1ZANH

Crystal structure of anti-ngf ad11 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
216
Chain Sequence
QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNNVNWVRQATGRGLEWMGGVWAGGATDYNSALKSRLTITRDTSKSQVFLKMHSLQSEDTATYYCARDGGYSSSTLYAMDAWGQGTTVTVSSASTTAPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLASGVHTFPAVLQSGLYTLSSSVTVPASPWASEAVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab AD11 Light Chain
publication title Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 42
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanH01
4NKOA 4CVZB 2H32H 4F37K 1TZHB 1CGSH 5HHMD 3ME0A 3EOTL 3MV9D 2BSTB 3N06B 3VJ6A 1U8HA 3T8XA 3CX5J 3HC4H 1CLOL 2ED8A 1EERB 4P3DB 1V3MA 4CRPA 3I6GB 3I75B 2D03L 5T1DH 2X9YA 4LLYB 1MJJB 3SHSA 4X5LA 1BM3L 3S3JA 5E00B 3IFPB 3ARDC 4XP5H 1NFIB 5TE6L 3PL6C 3I50H 1A6ZB 1N64L 2ERJB 3X14B 1MLCA 4JO2H 3C9NA 1BFVL 4NUJA 4PV9B 1P5VA 4B0MM 3ZYIA 2DQHH 4RGND 4RBPH 1WLHA 5CLWA 3X11A 1DVFA 3JZ7A 2IADB 2HT4C 1QBBA 1A7RH 2HJKB 2NW2B 3C60D 3RRQA 3KLAA 2JTDA 5J13C 4QHUB 2YA0A 4UINH 1C12B 3O3DA 1HCVA 5JHDE 1CD1B 1ZHKB 4ZFFA 3OKKA 5I1IH 2WUCH 2ZUQB 1FJ1B 3DXAD 3F7YA 4NZDA 3KVQA 3RY5A 4IEFB 1KC5H 1KLGA 3PQYB 1WBXB 4LK4A 2J8UB 5I75B 3ZTNH 4TUJA 4LGSB 4HQQH 4PRIB 3WIHH 5A2IH 1HHGB 2APWA 1BBDH 4ZXBA 2I27N 5ANMB 2ZJSH 5D7JA 3IGAB 3GHBL 1NUNB 5IROC 3DMMA 5GS2D 1P2CA 1CLYH 2E9WA 4FFYH 4NBXB 1NAKL 3SY0B 2ADIA 4MSWA 3HUJA 2D3VA 4KKAD 2XXMB 4TRPL 4NO3A 4TSAH 5HGDB 1WZ1L 4RDQF 4U31A 4AG4L 5F71A 4XB8A 2X41A 1IILE 1NLBL 2F5AL 3DV4B 1RUKH 5L2KA 1FO0L 2QL1A 2D7PA 3GHEH 2H45A 5KZCB 3O2VL 3ZO0A 1ZA6B 1BJMA 3FB5A 3G6JB 2F15A 1HSAA 3K4ZA 4YBLC 2BJMH 2X4SB 3QEQD 3WFHA 2G9HB 5BO1H 4LSVL 2DJUA 5C07B 1FFOB 5HI5D 2HRPH 4HH9A 4LLDA 3JUZA 4Q58C 5HGHA 3DI2B 5HYJB 4LHUB 1A6UL 4DZ8B 4KKLD 2QR0A 1FYTA 4A6YL 1E0OB 2FGWH 2VL5A 1A64A 4EQ2A 2R0WH 4PGCA 1YQ2A 3W2DL 3MOAH 2J3SA 1PX4A 3EGSB 4ZG1A 2E7LA 2CKBB 2VXUL 2V5MA 3JWDC 2EEDA 4XPGL 1WJ3A 3OF6D 3TN0A 1I4FB 1JVKA 1RUQH 4M6AA 4LSSL 5CSGA 3T2NL 2DTSA 1Z6JT 5F97E 3VD5A 1KTLB 1OSPH 4PRHE 4PJXE 1C5BL 4UTAL 1MRDH 4GBXD 3RWCA 1CGTA 2EYTA 3VGDA 5I74B 4YBQC 1MFBL 4DOHE 3X12B 2E7HA 4Q9CA 4DZBA 4KJWD 1MAMH 1LE5B 4JFEE 5EFIB 3O2DA 5GGVL 4OZFG 1S7UA 5INDA 1KB9J 3PWPD 4U6XA 4IMKA 1QKZL 2LU3A 2C7UB 4AENB 3DIFA 2P48B 2ITDA 3BVNA 3QFJA 4B41A 1AD0A 4HLZH 5DVMA 4DKEH 2CIKA 2N56A 2ZCHL 3WS3A 4ODVH 1GGTA 4Z95L 5GJSL 5I8EA 5ID1B 4U7KA 4POZC 3IU3B 4ZNEA 3V6ZB 2ZUUA 5DJ6A 1YDPA 2WIIA 1FFPA 1K9TA 3BYYA 2PYFB 3AREB 5LAXB 1OAXH 1YNTA 1DQJB 1FL6B 3THML 3EZJB 4YHZL 5LCVH 3T0WA 1SVZA 3PNWB 4TTDC 5L7XH 1I7RB 2C3VA 3WXWL 5KAQG 5E9DA 3U9PH 1SHMA 4D0DB 4JKPL 5ECJE 1I9RH 4NHUB 2AK4E 4LGRB 3SQOL 4KKBC 1NFDF 5AZEL 1ORSB 4YQXL 5D2LF 3QUZD 1FV1B 2AQ1A 2VAJA 1JWUB 3QA3A 1KPRA 4WHYG 5CZVL 1QFWH 2HFEA 2ZKHL 2ZUXA 3ARGD 4MB5A 2EYSA 3KPPB 1HCFX 1JMXA 5DXWA 4GMSL 3QWOB 1U36A 5EC2A 3RVVC 3UYRH 3CFEB 3WO4C 4PBWD 3OXRA 4BQ6A 1MUJB 4JDZA 3K8LA 3BQUA 3UTPD 2E27L 2YEZA 1MREH 2FL5A 4Y5XA 2GFBB 4F33B 3D39D 1J9CT 2BP3A 3DSFL 4Y1AE 5EULV 4B7LA 2AJVL 3RIFK 2HLAA 1HK6A 1FIEA 5FCUL 3VXNB 1L7IH 2X4NB 1EFXB 4P99A 3ROLB 3B9DA 5E2VH 2P5WE 2ARJB 1WCBB 5DMIL 5F1KC 2FX8H 4Q0XH 4POUB 3UDWC 3MV7B 5MENE 5J12C 1NL0L 3MCLL 5E4EB 5ISZD 1KEMH 5HHPB 4CJ1A 4OIIL 1RJYB 3S36H 3C60A 2W60B 2W0LA 4PJBF 4KK9C 3G08B 1EH9A 3I02A 2YRPA 3R4DA 1ZWIA 1E4JA 2HKFL 2Y06L 5F3HB 2JB5H 1NFKA 1N6UA 3OL2A 2DD8H 3DXAA 4TUOB 5C0BA 2ED9A 2FD6L 2MPAH 4WENB 1D3CA 5CJ5A 1P4IL 4YAQA 1NBZA 1U8QB 1SJVA 4PJDB 3QNYB 3TZVC 3GKZA 4PJ5E 4YHIA 5JR1L 1T1YA 2DTML 1P9MA 3GJFA 4FFZL 1TTUA 2X4UA 4TUKL 2DLFH 4QXWA 1I1FB 4HUVB 5KSBE 1NKRA 4QWWD 2C1OA 1XIWB 3U2SA 3TESA 4PG2A 3TT3L 1ORQB 2FNBA 4WUKL 1IGFH 5T5NF 3O4OB 1MRFL 2ARWA 1OL0A 3QNXA 4RQQB 1GOFA 4RAVA 5LQBL 2YPLB 4JO3L 5GRVK 2NYYD 1PVHA 4LSQL 1ZLUH 3A6CL 4WFHE 3ZHDA 5IOPB 4RMWA 4NO5B 2EO9A 3WHE0 5IMKB 8FABA 4DK6A 1G7HB 1OLZA 4L8SA 4R0LB 4PJIB 2DQTH 2F53E 4H0IA 4I3RL 2P24B 1NAMA 4K23H 4XHJC 4QRSB 2A1WH 3IKCB 3MXWH 3CVIL 3UC0H 4AT6B 3QEQA 4AIZB 1CZ8L 1Z5LA 3OAYK 2GJZA 3QEGL 4Z78B 3GBLA 4FQJH 4P4KB 1J8HA 1EEYB 1NBYA 5IQ7H 3DX9B 4XNXL 1A14H 4M3JA 1PKQE 1XF3A 3QFDB 1G9ML 3VDAA 1NC4D 3BZ4B 2BK8A 4JFPA 4X6DF 4PFEA 2DKUA 5H2BB 3VG0L 1Q0XL 3D1MC 3NACH 1A9BA 3VXMD 4LCUA 5FO9A 4X8JA 3RZCC 1YEKH 2LFGA 3PL6D 3RI5F 1IL1A 3PJSA 3P4MB 4ELMB 1R3KB 4KK6C 1CFTB 2N4IA 3OF6A 1I7ZB 1HINL 3DUHA 3HI6H 5TGBB 4N90D 1G9NH 2IC2A 3FO9B 3QT2A 5LXGH 3BE1L 3GI9H 4GBXA 4C56A 5IW6A 1QSFE 3VMPA 2R1YA 4JRYE 3BMVA 3O0RL 5D7SL 1IC1A 1TZGL 1FCCA 4RFOL 4ODTL 5B39B 5F9OH 3GUTB 4LEOB 2F19L 1ZLWK 4HULB 2IAMA 1MFCH 3GGWA 2AV7B 3FO1B 5BVJB 4P2RD 4YE4H 3ARVA 4K9EH 5KTEH 2V5TA 4CU6A 2D9CA 4JFZL 1OT2A 3CK0H 1Z0NA 3MRMB 1MPAH 1OTSC 3K1DA 5C08D 2R0ZH 2DL2A 3GO1L 3IDNA 3RP1A 5CJ8A 1JK8A 2H2SC 3K74B 2GITB 1DSFL 4G9FB 2ICES 4XPFH 3EYOB 2B0SH 4H88L 4FABL 3N85L 3MROA 1VDGA 4NC1C 1MCDA 3U9UA 1UT9A 3SKJL 3EAKA 4FQXC 1YMMD 3UTTD 5J3HD 1IM9D 3NABL 5LWYL 4L3EE 4ONOA 3TPUA 1LGVA 2FH8A 1HKFA 3TT1L 4OCMC 1LDPL 3D9AH 4KUZL 1A6AB 3JV4A 2BSSB 2WW8A 4KRMB 2K9UA 3QCVH 4GW4A 4R7NA 2VRAA 3L3JB 4BH7B 1N4XL 3ILQC 3BOVA 3HTLX 2ZP0T 3ZE1E 1EHLL 2DJSA 4NC0B 2Q8AH 1CT8A 4AY0A 4LGPB 2D7NA 5EB9A 3ARGA 4MAUL 4LPWA 2XN9D 5T1KD 5DR5H 5GZOD 1AFVH 2WBJC 1N7ML 1BZ9A 3O11B 1AY1H 1MCWW 2F58L 4P46C 4HF5H 4LLVB 3TBVB 2XQYK 3STZB 2R1WB 1IC5H 4M00A 3SCMC 5T1MA 1ZHBB 4HT1L 1BEYL 3ALPA 2CDEA 4JZOB 4TPRH 4XVUD 1K8IA 4MAYD 1OWRM 4P4RB 3T3MF 3QISA 1FVEB 3VE0B 1U8KA 5EOTB 4RZCB 1KJVA 1XF4B 5E6ID 4PP2A 4FMKA 2XKSA 4X6DA 1N5YL 1S9WA 4RMQA 1RUML 4PUBH 1OGAB 2D4FA 2FSEB 43C9B 5IMOB 3OHXA 4LNVA 4ONHA 2AVGA 4PJFB 5ISZA 1I9JH 4MNGE 4YPGB 2OJZL 1NSNH 4MD4B 4M1GL 1A3RH 5IB2B 5F9JB 5L6YH 1XGUA 5AWNL 4MLIA 5JPNA 4GRWH 4OT1H 3LEXA 1RMFH 1MFNA 4ZODA 3SN6N 1K4DA 3H9YA 3D3VD 5IB3A 2HN7A 2IBBA 2WWMD 3ZE0E 5B8CB 1JJUA 2EIEA 1INEL 7FABH 1BBJA 3FO0L 4FNLH 4XP6H 5D2NB 5EU4A 2BSRB 3RU8L 2BY3A 6FABL 1FVDA 4GRLC 2I5YL 1RJCA 2MWCA 5EUKA 1BF2A 3GMMA 5ICZB 3SGEH 4FOMA 1AGBA 2OL3B 3EYUL 3AU1B 4JFDE 5ERWA 2R2HB 4LSTL 4X6FA 3KPLA 3LEVL 4MNQA 3ZLQC 5E95B 4ZAKA 1K8DB 5JIHA 3SJVA 5IB5A 2JB6B 4OZHA 2UWEB 4UNUA 1N0LA 1QLRB 5FGRA 1WWAX 4R2GC 1FG2B 1H3VA 2YRLA 4HIEA 4JN1H 3QXDB 3B5HA 4C83B 5IFHH 3TLRA 3V6OC 4ELKA 4GG6E 3TJEH 2AJ3B 3T4YA 4FZ8L 4KQ3H 2XOTA 3QDJB 5DQJB 4OF6A 4UT6L 1RZ7H 3IU4L 5MP6H 4MNHB 2JE8A 3UTZA 1HEZA 5HHVL 1CGVA 1S9YB 4U2ZA 5DVNA 5F96H 1QSEE 2NY2B 1IQDB 3RVVD 2VLJD 4BK5A 3TBYB 4MS8C 4HS6B 3EDEA 3WN5C 1I3VA 5SX5H 2C5DC 1FC1A 4JFYA 3NIGF 1NC4A 1CE6B 1D5IL 2BFVL 4DK3A 5FM5M 5C70A 3M07A 4BJLA 4C54A 3OPZL 1H3GA 2AEQL 3OZ9L 4MJ6A 2VZVA 2YZ1A 1VADB 4WVRA 5FYKU 4QOKB 3W39B 1N6VA 1CTOA 5E94B 1FLRH 4PGBB 1T89C 5I17A 2AXFA 4KROD 4PGDB 1N59A 3HLAB 1A4KA 1X44A 2IPUG 1OAKH 5T1LA 4BQCA 4OD2B 3BEVB 3DVNA 1RFDL 2SEBB 3RNQA 3T0EB 2DQCL 4ESKA 1DLHB 1FN4A 1D6VH 4G3YH 4KVCL 1V7NL 2QADC 1N5AB 3ARUA 3KPMA 4U1GB 3TIEA 3P3YA 5I8CA 2Z4QA 4RWYL 2R69L 1UM4L 3K8KA 3SKNA 5LGJA 3FQRB 3EOBB 1FVCA 2JIXB 4P2RA 2NX5D 1T0NA 5CBEB 1JL8A 5I16B 1JGVH 4BUHA 5MEOA 1ZKAA 5IFJB 1H3UA 9CGTA 1FBIL 1R3LA 3HAEA 4XNMA 3I3EA 4Y19E 3KPRE 3ARFB 3MNZB 5BCAA 4PJEB 1QVOB 2BCKA 2VDRH 4GKSB 2ATPA 1CFSB 1DFBL 4QCIA 3TZVD 4AEIH 3O9WA 1T04A 3F12B 1JNHA 3ARRA 1PZ5B 5I0ZA 5F7DB 1Q9OB 4JG0H 2DWDA 4QRQA 1YMMA 1IM9A 2OL3H 5KN5A 3F5WB 3LPFA 2ZOLB 1U8NA 5GRJH 2C9AA 3DYMA 1WF5A 4S1RL 4WRLA 4X4ME 4X7SL 4JR9L 2HLFC 1CD0A 1MLBB 5DD6A 2O5ZH 1T0MB 2H2PC 4NHCL 4B50A 1CDCA 1CLZH 3VXSE 4MD0B 1IAOA 1JN6A 2XG4A 2YKLL 5J11B 1I8KB 1UWXK 4WO4C 2A6DA 1R3JB 1XF5B 2XN9A 5T1KA 3CFCH 1AQKH 1KCSL 3DV6B 4KC3B 3DX6A 4HIJA 2FR4A 3D18B 4G6MH 1J12A 2ZUYA 2BC4B 2LU4A 3FB8B 1EHXA 1MFEL 4KKCD 4YZFF 4Y5VB 3VXUB 3ULUE 4JM4H 2CLZA 4HKBB 2VDNL 4LKXB 1UQSB 2HFFB 1S9VA 2PF6A 3RBGA 3AS1A 3V4PL 1O7VA 2XNAA 5F1IB 2PW1A 4JQXC 4MAYA 4NQEB 4F7EA 1DEDA 4OZGF 1H5BC 5TE7L 2QSCL 3TYGL 3RZCD 5ALBH 3N1GC 3QJHA 5E6IA 3HKFA 4KK6D 4HXBH 5FK9B 1EO5A 4KJPC 3TVMC 1RZKH 1A9EB 4M6NH 3LKPB 3FB6A 3D2UB 1PY9A 3CPLA 5D1QC 1OGTA 3RKDC 2Z92A 3FQTA 1B0RB 4NP4H 4KDVA 4PJHE 4D9QE 2A6JA 2NZ9D 3SOBL 2VE6A 4N0UA 3L9RA 3QIBC 2VLRB 2XZQL 1RPQA 2EECA 3KG5A 4EIGB 2BOCA 2ITCB 3BN9D 1ONQA 3VXRA 2B5IB 3L7FB 4XAKD 4YEFA 3HFMH 4J7RA 1ED3B 3MFGB 5DT1L 5AYUL 2ESVE 3LV3B 4OCSL 3VFTA 5FGCE 1R3IH 5EO0B 4F2MA 1DDHA 4ALAL 4LLQA 1OTSD 3UJTH 4ENEC 4IS6A 2AJXH 3FQUB 5CAYB 3SDXF 2H2SD 4JPWH 1CFQA 3MCKB 1WISA 4X9GA 4XXCC 2PN5A 3HNSL 3OB0H 1YUHB 4QT5A 3DTXA 1QUNA 4XNUH 3D0LB 1P7KA 1VHPA 3BH8B 2XY2A 2AS5M 1JZ3A 4X7EC 4FQXD 4L8CB 2H6PB 4LARL 3SE8H 1I1AB 4LLUA 5JOPE 1DANT 3QHFL 3LHPL 4YEEA 5F93C 1F4YH 5B3JF 4KRNA 4L8SC 3P73A 1OAUL 3HG1D 4Z7UA 5I76B 5I30L 3D85A 3U0WH 3ULSB 4JQIH 5CEZD 3ILQD 5IWLC 3H9SB 3KWWA 1IM3B 3SDCB 1J8KA 3HZVA 4ZPTB 5HYSA 2APBA 1I3UA 5EBLA 1R5WB 3G9AB 1YYMH 3C09B 2XZAH 4U7SA 5F9WB 2FEEL 1INQA 2WBJD 2HTKC 4PJ7B 1H3WM 3U7YL 3V9FA 3Q3GB 5IVXE 4P46D 5ALCL 1KCKA 2HVJA 3C5ZB 1MCKA 1M7DA 3OKDA 1K3IA 1KF9B 1BVZA 3MLSH 1JRHL 3SDDC 4RIRA 1NQBA 2DQJL 5EIQA 4DGYH 1CG9B 1T3FB 2GJ6A 5EBWA 1BLNB 2GK0A 2OXGA 4HUNB 4OM1L 5JW3L 3E8UH 1HXMA 2X1QA 5INCA 5J13B 2ZG2A 3TBWB 4OKVA 4OZGA 5TDOB 3LZFL 1WBZA 2ADFL 3IETB 5EIIB 5C0AB 3CXDL 1Y6NR 4JN2A 2IG2L 5EBMA 2DN7A 4ZSOE 3IAGC 1KGCE 1YN6B 1GRWA 4NOFA 1KEGH 4NQCE 4NGHH 3HE7C 5DMKB 2V2TB 5D70L 3E2HB 1SEQH 4OFYA 1GZPA 3GK8L 1AJ7H 5HGAA 1LK3H 2DYPD 1U3HA 3MXVH 1WV7T 3GFUA 4KJYA 4OV5A 2FYYA 2I9LB 1JZ2A 3TV3L 3P11L 1OM3L 3UYPA 5T33L 2BVPB 2FZ3A 2DI9A 5E8NB 4MB3A 2J8UE 2V2XB 1S7WB 5GS1B 4DJMA 4DN3H 1TVHB 5F7KC 4GW1B 4WV1C 2FX9L 5GGSB 3BKJL 5ANME 4Z77B 2CXKA 4HBCH 1D9KA 2D7OA 4XVJH 4PB0L 4FTVE 4UV7L 3SDXA 1Q94A 4WHYH 3VD9A 5SX4H 3KXFA 4OCWH 4P2OC 2OZ4L 4GJTB 4LFHG 4OF8A 4XPHL 3P9MB 4GO6B 5CBAB 3P4OB 3SGKA 1G7PA 3SDAD 4L4VD 4YBLB 5F1NB 5JOFA 3HNVH 2RCSL 3C8KA 3ULUL 5E6YA 2IFFH 3WFEL 3TH2T 3TF7C 4Z5RA 4B53A 1DBKL 2GAZA 2VDOL 5HHOD 5F7HA 1BP3B 4APQD 2MQ3A 2BHYA 5C0DB 2Q76B 4RDQG 1F4AA 1FFNA 2WAHA 1W0VA 3H3BC 3FONB 4JRXD 3MMEB 3KYNA 4X4ZA 4Z7QE 1RUPH 4P23B 4Z7VA 4DGIH 1RIUH 5HYJE 3FFDB 5DJ8A 2CH8A 3L3DB 4S1DC 3U6RB 3L3KB 1T1WB 1K4CA 3FFCD 4MS8D 4L8DB 3O41A 4G8EA 4XMPH 4NSKA 1CGUA 1YJDL 1Q8MA 2Y36H 4Q6YA 1H0DA 5GHWH 5FHBH 5HYEA 1D6EB 2YA1A 2WIMA 4KHTH 4X99B 4G9DA 4XNZB 1JV5A 5DI8B 4G8IB 4FS0A 1S78C 2HRLA 5I8OL 3O6LL 5BOPA 4V1DE 5CINL 4JLRA 1MFAL 3RDTC 2HT2C 5DJDA 1IC4L 1QOKA 4DVRH 1EGJA 2LV4A 4ZFOB 4JO1L 3GBNL 5B3NA 2R8SL 2O5YH 5EORL 1CFBA 1BQSA 1TVBA 5TDNA 5FF6B 1GCFA 1F4WH 2QADD 4LQFL 3NA9L 1XGTA 2IGFH 5EWIL 4TNVK 1AC6A 3QWRA 5JQ6H 1HH6B 1G6VK 5HDQH 4PP1D 1NJ9B 5I2IA 3MBEA 4MQ7A 2VDLL 3BHBA 4Y7MA 5IMMA 1CU4H 5ID0B 1S9XA 1IAKA 1SEBB 4XP4L 2ENYA 5DVOA 5D7LE 2AI0H 4P59L 3R8QA 1BVKB 3VXTB 2FO4B 2QQQA 5GSVB 1A6TB 1QR4A 1RUKL 4WI5A 4CMMB 2XZZA 5MHSE 2Y1VA 4YXKH 5HPMA 4L8BA 4LQ1A 4S1QH 3TH4T 4Y16C 1U8LB 5FUCC 2B4CC 4JPIA 4C59B 2CKNA 2XQBH 4DKFH 2WLYA 4LCIH 4XWOD 1MIEL 1IQWH 2BY0A 3G5YB 3OKMA 4HIXL 1JFQH 4M5ZL 2HRPL 4ZS6C 4LAQH 1NGWB 3LPWA 1I7TB 4NKIL 2MHAA 2Y7QA 2V9RA 4O9HL 3O6FC 1BAFH 3B83A 3WS6A 5DDHA 4NOBA 4YLQT 2OI9C 3IF1B 3ZKQD 1V3KA 3IJHB 2X4TA 5GRUH 3WXVH 3HG1A 1MCCA 1QPXA 4P5TC 3VGFA 4F15C 3N1MC 4JREC 2H2PD 4AQOA 1RIHL 1RU9H 1IBGL 1M7IB 2WLZA 2X1XR 1G9EA 5GGTA 5I66B 1SMAA 4O5LH 5BRZD 1RZIB 2YD8A 1VSCA 1J10A 5C2UB 3WKML 4JY5H 5FCSH 2FJFB 2VOTA 3UJJL 2OSLA 4JGUA 1TTGA 1MAML 1D5MB 5E8PB 1ADQA 3NH7L 2Y6SC 5F9AC 5T5FL 4Q9QL 1VKXA 2XKNA 1KCUH 3RPIB 5EU6D 1DBMH 3MSPA 5J12B 3IFOB 2RB8A 3MRKA 3FCTB 3BRFA 4KJPD 4XCEB 4XZUB 4OUOA 1A5FH 4O2FB 5BQ7A 4ZUTB 2GI7A 2F74A 3LB6C 5D1QD 2E9IA 5DRZB 5JXEA 1IMHC 2D2OA 2JJSC 3HNTH 4WUUB 3QXWA 1AGDA 3I2CH 5D8JH 1WEJH 3QIBD 3JTTB 3QUYA 3MRRB 3QUXA 5C0FA 3R1GL 4M1DH 4UUJB 3QXUA 1D5BA 4PJAE 3QG6B 5LCVL 4F9LC 5GRVL 3MA7A 2EH7H 4QY8A 3MUGB 2ARJQ 3GKWL 1UVQB 2B1AH 3GI8H 4KTEL 1XR9B 2Z0BA 4PPTA 2OMBA 3JWOL 1NUDA 2EEBA 4YIQA 3SE9H 1SVCP 5BW7C 4RSVA 1T6VN 3KS0H 3VRJA 2VLKE 2RAMA 3N1QC 4LOUC 4WU7A 2Z9TA 4OJFH 5IJKA 4EEEA 5T3ZH 2QEJA 3LQAL 2VO5A 4EUPG 1KN4H 3U4EA 4S0TD 3QUKB 1JHTA 2Z31C 5DFTA 5D9SA 2YPLE 4M03A 4NQTA 4F58L 4ZTOL 5A16B 2NNAA 3SDAA 4YHOL 4J3UA 4L4VA 2E6JA 4P3WA 4N9GA 1IGJA 2FIKA 1HZHH 3HS0B 1IKFL 1B0GA 2WINB 1WC7A 3U1SH 5T5NG 1J0YA 2P1YA 4PJIE 5F7MC 3HE6B 5HHOA 5BS0D 4APQA 2HT3C 2J2ZA 3UJIL 1TNNA 1UJ3C 1JWMB 2CKBL 5AUMA 3VD3A 1DBJH 1J1OL 2GUOB 3TIDA 4ODWB 1TTFA 5DZOA 3UTSA 3WEXA 3EFFA 4G6AD 5DJ2B 3DOSA 3PWJB 3K2MC 4LPYA 2CIIB 1G1YA 1S8DA 3HCVA 5HXMA 1F6AB 3LKOB 3FFCA 3WNKA 2X9WA 4I2XB 3O2WH 1QFUL 1JNLH 2D7TL 4G80B 1SJEA 4XC1L 5C0NC 3IS1X 2HH0H 3SDDD 4HK3J 5DK2B 3U36B 2H26A 5E2UL 3ULVC 4N0RA 5L0QB 2FIRT 2I60L 5IR1A 4X80L 1FAIL 4L5FL 3LDBC 2P8LA 3W9DA 3MV01 4NJAH 4R4NC 3F6LA 2HVKA 4XC3H 4L4TB 1NANI 2XICA 1CL7H 3ZKND 2DLFL 4PJGF 4KTDH 4U6HB 3VFUA 2NCMA 3HC0B 4FA8A 3RA7L 4BZ2H 4BZ1L 3V7AG 3EDJA 1IGFL 3NFPB 4BKLA 1I8IB 5DJAB 1C16A 4RISH 5FFLA 2EE2A 4J3OC 2P4AB 12E8L 1KJ3H 1V3JA 5F89B 1JYVA 2LTQC 1DCLA 5FXCH 4NKMA 4KPHL 4JHBA 3NPZB 3H0TA 1RVFH 2NY1C 3U4BL 2XFXA 2WM0A 5GS0C 32C2B 1FNAA 3FT2A 4KMTL 2NY0D 3QG7L 2BNUB 1HKLL 1TVDA 2A1WL 3HZYB 3IXTB 1RURH 4U1SA 4YDLB 3W0WE 5MI0B 4OZIB 4A2LA 2KL6A 3M8OH 4UT7H 4NKOB 4J6RL 3V6FA 1KYOK 4NN5B 3MPCA 1U8HB 4P2OD 3MGAA 3RX5A 5HHME 3MV9E 4XCCH 5DQDL 5DEFB 4OLWL 3BJ91 3ARXA 4Y89A 1FZJA 1BWMA 3OAYH 4HKZA 2FB4H 3SCMB 1QZ1A 1ZGLA 4G42A 1JGDB 3WL9B 4DTGL 1G9NL 1MCRA 4HHAA 2DIBA 4X6EB 3QO1A 3GI9L 3C9NB 4OD1L 3UEZA 4NUJB 2R29L 5D6CB 4LPVA 4I3SH 4UDTA 3HRPA 4Y8DC 1LO0L 1WZKA 1DVFB 2EE6A 4HD9A 1AO7D 3MACL 4J3WA 4RGNE 3L1OL 3SE4A 3S3PA 1CBVH 2BRQA 1H15A 3KLAB 4HKXB 2A9NL 3B4NA 4NJ9L 1D7FA 4FG6C 1H3TA 3HI5H 3O3DB 4UU9A 1U2HA 2MKLC 1DQQA 4YHNB 3OKKB 1AXTL 1OTTD 1ZT7A 4UMGA 3JXAA 3F7YB 1MJ8H 2P7TA 3HMXH 1U8PA 3D0VA 4NYLB 3EDFA 1KLGB 3RDTD 2HT2D 1X5JA 3KPQB 3P4NA 4N8VA 1A0QH 4AIXA 4TUJB 3RHWF 5A2KH 4WI8A 1MHEA 4OCXH 1KOAA 2CMRL 1GPOH 2R4RL 4AQ1B 3DMMB 1P2CB 1Q38A 1B2WH 3GSXA 4OFIA 2ADIB 4GRLB 4MSWB 5D1XA 1LP9F 3HUJB 4GXUN 4U0RC 1YECL 4YDJB 5D2NE 4H0HB 1G7IB 2BX5A 3ARBC 2AEWA 2EDWA 4NO3B 5D4QA 1AR2A 2FJHA 3CSGA 3HAEG 1XGRA 5EU7E 2P8PB 5D96C 4NQDD 2P5ED 4I0PD 3QPQC 2Q8AL 4M7KL 1X5YA 4IJ3C 5KANI 5J9PA 1DP0A 2AQ3A 5IQ9B 3S5LA 3FB5B 2RFXA 1Q1JL 1HSAB 2O5XL 4M43H 2ZWLT 7CGTA 1S7QA 3WFHB 4ZS6D 3ECBA 4WHTA 1JCKA 1KTKE 2CJUH 4OLZH 2XTJC 1DLFL 4HEME 4PRBB 1BWWA 3O6FD 4HH9B 1M6OA 2QQLH 5HGHB 4W6YB 5D1ZD 1MCSA 4HPYL 2QR0B 1F3JA 4EN3C 1FYTB 2VL5B 1GH7A 1MI5D 1LD9B 3QDJE 4OFDA 1NLDL 4PGCB 3KJ4B 4MQXC 3PF2A 4G6FD 1GZQA 1A3QA 3L3HA 4ZMAT 4M5YL 3TN0B 3PWVA 4PUBL 4G7YH 4G8FA 2FX7H 2WWKO 3EBAA 4XCYA 3C2SA 4NZTL 5EO1B 4G8GA 1ZGLP 4LCWA 2X9XA 3RWCB 1W8NA 2IPUK 1W72L 1UM5H 1YEGL 3WFCH 2EYTB 1MAKA 2VDML 4XTRC 4R4FL 5J4MA 4HG4K 4DZBB 4TNWF 3VFWA 3Q1SH 2FJGA 4Z18A 2WQRA 1ZTXH 1UH3A 1S7UB 5INDB 7FABL 3LH2L 2VZ1A 5DHXB 4MA8H 3QIUC 5JHDD 4WFGE 3T0EE 5F7FA 2V5SA 3MOBH 3PWPE 1A2YA 3QFJB 2ZUVA 1MIMH 1AD0B 1TQCC 3PGCA 2AJZA 3MRIA 3LB6D 1AP2A 4JZJC 5L2JA 3R0MA 5CJXA 4FXKA 5CILH 2J4WL 5EG6C 1CWVA 5EUOF 5ESVA 2EC9T 1JHKH 5I8EB 1Q0YL 4K3EH 4H0GA 3VWJC 2QQKL 5DJ6B 3AROA 2XXCB 1YDPB 1X4ZA 2DJ4A 4X6CE 2WIIB 4L9LC 2LABA 5J1AA 3RBSA 5CZKA 2YC1A 5KVDL 2X7LA 2B1HH 3DSNA 3QIWC 1YNTB 3O3BA 5D71H 4YC2B 4MYWB 1P6FA 5E9DB 1LP9A 3OKLB 1OAZH 2P43B 3B6SB 2NW3A 1VACA 3O3AB 4OFVA 3NA4A 2V5RA 3G6DL 5MP6L 4LOUD 3NPSC 1A7PH 1C08A 3DVFA 3QA3B 2HFEB 3SQBA 3SKMA 2JELL 3AMLA 5F72S 5EZLA 2F8VA 2EYSB 2E7MA 5E5MA 5FIEA 2MTPA 1MHCA 2Z31D 1OCWH 4CKVX 4YFEA 2X40A 5EC2B 5TDPA 3OXRB 1P69B 2VDQL 2WMPA 5B38G 5D7IA 5KW9L 5LGHL 4LBEA 4NNPH 4JDZB 4PRPB 3BQUB 3A67H 2JCCE 2YEZB 3CSPA 4U6VL 3M1BA 2FL5B 4Y5XB 4K8RC 1S5IL 3RWEA 3UTPE 5I1GL 5HYSG 3D39E 5AEAA 3BP4B 1FO0A 4JFFB 1JPST 3WIIL 1OAKL 1RZ8A 4Y4KA 3AY4C 3V5DA 3RWJB 3X17A 1H5BB 1WFUA 5HD8D 2ID5A 3OBAA 3X3FH 2BDNH 5BZDA 3P9LA 1AO7A 3UYOD 3MV8A 2FATL 3HN3A 3TVMB 4NQEE 1T5WB 2VXQH 1AC0A 4ZYKA 4A6YA 3I02B 4YHML 1HIML 3GSNL 4O58H 1ZWIB 2J6EL 2EIBA 1J0ZA 1WWCA 1KB5L 3BDYL 3S37H 3BGMA 3O2DH 2XWJB 3VFGH 3CNKA 3K4DA 5F8RC 4IRSA 4JFED 4R4ND 3BXNB 5C0BB 4YAQB 5DUBB 4W4OA 1OPGL 5DRNA 1FE8H 3MUJA 1T1YB 3GJFB 2X4UB 4Y4FD 4BK4A 2NY3D 5CGMA 3HMWH 5FUZL 5K9OB 3BPLC 3LQMA 4ZUUA 5GRJL 2C1OB 5DD5L 4PJ9C 4GKOA 3U2SB 3QXTA 5EUOA 3ZKMC 1VA9A 3O8XC 4HLJA 4I77L 4QRTA 1G7MA 4NDMA 4YFLF 5TFSH 4K94L 3QNXB 3ZSSA 4RAVB 2XPGA 5IJKC 1QBML 2NY1D 3GBMH 3C08L 4MJIA 2EH8H 3NGBC 4I0PA 1HYSC 4X7DC 5ICXA 1GGIH 3LIZL 4L8SB 3OJDA 4CW1A 5E03A 2A73A 4K2UH 1NAMB 2AK4D 1X4YA 3OJ2C 3P0VH 5D6DA 1Z5LB 1NFDB 1K2DA 2EDNA 5D2LB 5DC4B 1TENA 1J8HB 1NBYB 1A7NL 3K2UL 4O00A 3REVA 4D9RD 1YNLL 3QUML 5D1ZA 3RTQC 1UYWH 5I19H 1XF3B 1BFSA 1G0DA 3GSRA 3MQIA 3LD8C 5HBBA 3VWKA 4EI5A 1A9BB 4LCUB 5FO9B 4X8JB 3FZUC 1IL1B 3PJSB 5E99L 3VXME 5EZIL 1R0AL 1QLFA 3KPSD 4NO0D 1S7TA 3GSVB 5E8DH 4Y1AD 4YGVA 4P2QD 5DD0H 1LHZA 2DLIA 1CDYA 4BQ8A 2PYEE 4C56B 5IW6B 2A74B 3A0OA 1RULL 3IDYB 3MRLA 4RGMB 2R2EA 2P5WD 4X5WA 4H1LA 5M94B 4LMQE 4L3CA 2V7NB 2O93L 4YDIH 3A6BH 2VZ3A 4GRWF 4FG6D 4YXHL 4QTIL 3ZHLA 2IAMB 4TQEL 3GGWB 4OSUL 1R3IL 3P40A 3HE7B 3WJJA 3LS4H 1WZMA 3L6FB 5IBUB 3VDCA 4U33A 4PJBB 1UZ6E 4FZEH 5L9DL 5JHDA 3K7UA 1U95B 1ZGLM 2YUZA 4UTBH 4QLRA 4WIQA 1MFDH 4JPWL 5EZOH 4XBGB 5K9QI 3IDNB 1JK8B 2EE3A 2AJSL 4N0CC 4IM8A 5C08E 2YN5A 2NQCA 3MROB 5KOMC 4XP9L 4JPKL 2EC8A 3GJFH 1GIGH 3U9UB 1HE7A 1MH5A 5ITBH 3ET9F 5GS2H 2C1PA 5DJZA 1R3HA 3ARBD 3UTTE 1JPSH 3OR6A 4HS3A 3JV4B 3RWHA 3F62A 5ETUA 4LSRL 5IP4A 4OM0H 4GW4B 2DLEA 4R7NB 4UT9L 3TO4D 1Y18A 1BHGA 1YEJL 1DE4B 1QFPA 2F9BT 5I1EL 3QPQD 3VFSA 4NZUL 2PNDA 4K3DL 5TQ2H 1WK0A 4OCYH 2J88L 4U49A 4WFHD 4BFIB 3L7EA 3I3DA 4UB0L 3CFBB 1BZ9B 1NAMH 2IALA 5I15H 1BFOA 2F53D 1QP1A 3FB7A 1H9VA 1QNZH 1C7SA 4HUKB 1IEHA 5EN2A 2CDEB 1T22A 4LASL 1K8IB 5FYJD 3CJJA 3CLFL 1F58L 4MQXD 2YXFA 3E8UL 1EX0A 1KJVB 4QRPB 1VFOA 4ONGH 5JNYA 2R2CA 1OVZA 3DETD 4X6DB 1KJMA 3HRZB 1S9WB 4OLYH 2GY7B 1KEGL 1HILB 3RY6A 2CLVA 4CUCA 2NY5L 1NGZA 3LOWA 2PO6A 1K3ZA 3OHXB 4P9MH 1U8JA 5HDLA 4ONHB 3VGEA 1AJ7L 1NMAL 4R6UA 1LK3L 4XTRD 1E4XH 3HR6A 3BPOC 4I0CC 4PRHA 1JNNH 4PJXA 1XGUB 3U46A 2LVEA 1QSFD 2PTUA 4ZNCD 2RBLA 2X1PA 1GVIA 4Z7WE 1NCWH 3PP4L 3LEXB 4YUEL 4XWGL 1RUAH 1K4DB 1OQOA 1MVFA 2HN7B 3BZFA 4JKWA 5IB3B 5GJTH 4JFEA 4QHNA 1XGYH 2W9EL 1A1MA 1PJ9A 3D3VE 3QIUD 3OAZH 5EU4B 5FYKH 2DS4A 3HI1A 1OP5K 2AKRA 1WT5A 3MNWA 4H8WH 1E4KC 3GMMB 4QYOA 5FYLH 4Y4FA 2BNRB 3PGFH 4G6JH 3VWJD 2X70A 4QEGA 5KSBF 3MLRH 3MLTA 1AGBB 2FH6A 4ONFH 4NCC2 2NY4B 3B2UC 5H94A 1ZVHA 4HJJH 5BVPL 1J0IA 1Q9KA 4Y16B 4MNQB 1OWWA 2Y07L 3P30L 2IPKA 4ZAKB 3LN5A 1UA6H 5IB5B 3SJVB 2IFFL 5IW3A 2Z35A 4PJ8D 4HZLB 5TF1L 1WAAE 3O4LB 4JCLA 2VN4A 3KR3H 3V0WH 4PIRF 3SO5A 1RZFH 3FT4A 4ELKB 5EBGA 3MRFB 3T4YB 1E4WL 3I3BA 5FECA 4ZUVA 3CFIC 1A7QL 2VH5L 3CH1A 3FQWA 5CHNA 4KV5F 2AK4A 3AUVA 1X6LA 1KN2H 3UTZB 1HEZB 1TMCB 3HHRB 5DUML 1JI1A 1IC7H 4IRZH 2RIKA 1Q72L 1UXSB 1EBAA 2EIZB 2R4SL 1NGPL 1ACYH 2VLJE 1CFVH 1BOYA 4JFYB 4IOIB 4NZRH 1IARB 4DUWA 1ZVSA 4K7PY 3CXHK 4K8RD 3Q6GL 3IYLW 4MJ6B 4N0YH 1FG9C 2CPCA 3VW3L 1EJOH 15C8L 1A7OH 1I8LC 4XMKH 2ADGA 2YS4A 1X5IA 4K3GA 4ORGA 5I17B 5IF0A 5J8OA 3MRHA 3RGVA 1A4KB 4Y1AA 5DD1L 5T1LB 3DVNB 4KK5C 2AXHA 2O5YL 3VI3E 4AH2B 3JVGC 1I1CA 3RNQB 3TCLA 1CI5A 3G5ZB 3VXOA 1VFAB 5GISL 2AERT 2IGFL 1FN4B 2P5WA 5JQ6L 4KKNA 1XGQA 4XXDA 1MEXH 3TIEB 3KPMB 4J12A 1A1OA 2G60H 5MENA 2Z4QB 3SKNB 5LGJB 4ZS7H 3B8YA 1S3KL 4LCCA 1FVCB 1CGWA 1SY6H 1T0NB 4OLXH 1F90L 3RVWD 4HC1L 2IAND 1R3LB 2NX5E 3HAEB 4S2SB 4XNMB 4M02A 4YXKL 2AXGB 3HC3H 4J4PC 4AEHL 2P49B 2OR7A 1CCZA 2ATPB 4WUUE 5DTFA 2Y23A 4QCIB 4JAMA 4DKFL 5I75C 1G7JA 3O9WB 1IQWL 2XV6B 1JFQL 1BFTA 3MRBB 3BZDA 1M71A 1ZA3A 2M2DA 4ZOAA 2X6MA 2QQNH 4PJ5A 2DWDB 3NAAL 4PJ9D 4X83A 4ZPVB 1YMMB 3OB8A 3EDKA 1V05A 3INUL 4NNYA 1U8NB 3T3PE 4MJ2A 3ZKMD 2LU7A 2X44D 1BF8A 5KSBA 3GSOA 2B4CH 4M6MH 2Z8SA 4FXLA 1FP5A 4I48B 3B9KD 3OAUL 4PV8A 4YPJA 3ARQA 1NCCL 3TO4A 5IT2H 4G5ZH 4KAQH 2BY1A 4WI7A 4WTZA 5A43C 1HYSD 1MCOH 1IAOB 4LRNL 1JN6B 1DR9A 2R56H 5I1HL 2MFNA 2VIRA 3C8HA 4DN4H 2P8MA 2L7UA 4BFGA 5DK0B 4ZFGH 3DX6B 4HIJB 1ETZB 4OGAD 4ISVA 2F53A 2PCPA 2DQUL 2FBJH 1T66C 3JWDL 2CLZB 4PLKC 3QDGD 3RTQD 5EZJA 3BD4A 2PW1B 4MCZA 1KLUA 2Y5TA 4J23A 4MMZC 1CICA 4TSCL 4F7EB 2VQ1A 4KHXL 4P3CH 2IQAA 5JDJA 1PKQA 5IGXL 1UWEL 3QJHB 1YN7A 2BVTA 1HI6B 4M6OL 1FFQA 3MRDB 2PXYC 1FH5H 1I85C 4UIKH 5T3XH 4FQIH 4R8WH 4BSWA 3VFNA 1MQ8A 2W92A 3X13A 1OGTB 4NCDA 3FQTB 1HHHA 4HX1A 3TH3T 3LDBB 1X5KA 3OXSA 2YD2A 4WWKD 4I8DA 4LRIC 2A6JB 1SJHA 3OGCA 1KIRA 5I74C 2VE6B 4N0UB 3KHQA 1NCDH 4OGXL 3MRNA 2EDDA 4OI9A 3SDYH 2BOCB 5MEQA 1QSFA 1GGBH 1ONQB 3VXRB 3SGDH 3OKEA 4JRYA 4RGOH 4Z0XA 4W4OC 4X0KA 5ESAA 3ZYZA 1WITA 4XAKE 4HPOH 4IOFC 3VFTB 5JIKA 2FEDD 2ORBH 4M7ZB 4F2MB 2P47B 1RZGA 2GQHA 1DDHB 5IKCA 2DLHA 4LLQB 3HAEH 5C71A 4HKJA 2RR3A 1DBBH 4ZQKB 2G5RA 3C87A 4OLVH 4N0CD 3KPRD 1CFQB 1AKJA 4D94A 4PLNC 4QT5B 2YXMA 4UV4H 3I6KA 3W81A 4X5XB 1NH6A 4XMLH 1KXQE 4KRPB 2YPVH 3FO2B 4OF5A 3KNBA 4LLUB 5HYQA 4NC1E 3AREC 3BPCB 5B38B 4Y8AA 1IGYA 2GSGA 4PJ8A 2ZUWA 5FO8A 2HG5A 4FQLL 2VABA 3EYSH 4F37F 4L3EA 3D85B 4NM4L 4KZDL 4D0CA 1NC2A 4LF3B 1SM3H 4QKXB 3VDBA 2W0FA 3KWWB 3OG4B 4X9BA 1KCRH 3HZVB 5HYSB 5CEZE 3O45B 4JQVC 1J1XL 1UH4A 5FOBA 3C5SB 4POYA 4H26B 1BX2A 1INQB 3GIVA 5I71C 4XPTH 1JNLL 1QA9A 1VGKA 2YD1A 4P5MA 3OKNA 3S34H 2ICWA 3GM8A 4JCMA 3MLUL 3IT8D 3KDMA 1FGVH 4JFXA 4HS8H 1N2RA 4JDTH 1LE9A 4RIRB 5F1SA 1OP3K 2GJ6B 5EBWB 1MJ7H 4XNYL 1YNKH 4P9HC 1N8ZA 5INCB 4IRJA 4AJ0A 5I1JH 1CLCA 4OZGB 1WBZB 3W11C 5HI3C 5EBMB 4EZMA 5K9JL 3L3GA 5CUSL 4FFWC 2Q8BH 4LSUL 3QHZH 4HV8A 2FBOJ 1X7QA 4BUGA 5IHZA 1GZPB 4PS4H 3W9EA 5HGAB 43CAA 4EI6B 1U3HB 3SE3C 1EMTL 4KJYB 4OV5B 2FYYB 4K9EC 1BQLH 5C6WH 3KYAA 2AJYH 2DOCA 1JYNA 4TSBL 1JTTA 3CFDA 5KS9E 1J1PH 3TC9A 4DQOL 1NEZA 2OTPA 2ESVD 3G9VA 4JB9H 3WIFB 4KQ4H 1FHGA 3H3PH 4OI7A 1JPGA 2DMKA 3VRLE 1T7WA 3V5HB 1SBSH 3EYVA 1D9KB 3CCHB 2KDGA 1MHPH 4HLZG 1VGEH 4XRCA 2ICWI 1NUGA 3LPGA 4PYGA 4GMTH 4JDVA 3SDXB 1Q94B 3B2UD 1XIWC 2RHEA 3KXFB 4LKCA 3K1KC 5CJQL 3I9GL 2ZSVB 3MLXL 3O4OC 4MDIA 1G7PB 4JFDA 2NY6D 1F3DJ 3K46A 5JOFB 4UILH 1RIVH 2UZYB 2BNQD 3B9KA 3C8KB 4F3FA 5JOPD 3OQ3B 4O02L 1J5OH 2FB4L 5F7WC 4Z5RB 1CVSC 2XTJB 4EVNA 3S4SG 1VEPA 1CVRA 4NM8H 4JJHA 5IK3A 1FFNB 4P57A 2OP4L 2C3XA 4R0LC 3V6OE 4F8QA 4I3SL 1R5IA 5C0RH 2Q1EA 2V5YA 3KYNB 4W6WB 3WFZA 3TYFA 4GG6A 2PW2A 3IKKA 4JRXE 1VB9A 5DJ8B 2EDHA 3ULUF 4P4KC 1DQML 4GKZA 2IPTH 3DVGA 5DQ9A 3HI5L 3FJTA 4NSKB 1QSEA 3UP1A 3T2OA 1MF2H 4LVOC 1H0DB 2Y72A 3RVUD 1FNGB 3RUGE 4G9DB 1JV5B 1SYSA 4Y2DA 4BFBD 1V8HA 4YX2L 1IT9H 3PDGA 4NPYB 1T1ZA 4AIOA 3FOMA 25C8H 4WFED 4RFEB 3AGVA 2ZSWA 4YDKH 3HB3D 3L5WA 3O6KH 3KAAA 1EEUA 4WWKA 5C2BH 4Q74A 1TVBB 5TDNB 2G2RB 1KGCD 1NGQH 2YUVA 1XGTB 1TQCB 3F7VA 1YEEH 5I2IB 3CMGA 4OQTL 4D9LH 3MBEB 3DROA 4MQ7B 5A2LH 3GMOA 4DW2L 3MLWH 1K6QL 2YWYA 1ZSDA 4KDTA 4P5KB 5FGBA 5DHVB 1MOEA 4G7VH 1T4KB 1KIQB 3CVHL 4BSJA 5DJ0A 5JHLH 3H6JA 4J4PD 4L9LB 4XVSL 4WTWA 3ETBF 3KYKL 3QIWB 4M48H 4L8BB 5FA4A 1Z9SA 4Y19A 3KPRA 4JPIB 4PTUB 2KBGA 4PRID 3BSZL 4UDUA 2BHZA 1B4JH 2EO1A 3UBXI 3OKMB 4HGWB 4GSDL 4OLZL 3VXPA 5CEZL 5HHQA 3RKPA 2MHAB 2VLLA 4D0BA 4JFHD 1JPTL 2UUDH 4ETQA 3DARA 5DDHB 3KJ6H 3VFRA 1I1RA 2DDQH 3F65A 2X4TB 1KCVH 3MGTB 3HG1B 1YEIH 1MRCH 3R06B 1PG7L 2JF1A 2WNGA 3NFNA 5DK3A 2V17H 4X4MA 3T1FA 4I1NB 1BGXH 1YEHH 3F58H 1CXFA 3HZMB 3IDIB 3LKRA 4OLUL 1G1CA 3V5KB 3WNOA 5KZCD 3BT2H 3VXSA 1AHWC 1QO3A 2DAVA 5F7NC 1FNSL 1T20A 5BRZE 5IVXF 1QBLH 4S0SD 4J8RA 5C07D 4PRPE 5E70A 4TOYH 1IKNA 3RIFF 2OZ4A 2F54E 2OSLB 5CJOL 4R7DA 5HYJD 4LHUD 3GMLA 2XRAL 4PR5A 4KUCF 4EBQH 3MLVH 1VKXB 4JFFE 4EOWH 5IUSA 2YZ8A 3MRKB 5C0EB 4U6YA 3DO7B 5EU6E 3M17A 4HDIB 5JPMA 1JYWA 4ODSL 1UGNA 4GG8A 4F8TA 4KY1L 2F74B 1ZANH 5B22A 4V1DD 5JLZA 5I1LA 1WGOA 1AGDB 1EGJH 2KH2B 1WWBX 5I9QB 1DBAH 2E7BA 3QUYB 1I7UA 3QUXB 3RJDA 2EZ0C 4PJHA 5D71L 2X4RA 5C0FB 5EO9A 4LAJH 2EDEA 2XZCH 4Z0BL 3MA7B 4QY8B 5C0GA 1J0KA 2CR3A 3CFKA 3ARWA 3OKOA 4LPUA 4IOFD 1P4BL 3LS5H 3BPLB 1XH3A 5B8CC 2J12B 2VISA 4LIQH 2FO1A 5AZ2H 2ESVA 3V8OA 4YIQB 3O8XB 2OM5A 5C09B 1A7PL 3VRJB 5D7LD 3BKML 1UJTA 5IHLB 5E08H 3MJ9H 1U8MA 4WU7B 4AMKL 3FAWA 3T0AA 3IFLH 1KENL 1T03H 5MHSD 4WCYH 3ELAT 5HHXH 3QXAA 1JHTB 1ZS8A 4GS7C 1KXVC 4BH8A 5D9SB 1CK0L 4UQ3A 2I9TB 3ARED 3G6AA 2NNAB 4X4XB 3IDJB 5F8QC 1PBYA 3IFNL 1IGJB 2FIKB 1B0GB 1F4XL 1WC7B 5DEGA 2OTWB 3VU2A 3BUYA 2HKHH 4APQB 1OP9A 1B9ZA 5MEPA 3BKYL 4W6XB 3VD4A 4UI2A 5AUMB 1NFDE 5BS0E 2VWEC 5D2LE 4U3HA 1ZT1A 4OZ4A 4Z7QF 3QP3A 4NIKB 3UTSB 3EFFB 3RL2B 4CVZA 3GIZL 1TCMA 1U8OA 2ZZUT 5GGTH 1KBGH 2UVEA 1QRNB 3ZDYE 3ZT6A 3ARSA 1ZLVK 4XP1H 3UO1H 1YQVH 5KVEL 2M8XA 4FHBD 4HW6A 3UZQA 5IVXA 1KIUA 2KPNA 2DM7A 2E7CA 2Q6WA 4D3CH 3I75A 2E9BA 1MJJA 2H26B 1HQ4A 5GRWA 5E00A 3RFZC 5KVMC 4YR6A 5GIRA 1UCBH 1RZKC 3NFSL 2P8LB 4FQ1L 3IDXL 4DUVA 4RMVA 2HVKB 2AEPH 2DQGH 1EFXD 5FUOL 4Z7OF 5JORB 5F9DC 1FE8L 2VZTA 1FORH 3W11D 4PV9A 2CDFA 3FN0L 4HXAH 1FRGH 1ZEAL 2IJ0C 4Q9RL 1U92A 1UM6H 1CF8H 3VFUB 1DQDH 1QSVA 5BXFA 3MV7D 4GAYA 4U1LA 4AZ8A 5I18L 4ZSOA 2ZPKL 3GMQA 4U1JA 4NQCA 3N9GH 4U1GC 5MERB 5CKAA 4R4BA 4QHUA 5FYKE 3ZYJA 2UZIL 4PJBE 1GXEA 4BKLB 4R26L 4E41B 1C16B 5CLTA 3AM8A 1CD1A 1WFNA 1ZHKA 1RZJH 3GBML 4JM2D 4NKMB 3H0TB 2OLDA 3BAEH 2XFXB 3VFMA 1GGIL 3FT2B 3S88H 4NUGH 4QXGH 1F3RB 3GSUA 3DI3B 2J8UA 1DEEA 4LP5A 3IAPA 5JDSA 1HHJA 3NCFB 1GGCL 4GAJL 4LPXA 2K7PA 1NCUA 2A77H 5ANMA 5CGYC 4EXPX 3IGAA 3V6FB 3WDJA 5IHUH 5EU3A 3MLYH 1H3PL 4IMLA 1XIWD 4F57L 1IGCH 4FTVA 1UYWL 1NANH 3LRSA 2F5BH 2JJWA 4OTXL 2Q7YB 4KZEH 4J3TA 5C0CA 2YPLD 3E1F1 5IESH 4HWBL 3EIFA 1FZJB 5A3ID 3V52H 1CR9H 4N5ED 1BIIA 2YA2A 4HKZB 4I5BB 1ZGLB 3NTCL 4HHAB 1CYGA 1I9EA 4AL8H 3QEHB 5J11C 1WTLA 4NN6B 1DUYA 1NCBL 3LEYH 3H9HB 1NGYA 4KVNL 4XCNB 4G6KL 3UCRA 3D69A 3WFBH 4HFUL 5E2WL 1FFOA 4KI5C 3QCTL 4P4KD 1JHLL 5IBTL 4Y5VC 3BKCH 3QPXL 3ZDZF 4DEPB 3S96A 2VZOA 1CGYA 4LHUA 1H15B 3KPNA 5HYJA 1BQHA 4QRPE 5DSCA 5LBSH 3LN4B 3LS4L 3TBSA 5KBNC 5SWSA 4X4YB 3B5TA 1A6VL 1DQQB 3BPOB 4R9HA 3MGOA 3MODL 1ZT7B 2CKBA 4ERSH 5IB1A 2P7TB 4GAGH 1U8PB 3D0VB 4ZTPL 5BJTA 1V7MH 5TE4H 2BRRH 3P4NB 4MXQC 4N8VB 1QSZA 4V1DA 3WLWC 1LQSR 3WJLA 3MBXH 1MHEB 3V7AE 3AMKA 1Z2KA 3BDBA 2AJUH 1CS6A 2VXVH 4JM2F 1MJUL 1KJ2L 3QDAA 1EV2E 3GSXB 3EDDA 3EJYC 4PJAF 2B5IC 5D1XB 2R9HD 4RAUA 4FQQB 5ILTL 2OR9H 1QFWI 2VQUA 1YEDB 1YPZE 3UROR 5B4MD 2DWEA 4OKDA 4HFWB 1XGRB 2C7UA 2BNRE 5DJXB 4GQ9H 1IGIH 5D7LA 1EO8L 4NQDE 5J9PB 1HH9A 2P5EE 4G9FD 2RFXB 1P7QA 4OCRH 3SGJA 5FUCE 3IU3A 1S7QB 3ECBB 4WHTB 2OQJB 1QNZL 1EO7A 4L1HA 1G6RL 4KDWA 3S35L 1I1AC 3O4LE 4GXVH 3RWGA 1BVLA 1N0XL 3EOAB 1X5HA 2JJVA 5EOQL 4N5UA 1D5ZA 3O6MH 4OGZA 1F3JB 2XA8H 2DLTA 3FMGH 3QCUH 4W81A 4WTZG 3C6LC 1GZQB 1OQXA 3PHOB 1MI5E 3SDCC 4Z8FL 4JPVH 3L95B 1U58A 4MHHI 3GEWB 5J89A 4XAWH 1IFHL 3H7LA 2A6KA 1OF2A 3C09C 5F9WC 3R0NA 4G8GB 1E4XL 4LCWB 1PSKL 4JGJA 5E56A 1JNNL 4FN0A 5HY9A 2WQ8A 4U1IA 5C6PB 3C5ZC 5D7KD 3LKQA 1YEFL 2YK1L 4I9WE 3VFWB 2QHRL 3WSQL 2XI9A 1SJXA 3U7WH 3QH3A 3B2VL 1FZKA 1W0YT 1ZT4A 5I1AA 3T3ME 3QRFM 3D87B 1JZ4A 4XBEH 1LEIB 4HAFA 5FYKL 5D72H 3VXNA 3TA3C 1MCQA 3N1FC 1TETH 1A2YB 3ROLA 1UACH 3PGCB 1ZLSL 2AJZB 3MRIB 4QXUL 2W9DH 1AP2B 1WCBA 2ARJA 5L2JB 2JK5A 2OS7A 4FXKB 3RVXC 3BUTA 1MQKL 3BD5A 4LLWA 3OMZA 4ONFL 3EFDH 3WNPA 5HHPA 3E2HC 1BZ7A 4WW2A 4NQSA 2W60A 3AS2A 2NY7H 5GZNC 2NXZC 2YC1B 2AK1L 2X7LB 5TPWL 4RMSA 3O3BB 1TJIH 3KLHC 5F3HA 4I13B 4JM2A 2HAZA 1N6QL 4PJAA 5GS1C 1LP9B 3V4UL 3QYCA 2L7JA 4WWID 1F8TH 1P4LA 2NY0B 2NW3B 5E5RB 1U8QA 1VACB 2Y9RT 3S4SB 3STLB 4EXKA 3E0GA 1OTUC 5DUPH 2XT1B 4R96A 1C08B 1T1XA 5ITFB 1NBVL 3SKMB 4Y4HA 2VR5A 2VR4A 5EZLB 5E5MB 4N8CH 1I1FA 2VLKA 4HUVA 1HHKB 1MHCB 2A83B 1TJHH 4YHKH 1KV3A 5TDPB 1W0WB 1ACYL 4JG1L 3I6LE 4PREB 4HUXA 4NZRL 4HBQA 1CE1L 1PEZA 1QYGL 4RQQA 1RAMA 5BMFH 2EDXA 2YPLA 3M1BB 4IIQA 1DUZA 4OCLC 3RWEB 3B5GA 2YBRA 1L6ZA 5IOPA 1EAPA 1A4JA 5E8OA 2HFGL 5IMKA 1FO0B 3JV5A 1AE6L 3UAJC 3QDJD 4PJIA 1RZ8B 3ZKXB 4Y4KB 4ZO8A 1TJGH 2P24A 35C8L 4QRSA 1X5LA 2HTLC 4FP8H 4AT6A 2PTTA 4P23C 5IBLC 4TYUA 4M7JL 2YUXA 2DKSA 4U1MB 5CIPB 4Z78A 4M8QA 3LQZA 4F7PB 4HUUA 1AO7B 2NY2D 3MV8B 3ALXA 4OF0A 2G60L 2PXYB 5GGQL 3B43A 4ZS7L 3H42L 1CLOH 3BMWA 1SY6L 4ZYKB 4A6YB 3BZ4A 4WDIA 4NQXA 5ADPL 4RBPK 2D03H 1FIGL 5K59E 4XNZC 3BGMB 3EO9H 1BM3H 2YD9A 4LPTA 1IAIL 3P4MA 4IRSB 4P0DA 3ULVE 5TE6H 1XEDA 2B8OT 1N64H 1YJDC 4Y0GA 1NMCC 5JIPA 1KG0A 2XWTB 3V4VL 4GAFB 4WFGD 3T0ED 1BFVH 5DWUL 1W72A 3VXRE 1YY9C 1QEWA 3VMOA 3QI9A 1INDL 4HEPG 5B39A 3P77B 2X05A 1HWGB 5EUOB 4JY6A 4HUWB 2B4CL 4YK4B 3FO1A 2JIXD 2YN3A 4NDMB 4ODHL 3BESR 1DN0A 1S7XA 4U1NB 3DGCR 2XPGB 3RX7A 5FB8A 1NEZG 4MJIB 3ARFD 4ZOEA 4I0PB 2IEPA 3HZKA 4U1KA 1EA9C 5ESQB 1MWAL 4CW1B 2N1KA 5CD5C 3CDGA 3CDCA 4K7PL 2A73B 3AAZA 5DVKA 3EYOA 3AFLA 4MX7A 5CGYD 5E2TL 5I1KL 5F7EL 3G04A 1K2DB 3QQ9C 3QAZB 4QTHA 3W0WA 3MR9A 1JGLL 3GHBH 1E6JL 4NRZA 3REVB 1HSBA 1NAKH 1JZ5A 4LCYB 4HCRL 3BX7C 2NLJA 1ITCA 3GSRB 1A6AA 3ROOB 4OAWA 2BSSA 4D9RE 4MXWL 3MV9A 5EPMB 3VGHA 3EHBC 3VWKB 4TRPH 5I71B 2UZXB 3WE6B 1GAFL 5EDXA 4EI5B 4HK3N 5JXAL 1PG7X 4XB7A 3CSYB 1OT1A 4AG4H 1MCLA 2VSCA 1HQRA 1NLBH 2F5AH 1S7TB 4IDLA 4ZD3L 4F9PC 4GFTB 4HWEL 4UAOB 4YGVB 1FO0H 4OIAA 3KPSE 2DQDL 3O2VH 2FHBA 3T0DA 5EA0L 4MZ2A 4KI5D 1WIPA 4P2QE 1NCDL 3CZFA 4LLVA 3MRLB 3VFOB 1C1EH 3SDYL 4LSVH 5HJ3A 3VXUD 2IH3A 2R2EB 5CIPH 4X5WB 4H1LB 1I9IL 5IJVB 2CDGA 5SWZB 1YY8A 1YYLL 4M62H 5CEXA 4I18A 3FTGA 1A6UH 4NQED 2JLLA 3ARPA 1FVEA 3VE0A 3OX8A 4A6YH 5EOTA 3NVQA 3SGEI 3GMNB 1XGPB 3W2DH 3K80A 4NT6A 1LEGA 4O4YL 5JHDB 4XNQA 3DYOA 1A3LL 5KG9B 2VXUH 4OLVL 5EOCL 1EVUA 1NCAH 4DGVL 4XPGH 3D2UD 4MXQD 4M93B 1URLA 2FSEA 4LSSH 2HWZL 5IMOA 3T2NH 3WLWD 1NDMA 4ZOBA 2ADJA 1CIUA 3WFDL 2YPVL 4Q6IC 4S1SL 1C5BH 4YPGA 4Z6AT 4UTAH 4PLJC 3IXAB 4FMFA 1G7QA 4X6CF 5IB2A 2VLRD 3PABA 1MH5B 5FDYA 4EDWL 1MFBH 3GSNA 2C1PB 2J6EA 3LKNA 4OZ4B 5DJZB 4JANB 2B2XL 3I84A 1KB5A 4M7LL 1FPTL 1R3HB 4Y5YC 2EDJA 5GGVH 1MNUL 4HS3B 1EUTA 3RWHB 2GTWA 5ETUB 2MSPA 3NCJL 2X89D 4NWTH 1U93B 5D2NA 4R90L 4E42B 1Y18B 3VI4F 4PY8I 1QKZH 2GJJA 3VFSB 2FHFA 5GGRB 2CO7B 3BPNC 1Z3GL 4CL7A 1GYAA 1OOAA 3NZHH 2ZCHH 3CGTA 3BD3A 2VYRE 3L7EB 4PTTA 3QZWG 4Z95H 5DZLA 5GJSH 1T2QL 1CXLA 1AR1C 3VGBA 3VCLA 4LVEA 1I1AD 3HPJA 4YHLL 3NN8B 5FEBA 1NMBL 4HZAA 1EHAA 1K8DA 5FM4A 2JB6A 2XTJE 1T22B 2JCCF 2KZ1B 5L8JB 3TBTA 3MA9L 2WUBL 3MLZL 1QLRA 1Q9LA 4YHZH 2VMFA 1EUUA 3ZKSD 3HE6C 4C83A 3WXWH 3QSKB 5FYJE 1T2JA 3SDCD 4PBXA 4JKPH 3IDGA 4NBZB 5JNYB 1RY7B 2XIDA 3QDJA 5DQJA 1AIFB 3SQOH 4LVOB 4WHDA 5AZEH 2H1PL 4YQXH 5JUEL 4LU5L 3BGFB 4R3SB 2CLVB 1NGZB 3ARDD 3ULVL 2PO6B 5CZVH 2EXWC 2ZKHH 1U8JB 4PRDA 4LEXL 4GMSH 3C5ZD 4JZNA 1ZK9A 4GW5B 4P9HH 1FSKB 3QUMA 4PRHB 1KFAH 3U46B 1OW0A 1IAMA 2PYED 4E0RB 2IQ9L 4H1LH 4LSPL 1CE6A 3QDME 2FHCA 1A6WL 1UWGL 2E27H 4NO2A 5L0QC 1OHQA 2D7MA 3BZFB 4MDJB 2HT4D 4M4PA 2P46B 4RWHA 5E94A 4JFEB 4GRWB 5TQ0H 1A1MB 3DSFH 2AJVH 3O3EA 5FCUH 3HLAA 5DRWA 2JJTA 5C0AD 4WY7L 1LO3L 2AKRB 4OD2A 3RVXD 5KSAC 3T0EA 3PWPA 4QYOB 2X4PB 5DMIH 3VH8A 5C6TH 4NRXA 3QRGL 1J11A 3P4LA 5GS0L 3OKYA 3MLTB 1S9KC 3QDHA 1EVTC 4ACPA 4FXGB 1NL0H 1SYVA 3MCLH 4OIIH 3SBWA 5LKNA 1Q9KB 4MWFA 2VDPL 3ZTJH 2X42A 2IPKB 2LE9A 3LN5B 3JV0A 4X6CA 3KLHD 2Z35B 4JFOB 1UH2A 1HNFA 4CU8A 1GHFL 2E9JA 3TP4A 2HKFH 2X4QA 4OZHF 3ZZ1A 5I8KL 1EK3A 1E6OL 3ARFA 5FHAL 2N7BA 2CK0L 2FD6H 3LSOA 2P45B 1P4IH 5FECB 4ZUVB 2VNCA 3CH1B 3FQWB 4YDLC 5GQBA 5CHNB 5MI0C 1ZHNA 3MUY1 3AXLB 2AK4B 1NEUA 1Q9OA 2EC9U 5JR1H 2X2YA 2DTMH 1FC2D 4ODUA 4FFZH 1ZLUK 4E5XB 4TUKH 3RX8A 1T83A 4NN5C 1T0PB 3GMRB 3X3GL 4ZDHB 3F5WA 1AGEA 3QUZA 1PY4A 3DBXA 4YHPA 5DA0B 3TT3H 1AHWB 2DQFA 4WUKH 3GRWL 1DZBA 1MRFH 3ZE2F 4PD4K 3MRQA 5LQBH 3T77A 4JO3H 1IT9L 4BA8A 2VLMD 2JCCA 4LSQH 5DURD 3A6CH 25C8L 1VPOL 3UAJD 4XPBL 1N26A 3MRHB 3RGVB 2OR8A 1WTGT 2IMMA 4Y1AB 1XF5A 2HTLD 3BI9X 3D39A 4PRAB 5F7LB 5IBLD 3DV6A 4L3AA 4TVSa 3CVIH 1DVFC 1AXIB 4KJQC 1CZ8H 1FZMA 3QEGH 4XXDB 3RWDA 4R97C 1A1OB 4C55A 1L7TL 5F1IA 4XNXH 5MENB 4IDJL 3RQ3A 1VFBA 2ZNWA 4NQEA 4CN6A 1RJZB 2PR4L 2VDKL 4GKNA 4MA1C 4G7VL 1IRAY 4OZFA 1UZ6F 3IJSB 4WFFD 1FNEB 1Q0XH 3VG0H 4YBQD 5FK9A 2DB8A 1A9EA 2BERA 3PWUB 2IANE 1XCQB 3VRIB 5DRXA 5DTFB 1HINH 4X7TA 4JAMB 1G7JB 4KK8C 4DVBB 1B3JA 4MVBC 4NQUA 5AAWA 3RPKA 3BE1H 4ZXBC 2NXYB 1ZA3B 5D7JC 4RAHA 2YSSA 3DMMC 4PJ5B 2W38A 3O0RH 5D7SH 1TZGH 3KJ6L 4GLRH 4XPAL 5E0QA 3L7FA 4NNYB 4RFOH 4ODTH 3P0YL 1MCPL 2F19H 4RMUA 4BQ9A 5KSBB 4PB9L 3GSOB 4POZD 3NIDE 5C09E 5EO0A 4PV8B 1TQBB 5E6ZA 4P2YA 5JMRA 4GS7B 3WHE1 2ZNXA 3WNMA 3MJ6A 3PP3H 5I0DA 4JFZH 3BT2L 2VIRB 5T3ZD 1MCNA 1ZAGA 3WD5L 3GO1H 4TTDD 2P8MB 1YUHA 1QBLL 1VENA 5FYJL 1DSFH 1UADC 3BH8A 3F8UB 4ISVB 2F53B 2PCPB 2Y4SA 4KKBD 2A9ML 4CVXB 4L8CA 4A2MA 3JTSA 3C8DA 3SKJH 3KPOB 3TWCL 3S35X 4OD3L 3DURA 3NABH 3V0AC 5LWYH 4EOWL 4MCZB 3TT1H 2Y5TB 3QDGE 1CICB 1JP5A 1LDPH 2VQ1B 4KUZH 3KJ4C 1BD2E 1PKQB 2E7LC 2BZDA 4LDOB 1YN7B 4ZPTA 1N4XH 3RJQB 3TN0C 1CDUA 1QRNE 4CNIA 1ERNA 2D31A 3VFNB 1EHLH 1KNOA 3L3OA 3ARDA 3VXMA 1JPFA 1HHHB 4MAUH 2R0LL 4HX1B 4XCFL 4YXLL 2J7LA 3PL6A 2I26N 3OXSB 2H3NA 5FM8A 1EDQA 3VGAB 5F21B 1N7MH 4O2CA 1SJHB 1KIRB 3CC5A 2F58H 3VG9C 2MJWA 1BQHG 2R15A 2PYEA 3MRNB 5IVZA 1R5VB 4Z7WF 1QSFB 3EOYG 4JRYB 4HT1H 3DGGA 4Z0XB 1BEYH 3NIFF 4X0KB 5ESAB 4JE4B 1T3FA 4H20L 1U42A 1UB6B 4IMKC 1EXUB 1HWHB 1BZQK 2D4DA 1CQKA 5IKCB 1I8MA 4KK9D 3MJ9L 3MYZA 3WV0A 5SX4I 3IETA 4HKJB 3RY4A 4M9PA 4FRWA 3BWUC 1N5YH 2X5PA 1RUMH 4OB5L 1AKJB 2IWGA 4CU7A 4WUUD 5CJBA 3I6KB 4E41E 4PLJD 3U4AA 1KELH 5C08A 2OJZH 3H7BA 4M1GH 5HYQB 1F11A 4FQCL 2I9LA 5AWNH 1OARL 3FT3A 2GSGB 1F3DH 1XAUA 1RJLB 4PJ8B 4RMRA 2HG5B 1WAAF 4HC1A 4YC2C 2E8ZA 5E8NA 4JHAL 3WHXA 4L3EB 4LLMA 4Z7UF 1RK0B 3UTTA 1NC2B 3EYQC 2DBLL 2W0FB 3RU8H 5GGSA 4N1HB 4Z77A 1CDIA 1E27B 1J05B 4RRPG 2HMIC 3DX8A 6FABH 5FOBB 4KRLB 3V0VA 2I5YH 2OCFD 4K8RL 1IGML 4FQ2H 3GIVB 5IW1A 2J5LB 3PIQB 1AR1D 3EYUH 4LMQI 1QA9B 1AI1L 1NCNA 4LSTH 4P5MB 5CBAA 2FLBT 3OKNB 1PG7W 4D3CL 5IIEA 5J57B 3KDMB 4XHJD 3LEVH 4K71B 5F1NA 3BYTA 3BQUC 2Y25A 1LE9B 4Y5XC 2O61B 3SO3B 2DQEL 3HE6D 2V9TA 1PFCA 2VXTL 5EH1A 3T2PA 1N8ZB 3EJZC 3FONA 4IRJB 4HXAL 5SX5K 4AEEA 2WP3O 4FZ8H 2XQYG 1V3LA 3VI3F 4OBSA 4XHQA 4UT6H 3L3GB 3IU4H 3FFDA 2LVCA 5HHVH 2C4XA 1JGUL 3L3DA 3U6RA 2GW5A 3UPAA 1U6AL 3W9EB 3C60C 4JO4L 4QRRB 5D5ME 43CAB 5JOEA 1QLEL 1GGUA 2EKJA 2V9QA 1AD9A 4TULL 1D5IH 3LMJH 5DI8A 5DLML 4Z7WA 3OPZH 2AEQH 3CFDB 3OZ9H 5AAMA 1Y6MR 4LDEB 4L4TD 5HGBA 1NEZB 2PUQT 2Z91A 3CDYA 4GRMB 3D3VA 3EYVB 4PJGE 1P9MC 1XR8B 4UOJA 4XRCB 1BREA 1LILA 1RFDH 1U2CA 3ZL4H 2DF3A 2XY1A 2VXSL 2DQCH 4JDVB 3ILPB 2YMXL 1HH6A 4KVCH 1V7NH 4PG2C 3T3PF 3ESVF 4O2EA 3WCYA 4RWYH 2R69H 4JFDB 1OSZA 1UM4H 4KKAC 3V8CA 4F3FB 5I1CL 3FL7A 3EW3B 3VXTA 4EVNB 3RAJL 1FBIH 2BNQE 4WI4A 1ITBB 1L0QA 1WAAA 1JTPA 1U8LA 3LEYL 1R5IB 2C4FT 1DFBH 3CZJA 4MA7L 3TYFB 2C3HA 4PJCE 4HMCA 4GG6B 3SKOA 4K7PX 3WNLA 2PW2B 3C6LB 3BKCL 4Z7VF 1J86A 2EYRA 5HI5C 4X9HA 1ZVYA 4GKZB 3DVGB 5LBSL 3IF1A 3IJHA 1T5XA 2CGRL 1QSEB 4WEBL 3CFJA 2X10A 3B3IA 4X7SH 1OD7A 4JR9H 4GUPA 3GNML 2VLJA 2DI8A 4NHCH 1KTDB 2NPLX 1SYSB 4Y2DB 5IM7B 3SCMD 2ZCLL 4M61A 1CDBA 1V7ML 5TE4L 2EIDA 1DQLL 1JGEA 1T1ZB 3FOMB 4DFHA 3FRPA 2YKLH 2ZSWB 1K5NA 4N1EA 3S97C 4WFEE 4WU5A 4GBXC 1XF2A 1KCSH 1DVFD 4KJQD 4WHCA 3IDYC 4RGMC 3TA3B 1QR1A 3MRJA 1D5MA 1MFEH 3F7VB 3TM6A 4ETYA 2VDNH 1FGNL 2IAMC 1PYWA 2KZWA 3DROB 3UDWA 1ZHLB 3GMOB 3RPIA 4OIBA 1ZSDB 5BV7C 4U0QB 5I1DA 3TYGH 2QSCH 5DJ0B 4HWZB 4XCEA 2NXZB 4H8WC 4O2FA 3UX9B 2IFGA 1S7SA 2NX5A 4Y19B 2DIAA 4KK8D 3KPRB 4O51A 3BIKA 3TEUA 3MX0A 2R0KL 3PQYE 1JMZA 4UDUB 3AS3A 4WUUA 3PDOA 1I3GH 3QZWB 4LHQB 4PRIE 3VXPB 4Q9BA 3DMMD 5IEHA 4YFDB 5HHQB 1DTUA 3SOBH 3VFVA 3TZVA 4D0BB 2OJEA 2XZQH 3J8F7 4GRLD 3QG6A 4ETQB 3VFRB 1CGSL 5EC1B 2AAVA 3OB0K 4JFHE 2IH1B 3HC4L 4KFZC 2GHWB 1FDLH 2R2BB 5AYUH 4HWNA 5K33A 3NFNB 4OCSH 4YO0B 3EKCA 3T1FB 4D8PA 3BZEB 4ALAH 5T1DL 3LKRB 5GGSY 1FYHB 1WFOA 3ALWA 4XP5L 2AGJH 3ARGC 3VXSB 1QO3B 3P9WB 4R2GD 3I50L 3HNSH 1T7XA 2VQTA 3G6JE 1BQUA 4IOSD 3C5JA 4JO2L 4BM7A 2H9GB 3DUSA 4R7DB 5C07E 2DQHL 1X6NA 4LARH 3U7WL 4PR5B 3QHFH 3LHPH 4V2BA 5IMLA 4HK0B 1PZUB 1CL7I 1FYTD 3MV11 3TO2A 1T80A 4XBEL 4S10A 5FKAB 1A7RL 1OAUH 5CP7A 4JEGB 1Q9WA 4NFCA 1D5XA 5I30H 4UINL 4BELD 3VXQA 5JPMB 4I3GA 1UB5A 4ODWA 4GG8B 3RL1A 2GKIA 3WO3B 5GRYA 5I1IL 2WUCL 1BPVA 3RZCA 3O3UN 3PWJA 5JLZB 1KC5L 3U7YH 1GL4B 5ALCH 1MCJA 4G80A 4JHWH 3ZTNL 1F45A 2DM4A 1CFNA 4HQQL 3RWFA 3MC0A 3WIHL 1NMCB 2X4RB 4M3KB 2QHLA 5C9JB 5EO9B 1F42A 1FNLA 1BBDL 5KJRH 2ZJSL 5C0GB 5J1SC 1YMHB 3BP7A 1JRHH 3CFKB 1CLYL 4FFYL 2DQJH 1N3NA 3S6CA 2VISB 2AV1A 4OM1H 2WK2A 1TITA 5JW3H 4TSAL 3MJGX 5FGCB 3VRLF 4OCNC 5GSRA 3LZFH 1U8MB 2ADFH 4XGZB 3CXDH 1J18A 2IG2H 3HC0A 1JF1B 4QHMB 1CXHA 5GGUA 2EDRA 2VB5A 4YHKL 3DHMA 4IHOA 5GXBB 5D70H 2NY4C 1ZS8B 3GHEL 1MCBA 4OQTA 4BH8B 3NFPA 3GK8H 4HUMB 4UQ3B 2BJML 1M1SA 1IJ9A 3G6AB 4LFHD 4PGZA 5DYOA 4ZAKC 2NY6B 5BO1L 4CVWA 2OMNA 5CWSA 3P11H 1OM3H 5T33H 3CVHA 2COQA 5E9DD 5DMGC 5ICYA 5C3LD 4FQXA 1WIOA 1AQDB 3MZTA 4M4RA 4X98A 3EYQD 2JKXA 4YDVB 2FGWL 4XX1E 3IXTA 2HLFD 2HMID 2FX9H 2R0WL 1ZT1B 3BKJH 3MOAL 4HIIA 1U8OB 4PB0H 1QFOA 4PG9A 4UV7H 1KYOJ 1RUQL 3G5VA 3KLDA 2XWBB 1NGXB 3JV6A 4WEMB 4HH8A 3FQXA 4MZ3A 1NUFA 4WO4D 5DEFA 5IB4B 1OSPL 1J88A 2OZ4H 5IVXB 1ND0A 1MRDL 4PRPD 3MRCA 3BQUD 4XPHH 2Z8WC 2A6IA 4RA0C 2Q6WB 3JUYA 2WBJA 5ACZA 3RUGF 2F54D 2VUOA 3EO9L 1HQ4B 3MTRA 3ORJA 4P46A 1CGXA 4XH2A 2RCSH 4YR6B 5IV2B 3ULUH 1FL5A 5GIRB 3WFEH 3SCMA 3U83A 1JGDA 3WL9A 3SPVB 1DBKH 1R24A 2VDOH 4X6EA 4JFFD 3EJZD 5F44A 5TJWK 4AEFA 4OGYH 3LVEA 4RNRA 3HR5A 3QQ4A 4K3JH 2CDFB 5D6CA 3EO1A 3MRGB 2CD0A 1KCLA 2V2WA 1U92B 3UTOA 5BXFB 4NCC1 4BSVA 4GAYB 4U1LB 5J6GA 5SWZE 4DKEL 3TVMD 4ZSOB 1SQ2N 3MV7E 3GMQB 4U1JB 3MFFB 4NQCB 4R4BB 4HKXA 4ODVL 3B8SA 2LAAA 3RKDD 2ZOKA 1YJDH 3QEUB 4QHLA 1T7YA 4Q6IB 4YHNA 2DM3A 3VFMB 2VJXA 1OAXL 5C0BD 3TNMB 2DYPA 5TH2A 4NYLA 4ZO9A 5CS7A 5EU5A 1EEQA 5I8OH 3O6LH 3BEWA 5CINH 3KPQA 3D6GA 3GSUB 5KS9A 5L7XL 1DEEB 5IBUG 1MFAH 4Y5YB 1IC4H 3O9WC 3U9PL 1HHJB 5JDSB 2FWOA 4PJDE 3VH8G 4ODBD 1I9RL 3DWTA 2L4OA 1UEMA 4JO1H 3GBNH 2R8SH 4L4JA 5EORH 5EU3B 4IMLB 4ENED 1T6WA 3F7PC 5F3BA 3FHAA 3IDMB 3BPNB 4FTVB 5J3HC 1QFWL 4GRLA 4LQFH 3NA9H 3LRSB 5EWIH 4YDJA 1G7IA 1RHHA 1P1ZA 2V7HA 5JW4M 1BOGA 2VDLH 5C0CB 3UYRL 3OJMB 4XP4H 2P8PA 3U0PA 1PKOA 1XZ0A 4P59H 1BIIB 3ZMRA 2VTFA 1MREL 5CSZB 1OAYH 4QNPF 2BVQA 5IQ9A 1DUYB 4CMHB 5GZOC 1TPXB 1NGYB 1P84K 1C1EL 1L7IL 3D69B 3V6OA 2DMBA 5F6IB 1MIEH 4HIXH 4M5ZH 1J8HD 2IBGA 4PRBA 2X1OA 3DRTB 5E2VL 4M62L 4NKIH 2FX8L 4JRXA 3S96B 3KPNB 4Q0XL 1P6AB 4O9HH 1BQHB 4XVUC 5DSCB 3TBSB 5SWSB 2HTKD 1KEML 4MAYC 4H5SB 5AYQA 2N7AA 1LD9A 3S36L 3KHOA 4DAGH 3ESUF 5HPOA 1TCRA 4QO1A 1RIHH 3MGOB 3U30B 5E6IC 3WN5A 1IBGH 1NCAL 4EDXA 3RUGA 5IB1B 3FKUS 1HOCA 3FQNB 4Z7NE 1UG9A 5BJTB 2G5BA 4ELME 2JB5L 1FZOA 2DD8L 2K3TA 4V1DB 2RJMA 5EO1A 2MPAL 4C56D 3WKMH 5JW5A 5CCKH 5E8EA 3KYOB 3RNKA 1T89A 4ZO6A 3DRQA 1I75A 3UJJH 1HXYA 4HG4J 5E24E 2Z93A 2W9LA 3ES6A 5KSAB 4GRWE 2IAMD 3NH7H 5HVHB 4RAUB 4NRYA 3HE7D 3D5OF 4NWTL 5T5FH 4Q9QH 2WWMC 5FYKD 4KI1A 5HHNA 4M7ZC 2DWEB 1PEWA 3E3QC 5ADOH 2Y5EA 3NOIA 1MCWM 2NTSP 3NZHL 5D7LB 5FYLD 3CDFA 1GC1C 1HH9B 2DRUA 3OR7A 4KXZH 1P7QB 5HVGB 5CZXC 4G9FE 4KRPC 2DQTL 5FO7A 5BZWB 4K23L 3MXWL 3UC0L 3RWGB 1BVLB 3R1GH 1D5ZB 4FQJL 4KGJA 1U3YA 5IQ7L 3GKWH 3VJ6B 1WBYA 4KTEH 3CX5K 1A14L 2ED7A 2EDQA 3T8XB 5FDWA 3OKLA 3RGHA 1UC6A 3B6SA 3JWOH 3O3AA 5H37G 1TZIA 2APXA 1U58B 3NACL 3TJHC 4NWUH 4YH6A 1YEKL 2A6KB 1OF2B 3WDHA 3ZDYF 3LQAH 3HI6L 4P9HL 3RWIA 1KFAL 5HY9B 4U1IB 1MLCB 3LKQB 5BRZA 4WO4A 3QO0A 5LXGL 4PRPA 5D7KE 4ZTOH 4F58H 2F54A 4YHOH 4HWBA 3QH3B 3X11B 1FZKB 1ZT4B 5I1AB 5TQ0L 1IKFH 4S1DD 5F9OL 4QRPD 4AYFA 3BP4A 1DQTA 4R97B 1MFCL 4JFFA 4KROC 3UJIH 5C0JA 2CKBH 4JQXA 4YE4L 4K9EL 5KTEL 1J1OH 4MA1B 5EU6A 3RWJA 2D0GA 1H5BA 2JK5B 5L8KB 1UFUA 4QXTA 5C6TL 4LLWB 1S78D 3CK0L 4ZFFB 1MPAL 4L29A 3BGAA 1U0QA 1OGAE 3TVMA 2Q3AA 2R0ZL 3DO3A 5JIIA 3FOLA 1BZ7B 1T5WA 1KULA 4WW2B 4BZYA 3BO8A 4J3XA 4NQSB 3T4AA 4PJFE 1F02I 5D1QA 1ZLWH 1U3HC 1QFUH 4XPFL 2D7TH 2B0SL 4W70A 4XC1H 5H35A 1I3RA 3MUHL 1L0YA 4ZXBB 4JM2B 2XWJA 5D7JB 5E2UH 3QIBA 3BWAA 1H8NA 4PJAB 3BXNA 2I60H 4X80H 1FAIH 4L5FH 4TVPH 1P4LB 3D9AL 5DUBA 1GJIA 1TFHA 2R23A 2VERN 4R96B 3QCVL 1D9KC 1T1XB 1MVUA 2BNRD 4Y4HB 3T2QA 2VLKB 5K9OA 5DC9B 5C8JA 1WSST 2J8OA 2NY4D 3Q6FA 3RA7H 1KJ2A 5E1AA 3DPBA 2EDTA 4AK1A 4LLAA 4Y16D 4MNQD 4BZ1H 5L2KB 5DR5L 4HUXB 1AFVL 4XXCA 4ZAKD 2GIYA 3SGKC 3SJVD 1AY1L 5D7IF 4HF5L 2GT9A 5GS3A 12E8H 4JJ5A 3O4LD 4IIQB 1DUZB 1IC5L 4YHYC 5DMGD 2UWEE 2YBRB 4KPHH 3U4BH 1CXEA 1EAPB 1A4JB 2VC2H 4TPRL 5E8OB 4LLDB 4KMTH 3QG7H 1HKLH 2XTLA 3PXJA 4P5TD 3CU7A 4KV5E 2PTTB 2QV2A 2VWEE 3BP5A 1NFDA 5BS0A 5IWLA 2EDOA 5D2LA 4M8QB 3LQZB 1G6RA 4HUUB 4J6RH 1Z0MA 1XT5A 4KKCC 4UIMA 3D25A 1YC8A 3V7MA 3DUUA 5DQDH 4WDIB 1I9JL 4NQXB 1IGTA 1NSNL 1MCIA 1VEMA 1A3RL 4OLWH 1KIPA 5L6YL 4I9WD 5T3XD 3VG9B 4OT1L 1RMFL 3IVKA 4QOKE 2Y6SD 4U2YA 3GSVA 3SDDA 4DTGH 4OI8A 2CRYA 1FCGA 1AGFA 2DQIH 2AW2A 5T1LD 1KG0B 1KB9K 4OD1H 4XP6L 4FNLL 4U6XB 2A74A 2R29H 1W72B 4ZUSA 1QEWB 2HFTA 1QHOA 2NZ9C 1LO0H 4JVUA 3QI9B 3DIFB 3BVNB 2ITDB 2V7NA 3MACH 3H2WA 2CIKB 3BN9C 3L1OH 4RFNB 3WS3B 4JY6B 3MBEC 2A9NH 4NJ9H 3HE7A 3L6FA 1DN0B