1ZAEA

Solution structure of the functional domain of phi29 replication organizer p16.7c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
HMDKTVNLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Early protein GP16.7
publication title Structure of the functional domain of phi29 replication organizer: insights into oligomerization and dna binding
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Dna binding protein
total genus 29
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.600 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1zaeA00
1ZAEA 2C5RA 2BNKA
chains in the Genus database with same CATH superfamily
5ITTA 2KHHA 4OX9M 4DV0M 3GLHE 1NNJA 4B7FA 4JV5M 4GH9A 1QVRA 4IBBA 4LJ4A 2QQ8A 2C99A 2Z4SA 2L4EA 4PDIA 1F4IA 1T6OA 1WXQA 2LH0A 4IIWA 2HKJA 2XZFA 1OIZA 3D8BA 2OO9A 4IBGA 2JZ1A 2Y0TA 4JI6M 4B3TM 2J7OA 1UFZA 2R6FA 1OAIA 3K9PA 3B7QA 4LJAA 5FTLA 4FW9A 1G8PA 1GKIA 2Z7JA 4XBOA 1QAOA 4XGIA 4NL4H 3GQ4A 3T38A 3UJNA 4DR7M 1ZQ9A 3E46A 2DAMA 5E6JA 4L16A 2R46A 3SYLA 4I5SA 2UUCM 4MM3B 2DHYA 4FWHA 3PNYA 5JI3E 1L1ZA 4AKIA 1TDHA 2R18A 4LY6A 2CUZA 2DHRA 8CATA 4OU7A 4FWGA 1JR3D 4LCBA 4XK8F 3GLIE 3UK6A 3U6SA 1IXRC 1EFUB 2JY5A 2APLA 3SATA 4LF9M 3KFUG 2F5PA 2M60A 3GP1A 4Y28F 1K3WA 4L8RC 1R2ZA 1D0MA 3FYDA 1QDTA 4P17A 2M5ZA 2CEAA 4QNRA 4W5WA 5LMNM 4ZPXA 4QHTA 1IN4A 3HJQA 4D81A 1L2DA 4B3SM 4LF5M 3DA1A 4LZZA 3GRRA 3GQ5A 1PM5A 1HT1E 2QP9X 1XXHE 1C7YA 5FTKA 3DFZA 4WURA 1IM2A 3WHKA 4LF4M 1R7RA 4FCWA 1N33M 4AW4A 4DR5M 4R3DA 2QBYB 4LF6M 2UXCM 1P3QQ 1KFVA 1SXJA 4P16A 1VEJA 3J7BA 2ERCA 2O25A 3C9PA 4FCVA 2KRKA 1MX0A 1TH3A 1OKSA 3FTFA 4IJFA 3TWLA 3KSJA 1QUSA 4RF0A 5LMUM 4CISA 1YE9A 1NY5A 1TGUA 3FE3A 1HJPA 5C1BA 4R71A 3GLHA 3NBIA 4M9SA 5DNYA 4JI0M 3GLGB 3T1YM 3U60A 3Q8GA 1N77A 1EIJA 2R4EA 1T3TA 1IXZA 2EJSA 3HWSA 2CV1A 4L6V6 3K1JA 2YQZA 1VQ1A 2Y20A 3J27B 1BVSA 2CHQA 2EA0A 2DZLA 1GL6A 2JY7A 4DV6M 2ZANA 2I7NA 2XH9A 2V1CA 1XMQM 3U61A 2W82A 3NWLA 1GJSA 1N36M 1GL7A 1R6BX 4BBAA 1DGHB 3KS4A 3U6DA 4PDGA 3E21A 2KZSA 1GVNA 3DZDA 1YSYA 3AOEC 3M7GA 3JR5A 3KS8A 4G4OA 4PT5A 2X8AA 1FJGM 4PCZA 3GPXA 1WGNA 3V76A 2O01F 3A42A 4FVMA 1XWIA 3FTCA 3KOXE 4RF1A 5KPRA 1JR3A 1W5TA 2QCUA 3H4MA 1G3IA 3HJSA 1A5TA 4GC5A 3CF2A 3HY5A 1Z6TA 1IXSA 4NSOB 3W0LB 1IBLM 3GRVA 3HU1A 1DO0A 2EO2A 2WZJA 3GRUA 4IBEA 3UMMA 2DWNA 3HJ8A 4NRVA 3AL0C 1PJTA 1NHWC 3AFHA 3SHGB 1N34M 4F2LA 1DV0A 4JN6A 4B7HA 3QAUA 2HWJA 2F4VM 4KLNA 5DYGA 2ZTCA 3ZQJA 1J5EM 1LV7A 4G6ZA 4EIWA 2C5RA 2DAIA 1SXJE 4IBIA 4M9ZA 3TL4X 2L6OA 2XF3A 2XFTA 2C9OA 4WW0A 1XXHA 2CP8A 3LQQA 4DV3M 3WHLA 3CGWA 2MROB 3KOZE 3LW5F 1L1TA 2L7HA 4GRIA 3JAMS 2RKOA 2Z3XA 1IY2A 1R2YA 3SARA 1OTRA 2L7IA 1Z5BA 1N78A 1IBKM 3DOAA 2FNAA 4K0KM 3NBXX 2CHGA 4YY3M 3VDUA 1HQCA 2A5YB 1XHBA 1OJLA 5ITXE 3HHWA 1R4GA 1NNUC 1OFIA 4GHLA 4IJEA 2ZAOA 1UM8A 2BWBA 3T1HM 4JXJA 4JI2M 1IQPA 4OW0A 4B7GA 3U5ZB 1Z5AA 1D0KA 2JXNA 1I4WA 3UGJA 2QBYA 4I81A 3BBZA 5F3WA 4GKKM 4MGHA 4G4QA 3HU2A 2KW0A 1AIPC 3TWMA 2OQ4A 2YNMD 4MB7A 3L26A 4DUZM 2CHVA 1I94M 2D7EA 3SC3A 3I01M 2DKLA 3I4VA 4DBGB 3A45A 1IFYA 5EP1A 4X65M 1JR3E 4CJ6A 4GC9A 3GLGA 4TUWA 3B9PA 1WHCA 2JY6B 4LJ8A 2F5QA 2EKFA 2X49A 4M0WA 3U6LA 2OOAA 3B89A 1GABA 2BJVA 4LRTA 3FRIA 4D80A 2VQFM 3C58A 2F5OA 2UUBM 2LVAA 1PJQA 4AQYM 4NRWA 4LJ9A 2R0IA 1V33A 1TF0B 3A46A 3QWLA 7CATA 3W0FA 4CHTB 3U6CA 3HHXA 3GLFB 4JYAM 3RGSA 2Z8YM 1T43A 3B74A 4DR1M 3W67A 1MJGM 2LTUA 3KOYE 3SHFA 1XNRM 1QAQA 3PFIA 3RGPA 2EUCA 2RGHA 3SFZA 3FTEA 5EXXA 1DGFA 3K2LA 2DAGA 3HZJA 2D7HA 3TQSA 4X62M 1TR8A 3TE6A 3HX3A 2NQ8C 2C98A 3QYEA 3T15A 1YUBA 2QENA 1KYIA 1L8QA 4IBJA 4AI6A 3HKPA 4ITQA 1Z59A 5E26A 4AG6A 3JR4A 2LVNC 1QANA 3CTWB 3AJIB 1G71A 2R44A 2XFSA 3C3DA 3VFDA 4F1IA 1QDRA 3W68A 5FTMA 1IN6A 3PXGA 2KEBA 1NV9A 1MU5A 4YHHM 3AV0A 3L2AA 4LG2A 1E32A 1GJTA 5ITXA 2G8LA 3FUUA 3KP1E 3U6QA 1QYRA 3FUWA 4PD2A 1WR1B 2UXBM 2BWEA 3LCUA 2F5NA 2XSZD 2JA2A 1OFHA 4QHSA 2DWLA 4Q7JA 4QOSA 5ITRA 4DR3M 3L29A 1JB0F 3R9XB 2JZ0A 1GLNA 3GLGE 1RU3A 1ZMWA 4LFBM 3IG8A 4DR4M 2JUJA 3MMPA 1V92A 5IZ7D 2F5SA 1ZAEA 3VKHA 5IREB 2L09A 1ZMUA 1E9RA 4M9XA 2HAKA 3I51A 4X66M 1G41A 2YFQA 3HU3A 2K47A 4NXNM 1D2NA 2Z4RA 1IN8A 1VEKA 2BNKA 4RKUF 2FE8A 1TTEA 2C9CA 2ZTDA 3FD9A 3IG5A 4G4NA 3EIHA 3VK7A 2LVQD 3F92A 2DAEA 1IN5A 4FD2A 4G3OA 4AKHA 4JI3M 3UZUA 4G4RA 1VG5A 3VK8A 1E94E 1QUTA 5GKNA 1L2CA 4CIZA 1VDDA 4OVZB 1YLAA 1G59A 2H5XA 4L15A 2RRUA 3FRHA 3SASA 5EP3A 3M6AA 2CRUA 4Z8XA 4DV7M 1XC8A 2MR9A 1PJSA 4M0DA 1K82A 2WSEF 2QSFX 4AZFA 3BXWA 1HT2E 2JNHA 2KDLA 5FLXS 3J7AS 4DR6M 2I7PA 1LTMA 1WGLA 3FUTA 4JI7M 2J5YA 4QNMA 2FFJA 3B7NA 1CUKA 4B08A 1SXJC 1HQYE 2VQEM 5IT9S 3TWKA 2Y0QA 4A3VB 1NSFA 4LFAM 2L4FA 1NVMA 4D82A 3PVSA 3GLFA 3ILKA 3U6PA 2ZM6M 1N75A 1VDLA 5EP4A 3MHVC 4DV4M 4JI5M 3GLHB 4ANRA 4Z6YA 4NXMM 1Q02A 2DVWB 3GPPA 3SAUA 3U60B 4DV2M 3U6EA 5ITQA 3J2PB 1KSFX 3EIEA 1SG9A 4NC6A 4LGYA 1QZMA 2HCBA 2RGOA 3I4YA 2D7GA 2R45A 2DENA 2JY8A 2LNHC 3FKEA 1PJIA 2X4AA 4DV1M 3FTDA 4IBFA 3C3EA 1JQJC 4NOOB 2VIIA 1IY0A 2XSZA 3U61B 2XGNA 3FYCA 3K8ZA 2XZUA 4GIPA 2EKKA 2K0BX 3GPUA 1IY1A 4HLQA 1NHGC 3TPZA 4GITA 4DV5M 1HNZM 4GHAA 5KQ8A 5EXSA 5FTJA 4S12A 5KPTA 4B3MM 1DO2A 3KDSE 2LVPC 2QHOB 5KO3A 2LHCA 2BJWA 3CF6E 2K6BA 3FUXA 1Q3BA 3GRYA 3KSXA 1NO1A 2LHGA 4KO8A 1ZMVA 2MH8A 4IBCA 2JWSA 3GPYA 3GLIB 1IXSB 2FH0A 4HEOA 4MGIE 4DR2M 1PJJA 3VLFB 2CV0A 4LZJA 3ZCBB 1DGHA 2FOIC 4L4UA 3RFWA 3AOEA 2ZAMA 5EXTA 1XNQM 3E4RA 4II7A 4UN2B 1PRBA 4GEWA 3LMMA 3BOSA 1MN3A 2QNJA 2UUAM 1NV8A 5EP2A 2UXDM 1XXHB 3THGA 4X64M 4MGZE 2G5GX 3KXEC 4GMQA 3KW6A 4MGYE 5DFLA 3SMSA 3ZC7B 3K9OA 5JI2E 3ZH9B 2H1RA 2MJ5B 3HGIA 3IECA 3GLFE 2CWBA 2LXEA 4FCTA 1OAOC 1TH2A 4I8OA 1ORYB 4RNAA 3GQ3A 5IWAM 2E5LM 5H37D 4OVZA 2HHHM 3VKGA 4I4LA 4LFCM 2K9DA 4B3RM 1K3XA 4JI8M 5A2QS 2OPFA 2J7NA 2GNOA 5FTNA 5BPVA 4FWDA 4LF7M 1HNXM 2CE7A 1QQWA 3MJ5A 4LF8M 4KHPM 3D8LA 1C1KA 4JI1M 2OOBA 1Y8GA 4BB9A 1Z5CA 2WSFF 1D0LA 3SBJA 3AKZA 3SAWA 2QZ4A 4WP2A 1DGGA 2Y21A 3I04M 2QPAA 4IBDA 4BLCA 2JP7A 1S3SA 2HL7A 2DZOB 2R4JA 1NY6A 4DUYM 2DNAA 1R5LA 2G3QA 5BR8M 3OTOM 3U6MA 1HR0M 1FNNA 2KNVA 1WJ7A 2KRUA 4NSRA 3L27A 4L78A 5KPZA 2UU9M 1WIVA 3M0EA 2V1UA 2LBCA 1EE8A 5C18A 5KQDA 3CF0A 1TH4A 3E9SA 3MK6A 4IBKA 4GKJM 1N32M 2KXEA 3U5ZA 2KA6B 2VDBB 2GQFA 1J09A 5EXPA 5ITYA 1OIPA 1XMOM 1DGBA 1L2BA 2KNAA 2WSCF 3A98B 2O5RA 1NJGA 2LVOC 3HHYA 2CV2A 3SAVA 2V6ZM 2DWMA 3SMPA 2DWZB 1H6UA 5DYIA 3Q8XA 4LJ5A 3LQRA 2DI0A 5EQTA 2Q2EB 1VEGA 4KT0F 5EJCA 3LCVB 3T6PA 3AOGA 2LWXA 3IHPA 3SYKA 2DAKA 5FSWA 5L8RF 3R8FA 1X37A 4HL4A 2FS1A 1QAMA 2N35A 1Q39A 3VDPA 1IBMM 2P5TA 4QOZC 1W5SA 2B3TA 1QZEA 2KZUA 3H4JA 2L2DA 2AHMA 3PNVA 3KVWA 4LRSA 3GO8A 1SXJB 3HHZA 3K92A 2ZBKB 3GLIA 3LVVA 1TDZA 4MH0E 3J80S 4LGMA 2CFOA 4AG5A 2DZNB 1ZV1A 2R62A 1AUAA 3L28A 2DXIA 1HNWM 1E9SA 4AKGA 3RE8A 3KOWE 1NJFA 1IN7A 2VF7A 4REZA 4CGYB 3U6OA 3QYBA 1J7KA 4JI4M 1GO5A 4MGKE 1G4AE 2KNZA 1XB2B 3J81S 1SXJD 2XEPA 3B7ZA 3FUVA 4LJ6A 1Q3CA 2YR0A 4LJ7A 4KODA 3L25A 2C96A 4R7GA 3KP0E 1V34A 2VF8A 2XLJA 1PGYA 5ITUA 2MGWA 2R65A 1OQYA 3LVWA
chains in the Genus database with same CATH topology
5ITTA 4OX9M 4DV0M 1NNJA 4B7FA 4JV5M 4GH9A 1QVRA 4IBBA 4LJ4A 2C99A 2Z4SA 4PDIA 1WXQA 2LH0A 4IIWA 2HKJA 2XZFA 3D8BA 4IBGA 2Y0TA 4JI6M 4B3TM 2J7OA 4LJAA 5FTLA 4FW9A 1G8PA 1GKIA 2Z7JA 4XBOA 1QAOA 4XGIA 4NL4H 3GQ4A 3T38A 3UJNA 4DR7M 1ZQ9A 5E6JA 4L16A 2R46A 3SYLA 4I5SA 2UUCM 4MM3B 4FWHA 1L1ZA 3PNYA 5JI3E 4AKIA 1TDHA 2R18A 4LY6A 2CUZA 2DHRA 8CATA 4OU7A 4FWGA 1JR3D 4LCBA 3U6SA 3UK6A 1IXRC 3SATA 4LF9M 3KFUG 2F5PA 2M60A 3GP1A 1K3WA 4L8RC 1R2ZA 3FYDA 4QNRA 2M5ZA 2CEAA 4W5WA 5LMNM 4ZPXA 4QHTA 1IN4A 3HJQA 4D81A 1L2DA 4LF5M 3DA1A 4LZZA 3GRRA 3GQ5A 1PM5A 1HT1E 2QP9X 5FTKA 3DFZA 4WURA 1IM2A 3WHKA 4LF4M 1R7RA 4FCWA 1N33M 4AW4A 4DR5M 4R3DA 2QBYB 4LF6M 2UXCM 1KFVA 1SXJA 4P16A 3J7BA 2ERCA 4FCVA 2KRKA 1MX0A 1TH3A 3FTFA 4IJFA 3TWLA 3KSJA 4RF0A 5LMUM 4CISA 1YE9A 1NY5A 1TGUA 5C1BA 3GLHA 3NBIA 4M9SA 5DNYA 4JI0M 3GLGB 3T1YM 3U60A 1N77A 2R4EA 1T3TA 1IXZA 3HWSA 2CV1A 3K1JA 2YQZA 2Y20A 3J27B 2CHQA 2EA0A 4DV6M 1GL6A 2ZANA 2I7NA 2XH9A 2V1CA 1XMQM 3U61A 2W82A 3NWLA 1N36M 1GL7A 1R6BX 4BBAA 1DGHB 3KS4A 3U6DA 4PDGA 2KZSA 3DZDA 1GVNA 1YSYA 3AOEC 3M7GA 3JR5A 3KS8A 4G4OA 4PT5A 2X8AA 1FJGM 4PCZA 3GPXA 3A42A 4FVMA 1XWIA 3KOXE 3FTCA 4RF1A 5KPRA 1JR3A 1W5TA 2QCUA 3H4MA 1G3IA 3HJSA 4GC5A 3CF2A 1Z6TA 4NSOB 3W0LB 1IBLM 3GRVA 3HU1A 1DO0A 2EO2A 3UMMA 3GRUA 4IBEA 2DWNA 4B3SM 3HJ8A 4NRVA 3AL0C 1NHWC 3AFHA 3SHGB 1N34M 4JN6A 4B7HA 3QAUA 2F4VM 4KLNA 5DYGA 1J5EM 1LV7A 4G6ZA 4EIWA 2C5RA 1SXJE 4IBIA 4M9ZA 3TL4X 2L6OA 2XF3A 2XFTA 2C9OA 4WW0A 1XXHA 3LQQA 4DV3M 3WHLA 3KOZE 1L1TA 2L7HA 4GRIA 3JAMS 2RKOA 2Z3XA 1IY2A 1R2YA 3SARA 2L7IA 1Z5BA 1N78A 1IBKM 3DOAA 2FNAA 4K0KM 2CHGA 4YY3M 3VDUA 1HQCA 2A5YB 1XHBA 1OJLA 5ITXE 3HHWA 1NNUC 1OFIA 4GHLA 4IJEA 2ZAOA 1UM8A 3T1HM 4JI2M 4JXJA 1IQPA 4OW0A 4B7GA 3U5ZB 1Z5AA 1I4WA 3UGJA 2QBYA 4I81A 5F3WA 4GKKM 4MGHA 4G4QA 3HU2A 2KW0A 3TWMA 2OQ4A 2YNMD 4MB7A 3L26A 4DUZM 2CHVA 1I94M 2D7EA 3SC3A 3I4VA 3A45A 5EP1A 4X65M 4TUWA 4GC9A 3GLGA 3B9PA 4LJ8A 2F5QA 2X49A 4M0WA 3U6LA 2BJVA 4LRTA 4D80A 2VQFM 3C58A 2F5OA 2UUBM 4NRWA 4AQYM 4LJ9A 3A46A 3QWLA 7CATA 3W0FA 4CHTB 3U6CA 3HHXA 3GLFB 4JYAM 3RGSA 4DR1M 3KOYE 3SHFA 1XNRM 1QAQA 3PFIA 3RGPA 2EUCA 2RGHA 3SFZA 3FTEA 5EXXA 1DGFA 3K2LA 2D7HA 3TQSA 4X62M 3TE6A 2NQ8C 2C98A 3T15A 1YUBA 2QENA 1KYIA 1L8QA 4IBJA 4AI6A 3HKPA 4ITQA 1Z59A 5E26A 4AG6A 3JR4A 1QANA 3CTWB 3AJIB 2XFSA 3VFDA 5FTMA 1IN6A 3PXGA 2KEBA 1MU5A 4YHHM 3AV0A 3L2AA 4LG2A 1E32A 5ITXA 2G8LA 3FUUA 3KP1E 3U6QA 1QYRA 3FUWA 4PD2A 2UXBM 2F5NA 2XSZD 2JA2A 1OFHA 4QHSA 2DWLA 4QOSA 5ITRA 4DR3M 3L29A 3R9XB 1GLNA 4LFBM 3IG8A 4DR4M 5IZ7D 2F5SA 1ZAEA 3VKHA 5IREB 2L09A 4M9XA 1E9RA 3I51A 4X66M 1G41A 2YFQA 3HU3A 2K47A 4NXNM 1D2NA 2Z4RA 1IN8A 2BNKA 2FE8A 3FD9A 2C9CA 3IG5A 4G4NA 3EIHA 3VK7A 1IN5A 4FD2A 4AKHA 4JI3M 3UZUA 4G4RA 3VK8A 1E94E 5GKNA 1L2CA 1VDDA 4OVZB 1G59A 4L15A 3SASA 5EP3A 3M6AA 4Z8XA 4DV7M 1XC8A 4M0DA 1K82A 4AZFA 1HT2E 5FLXS 3J7AS 4DR6M 2I7PA 3FUTA 4JI7M 4QNMA 2FFJA 4B08A 1SXJC 1HQYE 2VQEM 5IT9S 3TWKA 2Y0QA 4A3VB 1NSFA 4LFAM 1NVMA 4D82A 3PVSA 3GLFA 3ILKA 3U6PA 2ZM6M 1N75A 5EP4A 3MHVC 4DV4M 4JI5M 3GLHB 4Z6YA 4NXMM 2DVWB 3GPPA 3SAUA 3U60B 4DV2M 3U6EA 5ITQA 3J2PB 1KSFX 3EIEA 4LGYA 1QZMA 2HCBA 2RGOA 3I4YA 2D7GA 2R45A 2LNHC 3FKEA 1PJIA 2X4AA 4DV1M 3FTDA 4IBFA 1JQJC 4NOOB 2VIIA 1IY0A 2XSZA 3U61B 2XGNA 3FYCA 3K8ZA 2XZUA 4GIPA 3GPUA 1IY1A 4HLQA 1NHGC 3TPZA 4GITA 4DV5M 1HNZM 4GHAA 5KQ8A 5EXSA 5FTJA 4S12A 5KPTA 4B3MM 1DO2A 3KDSE 5KO3A 3GRYA 2BJWA 3CF6E 3FUXA 1Q3BA 3KSXA 4KO8A 4IBCA 3GPYA 3GLIB 1IXSB 4DR2M 4MGIE 1PJJA 3VLFB 2CV0A 4LZJA 3ZCBB 1DGHA 2FOIC 4L4UA 3RFWA 3AOEA 2ZAMA 5EXTA 1XNQM 3E4RA 4II7A 3LMMA 3BOSA 2UUAM 5EP2A 2UXDM 1XXHB 3THGA 4X64M 4MGZE 2G5GX 3KXEC 4GMQA 3KW6A 4MGYE 3SMSA 3ZC7B 5JI2E 3ZH9B 2H1RA 3HGIA 2LXEA 4FCTA 4I8OA 1TH2A 3GQ3A 4RNAA 1ORYB 2E5LM 2HHHM 5IWAM 3VKGA 5H37D 4OVZA 4I4LA 4LFCM 4B3RM 1K3XA 4JI8M 5A2QS 2OPFA 2J7NA 5FTNA 5BPVA 4FWDA 4LF7M 1HNXM 2CE7A 1QQWA 3MJ5A 4LF8M 4KHPM 3D8LA 1C1KA 4JI1M 4BB9A 1Z5CA 3SAWA 3SBJA 3AKZA 2QZ4A 1DGGA 2Y21A 2QPAA 4IBDA 4BLCA 1S3SA 2HL7A 2DZOB 2R4JA 1NY6A 4DUYM 3U6MA 3OTOM 5BR8M 1HR0M 1FNNA 2KRUA 4NSRA 3L27A 4L78A 5KPZA 2UU9M 3M0EA 2V1UA 1EE8A 5C18A 5KQDA 3CF0A 1TH4A 3E9SA 3MK6A 4IBKA 4GKJM 1N32M 2KXEA 3U5ZA 2KA6B 1J09A 5EXPA 5ITYA 1XMOM 1DGBA 1L2BA 3A98B 2O5RA 1NJGA 3HHYA 2CV2A 3SAVA 2V6ZM 2DWMA 3SMPA 2DWZB 1H6UA 5DYIA 3Q8XA 4LJ5A 3LQRA 5EQTA 2Q2EB 5EJCA 3AOGA 2LWXA 3SYKA 5FSWA 3R8FA 1X37A 4HL4A 1QAMA 1Q39A 3VDPA 1IBMM 2P5TA 4QOZC 1W5SA 2KZUA 2AHMA 3PNVA 3KVWA 4LRSA 3GO8A 1SXJB 3HHZA 3K92A 2ZBKB 3GLIA 3LVVA 1TDZA 4MH0E 3J80S 4LGMA 2CFOA 4AG5A 2DZNB 3L28A 2R62A 1HNWM 2DXIA 1E9SA 4AKGA 3RE8A 3KOWE 1NJFA 1IN7A 4REZA 4CGYB 3U6OA 1J7KA 4JI4M 4MGKE 1G4AE 3J81S 1SXJD 2XEPA 3FUVA 4LJ6A 1Q3CA 2YR0A 4LJ7A 4KODA 3L25A 2C96A 4R7GA 3KP0E 2XLJA 5ITUA 2R65A 3LVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAE A;  2C5R A;  2BNK A; 
#chains in the Genus database with same CATH topology
 5ITT A;  2KHH A;  4OX9 M;  4DV0 M;  3GLH E;  1NNJ A;  4B7F A;  4JV5 M;  4GH9 A;  1QVR A;  4IBB A;  4LJ4 A;  2QQ8 A;  2C99 A;  2Z4S A;  2L4E A;  4PDI A;  1F4I A;  1T6O A;  1WXQ A;  2LH0 A;  4IIW A;  2HKJ A;  2XZF A;  1OIZ A;  3D8B A;  2OO9 A;  4IBG A;  2JZ1 A;  2Y0T A;  4JI6 M;  4B3T M;  2J7O A;  1UFZ A;  2R6F A;  1OAI A;  3K9P A;  3B7Q A;  4LJA A;  5FTL A;  4FW9 A;  1G8P A;  1GKI A;  2Z7J A;  4XBO A;  1QAO A;  4XGI A;  4NL4 H;  3GQ4 A;  3T38 A;  3UJN A;  4DR7 M;  1ZQ9 A;  3E46 A;  2DAM A;  5E6J A;  4L16 A;  2R46 A;  3SYL A;  4I5S A;  2UUC M;  4MM3 B;  2DHY A;  4FWH A;  3PNY A;  5JI3 E;  1L1Z A;  4AKI A;  1TDH A;  2R18 A;  4LY6 A;  2CUZ A;  2DHR A;  8CAT A;  4OU7 A;  4FWG A;  1JR3 D;  4LCB A;  4XK8 F;  3GLI E;  3UK6 A;  3U6S A;  1IXR C;  1EFU B;  2JY5 A;  2APL A;  3SAT A;  4LF9 M;  3KFU G;  2F5P A;  2M60 A;  3GP1 A;  4Y28 F;  1K3W A;  4L8R C;  1R2Z A;  1D0M A;  3FYD A;  1QDT A;  4P17 A;  2M5Z A;  2CEA A;  4QNR A;  4W5W A;  5LMN M;  4ZPX A;  4QHT A;  1IN4 A;  3HJQ A;  4D81 A;  1L2D A;  4B3S M;  4LF5 M;  3DA1 A;  4LZZ A;  3GRR A;  3GQ5 A;  1PM5 A;  1HT1 E;  2QP9 X;  1XXH E;  1C7Y A;  5FTK A;  3DFZ A;  4WUR A;  1IM2 A;  3WHK A;  4LF4 M;  1R7R A;  4FCW A;  1N33 M;  4AW4 A;  4DR5 M;  4R3D A;  2QBY B;  4LF6 M;  2UXC M;  1P3Q Q;  1KFV A;  1SXJ A;  4P16 A;  1VEJ A;  3J7B A;  2ERC A;  2O25 A;  3C9P A;  4FCV A;  2KRK A;  1MX0 A;  1TH3 A;  1OKS A;  3FTF A;  4IJF A;  3TWL A;  3KSJ A;  1QUS A;  4RF0 A;  5LMU M;  4CIS A;  1YE9 A;  1NY5 A;  1TGU A;  3FE3 A;  1HJP A;  5C1B A;  4R71 A;  3GLH A;  3NBI A;  4M9S A;  5DNY A;  4JI0 M;  3GLG B;  3T1Y M;  3U60 A;  3Q8G A;  1N77 A;  1EIJ A;  2R4E A;  1T3T A;  1IXZ A;  2EJS A;  3HWS A;  2CV1 A;  4L6V 6;  3K1J A;  2YQZ A;  1VQ1 A;  2Y20 A;  3J27 B;  1BVS A;  2CHQ A;  2EA0 A;  2DZL A;  1GL6 A;  2JY7 A;  4DV6 M;  2ZAN A;  2I7N A;  2XH9 A;  2V1C A;  1XMQ M;  3U61 A;  2W82 A;  3NWL A;  1GJS A;  1N36 M;  1GL7 A;  1R6B X;  4BBA A;  1DGH B;  3KS4 A;  3U6D A;  4PDG A;  3E21 A;  2KZS A;  1GVN A;  3DZD A;  1YSY A;  3AOE C;  3M7G A;  3JR5 A;  3KS8 A;  4G4O A;  4PT5 A;  2X8A A;  1FJG M;  4PCZ A;  3GPX A;  1WGN A;  3V76 A;  2O01 F;  3A42 A;  4FVM A;  1XWI A;  3FTC A;  3KOX E;  4RF1 A;  5KPR A;  1JR3 A;  1W5T A;  2QCU A;  3H4M A;  1G3I A;  3HJS A;  1A5T A;  4GC5 A;  3CF2 A;  3HY5 A;  1Z6T A;  1IXS A;  4NSO B;  3W0L B;  1IBL M;  3GRV A;  3HU1 A;  1DO0 A;  2EO2 A;  2WZJ A;  3GRU A;  4IBE A;  3UMM A;  2DWN A;  3HJ8 A;  4NRV A;  3AL0 C;  1PJT A;  1NHW C;  3AFH A;  3SHG B;  1N34 M;  4F2L A;  1DV0 A;  4JN6 A;  4B7H A;  3QAU A;  2HWJ A;  2F4V M;  4KLN A;  5DYG A;  2ZTC A;  3ZQJ A;  1J5E M;  1LV7 A;  4G6Z A;  4EIW A;  2C5R A;  2DAI A;  1SXJ E;  4IBI A;  4M9Z A;  3TL4 X;  2L6O A;  2XF3 A;  2XFT A;  2C9O A;  4WW0 A;  1XXH A;  2CP8 A;  3LQQ A;  4DV3 M;  3WHL A;  3CGW A;  2MRO B;  3KOZ E;  3LW5 F;  1L1T A;  2L7H A;  4GRI A;  3JAM S;  2RKO A;  2Z3X A;  1IY2 A;  1R2Y A;  3SAR A;  1OTR A;  2L7I A;  1Z5B A;  1N78 A;  1IBK M;  3DOA A;  2FNA A;  4K0K M;  3NBX X;  2CHG A;  4YY3 M;  3VDU A;  1HQC A;  2A5Y B;  1XHB A;  1OJL A;  5ITX E;  3HHW A;  1R4G A;  1NNU C;  1OFI A;  4GHL A;  4IJE A;  2ZAO A;  1UM8 A;  2BWB A;  3T1H M;  4JXJ A;  4JI2 M;  1IQP A;  4OW0 A;  4B7G A;  3U5Z B;  1Z5A A;  1D0K A;  2JXN A;  1I4W A;  3UGJ A;  2QBY A;  4I81 A;  3BBZ A;  5F3W A;  4GKK M;  4MGH A;  4G4Q A;  3HU2 A;  2KW0 A;  1AIP C;  3TWM A;  2OQ4 A;  2YNM D;  4MB7 A;  3L26 A;  4DUZ M;  2CHV A;  1I94 M;  2D7E A;  3SC3 A;  3I01 M;  2DKL A;  3I4V A;  4DBG B;  3A45 A;  1IFY A;  5EP1 A;  4X65 M;  1JR3 E;  4CJ6 A;  4GC9 A;  3GLG A;  4TUW A;  3B9P A;  1WHC A;  2JY6 B;  4LJ8 A;  2F5Q A;  2EKF A;  2X49 A;  4M0W A;  3U6L A;  2OOA A;  3B89 A;  1GAB A;  2BJV A;  4LRT A;  3FRI A;  4D80 A;  2VQF M;  3C58 A;  2F5O A;  2UUB M;  2LVA A;  1PJQ A;  4AQY M;  4NRW A;  4LJ9 A;  2R0I A;  1V33 A;  1TF0 B;  3A46 A;  3QWL A;  7CAT A;  3W0F A;  4CHT B;  3U6C A;  3HHX A;  3GLF B;  4JYA M;  3RGS A;  2Z8Y M;  1T43 A;  3B74 A;  4DR1 M;  3W67 A;  1MJG M;  2LTU A;  3KOY E;  3SHF A;  1XNR M;  1QAQ A;  3PFI A;  3RGP A;  2EUC A;  2RGH A;  3SFZ A;  3FTE A;  5EXX A;  1DGF A;  3K2L A;  2DAG A;  3HZJ A;  2D7H A;  3TQS A;  4X62 M;  1TR8 A;  3TE6 A;  3HX3 A;  2NQ8 C;  2C98 A;  3QYE A;  3T15 A;  1YUB A;  2QEN A;  1KYI A;  1L8Q A;  4IBJ A;  4AI6 A;  3HKP A;  4ITQ A;  1Z59 A;  5E26 A;  4AG6 A;  3JR4 A;  2LVN C;  1QAN A;  3CTW B;  3AJI B;  1G71 A;  2R44 A;  2XFS A;  3C3D A;  3VFD A;  4F1I A;  1QDR A;  3W68 A;  5FTM A;  1IN6 A;  3PXG A;  2KEB A;  1NV9 A;  1MU5 A;  4YHH M;  3AV0 A;  3L2A A;  4LG2 A;  1E32 A;  1GJT A;  5ITX A;  2G8L A;  3FUU A;  3KP1 E;  3U6Q A;  1QYR A;  3FUW A;  4PD2 A;  1WR1 B;  2UXB M;  2BWE A;  3LCU A;  2F5N A;  2XSZ D;  2JA2 A;  1OFH A;  4QHS A;  2DWL A;  4Q7J A;  4QOS A;  5ITR A;  4DR3 M;  3L29 A;  1JB0 F;  3R9X B;  2JZ0 A;  1GLN A;  3GLG E;  1RU3 A;  1ZMW A;  4LFB M;  3IG8 A;  4DR4 M;  2JUJ A;  3MMP A;  1V92 A;  5IZ7 D;  2F5S A;  1ZAE A;  3VKH A;  5IRE B;  2L09 A;  1ZMU A;  1E9R A;  4M9X A;  2HAK A;  3I51 A;  4X66 M;  1G41 A;  2YFQ A;  3HU3 A;  2K47 A;  4NXN M;  1D2N A;  2Z4R A;  1IN8 A;  1VEK A;  2BNK A;  4RKU F;  2FE8 A;  1TTE A;  2C9C A;  2ZTD A;  3FD9 A;  3IG5 A;  4G4N A;  3EIH A;  3VK7 A;  2LVQ D;  3F92 A;  2DAE A;  1IN5 A;  4FD2 A;  4G3O A;  4AKH A;  4JI3 M;  3UZU A;  4G4R A;  1VG5 A;  3VK8 A;  1E94 E;  1QUT A;  5GKN A;  1L2C A;  4CIZ A;  1VDD A;  4OVZ B;  1YLA A;  1G59 A;  2H5X A;  4L15 A;  2RRU A;  3FRH A;  3SAS A;  5EP3 A;  3M6A A;  2CRU A;  4Z8X A;  4DV7 M;  1XC8 A;  2MR9 A;  1PJS A;  4M0D A;  1K82 A;  2WSE F;  2QSF X;  4AZF A;  3BXW A;  1HT2 E;  2JNH A;  2KDL A;  5FLX S;  3J7A S;  4DR6 M;  2I7P A;  1LTM A;  1WGL A;  3FUT A;  4JI7 M;  2J5Y A;  4QNM A;  2FFJ A;  3B7N A;  1CUK A;  4B08 A;  1SXJ C;  1HQY E;  2VQE M;  5IT9 S;  3TWK A;  2Y0Q A;  4A3V B;  1NSF A;  4LFA M;  2L4F A;  1NVM A;  4D82 A;  3PVS A;  3GLF A;  3ILK A;  3U6P A;  2ZM6 M;  1N75 A;  1VDL A;  5EP4 A;  3MHV C;  4DV4 M;  4JI5 M;  3GLH B;  4ANR A;  4Z6Y A;  4NXM M;  1Q02 A;  2DVW B;  3GPP A;  3SAU A;  3U60 B;  4DV2 M;  3U6E A;  5ITQ A;  3J2P B;  1KSF X;  3EIE A;  1SG9 A;  4NC6 A;  4LGY A;  1QZM A;  2HCB A;  2RGO A;  3I4Y A;  2D7G A;  2R45 A;  2DEN A;  2JY8 A;  2LNH C;  3FKE A;  1PJI A;  2X4A A;  4DV1 M;  3FTD A;  4IBF A;  3C3E A;  1JQJ C;  4NOO B;  2VII A;  1IY0 A;  2XSZ A;  3U61 B;  2XGN A;  3FYC A;  3K8Z A;  2XZU A;  4GIP A;  2EKK A;  2K0B X;  3GPU A;  1IY1 A;  4HLQ A;  1NHG C;  3TPZ A;  4GIT A;  4DV5 M;  1HNZ M;  4GHA A;  5KQ8 A;  5EXS A;  5FTJ A;  4S12 A;  5KPT A;  4B3M M;  1DO2 A;  3KDS E;  2LVP C;  2QHO B;  5KO3 A;  2LHC A;  2BJW A;  3CF6 E;  2K6B A;  3FUX A;  1Q3B A;  3GRY A;  3KSX A;  1NO1 A;  2LHG A;  4KO8 A;  1ZMV A;  2MH8 A;  4IBC A;  2JWS A;  3GPY A;  3GLI B;  1IXS B;  2FH0 A;  4HEO A;  4MGI E;  4DR2 M;  1PJJ A;  3VLF B;  2CV0 A;  4LZJ A;  3ZCB B;  1DGH A;  2FOI C;  4L4U A;  3RFW A;  3AOE A;  2ZAM A;  5EXT A;  1XNQ M;  3E4R A;  4II7 A;  4UN2 B;  1PRB A;  4GEW A;  3LMM A;  3BOS A;  1MN3 A;  2QNJ A;  2UUA M;  1NV8 A;  5EP2 A;  2UXD M;  1XXH B;  3THG A;  4X64 M;  4MGZ E;  2G5G X;  3KXE C;  4GMQ A;  3KW6 A;  4MGY E;  5DFL A;  3SMS A;  3ZC7 B;  3K9O A;  5JI2 E;  3ZH9 B;  2H1R A;  2MJ5 B;  3HGI A;  3IEC A;  3GLF E;  2CWB A;  2LXE A;  4FCT A;  1OAO C;  1TH2 A;  4I8O A;  1ORY B;  4RNA A;  3GQ3 A;  5IWA M;  2E5L M;  5H37 D;  4OVZ A;  2HHH M;  3VKG A;  4I4L A;  4LFC M;  2K9D A;  4B3R M;  1K3X A;  4JI8 M;  5A2Q S;  2OPF A;  2J7N A;  2GNO A;  5FTN A;  5BPV A;  4FWD A;  4LF7 M;  1HNX M;  2CE7 A;  1QQW A;  3MJ5 A;  4LF8 M;  4KHP M;  3D8L A;  1C1K A;  4JI1 M;  2OOB A;  1Y8G A;  4BB9 A;  1Z5C A;  2WSF F;  1D0L A;  3SBJ A;  3AKZ A;  3SAW A;  2QZ4 A;  4WP2 A;  1DGG A;  2Y21 A;  3I04 M;  2QPA A;  4IBD A;  4BLC A;  2JP7 A;  1S3S A;  2HL7 A;  2DZO B;  2R4J A;  1NY6 A;  4DUY M;  2DNA A;  1R5L A;  2G3Q A;  5BR8 M;  3OTO M;  3U6M A;  1HR0 M;  1FNN A;  2KNV A;  1WJ7 A;  2KRU A;  4NSR A;  3L27 A;  4L78 A;  5KPZ A;  2UU9 M;  1WIV A;  3M0E A;  2V1U A;  2LBC A;  1EE8 A;  5C18 A;  5KQD A;  3CF0 A;  1TH4 A;  3E9S A;  3MK6 A;  4IBK A;  4GKJ M;  1N32 M;  2KXE A;  3U5Z A;  2KA6 B;  2VDB B;  2GQF A;  1J09 A;  5EXP A;  5ITY A;  1OIP A;  1XMO M;  1DGB A;  1L2B A;  2KNA A;  2WSC F;  3A98 B;  2O5R A;  1NJG A;  2LVO C;  3HHY A;  2CV2 A;  3SAV A;  2V6Z M;  2DWM A;  3SMP A;  2DWZ B;  1H6U A;  5DYI A;  3Q8X A;  4LJ5 A;  3LQR A;  2DI0 A;  5EQT A;  2Q2E B;  1VEG A;  4KT0 F;  5EJC A;  3LCV B;  3T6P A;  3AOG A;  2LWX A;  3IHP A;  3SYK A;  2DAK A;  5FSW A;  5L8R F;  3R8F A;  1X37 A;  4HL4 A;  2FS1 A;  1QAM A;  2N35 A;  1Q39 A;  3VDP A;  1IBM M;  2P5T A;  4QOZ C;  1W5S A;  2B3T A;  1QZE A;  2KZU A;  3H4J A;  2L2D A;  2AHM A;  3PNV A;  3KVW A;  4LRS A;  3GO8 A;  1SXJ B;  3HHZ A;  3K92 A;  2ZBK B;  3GLI A;  3LVV A;  1TDZ A;  4MH0 E;  3J80 S;  4LGM A;  2CFO A;  4AG5 A;  2DZN B;  1ZV1 A;  2R62 A;  1AUA A;  3L28 A;  2DXI A;  1HNW M;  1E9S A;  4AKG A;  3RE8 A;  3KOW E;  1NJF A;  1IN7 A;  2VF7 A;  4REZ A;  4CGY B;  3U6O A;  3QYB A;  1J7K A;  4JI4 M;  1GO5 A;  4MGK E;  1G4A E;  2KNZ A;  1XB2 B;  3J81 S;  1SXJ D;  2XEP A;  3B7Z A;  3FUV A;  4LJ6 A;  1Q3C A;  2YR0 A;  4LJ7 A;  4KOD A;  3L25 A;  2C96 A;  4R7G A;  3KP0 E;  1V34 A;  2VF8 A;  2XLJ A;  1PGY A;  5ITU A;  2MGW A;  2R65 A;  1OQY A;  3LVW A; 
#chains in the Genus database with same CATH homology
 5ITT A;  4OX9 M;  4DV0 M;  1NNJ A;  4B7F A;  4JV5 M;  4GH9 A;  1QVR A;  4IBB A;  4LJ4 A;  2C99 A;  2Z4S A;  4PDI A;  1WXQ A;  2LH0 A;  4IIW A;  2HKJ A;  2XZF A;  3D8B A;  4IBG A;  2Y0T A;  4JI6 M;  4B3T M;  2J7O A;  4LJA A;  5FTL A;  4FW9 A;  1G8P A;  1GKI A;  2Z7J A;  4XBO A;  1QAO A;  4XGI A;  4NL4 H;  3GQ4 A;  3T38 A;  3UJN A;  4DR7 M;  1ZQ9 A;  5E6J A;  4L16 A;  2R46 A;  3SYL A;  4I5S A;  2UUC M;  4MM3 B;  4FWH A;  1L1Z A;  3PNY A;  5JI3 E;  4AKI A;  1TDH A;  2R18 A;  4LY6 A;  2CUZ A;  2DHR A;  8CAT A;  4OU7 A;  4FWG A;  1JR3 D;  4LCB A;  3U6S A;  3UK6 A;  1IXR C;  3SAT A;  4LF9 M;  3KFU G;  2F5P A;  2M60 A;  3GP1 A;  1K3W A;  4L8R C;  1R2Z A;  3FYD A;  4QNR A;  2M5Z A;  2CEA A;  4W5W A;  5LMN M;  4ZPX A;  4QHT A;  1IN4 A;  3HJQ A;  4D81 A;  1L2D A;  4LF5 M;  3DA1 A;  4LZZ A;  3GRR A;  3GQ5 A;  1PM5 A;  1HT1 E;  2QP9 X;  5FTK A;  3DFZ A;  4WUR A;  1IM2 A;  3WHK A;  4LF4 M;  1R7R A;  4FCW A;  1N33 M;  4AW4 A;  4DR5 M;  4R3D A;  2QBY B;  4LF6 M;  2UXC M;  1KFV A;  1SXJ A;  4P16 A;  3J7B A;  2ERC A;  4FCV A;  2KRK A;  1MX0 A;  1TH3 A;  3FTF A;  4IJF A;  3TWL A;  3KSJ A;  4RF0 A;  5LMU M;  4CIS A;  1YE9 A;  1NY5 A;  1TGU A;  5C1B A;  3GLH A;  3NBI A;  4M9S A;  5DNY A;  4JI0 M;  3GLG B;  3T1Y M;  3U60 A;  1N77 A;  2R4E A;  1T3T A;  1IXZ A;  3HWS A;  2CV1 A;  3K1J A;  2YQZ A;  2Y20 A;  3J27 B;  2CHQ A;  2EA0 A;  4DV6 M;  1GL6 A;  2ZAN A;  2I7N A;  2XH9 A;  2V1C A;  1XMQ M;  3U61 A;  2W82 A;  3NWL A;  1N36 M;  1GL7 A;  1R6B X;  4BBA A;  1DGH B;  3KS4 A;  3U6D A;  4PDG A;  2KZS A;  3DZD A;  1GVN A;  1YSY A;  3AOE C;  3M7G A;  3JR5 A;  3KS8 A;  4G4O A;  4PT5 A;  2X8A A;  1FJG M;  4PCZ A;  3GPX A;  3A42 A;  4FVM A;  1XWI A;  3KOX E;  3FTC A;  4RF1 A;  5KPR A;  1JR3 A;  1W5T A;  2QCU A;  3H4M A;  1G3I A;  3HJS A;  4GC5 A;  3CF2 A;  1Z6T A;  4NSO B;  3W0L B;  1IBL M;  3GRV A;  3HU1 A;  1DO0 A;  2EO2 A;  3UMM A;  3GRU A;  4IBE A;  2DWN A;  4B3S M;  3HJ8 A;  4NRV A;  3AL0 C;  1NHW C;  3AFH A;  3SHG B;  1N34 M;  4JN6 A;  4B7H A;  3QAU A;  2F4V M;  4KLN A;  5DYG A;  1J5E M;  1LV7 A;  4G6Z A;  4EIW A;  2C5R A;  1SXJ E;  4IBI A;  4M9Z A;  3TL4 X;  2L6O A;  2XF3 A;  2XFT A;  2C9O A;  4WW0 A;  1XXH A;  3LQQ A;  4DV3 M;  3WHL A;  3KOZ E;  1L1T A;  2L7H A;  4GRI A;  3JAM S;  2RKO A;  2Z3X A;  1IY2 A;  1R2Y A;  3SAR A;  2L7I A;  1Z5B A;  1N78 A;  1IBK M;  3DOA A;  2FNA A;  4K0K M;  2CHG A;  4YY3 M;  3VDU A;  1HQC A;  2A5Y B;  1XHB A;  1OJL A;  5ITX E;  3HHW A;  1NNU C;  1OFI A;  4GHL A;  4IJE A;  2ZAO A;  1UM8 A;  3T1H M;  4JI2 M;  4JXJ A;  1IQP A;  4OW0 A;  4B7G A;  3U5Z B;  1Z5A A;  1I4W A;  3UGJ A;  2QBY A;  4I81 A;  5F3W A;  4GKK M;  4MGH A;  4G4Q A;  3HU2 A;  2KW0 A;  3TWM A;  2OQ4 A;  2YNM D;  4MB7 A;  3L26 A;  4DUZ M;  2CHV A;  1I94 M;  2D7E A;  3SC3 A;  3I4V A;  3A45 A;  5EP1 A;  4X65 M;  4TUW A;  4GC9 A;  3GLG A;  3B9P A;  4LJ8 A;  2F5Q A;  2X49 A;  4M0W A;  3U6L A;  2BJV A;  4LRT A;  4D80 A;  2VQF M;  3C58 A;  2F5O A;  2UUB M;  4NRW A;  4AQY M;  4LJ9 A;  3A46 A;  3QWL A;  7CAT A;  3W0F A;  4CHT B;  3U6C A;  3HHX A;  3GLF B;  4JYA M;  3RGS A;  4DR1 M;  3KOY E;  3SHF A;  1XNR M;  1QAQ A;  3PFI A;  3RGP A;  2EUC A;  2RGH A;  3SFZ A;  3FTE A;  5EXX A;  1DGF A;  3K2L A;  2D7H A;  3TQS A;  4X62 M;  3TE6 A;  2NQ8 C;  2C98 A;  3T15 A;  1YUB A;  2QEN A;  1KYI A;  1L8Q A;  4IBJ A;  4AI6 A;  3HKP A;  4ITQ A;  1Z59 A;  5E26 A;  4AG6 A;  3JR4 A;  1QAN A;  3CTW B;  3AJI B;  2XFS A;  3VFD A;  5FTM A;  1IN6 A;  3PXG A;  2KEB A;  1MU5 A;  4YHH M;  3AV0 A;  3L2A A;  4LG2 A;  1E32 A;  5ITX A;  2G8L A;  3FUU A;  3KP1 E;  3U6Q A;  1QYR A;  3FUW A;  4PD2 A;  2UXB M;  2F5N A;  2XSZ D;  2JA2 A;  1OFH A;  4QHS A;  2DWL A;  4QOS A;  5ITR A;  4DR3 M;  3L29 A;  3R9X B;  1GLN A;  4LFB M;  3IG8 A;  4DR4 M;  5IZ7 D;  2F5S A;  1ZAE A;  3VKH A;  5IRE B;  2L09 A;  4M9X A;  1E9R A;  3I51 A;  4X66 M;  1G41 A;  2YFQ A;  3HU3 A;  2K47 A;  4NXN M;  1D2N A;  2Z4R A;  1IN8 A;  2BNK A;  2FE8 A;  3FD9 A;  2C9C A;  3IG5 A;  4G4N A;  3EIH A;  3VK7 A;  1IN5 A;  4FD2 A;  4AKH A;  4JI3 M;  3UZU A;  4G4R A;  3VK8 A;  1E94 E;  5GKN A;  1L2C A;  1VDD A;  4OVZ B;  1G59 A;  4L15 A;  3SAS A;  5EP3 A;  3M6A A;  4Z8X A;  4DV7 M;  1XC8 A;  4M0D A;  1K82 A;  4AZF A;  1HT2 E;  5FLX S;  3J7A S;  4DR6 M;  2I7P A;  3FUT A;  4JI7 M;  4QNM A;  2FFJ A;  4B08 A;  1SXJ C;  1HQY E;  2VQE M;  5IT9 S;  3TWK A;  2Y0Q A;  4A3V B;  1NSF A;  4LFA M;  1NVM A;  4D82 A;  3PVS A;  3GLF A;  3ILK A;  3U6P A;  2ZM6 M;  1N75 A;  5EP4 A;  3MHV C;  4DV4 M;  4JI5 M;  3GLH B;  4Z6Y A;  4NXM M;  2DVW B;  3GPP A;  3SAU A;  3U60 B;  4DV2 M;  3U6E A;  5ITQ A;  3J2P B;  1KSF X;  3EIE A;  4LGY A;  1QZM A;  2HCB A;  2RGO A;  3I4Y A;  2D7G A;  2R45 A;  2LNH C;  3FKE A;  1PJI A;  2X4A A;  4DV1 M;  3FTD A;  4IBF A;  1JQJ C;  4NOO B;  2VII A;  1IY0 A;  2XSZ A;  3U61 B;  2XGN A;  3FYC A;  3K8Z A;  2XZU A;  4GIP A;  3GPU A;  1IY1 A;  4HLQ A;  1NHG C;  3TPZ A;  4GIT A;  4DV5 M;  1HNZ M;  4GHA A;  5KQ8 A;  5EXS A;  5FTJ A;  4S12 A;  5KPT A;  4B3M M;  1DO2 A;  3KDS E;  5KO3 A;  3GRY A;  2BJW A;  3CF6 E;  3FUX A;  1Q3B A;  3KSX A;  4KO8 A;  4IBC A;  3GPY A;  3GLI B;  1IXS B;  4DR2 M;  4MGI E;  1PJJ A;  3VLF B;  2CV0 A;  4LZJ A;  3ZCB B;  1DGH A;  2FOI C;  4L4U A;  3RFW A;  3AOE A;  2ZAM A;  5EXT A;  1XNQ M;  3E4R A;  4II7 A;  3LMM A;  3BOS A;  2UUA M;  5EP2 A;  2UXD M;  1XXH B;  3THG A;  4X64 M;  4MGZ E;  2G5G X;  3KXE C;  4GMQ A;  3KW6 A;  4MGY E;  3SMS A;  3ZC7 B;  5JI2 E;  3ZH9 B;  2H1R A;  3HGI A;  2LXE A;  4FCT A;  4I8O A;  1TH2 A;  3GQ3 A;  4RNA A;  1ORY B;  2E5L M;  2HHH M;  5IWA M;  3VKG A;  5H37 D;  4OVZ A;  4I4L A;  4LFC M;  4B3R M;  1K3X A;  4JI8 M;  5A2Q S;  2OPF A;  2J7N A;  5FTN A;  5BPV A;  4FWD A;  4LF7 M;  1HNX M;  2CE7 A;  1QQW A;  3MJ5 A;  4LF8 M;  4KHP M;  3D8L A;  1C1K A;  4JI1 M;  4BB9 A;  1Z5C A;  3SAW A;  3SBJ A;  3AKZ A;  2QZ4 A;  1DGG A;  2Y21 A;  2QPA A;  4IBD A;  4BLC A;  1S3S A;  2HL7 A;  2DZO B;  2R4J A;  1NY6 A;  4DUY M;  3U6M A;  3OTO M;  5BR8 M;  1HR0 M;  1FNN A;  2KRU A;  4NSR A;  3L27 A;  4L78 A;  5KPZ A;  2UU9 M;  3M0E A;  2V1U A;  1EE8 A;  5C18 A;  5KQD A;  3CF0 A;  1TH4 A;  3E9S A;  3MK6 A;  4IBK A;  4GKJ M;  1N32 M;  2KXE A;  3U5Z A;  2KA6 B;  1J09 A;  5EXP A;  5ITY A;  1XMO M;  1DGB A;  1L2B A;  3A98 B;  2O5R A;  1NJG A;  3HHY A;  2CV2 A;  3SAV A;  2V6Z M;  2DWM A;  3SMP A;  2DWZ B;  1H6U A;  5DYI A;  3Q8X A;  4LJ5 A;  3LQR A;  5EQT A;  2Q2E B;  5EJC A;  3AOG A;  2LWX A;  3SYK A;  5FSW A;  3R8F A;  1X37 A;  4HL4 A;  1QAM A;  1Q39 A;  3VDP A;  1IBM M;  2P5T A;  4QOZ C;  1W5S A;  2KZU A;  2AHM A;  3PNV A;  3KVW A;  4LRS A;  3GO8 A;  1SXJ B;  3HHZ A;  3K92 A;  2ZBK B;  3GLI A;  3LVV A;  1TDZ A;  4MH0 E;  3J80 S;  4LGM A;  2CFO A;  4AG5 A;  2DZN B;  3L28 A;  2R62 A;  1HNW M;  2DXI A;  1E9S A;  4AKG A;  3RE8 A;  3KOW E;  1NJF A;  1IN7 A;  4REZ A;  4CGY B;  3U6O A;  1J7K A;  4JI4 M;  4MGK E;  1G4A E;  3J81 S;  1SXJ D;  2XEP A;  3FUV A;  4LJ6 A;  1Q3C A;  2YR0 A;  4LJ7 A;  4KOD A;  3L25 A;  2C96 A;  4R7G A;  3KP0 E;  2XLJ A;  5ITU A;  2R65 A;  3LVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...