1ZAUA

Adenylation domain of nad+ dependent dna ligase from m.tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
321
structure length
321
Chain Sequence
b'QTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGHVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRAPRWAIAYKYPPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title NAD+-dependent DNA Ligase (Rv3014c) from Mycobacterium tuberculosis: CRYSTAL STRUCTURE OF THE ADENYLATION DOMAIN AND IDENTIFICATION OF NOVEL INHIBITORS
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 61
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1zauA01
3.30.470.90 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1zauA02
3BA8A 5IWAB 2VQEB 1HR0B 4B3MB 4LF4B 4DV2B 4YY3B 4JI6B 4AQYB 4LF6B 4DV6B 4YHHB 2UXCB 1DGSA 1XNRB 1HNZB 5FPRA 2UUBB 5FPOA 3JSNA 4UCOA 2ZM6B 3BABA 4LH7A 5LMUB 1XMOB 4JV5B 4DV4B 2E5LB 1B04A 4DV5B 4GLXA 2F4VB 4KHPB 4TOIA 3T1YB 4CC5A 4UCTA 4JI2B 3UQ8A 4GKKB 1XMQB 1I94B 4UFZA 4DV1B 1N32B 4JI7B 4X62B 4OX9B 4JI8B 1V9PA 4UCRA 4B3SB 2VQFB 4JI0B 4B3RB 2UXDB 4DUYB 4DR6B 4CC6A 4EFEA 4LF9B 4DR7B 1HNWB 4EEQA 3SGIA 4X64B 1HNXB 3BAAA 4X66B 4LF8B 4DV3B 4X65B 4NXMB 4DR1B 5LMNB 4B3TB 1IBKB 1FJGB 2HHHB 1N33B 3OTOB 4UCSA 1N36B 1TA8A 2UU9B 1IBMB 3PN1A 1IBLB 4LFBB 4K0KB 4NXNB 4JI1B 4GLWA 2UUCB 4DV7B 4UCVA 4JYAB 4LFAB 4LH6A 4DR5B 3BACA 4DR2B 1ZAUA 3T1HB 4JI3B 1TAEA 1XNQB 4DV0B 4JI4B 3JSLA 5BR8B 3BA9A 4LFCB 4EFBA 4GKJB 4DUZB 2UXBB 2UUAB 4DR3B 4JI5B 4LF7B 1J5EB 4LF5B 1N34B 4DR4B 4UCUA 2OWOA
chains in the Genus database with same CATH superfamily
1B3QA 4KUMA 1PM9A 4WFEA 1FVIA 3G8CA 5KAIZ 5IJ0A 2GV9A 2ABJA 4LF6B 3OUZA 1SRYA 3JAMN 3JARB 3CCVV 1ULZA 4OX9O 3LDDA 1HNZB 2H94A 2QWRB 4B3RO 1FKAO 3T99A 2ZKOA 1R3IC 2WLLB 1NR7A 3V4ZA 2GQSA 5LMUB 2N04A 3WFVA 4JV5B 3LQSA 1KKCA 4GLXA 4JPRA 3R5HA 2MW2B 1M0TA 4ZHQF 4X66O 1EKVA 5LYJF 2SCUB 3JD3A 1VQ7V 2YYAA 5CM0A 3ZRWA 1Q5OA 2P7TC 3G67A 3T4ZA 3F5TA 5JVDF 5B3SC 2Q68A 4TQDA 2NU9B 4J42A 3ZHSA 4O7TA 5L3CA 2IBZH 4M9UA 4CKBA 1QLNA 1SQXH 1QLEB 2P4VA 3T9BA 4MV9A 1TUEB 1FYJA 1U97A 4ZKIA 4PDMA 4UV8A 3ZRWB 3OGCC 1VP7A 2Q7DA 3DC5A 3E35A 3K9AA 1NQTA 2B5UA 3LNMB 4CH5A 3ORRA 1XDNA 1F7YA 2YZLA 1K97A 1G2WA 3CRMA 4AILC 4J11A 4NTXA 5DN6G 1GSOA 4IWXA 1XQ8A 2KSDA 4FFNA 3H1JH 1AUXA 4GLWA 1KJ9A 3H1IH 1A0GA 2YZMA 1WJZA 2VQEO 3DXRB 2OIEA 3A2FA 1ZAUA 2N05A 3LDCA 2X7RB 3WWHA 1BGYH 5K3WA 4QE9A 4O4JF 2UXCO 2CNUA 3ZJZA 4XDKA 3BA9A 3WB1A 5J2TF 1M4UA 2EJ0A 3OMAB 2K1EA 1BQ0A 3RFCA 1GN2A 1Y76B 1VF6C 1PNKA 3RYFA 4O7NA 4HNVA 1Y4MA 2YRWA 1JQ0A 3SJBC 3ASOC 4J7JA 4MVSA 4MS2A 1NVPB 4HN2A 2Y0PA 3TJTA 5CBHA 2GPSA 3UT5A 5I60A 3KYHC 2OCCC 4I55A 3T9FA 3G71V 1ENVA 1GMGA 4PDLA 2F93B 3FB6C 4JZGA 1I2LA 3ABMC 3OUUA 3P3PA 3TXQA 4H37A 2F1MA 3JALA 2UXDO 3AG1C 2ETNA 5F2VO 3E8HA 2FPPB 2O57A 3L9DA 2E75B 1B04A 2QR4A 1ZWIC 4MV3A 4I9QA 1KJJA 3ABKB 3DC6A 3I5DA 5EIBD 4YIOA 4NXMO 5LMNO 2Q0OC 1K92A 1JLLB 1YHQV 3M7MX 5CA0B 5A2QN 4RWUA 1Y74A 2XTAA 3JALB 3FB5C 2UU9O 3ZHRA 2W6NA 4LNUB 4RQFA 3F7YC 1VIBA 4AI8A 4I4TA 4QSHA 1OZ0A 3N2GB 1Q7YW 3PFFA 1JDEA 5BPFA 2QM4A 2QGNA 2ITDC 2CZGA 1CXZB 4C5AA 5LHIA 4DR2O 1NH2D 2HHHB 4I50A 4WHXA 4JI3O 1GO3F 3MHSC 2NU7B 4CS4A 1Y74B 4MV1A 2Z04A 3NXSA 4OXSA 4QPJA 2CFMA 4L8JA 2IU3A 2HGSA 2Q73A 2WLIB 1A0IA 1XILA 3AG3C 4YJ2A 4X20A 2YC0A 2HVSA 4FM1A 1VQ8V 4O81A 2EIKB 1HR0O 1QQCA 3M99B 1PX2A 1XNQB 2QWOB 1M90W 4JAUA 2YXYA 3LUTB 3QWUA 4EFBA 3HR0A 1D2DA 5L3GA 2IJJA 4MTXA 1Q43A 4DR3B 3JATB 4YJ2B 3HKBA 1KYOF 2W71A 3A0HZ 1HW7A 1XEQA 3RGBA 1I0HA 1VQ6V 4DV2B 1I7FA 1CQJB 4JI6B 4GKKO 3JAWA 2R84A 3TIIA 4AQYB 4YHHB 3HKDA 3LSUA 4UVBA 3K5LA 2QJ1A 4J7KA 3ETGA 3Q4HB 1R6NA 3D3QA 3K06A 1IDSA 4EGQA 1WA8B 4O82A 2YSUB 4FLZA 4PZ8A 3I56V 1F23A 4KHPB 2CTQA 1B6QA 1SERA 2QWNB 2QF7A 1I94B 4JXUA 4IYHA 2WLNA 3BPZA 4O4HA 1HDJA 1KTAA 1R73A 2HKOA 3JASA 2DE0X 5CA0F 2OT5A 3CWBH 3CD6V 4UCRA 4B3SB 2VQFB 3QNEA 3F5WC 4TWKA 4TV9A 4EG0A 4U7OA 4LFBO 5LP6A 1YF2A 3DAAA 4BR6A 3ETHA 3T9CA 2HJFC 4JYAO 2AHYA 1NTZH 3CRRA 3APOA 3Q1KA 1KEEA 4O4HB 3DTUB 3JASB 4Z1VA 1KJ8A 2Q5ZA 1OHHG 2Z3YA 2IH1C 1P7BA 2XAHA 1F4MA 4FK5C 1M93A 1B6RA 1CEZA 2VWKA 2XAQA 1G8MA 1FXVA 2AW9A 2A79B 2EX3A 1UFIA 3R65A 4R6ZA 3G80A 4XZ3B 1BXRA 3CEBA 5D5PA 5LOVF 2YW2A 3T1HB 5L3FA 4L1KA 4LF6O 2YI9A 1VQ9V 5JJNB 1KB9F 2QK4A 2FB5A 1GN6A 3A8TA 3TW7A 2RCVA 3K08A 1EZVH 5LMUO 3AX6A 4JV5O 4HAMA 1D5NA 3U9TA 1J5EB 4DK0A 3SPIA 1VS0A 4O7SA 2QA4V 3OR7C 4UV9A 4DXWA 4C7UA 1YTFB 1EZJA 3ZBHA 1H2NA 5IYZF 4JAAA 3AW8A 2WPDG 5IY5B 2YWVA 2A7WA 5C1OA 1PL4A 3S24A 3RYCA 4H0LB 3LNNA 4J9ZB 3S3XA 4EKWA 4QPKA 3JSNA 1EKPA 5KMGA 3W1GA 2HVKC 1N4CA 5BY1A 1I2KA 4OPHA 1M56C 3JD4A 3T9DA 3J81N 1X4TA 4TOIA 3CCJV 3K5OA 4G28B 5B1AB 5LA6B 4YBZB 3SR2C 3RYCB 2PI4A 4JGSA 4X8AA 1BZKA 1V9PA 3A0BZ 1Q8IA 5KMGB 1Y66A 3IAYA 3N27A 4PBCA 1VQNV 4ZOLB 4GCZA 4F6RA 5EYPB 1KBHA 1HNXO 4JYBA 2CNQA 1OCCB 3GLKA 1MSWD 4DR1B 4NZNA 1Q81W 2L35A 2JDIG 1JOYA 1HWYA 3ZRVA 5EIBC 3SYAA 4J7ZA 3ZIAG 1AJQA 3QFFA 3W7TA 2Q2TA 1H38A 2NN4A 5L3EA 5KX5B 1VKZA 5GONB 1QLEC 4O2BA 1YITV 2ZR2A 4X1YB 2OTJV 2IJIA 2QKSA 1TUBA 2DQ0A 3D3IA 3P30A 5I47A 1PL0A 3E8GA 2ZXWB 2V5AA 2JJ2G 5BMVA 2YRXA 4MTOA 3OD4A 2RQ6A 1N0JA 1G4YB 5IYDO 3JSLA 5BR8B 5KAFZ 2IH3C 3ZMUA 1KUTA 3BCCH 1I5YA 3N2KA 4C5CA 2UUAB 4JI5B 1TUBB 3SPCA 1VMGA 4MVOA 4CMDA 2B1IA 3FAVA 4IWYA 1VF7A 1NTKH 5BMVB 3K79A 3CEIA 3OMNB 4N21A 4YY3O 1R3KC 1S5HC 2E3CA 4JYYA 3N2KB 1XDCA 4FPPA 4PA3A 3RYIB 3TEKA 4NTYA 4D7TA 4BW5A 3CS5A 5CA1B 1FXKB 3OEHG 5KHKA 1I1LA 3ABLB 3KAJA 4ZHQA 1ZL8A 3C3SA 4O4IF 5IYBO 3N8DA 5LA6F 5LYJA 3CC4V 2IJKA 1N32B 2HHHO 3QQMA 3C3TA 1WR2A 1FPOA 1ZX3A 2CE4A 2OLSA 1QR9A 3QVNA 1F4NA 4RAIA 4Z2WA 4FLTA 3K5MA 4ZOLF 4TUYA 2GQRA 4MVZA 3HKEB 1DIKA 1M57C 3AK1A 3BHPA 2YXHA 3L73H 4ZHQB 4K8ZA 1Q86W 1NR1A 3TGUH 1H2KA 2DABA 5BXZA 4O4LA 1FJGB 5C8YF 1TVKA 3TW6A 1XNQO 1IBKO 2PY5A 2B1GA 1GN3A 2RJZA 5JJJB 3DF7A 1RPOA 3GIDA 4F6EA 5DECA 5JVDB 2AHZA 5CB4A 1GSAA 5KA6A 2WYOA 2CUGA 4NXNB 2PTMA 4MV7A 4DR3O 3K9SA 2XT9A 2V7QG 2HHFB 3AG2B 3ZMZA 4U3JA 4LFAB 1E4EA 1YJ9V 1EUDB 3I12A 2DZDA 4O2AB 4DV2O 3B8NA 1OCOB 4YIPA 4AQYO 5E79Z 2W6IG 1YCIA 2FTKA 3WU2Z 3B09A 3RV3A 1AJPA 1CKOA 2A9HA 5J2TA 1P8LA 3IC7A 1NJIW 4YXWG 3VPBA 2XHBA 5JH7A 3Q2OA 4Q4DA 2EIKC 5CA3A 4KHPO 2YI8A 1Q90D 1OV9A 5IWAB 3K59A 2D2CB 4B3MB 1P84F 2HJDA 1SA0A 3IJ4A 2DAAA 4CMFA 1M1KW 1I94O 4NKGB 3EXAA 4O4JB 3AG4B 3DGEA 5AG2A 4KL1A 4DRFA 5J2TB 4B3SO 2VQFO 1R1BA 4HYOA 1OBDA 1L1FA 1XMOB 4NB5A 1G6UA 4DYLA 2RDCA 1RM1C 4RO2A 4CH6A 2H8PC 2DMXA 1AR1B 1E1QG 3TINA 4E4TA 3E83A 1SA0B 3L72H 4CH3A 1Q6IA 4JI2B 3WWIA 1SC5B 4WBNF 4DV1B 3M8AA 4JI8B 2DYRB 3OUSA 1BCCH 4MV4A 1OBGA 2W6MA 3ZHVA 4XYLB 4JI0O 5IYCO 1W93A 3IGAC 3UCSC 3CMEV 1QR8A 1AJNA 1Z5VA 3FYIB 1W0KG 2Q67A 3BAAA 2HVQA 2Q0AA 3SYCA 3U9SA 1LNQA 3SDLA 3ZMTA 1BHAA 5I5VA 4B7EA 3T7AA 1IX9A 1VARA 3T1HO 3DSQA 1B6SA 2FPIB 5LXTF 1ZUQA 4IGGA 3RFRA 1EKFA 1GK9A 3CSXA 5HFLA 1R6TA 5LHGA 4K0KB 5FR9A 4GX2A 4JTCB 4K3AA 3ZRXA 2C2AA 2UUCB 1J5EO 4UXNA 3GVMA 1FAFA 1JCHA 4O2AF 5CAEB 4O83A 2HGXA 4DW0A 3DXRA 1YI2V 1H2SB 5LP6C 4QNHB 4TSFG 4LFCB 2F95B 1UJWB 2KB1A 1NT2B 3MD0A 4E2LA 4DIMA 1LR1A 3O9OA 4ZI7F 2NU6B 3ETEA 1Y76A 3BY6A 3THOA 4FLYA 3UM7A 3R9RA 2RMKB 4FM2A 1N8RW 4LC1A 4YAKB 1AP6A 2CTPA 1H8HG 2Y69B 1GM7A 2JS3A 4QE7A 4UB8Z 3EVKA 4ZIBA 1BQZA 1L8DA 2I8CA 3NBYB 1DGSA 2E76B 3CJHB 2HP8A 1U96A 4TV8F 2UUBB 1FS0G 2HGWA 3CB2A 2R9IA 2GUZB 3FKSG 3W7UA 3L71H 2E5LB 3HBLA 4I0XA 1XL4A 2A3QA 5FL7G 3T2MA 3CCLV 1I7NA 1AI6A 4UVAA 2V1DA 4GX5A 2AXTZ 1KKDA 5DGHA 3VOTA 5IY5C 2PGGA 4DR1O 1D5AA 5CN0A 1KBLA 2HLDG 2LQTA 5EZYF 1Z5WA 1G1XB 1GAXA 2W0XA 2CGNA 2HFEC 4Q4CA 3J7AU 5CA0A 2G38A 1JVMA 4EFEA 2Y4UA 2LGQA 2YIBA 4DR7B 2WLMA 4LNUA 5JWPA 3TY9A 2ZDIA 3CX5F 3E8BA 3HT5A 4I0XB 2BOBC 3N2GA 1BT8A 2X0LA 1NI8A 3LSQA 2CK3G 2OCHA 4TQFA 2ODTX 1WN7A 3J80N 1Q6HA 4HNTA 1VQPV 1JKJB 4TM5A 2NU8B 5EC1C 2FKXA 3B40A 5HBRB 4HBNA 4UCSA 4BIZA 1SQFA 1CE8A 5BR8O 5KHJA 5J2UF 2I80A 3HB9A 1IBLB 3BG5A 1AI7A 2PYLA 1KJQA 1NZ6A 3WB0A 4JI5O 2WLIA 1SF9A 3H9VA 3ZX6A 3DTGA 1XBLA 5B1BB 4ICGA 4DR5O 1QBZA 5H9CA 1FFTB 3X2QB 2WA3A 3TY5A 1TAEA 1KD1W 4X89A 1MG1A 3VQXA 4JI4B 2UXXA 1SQVH 1PP9H 2CH7A 1KJIA 2ZDQA 2Q8VA 4IIJF 1MNGA 1GM8A 4RUEA 2EINB 4GKJB 4PI0A 1V54B 1KU9A 4UB6Z 3JATA 4LF5B 1CQIB 1JPXA 4FIPC 1PKXA 2Q4PA 5A9GA 2OWOA 4X88A 3QO8A 1SETA 5LOVB 4D7SA 1E1RG 2EIMB 3L70H 5BWVA 1BS3A 1EN6A 4MA0A 3PJSK 3W7SA 1N32O 1XNRB 3ASNB 2CH7B 1TGOA 3UO2A 1NVPD 3H01A 3Q4HA 3AK3A 2VWJA 1WA8A 1QNMA 2XAGA 4EB6B 1IVSA 3T9EA 4HZ3A 2Q69A 3P3NA 2NLJC 3ETDA 1B06A 2EULA 1UPGA 2CNVA 4Q6GA 5IYZB 1FJGO 2ZQMA 2YS6A 5KS8A 4O7ZA 4X62O 2P22C 4DUYB 1K4DC 2VQDA 4MV6A 3NC0B 3WG7C 4NXNO 2A0LA 4FFMA 4P9PA 3ZHQA 2GDSA 1BSMA 2BCCH 4LF8B 3ML0A 4DV3B 1KC8W 1Q6UA 3STZC 1RSOA 1VF5B 4FE2A 2GPWA 1SQPH 4IL6Z 3JD0A 1TA8A 3U0ZA 2Y0IA 4WFHA 3CRQA 5BWWA 3MJFA 3GB8B 2COIA 4BIUA 1DV1A 4W4LA 4MTFA 5BWUA 4MW8A 1VQKV 2YICA 3G6BA 4R8CA 4MA5A 1I5XA 2JJ1G 4I55F 1AR4A 1EUCB 3QG5A 4PELA 1RSOB 3AG7A 1SQQH 5E25A 5IWAO 1H2GA 3F7VC 4MT8A 2HJWA 1Z2PX 1EBOA 5JQWA 3NBZB 1E79G 2EIJB 4DV0B 2ZE8A 4ASUG 1QHTA 3JD2A 2R82A 2LGWA 3B2EE 1HP8A 4NZOA 2JEXA 2R72A 2FMLA 3N6RA 1CP9A 5B3SB 2DOSA 2UXBB 2ADQB 3OM3B 3P32A 3SJQC 3CRAA 2QWQB 1XMOO 4FLUA 1LUVA 1H2LA 2Y4RA 4CS2A 1N34B 4IHJF 1KC7A 2KQXA 1PV0A 2GTAA 5BWXA 2M7WA 3KREA 4FFKA 4DV1O 4OGQB 2QDOA 4JI8O 4P9OA 4I4TF 2R87A 1L0NH 3DTFA 5FPOA 1HNZO 2OTLV 2DQ3A 2ZIMA 3ABTA 5GW7A 1V55B 2QE7G 5BWTA 4EQ5A 3TXSA 1ET0A 1WAZA 5DEDA 1F51A 4K8XA 5H5NA 4I50F 1PPJH 2QM7A 3UQ8A 4LP8A 1QU7A 1K5SA 3CMAV 4D6TH 3TK1A 2X0SA 3K03A 2CTWA 2LP7A 5LA6A 3WB2A 4JI7B 2XOKG 5EBWC 1X9NA 2FYUH 1EM1A 4GX1A 1YJNV 1HNWB 4ZOLA 4X64B 3IC9A 4CZZA 2UUCO 3ZN0A 2YZNA 2W70A 5EYPA 1RP3B 1WB7A 2ZE6A 3ASOB 1BHBA 4XBFA 3CPWU 4O4IB 5B5EZ 3SJAC 3MHHC 4X1KA 3FYEB 2DWCA 2OCCB 4GT1A 2QM8A 4J80A 1OJHA 2EJ7A 3ABMB 3JD1A 3ZEDA 1JJOA 1PNLA 5KX5A 3AG1B 4JI1B 3RVZA 3RWRD 5GONA 2C00A 3GWOA 2IM9A 1M9NA 2QSAA 4DV7B 4X1YA 4Q20A 4LH6A 3E22B 1A9XA 3OW2U 4X1KB 1Z2GA 1H2MA 1GKFA 2YEVB 5C8YB 1UC8A 4OPAA 2HEPA 4A5UB 1AROP 3K5HA 5KLVH 3OE7G 1K33A 1I08A 2UUBO 2DWEC 2P06A 5FNVF 3D36A 1GRJA 4HNUA 1FFXB 4M0JA 2JK5C 2E5LO 2FP4B 1IOVA 2IJHA 1AB3A 2HIVA 3ETQA 1ORQC 2QKCA 2WLHA 2XD4A 3L75H 2W6ZA 3U10A 3V4SA 2GHYA 3RUPA 2W6JG 4DV6B 4LWSB 1Y67A 4B7KA 2P4KA 4TV9F 3WWJA 2WWWA 5LP6F 5B66Z 1KQSU 4DRXB 5HNEA 3W7XA 4FLWA 1BL8A 2FPGB 4DR7O 2QWPB 1YTFD 3UO3A 5I5SA 2NR5A 4DV4B 3RYIA 1MOFA 2F4VB 3U54A 3VPDA 3JAKB 2F43G 3AG3B 1R6KA 3CCMV 5CA1A 1FXKA 1Z2NX 1J95A 5CBGA 3T9AA 3VQWA 2ZCEA 5EBLC 4WBNA 4FLXA 4FLVA 3GJXB 3RTXA 3JZIA 2EZOA 2JEUA 2PZSA 4KXRA 2WAMA 4PI2A 4DR6B 4CC6A 1IBLO 3R23A 1QCEA 2PI5A 5H6RA 2EILB 3JZ6A 1OCZB 3HKEA 1K8AW 1R3JC 3OAAG 5JQGB 2JIZG 2PN1A 1SQBH 4WBNB 4Z1MG 4HNAB 1XOUA 3MWEA 2QEXV 4JTDB 1K3EA 1N36B 2EBOA 4WFFA 1GH6A 4JI4O 3CC7V 4NYKA 1P7GA 5LXTA 4FFRA 4O7RA 2ZR3A 5E1AC 5IE9A 5JVDA 4DK1A 4GKJO 3ABKC 3JYCA 2EJ3A 2I87A 4R7CA 3RBZA 4U7NA 4LF5O 3U11A 3AEIA 2HHFA 2PF4E 4G2KA 1VQLV 5B1NA 4O2AA 3FFQA 4K35A 3G4SV 1I1KA 3R5XA 5LXTB 2ZDIC 1KECA 1XNRO 5CR5A 1BMFG 4PJ0Z 4JYCA 2Q9LA 3JRXA 3HKCB 1SCUB 2NNUA 3ORQA 1YVWA 3FD9A 4ZQIA 3EFFK 3MDSA 1YSCA 3ZMSA 2D3OW 4PDVA 4BW9A 3ZN1A 1JMKC 3MWDA 2CTRA 3JRWA 4JI6O 4U3FH 4YHHO 2EINC 2BSKB 4RQEA 4O4JA 1QVGU 1V54C 4TV8A 2F23A 2OYQA 4DUYO 2Q2UA 2Z5UA 4ZI7B 1AUVA 2PVPA 5I5YA 2W6QA 2ZNJA 4KFMA 4O86A 1K4CC 2ZIOA 3S3WA 3ETJA 4DQNA 2EIMC 3E2EA 4LF8O 3A0RA 4ABMA 3GB7C 4H13B 5HV6A 1VQOV 4DV3O 1I7LA 2CDYA 1XMQB 1WRVA 2WSSG 2KG7B 1CKMA 3CRCA 4ME6A 1GM9A 4TV8B 5EZYA 5K1PA 1X59A 3K0GA 2PBZA 4UUGA 3CCSV 3ZHTA 3I55V 4LBEC 1SESA 2IP4A 5ITZB 5GTIZ 3TIGA 4XDLA 3NR7A 3ZRSA 5JQGF 4X65B 2UXNA 3SPGA 3B77A 3GDEA 4MV8A 4B3TB 4YB8B 4J41A 1CPYA 1XI1A 1SKVA 1O9HA 4MAMA 4CHIA 2P67A 3OTOB 4DV0O 5EZYB 3D8CA 5FLXN 2ODMA 1IBMB 3PN1A 1AI5A 5KA5A 1S5LZ 4YJ3F 2R85A 2W0FC 2E74B 1P16A 1N34O 4DW1A 1YDXA 1M56B 3RYHB 3KG2A 1VBGA 2WA4A 1KP2A 3HPLC 4X1IA 3AK2A 1S0VA 1IZ3A 5D5QA 1EHIA 4KP4A 1CS0A 3RW0A 5J2UB 5BPHA 2DJVA 2CGOA 3JCZA 1YEWA 1RFYA 2JGDA 4IIJA 3CCQV 4LF7B 5BWRA 2N74A 1FD9A 3APQA 3TETA 1Z2OX 3STLC 4TT3G 2YS8A 3K0DA 2DN9A 2EIJC 5IJ0B 3OR6C 3ZHUA 4LF4B 4X1IB 2BTOA 2IU0A 2HDKA 3E8FA 1CKNA 4RCNA 4JI7O 4LCUC 2WLJA 4TUYF 3CJHA 2Q7GA 5KKNB 2NUAB 3E86A 4MVQA 2RN9A 1A3GA 1UC9A 3UFXB 1DTOA 2GSMB 1IURA 2JGDB 4R50A 4IIJB 3UYYA 1IXBA 2ZE7A 5H80A 4LH7A 2QTOA 1HNWO 1GGOA 4L87A 4PA9A 1OCRB 2GUZA 4X64O 4JZ2A 2W6OA 5GTHZ 3SPHA 4X9QA 2LW7A 4O4LF 1NU1H 1DAAA 3T1YB 3VNNA 2EZPA 3T1CA 3QO5A 1VQMV 4I5SA 1CKNB 5CB4F 3KKYA 3NUAA 1LUWA 5DGIA 2MK3A 2R7NA 1V55C 1NH2B 4LF9B 3CCUV 4H44B 2EIYA 4JI1O 1HNXB 3O65A 4FZ0A 3RT3C 4DV7O 1XHZA 2B9ZA 1EN5A 1JDBB 1N33B 4LR3A 4MVMA 2A06H 3ZS8C 5JH7F 1ZTEA 2BE3A 2YUAA 3VMMA 5CBFA 2LFRA 1DK1A 1BNCA 5IDJA 4UCVA 5B1AC 1A32A 3RV4A 3VQYA 1SZXA 1M5IA 5BZBA 3VBBA 4GUNA 4PA4A 3K57A 5DAAA 2HG5C 2R9RB 4QJFB 2EJRA 4O7WA 1MABG 4DV6O 2QKAA 1QVFU 1P4RA 1K5QA 1C3OA 2P6JA 1H8EG 3RYFB 2VR1A 1WP8A 2R9AA 5KUKA 4PV1B 4DUZB 4JTAB 1XUQA 2UUAO 4DV4O 1OCCC 2DW4A 2F4VO 4WFBV 1M6VA 4UCUA 2AGAA 3UT5B 1M57B 3BA8A 1YJWV 5EC2C 4I55B 4FFPA 4EGJA 1R3LC 4JASA 4IHJA 5L3DA 4YY3B 4MVUA 5LOVA 1WNSA 1KUQA 1MZEA 3LP8A 1VQ5V 5JVLA 2ILMA 4FGRA 1ZLZA 2X6CA 2AZ0A 2LFSA 4Y8VB 2XUMA 1WLEA 1N0NA 3SYPA 4DR6O 5LL6Y 4JF3A 2ZM6B 5L3BA 3UZBA 4DV5B 2X6AA 4FU0A 1VQ4V 2ZXWC 5HFMA 1PK8A 4EB6A 4IHJB 4CC5A 3KALA 1S72V 2R70A 3VOUA 3CCEV 4HQ6A 4UFZA 1L0LH 1IYDA 1MSDA 1VBHA 5IYZA 3D36C 2R7MA 1N36O 2HVRA 3E5NA 3B8MA 1GSHA 4BIOA 4I4TB 2Y48A 4MW3A 4EEQA 2LW1A 4MTGA 1DV2A 4I7ZB 1K73W 2ATKC 2QB5A 2P5OA 5I5WA 3OTFA 5JCOA 4I50B 1IBKB 2V59A 3QF7A 4CKCA 5IT9N 4FJCC 4GYCB 4DLKA 1EFRG 1XHXA 1K7DA 3RN4A 2EILC 1OCZC 2GBOA 4BAYA 4X20B 1KMIZ 4FZ1A 4RUFA 1FXKC 3LDEA 3ABLC 3LWBA 1RM1B 3VQVA 5EK0A 4LFAO 1K34A 2DYSB 2YIBD 4K6NA 4E4EA 2PYJA 3UKMA 4NTWA 5B1OA 3R5FA 4FM0A 3HKBB 3CXHF 2GTSA 1WPXA 2R7LA 4PA7A 2CAZC 5FNVA 1EYZA 4DR4B 3TY8A 2DWDC 5D1OA 3JAWB 1GTOA 3K3WA 2A1HA 3HKDB 1DF5A 3ABUA 4B3MO 1XMQO 2WLKA 3MAQA 1AP5A 4CKEA 2HVJC 1IXMA 4UUJC 2COGA 1NTMH 5BYAA 2XAFA 2EJ2A 2HG8A 2P0AA 2ZGIA 1IOWA 2M6YA 3BRCA 4UCOA 2FL4A 2FB9A 3G8DA 3BABA 5FNVB 2BOCC 3AG2C 2H3OA 2KKWA 2YXLA 1M0WA 1AR5A 4IT5A 2XASA 5H2FZ 2XCLA 4QIWF 5D1OB 2DLNA 5C1PA 1OCOC 4UCTA 2YIAA 4X65O 3VPCA 3K5NA 4B3TO 2F66C 4JI2O 4FFBA 5DM6V 1JX9A 3QTCA 1Q3EA 4OX9B 4IZOA 3OTOO 4TV9B 1JR9A 2ADPA 2QTSA 5LP6B 1IBMO 4JI0B 4B3RB 4O84A 3ICXA 4NYEA 2XNDG 4O7YA 4TVIA 4XYMB 3SYQA 5LGUA 4XDJA 2ITCC 4X66B 4H33A 2YS7A 1WB8A 1MZFA 1VF6A 4GZRB 4C5BA 5C93A 1C30A 2HIXA 4FFBB 4PZ6A 2V4DA 3AG4C 1MMMA 3CP1A 2R86A 4PHZA 4O4IA 5I5TA 1WPBA 1RPRA 2K9PA 1W2BU 4YJ2F 3WO1A 4K0KO 2ZDHA 4LF7O 2P90A 3OMIB 1YZBA 1S68A 1COWG 4CH4A 2HR3A 4HR7A 3JZFA 4LF4O 3E22A 5EBMC 2ZE5A 2DYRC 1NKDA 5J9PC 1A48A 1GN4A 5KHHA 2YEVA 5C8YA 3UZOA 2X6BA 5BYBA 4E6NA 1URFA 1MA1A 3CYOA 4LFCO 2ZINA 2L6LA 5D1PA 2YL2A 3C90A 2ARHA 1KT8A 1FFXA 4CBCA 2Q7HA 4PD4F 2AZ2A 2VQEB 3T1YO 1WP7A 4F4LA 2OIGA 3L2PA 2UXCB 3JCUZ 3T54A 2ZNIA 1GLVA 3U0GA 2ZD9A 4LWSA 3RVYA 3ZMVA 3GWKC 4LF9O 4DRXA 2JVDA 5TISZ 4FMTA 4RZQA 1P49A 4BWAA 4I9WA 5LGTA 2Y4TA 3JAKA 1PD3A 5KUMA 2JS5A 4O4HF 4J9YB 1S3JA 4CE5A 4JAVA 3K3PA 3TQTA 1EZ1A 1W0JG 3KZIZ 1N33O 1IYEA 4GX0A 1S76D 1NS1A 1Q82W 2UXDB 3SYOA 3KCYA 3WNZA 4F6RB 1Y6XA 1OCRC 1AVMA 2Y69C 4MVRA 2Q6AA 1BE3H 4P30A 1PNMA 3R66A 1T36A 2W6PA 3W5OA 4NXMB 3K5IA 5H6QA 5LMNB 5JQGA 4PDRA 3KAKA 1O9GA 4PZ7A 1ZSPA 4W4KA 3CE2A 3TCUA 1FXHA 2RNBA 3OEEG 2BTQA 4HNAA 2UU9B 3OGIB 4WFAV 4G27B 2XAJA 4O2BB 5KHGA 2GLTA 4DUZO 1VEWA 1T5EA 4YJ3A 4WF9V 5JJEB 4DR5B 3BACA 1AI4A 2JRIA 2ZDGA 4DR2B 4JI3B 1XL6A 2BTQB 3IFXA 3FB8C 5CMUA 1K9MW 3VA7A 2VPQA 1W59A 2ZT9B 3OT7A 3U55A 2ZM6O 5DISC 3HKCA 4O7LA 5CE8A 2DIKA 4YJ3B 4DV5O 1THZA 1JFFA 3FAVB 3WG7B 3W1BA 1SQGA 2J9GA 3CSWA 5LHHA 1HR0B 3SNOA 4IYIA 3E89A 1I1MA 3G6EV 4AHCA 5D8DA 3T4DA 5LBQA 3LULA 5FPRA 3CCRV 1XK5A 2Z02A 2BSKA 3ZCCA 3LSSA 4NR1A 3CHXA 3CXCU 2Z0AA 2X5RA 1JFFB 4ZI7A 3L74H 4DAAA 3OFNG 1ZL8B 5B1BC 3HB3B 3X2QC 5LYJB 4GKKB 4B08A 5K1XA 3FB7C 4X62B 2IW5A 4ZBMA 1YIJV 3BFRA 2KG7A 4TUYB 3KCXA 5KX5F 5DMXA 4O7VA 5GONF 1EN4A 3B4SA 2YZGA 5K2MA 1SZTA 3SGIA 1JJ2U 3QO7A 1ROPA 4WFGA 2VUGA 5ITZA 4UVCA 3RR5A 1KP3A 3H1KH 4O4LB 4J10A 1TVKB 2VS0A 3ASNC 4CS3A 2COJA 4NZMA 5CB4B 1DLBA 3W7WA 3WO0A 2R7KA 5IJ9A 3H1LH 4LFBB 3SPJA 3HO8A 4O2BF 2V58A 5KHIA 3BVOA 1US6A 2YIDA 4U3JB 2LO1A 4NVPA 5I5XA 5LGNA 1E4EB 1YXBA 1AILA 4MSWC 4JYAB 2JGUA 4N23A 4DR4O 3BEHA 3SJCC 4XX0B 4FVMA 2YDEA 3K58A 4FFOA 2Q7EA 5BMVF 3H1HH 3SE7A 2VRZA 3RYHA 3EHBB 1XREA 3CC2V 3K04A 5I5UA 3JARA 4P2ZA 5IJ9B 1S5JA 4DO2A 2LJ2A 4PA6A 2PUSA 1SS3A 3FX7A 1W96A 4YAJB 1NBMG 5JH7B 2WLLA 5J2UA 1JA8A 5JCOC 3OUFA 2UXBO 4FFLA 1DF4A 4QGPA 4WCEV 5CA1F 1S77D 2DYSC
chains in the Genus database with same CATH topology
3BA8A 4I55B 4IWYA 1VF7A 4IHJA 4YY3B 5BWXA 5BMVB 5IJ0A 2GV9A 2ABJA 5LOVA 1WNSA 4LF6B 2E3CA 3JARB 1HNZB 3DTFA 3N2KB 5FPOA 3T99A 2ZIMA 3RYIB 2ZM6B 5LMUB 3TEKA 4JV5B 4D7TA 3UZBA 3LQSA 4DV5B 4GLXA 5BWTA 1ET0A 5CA1B 5KHKA 4K8XA 1I1LA 4EB6A 4IHJB 4ZHQA 1EKVA 4CC5A 2R70A 3UQ8A 5CM0A 4UFZA 5LYJA 1N32B 1IYDA 1Q5OA 3QQMA 4JI7B 5LA6A 3WB2A 5IYZA 4I4TB 4TQDA 4FLTA 3K5MA 4TUYA 1HNWB 4EEQA 3HKEB 4ZOLA 4X64B 4CKBA 3BHPA 3T9BA 4ZHQB 4K8ZA 2P5OA 2QB5A 5I5WA 5EYPA 3OTFA 5JCOA 4I50B 4O4IB 2DABA 3SJAC 2Q7DA 1IBKB 4O4LA 1FJGB 3QF7A 4X1KA 1TVKA 4CKCA 2PY5A 4GYCB 2RJZA 4CH5A 5JJJB 1XHXA 5JVDB 5CB4A 1G2WA 4AILC 3ZEDA 1JJOA 4X20B 1KMIZ 4NXNB 2PTMA 5KX5A 4IWXA 4JI1B 3RWRD 1XQ8A 5GONA 2IM9A 4GLWA 2HHFB 4DV7B 4X1YA 4U3JA 1A0GA 4LFAB 4LH6A 3VQVA 3E22B 4O2AB 3A2FA 3WWHA 1ZAUA 2YIBD 4X1KB 4K6NA 5K3WA 5C8YB 1UC8A 2HEPA 2PYJA 3WB1A 3BA9A 1M4UA 2EJ0A 4FM0A 5J2TA 3HKBB 3RYFA 1FFXB 2XHBA 2CAZC 5FNVA 5JH7A 4M0JA 4Q4DA 3SJBC 3ETQA 4DR4B 2YI8A 4HN2A 5IWAB 3K59A 3JAWB 3U10A 4B3MB 3UT5A 5I60A 2A1HA 1SA0A 3HKDB 2DAAA 4I55A 3T9FA 4CMFA 4CKEA 3MAQA 4DV6B 4O4JB 2F93B 2COGA 5BYAA 3WWJA 4KL1A 1I2LA 2EJ2A 2HG8A 2ZGIA 5J2TB 2F1MA 3JALA 3BRCA 4UCOA 4DRXB 5HNEA 4FLWA 3BABA 5FNVB 5I5SA 1XMOB 4DV4B 1G6UA 2KKWA 2YXLA 1B04A 3RYIA 2F4VB 3VPDA 3JAKB 4I9QA 4CH6A 1SA0B 5EIBD 4CH3A 5CA1A 4UCTA 2YIAA 4JI2B 3WWIA 3K5NA 2F66C 4DV1B 4FFBA 3T9AA 3VQWA 2ZCEA 3QTCA 4WBNA 4FLXA 1Q3EA 4FLVA 3M7MX 4OX9B 5CA0B 4JI8B 3UT5B 4TV9B 2PZSA 3JALB 5LP6B 4JI0B 4B3RB 4LNUB 4PI2A 4DR6B 3ICXA 4CC6A 4I4TA 4TVIA 3N2GB 1Z5VA 3PFFA 3JZ6A 3BAAA 3HKEA 4X66B 2Q0AA 2QM4A 5JQGB 5I5VA 4FFBB 2V4DA 3T7AA 4WBNB 3DSQA 2HHHB 4I50A 4WHXA 4HNAB 4PHZA 4O4IA 4CS4A 5I5TA 1N36B 1WPBA 3RFRA 1EKFA 5LXTA 3CSXA 4L8JA 5JVDA 5FR9A 4K0KB 4DK1A 4YJ2A 2EJ3A 4X20A 2UUCB 3U11A 4FM1A 2HHFA 4CH4A 1QQCA 3E22A 2HGXA 1XNQB 4O2AA 3FFQA 1I1KA 1H2SB 5LP6C 5KHHA 5LXTB 5C8YA 5CR5A 3UZOA 4LFCB 5BYBA 4EFBA 2F95B 3HKCB 1NT2B 2ZINA 1Q43A 4DR3B 3JATB 4YJ2B 3HKBA 3THOA 4FLYA 1KT8A 1FFXA 1HW7A 4FM2A 3RGBA 2Q7HA 4BW9A 2VQEB 1JMKC 4DV2B 1I7FA 4ZIBA 4JI6B 1L8DA 3JAWA 4AQYB 4YHHB 3HKDA 2UXCB 1DGSA 3T54A 2ZNIA 3U0GA 3K5LA 2QJ1A 4O4JA 2UUBB 4TV8A 2HGWA 3CB2A 2OYQA 4ZI7B 5I5YA 4DRXA 2JVDA 4FLZA 2ZNJA 2E5LB 2ZIOA 4KHPB 4DQNA 1P49A 4BWAA 3JAKA 5DGHA 2JS5A 2PGGA 1XMQB 1D5AA 4CE5A 1I94B 1WRVA 4JXUA 3BPZA 4O4HA 1IYEA 1KTAA 3JASA 1Z5WA 4TV8B 5EZYA 4UCRA 4Q4CA 5K1PA 5CA0A 4B3SB 2VQFB 2UXDB 4TV9A 4UUGA 4F6RB 4EFEA 5LP6A 4DR7B 2YIBA 4LNUA 3HT5A 3DAAA 5ITZB 3N2GA 3T9CA 4TQFA 4X65B 2ODTX 1WN7A 4NXMB 5LMNB 5JQGA 4B3TB 1XI1A 1O9GA 4O4HB 4TM5A 3JASB 1SKVA 1O9HA 4CHIA 3OTOB 4HBNA 4UCSA 5EZYB 1SQFA 2BTQA 4HNAA 2UU9B 1M93A 3PN1A 1IBMB 5KHJA 2VWKA 1IBLB 2PYLA 4O2BB 5KHGA 2EX3A 1T5EA 3WB0A 3DTGA 4YJ3A 5JJEB 3CEBA 5D5PA 4DR5B 3BACA 3RYHB 4DR2B 3T1HB 4JI3B 4X1IA 1TAEA 2YI9A 2BTQB 3VQXA 5JJNB 4JI4B 5D5QA 3TW7A 5J2UB 1YEWA 4GKJB 4PI0A 4IIJA 1KU9A 3HKCA 4LF7B 5BWRA 5CE8A 4YJ3B 3JATA 1J5EB 4DK0A 4LF5B 1JFFA 1SQGA 2OWOA 5IJ0B 3CSWA 1HR0B 5LOVB 4D7SA 4LF4B 3SNOA 4X1IB 2BTOA 5BWVA 2HDKA 4RCNA 1I1MA 1XNRB 4AHCA 3RYCA 3LNNA 3LULA 2Q7GA 1TGOA 5FPRA 1A3GA 1UC9A 3JSNA 1EKPA 5KMGA 3CHXA 4IIJB 3UYYA 4LH7A 2X5RA 1I2KA 2VWJA 1JFFB 4ZI7A 3T9EA 4EB6B 4DAAA 3T9DA 1X4TA 4TOIA 1DAAA 3K5OA 5LYJB 3T1YB 4GKKB 4Q6GA 5LA6B 4B08A 5K1XA 3SR2C 5IYZB 3RYCB 4X62B 5KS8A 5DGIA 1V9PA 1Q8IA 4TUYB 5KMGB 3IAYA 4PBCA 2P22C 4DUYB 4ZOLB 4LF9B 5K2MA 4F6RA 3SGIA 2EIYA 1HNXB 5EYPB 4LF8B 5ITZA 1XHZA 4DV3B 4O4LB 4DR1B 4NZNA 1TVKB 1RSOA 1N33B 4CS3A 5EIBC 2COJA 4NZMA 5CB4B 1TA8A 4LR3A 3U0ZA 3ZS8C 5IJ9A 4LFBB 5BWWA 5KX5B 5KHIA 5GONB 2COIA 4O2BA 5BWUA 4X1YB 4NVPA 4U3JB 5I5XA 1TUBA 4UCVA 4JYAB 2JGUA 5I47A 3SJCC 3VQYA 4FVMA 3QG5A 1M5IA 3K58A 5E25A 3K57A 2Q7EA 5DAAA 3RYHA 5BMVA 4DV0B 1QHTA 2RQ6A 5I5UA 3JSLA 5BR8B 3JARA 5IJ9B 1S5JA 2PUSA 3B2EE 4NZOA 3RYFB 2R72A 2R9AA 3N2KA 5JH7B 4DUZB 2UXBB 5J2UA 2UUAB 4JI5B 5JCOC 1TUBB 4FLUA 4CMDA 2Y4RA 4CS2A 1N34B 4UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BA8 A;  5IWA B;  2VQE B;  1HR0 B;  4B3M B;  4LF4 B;  4DV2 B;  4YY3 B;  4JI6 B;  4AQY B;  4LF6 B;  4DV6 B;  4YHH B;  2UXC B;  1DGS A;  1XNR B;  1HNZ B;  5FPR A;  2UUB B;  5FPO A;  3JSN A;  4UCO A;  2ZM6 B;  3BAB A;  4LH7 A;  5LMU B;  1XMO B;  4JV5 B;  4DV4 B;  2E5L B;  1B04 A;  4DV5 B;  4GLX A;  2F4V B;  4KHP B;  4TOI A;  3T1Y B;  4CC5 A;  4UCT A;  4JI2 B;  3UQ8 A;  4GKK B;  1XMQ B;  1I94 B;  4UFZ A;  4DV1 B;  1N32 B;  4JI7 B;  4X62 B;  4OX9 B;  4JI8 B;  1V9P A;  4UCR A;  4B3S B;  2VQF B;  4JI0 B;  4B3R B;  2UXD B;  4DUY B;  4DR6 B;  4CC6 A;  4EFE A;  4LF9 B;  4DR7 B;  1HNW B;  4EEQ A;  3SGI A;  4X64 B;  1HNX B;  3BAA A;  4X66 B;  4LF8 B;  4DV3 B;  4X65 B;  4NXM B;  4DR1 B;  5LMN B;  4B3T B;  1IBK B;  1FJG B;  2HHH B;  1N33 B;  3OTO B;  4UCS A;  1N36 B;  1TA8 A;  2UU9 B;  1IBM B;  3PN1 A;  1IBL B;  4LFB B;  4K0K B;  4NXN B;  4JI1 B;  4GLW A;  2UUC B;  4DV7 B;  4UCV A;  4JYA B;  4LFA B;  4LH6 A;  4DR5 B;  3BAC A;  4DR2 B;  1ZAU A;  3T1H B;  4JI3 B;  1TAE A;  1XNQ B;  4DV0 B;  4JI4 B;  3JSL A;  5BR8 B;  3BA9 A;  4LFC B;  4EFB A;  4GKJ B;  4DUZ B;  2UXB B;  2UUA B;  4DR3 B;  4JI5 B;  4LF7 B;  1J5E B;  4LF5 B;  1N34 B;  4DR4 B;  4UCU A;  2OWO A; 
#chains in the Genus database with same CATH topology
 1B3Q A;  4KUM A;  1PM9 A;  4WFE A;  1FVI A;  3G8C A;  5KAI Z;  5IJ0 A;  2GV9 A;  2ABJ A;  4LF6 B;  3OUZ A;  1SRY A;  3JAM N;  3JAR B;  3CCV V;  1ULZ A;  4OX9 O;  3LDD A;  1HNZ B;  2H94 A;  2QWR B;  4B3R O;  1FKA O;  3T99 A;  2ZKO A;  1R3I C;  2WLL B;  1NR7 A;  3V4Z A;  2GQS A;  5LMU B;  2N04 A;  3WFV A;  4JV5 B;  3LQS A;  1KKC A;  4GLX A;  4JPR A;  3R5H A;  2MW2 B;  1M0T A;  4ZHQ F;  4X66 O;  1EKV A;  5LYJ F;  2SCU B;  3JD3 A;  1VQ7 V;  2YYA A;  5CM0 A;  3ZRW A;  1Q5O A;  2P7T C;  3G67 A;  3T4Z A;  3F5T A;  5JVD F;  5B3S C;  2Q68 A;  4TQD A;  2NU9 B;  4J42 A;  3ZHS A;  4O7T A;  5L3C A;  2IBZ H;  4M9U A;  4CKB A;  1QLN A;  1SQX H;  1QLE B;  2P4V A;  3T9B A;  4MV9 A;  1TUE B;  1FYJ A;  1U97 A;  4ZKI A;  4PDM A;  4UV8 A;  3ZRW B;  3OGC C;  1VP7 A;  2Q7D A;  3DC5 A;  3E35 A;  3K9A A;  1NQT A;  2B5U A;  3LNM B;  4CH5 A;  3ORR A;  1XDN A;  1F7Y A;  2YZL A;  1K97 A;  1G2W A;  3CRM A;  4AIL C;  4J11 A;  4NTX A;  5DN6 G;  1GSO A;  4IWX A;  1XQ8 A;  2KSD A;  4FFN A;  3H1J H;  1AUX A;  4GLW A;  1KJ9 A;  3H1I H;  1A0G A;  2YZM A;  1WJZ A;  2VQE O;  3DXR B;  2OIE A;  3A2F A;  1ZAU A;  2N05 A;  3LDC A;  2X7R B;  3WWH A;  1BGY H;  5K3W A;  4QE9 A;  4O4J F;  2UXC O;  2CNU A;  3ZJZ A;  4XDK A;  3BA9 A;  3WB1 A;  5J2T F;  1M4U A;  2EJ0 A;  3OMA B;  2K1E A;  1BQ0 A;  3RFC A;  1GN2 A;  1Y76 B;  1VF6 C;  1PNK A;  3RYF A;  4O7N A;  4HNV A;  1Y4M A;  2YRW A;  1JQ0 A;  3SJB C;  3ASO C;  4J7J A;  4MVS A;  4MS2 A;  1NVP B;  4HN2 A;  2Y0P A;  3TJT A;  5CBH A;  2GPS A;  3UT5 A;  5I60 A;  3KYH C;  2OCC C;  4I55 A;  3T9F A;  3G71 V;  1ENV A;  1GMG A;  4PDL A;  2F93 B;  3FB6 C;  4JZG A;  1I2L A;  3ABM C;  3OUU A;  3P3P A;  3TXQ A;  4H37 A;  2F1M A;  3JAL A;  2UXD O;  3AG1 C;  2ETN A;  5F2V O;  3E8H A;  2FPP B;  2O57 A;  3L9D A;  2E75 B;  1B04 A;  2QR4 A;  1ZWI C;  4MV3 A;  4I9Q A;  1KJJ A;  3ABK B;  3DC6 A;  3I5D A;  5EIB D;  4YIO A;  4NXM O;  5LMN O;  2Q0O C;  1K92 A;  1JLL B;  1YHQ V;  3M7M X;  5CA0 B;  5A2Q N;  4RWU A;  1Y74 A;  2XTA A;  3JAL B;  3FB5 C;  2UU9 O;  3ZHR A;  2W6N A;  4LNU B;  4RQF A;  3F7Y C;  1VIB A;  4AI8 A;  4I4T A;  4QSH A;  1OZ0 A;  3N2G B;  1Q7Y W;  3PFF A;  1JDE A;  5BPF A;  2QM4 A;  2QGN A;  2ITD C;  2CZG A;  1CXZ B;  4C5A A;  5LHI A;  4DR2 O;  1NH2 D;  2HHH B;  4I50 A;  4WHX A;  4JI3 O;  1GO3 F;  3MHS C;  2NU7 B;  4CS4 A;  1Y74 B;  4MV1 A;  2Z04 A;  3NXS A;  4OXS A;  4QPJ A;  2CFM A;  4L8J A;  2IU3 A;  2HGS A;  2Q73 A;  2WLI B;  1A0I A;  1XIL A;  3AG3 C;  4YJ2 A;  4X20 A;  2YC0 A;  2HVS A;  4FM1 A;  1VQ8 V;  4O81 A;  2EIK B;  1HR0 O;  1QQC A;  3M99 B;  1PX2 A;  1XNQ B;  2QWO B;  1M90 W;  4JAU A;  2YXY A;  3LUT B;  3QWU A;  4EFB A;  3HR0 A;  1D2D A;  5L3G A;  2IJJ A;  4MTX A;  1Q43 A;  4DR3 B;  3JAT B;  4YJ2 B;  3HKB A;  1KYO F;  2W71 A;  3A0H Z;  1HW7 A;  1XEQ A;  3RGB A;  1I0H A;  1VQ6 V;  4DV2 B;  1I7F A;  1CQJ B;  4JI6 B;  4GKK O;  3JAW A;  2R84 A;  3TII A;  4AQY B;  4YHH B;  3HKD A;  3LSU A;  4UVB A;  3K5L A;  2QJ1 A;  4J7K A;  3ETG A;  3Q4H B;  1R6N A;  3D3Q A;  3K06 A;  1IDS A;  4EGQ A;  1WA8 B;  4O82 A;  2YSU B;  4FLZ A;  4PZ8 A;  3I56 V;  1F23 A;  4KHP B;  2CTQ A;  1B6Q A;  1SER A;  2QWN B;  2QF7 A;  1I94 B;  4JXU A;  4IYH A;  2WLN A;  3BPZ A;  4O4H A;  1HDJ A;  1KTA A;  1R73 A;  2HKO A;  3JAS A;  2DE0 X;  5CA0 F;  2OT5 A;  3CWB H;  3CD6 V;  4UCR A;  4B3S B;  2VQF B;  3QNE A;  3F5W C;  4TWK A;  4TV9 A;  4EG0 A;  4U7O A;  4LFB O;  5LP6 A;  1YF2 A;  3DAA A;  4BR6 A;  3ETH A;  3T9C A;  2HJF C;  4JYA O;  2AHY A;  1NTZ H;  3CRR A;  3APO A;  3Q1K A;  1KEE A;  4O4H B;  3DTU B;  3JAS B;  4Z1V A;  1KJ8 A;  2Q5Z A;  1OHH G;  2Z3Y A;  2IH1 C;  1P7B A;  2XAH A;  1F4M A;  4FK5 C;  1M93 A;  1B6R A;  1CEZ A;  2VWK A;  2XAQ A;  1G8M A;  1FXV A;  2AW9 A;  2A79 B;  2EX3 A;  1UFI A;  3R65 A;  4R6Z A;  3G80 A;  4XZ3 B;  1BXR A;  3CEB A;  5D5P A;  5LOV F;  2YW2 A;  3T1H B;  5L3F A;  4L1K A;  4LF6 O;  2YI9 A;  1VQ9 V;  5JJN B;  1KB9 F;  2QK4 A;  2FB5 A;  1GN6 A;  3A8T A;  3TW7 A;  2RCV A;  3K08 A;  1EZV H;  5LMU O;  3AX6 A;  4JV5 O;  4HAM A;  1D5N A;  3U9T A;  1J5E B;  4DK0 A;  3SPI A;  1VS0 A;  4O7S A;  2QA4 V;  3OR7 C;  4UV9 A;  4DXW A;  4C7U A;  1YTF B;  1EZJ A;  3ZBH A;  1H2N A;  5IYZ F;  4JAA A;  3AW8 A;  2WPD G;  5IY5 B;  2YWV A;  2A7W A;  5C1O A;  1PL4 A;  3S24 A;  3RYC A;  4H0L B;  3LNN A;  4J9Z B;  3S3X A;  4EKW A;  4QPK A;  3JSN A;  1EKP A;  5KMG A;  3W1G A;  2HVK C;  1N4C A;  5BY1 A;  1I2K A;  4OPH A;  1M56 C;  3JD4 A;  3T9D A;  3J81 N;  1X4T A;  4TOI A;  3CCJ V;  3K5O A;  4G28 B;  5B1A B;  5LA6 B;  4YBZ B;  3SR2 C;  3RYC B;  2PI4 A;  4JGS A;  4X8A A;  1BZK A;  1V9P A;  3A0B Z;  1Q8I A;  5KMG B;  1Y66 A;  3IAY A;  3N27 A;  4PBC A;  1VQN V;  4ZOL B;  4GCZ A;  4F6R A;  5EYP B;  1KBH A;  1HNX O;  4JYB A;  2CNQ A;  1OCC B;  3GLK A;  1MSW D;  4DR1 B;  4NZN A;  1Q81 W;  2L35 A;  2JDI G;  1JOY A;  1HWY A;  3ZRV A;  5EIB C;  3SYA A;  4J7Z A;  3ZIA G;  1AJQ A;  3QFF A;  3W7T A;  2Q2T A;  1H38 A;  2NN4 A;  5L3E A;  5KX5 B;  1VKZ A;  5GON B;  1QLE C;  4O2B A;  1YIT V;  2ZR2 A;  4X1Y B;  2OTJ V;  2IJI A;  2QKS A;  1TUB A;  2DQ0 A;  3D3I A;  3P30 A;  5I47 A;  1PL0 A;  3E8G A;  2ZXW B;  2V5A A;  2JJ2 G;  5BMV A;  2YRX A;  4MTO A;  3OD4 A;  2RQ6 A;  1N0J A;  1G4Y B;  5IYD O;  3JSL A;  5BR8 B;  5KAF Z;  2IH3 C;  3ZMU A;  1KUT A;  3BCC H;  1I5Y A;  3N2K A;  4C5C A;  2UUA B;  4JI5 B;  1TUB B;  3SPC A;  1VMG A;  4MVO A;  4CMD A;  2B1I A;  3FAV A;  4IWY A;  1VF7 A;  1NTK H;  5BMV B;  3K79 A;  3CEI A;  3OMN B;  4N21 A;  4YY3 O;  1R3K C;  1S5H C;  2E3C A;  4JYY A;  3N2K B;  1XDC A;  4FPP A;  4PA3 A;  3RYI B;  3TEK A;  4NTY A;  4D7T A;  4BW5 A;  3CS5 A;  5CA1 B;  1FXK B;  3OEH G;  5KHK A;  1I1L A;  3ABL B;  3KAJ A;  4ZHQ A;  1ZL8 A;  3C3S A;  4O4I F;  5IYB O;  3N8D A;  5LA6 F;  5LYJ A;  3CC4 V;  2IJK A;  1N32 B;  2HHH O;  3QQM A;  3C3T A;  1WR2 A;  1FPO A;  1ZX3 A;  2CE4 A;  2OLS A;  1QR9 A;  3QVN A;  1F4N A;  4RAI A;  4Z2W A;  4FLT A;  3K5M A;  4ZOL F;  4TUY A;  2GQR A;  4MVZ A;  3HKE B;  1DIK A;  1M57 C;  3AK1 A;  3BHP A;  2YXH A;  3L73 H;  4ZHQ B;  4K8Z A;  1Q86 W;  1NR1 A;  3TGU H;  1H2K A;  2DAB A;  5BXZ A;  4O4L A;  1FJG B;  5C8Y F;  1TVK A;  3TW6 A;  1XNQ O;  1IBK O;  2PY5 A;  2B1G A;  1GN3 A;  2RJZ A;  5JJJ B;  3DF7 A;  1RPO A;  3GID A;  4F6E A;  5DEC A;  5JVD B;  2AHZ A;  5CB4 A;  1GSA A;  5KA6 A;  2WYO A;  2CUG A;  4NXN B;  2PTM A;  4MV7 A;  4DR3 O;  3K9S A;  2XT9 A;  2V7Q G;  2HHF B;  3AG2 B;  3ZMZ A;  4U3J A;  4LFA B;  1E4E A;  1YJ9 V;  1EUD B;  3I12 A;  2DZD A;  4O2A B;  4DV2 O;  3B8N A;  1OCO B;  4YIP A;  4AQY O;  5E79 Z;  2W6I G;  1YCI A;  2FTK A;  3WU2 Z;  3B09 A;  3RV3 A;  1AJP A;  1CKO A;  2A9H A;  5J2T A;  1P8L A;  3IC7 A;  1NJI W;  4YXW G;  3VPB A;  2XHB A;  5JH7 A;  3Q2O A;  4Q4D A;  2EIK C;  5CA3 A;  4KHP O;  2YI8 A;  1Q90 D;  1OV9 A;  5IWA B;  3K59 A;  2D2C B;  4B3M B;  1P84 F;  2HJD A;  1SA0 A;  3IJ4 A;  2DAA A;  4CMF A;  1M1K W;  1I94 O;  4NKG B;  3EXA A;  4O4J B;  3AG4 B;  3DGE A;  5AG2 A;  4KL1 A;  4DRF A;  5J2T B;  4B3S O;  2VQF O;  1R1B A;  4HYO A;  1OBD A;  1L1F A;  1XMO B;  4NB5 A;  1G6U A;  4DYL A;  2RDC A;  1RM1 C;  4RO2 A;  4CH6 A;  2H8P C;  2DMX A;  1AR1 B;  1E1Q G;  3TIN A;  4E4T A;  3E83 A;  1SA0 B;  3L72 H;  4CH3 A;  1Q6I A;  4JI2 B;  3WWI A;  1SC5 B;  4WBN F;  4DV1 B;  3M8A A;  4JI8 B;  2DYR B;  3OUS A;  1BCC H;  4MV4 A;  1OBG A;  2W6M A;  3ZHV A;  4XYL B;  4JI0 O;  5IYC O;  1W93 A;  3IGA C;  3UCS C;  3CME V;  1QR8 A;  1AJN A;  1Z5V A;  3FYI B;  1W0K G;  2Q67 A;  3BAA A;  2HVQ A;  2Q0A A;  3SYC A;  3U9S A;  1LNQ A;  3SDL A;  3ZMT A;  1BHA A;  5I5V A;  4B7E A;  3T7A A;  1IX9 A;  1VAR A;  3T1H O;  3DSQ A;  1B6S A;  2FPI B;  5LXT F;  1ZUQ A;  4IGG A;  3RFR A;  1EKF A;  1GK9 A;  3CSX A;  5HFL A;  1R6T A;  5LHG A;  4K0K B;  5FR9 A;  4GX2 A;  4JTC B;  4K3A A;  3ZRX A;  2C2A A;  2UUC B;  1J5E O;  4UXN A;  3GVM A;  1FAF A;  1JCH A;  4O2A F;  5CAE B;  4O83 A;  2HGX A;  4DW0 A;  3DXR A;  1YI2 V;  1H2S B;  5LP6 C;  4QNH B;  4TSF G;  4LFC B;  2F95 B;  1UJW B;  2KB1 A;  1NT2 B;  3MD0 A;  4E2L A;  4DIM A;  1LR1 A;  3O9O A;  4ZI7 F;  2NU6 B;  3ETE A;  1Y76 A;  3BY6 A;  3THO A;  4FLY A;  3UM7 A;  3R9R A;  2RMK B;  4FM2 A;  1N8R W;  4LC1 A;  4YAK B;  1AP6 A;  2CTP A;  1H8H G;  2Y69 B;  1GM7 A;  2JS3 A;  4QE7 A;  4UB8 Z;  3EVK A;  4ZIB A;  1BQZ A;  1L8D A;  2I8C A;  3NBY B;  1DGS A;  2E76 B;  3CJH B;  2HP8 A;  1U96 A;  4TV8 F;  2UUB B;  1FS0 G;  2HGW A;  3CB2 A;  2R9I A;  2GUZ B;  3FKS G;  3W7U A;  3L71 H;  2E5L B;  3HBL A;  4I0X A;  1XL4 A;  2A3Q A;  5FL7 G;  3T2M A;  3CCL V;  1I7N A;  1AI6 A;  4UVA A;  2V1D A;  4GX5 A;  2AXT Z;  1KKD A;  5DGH A;  3VOT A;  5IY5 C;  2PGG A;  4DR1 O;  1D5A A;  5CN0 A;  1KBL A;  2HLD G;  2LQT A;  5EZY F;  1Z5W A;  1G1X B;  1GAX A;  2W0X A;  2CGN A;  2HFE C;  4Q4C A;  3J7A U;  5CA0 A;  2G38 A;  1JVM A;  4EFE A;  2Y4U A;  2LGQ A;  2YIB A;  4DR7 B;  2WLM A;  4LNU A;  5JWP A;  3TY9 A;  2ZDI A;  3CX5 F;  3E8B A;  3HT5 A;  4I0X B;  2BOB C;  3N2G A;  1BT8 A;  2X0L A;  1NI8 A;  3LSQ A;  2CK3 G;  2OCH A;  4TQF A;  2ODT X;  1WN7 A;  3J80 N;  1Q6H A;  4HNT A;  1VQP V;  1JKJ B;  4TM5 A;  2NU8 B;  5EC1 C;  2FKX A;  3B40 A;  5HBR B;  4HBN A;  4UCS A;  4BIZ A;  1SQF A;  1CE8 A;  5BR8 O;  5KHJ A;  5J2U F;  2I80 A;  3HB9 A;  1IBL B;  3BG5 A;  1AI7 A;  2PYL A;  1KJQ A;  1NZ6 A;  3WB0 A;  4JI5 O;  2WLI A;  1SF9 A;  3H9V A;  3ZX6 A;  3DTG A;  1XBL A;  5B1B B;  4ICG A;  4DR5 O;  1QBZ A;  5H9C A;  1FFT B;  3X2Q B;  2WA3 A;  3TY5 A;  1TAE A;  1KD1 W;  4X89 A;  1MG1 A;  3VQX A;  4JI4 B;  2UXX A;  1SQV H;  1PP9 H;  2CH7 A;  1KJI A;  2ZDQ A;  2Q8V A;  4IIJ F;  1MNG A;  1GM8 A;  4RUE A;  2EIN B;  4GKJ B;  4PI0 A;  1V54 B;  1KU9 A;  4UB6 Z;  3JAT A;  4LF5 B;  1CQI B;  1JPX A;  4FIP C;  1PKX A;  2Q4P A;  5A9G A;  2OWO A;  4X88 A;  3QO8 A;  1SET A;  5LOV B;  4D7S A;  1E1R G;  2EIM B;  3L70 H;  5BWV A;  1BS3 A;  1EN6 A;  4MA0 A;  3PJS K;  3W7S A;  1N32 O;  1XNR B;  3ASN B;  2CH7 B;  1TGO A;  3UO2 A;  1NVP D;  3H01 A;  3Q4H A;  3AK3 A;  2VWJ A;  1WA8 A;  1QNM A;  2XAG A;  4EB6 B;  1IVS A;  3T9E A;  4HZ3 A;  2Q69 A;  3P3N A;  2NLJ C;  3ETD A;  1B06 A;  2EUL A;  1UPG A;  2CNV A;  4Q6G A;  5IYZ B;  1FJG O;  2ZQM A;  2YS6 A;  5KS8 A;  4O7Z A;  4X62 O;  2P22 C;  4DUY B;  1K4D C;  2VQD A;  4MV6 A;  3NC0 B;  3WG7 C;  4NXN O;  2A0L A;  4FFM A;  4P9P A;  3ZHQ A;  2GDS A;  1BSM A;  2BCC H;  4LF8 B;  3ML0 A;  4DV3 B;  1KC8 W;  1Q6U A;  3STZ C;  1RSO A;  1VF5 B;  4FE2 A;  2GPW A;  1SQP H;  4IL6 Z;  3JD0 A;  1TA8 A;  3U0Z A;  2Y0I A;  4WFH A;  3CRQ A;  5BWW A;  3MJF A;  3GB8 B;  2COI A;  4BIU A;  1DV1 A;  4W4L A;  4MTF A;  5BWU A;  4MW8 A;  1VQK V;  2YIC A;  3G6B A;  4R8C A;  4MA5 A;  1I5X A;  2JJ1 G;  4I55 F;  1AR4 A;  1EUC B;  3QG5 A;  4PEL A;  1RSO B;  3AG7 A;  1SQQ H;  5E25 A;  5IWA O;  1H2G A;  3F7V C;  4MT8 A;  2HJW A;  1Z2P X;  1EBO A;  5JQW A;  3NBZ B;  1E79 G;  2EIJ B;  4DV0 B;  2ZE8 A;  4ASU G;  1QHT A;  3JD2 A;  2R82 A;  2LGW A;  3B2E E;  1HP8 A;  4NZO A;  2JEX A;  2R72 A;  2FML A;  3N6R A;  1CP9 A;  5B3S B;  2DOS A;  2UXB B;  2ADQ B;  3OM3 B;  3P32 A;  3SJQ C;  3CRA A;  2QWQ B;  1XMO O;  4FLU A;  1LUV A;  1H2L A;  2Y4R A;  4CS2 A;  1N34 B;  4IHJ F;  1KC7 A;  2KQX A;  1PV0 A;  2GTA A;  5BWX A;  2M7W A;  3KRE A;  4FFK A;  4DV1 O;  4OGQ B;  2QDO A;  4JI8 O;  4P9O A;  4I4T F;  2R87 A;  1L0N H;  3DTF A;  5FPO A;  1HNZ O;  2OTL V;  2DQ3 A;  2ZIM A;  3ABT A;  5GW7 A;  1V55 B;  2QE7 G;  5BWT A;  4EQ5 A;  3TXS A;  1ET0 A;  1WAZ A;  5DED A;  1F51 A;  4K8X A;  5H5N A;  4I50 F;  1PPJ H;  2QM7 A;  3UQ8 A;  4LP8 A;  1QU7 A;  1K5S A;  3CMA V;  4D6T H;  3TK1 A;  2X0S A;  3K03 A;  2CTW A;  2LP7 A;  5LA6 A;  3WB2 A;  4JI7 B;  2XOK G;  5EBW C;  1X9N A;  2FYU H;  1EM1 A;  4GX1 A;  1YJN V;  1HNW B;  4ZOL A;  4X64 B;  3IC9 A;  4CZZ A;  2UUC O;  3ZN0 A;  2YZN A;  2W70 A;  5EYP A;  1RP3 B;  1WB7 A;  2ZE6 A;  3ASO B;  1BHB A;  4XBF A;  3CPW U;  4O4I B;  5B5E Z;  3SJA C;  3MHH C;  4X1K A;  3FYE B;  2DWC A;  2OCC B;  4GT1 A;  2QM8 A;  4J80 A;  1OJH A;  2EJ7 A;  3ABM B;  3JD1 A;  3ZED A;  1JJO A;  1PNL A;  5KX5 A;  3AG1 B;  4JI1 B;  3RVZ A;  3RWR D;  5GON A;  2C00 A;  3GWO A;  2IM9 A;  1M9N A;  2QSA A;  4DV7 B;  4X1Y A;  4Q20 A;  4LH6 A;  3E22 B;  1A9X A;  3OW2 U;  4X1K B;  1Z2G A;  1H2M A;  1GKF A;  2YEV B;  5C8Y B;  1UC8 A;  4OPA A;  2HEP A;  4A5U B;  1ARO P;  3K5H A;  5KLV H;  3OE7 G;  1K33 A;  1I08 A;  2UUB O;  2DWE C;  2P06 A;  5FNV F;  3D36 A;  1GRJ A;  4HNU A;  1FFX B;  4M0J A;  2JK5 C;  2E5L O;  2FP4 B;  1IOV A;  2IJH A;  1AB3 A;  2HIV A;  3ETQ A;  1ORQ C;  2QKC A;  2WLH A;  2XD4 A;  3L75 H;  2W6Z A;  3U10 A;  3V4S A;  2GHY A;  3RUP A;  2W6J G;  4DV6 B;  4LWS B;  1Y67 A;  4B7K A;  2P4K A;  4TV9 F;  3WWJ A;  2WWW A;  5LP6 F;  5B66 Z;  1KQS U;  4DRX B;  5HNE A;  3W7X A;  4FLW A;  1BL8 A;  2FPG B;  4DR7 O;  2QWP B;  1YTF D;  3UO3 A;  5I5S A;  2NR5 A;  4DV4 B;  3RYI A;  1MOF A;  2F4V B;  3U54 A;  3VPD A;  3JAK B;  2F43 G;  3AG3 B;  1R6K A;  3CCM V;  5CA1 A;  1FXK A;  1Z2N X;  1J95 A;  5CBG A;  3T9A A;  3VQW A;  2ZCE A;  5EBL C;  4WBN A;  4FLX A;  4FLV A;  3GJX B;  3RTX A;  3JZI A;  2EZO A;  2JEU A;  2PZS A;  4KXR A;  2WAM A;  4PI2 A;  4DR6 B;  4CC6 A;  1IBL O;  3R23 A;  1QCE A;  2PI5 A;  5H6R A;  2EIL B;  3JZ6 A;  1OCZ B;  3HKE A;  1K8A W;  1R3J C;  3OAA G;  5JQG B;  2JIZ G;  2PN1 A;  1SQB H;  4WBN B;  4Z1M G;  4HNA B;  1XOU A;  3MWE A;  2QEX V;  4JTD B;  1K3E A;  1N36 B;  2EBO A;  4WFF A;  1GH6 A;  4JI4 O;  3CC7 V;  4NYK A;  1P7G A;  5LXT A;  4FFR A;  4O7R A;  2ZR3 A;  5E1A C;  5IE9 A;  5JVD A;  4DK1 A;  4GKJ O;  3ABK C;  3JYC A;  2EJ3 A;  2I87 A;  4R7C A;  3RBZ A;  4U7N A;  4LF5 O;  3U11 A;  3AEI A;  2HHF A;  2PF4 E;  4G2K A;  1VQL V;  5B1N A;  4O2A A;  3FFQ A;  4K35 A;  3G4S V;  1I1K A;  3R5X A;  5LXT B;  2ZDI C;  1KEC A;  1XNR O;  5CR5 A;  1BMF G;  4PJ0 Z;  4JYC A;  2Q9L A;  3JRX A;  3HKC B;  1SCU B;  2NNU A;  3ORQ A;  1YVW A;  3FD9 A;  4ZQI A;  3EFF K;  3MDS A;  1YSC A;  3ZMS A;  2D3O W;  4PDV A;  4BW9 A;  3ZN1 A;  1JMK C;  3MWD A;  2CTR A;  3JRW A;  4JI6 O;  4U3F H;  4YHH O;  2EIN C;  2BSK B;  4RQE A;  4O4J A;  1QVG U;  1V54 C;  4TV8 A;  2F23 A;  2OYQ A;  4DUY O;  2Q2U A;  2Z5U A;  4ZI7 B;  1AUV A;  2PVP A;  5I5Y A;  2W6Q A;  2ZNJ A;  4KFM A;  4O86 A;  1K4C C;  2ZIO A;  3S3W A;  3ETJ A;  4DQN A;  2EIM C;  3E2E A;  4LF8 O;  3A0R A;  4ABM A;  3GB7 C;  4H13 B;  5HV6 A;  1VQO V;  4DV3 O;  1I7L A;  2CDY A;  1XMQ B;  1WRV A;  2WSS G;  2KG7 B;  1CKM A;  3CRC A;  4ME6 A;  1GM9 A;  4TV8 B;  5EZY A;  5K1P A;  1X59 A;  3K0G A;  2PBZ A;  4UUG A;  3CCS V;  3ZHT A;  3I55 V;  4LBE C;  1SES A;  2IP4 A;  5ITZ B;  5GTI Z;  3TIG A;  4XDL A;  3NR7 A;  3ZRS A;  5JQG F;  4X65 B;  2UXN A;  3SPG A;  3B77 A;  3GDE A;  4MV8 A;  4B3T B;  4YB8 B;  4J41 A;  1CPY A;  1XI1 A;  1SKV A;  1O9H A;  4MAM A;  4CHI A;  2P67 A;  3OTO B;  4DV0 O;  5EZY B;  3D8C A;  5FLX N;  2ODM A;  1IBM B;  3PN1 A;  1AI5 A;  5KA5 A;  1S5L Z;  4YJ3 F;  2R85 A;  2W0F C;  2E74 B;  1P16 A;  1N34 O;  4DW1 A;  1YDX A;  1M56 B;  3RYH B;  3KG2 A;  1VBG A;  2WA4 A;  1KP2 A;  3HPL C;  4X1I A;  3AK2 A;  1S0V A;  1IZ3 A;  5D5Q A;  1EHI A;  4KP4 A;  1CS0 A;  3RW0 A;  5J2U B;  5BPH A;  2DJV A;  2CGO A;  3JCZ A;  1YEW A;  1RFY A;  2JGD A;  4IIJ A;  3CCQ V;  4LF7 B;  5BWR A;  2N74 A;  1FD9 A;  3APQ A;  3TET A;  1Z2O X;  3STL C;  4TT3 G;  2YS8 A;  3K0D A;  2DN9 A;  2EIJ C;  5IJ0 B;  3OR6 C;  3ZHU A;  4LF4 B;  4X1I B;  2BTO A;  2IU0 A;  2HDK A;  3E8F A;  1CKN A;  4RCN A;  4JI7 O;  4LCU C;  2WLJ A;  4TUY F;  3CJH A;  2Q7G A;  5KKN B;  2NUA B;  3E86 A;  4MVQ A;  2RN9 A;  1A3G A;  1UC9 A;  3UFX B;  1DTO A;  2GSM B;  1IUR A;  2JGD B;  4R50 A;  4IIJ B;  3UYY A;  1IXB A;  2ZE7 A;  5H80 A;  4LH7 A;  2QTO A;  1HNW O;  1GGO A;  4L87 A;  4PA9 A;  1OCR B;  2GUZ A;  4X64 O;  4JZ2 A;  2W6O A;  5GTH Z;  3SPH A;  4X9Q A;  2LW7 A;  4O4L F;  1NU1 H;  1DAA A;  3T1Y B;  3VNN A;  2EZP A;  3T1C A;  3QO5 A;  1VQM V;  4I5S A;  1CKN B;  5CB4 F;  3KKY A;  3NUA A;  1LUW A;  5DGI A;  2MK3 A;  2R7N A;  1V55 C;  1NH2 B;  4LF9 B;  3CCU V;  4H44 B;  2EIY A;  4JI1 O;  1HNX B;  3O65 A;  4FZ0 A;  3RT3 C;  4DV7 O;  1XHZ A;  2B9Z A;  1EN5 A;  1JDB B;  1N33 B;  4LR3 A;  4MVM A;  2A06 H;  3ZS8 C;  5JH7 F;  1ZTE A;  2BE3 A;  2YUA A;  3VMM A;  5CBF A;  2LFR A;  1DK1 A;  1BNC A;  5IDJ A;  4UCV A;  5B1A C;  1A32 A;  3RV4 A;  3VQY A;  1SZX A;  1M5I A;  5BZB A;  3VBB A;  4GUN A;  4PA4 A;  3K57 A;  5DAA A;  2HG5 C;  2R9R B;  4QJF B;  2EJR A;  4O7W A;  1MAB G;  4DV6 O;  2QKA A;  1QVF U;  1P4R A;  1K5Q A;  1C3O A;  2P6J A;  1H8E G;  3RYF B;  2VR1 A;  1WP8 A;  2R9A A;  5KUK A;  4PV1 B;  4DUZ B;  4JTA B;  1XUQ A;  2UUA O;  4DV4 O;  1OCC C;  2DW4 A;  2F4V O;  4WFB V;  1M6V A;  4UCU A;  2AGA A;  3UT5 B;  1M57 B;  3BA8 A;  1YJW V;  5EC2 C;  4I55 B;  4FFP A;  4EGJ A;  1R3L C;  4JAS A;  4IHJ A;  5L3D A;  4YY3 B;  4MVU A;  5LOV A;  1WNS A;  1KUQ A;  1MZE A;  3LP8 A;  1VQ5 V;  5JVL A;  2ILM A;  4FGR A;  1ZLZ A;  2X6C A;  2AZ0 A;  2LFS A;  4Y8V B;  2XUM A;  1WLE A;  1N0N A;  3SYP A;  4DR6 O;  5LL6 Y;  4JF3 A;  2ZM6 B;  5L3B A;  3UZB A;  4DV5 B;  2X6A A;  4FU0 A;  1VQ4 V;  2ZXW C;  5HFM A;  1PK8 A;  4EB6 A;  4IHJ B;  4CC5 A;  3KAL A;  1S72 V;  2R70 A;  3VOU A;  3CCE V;  4HQ6 A;  4UFZ A;  1L0L H;  1IYD A;  1MSD A;  1VBH A;  5IYZ A;  3D36 C;  2R7M A;  1N36 O;  2HVR A;  3E5N A;  3B8M A;  1GSH A;  4BIO A;  4I4T B;  2Y48 A;  4MW3 A;  4EEQ A;  2LW1 A;  4MTG A;  1DV2 A;  4I7Z B;  1K73 W;  2ATK C;  2QB5 A;  2P5O A;  5I5W A;  3OTF A;  5JCO A;  4I50 B;  1IBK B;  2V59 A;  3QF7 A;  4CKC A;  5IT9 N;  4FJC C;  4GYC B;  4DLK A;  1EFR G;  1XHX A;  1K7D A;  3RN4 A;  2EIL C;  1OCZ C;  2GBO A;  4BAY A;  4X20 B;  1KMI Z;  4FZ1 A;  4RUF A;  1FXK C;  3LDE A;  3ABL C;  3LWB A;  1RM1 B;  3VQV A;  5EK0 A;  4LFA O;  1K34 A;  2DYS B;  2YIB D;  4K6N A;  4E4E A;  2PYJ A;  3UKM A;  4NTW A;  5B1O A;  3R5F A;  4FM0 A;  3HKB B;  3CXH F;  2GTS A;  1WPX A;  2R7L A;  4PA7 A;  2CAZ C;  5FNV A;  1EYZ A;  4DR4 B;  3TY8 A;  2DWD C;  5D1O A;  3JAW B;  1GTO A;  3K3W A;  2A1H A;  3HKD B;  1DF5 A;  3ABU A;  4B3M O;  1XMQ O;  2WLK A;  3MAQ A;  1AP5 A;  4CKE A;  2HVJ C;  1IXM A;  4UUJ C;  2COG A;  1NTM H;  5BYA A;  2XAF A;  2EJ2 A;  2HG8 A;  2P0A A;  2ZGI A;  1IOW A;  2M6Y A;  3BRC A;  4UCO A;  2FL4 A;  2FB9 A;  3G8D A;  3BAB A;  5FNV B;  2BOC C;  3AG2 C;  2H3O A;  2KKW A;  2YXL A;  1M0W A;  1AR5 A;  4IT5 A;  2XAS A;  5H2F Z;  2XCL A;  4QIW F;  5D1O B;  2DLN A;  5C1P A;  1OCO C;  4UCT A;  2YIA A;  4X65 O;  3VPC A;  3K5N A;  4B3T O;  2F66 C;  4JI2 O;  4FFB A;  5DM6 V;  1JX9 A;  3QTC A;  1Q3E A;  4OX9 B;  4IZO A;  3OTO O;  4TV9 B;  1JR9 A;  2ADP A;  2QTS A;  5LP6 B;  1IBM O;  4JI0 B;  4B3R B;  4O84 A;  3ICX A;  4NYE A;  2XND G;  4O7Y A;  4TVI A;  4XYM B;  3SYQ A;  5LGU A;  4XDJ A;  2ITC C;  4X66 B;  4H33 A;  2YS7 A;  1WB8 A;  1MZF A;  1VF6 A;  4GZR B;  4C5B A;  5C93 A;  1C30 A;  2HIX A;  4FFB B;  4PZ6 A;  2V4D A;  3AG4 C;  1MMM A;  3CP1 A;  2R86 A;  4PHZ A;  4O4I A;  5I5T A;  1WPB A;  1RPR A;  2K9P A;  1W2B U;  4YJ2 F;  3WO1 A;  4K0K O;  2ZDH A;  4LF7 O;  2P90 A;  3OMI B;  1YZB A;  1S68 A;  1COW G;  4CH4 A;  2HR3 A;  4HR7 A;  3JZF A;  4LF4 O;  3E22 A;  5EBM C;  2ZE5 A;  2DYR C;  1NKD A;  5J9P C;  1A48 A;  1GN4 A;  5KHH A;  2YEV A;  5C8Y A;  3UZO A;  2X6B A;  5BYB A;  4E6N A;  1URF A;  1MA1 A;  3CYO A;  4LFC O;  2ZIN A;  2L6L A;  5D1P A;  2YL2 A;  3C90 A;  2ARH A;  1KT8 A;  1FFX A;  4CBC A;  2Q7H A;  4PD4 F;  2AZ2 A;  2VQE B;  3T1Y O;  1WP7 A;  4F4L A;  2OIG A;  3L2P A;  2UXC B;  3JCU Z;  3T54 A;  2ZNI A;  1GLV A;  3U0G A;  2ZD9 A;  4LWS A;  3RVY A;  3ZMV A;  3GWK C;  4LF9 O;  4DRX A;  2JVD A;  5TIS Z;  4FMT A;  4RZQ A;  1P49 A;  4BWA A;  4I9W A;  5LGT A;  2Y4T A;  3JAK A;  1PD3 A;  5KUM A;  2JS5 A;  4O4H F;  4J9Y B;  1S3J A;  4CE5 A;  4JAV A;  3K3P A;  3TQT A;  1EZ1 A;  1W0J G;  3KZI Z;  1N33 O;  1IYE A;  4GX0 A;  1S76 D;  1NS1 A;  1Q82 W;  2UXD B;  3SYO A;  3KCY A;  3WNZ A;  4F6R B;  1Y6X A;  1OCR C;  1AVM A;  2Y69 C;  4MVR A;  2Q6A A;  1BE3 H;  4P30 A;  1PNM A;  3R66 A;  1T36 A;  2W6P A;  3W5O A;  4NXM B;  3K5I A;  5H6Q A;  5LMN B;  5JQG A;  4PDR A;  3KAK A;  1O9G A;  4PZ7 A;  1ZSP A;  4W4K A;  3CE2 A;  3TCU A;  1FXH A;  2RNB A;  3OEE G;  2BTQ A;  4HNA A;  2UU9 B;  3OGI B;  4WFA V;  4G27 B;  2XAJ A;  4O2B B;  5KHG A;  2GLT A;  4DUZ O;  1VEW A;  1T5E A;  4YJ3 A;  4WF9 V;  5JJE B;  4DR5 B;  3BAC A;  1AI4 A;  2JRI A;  2ZDG A;  4DR2 B;  4JI3 B;  1XL6 A;  2BTQ B;  3IFX A;  3FB8 C;  5CMU A;  1K9M W;  3VA7 A;  2VPQ A;  1W59 A;  2ZT9 B;  3OT7 A;  3U55 A;  2ZM6 O;  5DIS C;  3HKC A;  4O7L A;  5CE8 A;  2DIK A;  4YJ3 B;  4DV5 O;  1THZ A;  1JFF A;  3FAV B;  3WG7 B;  3W1B A;  1SQG A;  2J9G A;  3CSW A;  5LHH A;  1HR0 B;  3SNO A;  4IYI A;  3E89 A;  1I1M A;  3G6E V;  4AHC A;  5D8D A;  3T4D A;  5LBQ A;  3LUL A;  5FPR A;  3CCR V;  1XK5 A;  2Z02 A;  2BSK A;  3ZCC A;  3LSS A;  4NR1 A;  3CHX A;  3CXC U;  2Z0A A;  2X5R A;  1JFF B;  4ZI7 A;  3L74 H;  4DAA A;  3OFN G;  1ZL8 B;  5B1B C;  3HB3 B;  3X2Q C;  5LYJ B;  4GKK B;  4B08 A;  5K1X A;  3FB7 C;  4X62 B;  2IW5 A;  4ZBM A;  1YIJ V;  3BFR A;  2KG7 A;  4TUY B;  3KCX A;  5KX5 F;  5DMX A;  4O7V A;  5GON F;  1EN4 A;  3B4S A;  2YZG A;  5K2M A;  1SZT A;  3SGI A;  1JJ2 U;  3QO7 A;  1ROP A;  4WFG A;  2VUG A;  5ITZ A;  4UVC A;  3RR5 A;  1KP3 A;  3H1K H;  4O4L B;  4J10 A;  1TVK B;  2VS0 A;  3ASN C;  4CS3 A;  2COJ A;  4NZM A;  5CB4 B;  1DLB A;  3W7W A;  3WO0 A;  2R7K A;  5IJ9 A;  3H1L H;  4LFB B;  3SPJ A;  3HO8 A;  4O2B F;  2V58 A;  5KHI A;  3BVO A;  1US6 A;  2YID A;  4U3J B;  2LO1 A;  4NVP A;  5I5X A;  5LGN A;  1E4E B;  1YXB A;  1AIL A;  4MSW C;  4JYA B;  2JGU A;  4N23 A;  4DR4 O;  3BEH A;  3SJC C;  4XX0 B;  4FVM A;  2YDE A;  3K58 A;  4FFO A;  2Q7E A;  5BMV F;  3H1H H;  3SE7 A;  2VRZ A;  3RYH A;  3EHB B;  1XRE A;  3CC2 V;  3K04 A;  5I5U A;  3JAR A;  4P2Z A;  5IJ9 B;  1S5J A;  4DO2 A;  2LJ2 A;  4PA6 A;  2PUS A;  1SS3 A;  3FX7 A;  1W96 A;  4YAJ B;  1NBM G;  5JH7 B;  2WLL A;  5J2U A;  1JA8 A;  5JCO C;  3OUF A;  2UXB O;  4FFL A;  1DF4 A;  4QGP A;  4WCE V;  5CA1 F;  1S77 D;  2DYS C; 
#chains in the Genus database with same CATH homology
 3BA8 A;  4I55 B;  4IWY A;  1VF7 A;  4IHJ A;  4YY3 B;  5BWX A;  5BMV B;  5IJ0 A;  2GV9 A;  2ABJ A;  5LOV A;  1WNS A;  4LF6 B;  2E3C A;  3JAR B;  1HNZ B;  3DTF A;  3N2K B;  5FPO A;  3T99 A;  2ZIM A;  3RYI B;  2ZM6 B;  5LMU B;  3TEK A;  4JV5 B;  4D7T A;  3UZB A;  3LQS A;  4DV5 B;  4GLX A;  5BWT A;  1ET0 A;  5CA1 B;  5KHK A;  4K8X A;  1I1L A;  4EB6 A;  4IHJ B;  4ZHQ A;  1EKV A;  4CC5 A;  2R70 A;  3UQ8 A;  5CM0 A;  4UFZ A;  5LYJ A;  1N32 B;  1IYD A;  1Q5O A;  3QQM A;  4JI7 B;  5LA6 A;  3WB2 A;  5IYZ A;  4I4T B;  4TQD A;  4FLT A;  3K5M A;  4TUY A;  1HNW B;  4EEQ A;  3HKE B;  4ZOL A;  4X64 B;  4CKB A;  3BHP A;  3T9B A;  4ZHQ B;  4K8Z A;  2P5O A;  2QB5 A;  5I5W A;  5EYP A;  3OTF A;  5JCO A;  4I50 B;  4O4I B;  2DAB A;  3SJA C;  2Q7D A;  1IBK B;  4O4L A;  1FJG B;  3QF7 A;  4X1K A;  1TVK A;  4CKC A;  2PY5 A;  4GYC B;  2RJZ A;  4CH5 A;  5JJJ B;  1XHX A;  5JVD B;  5CB4 A;  1G2W A;  4AIL C;  3ZED A;  1JJO A;  4X20 B;  1KMI Z;  4NXN B;  2PTM A;  5KX5 A;  4IWX A;  4JI1 B;  3RWR D;  1XQ8 A;  5GON A;  2IM9 A;  4GLW A;  2HHF B;  4DV7 B;  4X1Y A;  4U3J A;  1A0G A;  4LFA B;  4LH6 A;  3VQV A;  3E22 B;  4O2A B;  3A2F A;  3WWH A;  1ZAU A;  2YIB D;  4X1K B;  4K6N A;  5K3W A;  5C8Y B;  1UC8 A;  2HEP A;  2PYJ A;  3WB1 A;  3BA9 A;  1M4U A;  2EJ0 A;  4FM0 A;  5J2T A;  3HKB B;  3RYF A;  1FFX B;  2XHB A;  2CAZ C;  5FNV A;  5JH7 A;  4M0J A;  4Q4D A;  3SJB C;  3ETQ A;  4DR4 B;  2YI8 A;  4HN2 A;  5IWA B;  3K59 A;  3JAW B;  3U10 A;  4B3M B;  3UT5 A;  5I60 A;  2A1H A;  1SA0 A;  3HKD B;  2DAA A;  4I55 A;  3T9F A;  4CMF A;  4CKE A;  3MAQ A;  4DV6 B;  4O4J B;  2F93 B;  2COG A;  5BYA A;  3WWJ A;  4KL1 A;  1I2L A;  2EJ2 A;  2HG8 A;  2ZGI A;  5J2T B;  2F1M A;  3JAL A;  3BRC A;  4UCO A;  4DRX B;  5HNE A;  4FLW A;  3BAB A;  5FNV B;  5I5S A;  1XMO B;  4DV4 B;  1G6U A;  2KKW A;  2YXL A;  1B04 A;  3RYI A;  2F4V B;  3VPD A;  3JAK B;  4I9Q A;  4CH6 A;  1SA0 B;  5EIB D;  4CH3 A;  5CA1 A;  4UCT A;  2YIA A;  4JI2 B;  3WWI A;  3K5N A;  2F66 C;  4DV1 B;  4FFB A;  3T9A A;  3VQW A;  2ZCE A;  3QTC A;  4WBN A;  4FLX A;  1Q3E A;  4FLV A;  3M7M X;  4OX9 B;  5CA0 B;  4JI8 B;  3UT5 B;  4TV9 B;  2PZS A;  3JAL B;  5LP6 B;  4JI0 B;  4B3R B;  4LNU B;  4PI2 A;  4DR6 B;  3ICX A;  4CC6 A;  4I4T A;  4TVI A;  3N2G B;  1Z5V A;  3PFF A;  3JZ6 A;  3BAA A;  3HKE A;  4X66 B;  2Q0A A;  2QM4 A;  5JQG B;  5I5V A;  4FFB B;  2V4D A;  3T7A A;  4WBN B;  3DSQ A;  2HHH B;  4I50 A;  4WHX A;  4HNA B;  4PHZ A;  4O4I A;  4CS4 A;  5I5T A;  1N36 B;  1WPB A;  3RFR A;  1EKF A;  5LXT A;  3CSX A;  4L8J A;  5JVD A;  5FR9 A;  4K0K B;  4DK1 A;  4YJ2 A;  2EJ3 A;  4X20 A;  2UUC B;  3U11 A;  4FM1 A;  2HHF A;  4CH4 A;  1QQC A;  3E22 A;  2HGX A;  1XNQ B;  4O2A A;  3FFQ A;  1I1K A;  1H2S B;  5LP6 C;  5KHH A;  5LXT B;  5C8Y A;  5CR5 A;  3UZO A;  4LFC B;  5BYB A;  4EFB A;  2F95 B;  3HKC B;  1NT2 B;  2ZIN A;  1Q43 A;  4DR3 B;  3JAT B;  4YJ2 B;  3HKB A;  3THO A;  4FLY A;  1KT8 A;  1FFX A;  1HW7 A;  4FM2 A;  3RGB A;  2Q7H A;  4BW9 A;  2VQE B;  1JMK C;  4DV2 B;  1I7F A;  4ZIB A;  4JI6 B;  1L8D A;  3JAW A;  4AQY B;  4YHH B;  3HKD A;  2UXC B;  1DGS A;  3T54 A;  2ZNI A;  3U0G A;  3K5L A;  2QJ1 A;  4O4J A;  2UUB B;  4TV8 A;  2HGW A;  3CB2 A;  2OYQ A;  4ZI7 B;  5I5Y A;  4DRX A;  2JVD A;  4FLZ A;  2ZNJ A;  2E5L B;  2ZIO A;  4KHP B;  4DQN A;  1P49 A;  4BWA A;  3JAK A;  5DGH A;  2JS5 A;  2PGG A;  1XMQ B;  1D5A A;  4CE5 A;  1I94 B;  1WRV A;  4JXU A;  3BPZ A;  4O4H A;  1IYE A;  1KTA A;  3JAS A;  1Z5W A;  4TV8 B;  5EZY A;  4UCR A;  4Q4C A;  5K1P A;  5CA0 A;  4B3S B;  2VQF B;  2UXD B;  4TV9 A;  4UUG A;  4F6R B;  4EFE A;  5LP6 A;  4DR7 B;  2YIB A;  4LNU A;  3HT5 A;  3DAA A;  5ITZ B;  3N2G A;  3T9C A;  4TQF A;  4X65 B;  2ODT X;  1WN7 A;  4NXM B;  5LMN B;  5JQG A;  4B3T B;  1XI1 A;  1O9G A;  4O4H B;  4TM5 A;  3JAS B;  1SKV A;  1O9H A;  4CHI A;  3OTO B;  4HBN A;  4UCS A;  5EZY B;  1SQF A;  2BTQ A;  4HNA A;  2UU9 B;  1M93 A;  3PN1 A;  1IBM B;  5KHJ A;  2VWK A;  1IBL B;  2PYL A;  4O2B B;  5KHG A;  2EX3 A;  1T5E A;  3WB0 A;  3DTG A;  4YJ3 A;  5JJE B;  3CEB A;  5D5P A;  4DR5 B;  3BAC A;  3RYH B;  4DR2 B;  3T1H B;  4JI3 B;  4X1I A;  1TAE A;  2YI9 A;  2BTQ B;  3VQX A;  5JJN B;  4JI4 B;  5D5Q A;  3TW7 A;  5J2U B;  1YEW A;  4GKJ B;  4PI0 A;  4IIJ A;  1KU9 A;  3HKC A;  4LF7 B;  5BWR A;  5CE8 A;  4YJ3 B;  3JAT A;  1J5E B;  4DK0 A;  4LF5 B;  1JFF A;  1SQG A;  2OWO A;  5IJ0 B;  3CSW A;  1HR0 B;  5LOV B;  4D7S A;  4LF4 B;  3SNO A;  4X1I B;  2BTO A;  5BWV A;  2HDK A;  4RCN A;  1I1M A;  1XNR B;  4AHC A;  3RYC A;  3LNN A;  3LUL A;  2Q7G A;  1TGO A;  5FPR A;  1A3G A;  1UC9 A;  3JSN A;  1EKP A;  5KMG A;  3CHX A;  4IIJ B;  3UYY A;  4LH7 A;  2X5R A;  1I2K A;  2VWJ A;  1JFF B;  4ZI7 A;  3T9E A;  4EB6 B;  4DAA A;  3T9D A;  1X4T A;  4TOI A;  1DAA A;  3K5O A;  5LYJ B;  3T1Y B;  4GKK B;  4Q6G A;  5LA6 B;  4B08 A;  5K1X A;  3SR2 C;  5IYZ B;  3RYC B;  4X62 B;  5KS8 A;  5DGI A;  1V9P A;  1Q8I A;  4TUY B;  5KMG B;  3IAY A;  4PBC A;  2P22 C;  4DUY B;  4ZOL B;  4LF9 B;  5K2M A;  4F6R A;  3SGI A;  2EIY A;  1HNX B;  5EYP B;  4LF8 B;  5ITZ A;  1XHZ A;  4DV3 B;  4O4L B;  4DR1 B;  4NZN A;  1TVK B;  1RSO A;  1N33 B;  4CS3 A;  5EIB C;  2COJ A;  4NZM A;  5CB4 B;  1TA8 A;  4LR3 A;  3U0Z A;  3ZS8 C;  5IJ9 A;  4LFB B;  5BWW A;  5KX5 B;  5KHI A;  5GON B;  2COI A;  4O2B A;  5BWU A;  4X1Y B;  4NVP A;  4U3J B;  5I5X A;  1TUB A;  4UCV A;  4JYA B;  2JGU A;  5I47 A;  3SJC C;  3VQY A;  4FVM A;  3QG5 A;  1M5I A;  3K58 A;  5E25 A;  3K57 A;  2Q7E A;  5DAA A;  3RYH A;  5BMV A;  4DV0 B;  1QHT A;  2RQ6 A;  5I5U A;  3JSL A;  5BR8 B;  3JAR A;  5IJ9 B;  1S5J A;  2PUS A;  3B2E E;  4NZO A;  3RYF B;  2R72 A;  2R9A A;  3N2K A;  5JH7 B;  4DUZ B;  2UXB B;  5J2U A;  2UUA B;  4JI5 B;  5JCO C;  1TUB B;  4FLU A;  4CMD A;  2Y4R A;  4CS2 A;  1N34 B;  4UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...