1ZAUA

Adenylation domain of nad+ dependent dna ligase from m.tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
321
structure length
321
Chain Sequence
QTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGHVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRAPRWAIAYKYPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title NAD+-dependent DNA Ligase (Rv3014c) from Mycobacterium tuberculosis: CRYSTAL STRUCTURE OF THE ADENYLATION DOMAIN AND IDENTIFICATION OF NOVEL INHIBITORS
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 61
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1zauA01
3.30.470.90 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1zauA02
4DV6B 4DR5B 4JI8B 4DV2B 1I94B 1N34B 4LF6B 4EFBA 4DV3B 4LH7A 1IBLB 4OX9B 5BR8B 1V9PA 4DUYB 4JYAB 1IBKB 4JI3B 4DR1B 2E5LB 1IBMB 4X66B 4LF8B 4GKJB 4DV7B 2HHHB 1HR0B 3T1YB 4DR7B 2OWOA 2VQEB 3BACA 4TOIA 4NXMB 4LFAB 5IWAB 3BABA 4JI1B 3OTOB 1HNWB 4DV5B 3BA8A 5FPRA 4B3SB 4GKKB 2UXCB 2UUAB 1HNXB 4B3RB 4CC6A 4GLXA 1FJGB 4JI0B 4LFBB 2UXDB 4UCUA 4DR3B 4B3MB 1B04A 4JI6B 4X64B 4JV5B 4JI7B 4X62B 4UCVA 4YHHB 4JI5B 3T1HB 3BAAA 1HNZB 1J5EB 2UU9B 3SGIA 4UCRA 1N32B 4LF9B 3PN1A 4NXNB 4DR4B 4GLWA 1TA8A 4EFEA 1N33B 4LF7B 4AQYB 1TAEA 4DV1B 4UCOA 4DV4B 3JSLA 4B3TB 4KHPB 2F4VB 1N36B 4CC5A 4UCSA 2VQFB 5LMUB 4LFCB 2UUBB 4JI2B 4UFZA 4DUZB 4DV0B 4LF4B 4YY3B 1XNRB 5LMNB 2UXBB 1XNQB 4LH6A 1DGSA 3JSNA 1XMOB 3BA9A 3UQ8A 4UCTA 1XMQB 4DR2B 4LF5B 1ZAUA 5FPOA 4X65B 2ZM6B 4DR6B 4JI4B 4K0KB 4EEQA 2UUCB
chains in the Genus database with same CATH superfamily
5BZBA 2W6QA 4QE7A 1I94B 1ZL8A 5BWUA 4AI8A 4IIJB 4DRXB 2ITCC 5F2VO 5LGUA 4LF6B 1M93A 4DV3B 3AG7A 4LH7A 4O4JA 2PZSA 3VBBA 2Q7GA 3SJCC 5LGNA 1NVPB 4F6RA 4DUYB 4DUZO 1QCEA 4IIJF 4PDVA 2Z3YA 4J7ZA 4YJ3F 3PJSK 2EJ2A 2Y69B 2QDOA 4P30A 3S24A 2QWPB 3ABKC 5H6RA 1DK1A 2PVPA 3CJHB 1PL4A 2E3CA 5D5QA 1N36O 4UV8A 2C2AA 1A9XA 3SJQC 5KMGB 3B77A 3ZHUA 1ZLZA 2UUAB 1BZKA 1RSOA 4IHJA 1FJGB 4CKCA 4YY3O 4DYLA 4UCUA 4PA3A 1XDNA 4YJ2A 2N05A 3DAAA 5BMVB 1N4CA 1W0KG 2XNDG 4GT1A 1RM1B 1S72V 1L8DA 3UFXB 4R7CA 1H8HG 2Q2UA 4GLWA 4A5UB 5BMVF 3K5LA 4D7TA 1CKNA 3HKBB 5IE9A 5IY5B 2FKXA 1Y74A 4WBNA 1EZVH 4UCOA 1SA0B 2WLHA 1AROP 5KA6A 3AG1B 1Y67A 5LHHA 4WCEV 1MG1A 2HVRA 4X66O 3O65A 3GDEA 5KHKA 2QWNB 4J9ZB 4O2AA 1Z2OX 2O57A 4UUJC 1XNRB 2UXBB 3UT5A 2GQRA 5K2MA 5IJ9A 3BA9A 3UQ8A 3JZFA 2DWEC 5EYPA 5DGIA 1RFYA 4MV9A 4IT5A 3L74H 1B3QA 1EZJA 4E4EA 3W7SA 1TUBA 3OE7G 2Z0AA 4I4TA 4AQYO 2YZMA 2YIBD 1YJWV 2HJWA 4NTWA 4DLKA 4G27B 4X64O 1IBLB 1JJOA 1WPXA 1Q90D 5H6QA 3ZX6A 5HFMA 3H1LH 3K06A 1X59A 1R6NA 4LWSA 1S0VA 5L3DA 5KAFZ 4ABMA 3ZHRA 1EUDB 2Q7DA 2VQEB 2A0LA 3R5XA 2DAAA 5KUKA 2OCHA 3UZBA 4DV4O 4JASA 4O83A 3KKYA 1JA8A 3KREA 1JLLB 2W71A 2Q7HA 4B3SB 2V59A 1T36A 5JWPA 2EINB 4CC6A 5B1AB 1PP9H 3ORRA 2HEPA 4N23A 4RAIA 4P9OA 1B04A 2GUZB 3T54A 4JGSA 3ABUA 1B6RA 3R5HA 3JAWA 4F4LA 4K0KO 2JJ2G 1BHBA 3ZRWA 4WFEA 4QPKA 4MVMA 3WO1A 3QQMA 5C93A 2QWRB 4CH4A 5EK0A 1C3OA 1IBKO 5I5TA 3ZHVA 1KJQA 3WB2A 3E8HA 2ODMA 4MV8A 3ZRVA 2UUBB 4ZKIA 2LJ2A 1QQCA 3P3PA 3WU2Z 1YTFD 2YWVA 4Q20A 3ASNC 1JOYA 4FE2A 3G71V 3SE7A 4LF5B 1Z5VA 4DR6B 4KL1A 3VPCA 3W7WA 4MTXA 1W2BU 1I1MA 4DR5B 4ZHQF 1KU9A 4R8CA 4IZOA 4O2BB 3H1KH 2QF7A 3WWHA 4TWKA 1M56B 1MZFA 4TV8A 3ZJZA 5C8YA 4F6EA 1SQFA 4X8AA 4KUMA 4O2BF 4PDRA 2ZDIA 4L87A 4H0LB 3MWEA 2Q9LA 5B3SB 4IYIA 2UU9O 1NTMH 1GO3F 3ETHA 1YVWA 4JTCB 3AK1A 3LSSA 4BIZA 2XAQA 1Y6XA 3DGEA 1G8MA 4PDLA 1NVPD 3ICXA 3HKEA 3E8GA 3CXHF 4K3AA 1KUQA 4YIPA 3JD0A 3RTXA 1HNWB 2RN9A 2YL2A 2HG5C 4D7SA 4MVOA 3K0DA 3ABMC 3R65A 3OM3B 5DAAA 2UXDB 1XNQO 3ZIAG 2R7LA 1SRYA 2EIKB 5I5SA 4H13B 2WWWA 5B1NA 1D5AA 2K1EA 1AR4A 4JI5B 4O7WA 1V55B 2UUCO 3TETA 4X1KA 3TY5A 1KECA 3P30A 3ABKB 4UXNA 2NU9B 2AHYA 1EKFA 5LP6C 1RPRA 1EM1A 4O4HA 3K5NA 3CCMV 4OX9O 3DSQA 3L70H 4DV1B 1FXVA 1HWYA 1MZEA 4HAMA 4O81A 2P67A 4GX5A 4JTAB 3UKMA 4I50B 4PA4A 4PI2A 3TINA 3CHXA 2HHHO 4LF4B 1XDCA 3LUTB 1JVMA 3G67A 4HBNA 1NQTA 4NXMO 1MSDA 5CB4F 1XMQB 4I50F 4DR2B 5J2UB 1NTKH 3UYYA 1ZAUA 4JI1O 1FS0G 2YS6A 4Y8VB 4DV5O 4PI0A 2JS3A 2OIGA 2WA3A 1H2MA 1QU7A 1L0NH 1YCIA 4DQNA 2GV9A 3K5OA 1SQQH 3RVYA 1JJ2U 1QR8A 3U0ZA 1M57C 2KG7A 2ZE6A 5KHGA 2ZD9A 4MTOA 4LF8B 2V4DA 5B5EZ 4DV7B 3OUUA 2R85A 2P4KA 1AUXA 1NBMG 5LYJF 3BACA 5CMUA 1XL6A 4FK5C 3RFCA 4OXSA 3ZBHA 2CTRA 2VR1A 3I12A 4FFLA 4GYCB 3HKCB 4MVQA 3KALA 2LO1A 3CSXA 2VWJA 1KJJA 3RWRD 1N8RW 1SQPH 1UC9A 2WLIA 5LA6A 4X62B 4FLTA 1RM1C 1VP7A 1WB8A 2GTSA 3L73H 5JQGB 4XBFA 4PA7A 1HNZB 1I1KA 1B06A 2YIBA 5JJJB 1AR5A 4I55F 2WLJA 4JAAA 1EUCB 4AHCA 3SYPA 5IY5C 4LF9B 3JRWA 3Q1KA 1N0JA 5JQGF 3CX5F 2CFMA 4JZGA 1YDXA 3D3IA 1FFXB 1HDJA 1I7NA 3AX6A 2FL4A 3VA7A 4PDMA 3H9VA 4PV1B 3O9OA 4B3TB 3U55A 2Q2TA 1DLBA 4JI3O 3CRRA 3E86A 5IYZB 5H80A 3GB8B 5CA1A 1VS0A 3CMEV 2LFRA 5DISC 2BTQB 4ZI7B 2WLLA 3D36A 3RFRA 3C3TA 2QM7A 4QE9A 4WFHA 1GGOA 2BSKA 5IYZF 2ZE5A 4LH6A 3X2QC 1DGSA 3JD3A 2V5AA 5IWAO 4LC1A 4CKEA 1VIBA 1BQ0A 4CS2A 2JIZG 1SF9A 1BT8A 3JASA 4FFNA 2OIEA 2Q73A 2OT5A 4R50A 3S3WA 2W6ZA 3GB7C 1CEZA 4GCZA 3B2EE 5KAIZ 3ZHQA 4U7OA 1KP2A 3WWIA 1SQBH 3FKSG 4U3FH 1NJIW 3P32A 1K73W 2HR3A 2BE3A 4X1IA 1S77D 1HW7A 2HVKC 3ASNB 4FM1A 4DR1B 3K3PA 3WFVA 5CAEB 2JGUA 1IVSA 1NR7A 3EHBB 3TXQA 4O4IA 3RYIA 5IYBO 2YW2A 4PZ6A 2A7WA 1KC7A 5EC2C 1KMIZ 5LOVB 1AI4A 2RDCA 4TQDA 3BABA 1I7LA 1UJWB 2R82A 4X20A 5KX5A 3OTOB 5J2TF 1SETA 4FLXA 3FYIB 5GONA 3HKDB 5LOVF 3CCRV 3LDEA 5HV6A 4UB8Z 4OPHA 5LBQA 2CTPA 4W4LA 2Q67A 2LQTA 5KLVH 1VQOV 4K6NA 1FXKA 1VQ5V 4MA0A 2ZR3A 2I80A 2PI4A 3ETEA 3TJTA 3E5NA 3CC7V 1FD9A 2F66C 1F4MA 2QKAA 3VQYA 1XQ8A 3TK1A 3SYOA 1P4RA 1SZXA 2IJKA 2B1IA 1XK5A 4RUEA 1JFFB 4NYKA 3RR5A 1N36B 4MVUA 1E1RG 1TVKA 5AG2A 5B1OA 4P2ZA 2N04A 2DWCA 1HR0O 3G8DA 4BR6A 4YY3B 2EZPA 3AK2A 2EZOA 3K04A 3JATB 1ZTEA 3GWOA 1NH2D 1E4EA 1Y66A 4HNTA 2Y0PA 4EB6B 4O7RA 4R6ZA 3L2PA 4ZOLB 4ICGA 2QB5A 3JRXA 1R3IC 5LP6B 5IYCO 3NBZB 1WLEA 3QO7A 3RYHA 5LHIA 5KMGA 2B9ZA 1G6UA 3JARA 4JI7O 3SYCA 4ZOLF 5CR5A 5LP6F 3WB0A 2XAJA 5JJNB 4I0XB 1OV9A 1JKJB 3FB6C 4MW8A 1H38A 3N2KB 3TW7A 3JAKB 5IYDO 1IZ3A 2W0FC 4DAAA 3Q4HB 3TGUH 4X66B 1N32O 1FXHA 2JJ1G 5FNVB 1QNMA 2F43G 1JDEA 2NUAB 1M0WA 3IAYA 2H94A 3FAVB 2YRWA 1ET0A 4TOIA 5KHJA 2EIMB 4YJ3B 4FLVA 2YEVA 4X89A 3K5IA 3HKBA 5FNVF 2VQFO 1L1FA 5LMUO 5CA0A 1S5JA 1VQ4V 4CS4A 1SESA 3OGCC 5DEDA 2EIKC 4O4LB 1FFTB 1H2KA 2QK4A 4TVIA 1KT8A 4X64B 1M57B 1V55C 1MA1A 3ZN0A 2EJ7A 1NU1H 2E5LO 4X65O 4O4LF 4DW1A 2WLNA 1WA8A 5B1BC 3RYFA 2N74A 1Z2GA 5D8DA 3ZMVA 3E22B 5JVDA 4CH6A 5L3EA 4NZMA 3H1IH 2Q5ZA 1AP5A 4DV4B 2CH7A 3VPBA 2VRZA 4HR7A 2PI5A 2FMLA 1M6VA 5BPFA 4Z2WA 3K58A 4JI6O 4LP8A 2ZDIC 2ZQMA 4LFAO 3TXSA 2HGSA 3E2EA 2HVJC 4UCTA 2A9HA 1YJ9V 3CCUV 1OBGA 3OMNB 4AILC 1ZUQA 2WLKA 3KAJA 2ADPA 4K0KB 3R23A 3SYAA 2IBZH 4FVMA 1JDBB 2GLTA 3Q2OA 1ZL8B 3RUPA 3ZRSA 3GIDA 1SERA 1EZ1A 3MAQA 2FPGB 2MW2B 2Q69A 1IBKB 3K5HA 2OLSA 2ILMA 4O4JB 2XASA 2P22C 4XDLA 2DYRB 1J5EO 5EC1C 3KG2A 4F6RB 2YS8A 3DXRB 4DR4O 3X2QB 4M9UA 1VQPV 1VQ6V 4O7ZA 4DR7B 4LF7O 4O4JF 4J41A 2ZM6O 4CE5A 3TY9A 4FLYA 5I60A 1P8LA 2F4VO 3ETJA 5I5XA 3R9RA 1Z2PX 1VF6A 4H33A 4HQ6A 4J10A 2HHFB 2Y4RA 4PZ8A 1GLVA 5BWTA 1AI6A 3QO5A 5KKNB 1RSOB 1Q6UA 3A0RA 3RYCB 5D1OA 1IXBA 3W1BA 3LDDA 4JV5B 4HNUA 4FFKA 3A8TA 4JI4O 1JX9A 3M8AA 3BAAA 4YJ2B 3CC4V 1XL4A 5I5UA 2UU9B 4IHJF 1R1BA 1L0LH 4O7TA 3L71H 3MJFA 4YJ2F 1A3GA 1GK9A 2D3OW 5HNEA 1H2NA 1KBHA 1TAEA 3JALB 5KA5A 3AEIA 1CKNB 3UO2A 1Q43A 1S5LZ 1Y74B 3RBZA 1I2KA 5K3WA 4FLUA 2L6LA 3ZMUA 2EBOA 2BOBC 1FJGO 2YZGA 2KQXA 4JTDB 2ITDC 3N2GA 3ZEDA 4PD4F 1VQLV 4I5SA 3WB1A 5A2QN 4TT3G 1AB3A 1XEQA 4Z1VA 1XNQB 1Y76A 1A0IA 2DYSC 4O2AB 3BFRA 4FJCC 4LNUA 4O7YA 4CZZA 1K4DC 3K9SA 2YZLA 3OUFA 1YF2A 5IJ9B 4C5AA 5EYPB 2R9IA 2WA4A 1K7DA 2UUCB 4GKKO 4JI8B 1HNXO 4O2AF 4YIOA 3TIGA 3BEHA 4FIPC 2COJA 4IL6Z 4TSFG 1DF4A 1U97A 1KP3A 2DW4A 5BWWA 4CH3A 4I4TB 4J80A 5KHIA 1AI7A 4OX9B 2JS5A 3ASOC 3ZMZA 1BE3H 3CCVV 2IW5A 4RO2A 3TCUA 3AG2C 1P84F 1SQXH 2EILC 4ZHQB 2R9AA 1P7GA 5JVLA 4I4TF 3OEHG 3PFFA 4IYHA 5EIBC 3E89A 2HHHB 1I0HA 2LW1A 4LWSB 2W6OA 1M0TA 2ZCEA 4NXMB 4NYEA 1WN7A 3W7UA 5E79Z 1AJPA 3MDSA 4JI1B 1TUEB 4MVZA 5H9CA 2OYQA 4DV5B 1ZWIC 4FFBA 3DTFA 3BY6A 1HP8A 5FL7G 5GTIZ 2PF4E 1EBOA 1CXZB 4YAJB 3L75H 5K1XA 3ETQA 2F95B 5LMNO 2W70A 4N21A 4MV1A 2YYAA 1RP3B 2M7WA 1XMOO 3H1JH 2F1MA 4O84A 2DJVA 3FX7A 3E83A 3WNZA 4PELA 2EIJB 4J11A 3VNNA 3CS5A 3T9CA 5J2UA 1LUWA 3JAWB 1VF7A 4UCRA 4HNAB 4BIUA 4DV2O 1N34O 3PN1A 4MS2A 2FYUH 1F51A 3AK3A 4PJ0Z 3VOTA 1M1KW 1O9HA 2NNUA 1NI8A 1M90W 1V54C 3T4ZA 4OPAA 3FFQA 2DMXA 5BPHA 1AVMA 3IC9A 1US6A 1MABG 1I5XA 1BMFG 1KQSU 1VF5B 2P90A 3F5WC 1FYJA 1KUTA 5E25A 2ZDQA 1SZTA 1Q5OA 4UV9A 4TV9A 1WAZA 1XREA 1S3JA 3G4SV 5B1BB 5C1OA 2X0SA 2YIAA 3LSUA 4NVPA 4LCUC 2R84A 1EN4A 4JI0O 3H01A 5CB4B 1QLNA 2PBZA 1CQIB 4I9WA 3WO0A 2YICA 1GMGA 3CEBA 2A06H 4M0JA 2DN9A 3CB2A 2UUBO 1QVGU 1BNCA 4J7KA 1K97A 1T5EA 1AI5A 1PKXA 4JI3B 4CHIA 5LXTA 4H37A 4W4KA 2JK5C 2P7TC 2QE7G 2B1GA 3JD1A 4TUYA 3S3XA 4U3JA 1X4TA 2QA4V 4C7UA 4NXNO 2QWQB 2M6YA 2EIMC 1VKZA 4TV8F 4IGGA 5JH7A 1BHAA 5C8YF 3CP1A 4XYMB 4FFOA 5IWAB 2FTKA 2PTMA 1CKMA 5JQWA 4KHPO 4NZNA 3L72H 3K59A 3LNMB 3HKEB 3K03A 1MMMA 5IT9N 5JJEB 3OR6C 4LFCO 2NN4A 5LYJB 1XUQA 2YXLA 2C00A 1MNGA 2QM8A 2G38A 5J9PC 4LR3A 2A1HA 4ZI7A 1PL0A 2GTAA 1KTAA 4UCVA 3M99B 5D1PA 3TY8A 1SS3A 3JCZA 1H8EG 5ITZA 3SGIA 4JYYA 2IJJA 3QO8A 2X5RA 1TA8A 4EFEA 3CCQV 2E74B 2JGDA 3U11A 1VMGA 1EKPA 1A32A 3OW2U 2QJ1A 4X1KB 5EZYA 2HJDA 3OMIB 3LDCA 2NU8B 4RCNA 1ZSPA 4I55B 4JYAO 4O4HB 2PGGA 4E4TA 2VPQA 3G6BA 4UFZA 3CRMA 3VQVA 1JR9A 2HJFC 4O4HF 4TM5A 2AZ0A 4O86A 1O9GA 3IGAC 2ZXWB 3HT5A 1CS0A 3VQWA 4I7ZB 1YSCA 2HVSA 1F23A 4YB8B 4B3RO 3AG3C 2ZDGA 4FLWA 2Y0IA 1Q3EA 1K8AW 1PNKA 2PY5A 4DR3O 1OCOB 4DIMA 3JYCA 2DYRC 1GSAA 1S68A 3SPIA 4FGRA 2QR4A 4NTXA 1YIJV 2QKCA 4K8ZA 5GW7A 2DABA 4NR1A 4LF4O 4FM0A 4DK0A 1VBHA 4E6NA 3FD9A 1XBLA 4UB6Z 2F23A 2DYSB 3FB8C 3I56V 1HR0B 1UPGA 3NC0B 4YBZB 5BWVA 3U0GA 4G2KA 1GM7A 3ORQA 1WRVA 1GN2A 4WFFA 3B09A 2PN1A 5LL6Y 1WNSA 3BA8A 2K9PA 5IJ0A 4JI2O 3QTCA 3ASOB 1DV2A 1FKAO 3APQA 3OAAG 4LFBB 3UCSC 2ODTX 2ZINA 3AG2B 2QGNA 1URFA 2EILB 3B40A 3C3SA 4JI7B 2D2CB 4D6TH 4MSWC 5J2TB 4U7NA 4DXWA 3SPCA 3LWBA 2WLIB 5LA6B 2VS0A 1KJ8A 1OZ0A 2NLJC 1BSMA 4DV6O 1GN4A 3W5OA 1N32B 3BVOA 2OCCC 1OCZC 3J80N 3BPZA 4JYBA 3T99A 1IOVA 2RNBA 5LA6F 4YAKB 2CUGA 2CGOA 1VARA 3IC7A 3UM7A 1YHQV 5BR8O 2YS7A 1QVFU 2Q7EA 3T9FA 2W6IG 1I5YA 3FB5C 3QWUA 2VQFB 5LMUB 3T9EA 2VQDA 1G4YB 1IBMO 3CCJV 4GKJO 2EULA 4E2LA 4DUZB 2DWDC 4EGQA 2X0LA 5L3GA 4Q4DA 5CA1B 3T1YO 2EX3A 1VBGA 3KCXA 2WLLB 1OCRB 1ROPA 2HLDG 2BSKB 3BG5A 1GM9A 1CP9A 4X65B 2CNVA 1OCCC 3N8DA 5CA1F 2IH1C 2ZIMA 5TISZ 4DRXA 4IIJA 1CQJB 1WR2A 3T9AA 1WJZA 2HFEC 4YJ3A 2H3OA 2LGQA 2X7RB 1QBZA 2W0XA 3K0GA 1V54B 4B3MO 1KJ9A 1NT2B 5EBMC 1K9MW 3IJ4A 2ZE8A 1VF6C 4FFRA 3CCLV 2PYLA 1GH6A 1MOFA 5DM6V 1DIKA 3RT3C 1Z5WA 3T1HO 2IJHA 1JCHA 2FPIB 2YC0A 4QPJA 4X1IB 3EFFK 1IOWA 4ASUG 1N33O 3CJHA 3VQXA 4LFAB 5CBGA 1LR1A 4O4IB 3RYIB 1GSOA 1K5SA 1VQ7V 4BW5A 1IURA 2I8CA 2LP7A 1IX9A 1WPBA 1YTFB 4X20B 5KX5B 2ZE7A 4O4IF 3ABTA 1BGYH 4O7LA 5BMVA 2E76B 5GONB 5H5NA 3OT7A 3U9TA 3U9SA 4GX1A 4MV7A 3T9BA 2P4VA 3DTGA 2EIJC 2GDSA 2LFSA 4DR1O 5KX5F 3HBLA 3J7AU 1PX2A 4QIWF 4O7VA 3QVNA 1J5EB 1CKOA 5GONF 5I47A 2WPDG 4DR4B 4WHXA 4FZ1A 3SJAC 1QR9A 1SA0A 2IJIA 4X1YB 4LF7B 2WLMA 1KKCA 1RPOA 2Z04A 4QJFB 1OJHA 4AQYB 1DAAA 5B66Z 2F4VB 3SPGA 4FLZA 1PNMA 1OHHG 1KB9F 1B6QA 2AXTZ 2P6JA 1TVKB 1PNLA 1R6TA 4MAMA 1A48A 2DIKA 3J81N 3DXRA 2IP4A 4LBEC 5D5PA 4JZ2A 3QFFA 4JI4B 4RQEA 4UVAA 1E4EB 1NKDA 3KCYA 2UXCO 1XHZA 5JCOA 4CMDA 2RMKB 2KSDA 3LQSA 1GN3A 4MTGA 1CE8A 3CMAV 2HHFA 4FU0A 3N27A 3RYHB 2ADQB 1EN5A 1D2DA 4YHHO 3JARB 5CBHA 3RYCA 1W59A 3LSQA 4JYCA 1I2LA 4B08A 3VPDA 3CCEV 1JPXA 3GWKC 5EBWC 1YI2V 2EIYA 4P9PA 1IDSA 2CAZC 3QG5A 1WP7A 1SC5B 4IWYA 2X6AA 3MHSC 4DRFA 2DOSA 2DE0X 3NBYB 3AG3B 2HGXA 2HIVA 1E79G 5FPRA 1G1XB 4GKKB 3JALA 3P3NA 2YEVB 4CMFA 3CRQA 1HNXB 3LP8A 4DV0O 5CA0B 2GUZA 3THOA 1YJNV 4ME6A 1BL8A 3OEEG 4ZBMA 1GRJA 3WG7C 4K8XA 2YXHA 4O82A 5DN6G 2COIA 3A2FA 3FYEB 1ZX3A 2X6BA 2A79B 1Q86W 4B7KA 2QEXV 2R7MA 2QKSA 3TQTA 4FFMA 3G6EV 1PK8A 1JQ0A 5H2FZ 5CA0F 3DC6A 2GQSA 4Q4CA 4RUFA 1F7YA 2IH3C 2P5OA 2Q0AA 5GTHZ 1I94O 3SPJA 4EKWA 4QSHA 3R66A 5LHGA 4PBCA 1WA8B 3G80A 4J7JA 3RYFB 4LF6O 1R3LC 4DV3O 3EVKA 5JVDB 2OTLV 5BWXA 5EIBD 3GVMA 3JSLA 1H2GA 4DUYO 2OTJV 4NKGB 4IHJB 1W96A 4OGQB 2YRXA 4UCSA 4MV3A 3WWJA 3TEKA 2DLNA 4EG0A 2CH7B 4CBCA 5BYBA 1AJNA 5CN0A 4WFBV 2NU6B 2A3QA 3HPLC 5JVDF 2X6CA 2DQ3A 2XAFA 4ZHQA 1WP8A 3F5TA 5LMNB 1TGOA 2ZXWC 3ZCCA 4X9QA 3HB3B 1SQVH 1YXBA 4HYOA 1XMOB 4L1KA 2XCLA 3IFXA 1XI1A 3JZIA 1P7BA 4MVSA 4WF9V 1Q7YW 2R7NA 5KHHA 2OCCB 1OCZB 4RQFA 3G8CA 2HKOA 4O2BA 4XDKA 3V4ZA 3OUSA 4B7EA 3N6RA 1OCOC 2UUAO 4DV2B 1GKFA 3T1CA 1N34B 2V7QG 1P16A 4WBNB 2EJ3A 4PHZA 4WFAV 1DTOA 2Z02A 2HP8A 2QTOA 1EFRG 3U54A 3CXCU 1SKVA 5CBFA 4ZIBA 2KKWA 2CZGA 1V9PA 2UXXA 3CRCA 4WBNF 1FAFA 1AP6A 3OTFA 3K79A 5C1PA 2XAHA 3EXAA 3UT5B 3AG4C 4GX2A 4MV4A 4BW9A 2YXYA 1VQ8V 1UC8A 1U96A 5I5WA 2OWOA 1IYDA 5EBLC 1OCCB 4HNAA 2QSAA 3OGIB 5L3BA 3DTUB 2LW7A 4HNVA 3QF7A 5HBRB 1TUBB 2JDIG 4MVRA 2ZNJA 1QLEC 3VOUA 3T7AA 3K5MA 4JI0B 1W0JG 2XUMA 2R72A 2HVQA 1XNRO 3RGBA 2ZIOA 2UXBO 2IM9A 3APOA 1S76D 3LULA 2ABJA 1BS3A 3W7TA 2R86A 5D1OB 3CC2V 1KEEA 2Y48A 4JAUA 3HO8A 4UUGA 4DR7O 1H2SB 2KB1A 5FLXN 1KYOF 2BTOA 4BWAA 4NXNB 3SR2C 4KP4A 1M5IA 2RJZA 3T2MA 1K4CC 3I55V 1IBLO 2VUGA 4DK1A 5CB4A 4FM2A 5L3FA 3JZ6A 1BCCH 4X88A 4KHPB 4I50A 1W93A 4FZ0A 5L3CA 4MTFA 3CSWA 4LFCB 3DC5A 2F93B 3UO3A 3D36C 1OCRC 4JV5O 3ML0A 3OFNG 2V58A 3CPWU 3OUZA 3N2GB 2VQEO 4UVBA 1AILA 1H2LA 3ZRWB 1LUVA 1PM9A 4XZ3B 1Y76B 3MWDA 5CE8A 5FPOA 1NS1A 4TQFA 1C30A 2Q6AA 2YI8A 4LNUB 4O7SA 4B3SO 3ETGA 3HB9A 4BIOA 4JPRA 4CS3A 2ZR2A 4HN2A 2P06A 3SDLA 1SCUB 2YDEA 1FPOA 5LYJA 1J95A 1VQKV 1YITV 4XX0B 4JYAB 1GAXA 3V4SA 1R73A 2L35A 1VQMV 1PD3A 2P0AA 1Y4MA 3SPHA 1I1LA 3JD2A 2SCUB 1GM8A 3UZOA 5BXZA 3ZMTA 1KBLA 4KFMA 1GSHA 2QM4A 2WSSG 1K33A 3HKCA 3R5FA 1YZBA 3MD0A 1QHTA 3CEIA 3DF7A 4JI8O 2ZKOA 1AR1B 2YUAA 2QWOB 3CRAA 3JCUZ 3LNNA 2QTSA 4TV8B 4I55A 3KAKA 3A0HZ 3I5DA 3ABLC 4B3RB 5C8YB 1Q6IA 4FFBB 2VWKA 3TW6A 5JQGA 4IWXA 4DR3B 1NH2B 1FXKC 3F7YC 5CM0A 4KXRA 1I7FA 1EKVA 4LF5O 4PZ7A 2NU7B 4J9YB 4DR6O 2CTQA 1I08A 2UXNA 4DR5O 4EQ5A 3K9AA 2Q4PA 3OD4A 1ORQC 1FFXA 5DGHA 3CE2A 1PV0A 1A0GA 2BCCH 2PUSA 3STLC 1NR1A 5IYZA 2DQ0A 2AZ2A 4GZRB 2GSMB 3BHPA 2BTQA 2Q68A 2Q8VA 3A0BZ 4FPPA 4JAVA 5J2UF 5BWRA 1K5QA 3OR7C 3WG7B 2CDYA 4FFPA 4J42A 4MT8A 4JI2B 2HG8A 4QNHB 1NZ6A 2R87A 2HDKA 2EJRA 4WFGA 2Y4UA 2ZDHA 4Z1MG 3GJXB 1B6SA 4HZ3A 4ZQIA 1N0NA 1VQ9V 2BOCC 2Y69C 3BRCA 4TV9B 2I87A 4CKBA 3F7VC 2ZGIA 1HNWO 2YIDA 5A9GA 3ZMSA 1AJQA 4DV6B 4GX0A 1JMKC 5KS8A 1Q82W 5K1PA 1P49A 3FB7C 1K3EA 2UXDO 2XTAA 4TV9F 3CWBH 5LGTA 1XOUA 3SYQA 5BR8B 3RVZA 5DECA 4JI5O 3NR7A 1BXRA 3ZS8C 1D5NA 1Z2NX 2B5UA 2ETNA 5J2TA 1IBMB 4C5BA 5LXTB 1S5HC 4JXUA 4GKJB 4TUYB 4U3JB 5LOVA 3T1YB 2IU0A 1G2WA 1EYZA 2EJ0A 4DV1O 1E1QG 2AW9A 5LXTF 5JH7B 2ATKC 1PPJH 1COWG 4TUYF 3HKDA 3KYHC 3ETDA 4MV6A 2JEUA 1MSWD 5I5VA 2FB9A 3B4SA 3AG1C 3CD6V 3D8CA 2J9GA 2NR5A 4GLXA 3ZHSA 5JH7F 1KJIA 2RQ6A 1GN6A 4NB5A 4C5CA 1X9NA 4B3MB 1OBDA 2KG7B 4Q6GA 1XMQO 2ARHA 4DR2O 2Z5UA 3AG4B 4PA9A 4L8JA 1WB7A 3T1HB 2RCVA 1CPYA 3U10A 4NZOA 3W1GA 3TIIA 1AUVA 1XILA 2XOKG 2CNQA 1K92A 4K35A 1THZA 2E75B 2CTWA 2V1DA 5ITZB 2MK3A 1N33B 1JFFA 4ZI7F 2GHYA 2R70A 4XYLB 2JGDB 2WYOA 3JAMN 4XDJA 5JCOC 1QLEB 3HR0A 1R6KA 5EZYB 4CC5A 1YEWA 2JEXA 4GUNA 4UVCA 1Q81W 4JF3A 1EN6A 1BQZA 3E8BA 3GLKA 3H1HH 4DO2A 4LF8O 2DZDA 3JATA 4DV7O 3ZRXA 4NTYA 5EZYF 3E35A 5HFLA 4EB6A 1DV1A 2HGWA 2FB5A 3E8FA 4QGPA 2PYJA 1XHXA 4ZOLA 5LP6A 2FPPB 4EEQA 1KKDA 1LNQA 1Q8IA 2CK3G 4BAYA 5BYAA 3AW8A 1ULZA 3RN4A 5E1AC 4EFBA 2JRIA 3BCCH 2XT9A 4I0XA 2W6NA 2EINC 3D3QA 2W6MA 5B1AC 4X62O 1SQGA 1KD1W 3N2KA 2ZT9B 3JAKA 2XAGA 5DMXA 5CA3A 3RV3A 1VQNV 3ZHTA 3JD4A 3Q4HA 1HNZO 5FR9A 3NUAA 2IU3A 2W6JG 3RW0A 2AHZA 5FNVA 3CYOA 2E5LB 4LF9O 3FAVA 2YZNA 2JVDA 4FMTA 3T9DA 3JASB 2ZNIA 4RWUA 3MHHC 1DF5A 3W7XA 3K08A 3L9DA 4B3TO 4X1YA 3K57A 5KUMA 2Q0OC 4I9QA 4O4LA 2W6PA 2UXCB 4YXWG 4MA5A 1VEWA 4RZQA 3CCSV 2AGAA 5IJ0B 4PA6A 3SNOA 2HIXA 3B8NA 4JI6B 3M7MX 2XD4A 3ABMB 3K3WA 2GPWA 2YSUB 4YHHB 1EHIA 1NTZH 2R7KA 3RV4A 2GPSA 4EGJA 2WAMA 3E22A 2R9RB 1Q6HA 2YI9A 2FP4B 1F4NA 3QNEA 1IYEA 2CNUA 5BY1A 3SJBC 4O7NA 4H44B 4DW0A 1FVIA 4MW3A 1M56C 1KC8W 2GBOA 3ABLB 3B8MA 3NXSA 2CE4A 1R3KC 2COGA 2LGWA 4LFBO 1K34A 5IDJA 1FXKB 4CH5A 3VMMA 3KZIZ 4DV0B 5I5YA 2Y4TA 3ZN1A 1UFIA 5B3SC 1IXMA 2H8PC 3JSNA 1ENVA 4G28B 3OMAB 1M9NA 3STZC 3T4DA 2ZM6B 1GTOA 3C90A 2XHBA 1M4UA 3OTOO 2CGNA 1R3JC
chains in the Genus database with same CATH topology
4DV2B 1I94B 1N34B 2EJ3A 4WBNB 5CB4B 3B2EE 4PHZA 4DRXB 4IIJB 5BWUA 4LF6B 1M93A 4DV3B 3WWIA 4LH7A 4O4JA 3CEBA 2PZSA 1SKVA 4M0JA 4ZIBA 2KKWA 3CB2A 1V9PA 2Q7GA 3SJCC 1T5EA 4F6RA 4DUYB 4JI3B 4CHIA 5LXTA 4X1IA 3OTFA 1HW7A 4TUYA 4FM1A 3UT5B 4U3JA 4DR1B 1X4TA 4BW9A 2JGUA 1UC8A 2EJ2A 4O4IA 3RYIA 5I5WA 5JH7A 2OWOA 1IYDA 1KMIZ 4HNAA 5LOVB 4TQDA 2PTMA 5IWAB 3BABA 2E3CA 5D5QA 3QF7A 4X20A 1TUBB 4NZNA 3K59A 3HKEB 5KX5A 3OTOB 5JJEB 5KMGB 4FLXA 2ZNJA 2UUAB 1RSOA 3T7AA 5GONA 3HKDB 5LYJB 4IHJA 3K5MA 2YXLA 1FJGB 4JI0B 4CKCA 2R72A 3RGBA 2ZIOA 4UCUA 2IM9A 4LR3A 3LULA 2A1HA 4K6NA 2ABJA 4ZI7A 4YJ2A 1KTAA 4UCVA 3DAAA 5BMVB 4UUGA 5ITZA 1H2SB 1L8DA 2BTOA 3SGIA 4BWAA 4NXNB 4GLWA 2X5RA 1TA8A 3SR2C 4EFEA 2F66C 3K5LA 4D7TA 3U11A 3VQYA 1M5IA 1EKPA 1XQ8A 2QJ1A 3HKBB 4X1KB 2RJZA 5EZYA 4WBNA 4UCOA 4RCNA 1SA0B 4DK1A 1JFFB 5CB4A 4I55B 4FM2A 3JZ6A 4KHPB 4O4HB 4I50A 1N36B 1TVKA 2PGGA 3CSWA 4LFCB 2F93B 4UFZA 5KHKA 4O2AA 3VQVA 4YY3B 1XNRB 4TM5A 3N2GB 3UT5A 2UXBB 3JATB 5K2MA 5IJ9A 3BA9A 3UQ8A 1O9GA 4EB6B 5EYPA 5CE8A 5FPOA 5DGIA 3HT5A 4TQFA 3VQWA 2YI8A 4LNUB 4ZOLB 2QB5A 5LP6B 1TUBA 4CS3A 4I4TA 4FLWA 2YIBD 3RYHA 4HN2A 1Q3EA 5KMGA 2PY5A 1G6UA 3JARA 1IBLB 5LYJA 1JJOA 5CR5A 3WB0A 5JJNB 4JYAB 4K8ZA 3N2KB 2DABA 3TW7A 3JAKB 4FM0A 4DK0A 1I1LA 4DAAA 4X66B 3UZOA 1HR0B 5FNVB 2QM4A 3IAYA 5BWVA 2Q7DA 2VQEB 1ET0A 4TOIA 2DAAA 3U0GA 5KHJA 1WRVA 3HKCA 3UZBA 1QHTA 4YJ3B 4FLVA 3HKBA 2Q7HA 5CA0A 1WNSA 1S5JA 3BA8A 3LNNA 4B3SB 5IJ0A 4TV8B 3QTCA 4I55A 4CS4A 4B3RB 4CC6A 5C8YB 4FFBB 4O4LB 2VWKA 4LFBB 2HEPA 5JQGA 4IWXA 2ODTX 4DR3B 2ZINA 4TVIA 5CM0A 1B04A 1KT8A 4X64B 3T54A 4JI7B 1I7FA 5J2TB 1EKVA 3JAWA 5LA6B 3RYFA 1N32B 3QQMA 1FFXA 3BPZA 3E22B 5DGHA 5JVDA 3T99A 4CH6A 1A0GA 2PUSA 4CH4A 4NZMA 5IYZA 4DV4B 2Q7EA 5I5TA 3T9FA 3WB2A 3BHPA 2BTQA 2VQFB 5BWRA 5LMUB 2UUBB 3T9EA 1QQCA 4JI2B 3K58A 4DUZB 2HG8A 2HDKA 4Q4DA 5CA1B 2EX3A 4UCTA 4LF5B 4X65B 1Z5VA 4DR6B 3BRCA 4KL1A 4TV9B 4AILC 4CKBA 2ZGIA 2ZIMA 4K0KB 1I1MA 4DRXA 4IIJA 4DV6B 4DR5B 3T9AA 4YJ3A 1JMKC 5KS8A 1KU9A 4FVMA 4O2BB 5K1PA 1P49A 3WWHA 1NT2B 4TV8A 5BR8B 5C8YA 1SQFA 3MAQA 2PYLA 1IBKB 1Z5WA 4O4JB 3ZS8C 2P22C 4F6RB 5J2TA 1IBMB 5LXTB 4JXUA 4X1IB 4GKJB 4TUYB 4U3JB 5LOVA 3T1YB 4DR7B 1G2WA 4CE5A 3VQXA 4LFAB 3ICXA 3HKEA 2EJ0A 4FLYA 4O4IB 3RYIB 5I60A 5JH7B 3HKDA 1HNWB 1WPBA 5I5XA 5I5VA 4X20B 4D7SA 5KX5B 2HHFB 2Y4RA 4GLXA 5BWTA 2RQ6A 5DAAA 2UXDB 5BMVA 5GONB 4B3MB 3RYCB 4Q6GA 4JV5B 3T9BA 3DTGA 5I5SA 1D5AA 4JI5B 4L8JA 3T1HB 3BAAA 4YJ2B 3U10A 4NZOA 5I5UA 1J5EB 2UU9B 5I47A 4X1KA 4DR4B 4WHXA 3SJAC 5ITZB 1EKFA 1N33B 5LP6C 1SA0A 4X1YB 1JFFA 4LF7B 2R70A 4O4HA 3K5NA 1A3GA 3DSQA 5HNEA 4AQYB 1TAEA 3JALB 4DV1B 1DAAA 5JCOC 5EZYB 2F4VB 4CC5A 1Q43A 1YEWA 4FLZA 1I2KA 5K3WA 4FLUA 4I50B 1TVKB 3N2GA 4PI2A 3ZEDA 3JATA 3CHXA 3WB1A 4LF4B 4EB6A 1XNQB 4HBNA 2HGWA 4O2AB 5D5PA 1XMQB 2PYJA 1XHXA 4DR2B 4LNUA 5J2UB 4ZOLA 3UYYA 1ZAUA 5LP6A 4JI4B 5IJ9B 4EEQA 5EYPB 2UUCB 4PI0A 1Q8IA 1XHZA 4JI8B 5JCOA 4CMDA 5BYAA 2COJA 3LQSA 4DQNA 4EFBA 5BWWA 2GV9A 3K5OA 4CH3A 4I4TB 5KHIA 4OX9B 2JS5A 2HHFA 1SQGA 3RYHB 3N2KA 3JAKA 3JARB 5FR9A 3U0ZA 3RYCA 4ZHQB 1I2LA 2R9AA 4B08A 5KHGA 5FNVA 2E5LB 3VPDA 4LF8B 3PFFA 2V4DA 5EIBC 2JVDA 4DV7B 2HHHB 3T9DA 3JASB 2ZNIA 3BACA 2EIYA 2ZCEA 4NXMB 2CAZC 1WN7A 3QG5A 4IWYA 4JI1B 4X1YA 3K57A 2OYQA 4GYCB 3HKCB 2HGXA 4DV5B 5FPRA 4FFBA 4I9QA 4O4LA 3JALA 4GKKB 2UXCB 3DTFA 4CMFA 1HNXB 3CSXA 2VWJA 5CA0B 3THOA 3RWRD 5K1XA 3ETQA 2F95B 5IJ0B 4K8XA 3SNOA 1UC9A 2COIA 4JI6B 3M7MX 3A2FA 5LA6A 4X62B 4FLTA 5JQGB 2F1MA 4YHHB 1HNZB 1I1KA 4Q4CA 2YIBA 5JJJB 2P5OA 3E22A 2Q0AA 4AHCA 5J2UA 3T9CA 3JAWB 4UCRA 1VF7A 2YI9A 4HNAB 4LF9B 3PN1A 4PBCA 3RYFB 1IYEA 1O9HA 3SJBC 1FFXB 5JVDB 5BWXA 5EIBD 3JSLA 4B3TB 4IHJB 3FFQA 4UCSA 5IYZB 3WWJA 3TEKA 2COGA 5CA1A 5BYBA 2BTQB 4CH5A 4ZI7B 4DV0B 5E25A 5I5YA 3RFRA 4ZHQA 5LMNB 1TGOA 1Q5OA 4LH6A 4TV9A 1DGSA 3JSNA 1XMOB 4CKEA 4CS2A 1XI1A 2ZM6B 2XHBA 3JASA 1M4UA 2YIAA 5KHHA 4NVPA 4O2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 B;  4DR5 B;  4JI8 B;  4DV2 B;  1I94 B;  1N34 B;  4LF6 B;  4EFB A;  4DV3 B;  4LH7 A;  1IBL B;  4OX9 B;  5BR8 B;  1V9P A;  4DUY B;  4JYA B;  1IBK B;  4JI3 B;  4DR1 B;  2E5L B;  1IBM B;  4X66 B;  4LF8 B;  4GKJ B;  4DV7 B;  2HHH B;  1HR0 B;  3T1Y B;  4DR7 B;  2OWO A;  2VQE B;  3BAC A;  4TOI A;  4NXM B;  4LFA B;  5IWA B;  3BAB A;  4JI1 B;  3OTO B;  1HNW B;  4DV5 B;  3BA8 A;  5FPR A;  4B3S B;  4GKK B;  2UXC B;  2UUA B;  1HNX B;  4B3R B;  4CC6 A;  4GLX A;  1FJG B;  4JI0 B;  4LFB B;  2UXD B;  4UCU A;  4DR3 B;  4B3M B;  1B04 A;  4JI6 B;  4X64 B;  4JV5 B;  4JI7 B;  4X62 B;  4UCV A;  4YHH B;  4JI5 B;  3T1H B;  3BAA A;  1HNZ B;  1J5E B;  2UU9 B;  3SGI A;  4UCR A;  1N32 B;  4LF9 B;  3PN1 A;  4NXN B;  4DR4 B;  4GLW A;  1TA8 A;  4EFE A;  1N33 B;  4LF7 B;  4AQY B;  1TAE A;  4DV1 B;  4UCO A;  4DV4 B;  3JSL A;  4B3T B;  4KHP B;  2F4V B;  1N36 B;  4CC5 A;  4UCS A;  2VQF B;  5LMU B;  4LFC B;  2UUB B;  4JI2 B;  4UFZ A;  4DUZ B;  4DV0 B;  4LF4 B;  4YY3 B;  1XNR B;  5LMN B;  2UXB B;  1XNQ B;  4LH6 A;  1DGS A;  3JSN A;  1XMO B;  3BA9 A;  3UQ8 A;  4UCT A;  1XMQ B;  4DR2 B;  4LF5 B;  1ZAU A;  5FPO A;  4X65 B;  2ZM6 B;  4DR6 B;  4JI4 B;  4K0K B;  4EEQ A;  2UUC B; 
#chains in the Genus database with same CATH topology
 5BZB A;  2W6Q A;  4QE7 A;  1I94 B;  1ZL8 A;  5BWU A;  4AI8 A;  4IIJ B;  4DRX B;  2ITC C;  5F2V O;  5LGU A;  4LF6 B;  1M93 A;  4DV3 B;  3AG7 A;  4LH7 A;  4O4J A;  2PZS A;  3VBB A;  2Q7G A;  3SJC C;  5LGN A;  1NVP B;  4F6R A;  4DUY B;  4DUZ O;  1QCE A;  4IIJ F;  4PDV A;  2Z3Y A;  4J7Z A;  4YJ3 F;  3PJS K;  2EJ2 A;  2Y69 B;  2QDO A;  4P30 A;  3S24 A;  2QWP B;  3ABK C;  5H6R A;  1DK1 A;  2PVP A;  3CJH B;  1PL4 A;  2E3C A;  5D5Q A;  1N36 O;  4UV8 A;  2C2A A;  1A9X A;  3SJQ C;  5KMG B;  3B77 A;  3ZHU A;  1ZLZ A;  2UUA B;  1BZK A;  1RSO A;  4IHJ A;  1FJG B;  4CKC A;  4YY3 O;  4DYL A;  4UCU A;  4PA3 A;  1XDN A;  4YJ2 A;  2N05 A;  3DAA A;  5BMV B;  1N4C A;  1W0K G;  2XND G;  4GT1 A;  1RM1 B;  1S72 V;  1L8D A;  3UFX B;  4R7C A;  1H8H G;  2Q2U A;  4GLW A;  4A5U B;  5BMV F;  3K5L A;  4D7T A;  1CKN A;  3HKB B;  5IE9 A;  5IY5 B;  2FKX A;  1Y74 A;  4WBN A;  1EZV H;  4UCO A;  1SA0 B;  2WLH A;  1ARO P;  5KA6 A;  3AG1 B;  1Y67 A;  5LHH A;  4WCE V;  1MG1 A;  2HVR A;  4X66 O;  3O65 A;  3GDE A;  5KHK A;  2QWN B;  4J9Z B;  4O2A A;  1Z2O X;  2O57 A;  4UUJ C;  1XNR B;  2UXB B;  3UT5 A;  2GQR A;  5K2M A;  5IJ9 A;  3BA9 A;  3UQ8 A;  3JZF A;  2DWE C;  5EYP A;  5DGI A;  1RFY A;  4MV9 A;  4IT5 A;  3L74 H;  1B3Q A;  1EZJ A;  4E4E A;  3W7S A;  1TUB A;  3OE7 G;  2Z0A A;  4I4T A;  4AQY O;  2YZM A;  2YIB D;  1YJW V;  2HJW A;  4NTW A;  4DLK A;  4G27 B;  4X64 O;  1IBL B;  1JJO A;  1WPX A;  1Q90 D;  5H6Q A;  3ZX6 A;  5HFM A;  3H1L H;  3K06 A;  1X59 A;  1R6N A;  4LWS A;  1S0V A;  5L3D A;  5KAF Z;  4ABM A;  3ZHR A;  1EUD B;  2Q7D A;  2VQE B;  2A0L A;  3R5X A;  2DAA A;  5KUK A;  2OCH A;  3UZB A;  4DV4 O;  4JAS A;  4O83 A;  3KKY A;  1JA8 A;  3KRE A;  1JLL B;  2W71 A;  2Q7H A;  4B3S B;  2V59 A;  1T36 A;  5JWP A;  2EIN B;  4CC6 A;  5B1A B;  1PP9 H;  3ORR A;  2HEP A;  4N23 A;  4RAI A;  4P9O A;  1B04 A;  2GUZ B;  3T54 A;  4JGS A;  3ABU A;  1B6R A;  3R5H A;  3JAW A;  4F4L A;  4K0K O;  2JJ2 G;  1BHB A;  3ZRW A;  4WFE A;  4QPK A;  4MVM A;  3WO1 A;  3QQM A;  5C93 A;  2QWR B;  4CH4 A;  5EK0 A;  1C3O A;  1IBK O;  5I5T A;  3ZHV A;  1KJQ A;  3WB2 A;  3E8H A;  2ODM A;  4MV8 A;  3ZRV A;  2UUB B;  4ZKI A;  2LJ2 A;  1QQC A;  3P3P A;  3WU2 Z;  1YTF D;  2YWV A;  4Q20 A;  3ASN C;  1JOY A;  4FE2 A;  3G71 V;  3SE7 A;  4LF5 B;  1Z5V A;  4DR6 B;  4KL1 A;  3VPC A;  3W7W A;  4MTX A;  1W2B U;  1I1M A;  4DR5 B;  4ZHQ F;  1KU9 A;  4R8C A;  4IZO A;  4O2B B;  3H1K H;  2QF7 A;  3WWH A;  4TWK A;  1M56 B;  1MZF A;  4TV8 A;  3ZJZ A;  5C8Y A;  4F6E A;  1SQF A;  4X8A A;  4KUM A;  4O2B F;  4PDR A;  2ZDI A;  4L87 A;  4H0L B;  3MWE A;  2Q9L A;  5B3S B;  4IYI A;  2UU9 O;  1NTM H;  1GO3 F;  3ETH A;  1YVW A;  4JTC B;  3AK1 A;  3LSS A;  4BIZ A;  2XAQ A;  1Y6X A;  3DGE A;  1G8M A;  4PDL A;  1NVP D;  3ICX A;  3HKE A;  3E8G A;  3CXH F;  4K3A A;  1KUQ A;  4YIP A;  3JD0 A;  3RTX A;  1HNW B;  2RN9 A;  2YL2 A;  2HG5 C;  4D7S A;  4MVO A;  3K0D A;  3ABM C;  3R65 A;  3OM3 B;  5DAA A;  2UXD B;  1XNQ O;  3ZIA G;  2R7L A;  1SRY A;  2EIK B;  5I5S A;  4H13 B;  2WWW A;  5B1N A;  1D5A A;  2K1E A;  1AR4 A;  4JI5 B;  4O7W A;  1V55 B;  2UUC O;  3TET A;  4X1K A;  3TY5 A;  1KEC A;  3P30 A;  3ABK B;  4UXN A;  2NU9 B;  2AHY A;  1EKF A;  5LP6 C;  1RPR A;  1EM1 A;  4O4H A;  3K5N A;  3CCM V;  4OX9 O;  3DSQ A;  3L70 H;  4DV1 B;  1FXV A;  1HWY A;  1MZE A;  4HAM A;  4O81 A;  2P67 A;  4GX5 A;  4JTA B;  3UKM A;  4I50 B;  4PA4 A;  4PI2 A;  3TIN A;  3CHX A;  2HHH O;  4LF4 B;  1XDC A;  3LUT B;  1JVM A;  3G67 A;  4HBN A;  1NQT A;  4NXM O;  1MSD A;  5CB4 F;  1XMQ B;  4I50 F;  4DR2 B;  5J2U B;  1NTK H;  3UYY A;  1ZAU A;  4JI1 O;  1FS0 G;  2YS6 A;  4Y8V B;  4DV5 O;  4PI0 A;  2JS3 A;  2OIG A;  2WA3 A;  1H2M A;  1QU7 A;  1L0N H;  1YCI A;  4DQN A;  2GV9 A;  3K5O A;  1SQQ H;  3RVY A;  1JJ2 U;  1QR8 A;  3U0Z A;  1M57 C;  2KG7 A;  2ZE6 A;  5KHG A;  2ZD9 A;  4MTO A;  4LF8 B;  2V4D A;  5B5E Z;  4DV7 B;  3OUU A;  2R85 A;  2P4K A;  1AUX A;  1NBM G;  5LYJ F;  3BAC A;  5CMU A;  1XL6 A;  4FK5 C;  3RFC A;  4OXS A;  3ZBH A;  2CTR A;  2VR1 A;  3I12 A;  4FFL A;  4GYC B;  3HKC B;  4MVQ A;  3KAL A;  2LO1 A;  3CSX A;  2VWJ A;  1KJJ A;  3RWR D;  1N8R W;  1SQP H;  1UC9 A;  2WLI A;  5LA6 A;  4X62 B;  4FLT A;  1RM1 C;  1VP7 A;  1WB8 A;  2GTS A;  3L73 H;  5JQG B;  4XBF A;  4PA7 A;  1HNZ B;  1I1K A;  1B06 A;  2YIB A;  5JJJ B;  1AR5 A;  4I55 F;  2WLJ A;  4JAA A;  1EUC B;  4AHC A;  3SYP A;  5IY5 C;  4LF9 B;  3JRW A;  3Q1K A;  1N0J A;  5JQG F;  3CX5 F;  2CFM A;  4JZG A;  1YDX A;  3D3I A;  1FFX B;  1HDJ A;  1I7N A;  3AX6 A;  2FL4 A;  3VA7 A;  4PDM A;  3H9V A;  4PV1 B;  3O9O A;  4B3T B;  3U55 A;  2Q2T A;  1DLB A;  4JI3 O;  3CRR A;  3E86 A;  5IYZ B;  5H80 A;  3GB8 B;  5CA1 A;  1VS0 A;  3CME V;  2LFR A;  5DIS C;  2BTQ B;  4ZI7 B;  2WLL A;  3D36 A;  3RFR A;  3C3T A;  2QM7 A;  4QE9 A;  4WFH A;  1GGO A;  2BSK A;  5IYZ F;  2ZE5 A;  4LH6 A;  3X2Q C;  1DGS A;  3JD3 A;  2V5A A;  5IWA O;  4LC1 A;  4CKE A;  1VIB A;  1BQ0 A;  4CS2 A;  2JIZ G;  1SF9 A;  1BT8 A;  3JAS A;  4FFN A;  2OIE A;  2Q73 A;  2OT5 A;  4R50 A;  3S3W A;  2W6Z A;  3GB7 C;  1CEZ A;  4GCZ A;  3B2E E;  5KAI Z;  3ZHQ A;  4U7O A;  1KP2 A;  3WWI A;  1SQB H;  3FKS G;  4U3F H;  1NJI W;  3P32 A;  1K73 W;  2HR3 A;  2BE3 A;  4X1I A;  1S77 D;  1HW7 A;  2HVK C;  3ASN B;  4FM1 A;  4DR1 B;  3K3P A;  3WFV A;  5CAE B;  2JGU A;  1IVS A;  1NR7 A;  3EHB B;  3TXQ A;  4O4I A;  3RYI A;  5IYB O;  2YW2 A;  4PZ6 A;  2A7W A;  1KC7 A;  5EC2 C;  1KMI Z;  5LOV B;  1AI4 A;  2RDC A;  4TQD A;  3BAB A;  1I7L A;  1UJW B;  2R82 A;  4X20 A;  5KX5 A;  3OTO B;  5J2T F;  1SET A;  4FLX A;  3FYI B;  5GON A;  3HKD B;  5LOV F;  3CCR V;  3LDE A;  5HV6 A;  4UB8 Z;  4OPH A;  5LBQ A;  2CTP A;  4W4L A;  2Q67 A;  2LQT A;  5KLV H;  1VQO V;  4K6N A;  1FXK A;  1VQ5 V;  4MA0 A;  2ZR3 A;  2I80 A;  2PI4 A;  3ETE A;  3TJT A;  3E5N A;  3CC7 V;  1FD9 A;  2F66 C;  1F4M A;  2QKA A;  3VQY A;  1XQ8 A;  3TK1 A;  3SYO A;  1P4R A;  1SZX A;  2IJK A;  2B1I A;  1XK5 A;  4RUE A;  1JFF B;  4NYK A;  3RR5 A;  1N36 B;  4MVU A;  1E1R G;  1TVK A;  5AG2 A;  5B1O A;  4P2Z A;  2N04 A;  2DWC A;  1HR0 O;  3G8D A;  4BR6 A;  4YY3 B;  2EZP A;  3AK2 A;  2EZO A;  3K04 A;  3JAT B;  1ZTE A;  3GWO A;  1NH2 D;  1E4E A;  1Y66 A;  4HNT A;  2Y0P A;  4EB6 B;  4O7R A;  4R6Z A;  3L2P A;  4ZOL B;  4ICG A;  2QB5 A;  3JRX A;  1R3I C;  5LP6 B;  5IYC O;  3NBZ B;  1WLE A;  3QO7 A;  3RYH A;  5LHI A;  5KMG A;  2B9Z A;  1G6U A;  3JAR A;  4JI7 O;  3SYC A;  4ZOL F;  5CR5 A;  5LP6 F;  3WB0 A;  2XAJ A;  5JJN B;  4I0X B;  1OV9 A;  1JKJ B;  3FB6 C;  4MW8 A;  1H38 A;  3N2K B;  3TW7 A;  3JAK B;  5IYD O;  1IZ3 A;  2W0F C;  4DAA A;  3Q4H B;  3TGU H;  4X66 B;  1N32 O;  1FXH A;  2JJ1 G;  5FNV B;  1QNM A;  2F43 G;  1JDE A;  2NUA B;  1M0W A;  3IAY A;  2H94 A;  3FAV B;  2YRW A;  1ET0 A;  4TOI A;  5KHJ A;  2EIM B;  4YJ3 B;  4FLV A;  2YEV A;  4X89 A;  3K5I A;  3HKB A;  5FNV F;  2VQF O;  1L1F A;  5LMU O;  5CA0 A;  1S5J A;  1VQ4 V;  4CS4 A;  1SES A;  3OGC C;  5DED A;  2EIK C;  4O4L B;  1FFT B;  1H2K A;  2QK4 A;  4TVI A;  1KT8 A;  4X64 B;  1M57 B;  1V55 C;  1MA1 A;  3ZN0 A;  2EJ7 A;  1NU1 H;  2E5L O;  4X65 O;  4O4L F;  4DW1 A;  2WLN A;  1WA8 A;  5B1B C;  3RYF A;  2N74 A;  1Z2G A;  5D8D A;  3ZMV A;  3E22 B;  5JVD A;  4CH6 A;  5L3E A;  4NZM A;  3H1I H;  2Q5Z A;  1AP5 A;  4DV4 B;  2CH7 A;  3VPB A;  2VRZ A;  4HR7 A;  2PI5 A;  2FML A;  1M6V A;  5BPF A;  4Z2W A;  3K58 A;  4JI6 O;  4LP8 A;  2ZDI C;  2ZQM A;  4LFA O;  3TXS A;  2HGS A;  3E2E A;  2HVJ C;  4UCT A;  2A9H A;  1YJ9 V;  3CCU V;  1OBG A;  3OMN B;  4AIL C;  1ZUQ A;  2WLK A;  3KAJ A;  2ADP A;  4K0K B;  3R23 A;  3SYA A;  2IBZ H;  4FVM A;  1JDB B;  2GLT A;  3Q2O A;  1ZL8 B;  3RUP A;  3ZRS A;  3GID A;  1SER A;  1EZ1 A;  3MAQ A;  2FPG B;  2MW2 B;  2Q69 A;  1IBK B;  3K5H A;  2OLS A;  2ILM A;  4O4J B;  2XAS A;  2P22 C;  4XDL A;  2DYR B;  1J5E O;  5EC1 C;  3KG2 A;  4F6R B;  2YS8 A;  3DXR B;  4DR4 O;  3X2Q B;  4M9U A;  1VQP V;  1VQ6 V;  4O7Z A;  4DR7 B;  4LF7 O;  4O4J F;  4J41 A;  2ZM6 O;  4CE5 A;  3TY9 A;  4FLY A;  5I60 A;  1P8L A;  2F4V O;  3ETJ A;  5I5X A;  3R9R A;  1Z2P X;  1VF6 A;  4H33 A;  4HQ6 A;  4J10 A;  2HHF B;  2Y4R A;  4PZ8 A;  1GLV A;  5BWT A;  1AI6 A;  3QO5 A;  5KKN B;  1RSO B;  1Q6U A;  3A0R A;  3RYC B;  5D1O A;  1IXB A;  3W1B A;  3LDD A;  4JV5 B;  4HNU A;  4FFK A;  3A8T A;  4JI4 O;  1JX9 A;  3M8A A;  3BAA A;  4YJ2 B;  3CC4 V;  1XL4 A;  5I5U A;  2UU9 B;  4IHJ F;  1R1B A;  1L0L H;  4O7T A;  3L71 H;  3MJF A;  4YJ2 F;  1A3G A;  1GK9 A;  2D3O W;  5HNE A;  1H2N A;  1KBH A;  1TAE A;  3JAL B;  5KA5 A;  3AEI A;  1CKN B;  3UO2 A;  1Q43 A;  1S5L Z;  1Y74 B;  3RBZ A;  1I2K A;  5K3W A;  4FLU A;  2L6L A;  3ZMU A;  2EBO A;  2BOB C;  1FJG O;  2YZG A;  2KQX A;  4JTD B;  2ITD C;  3N2G A;  3ZED A;  4PD4 F;  1VQL V;  4I5S A;  3WB1 A;  5A2Q N;  4TT3 G;  1AB3 A;  1XEQ A;  4Z1V A;  1XNQ B;  1Y76 A;  1A0I A;  2DYS C;  4O2A B;  3BFR A;  4FJC C;  4LNU A;  4O7Y A;  4CZZ A;  1K4D C;  3K9S A;  2YZL A;  3OUF A;  1YF2 A;  5IJ9 B;  4C5A A;  5EYP B;  2R9I A;  2WA4 A;  1K7D A;  2UUC B;  4GKK O;  4JI8 B;  1HNX O;  4O2A F;  4YIO A;  3TIG A;  3BEH A;  4FIP C;  2COJ A;  4IL6 Z;  4TSF G;  1DF4 A;  1U97 A;  1KP3 A;  2DW4 A;  5BWW A;  4CH3 A;  4I4T B;  4J80 A;  5KHI A;  1AI7 A;  4OX9 B;  2JS5 A;  3ASO C;  3ZMZ A;  1BE3 H;  3CCV V;  2IW5 A;  4RO2 A;  3TCU A;  3AG2 C;  1P84 F;  1SQX H;  2EIL C;  4ZHQ B;  2R9A A;  1P7G A;  5JVL A;  4I4T F;  3OEH G;  3PFF A;  4IYH A;  5EIB C;  3E89 A;  2HHH B;  1I0H A;  2LW1 A;  4LWS B;  2W6O A;  1M0T A;  2ZCE A;  4NXM B;  4NYE A;  1WN7 A;  3W7U A;  5E79 Z;  1AJP A;  3MDS A;  4JI1 B;  1TUE B;  4MVZ A;  5H9C A;  2OYQ A;  4DV5 B;  1ZWI C;  4FFB A;  3DTF A;  3BY6 A;  1HP8 A;  5FL7 G;  5GTI Z;  2PF4 E;  1EBO A;  1CXZ B;  4YAJ B;  3L75 H;  5K1X A;  3ETQ A;  2F95 B;  5LMN O;  2W70 A;  4N21 A;  4MV1 A;  2YYA A;  1RP3 B;  2M7W A;  1XMO O;  3H1J H;  2F1M A;  4O84 A;  2DJV A;  3FX7 A;  3E83 A;  3WNZ A;  4PEL A;  2EIJ B;  4J11 A;  3VNN A;  3CS5 A;  3T9C A;  5J2U A;  1LUW A;  3JAW B;  1VF7 A;  4UCR A;  4HNA B;  4BIU A;  4DV2 O;  1N34 O;  3PN1 A;  4MS2 A;  2FYU H;  1F51 A;  3AK3 A;  4PJ0 Z;  3VOT A;  1M1K W;  1O9H A;  2NNU A;  1NI8 A;  1M90 W;  1V54 C;  3T4Z A;  4OPA A;  3FFQ A;  2DMX A;  5BPH A;  1AVM A;  3IC9 A;  1US6 A;  1MAB G;  1I5X A;  1BMF G;  1KQS U;  1VF5 B;  2P90 A;  3F5W C;  1FYJ A;  1KUT A;  5E25 A;  2ZDQ A;  1SZT A;  1Q5O A;  4UV9 A;  4TV9 A;  1WAZ A;  1XRE A;  1S3J A;  3G4S V;  5B1B B;  5C1O A;  2X0S A;  2YIA A;  3LSU A;  4NVP A;  4LCU C;  2R84 A;  1EN4 A;  4JI0 O;  3H01 A;  5CB4 B;  1QLN A;  2PBZ A;  1CQI B;  4I9W A;  3WO0 A;  2YIC A;  1GMG A;  3CEB A;  2A06 H;  4M0J A;  2DN9 A;  3CB2 A;  2UUB O;  1QVG U;  1BNC A;  4J7K A;  1K97 A;  1T5E A;  1AI5 A;  1PKX A;  4JI3 B;  4CHI A;  5LXT A;  4H37 A;  4W4K A;  2JK5 C;  2P7T C;  2QE7 G;  2B1G A;  3JD1 A;  4TUY A;  3S3X A;  4U3J A;  1X4T A;  2QA4 V;  4C7U A;  4NXN O;  2QWQ B;  2M6Y A;  2EIM C;  1VKZ A;  4TV8 F;  4IGG A;  5JH7 A;  1BHA A;  5C8Y F;  3CP1 A;  4XYM B;  4FFO A;  5IWA B;  2FTK A;  2PTM A;  1CKM A;  5JQW A;  4KHP O;  4NZN A;  3L72 H;  3K59 A;  3LNM B;  3HKE B;  3K03 A;  1MMM A;  5IT9 N;  5JJE B;  3OR6 C;  4LFC O;  2NN4 A;  5LYJ B;  1XUQ A;  2YXL A;  2C00 A;  1MNG A;  2QM8 A;  2G38 A;  5J9P C;  4LR3 A;  2A1H A;  4ZI7 A;  1PL0 A;  2GTA A;  1KTA A;  4UCV A;  3M99 B;  5D1P A;  3TY8 A;  1SS3 A;  3JCZ A;  1H8E G;  5ITZ A;  3SGI A;  4JYY A;  2IJJ A;  3QO8 A;  2X5R A;  1TA8 A;  4EFE A;  3CCQ V;  2E74 B;  2JGD A;  3U11 A;  1VMG A;  1EKP A;  1A32 A;  3OW2 U;  2QJ1 A;  4X1K B;  5EZY A;  2HJD A;  3OMI B;  3LDC A;  2NU8 B;  4RCN A;  1ZSP A;  4I55 B;  4JYA O;  4O4H B;  2PGG A;  4E4T A;  2VPQ A;  3G6B A;  4UFZ A;  3CRM A;  3VQV A;  1JR9 A;  2HJF C;  4O4H F;  4TM5 A;  2AZ0 A;  4O86 A;  1O9G A;  3IGA C;  2ZXW B;  3HT5 A;  1CS0 A;  3VQW A;  4I7Z B;  1YSC A;  2HVS A;  1F23 A;  4YB8 B;  4B3R O;  3AG3 C;  2ZDG A;  4FLW A;  2Y0I A;  1Q3E A;  1K8A W;  1PNK A;  2PY5 A;  4DR3 O;  1OCO B;  4DIM A;  3JYC A;  2DYR C;  1GSA A;  1S68 A;  3SPI A;  4FGR A;  2QR4 A;  4NTX A;  1YIJ V;  2QKC A;  4K8Z A;  5GW7 A;  2DAB A;  4NR1 A;  4LF4 O;  4FM0 A;  4DK0 A;  1VBH A;  4E6N A;  3FD9 A;  1XBL A;  4UB6 Z;  2F23 A;  2DYS B;  3FB8 C;  3I56 V;  1HR0 B;  1UPG A;  3NC0 B;  4YBZ B;  5BWV A;  3U0G A;  4G2K A;  1GM7 A;  3ORQ A;  1WRV A;  1GN2 A;  4WFF A;  3B09 A;  2PN1 A;  5LL6 Y;  1WNS A;  3BA8 A;  2K9P A;  5IJ0 A;  4JI2 O;  3QTC A;  3ASO B;  1DV2 A;  1FKA O;  3APQ A;  3OAA G;  4LFB B;  3UCS C;  2ODT X;  2ZIN A;  3AG2 B;  2QGN A;  1URF A;  2EIL B;  3B40 A;  3C3S A;  4JI7 B;  2D2C B;  4D6T H;  4MSW C;  5J2T B;  4U7N A;  4DXW A;  3SPC A;  3LWB A;  2WLI B;  5LA6 B;  2VS0 A;  1KJ8 A;  1OZ0 A;  2NLJ C;  1BSM A;  4DV6 O;  1GN4 A;  3W5O A;  1N32 B;  3BVO A;  2OCC C;  1OCZ C;  3J80 N;  3BPZ A;  4JYB A;  3T99 A;  1IOV A;  2RNB A;  5LA6 F;  4YAK B;  2CUG A;  2CGO A;  1VAR A;  3IC7 A;  3UM7 A;  1YHQ V;  5BR8 O;  2YS7 A;  1QVF U;  2Q7E A;  3T9F A;  2W6I G;  1I5Y A;  3FB5 C;  3QWU A;  2VQF B;  5LMU B;  3T9E A;  2VQD A;  1G4Y B;  1IBM O;  3CCJ V;  4GKJ O;  2EUL A;  4E2L A;  4DUZ B;  2DWD C;  4EGQ A;  2X0L A;  5L3G A;  4Q4D A;  5CA1 B;  3T1Y O;  2EX3 A;  1VBG A;  3KCX A;  2WLL B;  1OCR B;  1ROP A;  2HLD G;  2BSK B;  3BG5 A;  1GM9 A;  1CP9 A;  4X65 B;  2CNV A;  1OCC C;  3N8D A;  5CA1 F;  2IH1 C;  2ZIM A;  5TIS Z;  4DRX A;  4IIJ A;  1CQJ B;  1WR2 A;  3T9A A;  1WJZ A;  2HFE C;  4YJ3 A;  2H3O A;  2LGQ A;  2X7R B;  1QBZ A;  2W0X A;  3K0G A;  1V54 B;  4B3M O;  1KJ9 A;  1NT2 B;  5EBM C;  1K9M W;  3IJ4 A;  2ZE8 A;  1VF6 C;  4FFR A;  3CCL V;  2PYL A;  1GH6 A;  1MOF A;  5DM6 V;  1DIK A;  3RT3 C;  1Z5W A;  3T1H O;  2IJH A;  1JCH A;  2FPI B;  2YC0 A;  4QPJ A;  4X1I B;  3EFF K;  1IOW A;  4ASU G;  1N33 O;  3CJH A;  3VQX A;  4LFA B;  5CBG A;  1LR1 A;  4O4I B;  3RYI B;  1GSO A;  1K5S A;  1VQ7 V;  4BW5 A;  1IUR A;  2I8C A;  2LP7 A;  1IX9 A;  1WPB A;  1YTF B;  4X20 B;  5KX5 B;  2ZE7 A;  4O4I F;  3ABT A;  1BGY H;  4O7L A;  5BMV A;  2E76 B;  5GON B;  5H5N A;  3OT7 A;  3U9T A;  3U9S A;  4GX1 A;  4MV7 A;  3T9B A;  2P4V A;  3DTG A;  2EIJ C;  2GDS A;  2LFS A;  4DR1 O;  5KX5 F;  3HBL A;  3J7A U;  1PX2 A;  4QIW F;  4O7V A;  3QVN A;  1J5E B;  1CKO A;  5GON F;  5I47 A;  2WPD G;  4DR4 B;  4WHX A;  4FZ1 A;  3SJA C;  1QR9 A;  1SA0 A;  2IJI A;  4X1Y B;  4LF7 B;  2WLM A;  1KKC A;  1RPO A;  2Z04 A;  4QJF B;  1OJH A;  4AQY B;  1DAA A;  5B66 Z;  2F4V B;  3SPG A;  4FLZ A;  1PNM A;  1OHH G;  1KB9 F;  1B6Q A;  2AXT Z;  2P6J A;  1TVK B;  1PNL A;  1R6T A;  4MAM A;  1A48 A;  2DIK A;  3J81 N;  3DXR A;  2IP4 A;  4LBE C;  5D5P A;  4JZ2 A;  3QFF A;  4JI4 B;  4RQE A;  4UVA A;  1E4E B;  1NKD A;  3KCY A;  2UXC O;  1XHZ A;  5JCO A;  4CMD A;  2RMK B;  2KSD A;  3LQS A;  1GN3 A;  4MTG A;  1CE8 A;  3CMA V;  2HHF A;  4FU0 A;  3N27 A;  3RYH B;  2ADQ B;  1EN5 A;  1D2D A;  4YHH O;  3JAR B;  5CBH A;  3RYC A;  1W59 A;  3LSQ A;  4JYC A;  1I2L A;  4B08 A;  3VPD A;  3CCE V;  1JPX A;  3GWK C;  5EBW C;  1YI2 V;  2EIY A;  4P9P A;  1IDS A;  2CAZ C;  3QG5 A;  1WP7 A;  1SC5 B;  4IWY A;  2X6A A;  3MHS C;  4DRF A;  2DOS A;  2DE0 X;  3NBY B;  3AG3 B;  2HGX A;  2HIV A;  1E79 G;  5FPR A;  1G1X B;  4GKK B;  3JAL A;  3P3N A;  2YEV B;  4CMF A;  3CRQ A;  1HNX B;  3LP8 A;  4DV0 O;  5CA0 B;  2GUZ A;  3THO A;  1YJN V;  4ME6 A;  1BL8 A;  3OEE G;  4ZBM A;  1GRJ A;  3WG7 C;  4K8X A;  2YXH A;  4O82 A;  5DN6 G;  2COI A;  3A2F A;  3FYE B;  1ZX3 A;  2X6B A;  2A79 B;  1Q86 W;  4B7K A;  2QEX V;  2R7M A;  2QKS A;  3TQT A;  4FFM A;  3G6E V;  1PK8 A;  1JQ0 A;  5H2F Z;  5CA0 F;  3DC6 A;  2GQS A;  4Q4C A;  4RUF A;  1F7Y A;  2IH3 C;  2P5O A;  2Q0A A;  5GTH Z;  1I94 O;  3SPJ A;  4EKW A;  4QSH A;  3R66 A;  5LHG A;  4PBC A;  1WA8 B;  3G80 A;  4J7J A;  3RYF B;  4LF6 O;  1R3L C;  4DV3 O;  3EVK A;  5JVD B;  2OTL V;  5BWX A;  5EIB D;  3GVM A;  3JSL A;  1H2G A;  4DUY O;  2OTJ V;  4NKG B;  4IHJ B;  1W96 A;  4OGQ B;  2YRX A;  4UCS A;  4MV3 A;  3WWJ A;  3TEK A;  2DLN A;  4EG0 A;  2CH7 B;  4CBC A;  5BYB A;  1AJN A;  5CN0 A;  4WFB V;  2NU6 B;  2A3Q A;  3HPL C;  5JVD F;  2X6C A;  2DQ3 A;  2XAF A;  4ZHQ A;  1WP8 A;  3F5T A;  5LMN B;  1TGO A;  2ZXW C;  3ZCC A;  4X9Q A;  3HB3 B;  1SQV H;  1YXB A;  4HYO A;  1XMO B;  4L1K A;  2XCL A;  3IFX A;  1XI1 A;  3JZI A;  1P7B A;  4MVS A;  4WF9 V;  1Q7Y W;  2R7N A;  5KHH A;  2OCC B;  1OCZ B;  4RQF A;  3G8C A;  2HKO A;  4O2B A;  4XDK A;  3V4Z A;  3OUS A;  4B7E A;  3N6R A;  1OCO C;  2UUA O;  4DV2 B;  1GKF A;  3T1C A;  1N34 B;  2V7Q G;  1P16 A;  4WBN B;  2EJ3 A;  4PHZ A;  4WFA V;  1DTO A;  2Z02 A;  2HP8 A;  2QTO A;  1EFR G;  3U54 A;  3CXC U;  1SKV A;  5CBF A;  4ZIB A;  2KKW A;  2CZG A;  1V9P A;  2UXX A;  3CRC A;  4WBN F;  1FAF A;  1AP6 A;  3OTF A;  3K79 A;  5C1P A;  2XAH A;  3EXA A;  3UT5 B;  3AG4 C;  4GX2 A;  4MV4 A;  4BW9 A;  2YXY A;  1VQ8 V;  1UC8 A;  1U96 A;  5I5W A;  2OWO A;  1IYD A;  5EBL C;  1OCC B;  4HNA A;  2QSA A;  3OGI B;  5L3B A;  3DTU B;  2LW7 A;  4HNV A;  3QF7 A;  5HBR B;  1TUB B;  2JDI G;  4MVR A;  2ZNJ A;  1QLE C;  3VOU A;  3T7A A;  3K5M A;  4JI0 B;  1W0J G;  2XUM A;  2R72 A;  2HVQ A;  1XNR O;  3RGB A;  2ZIO A;  2UXB O;  2IM9 A;  3APO A;  1S76 D;  3LUL A;  2ABJ A;  1BS3 A;  3W7T A;  2R86 A;  5D1O B;  3CC2 V;  1KEE A;  2Y48 A;  4JAU A;  3HO8 A;  4UUG A;  4DR7 O;  1H2S B;  2KB1 A;  5FLX N;  1KYO F;  2BTO A;  4BWA A;  4NXN B;  3SR2 C;  4KP4 A;  1M5I A;  2RJZ A;  3T2M A;  1K4C C;  3I55 V;  1IBL O;  2VUG A;  4DK1 A;  5CB4 A;  4FM2 A;  5L3F A;  3JZ6 A;  1BCC H;  4X88 A;  4KHP B;  4I50 A;  1W93 A;  4FZ0 A;  5L3C A;  4MTF A;  3CSW A;  4LFC B;  3DC5 A;  2F93 B;  3UO3 A;  3D36 C;  1OCR C;  4JV5 O;  3ML0 A;  3OFN G;  2V58 A;  3CPW U;  3OUZ A;  3N2G B;  2VQE O;  4UVB A;  1AIL A;  1H2L A;  3ZRW B;  1LUV A;  1PM9 A;  4XZ3 B;  1Y76 B;  3MWD A;  5CE8 A;  5FPO A;  1NS1 A;  4TQF A;  1C30 A;  2Q6A A;  2YI8 A;  4LNU B;  4O7S A;  4B3S O;  3ETG A;  3HB9 A;  4BIO A;  4JPR A;  4CS3 A;  2ZR2 A;  4HN2 A;  2P06 A;  3SDL A;  1SCU B;  2YDE A;  1FPO A;  5LYJ A;  1J95 A;  1VQK V;  1YIT V;  4XX0 B;  4JYA B;  1GAX A;  3V4S A;  1R73 A;  2L35 A;  1VQM V;  1PD3 A;  2P0A A;  1Y4M A;  3SPH A;  1I1L A;  3JD2 A;  2SCU B;  1GM8 A;  3UZO A;  5BXZ A;  3ZMT A;  1KBL A;  4KFM A;  1GSH A;  2QM4 A;  2WSS G;  1K33 A;  3HKC A;  3R5F A;  1YZB A;  3MD0 A;  1QHT A;  3CEI A;  3DF7 A;  4JI8 O;  2ZKO A;  1AR1 B;  2YUA A;  2QWO B;  3CRA A;  3JCU Z;  3LNN A;  2QTS A;  4TV8 B;  4I55 A;  3KAK A;  3A0H Z;  3I5D A;  3ABL C;  4B3R B;  5C8Y B;  1Q6I A;  4FFB B;  2VWK A;  3TW6 A;  5JQG A;  4IWX A;  4DR3 B;  1NH2 B;  1FXK C;  3F7Y C;  5CM0 A;  4KXR A;  1I7F A;  1EKV A;  4LF5 O;  4PZ7 A;  2NU7 B;  4J9Y B;  4DR6 O;  2CTQ A;  1I08 A;  2UXN A;  4DR5 O;  4EQ5 A;  3K9A A;  2Q4P A;  3OD4 A;  1ORQ C;  1FFX A;  5DGH A;  3CE2 A;  1PV0 A;  1A0G A;  2BCC H;  2PUS A;  3STL C;  1NR1 A;  5IYZ A;  2DQ0 A;  2AZ2 A;  4GZR B;  2GSM B;  3BHP A;  2BTQ A;  2Q68 A;  2Q8V A;  3A0B Z;  4FPP A;  4JAV A;  5J2U F;  5BWR A;  1K5Q A;  3OR7 C;  3WG7 B;  2CDY A;  4FFP A;  4J42 A;  4MT8 A;  4JI2 B;  2HG8 A;  4QNH B;  1NZ6 A;  2R87 A;  2HDK A;  2EJR A;  4WFG A;  2Y4U A;  2ZDH A;  4Z1M G;  3GJX B;  1B6S A;  4HZ3 A;  4ZQI A;  1N0N A;  1VQ9 V;  2BOC C;  2Y69 C;  3BRC A;  4TV9 B;  2I87 A;  4CKB A;  3F7V C;  2ZGI A;  1HNW O;  2YID A;  5A9G A;  3ZMS A;  1AJQ A;  4DV6 B;  4GX0 A;  1JMK C;  5KS8 A;  1Q82 W;  5K1P A;  1P49 A;  3FB7 C;  1K3E A;  2UXD O;  2XTA A;  4TV9 F;  3CWB H;  5LGT A;  1XOU A;  3SYQ A;  5BR8 B;  3RVZ A;  5DEC A;  4JI5 O;  3NR7 A;  1BXR A;  3ZS8 C;  1D5N A;  1Z2N X;  2B5U A;  2ETN A;  5J2T A;  1IBM B;  4C5B A;  5LXT B;  1S5H C;  4JXU A;  4GKJ B;  4TUY B;  4U3J B;  5LOV A;  3T1Y B;  2IU0 A;  1G2W A;  1EYZ A;  2EJ0 A;  4DV1 O;  1E1Q G;  2AW9 A;  5LXT F;  5JH7 B;  2ATK C;  1PPJ H;  1COW G;  4TUY F;  3HKD A;  3KYH C;  3ETD A;  4MV6 A;  2JEU A;  1MSW D;  5I5V A;  2FB9 A;  3B4S A;  3AG1 C;  3CD6 V;  3D8C A;  2J9G A;  2NR5 A;  4GLX A;  3ZHS A;  5JH7 F;  1KJI A;  2RQ6 A;  1GN6 A;  4NB5 A;  4C5C A;  1X9N A;  4B3M B;  1OBD A;  2KG7 B;  4Q6G A;  1XMQ O;  2ARH A;  4DR2 O;  2Z5U A;  3AG4 B;  4PA9 A;  4L8J A;  1WB7 A;  3T1H B;  2RCV A;  1CPY A;  3U10 A;  4NZO A;  3W1G A;  3TII A;  1AUV A;  1XIL A;  2XOK G;  2CNQ A;  1K92 A;  4K35 A;  1THZ A;  2E75 B;  2CTW A;  2V1D A;  5ITZ B;  2MK3 A;  1N33 B;  1JFF A;  4ZI7 F;  2GHY A;  2R70 A;  4XYL B;  2JGD B;  2WYO A;  3JAM N;  4XDJ A;  5JCO C;  1QLE B;  3HR0 A;  1R6K A;  5EZY B;  4CC5 A;  1YEW A;  2JEX A;  4GUN A;  4UVC A;  1Q81 W;  4JF3 A;  1EN6 A;  1BQZ A;  3E8B A;  3GLK A;  3H1H H;  4DO2 A;  4LF8 O;  2DZD A;  3JAT A;  4DV7 O;  3ZRX A;  4NTY A;  5EZY F;  3E35 A;  5HFL A;  4EB6 A;  1DV1 A;  2HGW A;  2FB5 A;  3E8F A;  4QGP A;  2PYJ A;  1XHX A;  4ZOL A;  5LP6 A;  2FPP B;  4EEQ A;  1KKD A;  1LNQ A;  1Q8I A;  2CK3 G;  4BAY A;  5BYA A;  3AW8 A;  1ULZ A;  3RN4 A;  5E1A C;  4EFB A;  2JRI A;  3BCC H;  2XT9 A;  4I0X A;  2W6N A;  2EIN C;  3D3Q A;  2W6M A;  5B1A C;  4X62 O;  1SQG A;  1KD1 W;  3N2K A;  2ZT9 B;  3JAK A;  2XAG A;  5DMX A;  5CA3 A;  3RV3 A;  1VQN V;  3ZHT A;  3JD4 A;  3Q4H A;  1HNZ O;  5FR9 A;  3NUA A;  2IU3 A;  2W6J G;  3RW0 A;  2AHZ A;  5FNV A;  3CYO A;  2E5L B;  4LF9 O;  3FAV A;  2YZN A;  2JVD A;  4FMT A;  3T9D A;  3JAS B;  2ZNI A;  4RWU A;  3MHH C;  1DF5 A;  3W7X A;  3K08 A;  3L9D A;  4B3T O;  4X1Y A;  3K57 A;  5KUM A;  2Q0O C;  4I9Q A;  4O4L A;  2W6P A;  2UXC B;  4YXW G;  4MA5 A;  1VEW A;  4RZQ A;  3CCS V;  2AGA A;  5IJ0 B;  4PA6 A;  3SNO A;  2HIX A;  3B8N A;  4JI6 B;  3M7M X;  2XD4 A;  3ABM B;  3K3W A;  2GPW A;  2YSU B;  4YHH B;  1EHI A;  1NTZ H;  2R7K A;  3RV4 A;  2GPS A;  4EGJ A;  2WAM A;  3E22 A;  2R9R B;  1Q6H A;  2YI9 A;  2FP4 B;  1F4N A;  3QNE A;  1IYE A;  2CNU A;  5BY1 A;  3SJB C;  4O7N A;  4H44 B;  4DW0 A;  1FVI A;  4MW3 A;  1M56 C;  1KC8 W;  2GBO A;  3ABL B;  3B8M A;  3NXS A;  2CE4 A;  1R3K C;  2COG A;  2LGW A;  4LFB O;  1K34 A;  5IDJ A;  1FXK B;  4CH5 A;  3VMM A;  3KZI Z;  4DV0 B;  5I5Y A;  2Y4T A;  3ZN1 A;  1UFI A;  5B3S C;  1IXM A;  2H8P C;  3JSN A;  1ENV A;  4G28 B;  3OMA B;  1M9N A;  3STZ C;  3T4D A;  2ZM6 B;  1GTO A;  3C90 A;  2XHB A;  1M4U A;  3OTO O;  2CGN A;  1R3J C; 
#chains in the Genus database with same CATH homology
 4DV2 B;  1I94 B;  1N34 B;  2EJ3 A;  4WBN B;  5CB4 B;  3B2E E;  4PHZ A;  4DRX B;  4IIJ B;  5BWU A;  4LF6 B;  1M93 A;  4DV3 B;  3WWI A;  4LH7 A;  4O4J A;  3CEB A;  2PZS A;  1SKV A;  4M0J A;  4ZIB A;  2KKW A;  3CB2 A;  1V9P A;  2Q7G A;  3SJC C;  1T5E A;  4F6R A;  4DUY B;  4JI3 B;  4CHI A;  5LXT A;  4X1I A;  3OTF A;  1HW7 A;  4TUY A;  4FM1 A;  3UT5 B;  4U3J A;  4DR1 B;  1X4T A;  4BW9 A;  2JGU A;  1UC8 A;  2EJ2 A;  4O4I A;  3RYI A;  5I5W A;  5JH7 A;  2OWO A;  1IYD A;  1KMI Z;  4HNA A;  5LOV B;  4TQD A;  2PTM A;  5IWA B;  3BAB A;  2E3C A;  5D5Q A;  3QF7 A;  4X20 A;  1TUB B;  4NZN A;  3K59 A;  3HKE B;  5KX5 A;  3OTO B;  5JJE B;  5KMG B;  4FLX A;  2ZNJ A;  2UUA B;  1RSO A;  3T7A A;  5GON A;  3HKD B;  5LYJ B;  4IHJ A;  3K5M A;  2YXL A;  1FJG B;  4JI0 B;  4CKC A;  2R72 A;  3RGB A;  2ZIO A;  4UCU A;  2IM9 A;  4LR3 A;  3LUL A;  2A1H A;  4K6N A;  2ABJ A;  4ZI7 A;  4YJ2 A;  1KTA A;  4UCV A;  3DAA A;  5BMV B;  4UUG A;  5ITZ A;  1H2S B;  1L8D A;  2BTO A;  3SGI A;  4BWA A;  4NXN B;  4GLW A;  2X5R A;  1TA8 A;  3SR2 C;  4EFE A;  2F66 C;  3K5L A;  4D7T A;  3U11 A;  3VQY A;  1M5I A;  1EKP A;  1XQ8 A;  2QJ1 A;  3HKB B;  4X1K B;  2RJZ A;  5EZY A;  4WBN A;  4UCO A;  4RCN A;  1SA0 B;  4DK1 A;  1JFF B;  5CB4 A;  4I55 B;  4FM2 A;  3JZ6 A;  4KHP B;  4O4H B;  4I50 A;  1N36 B;  1TVK A;  2PGG A;  3CSW A;  4LFC B;  2F93 B;  4UFZ A;  5KHK A;  4O2A A;  3VQV A;  4YY3 B;  1XNR B;  4TM5 A;  3N2G B;  3UT5 A;  2UXB B;  3JAT B;  5K2M A;  5IJ9 A;  3BA9 A;  3UQ8 A;  1O9G A;  4EB6 B;  5EYP A;  5CE8 A;  5FPO A;  5DGI A;  3HT5 A;  4TQF A;  3VQW A;  2YI8 A;  4LNU B;  4ZOL B;  2QB5 A;  5LP6 B;  1TUB A;  4CS3 A;  4I4T A;  4FLW A;  2YIB D;  3RYH A;  4HN2 A;  1Q3E A;  5KMG A;  2PY5 A;  1G6U A;  3JAR A;  1IBL B;  5LYJ A;  1JJO A;  5CR5 A;  3WB0 A;  5JJN B;  4JYA B;  4K8Z A;  3N2K B;  2DAB A;  3TW7 A;  3JAK B;  4FM0 A;  4DK0 A;  1I1L A;  4DAA A;  4X66 B;  3UZO A;  1HR0 B;  5FNV B;  2QM4 A;  3IAY A;  5BWV A;  2Q7D A;  2VQE B;  1ET0 A;  4TOI A;  2DAA A;  3U0G A;  5KHJ A;  1WRV A;  3HKC A;  3UZB A;  1QHT A;  4YJ3 B;  4FLV A;  3HKB A;  2Q7H A;  5CA0 A;  1WNS A;  1S5J A;  3BA8 A;  3LNN A;  4B3S B;  5IJ0 A;  4TV8 B;  3QTC A;  4I55 A;  4CS4 A;  4B3R B;  4CC6 A;  5C8Y B;  4FFB B;  4O4L B;  2VWK A;  4LFB B;  2HEP A;  5JQG A;  4IWX A;  2ODT X;  4DR3 B;  2ZIN A;  4TVI A;  5CM0 A;  1B04 A;  1KT8 A;  4X64 B;  3T54 A;  4JI7 B;  1I7F A;  5J2T B;  1EKV A;  3JAW A;  5LA6 B;  3RYF A;  1N32 B;  3QQM A;  1FFX A;  3BPZ A;  3E22 B;  5DGH A;  5JVD A;  3T99 A;  4CH6 A;  1A0G A;  2PUS A;  4CH4 A;  4NZM A;  5IYZ A;  4DV4 B;  2Q7E A;  5I5T A;  3T9F A;  3WB2 A;  3BHP A;  2BTQ A;  2VQF B;  5BWR A;  5LMU B;  2UUB B;  3T9E A;  1QQC A;  4JI2 B;  3K58 A;  4DUZ B;  2HG8 A;  2HDK A;  4Q4D A;  5CA1 B;  2EX3 A;  4UCT A;  4LF5 B;  4X65 B;  1Z5V A;  4DR6 B;  3BRC A;  4KL1 A;  4TV9 B;  4AIL C;  4CKB A;  2ZGI A;  2ZIM A;  4K0K B;  1I1M A;  4DRX A;  4IIJ A;  4DV6 B;  4DR5 B;  3T9A A;  4YJ3 A;  1JMK C;  5KS8 A;  1KU9 A;  4FVM A;  4O2B B;  5K1P A;  1P49 A;  3WWH A;  1NT2 B;  4TV8 A;  5BR8 B;  5C8Y A;  1SQF A;  3MAQ A;  2PYL A;  1IBK B;  1Z5W A;  4O4J B;  3ZS8 C;  2P22 C;  4F6R B;  5J2T A;  1IBM B;  5LXT B;  4JXU A;  4X1I B;  4GKJ B;  4TUY B;  4U3J B;  5LOV A;  3T1Y B;  4DR7 B;  1G2W A;  4CE5 A;  3VQX A;  4LFA B;  3ICX A;  3HKE A;  2EJ0 A;  4FLY A;  4O4I B;  3RYI B;  5I60 A;  5JH7 B;  3HKD A;  1HNW B;  1WPB A;  5I5X A;  5I5V A;  4X20 B;  4D7S A;  5KX5 B;  2HHF B;  2Y4R A;  4GLX A;  5BWT A;  2RQ6 A;  5DAA A;  2UXD B;  5BMV A;  5GON B;  4B3M B;  3RYC B;  4Q6G A;  4JV5 B;  3T9B A;  3DTG A;  5I5S A;  1D5A A;  4JI5 B;  4L8J A;  3T1H B;  3BAA A;  4YJ2 B;  3U10 A;  4NZO A;  5I5U A;  1J5E B;  2UU9 B;  5I47 A;  4X1K A;  4DR4 B;  4WHX A;  3SJA C;  5ITZ B;  1EKF A;  1N33 B;  5LP6 C;  1SA0 A;  4X1Y B;  1JFF A;  4LF7 B;  2R70 A;  4O4H A;  3K5N A;  1A3G A;  3DSQ A;  5HNE A;  4AQY B;  1TAE A;  3JAL B;  4DV1 B;  1DAA A;  5JCO C;  5EZY B;  2F4V B;  4CC5 A;  1Q43 A;  1YEW A;  4FLZ A;  1I2K A;  5K3W A;  4FLU A;  4I50 B;  1TVK B;  3N2G A;  4PI2 A;  3ZED A;  3JAT A;  3CHX A;  3WB1 A;  4LF4 B;  4EB6 A;  1XNQ B;  4HBN A;  2HGW A;  4O2A B;  5D5P A;  1XMQ B;  2PYJ A;  1XHX A;  4DR2 B;  4LNU A;  5J2U B;  4ZOL A;  3UYY A;  1ZAU A;  5LP6 A;  4JI4 B;  5IJ9 B;  4EEQ A;  5EYP B;  2UUC B;  4PI0 A;  1Q8I A;  1XHZ A;  4JI8 B;  5JCO A;  4CMD A;  5BYA A;  2COJ A;  3LQS A;  4DQN A;  4EFB A;  5BWW A;  2GV9 A;  3K5O A;  4CH3 A;  4I4T B;  5KHI A;  4OX9 B;  2JS5 A;  2HHF A;  1SQG A;  3RYH B;  3N2K A;  3JAK A;  3JAR B;  5FR9 A;  3U0Z A;  3RYC A;  4ZHQ B;  1I2L A;  2R9A A;  4B08 A;  5KHG A;  5FNV A;  2E5L B;  3VPD A;  4LF8 B;  3PFF A;  2V4D A;  5EIB C;  2JVD A;  4DV7 B;  2HHH B;  3T9D A;  3JAS B;  2ZNI A;  3BAC A;  2EIY A;  2ZCE A;  4NXM B;  2CAZ C;  1WN7 A;  3QG5 A;  4IWY A;  4JI1 B;  4X1Y A;  3K57 A;  2OYQ A;  4GYC B;  3HKC B;  2HGX A;  4DV5 B;  5FPR A;  4FFB A;  4I9Q A;  4O4L A;  3JAL A;  4GKK B;  2UXC B;  3DTF A;  4CMF A;  1HNX B;  3CSX A;  2VWJ A;  5CA0 B;  3THO A;  3RWR D;  5K1X A;  3ETQ A;  2F95 B;  5IJ0 B;  4K8X A;  3SNO A;  1UC9 A;  2COI A;  4JI6 B;  3M7M X;  3A2F A;  5LA6 A;  4X62 B;  4FLT A;  5JQG B;  2F1M A;  4YHH B;  1HNZ B;  1I1K A;  4Q4C A;  2YIB A;  5JJJ B;  2P5O A;  3E22 A;  2Q0A A;  4AHC A;  5J2U A;  3T9C A;  3JAW B;  4UCR A;  1VF7 A;  2YI9 A;  4HNA B;  4LF9 B;  3PN1 A;  4PBC A;  3RYF B;  1IYE A;  1O9H A;  3SJB C;  1FFX B;  5JVD B;  5BWX A;  5EIB D;  3JSL A;  4B3T B;  4IHJ B;  3FFQ A;  4UCS A;  5IYZ B;  3WWJ A;  3TEK A;  2COG A;  5CA1 A;  5BYB A;  2BTQ B;  4CH5 A;  4ZI7 B;  4DV0 B;  5E25 A;  5I5Y A;  3RFR A;  4ZHQ A;  5LMN B;  1TGO A;  1Q5O A;  4LH6 A;  4TV9 A;  1DGS A;  3JSN A;  1XMO B;  4CKE A;  4CS2 A;  1XI1 A;  2ZM6 B;  2XHB A;  3JAS A;  1M4U A;  2YIA A;  5KHH A;  4NVP A;  4O2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...