1ZANH

Crystal structure of anti-ngf ad11 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
216
Chain Sequence
b'QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNNVNWVRQATGRGLEWMGGVWAGGATDYNSALKSRLTITRDTSKSQVFLKMHSLQSEDTATYYCARDGGYSSSTLYAMDAWGQGTTVTVSSASTTAPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLASGVHTFPAVLQSGLYTLSSSVTVPASPWASEAVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab AD11 Light Chain
publication title Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 42
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanH01
5CIPB 4GG6F 5EZJA 2IANA 2W92A 3QIWA 1CD9B 3LS4H 4ZUUB 3H9YA 4CADA 3L1OH 4LSTH 3NTCL 4G7VH 2MPAL 5KS9A 3A67H 2YC1B 3O3AA 2Q1EA 4XPTL 3CXHK 3WHE1 3MRFB 3WHE0 4ONOA 1IAOA 1FYTA 4LLMA 5D2NB 3IAPA 2YD6A 2YUXA 4LDOB 2VL5B 3WXWL 5EO1B 1CGSL 2VOTA 3C2AL 3EO1A 4PIRF 4NM8L 2BDNH 3H0TB 3HNVL 4YC2C 2EZ0C 5C1MB 1J5OL 2AEWA 2F15A 1UXWB 4QY8B 2O5ZH 3BRFA 3AREC 3L3GB 3MRMB 1F3JB 3GJFK 3KPSE 3AY4A 4L4TE 4JRXB 5GRUH 2DBLL 3S36X 2XNAB 3DX6B 3PQYD 3P4MB 4MXQC 5I76B 4J6RH 3P30H 1J0YA 1QNZL 2X9YA 3SE9H 1NPUA 1PQZB 1BECA 3BPOC 3AFLA 4JZJC 5C0DB 2BNQD 1ZS8A 3HUJB 1BQLL 1OW0A 3CFJB 5E7FA 3UTZB 2IG2L 4L9DA 1S3KH 4KKLC 1JF1B 5E2VL 4DUXA 5E1AA 4OI9A 4M6AA 4BQBA 4NUJB 4OGXL 4JJ5B 5FGCB 3MQIA 1S8DA 5D70H 1TETL 3H9SE 4WVRA 4MQXD 1AI1H 4GQ9L 4HC1A 4KK6C 1MCSA 4CMHC 5HYSA 4EIGB 1G9MH 4KI5D 5CJXA 1TITA 4NWUL 4EN3B 3QSKB 4YHML 4L8SA 3QWOA 4F9PA 2H45A 2H6PB 3P3YA 3CX2A 4LAJH 5ADOH 3S9DB 2R9HC 1H8NA 4U1SA 3S37H 3PP3H 4IOSD 3ALXA 5A2LH 3RI5F 1I7UA 1UM5H 1FV1A 3RHWK 5DC0A 5I1DA 4U1LA 3TO4B 3P2TA 1IQDA 2LV4A 1MLBB 4JQIH 5GXBB 4M8QA 5GRYA 2GAZA 1FBIL 1JN6B 4PRHE 2R1WA 4LIQH 4KTEH 4KVCL 4UT9L 2NXZB 4GMTL 2XZZA 4JO1H 5HDQL 1AE6H 4J4PC 2DMKA 2ZWLT 1XR9B 1U8QA 3OJDA 3V6ZB 3QNZA 4KJPC 3C9NB 5HYJA 3BWUC 1D9KD 1M05A 4NZTL 3RUGB 3TBVB 5LAXA 4F37F 1AGBB 3SDCC 3UTTD 3KDMA 3GI8H 5C0AB 3NBNA 2NY1B 2NTSP 4F7EB 1SMAA 1HKFA 5DQJB 2HT3C 1DTUA 1Q9LA 2O5XL 4J3UA 4WUUB 5TGBA 2FBOJ 1AGEA 5I8CB 4CMMB 4LVNC 2Y07L 5IB5A 5JO5B 4KVNH 3RTQA 1JPGA 3FMGH 3BP4A 2AK1H 3RWCA 2ERJB 1VA9A 3QNYB 1U3JA 3V8OA 1OP3K 2VIRA 5E6IC 1TZIB 4TTDD 1A6UL 3SGKA 1UM4H 2HH0H 4L29B 2QR0B 4KRPC 4YHIA 3P0VH 4KV5F 1DVFB 1S7XB 5DDHA 2ED9A 3MRCA 1D5MA 1JZ4A 3RVUD 1NFDF 3TP4A 4HCRH 5DHXB 4HJ0D 1CZ8H 4JY5L 1KIQA 1P7QB 3TV3L 2HLFD 3TYGL 5ANME 1G7JB 1T2QH 3IFNH 1INQA 5E8EB 1G1CA 4LCWA 4X5XA 5KSUB 1IBGL 4X4ME 5CUSH 4C4KO 3OB0K 3ZDXE 2CDFB 2AQ3A 2JB5H 1FFOA 1SEQL 4KAQL 5LGJB 5FIEA 2APXA 1YQVL 4WU5A 2G2RB 5I17A 3RDTD 5I1IH 3U4EA 3U0PA 4ZOAA 1YYMH 3ULUF 4D9LH 3LKNB 4LL9A 4W6XB 2Q8AH 4XC1L 3MLPA 2BHYA 4DVRL 1CE1L 3O6LL 1QLFB 3MJ8A 5IWLA 5EU6A 4ZOBA 4I5BA 2P5WD 4LHQB 3BQUA 1ZLWH 3UJIH 2ZUQC 5J57B 5D2LA 4GOSA 2V17H 4LLVB 3VMOA 2XI9A 3WFDH 1RIHH 1VACB 3G5ZA 1NSNH 1I8IA 4Y0GA 4JVUA 4MJIB 1NLBH 5D8JL 1Y0LA 5TF0A 3VXNA 5D96B 2PO6B 3HNTH 3BPCB 3DX7A 2X1PA 3QHZL 2BX5A 2EDHA 1FJ1A 2VXUH 1BVLA 5F9WC 2ILLA 4ISVA 1RURH 12E8H 3NZHH 1HXMB 1RZKH 4QXTA 5E4EC 4DOHB 1R3KA 4BM7A 2G75A 3W2DH 4MZ3A 4A6YH 4R0LC 1Z9OA 3CFKA 5HYEA 3WFHA 3WS3B 1ZWIA 3QDGE 1P69B 3QWRA 5C0JA 4LLUA 1Q72H 4OZHE 1H8SA 3K8MA 4X7FC 1DQTA 4U1IA 3QPXL 4F8TA 3GMRB 3EZ8A 2QEJA 3QQ9D 4JPVH 5EC2B 4JG0H 5IK3B 4JN2A 4K8RC 4PJ5E 1OTSC 1G9NL 4RA3A 2PYFA 3HR5A 4RZCB 2R29H 5B38G 4FFYL 1J0ZA 5I75C 4MD5B 5TE4H 5I9QC 2FZ3A 4QRUA 4HIXH 2VSCA 5DEGB 1VGKB 3LHPH 2BNUA 1NKRA 4Z0BL 4YC2B 5E8PB 3C08H 3AREB 3PNWA 3SO3B 4MLSA 2NY7H 2EE6A 1RUPL 4XCFL 2WLYA 3OKOA 3A6BH 1WV7T 1N7ML 1XGUA 4MCZB 1L4IA 3GIZL 5JOPD 2DJUA 4EDXA 4JKMA 3ARSA 4XPFL 3LKOA 4J8RA 3I6LE 4Z7UE 1WFUA 1KJ3H 2XOTA 4TTGA 3P4NB 3HC3L 5TDPA 1V3JA 3MLWH 3BPOB 4GMSH 1QLRB 4JZJB 3QDMA 4K8RH 2WINA 3CXDL 4NQCD 1N59A 2BP3A 3BP6A 4ZUSB 1JWMA 1Y6KR 4YQXH 5BRZE 2JF1A 4EI5B 5FHAH 1MVUA 3F7YA 3TT3H 4HFWB 4M3JA 3L6FA 3WE6A 2AEQH 1A9EA 2F54E 1CFNA 1MI5D 2X89A 4HUWA 4K94L 4U1KB 3IDNA 4KKCC 2XRAL 2AV1B 4CMHB 5C0IA 2VLKD 3BMVA 4ZFGL 3IJYA 4L9LA 4FZ8L 5CILL 4DKEH 3MO1B 3BD3A 2KZ1B 3LH2L 3BDBA 4PJCB 4AEIL 4JDTL 3VFNA 1QG3A 2ADJA 3AMLA 4O02L 2H1PH 1UEMA 4OCSH 4RMTA 1RZ7L 1VFMA 5TH2B 1KELH 4U6YB 1KN2L 4FN0A 2F58L 4FQJH 2H2SC 2EYTA 2QKIB 5M94B 2Y7QA 2VUOA 3UBXA 2ARJB 1WCQA 2HWZH 1AR1C 4A2LA 3WIFA 1JRHL 3GM0A 4YO0A 3NCYS 4Z7NF 5DRXB 4WEBL 4P3CL 35C8L 1NC4A 1FDLH 2AJSH 5IJVA 2Q76B 3NPZB 4LFHG 5HHPB 1V3MA 4YAQB 3PDOB 3CU1A 5GZND 4M4RA 1C12B 5SWZB 3SDCB 1NCWL 4WW2C 5EUOE 1TZHA 2HA1A 3F7VA 4PJAF 3G04A 3O9WA 1N5AB 1RJYB 3HG1B 1A9BA 2IBGA 5F7YC 2P4AB 1YMMD 3KPLB 2FX7H 3QA3A 4PJ8A 4JFZH 3TN0C 4XX1E 3KLAA 1CYGA 4OI7A 3EDKA 3V6OC 2VO5A 2X7LA 1E4KC 4XPGH 1H3TA 1N5YH 4BJLA 1HN1A 3BO8A 3MLUH 2M26A 3MV11 3B3IB 2A73A 5D7JD 2HLAB 3IDXH 1IEBA 2P8PA 1T83A 4TNVF 3DXAB 4V1DA 5IHLB 1EMTL 3MNVA 2V7NB 1H9VA 4PLOB 2Z31C 3Q1SH 3OG4B 4HIHB 3GI9H 3BKYH 5CZVH 1P6AB 1UB6B 3F65A 3BPNC 1MOEA 3P9LA 3S36H 2OZ4H 2Q7YB 3T1WA 1EGJL 1CR9H 5D2NE 4GLRH 5HGHB 2DTMH 4I2XA 5T5NG 4M7ZC 5GSVB 3PGFL 1P2CB 1X5YA 2ENSA 4GS7B 1X5GA 1I1AC 3QUZD 3WDIA 1KFAH 3HLAA 1QHPA 2CLRA 5DT1L 3FQRA 1T1ZA 2D7OA 3B8SA 3WFBL 4E41B 2NMSA 5DJZA 3W39A 2WQRA 4TSCH 3LMJH 4U2ZA 5T1LA 4QTHB 3BT2H 3ZHLA 1IAKB 1S9VB 3CLFL 2ZUQB 4JRXE 2JJUA 3OKNA 1ERNA 4OFDA 4KFZC 1P9MA 4XCNB 3DMMD 3LAFA 5IFHL 1FORH 1HK6A 1MRCL 4KKAC 5J1TC 4JM4L 3VXPB 3BGMA 2OTPA 1HOCB 4NQDD 1CVSC 2YZ1A 5JW4N 3PDGA 1G7IB 3IU4L 4NM4L 5EBMB 4AIXA 4YXLL 1REIA 1ZVSA 1L6XA 3HFML 4RMRA 4WU7B 5IW1A 4WTZA 4Y5VC 3GKWH 3HUJE 1JYXA 3F58L 3DV4A 3VGHA 1VFBA 1I7TB 1CGYA 5T1KD 5IMKA 3R06A 2R56L 3CK0H 5IESH 5FGCE 5DUML 2FR4B 3ULVE 3RX8A 4EOWH 3SQOH 3T1FB 3CCHB 1CFTB 4B0MM 2VDNL 4NRYA 2CMRH 3O8XC 4DEPC 5L9DH 2DLHA 5FA4B 4MJ2A 3WFCL 3FT4A 5SX4I 1XGRA 3FFCD 2VABA 3M17A 4UDTB 4PFEA 4U4BA 3OAUL 5LGKA 1JP5A 1EEUA 1WF5A 5TQ0H 3U82B 1MHPL 2DYPA 3OV6A 3DIFB 4I3GA 2GSGB 5CBAB 4AQ1B 4X4YB 1X5ZA 4UT6L 1LK2B 1AQDB 3CDCA 4HH8A 1CD1A 2OR9H 1R3LB 3LPFA 2VDOH 3AROA 4YX2L 2XWTA 2JIXA 4UV7H 3SE8L 5E70A 4OGYL 1CIDA 5T1MB 2RGSA 3RUGE 4G6AD 3KPSA 4D9RD 4QYOB 3O2WL 5DLMH 4GKNB 3GMNA 4LEXH 4HZLA 4GRLD 2UZYB 2XFXB 3O4OB 5F21B 4QHKI 5F88B 4ZFZA 2VLRD 1KC5L 5GZOD 5JXEC 5C0AE 2H26A 4J23A 1OTTC 1X4ZA 1UH4A 2B4CC 4CN4A 5D7LA 1N6QH 3MJ7A 1G0YR 5CP3H 5D1ZD 2DWEA 3MRGA 4WUUE 3VH8G 3PL6D 3C60D 1FGNL 1IKNC 3L5HA 4NNPL 4WO4D 3QCVH 3M1BB 1KB5H 5FB8A 3REWB 1MCOL 2DQUH 2CD0A 4LGSB 3LN4B 4P2RA 5EOQH 4OV5A 2AJUL 1AHWA 2LE9A 4CRPA 4TSBH 1FAKT 4ZUVB 4LDLB 3CFEA 1CDGA 3GSXA 3ARGD 3K4DA 1QACA 3MOQA 1AXSB 4P2OA 3ZDZE 3W81A 4X0KB 1HHJB 4Z7OE 1S9XA 3WLBB 1T5WA 3KHQA 1FVDB 1LILA 5C0RH 4Y4HA 3BWAB 3CZJA 4X6FB 2ADFL 4KDVA 2CK0L 2EIZB 1I3VA 1ZHLA 2VXQH 3KHOA 1BREA 3QZWG 4BH7A 1IZKA 3IS1X 5F44A 4TQEH 1C16B 2WBKA 5F1NB 3S35X 2R2BA 1E4XI 2QHRH 4YE4H 5D9SA 3QDJD 1RD6A 3MXWH 3VG9C 4XPBH 4P9HC 4LLQA 2QSCL 3CC5A 4QCIB 3ZTNL 1FZMA 4OSUH 4WI3A 2F5AL 2E5EA 3IDGB 5FYKU 5J12C 4L8DA 3N1GC 4D9QD 3TNNB 4QWWD 4GBXD 2O5YH 2Q3ZA 2C7UA 3T4AA 3D3VB 2YS4A 2IMMA 4AIZB 5INCA 3AB0C 1E4XH 1RZ8A 4HWZA 5C09D 4MJIE 3TN0B 1X6LA 3LN5A 4PYHA 3ZYJA 1NFIA 3DRQA 5L2JB 2WWMC 1PGRB 1UC6A 1FE8L 2C3GA 4UINH 3T0XA 4F7PB 1SYSA 3GIVB 1MHEA 1ZHBA 4KUCD 4DOHE 2HVJB 3MLYL 3SDDA 5IKCA 1BX2A 4Y19D 4HZAA 1X5AA 4KMLB 2R0WH 1NEZA 4P9HH 4AT6B 2NZIA 2ED7A 1HSBA 1JPTL 3SCMA 3WEXB 3KLHD 3MXVH 2BVEA 5EORL 8FABA 3REVA 4M1GL 4C55A 4JRYB 1UGNA 2VH5L 4GKSA 5CAYB 4O58L 3LEVH 5JHDB 4OQTH 1QFHA 3T2OA 3IKKA 5I6XC 4ODXA 1OGAB 2X4QA 5DJCB 3D0VA 3EOYG 2PUQT 1MAMH 3GSUA 3L9RB 1NGYB 5F70A 5GRVK 1I4FB 5CGYC 1I1AB 1SHMA 4I3RH 4MDJB 1F4WL 1F3DJ 3H42H 1N8ZA 4X4MA 3ZKND 4IRSD 2BSSB 3QULB 4B50A 4IM8A 4AEEA 2W60B 1CLZH 3I75B 1IKFH 1UYWH 1HKLH 2NW2A 4G8GB 3I85A 3BH9A 5A40E 2F8OA 3RWHA 2VQ1A 3M45A 4JFED 4ZPVB 1BBDL 1K4CA 3U9PH 1TXKA 1BJMA 3CNKA 3VWJC 4HFUL 3NFSL 3ULVL 3MRBB 2C1PB 2MCG1 3B83A 2IAND 3QIWD 1EGJA 2W0FA 4GKOA 4G43B 1MCPL 5E99L 3NACH 4HJJL 3CFDA 3TBWA 4U7KA 1KXTB 4MVBC 4KC3B 2P7TA 3FRUA 2V6HA 1E6JH 4HV8A 1JFQL 1ULVA 4Y5VB 1SJXA 1RZFH 1RUMH 1K6QL 3UJTH 3HE7C 4HIEB 1OCWL 4O4YL 3KXFB 1UWEL 1FYTD 3LS5L 4NNYA 4EI6A 5C2BH 4E0RB 2B8OT 2OLDA 5IMOA 1OD7A 1MF2L 4J3XA 4FXGA 1XFPA 4P4KA 1XGYH 5DVMA 3HI5H 4PLKD 4G9DA 3L95A 1A4JB 2EDOA 4U1HA 4DEPB 1IGJB 3QDGA 1LGVA 2VXSH 1H3VA 3P0YH 4H26B 4MX7A 4PJCE 1EJ6A 1Z3GL 3B9VA 4OZHA 3D18B 5JORA 4OQ1A 3C6LA 1B6UA 5TQ2L 5A2IH 1OAKH 1JWSB 2N7AA 2DLFH 4Y5XC 4ZAKB 4NQTA 4LBEB 1NJ9A 3FB7B 5D93C 1KCRH 1OAUH 4PJ5A 1FH5H 3FO9B 1LO4L 3U4BL 1K8DB 5K93A 2F9BT 4WV1C 1JGDA 1QFWH 1MIEH 4PP2B 1P4LA 2XG5A 5E8OB 4H25A 5A16B 5T5NF 1SEBB 4LVHB 5ICYA 5FOBA 3PWPB 2A9ML 2A74B 2R2EA 2G60L 4UTBL 1EAPA 4ODUA 1AIFB 3I50H 4XNZC 4ZUWB 1DBML 1S9YA 1T6WA 2P8LB 3S96A 3ZMRA 1IFHL 5SWZE 3MRLA 1F3RB 1FNGA 1V8HA 2GJ6D 3Q6GH 2CPCA 3MUGA 1MQKH 4DN4H 4QRRA 4Z7UA 1RK0B 3Q6FA 3HG1E 4P5TB 1M6OB 5DK0A 1J7VR 3ECBB 2J4WL 4WWID 1A2YA 1I1CA 3O6FA 3C8HA 4XH2B 1HQRA 3IFLH 2YRLA 4WWKB 1YEKL 4XXDA 1NMAH 5CSBA 3WN5C 1DEEB 1ORSB 2Y72A 1U92A 3H7BB 4N1HB 1DQJB 4YDIH 4ZTPL 5IB4A 2A1WL 4X7TB 3H9HA 2F54A 2O61B 3WJJC 5HTSA 3WCYA 4GKZA 3DXAE 4MZ2A 4PREB 1HHIA 4YHPB 1PYWA 2WBWB 3L3IB 1I7RB 4NBXB 5DWUH 3BH8A 1RHHA 1ZLWK 1I8MB 3MA7B 32C2A 4X5LA 5M7QA 3D69A 2BY2A 5HYJD 2W9DL 1WWWX 3V7AG 2ZUSA 1UCTA 5EA0H 5I73B 3QO0A 1VEOA 2VRAA 1XGQB 5ERWA 4MXVF 2FB4H 2NX5B 1L0XA 1JGLL 2CJUL 4X9FA 5DGQA 2JJSC 1UCBL 4CU8A 2VITA 4FQLH 5FA3A 4E41E 1T22B 5IB1B 3O3BB 1SJEA 3MV9B 2E9IA 2BDNL 3MCG1 1MJUH 1W8NA 3OPZH 4LF3A 1WZKA 4OD3H 4E9LA 1YN7B 3JWNC 1N4XL 4JFHE 1J87A 4K7PX 3WL9A 4S2SB 4L1HA 3K1KC 3RTQD 1QFOA 2VAJA 1YN6B 1T1YA 3J8F7 2Q8BL 3X11A 3PGCB 4P3WA 1PD6A 5EUOA 3AB0B 1N6UA 4NCDA 4LCIH 4QGTA 5F3HA 2NY4D 3P30L 1JWUB 1RUKH 5CD3B 2OK0H 3SE9L 5DFTA 2HT2C 4OZIA 3K1DA 5LG1A 1KNOA 1VB9A 1F90H 2YEZA 4HK0A 5FOJA 5CIPA 5IVXB 2P44B 5EOTB 5C7XL 2C4FT 4R4BB 2ZUUA 2W0KA 4LCWD 2XZCL 1AKJB 1KGCD 5CSZA 3X3FL 3JV5A 1U6AL 3BJ91 4OM1L 2YC1A 4QTIH 4HWNA 5I6XB 3HI6L 1A0QL 3N50A 3MRFA 4TSAL 5H37G 4AQOA 5EU6D 2VLLB 1JHTB 3BQUD 3RGVC 4M7JL 5J9PB 2YOCA 3LOWA 4MMZC 5D2NA 3RVVC 1MRDL 3EIFA 1SY6L 4XMPL 4RMUA 1M7DB 5A2FA 5IGXL 2VL5A 5EO1A 4D0DB 2KUTA 3PWJB 5C08B 1EHLL 3H0TA 3MODL 1IT9L 2YMXL 4ERSH 5E4IA 2DQDH 3L3GA 3MRMA 4M62L 5KBNC 1F3JA 4YFLF 3S4SA 5IUSA 3UX9B 1NDMB 3THML 1AE6L 5CJOH 4ACPA 1A6AB 4JRXA 2ZOKB 1OP9A 2YD3A 1SMOA 3SE4A 1U8IB 2XNAA 3DX6A 4TNVK 1LK3H 1OAZL 1D3CA 3NAAL 4XMLH 3P4MA 3KNBA 1XIWA 3TJHC 5I76A 1OSZB 2QQNH 2XICA 3KPRB 1FFRA 3TBTB 4M7LH 3QWRD 1NGWB 1T3FB 1PQZA 2AABH 4YXHH 3VXMB 5ISZB 3IXAB 5KVMC 4TVPD 4JKLA 5C0DA 3O2VL 2G9HB 3EUUA 2GI7A 43CAB 3HUJA 2UWEB 2CH8A 4M9OA 4LAQH 3UTZA 1FIEA 4R7NB 3JTTA 3QRGH 2D2OA 4JREC 4ZO6A 4ZOCA 4JJ5A 1ZA3B 3FMGL 3DURB 3S35H 4KTDH 2RFXB 3C5SB 3EJYD 1NUGA 2AQ2A 3IVKB 4EN3A 4HGMA 4RFNC 2ORBL 3CDFA 4LQ1A 3BKMH 1UVQB 2DI9A 2H6PA 4JZNB 5L8JB 4ZG1A 1C1EH 3P11H 3M8OL 2KH2B 1CZ8L 2GSIB 2VAAB 4I4WB 3DPBA 4OZGB 4EBQL 3TO4A 3T8XB 4GO6B 1MLBA 2VN4A 2NNAA 3K2UH 4PJ7F 5C8JB 4M1CC 3GKZA 3FQXB 3MBEB 5D1QC 1JN6A 3K0WA 5FO9B 1PKQB 4K9EH 3QDMD 4LQFL 5KVFL 5TE7L 5L8KB 3RIFF 3UDWA 3MCLL 3MJ9H 2ZUVA 1XR9A 3NCJH 4NKOB 4XNZB 3V6ZA 3C9NA 4HXBH 1HH6B 1WCBB 2CRYA 3RUGA 3TBVA 3TF7C 4EDWL 1A1MB 2X89D 4OF7A 3SJVB 4D0BB 1AGBA 4IDJH 1QPXA 2COQA 5K59F 2IF7A 4CVXB 1WWBX 3D3VE 5D72L 3RZCD 5C0AA 3FFDB 3NABH 5T3XD 5ITBH 4F7EA 4OB5L 4ENEC 4HLZG 5DQJA 1N0LA 4J3WA 4WUUA 3DSFH 3G6JB 4XP1H 3WN5B 2WQ8A 1NLBL 4H20H 5I8CA 4CMMA 2AS5M 5JO5A 3H9ZA 4TUKL 3D39A 2R8SH 4NP4L 2BHUA 3QNYA 5AYUH 3OSKA 5IHUL 4LSRL 1TZIA 1B3JA 3DYPA 4WUKL 5ENWA 1G7PB 2QR0A 4WNQB 1DVFA 1S7XA 4JRYE 1V7NL 2CKBB 5JHDE 5IHBA 4O00A 2DQEH 4GRMA 4LLYA 1RZJC 3VFWB 1OGAE 2HVKB 1NC4D 4NN5C 5JDSB 3MRKB 5DMKB 5KVGL 2YRZA 5F7NC 4LOUC 1P7QA 1EBPA 3CXHJ 1G7JA 4JO2H 5I74C 5E8EA 3WIIH 3O9WD 4NO0B 5KSUA 3H3KA 4YIQB 1VEPA 5EOCH 5TF1H 2CDFA 3N1PC 5LGJA 1KJ2B 4PRAA 1JF5A 4PJ8D 1J1OH 2G2RA 3EYUH 4PJFB 3VG0L 4G8GE 5FKPB 2FECL 4LSSH 2VLME 3DROB 3LKNA 1QLFA 3UAJD 5IR1B 2XYCA 2XKNB 4HJGB 5BV7H 5EC1B 1VFUA 3O0RH 3UTQB 1QR1B 4LLVA 3R0NA 3VFOB 3JWDC 1RZJH 4APQC 4V1DD 1VACA 2AJXL 4I77H 1OM3H 3DJ9A 4MJIA 2PTUA 1UB5B 4WEMB 2PO6A 4BK4A 4FQIH 1ITBB 3BPCA 1CGTA 4XZUA 3K8KA 4YZFE 2DIAA 4K8RL 5BVPH 4XWOC 5JZ7C 1ZTXH 2HFFB 3KXFE 4F7MB 3PIQB 1YNKH 3DI3B 1LEGB 1BEYH 1MCEA 2X4PB 4PLJC 3E2HB 4R2GC 4HPOH 6FABH 5ILTL 4I0PB 3CPLB 1FZJB 1U8LA 5E08H 3TWCH 3WS3A 5LWYL 3HNSH 5IW6B 3BDXA 3G5XB 5IJKC 4WCYH 5L2KB 1VGEL 3QI9B 2X1WL 2WZPD 1JHLH 4FXLA 3DO3A 5T1LD 1WBZB 4HUMB 5EC2A 1IAMA 1HDMB 5GGQH 5IK3A 1KEMH 4R8WL 4ODHH 5MHSE 4EQ3A 5IB3B 4FQ1L 4RZCA 3D1MC 4MD5A 4OLZL 1PFCA 2R2CA 1D5ZB 3IDMB 1NLDH 4DWHA 1QFUH 1VGKA 5FYJD 4X6CF 2YD8A 5D7IB 5DD3L 5MP6H 5H37H 4HUVB 4O2EB 3AREA 1QSFB 3PWPE 4HS6B 1X5FA 4YDLC 3MNWB 4PD4K 4X9HA 4LRNL 1DSFH 2R23A 3L3DB 4MCZA 2MKLC 4IHOB 3QP3A 1CS6A 1SY6A 4PJIF 1L9NA 3MFFA 4PJXF 4UBDD 4DK3A 4ZO8A 1GGUA 1QLRA 3HC4L 4JZJA 3G6DH 4ZUSA 2FX7L 2NZ9D 1ZOXA 3VCLA 4MAYC 4HFWA 4FMKA 4MNQB 1BVZA 3KPPB 1OLLA 1G6RB 4U1KA 4K3JL 5FDYA 1FNSL 2AV1A 1CDUA 4U1MB 3MO1A 2QBWA 3WYRA 1U8OA 2BFVH 3P9MB 2AEPH 4PJCA 2JIXD 2XA8H 1I9IH 1BFTA 3BESR 3GI9L 4WEUD 5I1GH 5C0CB 5F7HA 1RUAH 5F7FA 3KPSD 5TH2A 1ONQA 3QIBC 3K4AA 3N1QC 4U6YA 2F74A 1A7PL 2Q87A 2OZ4L 4R4NC 4EXKA 2PR4H 2J5LC 3BN9C 3ZE2F 2NX5E 3QUXB 5D1QB 2QKIA 1AD0B 3CFCL 3TFKC 1BF8A 5D7LD 4M6NH 2A9NL 1T7ZA 1GRWA 4OLWH 2VDKL 4J4PA 5DRXA 2FX8L 1BWMA 5DD6B 1PG7X 3MV9E 4BFIB 5EZIH 4YHZH 2R4RH 2Q76A 4P2RD 3U48A 5HHPA 2NTFB 4YAQA 3PDOA 3C8KB 4HD9A 1C12A 5SWZA 3SDCA 3K74B 1LO2H 4Z7WB 4LNRB 3JVGC 1N5AA 1RJYA 5F3BB 3HG1A 1EEYB 1X5JA 2FEDD 3KPLA 4ZPTB 1UFUA 1KCSL 1FVCB 4GAYB 1GC1C 3FQWB 2AJZB 2YA1A 5GSRB 4RGMB 3MACH 4ZSOA 1ROWA 1PW3A 4Y4HD 1CF8L 1F45A 3QXVA 1NEUA 4M5ZH 5IVXE 1DL7H 2R0LH 4PJEB 4DKAA 4HLZH 3WXVL 3HI1B 3B3IA 1E4JA 4WY7H 4ZO7A 5HGDA 3V4PL 1MCFA 3DXAA 3LDBC 1F00I 2Z35B 3QUYC 1OY3B 4PRDB 1OWWA 1WSST 3KJ4C 1T0MB 4HIHA 4GAJL 5HYSG 1NCAL 3ULSB 1AFVH 4NN5B 4HUUB 2WP3O 4OTXL 4TYUA 3WD5L 1AH1A 2EKSB 3SE3C 1UB6A 4PJDB 4Z7VF 4YH6A 4RISL 2Z92B 1QPPA 3QXUA 2Q7YA 1KOAA 5I74B 5HGHA 1GPOH 3F7RA 2UUDH 1MFCH 2IGFL 1QKZL 5HI5C 1A6PA 1FNEB 1ZT7A 5GSVA 1GC1H 1V5JA 3QR2A 1P2CA 4HAGA 2CIIB 3SKJH 2DQHH 2VJXA 3SDXA 1ZT1B 1QTYT 2FJHB 4KK9C 2ICES 4K23H 5C08E 5EWIL 2OR8A 4Q0XH 1ZANH 1XZ0B 2CGRL 2OR9L 4E41A 3QEUA 5T3ZH 3WNNA 4JPKH 5FXCH 4QTHA 3C09C 1U58A 5IT2L 2H9GB 1S9VA 4ZNEE 3SDDD 5FM5M 1FC2D 2EDDA 4IRJD 3GSNH 1AGFA 3RY6C 4Q2ZB 3VXPA 3T3PE 1HOCA 1DDHA 3SCMD 2ITCB 3MA9H 3KPRE 5IBUB 3PV6B 1T5XB 2VKWA 2E3VA 1RJCA 2BVTA 1MFBL 3VXME 5ISZE 2AJ3B 1T66C 3HZVB 2PCPB 2J8HA 4WU7A 2YBRB 2UWEE 4PBXA 2QADC 2N4IA 4WI8A 2FO4B 3U0WH 3CMGA 4A2MA 3KYKH 3AXLB 4YGAB 3N85L 1O0VA 3R0MA 3T1FA 3CCHA 1CFTA 3HB3C 1JCKA 3QBTB 1NAKH 1WISA 5DZOA 1RZIB 3EFDL 4HS3B 2CK2A 3S7GA 5DURD 4PJ9C 2BY1A 4H8WC 3BPLB 1Z9LA 3FO1B 4PJAA 5GJSL 1NBYB 1CXIA 1PEZA 5C2UB 4UDTA 2DKUA 3ARPA 2I26N 4MS8C 4LMQI 4OZGE 2AQ1A 2B4CL 1I3RB 5I8OH 3DIFA 1EXUB 2GSGA 4F33B 5CBAA 1YNLH 4K3GA 4X4YA 2DF3A 2FLRT 4HQQL 1LK2A 5HXMA 1AQDA 3MFGB 1A6ZB 4R97C 1R3LA 1PKQE 1EK3A 4AM0B 4YDLB 3MMEB 3MXWL 4ONHB 3ZKNC 2C1OB 2BZDA 4BZ1L 4JQXA 3MRJB 5T1MA 3VRLF 5D1XB 3MRIB 2IAMC 4QYOA 2DN7A 4GKNA 3SJVE 1FG2B 1S7QB 4ODTL 5GGTH 2XFXA 4P4KD 5F88A 1D6VH 1LDPH 5C6TL 4UNTA 1XF4B 2RCSH 3L5XH 3PABB 5LGHH 1IGFL 2BJMH 3QDGD 3VFGL 3G6JE 2IFFL 3M1BA 1OTUD 3C6LD 3REWA 4MAYB 5I1KL 3I6GB 5KW9H 5B3JE 3LN4A 4D8PB 3WO3B 2P43B 5DR5H 5E0QA 3BUYB 4OIIL 1S78D 4PJ5D 3VWKD 2BMKB 3RAJL 4DW2L 3HZYB 4Y16B 5F9JB 4ZUVA 5CKGA 1T7XA 4WGWB 3WNLA 2PW1B 4S0TD 1D5IL 4Z8FL 5I1HL 1AXSA 2D9CA 2HRPH 4X0KA 1HHJA 1NMCC 3WLBA 5EU5B 3ZHKA 2YUVA 1FVDA 2CXKA 5GGUB 3BWAA 3QIBB 4X6FA 5CS7A 2YHGA 2Y06H 4V2BA 3AVEA 1RMFL 1V05A 4JDZB 2EIZA 2XQYG 1MAML 3CMOL 4OCRL 4DN3L 4POZD 3FQTB 4QRRD 3I6LD 1L7IL 3AY4C 5FF6B 4AENB 1U91B 2EECA 1IVLA 1C16A 5F1NA 1I9EA 4I0KA 3O6FD 1ZLSH 5DRWA 2FH6A 4PJFE 2MQ0A 3QCUH 2MNUA 4KUCF 5IBTL 4QCIA 1A7OL 5J11B 2FEEI 1CLZL 1A7RH 1BBJB 4TNWF 1IKFL 3BGAA 3IDGA 4PP1C 4YBHA 5K9OB 4PY7B 1A22B 3TNNA 2A83B 4WW2A 2F54D 5E9DB 1M71B 4L4VD 2IWGA 3ZHDA 2HMID 3S3SA 2OZ4A 4L8BB 1GGIH 3CSYB 4K7FB 4AIZA 4IBLT 3OG6B 3TN0A 3T77B 4MAUH 3DYMA 1MY7A 5KJRL 4KI1A 2DM4A 3DETC 5DZLA 3V6OA 2ENYA 5L2JA 1HHGB 3OKDB 1E4KA 2C4FU 2M2DA 1E6JL 3NN8B 4JPIB 4F7PA 2W38A 5CJXC 3GIVA 4OGZA 5ECJE 3V0WH 2HVJA 2AAVA 5TDNA 1VFAB 1UA6L 5ACLA 3VDAA 4AT6A 1C5BH 3WEXA 2C4XA 4P23C 2FYYB 2XZQL 3KJ4B 3PGDB 4MB5A 5CEXB 5L0QC 3HI5L 3RIFK 1HZHL 5L2KE 4JRYA 2EC9T 1FNLA 5JHDA 2DL2A 1OGAA 1MAJA 3S34L 2AJYH 1DBJL 3OKKB 3L9RA 3T3MF 5MEOB 4OZ4B 2L0DA 1NGYA 4OGAC 5E2WH 1I4FA 4NC0B 4NZUH 1I1AA 1DCLA 1JNLH 4MDJA 5I1EH 5KS9F 1JK8B 1R3JB 4HG4K 1NBZB 5D7IE 4URTB 1TPXC 3QULA 4QEGA 3I3BA 1I9RL 2W60A 1UWGH 3I75A 4TRPL 1Q1JL 3GK8L 1QSFE 4P99A 1WC7B 4G8GA 3TT1H 4K07A 2VDPL 1QVOB 43C9B 4ZPVA 4MLIA 2BVUA 5FM8A 3MRBA 5AD0B 1KN4H 3NCFB 4G43A 3Q6GL 5T1DH 1CGWA 4M5YH 4UDUB 1MQKL 5DJXB 3ZKXC 2XN9B 1C8PA 2VDML 4ODSL 1N64L 3O6MH 4Y5VA 4KY1L 4BK5A 1MUJB 1HSAB 1OSPH 2QADB 3QFDB 1U95A 3IRZA 4PJGA 2NY4C 3IFLL 3KXFA 4MNQE 1F6FB 4E0RA 1TQBB 1BVKB 4E42B 1FRGH 3VGDA 3GB7B 3O8XA 4XGZB 4V2CB 1IAIH 2APTA 3SOBL 4PJ9B 4H26A 4AH2B 1PG7H 2NR6C 3D18A 1VADB 4JKPH 1X4YA 1JWSA 3UZVB 5C0CE 4LBEA 1MLCB 4HKXB 5MENB 3FB7A 4JRXD 2GTWB 1QP1A 2FNBA 3F6LA 3FO9A 3K7UA 5T5FL 3CGTA 4DFIA 4LSUH 1MFDL 1XIWD 3BQUC 4R97B 3MRHB 1LD9B 3OXSA 4XWGH 4LSVH 4PP2A 2QQKL 4JM2C 5E8OA 1WEJL 5A16A 1FIGL 1SEBA 5ESVA 3HA0A 1ZT4B 4OLUH 3DBXB 3PWPA 4G6JH 2A74A 1F11B 1AIFA 4G7YH 2ZP0T 2X42A 2YD1A 5J0BA 2FD6L 2P8LA 4GSDH 4JZOB 5E7BA 3Q5OA 2Z8RA 4PJHA 4S1DD 3FO0H 5JXEA 3ARFC 1BD2B 4Z7WE 2IMNA 1RK0A 4NC2B 4P5TA 1M6OA 4XVUD 2A6JB 2CKBL 1IKNA 1EHNA 3GMLB 3ECBA 4NZRH 4EN3D 3DRTB 4WWKA 5EFIB 1HYSC 1DEEA 1ORSA 5GS0C 3H7BA 4K3EL 4WTZG 1DQJA 5KVDL 4GUPA 4X7TA 3L5IA 1YA5A 4OIBA 2FATH 4PJEE 1C7SA 1S5HB 3T04D 3TO4D 2O61A 2F5BL 5JDJA 3KYMB 5F7MC 1KJ2L 4PREA 3EHBC 2GKIA 1F8TH 4YHPA 1EVTC 1H3XA 1J05B 3IETA 3MOAH 2UY6A 3L3IA 3IF1B 2XPGA 1I7RA 3NA9H 5FO7B 4XT1C 1I8MA 3MA7A 1AO7B 4HBCL 4PJDE 1RK1B 4OKVB 1P7HL 1TJIH 5ACZB 4YK4C 2D7QA 1GGCL 1XAUA 3GSQB 2ZKHH 4KGLA 5MEPB 4BELD 1MCJA 1XGQA 3QCTH 5L6YL 1FL5B 2NX5A 4ZXBB 4ZQKA 4NHCH 1LO3H 5FKAB 5J6GB 2Q20A 4YXKL 4HPYL 4WUUD 5IMLB 1RFDL 3QHFH 1QSEB 1T22A 5IB1A 2AERT 3O3BA 1E28A 1YYLH 4P9MH 3CFIC 5HHVL 1YN7A 1NUFA 4ERSL 5LBSH 4S2SA 4C4KT 4RWYL 2DQDL 1WZ1H 3O45B 3D39D 2GITB 2X4OB 1K85A 1YN6A 2GHWB 4NIKB 4R9HA 2NCMA 3UP1A 2RQ8A 2ZJSH 3KLSA 4AEFA 4PY8I 3O3UN 3FB5A 4WHYG 4R90L 4XCEB 3FB8B 5HDBE 1DVFD 4LDEB 1JWUA 3NTCH 3GMPB 2MPAH 5CD3A 1UM6L 5FYKE 1FL6B 1UG9A 4JFOB 4GXUN 3GBLA 4YXHL 1ODAA 4XPTH 1RSFA 5D2LF 5J89A 3RWGB 5GJTH 4KZDL 1P7QD 5FGSA 1CDIA 1T89C 5IVXA 5EOTA 5KANG 5EBLB 3VDBA 4R4BA 5KOMC 4P23B 3X17A 2BVPB 2VQUA 4OM0H 5L0QB 3WXWH 1CGSH 1AKJA 4FQCL 1U8PB 1X5LA 3EYOB 2Y1VA 4OZFG 3T0WA 1U3HC 4NM8H 5M95B 3TO2B 4U1GC 3HNVH 1J5OH 2X09A 2NY0C 3BKML 4MD0B 2AJVL 2VLLA 5DQDL 1JHTA 5K9JL 3KPOB 5J9PA 2DBLH 5ITFA 3MLSL 5JUEL 3KWWB 4FFZH 1M7DA 3K3QA 3OHXA 2ICCA 4D0DA 1U8KB 3WLWC 3MV8B 1FL3B 3PWJA 4MJID 5C08A 5KAQF 3GNML 2PO6D 2EDRA 4HF5L 2ICEB 1YY9C 4AMKL 4PS4L 1CK0L 4O5LL 2CO6B 1BQLH 1NDMA 1G6RL 3UEZA 1E4WL 3VWJA 2IG2H 3MRRB 1A6AA 5F9DC 2ZOKA 4ZNEA 3F62A 2ZG2A 5E2VH 4Y1AB 5FM5O 2OI9B 4OGXH 3UAJC 2VTFA 1OSZA 1ZEAL 2YXMA 2VWEE 1TETH 3KPRA 3BD4A 4LRIA 3TBTA 4GQ9H 4PGDB 1T3FA 1VKXB 4EJ1C 5FHBL 2OL3B 3NABL 2V5TA 3VXMA 5ISZA 3IXAA 1T83C 1B0RB 1C08B 4WTXA 4YHMH 1KULA 1P1ZB 3AGVA 43CAA 2UWEA 3SPVB 2DICA 3FKUS 1QBAA 4R7NA 1A1OB 4G42B 5BO1L 4L3EB 5IFAL 2EEBA 1EIBA 1ZA3A 5F1OB 3QISA 3DURA 2RFXA 1NEZG 3C5SA 2XA3A 1FBIH 4JR9L 3IVKA 2EZ0D 4QRQB 5BOPA 4KVCH 4LLDB 1KCLA 2BY3A 3ARED 4UT9H 3EJZC 5MEQB 4GMTH 1UVQA 3OXRA 4NYLB 1JNNL 3LCYA 4Y5XA 1MCQA 1WICA 5HDQH 2EH7L 4I1NB 4JZNA 2L7JA 3JV6B 3LQAL 1YDPB 3HZMB 4X7SL 2GSIA 4C57C 2VAAA 4I4WA 4UAOC 3LRGA 4OZGA 3T8XA 3ET9F 2GJJA 4RGNC 3KS0H 1IC5L 2EYRB 5C8JA 3FQXA 3MBEA 3QG7H 1NQBA 3S8WA 4JM2B 4UIKL 1EFQA 5FO9A 1PKQA 5EOCL 2O5XH 4U3CA 3BEWB 3IT8D 3OKLB 4GW5A 5GGRB 5CEYB 1J1OL 4NKOA 4KKLD 4XTRC 5KTEL 2Y07H 1HH6A 3TJEL 3IDYB 1NDGB 2AI0L 1J86A 2BVOB 4PGJA 5JIKA 1BQSA 5EBWB 5EUKB 3ARFB 5E9DE 1XF1A 1A1MA 3SJVA 1EV2E 4KK6D 5AG9A 1MFAL 4CVXA 4FABL 1NCCL 3BE1L 4NQSB 1VHPA 3FFDA 4J2XA 1NCNA 2WANA 1S5IL 2OQJB 4MA8L 4KROC 4N9GB 1VCAA 4LVOC 5AZ2L 5KZCB 3GO1L 1SBSL 5DJAB 3G6JA 3WN5A 4Z78B 3NCMA 1IM9B 3LQZB 2UUDK 1LVEA 5IIEB 2AP2A 1S7VB 2XWJB 4JY5H 5CHNB 1NGZB 4NT6B 5SV3A 3TV3H 1CXEA 3TYGH 1CFQA 3WJJA 3NIDF 3WFZA 3FAXA 4JQVC 2FGWL 1G7PA 4MD4B 3WNPA 1IBGH 3RVXC 2CKBA 1U8JB 4J4PD 1YQVH 5E08L 3TWCL 3HNSL 2J6EH 4KJPD 4NUGL 3VFWA 4I9WE 3LRHA 4XC1H 5DMKA 1OPGL 1JHLL 1CE1H 4DVRH 5HHOD 2DDQL 3JWDL 5D6DC 1CG9A 5SWZD 3SDCD 1D5BB 1RPQA 1KEML 4ODHL 3OR7A 4OFVA 4YIQA 1FHGA 3HG1D 3FONB 1OD9A 3FAWA 1KJ2A 5FYKL 3KVQA 2R4SL 5ETUB 4X6BB 5E8NB 4PJBB 5FKPA 3DROA 5IR1A 1TJHL 2XKNA 4HJGA 5EC1A 1QRNA 4N0UA 3UTQA 4PV9B 1NC2A 1QR1A 3CLEL 3AM8C 2Q86B 4KRPD 3DARA 1T2JA 5C6WH 2XN9E 2OMNA 1UB5A 4OF0A 1K2DB 1KENL 2DI7A 3VD7A 1NCTA 2I24N 3G6DL 2HFFA 2FEDC 2F19L 2P8MB 3ORJA 3PHOB 4P2OC 2CSPA 3PIQA 4WHYH 1LEGA 1G9NH 4OLVL 2X4PA 5GS1B 4Y4HC 4FFYH 4I0PA 4UOW1 3CPLA 4DJMA 1FZJA 4UOW0 1GJIA 2HAZA 1U3HB 2JB6B 4TPRL 5IW6A 2V5MA 1Q94B 1ZKAA 4Z0BH 2CO7B 2IADB 4K94C 5L2KA 4KZEL 3QI9A 4TNWK 4E41D 1IEHA 3KGRA 1EAJA 2NY0B 1BOGB 5I8KL 5IF0B 2W1NA 2J88L 4PLNC 4PRPE 2YWZA 5IHZB 3RGVA 4HKBB 1WBZA 1DLHB 5MENE 3RNQA 4JFHD 1RUPH 4XCFH 3EOBB 1HDMA 4K7PL 1CBVL 5H35A 3T0VA 1N7MH 1RUAL 3NZ8B 3GIZH 1XMWA 2MQCA 5IB3A 2R69L 4XPFH 4OZFH 1D5ZA 2EC8A 3IDMA 3I9GL 2PR4L 4ONGL 1JYNA 1Y6MR 3QJFB 4O2EA 4OLXL 4HUVA 4P48A 3CSBA 3CXDH 4HBQA 1QSFA 5I1CL 3K80A 2YUZA 4HS6A 3IFOB 4LGRB 1NGPL 4OLWL 4RMSA 2BRRL 4NKIL 3L3DA 2H32H 2NY2C 5DGRA 5DD0L 1S9KC 3JV0A 3WUWG 4IHOA 1BD2E 4K94H 1H3PL 4NBYB 3VXTB 2QV2A 2E6QA 2XRAH 3ILQC 3RL1B 1IC1A 3MLZL 5HGBB 2DLIA 4FZ8H 4GQPH 5CILH 5L7XL 3UYPA 3LH2H 1I8LC 3RX5A 4AEIH 1J9CT 1BF2A 4I13B 4JDTH 4XX1G 1YC7A 2A0LC 4K8RD 1OTSD 1CFVL 2CRIA 4MNQA 3QUMB 4U0RC 4O02H 3KPPA 1RZ7H 1G6RA 3EYSL 1NGXB 3T4YB 1KN2H 2DM7A 2GCYB 1EO8L 5HDLA 3OX8B 2F58H 4LP4A 4U1MA 1T0PB 2HJFB 3P9MA 3BDYL 1D9KB 2CLVB 1AO7E 4WEBH 4P3CH 35C8H 1AFVL 4GW1B 5C0CA 5DFVC 1OVZA 4UAOB 1JI2A 3JV4B 4TVSa 2CQVA 1B6DA 1NCWH 2E9BA 5C0GB 1TVBB 2AK4B 5D1QA 4FXKB 1AD0A 4NWTL 4PJ7B 2V2XB 3RIAK 3RHWF 3TIDB 3QUKA 3KYNB 4NOFA 3IU3B 3VFSB 1QSEE 4UNVA 2G5BB 3MYJB 5DD6A 4BFIA 5K33A 4IS6B 2V9RA 3B4NA 1DP0A 4GXVL 1HINL 3MBXL 5DJ0B 2WBJC 3C8KA 4X5WB 5DC9B 1YEIL 4KKCD 1W0VB 3ILPB 2BXZA 4Z7WA 4LNRA 2NXYC 2YUWA 5F3BA 3HRPA 1EEYA 4LVOB 1EMTH 3VI4E 4CN6A 2KKQA 4Y88A 1FVCA 4GAYA 5GSRA 3FQWA 2AJZA 4JCMA 1YUHB 4PRIA 2AW2A 4GJTB 4XNUL 4UTAH 3UYRL 2QL1A 1X3DA 4MXWL 3KPQB 1EGJH 4PJEA 5JR1L 2H2SD 3HI1A 2M1KA 4KDWA 1JTOA 3PGFH 3QG6B 4M7KL 3SDAB 1NCDL 2HJLB 3RDTB 1AR1D 2Z35A 4PRDA 1MWAB 1EDQA 5DT1H 1F4XL 3QYCA 1U8NB 1T0MA 5J3HC 3ULSA 2VSDA 4HUUA 5F93C 3WFBH 4OUUB 1V7ML 2VDQL 2EKSA 1M7XA 4PJDA 2XTLA 2ZG3A 1CWVA 3CLFH 2Z92A 2LU4A 4K7PY 2IFGA 1MY5A 5IFHH 1KJVB 4OAWB 1MRCH 2CIIA 4JM4H 4DTGL 1ZT1A 3MV8E 1A1NB 1FPTL 3SO5A 3IU4H 3OTTA 3TN0D 4NM4H 3JXAA 4YXLH 5I1LB 4KU1A 1XZ0A 1CVRA 1PKOA 3IJSB 3HFMH 2DD8L 2H9GA 2WSKA 3O6FC 3F58H 2I60L 3BHBB 5A2JH 4XB8A 1HWHB 5CBEB 4P2QB 4Y1AE 4PD4J 2VZ3A 2R56H 3OB8A 4XNMB 3ZDXF 4QHKJ 4Q2ZA 5DUMH 4HH9B 2ITCA 3EDDA 3PV6A 1T5XA 4H8WL 4P0DA 4JDVB 4S1QL 3NPSC 4Z95L 2AJ3A 4JRYD 4OZFB 3HZVA 5JHDD 1D6EB 4OUOA 1T21B 3WFCH 1WVZA 1OGAD 1A6WL 4JO4H 5I1AB 1DQDL 3OAUH 2FO4A 4L3EE 2B5IB 5DR5L 3V7MA 1MHPH 1I1AD 1Q9OA 1QZ1A 4MMXC 3P0GB 2H32B 4HK3J 4UT6H 5IJKA 4WI9A 4XVTL 1NFKA 2HKHL 4HS3A 3U0TB 4KJWC 3I3DA 4YX2H 3FO1A 1O5DT 3E3QE 4G8GD 1NBYA 3SE8H 2HTKC 4OGYH 4QHMB 3U4AA 5DVOA 5DRNB 2WNGA 3R1GL 4KKAD 3STLB 3O2WH 1I3RA 5DEFB 2GW5A 1EXUA 3O2DL 4LCUB 4F33A 4KMTL 1FFPB 1KC5H 4QF1B 4NQCB 1K3IA 1XH3B 4OZHF 1A6ZA 1F02I 2OXGA 3WUZA 4HEME 4G8FB 1PY4A 3TBSB 4O9HL 3ARUA 1FGNH 3MMEA 4NNPH 4M93B 3WV0A 4ONHA 1MCOH 3R8BB 2C1OA 1X6NA 1MI5B 3MRJA 5D1XA 3K8LA 3KXFD 2MTPA 4JY4B 2AJUH 4X83A 3U83A 3PJSB 3Q5YA 3FOLA 1S7QA 5HVGB 1MCIA 1P4BL 1T80A 2LQRA 4OCYL 1W2KT 1NH6A 3WKMH 1XF4A 3IDIB 4Q6YA 3RWIB 4OFKA 2PXYC 3O8XD 4OCLC 1ZLUK 4H0HB 2R0ZL 4G6MH 4PRNB 4MAYA 1MFNA 3I6GA 2Y36L 4D8PA 1WWAX 5CD5C 2FEEL 2LAAA 4MA3B 2ADFH 4Z7UF 5I8EB 3LEYL 5MHSD 2CK0H 4HX1B 2BMKA 4OI8A 1FFNB 1IGIL 5F9JA 1INDH 1V3LA 3FQNB 3HZKB 5D2NC 2PW1A 1CL7I 2ZZUT 3DVNB 3TBYA 2YD2A 1J11A 4UB0L 2D9QB 3CFBA 1J88A 4Z18A 5EU5A 2QSCH 3ZTNH 5CIPH 2F5AH 5GGUA 3QIBA 3C5ZB 1DANT 4JDZA 1WQVT 1S7WB 2K1MA 5JXED 2GY7B 3UCRA 3WNMA 2A6DA 1OTTD 5HHQB 3FQTA 5FF6A 4AENA 1U91A 4P5TD 4KKNA 3SKMB 1CL7H 1CDYA 1R3IH 5KSBB 4RA0C 3AU1B 3N9GL 2ESVA 2VE6A 1CLOL 3FTGB 2HN7B 4WWKD 5DHYB 1FE8H 5K9OA 4PY7A 2FX9L 3HRZB 5D7JB 3MLYH 5DJ2B 5IEHA 4W4OA 2A83A 1M71A 1FNHA 3NH7L 2Q3AA 2QTEA 3LV3B 4L8BA 3CSYA 1KN4L 5FYJU 4K7FA 1CDJA 4S1DC 3IYLW 3BZFB 3T77A 5EORH 3ZKSD 3ULVC 4NSKB 2VH5H 3OKDA 4O58H 4WFGE 4XVUC 3NN8A 4JPIA 1BGXL 1DN2A 2YWYA 3OMZA 1CICB 5EUOF 2W9EL 1VFAA 3PWVB 2N7BA 3UO1L 3RNKA 1SM3L 2NX5D 3QUYA 4EIZC 3IS0X 1A21A 2FYYA 3PGDA 3TYFB 5CEXA 2BCKB 4BFEA 3GSNA 4XNXL 4Q6IC 4NDMB 4YHNA 3SE3A 2EDBA 3W9DB 2XXMB 2X4RB 5BZWB 2YN3A 4ZOEA 4N0CC 2A6KB 2EDKA 3OKKA 3STBA 2JK5B 1BBDH 2NXZC 1XF5B 4WHTB 4NQDB 3RX7A 5MEOA 1MH5B 4M61B 4OZ4A 5I19L 4HFUH 1WAAE 3NFSH 4LLWB 3ULVH 4O51B 5DMYA 2FO1A 3PWUB 5IMMB 1W72B 1MCPH 5C0ND 5E99H 1JK8A 1R3JA 4HJJH 1HNFA 2OL3L 3OKEA 4ODWA 2ADIA 1TENA 2WWMD 2CR3A 1G9EA 1JFQH 1L6ZA 4QXGH 1ZA6A 2NY1C 3D87B 4NHUB 3FB6B 1K6QH 1GYAA 43C9A 4O4YH 3U36B 1UWEH 3LS5H 3RY6A 5AD0A 1MF2H 4KI5E 4ORGB 2ZOLB 5HD8D 1WFNA 4IOIA 1AKJD 4OCWL 4UDUA 5DMJB 3NPSB 1FNAA 5DJXA 2XN9A 1DQLL 3FFCB 5EIVA 4M6ML 4M6OL 1Z3GH 3RRQA 1MUJA 1HSAA 5FDWB 5TQ2H 3QFDA 4GH7B 1DVFC 3GSOB 1C5DA 2UYLB 4UU9B 4WIQA 4ZNCD 1KTLB 5CGYD 1A3LL 1BVKA 3DV6A 1S9WB 1LO4H 3U4BH 3AS1A 3MTRA 3DUHA 1SYVB 3GB7A 2NQCA 4XGZA 2EXYC 5LXGL 4PJ9A 4LCYB 3O6KL 2MOVA 2XY1A 3HUJF 3DGGB 1VADA 3VXUD 3OGCB 3NA9L 2A9MH 2NW3B 1T03L 2G60H 4UTBH 1MLCA 4HKXA 3VWJD 4NO2A 5MENA 3HAEB 1DBMH 2GTWA 1UENA 1IFHH 1ACYL 3R4DA 1OB1B 3UTPE 5ICZB 1MJ7L 2AK4E 5D1ZB 4PJ7E 1KBGL 1O7VA 3PL6B 3VJ6B 3MRHA 4MVBD 1LD9A 1EUTA 1SJHB 1ZXQA 3GGWB 3QT2A 1FG9C 3QJHB 3CDYA 2VLJB 4NHCL 1DBAL 2J4WH 1NUDA 1ZGLB 3RY5A 2L4OA 3VXMD 5GS0L 3VRIB 5DSCB 1JZ2A 1ZT4A 4J3VA 1YEKH 3QHFL 1F11A 2P45B 3VXQB 2IAMA 4K3DL 4JZOA 5DRZB 4ZTPH 1N0XL 2A1WH 2BHZA 1YNTB 3MJGX 1BD2A 4MA7L 2CXGA 2HTLC 1KLUB 2PXYB 2ZSVB 4UQ2B 1T7VA 2IH1B 3O2DA 2AEIT 2A6JA 2VL4A 4KTYA 5GQBA 2ZJSL 1IEAB 4N0FA 4KJQC 2DRUA 4DCQB 4WHCA 3RUGF 4WFFD 5DUBB 4WJ5B 1XF3B 1WT5C 4XPHL 2W9DH 4U6HB 2YZ8A 1T4KB 5GJTL 1S5HA 5IVOA 5ID0B 1FC1A 3CSPA 4LPXA 1DBKL 5EO0A 3KYMA 4YFEA 3LIZL 2LFGA 5JNYB 2ICWJ 3MBED 5DTFB 1RUQL 1JGLH 2CJUH 3ARYA 1ACZA 4OM0L 2D03L 4P2YA 3V0VB 3IF1A 1UCBH 5FO7A 1KACB 3BZ4B 4Y89A 1AO7A 1RK1A 4OKVA 5CJBA 5HPOA 5ACZA 1CDHA 1RAMA 4GBXB 1N4XH 1P7KB 3KJ6L 3GSQA 3FHQA 3G08A 3PXHA 3SO3C 2FSEB 5DJ6A 5MEPA 3SJVD 2X4NB 2P42B 5GS3A 1WZMA 5C09B 4LU5L 2Q8BH 1FL5A 4ZXBA 5JA8B 1OF2A 4FFZL 5FKAA 5J6GA 3ZDZF 1BQHB 1GGYA 4Z7OF 1I1RA 5FUZH 5IMLA 3HCVB 1QSEA 4KQ4L 4L8CB 3GJEB 1N3NB 3V6FB 2DB8A 4P49A 7CGTA 3LKPB 3O45A 4KK5C 2ADGB 1X5IA 1RIVH 2GITA 2X4OA 2MCPL 4P2QE 1MJ8L 4EI5C 4NKDB 5C7XH 2APVA 1HIML 3VFPB 4HT1L 2OTWB 4I18B 3RKDC 2BK8A 5GISL 4KHTL 1LP9B 2XZCH 4HKZB 4XCEA 3FB8A 3H3PL 1IL1A 1I9JL 4X9IA 1KCKA 3DX9B 3GMPA 4P4RB 3RP1A 1TCMA 3X3FH 1U6AH 4OM1H 1FL6A 3CVIL 4JFOA 1SQ2N 2ATPB 1J0KA 5B39B 3HI6H 5L8LB 1A0QH 2CIKB 1OAQL 4TSAH 1W0YT 5HBBA 4NRXB 2PYEB 4M7JH 5L88L 5IROC 3CVHB 5EBLA 1G7MB 4UZGA 1MRDH 3N1FC 4IRSB 4P23A 1SY6H 4XMPH 2BVPA 3WJLA 1IRAY 5IGXH 3ARQA 2E8YA 3F12B 1N26A 4Q6IB 2B0SL 5GGRY 5DK3A 4HW6A 1CLYL 2EDEA 1EHLH 3TO2A 5C0BB 4PG2C 3MODH 1IT9H 1BJ8A 2YMXH 1K9TA 5JOPE 3Q48A 1T6VN 2E9JA 1OARL 4M62H 4MD0A 5JOFB 3THMH 1KTRL 5BS0D 4S1RL 1EFXB 1QRND 4CADB 3KWWA 1NC2D 5BMFL 1A7NH 2E8ZA 5DJDB 3AS0A 1OAZH 3NAAH 3GSWA 5ICXB 4NQCE 2LVCA 3WKNA 1U8KA 2ZPKL 4QRPB 4X6CE 1CDBA 5E03A 3MV8A 5BZDB 1FL3A 2GT9A 5E6ZA 3QG7L 2HT2D 3TCXA 3W0WA 2ICEA 2ID5A 3ARTA 1MI5E 3O2VH 3QUML 2DLTA 3QNXB 4R4FL 1F97A 4DGYL 3RPIB 2EDNA 4H0GA 5FO8A 3MLVL 1JIBA 5GRZA 3DHJA 4U7MA 4PGDA 4TULL 3QXAB 2X5PA 1VKXA 1U2CA 2OL3A 4Q74A 4F7TA 5L2KD 1B0RA 2ORBH 1C08A 4ZS7L 4DGIL 3BRGC 2J1KA 5TDOA 2QHLA 3RGVD 3SPVA 2SEBB 3MLTB 2DQFB 4YFDB 3E0GA 1JZ8A 2NY6C 2FWOB 1QQDA 3RVVD 1A1OA 4G42A 3M8OH 4L3EA 4EUPG 3V95A 4EBQH 2GJZB 4B41A 3VFMB 5ALCL 5EOCJ 5I18L 2OP4L 2WIIB 4CL7A 1YEJL 4GS7C 4KGJA 4LQFH 4LLDA 5KVFH 5DD5L 2CR6A 3FZUC 5TE7H 5IV2A 1QSFD 3FCTB 4NYLA 3V0AC 5E1AB 3MCLH 3VI3E 3I2CL 2GJ6B 2J6EL 4DZ8B 4YDJB 3JV6A 2CRZA 1YDPA 3HZMA 4KPHL 4LKXB 4EDWH 1DQML 3ZE2E 3TJHD 1F58L 4FNLL 4R7DB 4N9OB 4CUCA 4F58L 5D72H 4PJCF 4YHOL 4TUOB 4LASL 3F7PC 4JM2A 5KSBE 1SVZA 4OB5H 5JW4Q 3BEWA 3OKLA 5GGRA 4N1EA 4YBQC 1EERB 2AXGB 1I7UB 3VXSD 3UTSB 5EU4B 2H2PD 1NDGA 4TUKH 1MAKA 5EUKA 5EBWA 3ARFA 4NP4H 5JPMB 3BX7C 1URLA 5IHUH 2R2HB 4XAWH 4LSRH 1MWAL 3JWOL 5HGAB 5F1SA 3CH8A 4NQSA 4RAUB 1F2XK 2OQJA 4WUKH 5FUCE 4RAHA 1A47A 4QOKB 3UJJL 3Q2CA 1V7NH 2YD9A 4WENB 5DJAA 1IM9A 3LQZA 3X3GL 5IIEA 2FECI 1S7VA 5C0CD 2XWJA 5KVGH 4F3FA 5CHNA 3ARDB 3C2SA 2F53B 3U1SL 4X8XA 2B2XH 3EOAB 4M1CD 5IQ9B 5D1QD 3TC9A 4HXAL 5JHLL 4MD4A 2WLZA 4W6YB 3PE9A 1U8JA 3SBWC 3VG0H 4AG4L 4AIOA 5D7KE 1JHKL 5DO2C 3FRPG 1CIUA 4NQDE 2ED8A 3MR9B 4RIRB 1D5BA 2LTQC 3DI2B 3QQ3B 2WP3T 1U8HB 4JQXC 2RR3A 4ENED 2X40A 2BVYA 2AJXH 5DMIL 3FONA 5HHNB 3RPKA 3ZKQD 4O2FA 3O4OC 4QXUL 5C07B 4X6BA 3E6FB 5E8NA 4PJBA 5LQBL 4PRID 1UADC 3TA3C 1MPAL 1RHFA 3SDXF 4X5XB 2RHEA 2WMPA 2VR5A 5JLZB 4PV9A 1X4XA 3QAZB 1KYOK 2IPTL 2Q86A 2BC4B 5ILTH 4PRBA 1DLFH 5HSFA 3PG2A 3TPUB 1ZGLP 5LWYH 4XMKL 4Z6AT 1J1PH 3FFCE 1FN4B 1K2DA 3QEGL 5JMRA 1VGEH 2I9LB 3QQNA 5F7WC 5FCSH 2YXFA 4LOUD 4KK8C 3DECA 1T89A 5ESQB 2P8MA 5FUOH 2VN7A 2BXYA 25C8L 1WFTA 1HEZB 4R8WH 4FQ1H 3VXNB 4OLZH 2H3NB 3BZDA 3BKJL 1U3HA 2JB6A 1Q94A 5DD3H 1NAMB 3X12B 2IADA 2OTUB 3EGSB 3JTSA 1NCUA 4D9RE 5IF0A 5MI0C 5IHZA 4HKBA 1DLHA 2EDLA 4LRNH 3EOBA 3X14A 5B8CB 1T04B 3D0LB 3NZ8A 1S7RB 2E27L 1WAAA 1D5XB 5H2BB 1WGOA 4Y2DC 5LVEA 4APQD 3WFHB 5C0JB 1ZWIB 2X2YA 5FYLE 3EOTL 4J3OC 4YDVB 4I48B 2X6MA 5AWNL 4U49A 2VLJE 5CJ8A 1IQWL 3HC4H 2K7QA 3QJFA 1LO5A 4XWOD 5JZ7D 4XP4L 4XCCL 1G84A 3T2NL 1FVEB 4PLJD 2OYPA 3KYOB 3KPMB 4M02A 4R2GD 4CGTA 5CGMA 4K3JH 1Y18B 3VXTA 1FCGA 1FNSH 1KLGB 3ROOB 3RL1A 5EDXA 3PNWB 5HGBA 4OCNC 2D0HA 3VGAB 4LKCB 3E8UH 3OKOB 2E7LC 5J1AB 3SHSA 2NY6B 4H5SB 2UZIL 1M1SA 3QUMA 4HGWB 4XPAL 3RU8L 4UTAL 4XBPA 1NGXA 3T4YA 1CQYA 4PBWD 2GCYA 1A7PH 2OCFD 4DQOL 5CWSB 3OX8A 3QDMB 1MRFH 2WINB 3U7WL 3CFCH 3BGFC 5JQ6H 2A9NH 2HJFA 1DANU 3F7YB 2D31B 4U6VL 1KLFA 2VDKH 2FX8H 1OAYL 2CLVA 4G9FB 4Q58C 3VFRA 1MCCA 2D4FA 3WDJA 4EUPH 4HUWB 5D1XD 4U3HA 1WFOA 3IDNB 4ODVL 3RZCB 3JV4A 4X98B 1TFHA 4L9LB 2GYSA 1FFQA 5C09E 1P5VA 1TVBA 2AK4A 4FXKA 1MJJB 2V2XA 1HH9A 1B4JL 1LEKA 1PJ9A 3TIDA 4OT1L 3KYNA 5C9KA 3IU3A 4XP6L 3VFSA 4QNPF 1KCSH 3MYJA 4ELMB 1RU9L 4MAYD 1EZVY 3OZ9H 3ALWA 4IS6A 4BQ8A 4MNGB 3SKOA 5DJ0A 1CF8H 2J6EA 5D5MB 2EH8L 1YECL 5AAMA 3ILPA 1OQXA 4DFHA 4G8EB 5EO9B 3WXVH 4U1NB 5C92A 2JE8A 3V4PH 3MC0A 1EBAA 1LP9E 3MOBL 2BSTB 2KBGA 1L7TL 5DHVH 4ONFL 5HJ3B 4EKXA 1JNJA 4GAJH 1NCAH 1YUHA 4OTXH 1U9KA 3WD5H 3D25B 4MQ7B 4WW2F 3LPGA 3QIBD 1KXVC 3P4LA 1JZ3A 4RISH 3KPQA 1RI8A 2PYEE 3C6SB 3MV01 4R4ND 4JO4L 3ZLQC 3BN9D 4YBLB 3S6CA 3ZKMC 5KSAC 1W72L 2IGFH 1QKZH 1I7ZA 1QBBA 4ZAKC 3TFKD 4JQVA 4NQUA 4AJ0A 1R5WB 3SDAA 4QRSB 2CKNA 2HJLA 1KTDB 4OF3A 4P46C 3BSZL 3CX5J 5SWQA 3SDYH 1U8NA 1L0YA 2ESVD 5EWIH 5C0BE 3LN9A 1DUYB 3LQMA 2CGRH 4OUUA 4JANB 3W5NA 4CN1A 5D6DA 2HT4D 5IT2H 5CFHA 2A73B 5SX4H 2JCCB 2LTQB 4LVHC 2O26U 1LQSR 3MRDB 2XTJC 1KJVA 4OAWA 2XKUA 4L4TA 3T65B 2D7TL 4QRPE 1FYHB 3NOIA 3MZTA 1A1NA 4C54A 5I1LA 5KOVC 1MFBH 2OJZL 3IJSA 1OT2A 3TCLB 1YEFL 2Y9RT 4P5TC 1L9MA 3TA3B 3BHBA 4TUJB 4XP5L 1GZQB 4WWKC 5T3ZD 5CBEA 2BOBA 4P2QA 5CZKA 3AM8A 4PB0L 4XNMA 2CLRB 3TESA 4HH9A 3RY4A 3QUYD 3N85H 3WKML 4JDVA 2AGJL 3H9SA 2EICA 3EFDH 4F57L 4OZFA 1G0XA 1A5FL 1D6EA 2YD7A 3OKNB 3VGGA 1T21A 5GJSH 4I9WD 4JHAL 4G6ML 1J18A 3F7QA 3EYQC 5I1AA 5HI5D 1NL0L 1G7QA 5FYLL 2B4CH 3GSRB 4JY6B 3MUHL 3UPRB 1UJ3B 4KK9D 5I15L 2H32A 5I73C 4O2CB 4HQQH 1UZ6E 1INDL 1Z2KA 1NBVL 4YZFF 3U0TA 4PJGF 5MI0B 1VFBB 4PRHA 1TLKA 2GJ6E 3R06B 4QHMA 5MERB 2MKWA 4MA1B 4BZ1H 3SGDI 5DRNA 3RA7L 5C0EA 4Y2DB 2XWBB 1IE5A 5DEFA 1EPFA 4CAGA 4ODTH 4POYA 4LCUA 1IC4L 1FFPA 5TPWL 2QQLL 4QF1A 5C6TH 4NQCA 3UC0L 1XH3A 2DQJL 3IFPB 1IGFH 1T66D 4RQQA 3ZE1E 4G8FA 2XN9D 1MIML 3TBSA 3VFGH 4HS8L 1CL7L 1R3IL 1ZVYA 5C0NC 2IFFH 4XNQB 4CVZB 2QADD 5I1KH 3UTSE 1MI5A 3MV7B 4PGEA 5KG9B 3HTLX 5DC4B 5TE6L 3PJSA 4OIIH 5AYQA 1BQUA 4EUPB 1CD1B 3RAJH 4DW2H 3BZEB 3HB3D 3GJFB 1DZBA 1AQKL 3IDIA 3RWIA 2Z0BA 1MCHA 3HPLB 1AXTH 1I8LA 1F4AA 2DTSA 3HS0B 4PJ9D 2X1OA 4QOKE 1D5IH 5ELIA 5HD8C 2OJEA 4Z8FH 5I1HH 4PRNA 3WNKA 4X80L 3RJDA 4PJHF 2ZUXA 4OLYL 4MS8D 5T33L 2EE2A 5MEND 4UOJA 3EDJA 2GK2A 3NIGE 3QO1B 2F53E 5I8EA 1YMHB 5C0FB 5HVHB 1RMFH 3IAQA 4HX1A 5D7LB 3CMOH 2X4UA 4JN1L 4OCRH 4DN3H 3BGFB 5ANMA 1L7IH 5E00B 3HZKA 3DVNA 1Z0MA 4P2RB 5IBTH 1A7OH 1KIUA 4OCXL 4XP9L 2IAMD 4ZFFB 3QFJB 5DHVB 3B5TA 4KXZI 3UXFA 3L3KB 3C5ZA 1VPOL 2E9WA 5HPMB 1S7WA 3EFFA 3CFEB 4LPCA 1BD2D 5HHQA 2JKXA 1G7LA 2IPUK 3SKMA 4XRCB 3AU1A 5C07E 2PN5A 1GSMA 3U2SA 3Q3GB 2W91A 3FTGA 5KJRH 2HN7A 4LRIC 1EEZB 2XXCB 2V5SA 5A43C 5DHYA 4X4ZA 2VDLH 4IDLA 2VISB 2IPKA 4QXGL 2WBJA 1JNHB 3DOSA 3HRZA 5D7JA 3CVHL 4NNXB 5DJ2A 3ZE0E 1UA6H 2EIBA 1I85C 1DE4B 5SWSB 1WIOA 3LV3A 3LZFL 3VGBA 2XZQH 3CC5B 1EO7A 2G5RA 1HZHH 2UVFA 3B9DA 4NSKA 1AO7D 1AP2B 1U2HA 1XGTB 5DYOB 1H15B 3S34H 1DBJH 5KSAB 1CICA 1GGTA 4FQQB 1Z9MA 3W11C 3LN5B 2YK1L 3HC0B 2IH3B 1CD8A 4P46B 3TYFA 2BCKA 4JKKA 4BH8B 4L3CB 1RVFL 5EZOH 1QSED 1MHEB 1I9RH 3KR3L 4FOMA 4TRPH 1Q1JH 2A38A 3GK8H 5FCUL 4KRNA 4PP1D 3RZWA 3MBEC 2X4RA 5IVXF 2IBZY 2VDPH 1IILE 4IRJB 2A6KA 1K8IB 1XF5A 2C3VB 4WHTA 4NQDA 1HSBB 1MH5A 2XTJB 4LLWA 3MX0A 4I0CC 4O51A 5CCKL 3PWUA 5IMMA 1W72A 2MFNA 3B9KB 4TVPE 3MLXL 3DETD 1G1YA 3D0VB 2VDMH 1E6OH 1PDKA 1N64H 4ODSH 2FJFB 1ED3B 4KDTA 4KY1H 3QPQC 1YJDL 4N90E 3BUTA 3FB6A 4N8VB 3BKCL 3U36A 4BZ2H 2J8UB 5FV1L 3PHQB 5BRZA 3K81A 4CU6A 3O41B 4P23D 2BNRB 2ZOLA 1X5KA 5C3LD 2X44D 5D7SL 5DURB 1AD9B 4N8PA 2X1XR 3DGCR 4WI5A 4S0SD 4QXWA 3IXTB 1DJSA 5I71C 3SOBH 3FFCA 3GHBL 1K4CB 5FDWA 2YKLL 2KL6A 3GSOA 1HNGA 2UYLA 4HC1L 4UU9A 1NANI 1KTLA 1B9ZA 4OGAD 2ZUTA 4G3YL 4FMFA 3T3PF 1S9WA 2WW8A 1RULL 4WW1B 3QDME 5T5FH 4HV8B 1MFDH 1SYVA 3MV8D 1KB9K 3H8NA 4LCYA 3IJHB 2QQKH 2UWEF 3DGGA 1WEJH 4G9FE 4MSWB 1FIGH 3W0WD 3OGCA 3MLRL 2NW3A 4R96B 2QLVB 1OOAA 5IM7B 3V52H 4CVWA 2FD6H 1BPVA 3BI9X 1CI5A 5T3XE 3NGBB 3WUWA 1LE9B 5ICZA 4MX7B 3PL6A 3VJ6A 3TZVC 2CRMA 4NJAL 3C6LB 5IB2B 3GGWA 2CKBH 1QLEL 3QJHA 5JXAL 2VLJA 1A3RL 2LABA 1ZGLA 4ELME 4P57B 4WHDA 1BZ7B 3VRIA 4XNYH 5FUZL 2HYMA 3VWKB 1U41A 2ZCHH 1MEXL 3VXQA 4MNGE 4OZGF 1YEDB 1ADQH 4XHJC 4K3EH 5KVDH 5D5ME 5DRZA 4LPVA 1MSPA 4XVJL 3F8UB 3VDCA 1RIVL 1KLUA 2PXYA 2O93L 2ZSVA 4UQ2A 2F5BH 2WUBL 4K71B 2IH1A 2R1YB 4L5FL 1IC7L 4RGOL 4HWEL 1KJ2H 5F9OL 3FOMB 1KPRB 2EO9A 2BSED 2NR6D 1B0GB 1IEAA 4GRWB 3E2HC 5IBUG 1CCZA 4ODBD 4ODUB 5DQ9B 2FIKB 4ZUUA 1HXYB 4DCQA 4I0PC 1S9YB 2FCBA 1A7QL 1TZGL 5DUBA 1JPSL 4HBCH 1I1YB 5HI4D 1NMBL 2AKRB 2FJGB 4U6HA 1GGCH 4M43L 3BOVA 3QI9C 4QRRB 3S3PA 1T4KA 4ZO9A 1MHHB 2VNCA 1WTLA 1S7TB 5ID0A 5GHWH 1QBLL 5L6YH 2V9TA 5E5MB 3FJTA 5JNYA 3G6JF 5DTFA 3VRJB 4JM2D 4YXKH 2QQQA 1YEHH 3V0VA 4HPYH 5B3JF 4FP8L 1RFDH 4YHKL 3BZ4A 1QA9B 3INUH 4NZDA 4HULB 4L4VB 5HHVH 4GBXA 1P7KA 1UXWA 2JCCE 4QY8A 4RWYH 4WGVB 3ARFD 2FSEA 2X4NA 4B53A 4OFPA 4Y5YB 5F7LB 3V4UL 3KLDA 5B22A 1Q9KB 1A7NL 3R8QA 2J7LA 1Z5LB 2VZUA 3NIFE 4R90H 5KZCD 1B0WA 3HCVA 4L8CA 1UM6H 3GJEA 1GH7A 2ATKB 1HYSD 1N3NA 3U79A 1IM9D 9CGTA 5GS0D 1FZKB 4FZEL 1FO0B 2DMBA 3DX8B 3LKPA 3K2MC 4KZDH 2VUYA 4QT5B 4NN7B 1XGPB 3CFJA 4XXCA 5E2UL 3BRDA 3T09A 5J56B 4NKDA 1JF1A 3EHBD 2H2PC 2OTWA 1BFOB 4JGMA 5F7DB 2B1AL 2CLZB 4NUJA 1MHCB 1JE6A 1NAML 1LP9A 4HKZA 1ORQB 5F6HJ 4H1LG 4FQCH 3DX9A 1DBBL 1KT2B 3BW9B 3DTXB 5E2TL 2ATPA 5B39A 5E8DL 2CIKA 2W59A 4FQPA 1J12A 2AJVH 5DQDH 3S97C 5K9JH 2PYEA 3M07A 4LPUA 1ND0B 5FYJE 2A77L 3CVHA 4K3HA 1G7MA 4FQXC 1GAFL 3MLSH 2ZSWB 4IRSA 4YEEA 5JUEH 4TVPL 4ETQB 3KS0J 1X9QA 4Y4KC 2FBJH 1MELA 3F12A 3BIAX 1KEGL 4Q6IA 4OZIB 1KNOB 1T0NB 1KIPB 2VZVA 3GNMH 3AMKA 3QUXC 5C0BA 1BWWA 3Q5TA 4ZS6C 1W0WB 2V2TB 4Z7QE 4HF5H 3ZT5A 1BZQK 4AMKH 4PS4H 1CK0H 4O5LH 5JOFA 4YEFA 1G6RH 1BFVL 1E4WH 3T0EB 5I16B 3E6HB 1INEH 3MREB 3OAZH 2D7NA 1EFXA 5CSZB 5DJDA 5IP4A 5ICXA 1ZEAH 4QRPA 3A6CH 1HHKB 5BZDA 3LQAC 4X6DB 1KF9B 4S1SL 5FHBH 4Z5RB 3MNZB 4PTTB 4WFGD 4WFEE 1II4E 3QNXA 4NRZB 3MV7E 3QQ4B 1HE7A 3RPIA 4RGMC 3KG5A 2MWCA 5CLTA 5BO1H 3EYFB 5IFAH 4LEOB 5JW3L 5D7IF 2MQ3A 1CTOA 3WHXB 5F1IB 1JI1A 4XAWL 5I71B 4JVWA 1YPZB 5C9JB 2H41A 4KHXL 1U3HD 3QXAA 4JR9H 2MMXA 3S4SB 2K9UA 4L29A 3RKPA 2D7MA 3ARVA 1G9MC 4HGKC 2NY0D 1JNNH 4WRLA 2EH7H 5I0ZA 2SEBA 3MLTA 2DQFA 4U31A 5T3XL 2FWOA 3KNBB 3LQAH 1TCRB 1XIWB 4X7SH 5D7LE 2ZCKL 4DZBB 2GUOB 4LLAA 4QLRA 5BW7A 3HE6C 3SGEI 1PG7W 3WLWD 1IC5H 2GJZA 2ITDB 3VFMA 3WFEL 2B2XL 2WIIA 1ZLVH 3ZYOA 4UIKH 2XQBH 4NFCA 2OS7A 4P2RE 1YY9D 5DFWH 3C5JB 3FCTA 4W81A 3F5WB 3JTTB 2GJ6A 1AJ7L 3QFJE 5KTEH 2IALB 4YDJA 4DZ8A 3TJEH 4LPYA 2AI0H 5F6IC 4LKXA 3ULUC 3GBML 2ZNWA 3ZDYE 2YRPA 3TZVB 3SGEH 1JVKA 4R7DA 1EH9A 3ZSTA 1MFAH 4FABH 2XT1B 1NCCH 3BE1H 5ALBL 3O3EB 4TUOA 3MRPB 4P5MB 4MA8H 1OQOA 1S5IH 3QWQB 4UUJB 5CP7B 5AZ2H 4JPWL 3GO1H 1SBSH 3OKYA 1QFWM 1QR4A 5ABDE 2AXGA 2BSRB 3QHTC 5J4MA 4LHUB 5EU4A 3UTSA 5J1SC 1OAXL 4JRWA 2NNAB 1HXMA 5J6HB 5JPMA 2R2HA 5SWSE 5ADPL 4GG6B 4R26L 5HGAA 4YPGB 4RAUA 2PTTB 2FGWH 4AEHL 4OD1L 5E56A 3EJZD 3ULUH 1DLFL 4QOKA 3D9AL 1ZHNB 4WTWA 1JZ6A 3S88L 1J1PL 1WT5A 2YPLB 4AK1A 4OKDA 4NUGH 3U9UB 1KTKE 1OPGH 3B8YA 3FT2B 4YHYB 2DDQH 2AXHA 2X9XA 3ARDA 4Z7WF 3S5LB 3BPLC 4P5KB 2F53A 3JWDH 5FUOL 4RGND 4IIQC 3GMRA 4N8CL 3UTPD 3EOAA 2AK4D 5IQ9A 4G6KL 3K46A 4BQ9A 5FYKH 2R4SH 5DEGA 5D6CB 3D39B 4XTRD 2F8VA 5E8PA 4RRPA 4PJEF 1TJHH 3MR9A 2XTJE 4RIRA 5ENWB 2IBBA 4PV8B 1VENA 3GEWB 3QQ3A 4OLEA 4IJ3C 1U8HA 3CLEH 5D1XC 1LNUB 4KROD 1ZV5A 2EEAA 1KPUB 3WIHL 5HHNA 1KJMB 4GRMB 4NQVB 4LLYB 4NGHL 3LB6C 3BN3B 5IVNA 4PJDF 1DEDA 5C07A 3RWJB 3P4NA 3E6FA 2W65B 1KENH 2VWEC 1OWRM 2EXWC 3G5YB 2NY3C 2J8UE 2F19H 4UT7L 4JB9L 5FYJL 3NCYP 5CINL 2NYYC 4EI5A 3RGHA 1RZKC 2PETA 5JLZA 5E5UB 5F8QC 4OLVH 2BNRE 3FN0L 1PLGL 4PRAB 5A2KH 2BC4A 3SDAD 3RVXD 2DYPD 7FABL 1M7IB 5BQ7B 4W4NA 3TPUA 4TPRH 1FN4A 4Y16C 1PEWA 4P2CG 2I9LA 2FDBP 1PX4A 4KZEH 1TNMA 2E7MA 3N06B 5I8KH 3E8UL 2HKFH 2J88H 4KQ3L 4MCYB 5ESQA 4WDIB 5IROA 1NBQA 3BD5A 4K7PH 1CBVH 1HEZA 4FQXB 1MFEL 4H1LH 2R69H 4L4TD 3QEQB 4Y4KB 1KV3A 1MREL 5HDBF 2H3NA 4RNRB 3T0AA 3I9GH 4XZUB 2RJMA 3MCKB 4YUEL 4ONGH 5E94B 1YZZA 3VW3L 2E7HA 3RWDB 1MRFL 4PG2A 5DJYB 3BXNB 1NAMA 3ES6B 2C26A 3WSQL 3X12A 5JQ6L 2OTUA 2ARJA 3EGSA 4OLXH 5GS2D 4PTUB 5HDOA 5I1CH 1NGPH 2BRRH 4NKIH 1GIGL 4M3KB 3D85B 5B8CA 1T04A 3D0LA 1JUFB 4P2QD 5J11C 1S7RA 5DD0H 1U8LB 1D5XA 5H2BA 3KAAA 1BFSA 1H3PH 2KPNA 2HT4C 1DQQB 4GAFB 4YDVA 3BYTA 4I48A 4W4OC 3GRWL 2IQ9L 3MLZH 3VMNA 3HN3A 3H9SD 5L7XH 4PUBL 2JELL 4ZYKB 3MGOB 3GSVB 4P2OD 5KVEL 3OZ9L 1FVEA 1CFVH 4ZTOL 4CW1B 3NCEB 1PAMA 3KYOA 3KPMA 3EYSH 1IM3B 1Y18A 3D2UB 1EO8H 4C56B 1IGML 3BIBX 4ZD3L 5BOZG 1KLGA 3ROOA 4Q9QL 3VXOB 4PGCB 1U3YA 2HLAA 1K4DB 4GRWE 2CUIA 5E24E 3B2UC 1G7HB 4LKCA 2V7NA 4UV4L 2R23B 3BDYH 4PRHD 1BP3B 5J1AA 5JQHC 1FSKC 1WWCA 4XB7A 3GHEL 1NFDB 3HMXL 4H5SA 3VD4A 4X9BA 4HGWA 4QRRE 3EDEA 4W70A 3HE6B 4WI2A 5BVJB 3MFFB 2JJTA 5CWSA 5EIIB 3IGAB 4CNIB 4NWTH 1FCCA 1ETZB 1FLRL 4MDIB 2I5YL 5EZLB 3H3BC 2DQCL 2DQTH 2EIEA 3VCLB 2D31A 1HILB 4I3SL 4G9FA 1RJLB 3SDYL 3QXDB 4L4VE 5F6IB 1R5IB 2NY2D 1PZ5B 5I1JL 3PWNB 3RZCA 3B6SB 2FHCA 1HINH 3MBXH 4GXVH 4UILL 4X98A 5EBGA 1IAKA 3MRNB 2KDGA 1YEIH 3ILQD 4D3CH 1U8OB 4XCNA 4AY0A 1KCVL 1TQCC 4D94A 1MJJA 1QBMH 4IOFC 3V4VL 2MHAB 4MJ5B 2WWKO 1G7IA 4KJYB 4ELMA 5EBMA 4XAKE 1FQ9C 1ONQB 1Q0XH 1J0HA 2A0LD 4XNUH 1A6VL 2F74B 3UYRH 3N0PB 2EDFA 4MXWH 4MNGA 2E6JA 3LEXB 4X7DC 5D5MA 1GOGA 1I7TA 4G8EA 5CZXD 1YY8B 5EO9A 5JR1H 4U1NA 1X7QB 4M7KH 1TQBC 1NCDH 5CGTA 2FR4A 4EVNB 2BSTA 3MGAA 4GFTB 1KYOJ 2FHBA 2VXVH 5HJ3A 1F4XH 1BAFL 2X4TB 1JJUA 5HHOB 4RFEB 5GPRA 4LK4A 5F96L 4RCAA 4D0CB 5DFVD 1V7MH 3D25A 2VDQH 4MQ7A 3TVMC 1RIUL 3C5ZD 2GTZB 5FA4A 4IIQB 3C6SA 4JFQB 2BVQB 2AVGA 1JL8A 1R5WA 4QRSA 5GRJL 3L7EB 4DTGH 5AUMB 1ES0B 1NCBL 1VERA 4LVNB 4OZIE 1KTDA 4ZSOB 2I27N 1FPTH 3SBWA 4XBEH 5LCVL 1R0AL 3V5DB 2V7HB 1DUYA 3L5JA 4LSDA 4JANA 4Q9RL 4JHBA 4GLRI 5E6IB 1LMKA 2DD8H 2WBJD 2IJ0C 2ZCLL 2I60H 4IRZH 1ZMYA 3T0EE 5HGDB 2JCCA 5AAWA 4KRPB 1X5XA 4IJ3B 3MRDA 2NXYD 4ALAL 2FL5B 4XC3L 3TEUA 1RZGB 1H3UA 2C3WA 3T65A 5SV4A 4BFGA 4X6DE 4H8WH 1U42A 1HHHB 4H1LB 1P5UA 3L5WB 4S1QH 4Z95H 1J0JA 4OF8A 2OMBA 3TCLA 3HMWH 3ESVF 2NY3B 5B21A 4PGBB 2VZSA 3TA3A 1ZT7B 4TUJA 3SQBA 1A6WH 4XI5C 1GZQA 3SDXB 1CICD 1DQDH 4HWBL 5CEZE 1MNUH 4KKBC 1M4KA 1JGVL 2VDRL 3P40A 1VDGA 1F6AB 1QO3B 1UACH 1YPZE 4A6YB 3QEUB 1IZJA 3P73B 5J3HD 4LSPL 4XVTH 3ZT7A