1ZAUA

Adenylation domain of nad+ dependent dna ligase from m.tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
321
structure length
321
Chain Sequence
QTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGHVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRAPRWAIAYKYPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD+-dependent DNA Ligase (Rv3014c) from Mycobacterium tuberculosis: CRYSTAL STRUCTURE OF THE ADENYLATION DOMAIN AND IDENTIFICATION OF NOVEL INHIBITORS
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords DNA ligase
total genus 61
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1zauA01
3.30.470.90 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1zauA02
2UU9B 3SGIA 4X65B 3T1HB 4LF7B 3JSLA 3T1YB 1IBLB 4JI5B 4UCVA 4JI3B 4JI7B 1XNRB 4LFAB 4DUYB 4LF9B 4NXNB 3JSNA 4DR5B 4AQYB 2ZM6B 4JI0B 4LH6A 4UCTA 4DV4B 4UCSA 3OTOB 1XNQB 4JYAB 4DR4B 1N33B 2UXBB 5FPOA 4GLXA 4UFZA 4LF8B 2VQEB 2F4VB 4GLWA 4B3TB 4GKKB 1V9PA 4JI1B 4DR2B 1FJGB 3BA8A 1HNZB 4LFBB 4GKJB 2UXCB 1DGSA 3BABA 4OX9B 3UQ8A 4CC6A 4DV6B 4LF6B 4UCRA 4EEQA 5FPRA 4YY3B 1HNXB 2E5LB 4DR1B 4X66B 4YHHB 4EFBA 4UCUA 2UUCB 1B04A 2UXDB 4DR7B 1XMQB 2VQFB 4JV5B 1HR0B 5BR8B 4EFEA 5LMUB 4LF4B 4DV2B 4DV1B 2UUBB 4X62B 4CC5A 4LF5B 1N32B 4K0KB 4DV0B 4DUZB 4TOIA 1J5EB 4JI8B 1IBMB 4JI6B 4DV5B 1IBKB 4X64B 4UCOA 1N36B 4KHPB 4DV7B 1XMOB 4JI2B 4B3RB 1I94B 1TAEA 4NXMB 4DR3B 4JI4B 1HNWB 3BACA 3PN1A 4B3MB 4LH7A 1ZAUA 2UUAB 4B3SB 4DV3B 2OWOA 1N34B 3BAAA 5IWAB 2HHHB 5LMNB 3BA9A 4LFCB 4DR6B 1TA8A
chains in the Genus database with same CATH superfamily
3SR2C 3JSLA 2M6YA 5E79Z 4DK0A 4QPKA 2IU0A 4PA4A 2EIYA 4TV9A 4YJ2A 1M56C 5JQGA 1G6UA 2CTPA 4H37A 3I5DA 4I5SA 3G8CA 4UCTA 4JI1O 4MW3A 5BMVA 2YL2A 2Q5ZA 5FNVA 3G6EV 1QLEB 4U7OA 4NXMO 4L8JA 3R23A 1DV1A 5BWXA 3RYIA 2AXTZ 3GVMA 2CTQA 1O9GA 4I50A 3JRWA 1IZ3A 5K3WA 2P5OA 2EJ0A 1RM1B 3D36C 1CKMA 4WCEV 1Q81W 3LSUA 2ZXWB 2HDKA 1VP7A 1SQVH 4GKKO 2ZCEA 3GB8B 2QKSA 3F7VC 2DE0X 1EKFA 2Q9LA 5GONB 4DRFA 2ZINA 4UV9A 1V55B 5JJEB 1K33A 3BPZA 4I50F 4WFBV 2EIJB 2D2CB 3C3SA 1L8DA 3APOA 1S5LZ 3RV4A 5HV6A 1JX9A 4GX5A 3ZN0A 2YICA 2W6QA 2I87A 3WO0A 4PZ6A 3OD4A 2F1MA 3B77A 4O4HF 1AJNA 1FVIA 4O4JA 1L1FA 2QWRB 1ORQC 3OFNG 4DV1B 1OCOB 2R9AA 2DABA 1Q6UA 3ZRWB 4AI8A 1OCCB 3H1KH 3ZMUA 2QM4A 4X1KA 2IM9A 1K3EA 1SQXH 2EJ7A 5LA6B 4UVAA 5GONA 2HLDG 4MSWC 4FZ1A 1VMGA 3P32A 4Q4DA 4NXMB 1RP3B 4DR3B 3JAWB 4KL1A 3CCSV 3B09A 3Q4HB 1ENVA 2ZM6O 4DK1A 2HHHB 3W5OA 1EN5A 3A2FA 3BRCA 3ZBHA 1QQCA 1VQLV 1JLLB 2JIZG 3HKBA 3LSQA 4DRXA 4K6NA 2GUZA 3JZIA 4JI3B 4O81A 2ZT9B 1YJNV 5CB4A 1K4CC 3B8MA 1XDNA 1K7DA 3OW2U 2P22C 3IGAC 4QSHA 1OCRB 4O2AA 4LH6A 2OCCC 3K9SA 4LF9O 2OIGA 2QKAA 3ZMSA 4LF8B 2F66C 1QHTA 4BIZA 3APQA 2QTSA 2AZ0A 1VKZA 4JTCB 5DGIA 1I2KA 4CS4A 4DR2B 3U55A 1SZTA 4HNAA 1NTZH 1PPJH 1YXBA 1TUBA 3UZBA 3L70H 4E6NA 3ZRSA 4MVMA 1Q8IA 4I4TF 1I5XA 4P30A 2AHZA 4X1KB 5LP6B 3ZHVA 4DR1B 5B1BB 5I5TA 2ZGIA 4DR5O 4O2BA 2YS8A 1B6RA 3UYYA 2NU7B 1N34O 1H8HG 5LYJB 2ZE6A 1DAAA 5CA1F 3ABKC 1W0KG 2NU9B 1Y4MA 3D3IA 1DTOA 1JQ0A 3SJBC 1V55C 1N4CA 1BXRA 4ME6A 3ASOC 1EUCB 3DTFA 2NU6B 2VUGA 4R7CA 2RCVA 2C00A 3VMMA 4ZKIA 4FFMA 5AG2A 4EKWA 1Q6HA 3LDDA 4MTXA 1JR9A 4JI6B 3U0ZA 1SCUB 3JZ6A 3V4ZA 2K9PA 1A3GA 1VBHA 3E8FA 2WYOA 1PL0A 4LNUA 3T9AA 1F51A 2Y0IA 4HZ3A 4O4LB 4AQYO 4LFCB 3TGUH 4I0XB 1IYDA 2GUZB 1FS0G 1SQPH 5D1OB 4C5BA 4WFGA 2I80A 2CGOA 4LF9B 2R87A 4HR7A 3MJFA 1WN7A 5EYPA 2GHYA 4O7LA 3N2KA 5H80A 5BMVF 5KHHA 4J11A 2RNBA 3IAYA 3VPCA 4RQEA 1BSMA 1OCZC 4XYMB 5BYAA 4JYAB 1N33B 4B3RO 2N74A 4LCUC 1DF4A 4B08A 5HBRB 2ADPA 1EZJA 4EGQA 2JDIG 5B1BC 3NXSA 1PX2A 3H1LH 4O2BF 4MA5A 1BL8A 5CA0A 5J2TB 4O4JF 3R5XA 2JGDA 2ZR2A 1N0NA 3E22A 3QO8A 3VPBA 3ETEA 2EULA 2ADQB 3BABA 2EJ2A 1U97A 1I1KA 2YS6A 5EBWC 3FB8C 2XAQA 2A79B 5DEDA 2UUCO 2LJ2A 1AI4A 1I94O 4PDMA 4J7JA 1S76D 3K5HA 5B1OA 3ASNC 2E5LB 4R8CA 1W93A 2HHHO 1YTFD 2CZGA 1THZA 2FTKA 1PP9H 2IP4A 1YJWV 5EC2C 2JRIA 3WB1A 1FFXA 4EFEA 1I7LA 4QNHB 4PI2A 1SQQH 1D5AA 3ZIAG 5H9CA 4MTOA 1M6VA 1FYJA 2Q2TA 4U7NA 1CP9A 2P90A 3CC4V 1J5EB 1WPBA 1E4EB 4D7TA 3FAVA 2VWKA 2Z5UA 4WBNA 3DTGA 4JZGA 4FLUA 3ZHUA 1Q6IA 4PD4F 3QG5A 4LBEC 1GTOA 1NVPD 4HBNA 5BWUA 2IH3C 4MVZA 1M5IA 4HN2A 1IBMO 3WG7B 4DR2O 5IWAB 1QNMA 3RW0A 2UUAO 4BIUA 5BR8O 1VQ5V 1TA8A 1K73W 2FPGB 3TETA 3J7AU 5DISC 1KEEA 4UCVA 4JI7B 4JYAO 3TY9A 1P8LA 4UB6Z 4DUZO 1EBOA 3OR7C 2HIXA 3GLKA 5KUKA 2K1EA 1BQ0A 2W6OA 2ODMA 4RAIA 3SE7A 3P3PA 2E74B 3JAWA 3K9AA 3X2QB 5CN0A 4O7RA 4XYLB 1M57B 2EJ3A 5LA6A 2NU8B 4DR3O 1GN6A 2N04A 3E8BA 1FXKC 1QCEA 4DV4O 2NUAB 2PBZA 2GDSA 1V9PA 5K1PA 4LFBO 2XAGA 1DIKA 2JJ2G 4O2AF 1GGOA 1IXBA 3JCZA 4O4LF 1Y74A 4DV6B 5EZYA 1I2LA 1X59A 4CE5A 3CCQV 4JI6O 1K4DC 4YBZB 3BG5A 1ROPA 1V54B 3G67A 2WLJA 5BWRA 1KMIZ 3G80A 4XDJA 4X89A 4K8ZA 3DC5A 5KX5B 1XQ8A 3OGIB 1NH2D 3VA7A 3DSQA 3W7UA 1S5JA 3H1HH 5BMVB 5FNVF 2OLSA 1YCIA 2DWEC 2CTWA 3BHPA 4EGJA 3J81N 4PA7A 1I0HA 4R6ZA 5JQGB 1E1QG 5J2TA 1P16A 3KG2A 4LF5B 4YJ2F 3L71H 5CE8A 1AP6A 4X66O 4MA0A 3ZRWA 3RUPA 1CKOA 4X64B 5LP6A 1L0NH 1N36B 2W0FC 5I5SA 3RN4A 2EX3A 2HGWA 3HKCA 2YRWA 3TY5A 1M56B 4ABMA 1GKFA 3ZCCA 3DGEA 1UJWB 1P49A 1G1XB 5C8YA 2MK3A 4X62O 2ILMA 2YI9A 4MTFA 4BR6A 3T9CA 1Q5OA 3HR0A 4JAUA 2CUGA 3KYHC 2QB5A 4X8AA 1ZLZA 4ZI7A 2OT5A 3U0GA 4MTGA 4KUMA 4XBFA 3UFXB 3RYCA 1QU7A 3JSNA 5H6QA 2WLLB 4DR5B 2B1GA 1TVKA 1US6A 1LUVA 1NBMG 4J10A 3VQXA 4PJ0Z 1G2WA 4I55F 1O9HA 2W71A 1JFFA 4TQFA 1HWYA 3ABLB 3RBZA 2YDEA 3TIIA 1Q43A 4GLWA 2DWDC 4K0KO 4YJ3F 3D8CA 3RWRD 3TQTA 4O4IA 4CMDA 1SA0B 1PL4A 3CRAA 5IJ9A 3ETGA 5LOVB 2DWCA 3T1YO 2PVPA 4CS2A 4NYEA 5I5XA 1WNSA 1JMKC 4MV8A 2RDCA 2Q2UA 5B1NA 2ABJA 1R3IC 2CNUA 2HVKC 3UCSC 1YHQV 3SYAA 1VBGA 2EIMB 4FLZA 4ZHQF 2XTAA 1HR0B 3N27A 2Y0PA 4DV2B 2C2AA 3T2MA 2XD4A 4JI0O 3CCRV 3WU2Z 4DV0B 2Q7GA 3JALA 4TOIA 2EIKC 3CCVV 4JAAA 2ODTX 5KAIZ 1LUWA 4DV5B 4YIPA 5JWPA 2A0LA 1EKVA 2DMXA 1QLNA 1Z2OX 2ARHA 1GK9A 2QK4A 2P6JA 1I94B 3CEBA 3JD2A 2Z04A 1SERA 3OEEG 4MVQA 1VQMV 2V58A 3THOA 5EZYB 3TY8A 2GBOA 1WRVA 5KAFZ 1AUXA 1H38A 3MWDA 1N32O 2AGAA 1OCCC 1OZ0A 5ITZA 2WWWA 5L3DA 3OMNB 5LXTF 4CKCA 1W59A 1VQ8V 4Z1VA 2UXXA 4X65B 1NT2B 1NJIW 2ITDC 5DECA 3K06A 4NXNB 4O4LA 1EZ1A 5EIBD 2ZD9A 3AG3C 5IYZA 4Z1MG 1S3JA 1PNLA 2W6JG 5EBMC 3TK1A 2F23A 3K57A 4C5CA 5C1PA 1NS1A 2DYRC 1M57C 5DGHA 4P9OA 4EB6B 3L74H 3BCCH 4F6RA 2PUSA 2YEVB 3T1CA 1H2NA 1PK8A 1FXKB 1GRJA 4F6RB 4PELA 1ZWIC 1NTKH 1H2MA 2HJDA 3BA8A 5E1AC 5BPHA 4PBCA 1DGSA 1A0GA 3A0HZ 3ABLC 2ZXWC 3CC2V 3SPIA 3GB7C 5CA1A 5LHHA 2HIVA 4TV9F 3AG3B 2W6NA 4J9ZB 1YJ9V 1T36A 2PTMA 4Q20A 3CX5F 1DLBA 2FB9A 5CMUA 1Y6XA 2COIA 3L73H 2P4KA 4X66B 4E4EA 5JCOC 2Q69A 4LWSA 4EFBA 4FK5C 1RM1C 2HHFB 5D8DA 3WO1A 2WLKA 1KJ9A 4JV5B 2ZDHA 2G38A 1D2DA 1IBKO 5IDJA 2UUBB 3SNOA 3TCUA 2BOBC 4FFPA 4DV2O 2WSSG 3FYIB 3LULA 4JI8B 4YJ3B 5J2UF 1IBKB 4XX0B 4F4LA 4JI2B 1HW7A 4LF7O 1TAEA 1KJ8A 4ZQIA 1BMFG 4J80A 3AG1C 4WFEA 1FFXB 3JAKA 2W0XA 3IFXA 4O4HB 3CCLV 4NZOA 3I55V 1XDCA 1ZX3A 4I4TB 4ZI7B 3DAAA 3T1YB 4TUYF 5DMXA 3C3TA 2WA4A 2F95B 2R7KA 3CMAV 3HB9A 1IYEA 1AROP 1B3QA 1VQ4V 4FLVA 3K0DA 3U11A 5CA1B 2JJ1G 3WWIA 1MA1A 3GIDA 3E35A 4GUNA 3E22B 5L3CA 2H8PC 4FFBA 5IYZF 4GT1A 3SYQA 1JDBB 3GJXB 2OCCB 4KFMA 4PV1B 3K3PA 1YSCA 3T9DA 5LP6F 1H8EG 3B4SA 2AZ2A 3UT5A 1MZEA 1QR8A 2Z3YA 3R65A 5D5QA 4EQ5A 4PDLA 4QJFB 4NZMA 1AI5A 3NUAA 1UC8A 2HR3A 2ZNJA 5KUMA 4Z2WA 4NVPA 5K1XA 2QWNB 5FLXN 2YZMA 1OBDA 3W1GA 3VPDA 3K0GA 3L2PA 4YAJB 3ORQA 3E83A 3J80N 1WJZA 2W6MA 1H2KA 2H94A 4DV7O 5JCOA 1JCHA 4GKJO 4TQDA 2YRXA 3EXAA 2WLHA 2HFEC 2OIEA 1Q7YW 3F7YC 3G6BA 2I8CA 2W6ZA 4DW1A 1SESA 3LDCA 4YHHB 4BW9A 2DOSA 2QM8A 4UCUA 5ITZB 2Y4UA 4FIPC 4MV4A 2Q7DA 2IBZH 1NU1H 4TVIA 3R5HA 5I47A 1I7NA 2RMKB 1EYZA 4NKGB 3OEHG 3NBYB 1N32B 5LHIA 3CD6V 3C90A 3CRMA 5KMGB 1CQIB 5HNEA 4NXNO 2KKWA 3H1JH 1NH2B 4KHPB 2YW2A 3S3WA 3G4SV 3ZN1A 4HQ6A 1JVMA 5LYJF 3FYEB 4B3MB 3JAKB 3AK2A 4JAVA 2UUAB 1FXHA 4DV3B 4FM1A 3AG2C 5C8YB 1J5EO 1H2LA 2OWOA 1FJGO 1SA0A 4DR6B 4OGQB 2R9RB 2XNDG 3PJSK 4JI4O 2PI4A 4JI5B 3AG1B 2EJRA 2M7WA 3B8NA 3OR6C 4EB6A 3HB3B 1VF6C 4DV0O 2YZLA 2CH7B 2EINC 4LNUB 4B7KA 2A7WA 4HNUA 4DR1O 3CSWA 3EHBB 1R3JC 3CYOA 1ZSPA 4X1YB 2UXNA 1OCOC 1E4EA 4GLXA 1OCRC 2YI8A 3AG2B 5J2UB 5GTIZ 1VQNV 2KG7B 4P2ZA 4IIJA 3RYIB 5A2QN 1BNCA 2COGA 3ZMTA 4XDKA 3ZX6A 4FGRA 2UXCB 1Q3EA 3KAKA 3JD1A 4OX9B 4LC1A 2A9HA 3OGCC 2X7RB 3D3QA 4MVUA 5CM0A 4LWSB 5BWWA 1F7YA 4HNTA 1MMMA 3L75H 3UZOA 5F2VO 1GSAA 3M99B 1YI2V 1BZKA 4IHJB 4FFOA 5KHGA 1ZL8A 1KC7A 2QM7A 2P7TC 3VQWA 2BOCC 4KXRA 3IC9A 5J2TF 4FLYA 3VQYA 1P7BA 1N33O 3LQSA 5IYZB 1PNMA 2F43G 3NC0B 5CA0F 1Z5WA 1FD9A 4WHXA 3QWUA 3OE7G 2IH1C 4CC5A 1Q90D 4X20B 2IJIA 4MV3A 1WR2A 5KMGA 3TW7A 4D6TH 3H1IH 2JEXA 2O57A 1Q82W 3I12A 1N36O 3T7AA 4TV8F 4JTDB 4JI4B 1WP7A 3BVOA 5LHGA 3M8AA 5JH7A 2YXLA 1AUVA 3H01A 4UV8A 1B06A 4JYYA 4RUFA 3Q2OA 4O4IB 2XAFA 4U3JB 2WA3A 2FKXA 2FPPB 4MS2A 1WB7A 4MVRA 4IIJF 4LFAB 2ZIMA 2NNUA 2N05A 3OTFA 5I5WA 3E2EA 2DLNA 1WPXA 3K5MA 3MWEA 3DTUB 3LDEA 1GLVA 4ZOLB 3SYCA 4DV4B 4JYBA 2Q67A 2HVQA 3N8DA 3GDEA 5FPOA 2ITCC 1KP2A 3SYPA 1I08A 4AILC 3LNMB 3KCXA 1NI8A 4GKKB 5JJJB 5BZBA 3CCEV 5IYBO 1WLEA 1E79G 1R73A 3FB6C 2YC0A 5JQGF 2QWOB 3N2KB 3X2QC 3ZHTA 1XI1A 4NTYA 5EBLC 4CC6A 4MVOA 4JI5O 5LP6C 4CMFA 2JEUA 1XHZA 4OX9O 5FPRA 1YF2A 2XUMA 4C7UA 5KHJA 4I4TA 4M0JA 3CXHF 3RFCA 1SC5B 4I9QA 1Q86W 2B9ZA 2XHBA 3G8DA 4WFHA 4DV1O 2CDYA 4JI7O 4LF8O 1B04A 1PM9A 1MZFA 2HP8A 1P7GA 3IJ4A 4UVBA 3T1HO 4DAAA 1SQFA 5EYPB 2HG5C 2R7NA 3ZRXA 1JJ2U 4FLTA 1DK1A 3KAJA 4DLKA 1GM8A 1MOFA 4BWAA 3B40A 5C1OA 3AK1A 4X62B 2EZPA 3I56V 4DUZB 2CAZC 4GX2A 1KKDA 2QEXV 1ET0A 3U9SA 4U3JA 2PYJA 1W2BU 4FU0A 4B3SB 2EILC 4PHZA 1NVPB 1UPGA 3CRCA 3QFFA 5LOVF 2Z0AA 1VF7A 2MW2B 1XMQO 3L72H 1AVMA 4UXNA 4WFAV 3JATB 2XAJA 2VR1A 4DW0A 1EKPA 1OBGA 4FMTA 3V4SA 1OHHG 4NTWA 4X65O 1WAZA 1AILA 1PD3A 2BSKB 4FJCC 1URFA 1KKCA 1N0JA 2R9IA 3Q4HA 3CS5A 4CKBA 3HPLC 3RVYA 2FYUH 1M9NA 4LP8A 2DJVA 4GCZA 5IY5B 3ZS8C 4UCSA 3ZMVA 1J95A 1GN2A 1OV9A 4DQNA 1HDJA 1K8AW 2QGNA 3QQMA 3FX7A 3ORRA 5GW7A 3AG4B 4ZHQB 2E3CA 4DV3O 4QIWF 4O4HA 4CH5A 4CHIA 5LOVA 4UB8Z 4O7YA 3K59A 1I5YA 2R85A 4DO2A 1GAXA 1XHXA 1KU9A 1T5EA 4UCRA 4DYLA 4LF6B 2WLIB 1I1MA 1JKJB 4WBNB 3TIGA 5LXTB 5CBGA 2Q73A 2QF7A 2F93B 1XOUA 4IIJB 1C3OA 1P4RA 5B1AB 1M0TA 1K5SA 5BYBA 3MHSC 2Y4TA 3RYFA 5CR5A 2YWVA 2UUCB 2LGWA 2L6LA 1S77D 2XASA 4YB8B 4FFBB 2HVRA 2R82A 1XMQB 2EILB 1EM1A 4U3FH 2X6CA 4W4LA 4O82A 5B3SB 2QTOA 3SJAC 1KYOF 4LF4B 2X0LA 2WLLA 4K0KB 3T4ZA 1XL6A 2QSAA 1XK5A 2XCLA 1VIBA 1OCZB 4CH4A 3CP1A 3E8GA 4OPHA 4E2LA 5JVDF 2LW7A 3BEHA 1XMOB 4JV5O 1JOYA 2V1DA 3CWBH 2IJKA 3AG7A 1AJPA 3O9OA 4JI2O 4YHHO 4X1IA 2FB5A 3JASA 4FFKA 4X88A 3A0RA 2JS5A 2DIKA 1GN4A 2E76B 1EZVH 4HNAB 5LYJA 4RQFA 4TV9B 1WP8A 4GZRB 2ZE5A 3ZHRA 1S68A 4B3TB 5LMUO 2V59A 1HNWO 2XOKG 2EIJC 3ABKB 1FPOA 2LFSA 3KKYA 4QGPA 2BTQB 4DR7O 5J2UA 2J9GA 5HFLA 1LNQA 1R6KA 1KP3A 5L3GA 1W96A 4CZZA 5KS8A 3K58A 3TEKA 1VQ7V 1KJIA 4UUGA 3HT5A 2GPSA 3OMIB 5C93A 2Q7EA 3BY6A 4K3AA 2Q0AA 2Y48A 2PZSA 4ZOLA 1M0WA 2ZE7A 4DXWA 4JI0B 5IYCO 1IXMA 1GMGA 2HHFA 1L0LH 1MABG 2WLNA 3K5NA 3PFFA 5B66Z 3F5TA 5KX5A 1JPXA 1H2GA 2LFRA 3ML0A 3K08A 2P4VA 2P67A 1R6TA 1OJHA 4DR6O 1S0VA 2Q7HA 3OAAG 2A1HA 3HKBB 3HBLA 4YXWG 4QPJA 2HJFC 2FMLA 4MAMA 3FFQA 3AK3A 1KUQA 3T9FA 4ZIBA 1IBLO 5LGTA 4UUJC 1XMOO 4EEQA 2HGSA 1HP8A 3OTOO 1XNQO 3SJQC 3H9VA 4E4TA 2GTSA 1FAFA 2PI5A 1K34A 1AB3A 2CNQA 3UT5B 3AEIA 3QO7A 5D1PA 3ABMB 2F4VO 3U54A 4LFAO 3CJHA 5L3FA 2QR4A 3R5FA 2WLMA 2YXHA 2YYAA 4MV9A 1WA8A 1A9XA 5KHIA 3A8TA 1YDXA 3LP8A 2Q8VA 2X0SA 1RPRA 3JATA 1BE3H 4FE2A 5I5YA 3OMAB 4UCOA 4J7ZA 4PDVA 1BGYH 4G27B 4JGSA 4KHPO 2JGUA 4UVCA 1K5QA 5B3SC 1HNWB 4F6EA 2LO1A 3R66A 3PN1A 1BT8A 3SJCC 4LH7A 2OCHA 2CTRA 2QWPB 3MAQA 2LP7A 3RYHB 3U9TA 1X4TA 3VOTA 4IGGA 5FL7G 3SPJA 1A0IA 2ZR3A 1NQTA 1XNRO 3T1HB 1KC8W 3DF7A 4YJ3A 4IT5A 1JDEA 5CBFA 1Z5VA 3ZRVA 3TXSA 4DV5O 1GM7A 3WFVA 4K8XA 5B5EZ 1Y66A 4JF3A 2EIMC 3E5NA 3S3XA 4O84A 3CE2A 4DR4B 2A3QA 5KKNB 4I50B 4FLWA 2DZDA 2F4VB 3N2GB 3W7XA 4TT3G 2WPDG 3GWKC 1I1LA 4BW5A 1YVWA 2YIAA 4X20A 4ZI7F 5CAEB 4TUYB 2YZNA 4PZ7A 1PKXA 4FM2A 2GQRA 1MG1A 4JPRA 1CPYA 4GKJB 5JJNB 1EUDB 3ZEDA 1DV2A 3QF7A 2NR5A 1N8RW 3TW6A 4O7SA 4PZ8A 3RVZA 4KP4A 3WB2A 5C8YF 1NR7A 2JGDB 2YXYA 5H6RA 1CXZB 4IWYA 2FPIB 4TM5A 4H13B 1RSOB 1NR1A 2Q0OC 2V4DA 2QA4V 5LMNO 1XEQA 3T9BA 2ZDIA 3CCMV 3HO8A 5H2FZ 3SPCA 5CA3A 2R84A 4IZOA 5GTHZ 1XILA 5A9GA 3JD3A 1HR0O 4EG0A 1Z2PX 4I55A 5KHKA 1F4MA 3E86A 3JASB 4DR7B 1VQ6V 2GSMB 5LGUA 2UXBO 1TGOA 4QE7A 1UC9A 5I5UA 2Q68A 3RTXA 4B3TO 4MT8A 3RFRA 4FFNA 1IVSA 1H2SB 3MD0A 2Z02A 1K92A 2DQ0A 1IBMB 2R7MA 5D1OA 2ZIOA 3KZIZ 3QVNA 5B1AC 1XREA 4LF6O 4B3RB 1NZ6A 3RGBA 1M1KW 2D3OW 1SS3A 3ZJZA 4BIOA 1Y74B 2HEPA 4QE9A 3L9DA 2KQXA 1N34B 3FKSG 1F4NA 3JD0A 3SYOA 3QNEA 1EN6A 5KLVH 1B6QA 3HKCB 3CEIA 1SQBH 3WG7C 4LF7B 1IBLB 1KT8A 3QO5A 3JALB 3ZMZA 4IHJF 2FL4A 4JI8O 4ICGA 1Y76B 5I5VA 2W6PA 1ZUQA 3NR7A 4H33A 5LA6F 2B1IA 2DYRB 2YUAA 4LF4O 3RV3A 4I9WA 3QTCA 3STZC 3R9RA 4NYKA 5L3BA 1QBZA 5JVDA 4RCNA 1F23A 3UO2A 3N2GA 2YEVA 4YIOA 3Q1KA 2CGNA 2OYQA 4TSFG 2DYSB 2GTAA 2QE7G 3MHHC 1HNZB 4LFBB 1COWG 2WAMA 1JJOA 1C30A 1GO3F 3ETQA 1R3LC 1KBHA 3UQ8A 2PF4E 1M90W 1Y76A 3K5IA 1A48A 3T9EA 4O4IF 1VQ9V 2OTJV 2CNVA 4HNVA 1AJQA 1NTMH 3OT7A 5LXTA 4HYOA 4MVSA 1VQOV 4IWXA 4J9YB 1GH6A 4WF9V 4L1KA 2QWQB 1IURA 1KJQA 3VNNA 5EK0A 3SPGA 4O86A 1VEWA 5BR8B 1K97A 1R1BA 2ZDIC 5K2MA 2JK5C 1IX9A 4GX1A 4CKEA 4JTAB 3D36A 4RUEA 4DRXB 2VQFO 1RPOA 1WA8B 4X1YA 1SQGA 2IJHA 2UXDO 3AG4C 3B2EE 3K79A 3K04A 4ZOLF 2DQ3A 5JQWA 2JVDA 1EFRG 1GSHA 3CJHB 2R72A 1XUQA 4X1IB 2QKCA 3BAAA 2HVSA 4CH3A 2E5LO 4B3SO 1P84F 5CA0B 2ZDQA 4OXSA 3T54A 2DAAA 3F5WC 1EN4A 2UU9B 2EZOA 3A0BZ 1G4YB 1VARA 1ZTEA 2ETNA 1KUTA 5JVLA 3ASOB 2YSUB 5LBQA 4AQYB 3JARA 4TV8B 2V5AA 5IJ0A 3K03A 1SF9A 1Z2GA 1BHAA 2EINB 2VQEO 1Z2NX 3HKDA 2VQDA 2VWJA 4P9PA 4FLXA 2W70A 2KG7A 3ASNB 4MW8A 3FB7C 4C5AA 1YIJV 3CSXA 1JFFB 2RJZA 1FJGB 5LGNA 4O7VA 1BHBA 5EC1C 3CRRA 5BWTA 3RT3C 3OM3B 2Y69C 3K5LA 4PI0A 2VS0A 1QVFU 4YAKB 4FZ0A 4CH6A 4NR1A 4YY3B 1HNXB 1CKNB 2PGGA 4O7WA 1CEZA 4WFFA 4LF5O 1M93A 2SCUB 4G2KA 2L35A 2PY5A 4JASA 5JH7B 2ATKC 4D7SA 4O4JB 2E75B 3OUUA 2VQFB 3JD4A 2ZNIA 1R6NA 4BAYA 4ZHQA 4Y8VB 1NKDA 4J42A 4MV6A 4JXUA 4O2BB 2GLTA 5IY5C 1D5NA 1GSOA 1MSDA 5BWVA 3T4DA 3W1BA 4PA3A 4RO2A 3CPWU 3ABUA 3K3WA 1YZBA 4DV7B 2BE3A 3LUTB 3JCUZ 1EHIA 3WNZA 3CC7V 3DXRA 2BTOA 1X9NA 2PYLA 1KECA 1MSWD 2LQTA 1ZAUA 2CE4A 3ICXA 3S24A 5KA6A 5IYDO 2BCCH 2X5RA 3OUSA 3U10A 5LMNB 4XDLA 2X6BA 3CCJV 1AR4A 5H5NA 3JZFA 1M4UA 5FR9A 4WBNF 4W4KA 4LR3A 3SGIA 3UO3A 5IT9N 3STLC 2W6IG 2A06H 3W7WA 1CKNA 4I0XA 2LW1A 4RZQA 2COJA 2R7LA 4FM0A 4O7TA 2KB1A 4H44B 4LFCO 3T99A 2DN9A 5IWAO 2P06A 4IL6Z 3VQVA 4TV8A 1VS0A 3CMEV 1WB8A 1GN3A 3BFRA 1QLEC 1VQKV 5LL6Y 2RQ6A 2YIDA 2UXBB 1AR1B 1KBLA 4DUYO 3SPHA 3VOUA 4X64O 2CFMA 2EIKB 5CB4F 2HVJC 4NB5A 2RN9A 4GYCB 2VQEB 2XAHA 5KX5F 3FB5C 3KCYA 3M7MX 2V7QG 3WB0A 4H0LB 5JVDB 2UXCO 3AX6A 3TINA 1AI6A 5FNVB 3KALA 3ABMC 1KJJA 1KD1W 2EBOA 2UUBO 1FFTB 3ETJA 3VBBA 3ZHSA 2R86A 1KTAA 3JRXA 4L87A 5CBHA 2CH7A 3DXRB 1KB9F 4YJ2B 2BSKA 4X9QA 1K9MW 3SDLA 4GX0A 2Y4RA 4TUYA 4CBCA 5BPFA 3FAVB 4ZBMA 2HGXA 4N21A 1RSOA 4PA6A 2OTLV 1JA8A 1KQSU 3CCUV 3N6RA 5BXZA 1PV0A 3AW8A 2Y69B 2GV9A 2YS7A 4JI3O 1U96A 2PN1A 4XZ3B 2UXDB 4I7ZB 4O2AB 3ZHQA 2DW4A 2FP4B 4ASUG 4G28B 5L3EA 5LMUB 4TWKA 4O7NA 2YIBA 1E1RG 2Q6AA 1FXKA 4B7EA 3G71V 4M9UA 2GPWA 1W0JG 2IW5A 1AP5A 1VF5B 2ZQMA 2VPQA 2YZGA 5J9PC 2IJJA 2NLJC 1A32A 1YEWA 4K35A 3W7TA 1IDSA 1I7FA 3RYHA 2NN4A 3MDSA 1XBLA 3BACA 3LNNA 1YITV 2ZDGA 2HJWA 1IOWA 2KSDA 4I55B 4HAMA 1FXVA 5DAAA 3E89A 1PNKA 3RYFB 1S72V 3RYCB 3HKEA 3KREA 3W7SA 3CXCU 5GONF 3CRQA 3OUZA 2DYSC 3LWBA 2IU3A 4DR4O 3JYCA 1XNRB 4PDRA 2WLIA 1TUEB 4DUYB 1BS3A 3HKDB 4FVMA 5JH7F 2P0AA 5I60A 2ZM6B 3ETDA 5IJ0B 3LSSA 4YY3O 4OPAA 1QR9A 3OTOB 1XNQB 1DF5A 4IYHA 4MV7A 4AHCA 1SETA 5IE9A 1XL4A 2HG8A 4UFZA 2VRZA 2CK3G 4IHJA 3TXQA 4DV6O 2QJ1A 2AW9A 3DC6A 3ABTA 1Y67A 3NBZB 4J41A 2ZKOA 3CHXA 2XT9A 4JI1B 1CE8A 3RR5A 3UM7A 5TISZ 1B6SA 2YIBD 4J7KA 1R3KC 4O7ZA 5E25A 1LR1A 4JZ2A 5KA5A 1TUBB 1QVGU 4IYIA 5IJ9B 1AI7A 4R50A 1UFIA 2UU9O 1VF6A 2QDOA 3WWHA 3P30A 1SRYA 2B5UA 3UKMA 4N23A 2H3OA 2JS3A 2AHYA 4FPPA 4NZNA 1MNGA 2GQSA 3ETHA 3HKEB 5EZYF 2X6AA 1SKVA 2R70A 2ZE8A 3GWOA 3O65A 5D5PA 3P3NA 1VQPV 3WWJA 1BQZA 3JARB 1HNZO 3EFFK 3CB2A 4DIMA 3EVKA 3JAMN 1SZXA 5CB4B 1G8MA 5DN6G 4Q6GA 4B3MO 2HKOA 4RWUA 2BTQA 4JYCA 4NTXA 5HFMA 4A5UB 1V54C 1FKAO 1CQJB 1HNXO 4PA9A 3K5OA 4MV1A 5BY1A 1YTFB 3TJTA 5DM6V 1AR5A 4O83A 5EIBC 1ULZA 2Q4PA 3E8HA 1CS0A 1GM9A 1RFYA 4CS3A 1IOVA 1TVKB 4FFLA 1BCCH 1S5HC 3FD9A 1ZL8B 2LGQA 3OUFA 4Q4CA 3IC7A 3BA9A 4FFRA
chains in the Genus database with same CATH topology
3SR2C 2QB5A 4LF7B 4ZI7A 3JSLA 1IBLB 3U0GA 1KT8A 4DK0A 3JALB 3RYCA 2EIYA 4LFAB 4TV9A 2ZIMA 4YJ2A 3JSNA 5I5VA 4DR5B 3OTFA 1TVKA 5I5WA 5JQGA 1G6UA 3K5MA 3VQXA 4ZOLB 3QTCA 4UCTA 5BMVA 1G2WA 4DV4B 1O9HA 5FNVA 1JFFA 4TQFA 4RCNA 5JVDA 4L8JA 5FPOA 4AILC 5BWXA 3N2GA 3RYIA 1Q43A 4GLWA 4GKKB 5JJJB 1O9GA 4I50A 3RWRD 4O4IA 4CMDA 1SA0B 2OYQA 5K3WA 2P5OA 2EJ0A 1HNZB 4LFBB 1JJOA 3ETQA 5IJ9A 2HDKA 3N2KB 1XI1A 3UQ8A 5LOVB 4CC6A 4CMFA 5LP6C 2ZCEA 4CS2A 5I5XA 1XHZA 1WNSA 1EKFA 5FPRA 5GONB 2ZINA 3T9EA 1JMKC 5JJEB 3BPZA 5KHJA 4I4TA 5LXTA 4M0JA 4IWXA 1L8DA 4I9QA 2ABJA 2XHBA 1B04A 2F1MA 4FLZA 1HR0B 4DAAA 4O4JA 1SQFA 5EYPB 5BR8B 4FLTA 5K2MA 4DV2B 4DV1B 4BWAA 4X62B 2R9AA 2DABA 4DUZB 4DV0B 4CKEA 2Q7GA 2CAZC 3JALA 4TOIA 2ODTX 4DV5B 2QM4A 1ET0A 4X1KA 2IM9A 4DRXB 4U3JA 1EKVA 1SQGA 4X1YA 5LA6B 1I94B 5GONA 3CEBA 3B2EE 2PYJA 4Q4DA 4NXMB 4DR3B 3THOA 3JAWB 5EZYB 2JVDA 4KL1A 1WRVA 4B3SB 2R72A 4PHZA 4X1IB 3BAAA 1VF7A 4DK1A 5ITZA 2HHHB 4CH3A 3BRCA 3A2FA 5CA0B 1QQCA 3HKBA 3T54A 4CKCA 2DAAA 4DRXA 2UU9B 4K6NA 4X65B 1NT2B 3JATB 1EKPA 4JI3B 5CB4A 4NXNB 4O4LA 5EIBD 2P22C 4CKBA 4AQYB 3JARA 5IYZA 4TV8B 5IJ0A 4O2AA 4LH6A 3K57A 3ZS8C 4UCSA 5DGHA 3HKDA 4EB6B 4DQNA 2VWJA 4F6RA 4FLXA 2PUSA 4LF8B 2F66C 1QHTA 3QQMA 3CSXA 4F6RB 1JFFB 5DGIA 1I2KA 4CS4A 2RJZA 4DR2B 1FJGB 4ZHQB 2E3CA 3BA8A 4HNAA 4O4HA 4CH5A 1DGSA 1A0GA 4PBCA 5LOVA 5BWTA 4CHIA 1TUBA 3UZBA 3K59A 5CA1A 3K5LA 4PI0A 1XHXA 1KU9A 1T5EA 4UCRA 4LF6B 1I1MA 1Q8IA 4CH6A 4YY3B 2PTMA 1HNXB 4WBNB 2PGGA 5LXTB 4X1KB 5LP6B 4DR1B 2F93B 5I5TA 1M93A 4IIJB 2COIA 2ZGIA 4O2BA 4X66B 5JCOC 3UYYA 5BYBA 3RYFA 4EFBA 5CR5A 5LYJB 2UUCB 2PY5A 1DAAA 5JH7B 4FFBB 2HHFB 4D7SA 4O4JB 1XMQB 3SJBC 2VQFB 4JV5B 2ZNIA 4ZHQA 3DTFA 4LF4B 3SJAC 2UUBB 3SNOA 4K0KB 4JXUA 4O2BB 3LULA 4JI8B 4YJ3B 4CH4A 5BWVA 4JI6B 3U0ZA 1IBKB 3JZ6A 4DV7B 1XMOB 4JI2B 1A3GA 1HW7A 1TAEA 2BTOA 4LNUA 4X1IA 3JASA 2PYLA 3T9AA 1FFXB 1ZAUA 3ICXA 3JAKA 2JS5A 4O4HB 4NZOA 4O4LB 4HNAB 2X5RA 5LYJA 4TV9B 3U10A 5LMNB 4LFCB 5FR9A 1M4UA 4B3TB 4I4TB 4ZI7B 4LR3A 3SGIA 1IYDA 3DAAA 3T1YB 2BTQB 5J2UA 2F95B 2COJA 4LF9B 1IYEA 4FM0A 5KS8A 3TEKA 3K58A 4FLVA 3U11A 3HT5A 5CA1B 4UUGA 3T99A 2Q7EA 1WN7A 5EYPA 2Q0AA 3WWIA 3N2KA 2PZSA 3VQVA 4ZOLA 4TV8A 5KHHA 4JI0B 3E22B 3IAYA 4FFBA 2HHFA 3K5NA 3PFFA 5BYAA 4JYAB 2RQ6A 1N33B 2UXBB 3T9DA 5KX5A 4B08A 3UT5A 5D5QA 2VQEB 4GYCB 4NZMA 3M7MX 2Q7HA 3WB0A 5JVDB 1UC8A 2A1HA 2ZNJA 3HKBB 5FNVB 5CA0A 4NVPA 5J2TB 5K1XA 3E22A 3VPDA 3BABA 1KTAA 2EJ2A 3FFQA 3T9FA 1I1KA 4ZIBA 4YJ2B 4EEQA 5JCOA 2Y4RA 4TQDA 4TUYA 2HGXA 2E5LB 1RSOA 3UT5B 4YHHB 4BW9A 4UCUA 5ITZB 2GV9A 2Q7DA 3WB1A 1FFXA 2UXDB 4O2AB 4TVIA 5I47A 4EFEA 4PI2A 5LMUB 1D5AA 2YIBA 5KHIA 1N32B 5KMGB 1J5EB 3JATA 5HNEA 1WPBA 5I5YA 2KKWA 4UCOA 4KHPB 4D7TA 2VWKA 4WBNA 1YEWA 3DTGA 1I7FA 4FLUA 3RYHA 2JGUA 3QG5A 1HNWB 3BACA 3LNNA 4HBNA 5BWUA 3PN1A 4B3MB 3SJCC 4I55B 3JAKB 4LH7A 2UUAB 1M5IA 4DV3B 2OWOA 4FM1A 5C8YB 4HN2A 5DAAA 3MAQA 5IWAB 3RYHB 3RYFB 1X4TA 1SA0A 3RYCB 3HKEA 4DR6B 1TA8A 3T1HB 4YJ3A 4JI5B 4UCVA 4JI7B 1Z5VA 1XNRB 4DUYB 3HKDB 4EB6A 4K8XA 4FVMA 5I60A 2ZM6B 5IJ0B 4LNUB 3JAWA 3CSWA 3OTOB 1XNQB 2EJ3A 4DR4B 4X1YB 5LA6A 4AHCA 4I50B 4FLWA 4GLXA 2YI8A 5J2UB 2HG8A 4UFZA 2F4VB 4IHJA 4IIJA 3N2GB 3RYIB 2COGA 2QJ1A 1I1LA 2YIAA 1V9PA 4X20A 5K1PA 3CHXA 4JI1B 4TUYB 4FM2A 2YIBD 5E25A 2UXCB 4GKJB 5JJNB 3ZEDA 1Q3EA 3QF7A 4OX9B 1TUBB 5IJ9B 4DV6B 5EZYA 1I2LA 3WB2A 5CM0A 4CE5A 5BWWA 3WWHA 4IWYA 4TM5A 2V4DA 3UZOA 4NZNA 3T9BA 4IHJB 5BWRA 1KMIZ 3HKEB 4K8ZA 5KHGA 5KX5B 1XQ8A 1SKVA 2R70A 3DSQA 3VQWA 1S5JA 5BMVB 4I55A 5KHKA 5D5PA 4FLYA 3JASB 4DR7B 3VQYA 3BHPA 3WWJA 3LQSA 1TGOA 3JARB 5IYZB 1UC9A 5I5UA 5JQGB 1Z5WA 5J2TA 3CB2A 4WHXA 3RFRA 4CC5A 4LF5B 5CB4B 4X20B 1H2SB 4Q6GA 5CE8A 2BTQA 5KMGA 1IBMB 2ZIOA 3TW7A 4X64B 5LP6A 1N36B 5I5SA 2EX3A 2HGWA 3HKCA 4B3RB 3K5OA 3RGBA 3T7AA 4JI4B 1P49A 5EIBC 5C8YA 2HEPA 5JH7A 4CS3A 1TVKB 2YXLA 1N34B 2YI9A 4Q4CA 3T9CA 1Q5OA 3BA9A 4O4IB 3HKCB 4U3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 B;  3SGI A;  4X65 B;  3T1H B;  4LF7 B;  3JSL A;  3T1Y B;  1IBL B;  4JI5 B;  4UCV A;  4JI3 B;  4JI7 B;  1XNR B;  4LFA B;  4DUY B;  4LF9 B;  4NXN B;  3JSN A;  4DR5 B;  4AQY B;  2ZM6 B;  4JI0 B;  4LH6 A;  4UCT A;  4DV4 B;  4UCS A;  3OTO B;  1XNQ B;  4JYA B;  4DR4 B;  1N33 B;  2UXB B;  5FPO A;  4GLX A;  4UFZ A;  4LF8 B;  2VQE B;  2F4V B;  4GLW A;  4B3T B;  4GKK B;  1V9P A;  4JI1 B;  4DR2 B;  1FJG B;  3BA8 A;  1HNZ B;  4LFB B;  4GKJ B;  2UXC B;  1DGS A;  3BAB A;  4OX9 B;  3UQ8 A;  4CC6 A;  4DV6 B;  4LF6 B;  4UCR A;  4EEQ A;  5FPR A;  4YY3 B;  1HNX B;  2E5L B;  4DR1 B;  4X66 B;  4YHH B;  4EFB A;  4UCU A;  2UUC B;  1B04 A;  2UXD B;  4DR7 B;  1XMQ B;  2VQF B;  4JV5 B;  1HR0 B;  5BR8 B;  4EFE A;  5LMU B;  4LF4 B;  4DV2 B;  4DV1 B;  2UUB B;  4X62 B;  4CC5 A;  4LF5 B;  1N32 B;  4K0K B;  4DV0 B;  4DUZ B;  4TOI A;  1J5E B;  4JI8 B;  1IBM B;  4JI6 B;  4DV5 B;  1IBK B;  4X64 B;  4UCO A;  1N36 B;  4KHP B;  4DV7 B;  1XMO B;  4JI2 B;  4B3R B;  1I94 B;  1TAE A;  4NXM B;  4DR3 B;  4JI4 B;  1HNW B;  3BAC A;  3PN1 A;  4B3M B;  4LH7 A;  1ZAU A;  2UUA B;  4B3S B;  4DV3 B;  2OWO A;  1N34 B;  3BAA A;  5IWA B;  2HHH B;  5LMN B;  3BA9 A;  4LFC B;  4DR6 B;  1TA8 A; 
#chains in the Genus database with same CATH topology
 3SR2 C;  3JSL A;  2M6Y A;  5E79 Z;  4DK0 A;  4QPK A;  2IU0 A;  4PA4 A;  2EIY A;  4TV9 A;  4YJ2 A;  1M56 C;  5JQG A;  1G6U A;  2CTP A;  4H37 A;  3I5D A;  4I5S A;  3G8C A;  4UCT A;  4JI1 O;  4MW3 A;  5BMV A;  2YL2 A;  2Q5Z A;  5FNV A;  3G6E V;  1QLE B;  4U7O A;  4NXM O;  4L8J A;  3R23 A;  1DV1 A;  5BWX A;  3RYI A;  2AXT Z;  3GVM A;  2CTQ A;  1O9G A;  4I50 A;  3JRW A;  1IZ3 A;  5K3W A;  2P5O A;  2EJ0 A;  1RM1 B;  3D36 C;  1CKM A;  4WCE V;  1Q81 W;  3LSU A;  2ZXW B;  2HDK A;  1VP7 A;  1SQV H;  4GKK O;  2ZCE A;  3GB8 B;  2QKS A;  3F7V C;  2DE0 X;  1EKF A;  2Q9L A;  5GON B;  4DRF A;  2ZIN A;  4UV9 A;  1V55 B;  5JJE B;  1K33 A;  3BPZ A;  4I50 F;  4WFB V;  2EIJ B;  2D2C B;  3C3S A;  1L8D A;  3APO A;  1S5L Z;  3RV4 A;  5HV6 A;  1JX9 A;  4GX5 A;  3ZN0 A;  2YIC A;  2W6Q A;  2I87 A;  3WO0 A;  4PZ6 A;  3OD4 A;  2F1M A;  3B77 A;  4O4H F;  1AJN A;  1FVI A;  4O4J A;  1L1F A;  2QWR B;  1ORQ C;  3OFN G;  4DV1 B;  1OCO B;  2R9A A;  2DAB A;  1Q6U A;  3ZRW B;  4AI8 A;  1OCC B;  3H1K H;  3ZMU A;  2QM4 A;  4X1K A;  2IM9 A;  1K3E A;  1SQX H;  2EJ7 A;  5LA6 B;  4UVA A;  5GON A;  2HLD G;  4MSW C;  4FZ1 A;  1VMG A;  3P32 A;  4Q4D A;  4NXM B;  1RP3 B;  4DR3 B;  3JAW B;  4KL1 A;  3CCS V;  3B09 A;  3Q4H B;  1ENV A;  2ZM6 O;  4DK1 A;  2HHH B;  3W5O A;  1EN5 A;  3A2F A;  3BRC A;  3ZBH A;  1QQC A;  1VQL V;  1JLL B;  2JIZ G;  3HKB A;  3LSQ A;  4DRX A;  4K6N A;  2GUZ A;  3JZI A;  4JI3 B;  4O81 A;  2ZT9 B;  1YJN V;  5CB4 A;  1K4C C;  3B8M A;  1XDN A;  1K7D A;  3OW2 U;  2P22 C;  3IGA C;  4QSH A;  1OCR B;  4O2A A;  4LH6 A;  2OCC C;  3K9S A;  4LF9 O;  2OIG A;  2QKA A;  3ZMS A;  4LF8 B;  2F66 C;  1QHT A;  4BIZ A;  3APQ A;  2QTS A;  2AZ0 A;  1VKZ A;  4JTC B;  5DGI A;  1I2K A;  4CS4 A;  4DR2 B;  3U55 A;  1SZT A;  4HNA A;  1NTZ H;  1PPJ H;  1YXB A;  1TUB A;  3UZB A;  3L70 H;  4E6N A;  3ZRS A;  4MVM A;  1Q8I A;  4I4T F;  1I5X A;  4P30 A;  2AHZ A;  4X1K B;  5LP6 B;  3ZHV A;  4DR1 B;  5B1B B;  5I5T A;  2ZGI A;  4DR5 O;  4O2B A;  2YS8 A;  1B6R A;  3UYY A;  2NU7 B;  1N34 O;  1H8H G;  5LYJ B;  2ZE6 A;  1DAA A;  5CA1 F;  3ABK C;  1W0K G;  2NU9 B;  1Y4M A;  3D3I A;  1DTO A;  1JQ0 A;  3SJB C;  1V55 C;  1N4C A;  1BXR A;  4ME6 A;  3ASO C;  1EUC B;  3DTF A;  2NU6 B;  2VUG A;  4R7C A;  2RCV A;  2C00 A;  3VMM A;  4ZKI A;  4FFM A;  5AG2 A;  4EKW A;  1Q6H A;  3LDD A;  4MTX A;  1JR9 A;  4JI6 B;  3U0Z A;  1SCU B;  3JZ6 A;  3V4Z A;  2K9P A;  1A3G A;  1VBH A;  3E8F A;  2WYO A;  1PL0 A;  4LNU A;  3T9A A;  1F51 A;  2Y0I A;  4HZ3 A;  4O4L B;  4AQY O;  4LFC B;  3TGU H;  4I0X B;  1IYD A;  2GUZ B;  1FS0 G;  1SQP H;  5D1O B;  4C5B A;  4WFG A;  2I80 A;  2CGO A;  4LF9 B;  2R87 A;  4HR7 A;  3MJF A;  1WN7 A;  5EYP A;  2GHY A;  4O7L A;  3N2K A;  5H80 A;  5BMV F;  5KHH A;  4J11 A;  2RNB A;  3IAY A;  3VPC A;  4RQE A;  1BSM A;  1OCZ C;  4XYM B;  5BYA A;  4JYA B;  1N33 B;  4B3R O;  2N74 A;  4LCU C;  1DF4 A;  4B08 A;  5HBR B;  2ADP A;  1EZJ A;  4EGQ A;  2JDI G;  5B1B C;  3NXS A;  1PX2 A;  3H1L H;  4O2B F;  4MA5 A;  1BL8 A;  5CA0 A;  5J2T B;  4O4J F;  3R5X A;  2JGD A;  2ZR2 A;  1N0N A;  3E22 A;  3QO8 A;  3VPB A;  3ETE A;  2EUL A;  2ADQ B;  3BAB A;  2EJ2 A;  1U97 A;  1I1K A;  2YS6 A;  5EBW C;  3FB8 C;  2XAQ A;  2A79 B;  5DED A;  2UUC O;  2LJ2 A;  1AI4 A;  1I94 O;  4PDM A;  4J7J A;  1S76 D;  3K5H A;  5B1O A;  3ASN C;  2E5L B;  4R8C A;  1W93 A;  2HHH O;  1YTF D;  2CZG A;  1THZ A;  2FTK A;  1PP9 H;  2IP4 A;  1YJW V;  5EC2 C;  2JRI A;  3WB1 A;  1FFX A;  4EFE A;  1I7L A;  4QNH B;  4PI2 A;  1SQQ H;  1D5A A;  3ZIA G;  5H9C A;  4MTO A;  1M6V A;  1FYJ A;  2Q2T A;  4U7N A;  1CP9 A;  2P90 A;  3CC4 V;  1J5E B;  1WPB A;  1E4E B;  4D7T A;  3FAV A;  2VWK A;  2Z5U A;  4WBN A;  3DTG A;  4JZG A;  4FLU A;  3ZHU A;  1Q6I A;  4PD4 F;  3QG5 A;  4LBE C;  1GTO A;  1NVP D;  4HBN A;  5BWU A;  2IH3 C;  4MVZ A;  1M5I A;  4HN2 A;  1IBM O;  3WG7 B;  4DR2 O;  5IWA B;  1QNM A;  3RW0 A;  2UUA O;  4BIU A;  5BR8 O;  1VQ5 V;  1TA8 A;  1K73 W;  2FPG B;  3TET A;  3J7A U;  5DIS C;  1KEE A;  4UCV A;  4JI7 B;  4JYA O;  3TY9 A;  1P8L A;  4UB6 Z;  4DUZ O;  1EBO A;  3OR7 C;  2HIX A;  3GLK A;  5KUK A;  2K1E A;  1BQ0 A;  2W6O A;  2ODM A;  4RAI A;  3SE7 A;  3P3P A;  2E74 B;  3JAW A;  3K9A A;  3X2Q B;  5CN0 A;  4O7R A;  4XYL B;  1M57 B;  2EJ3 A;  5LA6 A;  2NU8 B;  4DR3 O;  1GN6 A;  2N04 A;  3E8B A;  1FXK C;  1QCE A;  4DV4 O;  2NUA B;  2PBZ A;  2GDS A;  1V9P A;  5K1P A;  4LFB O;  2XAG A;  1DIK A;  2JJ2 G;  4O2A F;  1GGO A;  1IXB A;  3JCZ A;  4O4L F;  1Y74 A;  4DV6 B;  5EZY A;  1I2L A;  1X59 A;  4CE5 A;  3CCQ V;  4JI6 O;  1K4D C;  4YBZ B;  3BG5 A;  1ROP A;  1V54 B;  3G67 A;  2WLJ A;  5BWR A;  1KMI Z;  3G80 A;  4XDJ A;  4X89 A;  4K8Z A;  3DC5 A;  5KX5 B;  1XQ8 A;  3OGI B;  1NH2 D;  3VA7 A;  3DSQ A;  3W7U A;  1S5J A;  3H1H H;  5BMV B;  5FNV F;  2OLS A;  1YCI A;  2DWE C;  2CTW A;  3BHP A;  4EGJ A;  3J81 N;  4PA7 A;  1I0H A;  4R6Z A;  5JQG B;  1E1Q G;  5J2T A;  1P16 A;  3KG2 A;  4LF5 B;  4YJ2 F;  3L71 H;  5CE8 A;  1AP6 A;  4X66 O;  4MA0 A;  3ZRW A;  3RUP A;  1CKO A;  4X64 B;  5LP6 A;  1L0N H;  1N36 B;  2W0F C;  5I5S A;  3RN4 A;  2EX3 A;  2HGW A;  3HKC A;  2YRW A;  3TY5 A;  1M56 B;  4ABM A;  1GKF A;  3ZCC A;  3DGE A;  1UJW B;  1P49 A;  1G1X B;  5C8Y A;  2MK3 A;  4X62 O;  2ILM A;  2YI9 A;  4MTF A;  4BR6 A;  3T9C A;  1Q5O A;  3HR0 A;  4JAU A;  2CUG A;  3KYH C;  2QB5 A;  4X8A A;  1ZLZ A;  4ZI7 A;  2OT5 A;  3U0G A;  4MTG A;  4KUM A;  4XBF A;  3UFX B;  3RYC A;  1QU7 A;  3JSN A;  5H6Q A;  2WLL B;  4DR5 B;  2B1G A;  1TVK A;  1US6 A;  1LUV A;  1NBM G;  4J10 A;  3VQX A;  4PJ0 Z;  1G2W A;  4I55 F;  1O9H A;  2W71 A;  1JFF A;  4TQF A;  1HWY A;  3ABL B;  3RBZ A;  2YDE A;  3TII A;  1Q43 A;  4GLW A;  2DWD C;  4K0K O;  4YJ3 F;  3D8C A;  3RWR D;  3TQT A;  4O4I A;  4CMD A;  1SA0 B;  1PL4 A;  3CRA A;  5IJ9 A;  3ETG A;  5LOV B;  2DWC A;  3T1Y O;  2PVP A;  4CS2 A;  4NYE A;  5I5X A;  1WNS A;  1JMK C;  4MV8 A;  2RDC A;  2Q2U A;  5B1N A;  2ABJ A;  1R3I C;  2CNU A;  2HVK C;  3UCS C;  1YHQ V;  3SYA A;  1VBG A;  2EIM B;  4FLZ A;  4ZHQ F;  2XTA A;  1HR0 B;  3N27 A;  2Y0P A;  4DV2 B;  2C2A A;  3T2M A;  2XD4 A;  4JI0 O;  3CCR V;  3WU2 Z;  4DV0 B;  2Q7G A;  3JAL A;  4TOI A;  2EIK C;  3CCV V;  4JAA A;  2ODT X;  5KAI Z;  1LUW A;  4DV5 B;  4YIP A;  5JWP A;  2A0L A;  1EKV A;  2DMX A;  1QLN A;  1Z2O X;  2ARH A;  1GK9 A;  2QK4 A;  2P6J A;  1I94 B;  3CEB A;  3JD2 A;  2Z04 A;  1SER A;  3OEE G;  4MVQ A;  1VQM V;  2V58 A;  3THO A;  5EZY B;  3TY8 A;  2GBO A;  1WRV A;  5KAF Z;  1AUX A;  1H38 A;  3MWD A;  1N32 O;  2AGA A;  1OCC C;  1OZ0 A;  5ITZ A;  2WWW A;  5L3D A;  3OMN B;  5LXT F;  4CKC A;  1W59 A;  1VQ8 V;  4Z1V A;  2UXX A;  4X65 B;  1NT2 B;  1NJI W;  2ITD C;  5DEC A;  3K06 A;  4NXN B;  4O4L A;  1EZ1 A;  5EIB D;  2ZD9 A;  3AG3 C;  5IYZ A;  4Z1M G;  1S3J A;  1PNL A;  2W6J G;  5EBM C;  3TK1 A;  2F23 A;  3K57 A;  4C5C A;  5C1P A;  1NS1 A;  2DYR C;  1M57 C;  5DGH A;  4P9O A;  4EB6 B;  3L74 H;  3BCC H;  4F6R A;  2PUS A;  2YEV B;  3T1C A;  1H2N A;  1PK8 A;  1FXK B;  1GRJ A;  4F6R B;  4PEL A;  1ZWI C;  1NTK H;  1H2M A;  2HJD A;  3BA8 A;  5E1A C;  5BPH A;  4PBC A;  1DGS A;  1A0G A;  3A0H Z;  3ABL C;  2ZXW C;  3CC2 V;  3SPI A;  3GB7 C;  5CA1 A;  5LHH A;  2HIV A;  4TV9 F;  3AG3 B;  2W6N A;  4J9Z B;  1YJ9 V;  1T36 A;  2PTM A;  4Q20 A;  3CX5 F;  1DLB A;  2FB9 A;  5CMU A;  1Y6X A;  2COI A;  3L73 H;  2P4K A;  4X66 B;  4E4E A;  5JCO C;  2Q69 A;  4LWS A;  4EFB A;  4FK5 C;  1RM1 C;  2HHF B;  5D8D A;  3WO1 A;  2WLK A;  1KJ9 A;  4JV5 B;  2ZDH A;  2G38 A;  1D2D A;  1IBK O;  5IDJ A;  2UUB B;  3SNO A;  3TCU A;  2BOB C;  4FFP A;  4DV2 O;  2WSS G;  3FYI B;  3LUL A;  4JI8 B;  4YJ3 B;  5J2U F;  1IBK B;  4XX0 B;  4F4L A;  4JI2 B;  1HW7 A;  4LF7 O;  1TAE A;  1KJ8 A;  4ZQI A;  1BMF G;  4J80 A;  3AG1 C;  4WFE A;  1FFX B;  3JAK A;  2W0X A;  3IFX A;  4O4H B;  3CCL V;  4NZO A;  3I55 V;  1XDC A;  1ZX3 A;  4I4T B;  4ZI7 B;  3DAA A;  3T1Y B;  4TUY F;  5DMX A;  3C3T A;  2WA4 A;  2F95 B;  2R7K A;  3CMA V;  3HB9 A;  1IYE A;  1ARO P;  1B3Q A;  1VQ4 V;  4FLV A;  3K0D A;  3U11 A;  5CA1 B;  2JJ1 G;  3WWI A;  1MA1 A;  3GID A;  3E35 A;  4GUN A;  3E22 B;  5L3C A;  2H8P C;  4FFB A;  5IYZ F;  4GT1 A;  3SYQ A;  1JDB B;  3GJX B;  2OCC B;  4KFM A;  4PV1 B;  3K3P A;  1YSC A;  3T9D A;  5LP6 F;  1H8E G;  3B4S A;  2AZ2 A;  3UT5 A;  1MZE A;  1QR8 A;  2Z3Y A;  3R65 A;  5D5Q A;  4EQ5 A;  4PDL A;  4QJF B;  4NZM A;  1AI5 A;  3NUA A;  1UC8 A;  2HR3 A;  2ZNJ A;  5KUM A;  4Z2W A;  4NVP A;  5K1X A;  2QWN B;  5FLX N;  2YZM A;  1OBD A;  3W1G A;  3VPD A;  3K0G A;  3L2P A;  4YAJ B;  3ORQ A;  3E83 A;  3J80 N;  1WJZ A;  2W6M A;  1H2K A;  2H94 A;  4DV7 O;  5JCO A;  1JCH A;  4GKJ O;  4TQD A;  2YRX A;  3EXA A;  2WLH A;  2HFE C;  2OIE A;  1Q7Y W;  3F7Y C;  3G6B A;  2I8C A;  2W6Z A;  4DW1 A;  1SES A;  3LDC A;  4YHH B;  4BW9 A;  2DOS A;  2QM8 A;  4UCU A;  5ITZ B;  2Y4U A;  4FIP C;  4MV4 A;  2Q7D A;  2IBZ H;  1NU1 H;  4TVI A;  3R5H A;  5I47 A;  1I7N A;  2RMK B;  1EYZ A;  4NKG B;  3OEH G;  3NBY B;  1N32 B;  5LHI A;  3CD6 V;  3C90 A;  3CRM A;  5KMG B;  1CQI B;  5HNE A;  4NXN O;  2KKW A;  3H1J H;  1NH2 B;  4KHP B;  2YW2 A;  3S3W A;  3G4S V;  3ZN1 A;  4HQ6 A;  1JVM A;  5LYJ F;  3FYE B;  4B3M B;  3JAK B;  3AK2 A;  4JAV A;  2UUA B;  1FXH A;  4DV3 B;  4FM1 A;  3AG2 C;  5C8Y B;  1J5E O;  1H2L A;  2OWO A;  1FJG O;  1SA0 A;  4DR6 B;  4OGQ B;  2R9R B;  2XND G;  3PJS K;  4JI4 O;  2PI4 A;  4JI5 B;  3AG1 B;  2EJR A;  2M7W A;  3B8N A;  3OR6 C;  4EB6 A;  3HB3 B;  1VF6 C;  4DV0 O;  2YZL A;  2CH7 B;  2EIN C;  4LNU B;  4B7K A;  2A7W A;  4HNU A;  4DR1 O;  3CSW A;  3EHB B;  1R3J C;  3CYO A;  1ZSP A;  4X1Y B;  2UXN A;  1OCO C;  1E4E A;  4GLX A;  1OCR C;  2YI8 A;  3AG2 B;  5J2U B;  5GTI Z;  1VQN V;  2KG7 B;  4P2Z A;  4IIJ A;  3RYI B;  5A2Q N;  1BNC A;  2COG A;  3ZMT A;  4XDK A;  3ZX6 A;  4FGR A;  2UXC B;  1Q3E A;  3KAK A;  3JD1 A;  4OX9 B;  4LC1 A;  2A9H A;  3OGC C;  2X7R B;  3D3Q A;  4MVU A;  5CM0 A;  4LWS B;  5BWW A;  1F7Y A;  4HNT A;  1MMM A;  3L75 H;  3UZO A;  5F2V O;  1GSA A;  3M99 B;  1YI2 V;  1BZK A;  4IHJ B;  4FFO A;  5KHG A;  1ZL8 A;  1KC7 A;  2QM7 A;  2P7T C;  3VQW A;  2BOC C;  4KXR A;  3IC9 A;  5J2T F;  4FLY A;  3VQY A;  1P7B A;  1N33 O;  3LQS A;  5IYZ B;  1PNM A;  2F43 G;  3NC0 B;  5CA0 F;  1Z5W A;  1FD9 A;  4WHX A;  3QWU A;  3OE7 G;  2IH1 C;  4CC5 A;  1Q90 D;  4X20 B;  2IJI A;  4MV3 A;  1WR2 A;  5KMG A;  3TW7 A;  4D6T H;  3H1I H;  2JEX A;  2O57 A;  1Q82 W;  3I12 A;  1N36 O;  3T7A A;  4TV8 F;  4JTD B;  4JI4 B;  1WP7 A;  3BVO A;  5LHG A;  3M8A A;  5JH7 A;  2YXL A;  1AUV A;  3H01 A;  4UV8 A;  1B06 A;  4JYY A;  4RUF A;  3Q2O A;  4O4I B;  2XAF A;  4U3J B;  2WA3 A;  2FKX A;  2FPP B;  4MS2 A;  1WB7 A;  4MVR A;  4IIJ F;  4LFA B;  2ZIM A;  2NNU A;  2N05 A;  3OTF A;  5I5W A;  3E2E A;  2DLN A;  1WPX A;  3K5M A;  3MWE A;  3DTU B;  3LDE A;  1GLV A;  4ZOL B;  3SYC A;  4DV4 B;  4JYB A;  2Q67 A;  2HVQ A;  3N8D A;  3GDE A;  5FPO A;  2ITC C;  1KP2 A;  3SYP A;  1I08 A;  4AIL C;  3LNM B;  3KCX A;  1NI8 A;  4GKK B;  5JJJ B;  5BZB A;  3CCE V;  5IYB O;  1WLE A;  1E79 G;  1R73 A;  3FB6 C;  2YC0 A;  5JQG F;  2QWO B;  3N2K B;  3X2Q C;  3ZHT A;  1XI1 A;  4NTY A;  5EBL C;  4CC6 A;  4MVO A;  4JI5 O;  5LP6 C;  4CMF A;  2JEU A;  1XHZ A;  4OX9 O;  5FPR A;  1YF2 A;  2XUM A;  4C7U A;  5KHJ A;  4I4T A;  4M0J A;  3CXH F;  3RFC A;  1SC5 B;  4I9Q A;  1Q86 W;  2B9Z A;  2XHB A;  3G8D A;  4WFH A;  4DV1 O;  2CDY A;  4JI7 O;  4LF8 O;  1B04 A;  1PM9 A;  1MZF A;  2HP8 A;  1P7G A;  3IJ4 A;  4UVB A;  3T1H O;  4DAA A;  1SQF A;  5EYP B;  2HG5 C;  2R7N A;  3ZRX A;  1JJ2 U;  4FLT A;  1DK1 A;  3KAJ A;  4DLK A;  1GM8 A;  1MOF A;  4BWA A;  3B40 A;  5C1O A;  3AK1 A;  4X62 B;  2EZP A;  3I56 V;  4DUZ B;  2CAZ C;  4GX2 A;  1KKD A;  2QEX V;  1ET0 A;  3U9S A;  4U3J A;  2PYJ A;  1W2B U;  4FU0 A;  4B3S B;  2EIL C;  4PHZ A;  1NVP B;  1UPG A;  3CRC A;  3QFF A;  5LOV F;  2Z0A A;  1VF7 A;  2MW2 B;  1XMQ O;  3L72 H;  1AVM A;  4UXN A;  4WFA V;  3JAT B;  2XAJ A;  2VR1 A;  4DW0 A;  1EKP A;  1OBG A;  4FMT A;  3V4S A;  1OHH G;  4NTW A;  4X65 O;  1WAZ A;  1AIL A;  1PD3 A;  2BSK B;  4FJC C;  1URF A;  1KKC A;  1N0J A;  2R9I A;  3Q4H A;  3CS5 A;  4CKB A;  3HPL C;  3RVY A;  2FYU H;  1M9N A;  4LP8 A;  2DJV A;  4GCZ A;  5IY5 B;  3ZS8 C;  4UCS A;  3ZMV A;  1J95 A;  1GN2 A;  1OV9 A;  4DQN A;  1HDJ A;  1K8A W;  2QGN A;  3QQM A;  3FX7 A;  3ORR A;  5GW7 A;  3AG4 B;  4ZHQ B;  2E3C A;  4DV3 O;  4QIW F;  4O4H A;  4CH5 A;  4CHI A;  5LOV A;  4UB8 Z;  4O7Y A;  3K59 A;  1I5Y A;  2R85 A;  4DO2 A;  1GAX A;  1XHX A;  1KU9 A;  1T5E A;  4UCR A;  4DYL A;  4LF6 B;  2WLI B;  1I1M A;  1JKJ B;  4WBN B;  3TIG A;  5LXT B;  5CBG A;  2Q73 A;  2QF7 A;  2F93 B;  1XOU A;  4IIJ B;  1C3O A;  1P4R A;  5B1A B;  1M0T A;  1K5S A;  5BYB A;  3MHS C;  2Y4T A;  3RYF A;  5CR5 A;  2YWV A;  2UUC B;  2LGW A;  2L6L A;  1S77 D;  2XAS A;  4YB8 B;  4FFB B;  2HVR A;  2R82 A;  1XMQ B;  2EIL B;  1EM1 A;  4U3F H;  2X6C A;  4W4L A;  4O82 A;  5B3S B;  2QTO A;  3SJA C;  1KYO F;  4LF4 B;  2X0L A;  2WLL A;  4K0K B;  3T4Z A;  1XL6 A;  2QSA A;  1XK5 A;  2XCL A;  1VIB A;  1OCZ B;  4CH4 A;  3CP1 A;  3E8G A;  4OPH A;  4E2L A;  5JVD F;  2LW7 A;  3BEH A;  1XMO B;  4JV5 O;  1JOY A;  2V1D A;  3CWB H;  2IJK A;  3AG7 A;  1AJP A;  3O9O A;  4JI2 O;  4YHH O;  4X1I A;  2FB5 A;  3JAS A;  4FFK A;  4X88 A;  3A0R A;  2JS5 A;  2DIK A;  1GN4 A;  2E76 B;  1EZV H;  4HNA B;  5LYJ A;  4RQF A;  4TV9 B;  1WP8 A;  4GZR B;  2ZE5 A;  3ZHR A;  1S68 A;  4B3T B;  5LMU O;  2V59 A;  1HNW O;  2XOK G;  2EIJ C;  3ABK B;  1FPO A;  2LFS A;  3KKY A;  4QGP A;  2BTQ B;  4DR7 O;  5J2U A;  2J9G A;  5HFL A;  1LNQ A;  1R6K A;  1KP3 A;  5L3G A;  1W96 A;  4CZZ A;  5KS8 A;  3K58 A;  3TEK A;  1VQ7 V;  1KJI A;  4UUG A;  3HT5 A;  2GPS A;  3OMI B;  5C93 A;  2Q7E A;  3BY6 A;  4K3A A;  2Q0A A;  2Y48 A;  2PZS A;  4ZOL A;  1M0W A;  2ZE7 A;  4DXW A;  4JI0 B;  5IYC O;  1IXM A;  1GMG A;  2HHF A;  1L0L H;  1MAB G;  2WLN A;  3K5N A;  3PFF A;  5B66 Z;  3F5T A;  5KX5 A;  1JPX A;  1H2G A;  2LFR A;  3ML0 A;  3K08 A;  2P4V A;  2P67 A;  1R6T A;  1OJH A;  4DR6 O;  1S0V A;  2Q7H A;  3OAA G;  2A1H A;  3HKB B;  3HBL A;  4YXW G;  4QPJ A;  2HJF C;  2FML A;  4MAM A;  3FFQ A;  3AK3 A;  1KUQ A;  3T9F A;  4ZIB A;  1IBL O;  5LGT A;  4UUJ C;  1XMO O;  4EEQ A;  2HGS A;  1HP8 A;  3OTO O;  1XNQ O;  3SJQ C;  3H9V A;  4E4T A;  2GTS A;  1FAF A;  2PI5 A;  1K34 A;  1AB3 A;  2CNQ A;  3UT5 B;  3AEI A;  3QO7 A;  5D1P A;  3ABM B;  2F4V O;  3U54 A;  4LFA O;  3CJH A;  5L3F A;  2QR4 A;  3R5F A;  2WLM A;  2YXH A;  2YYA A;  4MV9 A;  1WA8 A;  1A9X A;  5KHI A;  3A8T A;  1YDX A;  3LP8 A;  2Q8V A;  2X0S A;  1RPR A;  3JAT A;  1BE3 H;  4FE2 A;  5I5Y A;  3OMA B;  4UCO A;  4J7Z A;  4PDV A;  1BGY H;  4G27 B;  4JGS A;  4KHP O;  2JGU A;  4UVC A;  1K5Q A;  5B3S C;  1HNW B;  4F6E A;  2LO1 A;  3R66 A;  3PN1 A;  1BT8 A;  3SJC C;  4LH7 A;  2OCH A;  2CTR A;  2QWP B;  3MAQ A;  2LP7 A;  3RYH B;  3U9T A;  1X4T A;  3VOT A;  4IGG A;  5FL7 G;  3SPJ A;  1A0I A;  2ZR3 A;  1NQT A;  1XNR O;  3T1H B;  1KC8 W;  3DF7 A;  4YJ3 A;  4IT5 A;  1JDE A;  5CBF A;  1Z5V A;  3ZRV A;  3TXS A;  4DV5 O;  1GM7 A;  3WFV A;  4K8X A;  5B5E Z;  1Y66 A;  4JF3 A;  2EIM C;  3E5N A;  3S3X A;  4O84 A;  3CE2 A;  4DR4 B;  2A3Q A;  5KKN B;  4I50 B;  4FLW A;  2DZD A;  2F4V B;  3N2G B;  3W7X A;  4TT3 G;  2WPD G;  3GWK C;  1I1L A;  4BW5 A;  1YVW A;  2YIA A;  4X20 A;  4ZI7 F;  5CAE B;  4TUY B;  2YZN A;  4PZ7 A;  1PKX A;  4FM2 A;  2GQR A;  1MG1 A;  4JPR A;  1CPY A;  4GKJ B;  5JJN B;  1EUD B;  3ZED A;  1DV2 A;  3QF7 A;  2NR5 A;  1N8R W;  3TW6 A;  4O7S A;  4PZ8 A;  3RVZ A;  4KP4 A;  3WB2 A;  5C8Y F;  1NR7 A;  2JGD B;  2YXY A;  5H6R A;  1CXZ B;  4IWY A;  2FPI B;  4TM5 A;  4H13 B;  1RSO B;  1NR1 A;  2Q0O C;  2V4D A;  2QA4 V;  5LMN O;  1XEQ A;  3T9B A;  2ZDI A;  3CCM V;  3HO8 A;  5H2F Z;  3SPC A;  5CA3 A;  2R84 A;  4IZO A;  5GTH Z;  1XIL A;  5A9G A;  3JD3 A;  1HR0 O;  4EG0 A;  1Z2P X;  4I55 A;  5KHK A;  1F4M A;  3E86 A;  3JAS B;  4DR7 B;  1VQ6 V;  2GSM B;  5LGU A;  2UXB O;  1TGO A;  4QE7 A;  1UC9 A;  5I5U A;  2Q68 A;  3RTX A;  4B3T O;  4MT8 A;  3RFR A;  4FFN A;  1IVS A;  1H2S B;  3MD0 A;  2Z02 A;  1K92 A;  2DQ0 A;  1IBM B;  2R7M A;  5D1O A;  2ZIO A;  3KZI Z;  3QVN A;  5B1A C;  1XRE A;  4LF6 O;  4B3R B;  1NZ6 A;  3RGB A;  1M1K W;  2D3O W;  1SS3 A;  3ZJZ A;  4BIO A;  1Y74 B;  2HEP A;  4QE9 A;  3L9D A;  2KQX A;  1N34 B;  3FKS G;  1F4N A;  3JD0 A;  3SYO A;  3QNE A;  1EN6 A;  5KLV H;  1B6Q A;  3HKC B;  3CEI A;  1SQB H;  3WG7 C;  4LF7 B;  1IBL B;  1KT8 A;  3QO5 A;  3JAL B;  3ZMZ A;  4IHJ F;  2FL4 A;  4JI8 O;  4ICG A;  1Y76 B;  5I5V A;  2W6P A;  1ZUQ A;  3NR7 A;  4H33 A;  5LA6 F;  2B1I A;  2DYR B;  2YUA A;  4LF4 O;  3RV3 A;  4I9W A;  3QTC A;  3STZ C;  3R9R A;  4NYK A;  5L3B A;  1QBZ A;  5JVD A;  4RCN A;  1F23 A;  3UO2 A;  3N2G A;  2YEV A;  4YIO A;  3Q1K A;  2CGN A;  2OYQ A;  4TSF G;  2DYS B;  2GTA A;  2QE7 G;  3MHH C;  1HNZ B;  4LFB B;  1COW G;  2WAM A;  1JJO A;  1C30 A;  1GO3 F;  3ETQ A;  1R3L C;  1KBH A;  3UQ8 A;  2PF4 E;  1M90 W;  1Y76 A;  3K5I A;  1A48 A;  3T9E A;  4O4I F;  1VQ9 V;  2OTJ V;  2CNV A;  4HNV A;  1AJQ A;  1NTM H;  3OT7 A;  5LXT A;  4HYO A;  4MVS A;  1VQO V;  4IWX A;  4J9Y B;  1GH6 A;  4WF9 V;  4L1K A;  2QWQ B;  1IUR A;  1KJQ A;  3VNN A;  5EK0 A;  3SPG A;  4O86 A;  1VEW A;  5BR8 B;  1K97 A;  1R1B A;  2ZDI C;  5K2M A;  2JK5 C;  1IX9 A;  4GX1 A;  4CKE A;  4JTA B;  3D36 A;  4RUE A;  4DRX B;  2VQF O;  1RPO A;  1WA8 B;  4X1Y A;  1SQG A;  2IJH A;  2UXD O;  3AG4 C;  3B2E E;  3K79 A;  3K04 A;  4ZOL F;  2DQ3 A;  5JQW A;  2JVD A;  1EFR G;  1GSH A;  3CJH B;  2R72 A;  1XUQ A;  4X1I B;  2QKC A;  3BAA A;  2HVS A;  4CH3 A;  2E5L O;  4B3S O;  1P84 F;  5CA0 B;  2ZDQ A;  4OXS A;  3T54 A;  2DAA A;  3F5W C;  1EN4 A;  2UU9 B;  2EZO A;  3A0B Z;  1G4Y B;  1VAR A;  1ZTE A;  2ETN A;  1KUT A;  5JVL A;  3ASO B;  2YSU B;  5LBQ A;  4AQY B;  3JAR A;  4TV8 B;  2V5A A;  5IJ0 A;  3K03 A;  1SF9 A;  1Z2G A;  1BHA A;  2EIN B;  2VQE O;  1Z2N X;  3HKD A;  2VQD A;  2VWJ A;  4P9P A;  4FLX A;  2W70 A;  2KG7 A;  3ASN B;  4MW8 A;  3FB7 C;  4C5A A;  1YIJ V;  3CSX A;  1JFF B;  2RJZ A;  1FJG B;  5LGN A;  4O7V A;  1BHB A;  5EC1 C;  3CRR A;  5BWT A;  3RT3 C;  3OM3 B;  2Y69 C;  3K5L A;  4PI0 A;  2VS0 A;  1QVF U;  4YAK B;  4FZ0 A;  4CH6 A;  4NR1 A;  4YY3 B;  1HNX B;  1CKN B;  2PGG A;  4O7W A;  1CEZ A;  4WFF A;  4LF5 O;  1M93 A;  2SCU B;  4G2K A;  2L35 A;  2PY5 A;  4JAS A;  5JH7 B;  2ATK C;  4D7S A;  4O4J B;  2E75 B;  3OUU A;  2VQF B;  3JD4 A;  2ZNI A;  1R6N A;  4BAY A;  4ZHQ A;  4Y8V B;  1NKD A;  4J42 A;  4MV6 A;  4JXU A;  4O2B B;  2GLT A;  5IY5 C;  1D5N A;  1GSO A;  1MSD A;  5BWV A;  3T4D A;  3W1B A;  4PA3 A;  4RO2 A;  3CPW U;  3ABU A;  3K3W A;  1YZB A;  4DV7 B;  2BE3 A;  3LUT B;  3JCU Z;  1EHI A;  3WNZ A;  3CC7 V;  3DXR A;  2BTO A;  1X9N A;  2PYL A;  1KEC A;  1MSW D;  2LQT A;  1ZAU A;  2CE4 A;  3ICX A;  3S24 A;  5KA6 A;  5IYD O;  2BCC H;  2X5R A;  3OUS A;  3U10 A;  5LMN B;  4XDL A;  2X6B A;  3CCJ V;  1AR4 A;  5H5N A;  3JZF A;  1M4U A;  5FR9 A;  4WBN F;  4W4K A;  4LR3 A;  3SGI A;  3UO3 A;  5IT9 N;  3STL C;  2W6I G;  2A06 H;  3W7W A;  1CKN A;  4I0X A;  2LW1 A;  4RZQ A;  2COJ A;  2R7L A;  4FM0 A;  4O7T A;  2KB1 A;  4H44 B;  4LFC O;  3T99 A;  2DN9 A;  5IWA O;  2P06 A;  4IL6 Z;  3VQV A;  4TV8 A;  1VS0 A;  3CME V;  1WB8 A;  1GN3 A;  3BFR A;  1QLE C;  1VQK V;  5LL6 Y;  2RQ6 A;  2YID A;  2UXB B;  1AR1 B;  1KBL A;  4DUY O;  3SPH A;  3VOU A;  4X64 O;  2CFM A;  2EIK B;  5CB4 F;  2HVJ C;  4NB5 A;  2RN9 A;  4GYC B;  2VQE B;  2XAH A;  5KX5 F;  3FB5 C;  3KCY A;  3M7M X;  2V7Q G;  3WB0 A;  4H0L B;  5JVD B;  2UXC O;  3AX6 A;  3TIN A;  1AI6 A;  5FNV B;  3KAL A;  3ABM C;  1KJJ A;  1KD1 W;  2EBO A;  2UUB O;  1FFT B;  3ETJ A;  3VBB A;  3ZHS A;  2R86 A;  1KTA A;  3JRX A;  4L87 A;  5CBH A;  2CH7 A;  3DXR B;  1KB9 F;  4YJ2 B;  2BSK A;  4X9Q A;  1K9M W;  3SDL A;  4GX0 A;  2Y4R A;  4TUY A;  4CBC A;  5BPF A;  3FAV B;  4ZBM A;  2HGX A;  4N21 A;  1RSO A;  4PA6 A;  2OTL V;  1JA8 A;  1KQS U;  3CCU V;  3N6R A;  5BXZ A;  1PV0 A;  3AW8 A;  2Y69 B;  2GV9 A;  2YS7 A;  4JI3 O;  1U96 A;  2PN1 A;  4XZ3 B;  2UXD B;  4I7Z B;  4O2A B;  3ZHQ A;  2DW4 A;  2FP4 B;  4ASU G;  4G28 B;  5L3E A;  5LMU B;  4TWK A;  4O7N A;  2YIB A;  1E1R G;  2Q6A A;  1FXK A;  4B7E A;  3G71 V;  4M9U A;  2GPW A;  1W0J G;  2IW5 A;  1AP5 A;  1VF5 B;  2ZQM A;  2VPQ A;  2YZG A;  5J9P C;  2IJJ A;  2NLJ C;  1A32 A;  1YEW A;  4K35 A;  3W7T A;  1IDS A;  1I7F A;  3RYH A;  2NN4 A;  3MDS A;  1XBL A;  3BAC A;  3LNN A;  1YIT V;  2ZDG A;  2HJW A;  1IOW A;  2KSD A;  4I55 B;  4HAM A;  1FXV A;  5DAA A;  3E89 A;  1PNK A;  3RYF B;  1S72 V;  3RYC B;  3HKE A;  3KRE A;  3W7S A;  3CXC U;  5GON F;  3CRQ A;  3OUZ A;  2DYS C;  3LWB A;  2IU3 A;  4DR4 O;  3JYC A;  1XNR B;  4PDR A;  2WLI A;  1TUE B;  4DUY B;  1BS3 A;  3HKD B;  4FVM A;  5JH7 F;  2P0A A;  5I60 A;  2ZM6 B;  3ETD A;  5IJ0 B;  3LSS A;  4YY3 O;  4OPA A;  1QR9 A;  3OTO B;  1XNQ B;  1DF5 A;  4IYH A;  4MV7 A;  4AHC A;  1SET A;  5IE9 A;  1XL4 A;  2HG8 A;  4UFZ A;  2VRZ A;  2CK3 G;  4IHJ A;  3TXQ A;  4DV6 O;  2QJ1 A;  2AW9 A;  3DC6 A;  3ABT A;  1Y67 A;  3NBZ B;  4J41 A;  2ZKO A;  3CHX A;  2XT9 A;  4JI1 B;  1CE8 A;  3RR5 A;  3UM7 A;  5TIS Z;  1B6S A;  2YIB D;  4J7K A;  1R3K C;  4O7Z A;  5E25 A;  1LR1 A;  4JZ2 A;  5KA5 A;  1TUB B;  1QVG U;  4IYI A;  5IJ9 B;  1AI7 A;  4R50 A;  1UFI A;  2UU9 O;  1VF6 A;  2QDO A;  3WWH A;  3P30 A;  1SRY A;  2B5U A;  3UKM A;  4N23 A;  2H3O A;  2JS3 A;  2AHY A;  4FPP A;  4NZN A;  1MNG A;  2GQS A;  3ETH A;  3HKE B;  5EZY F;  2X6A A;  1SKV A;  2R70 A;  2ZE8 A;  3GWO A;  3O65 A;  5D5P A;  3P3N A;  1VQP V;  3WWJ A;  1BQZ A;  3JAR B;  1HNZ O;  3EFF K;  3CB2 A;  4DIM A;  3EVK A;  3JAM N;  1SZX A;  5CB4 B;  1G8M A;  5DN6 G;  4Q6G A;  4B3M O;  2HKO A;  4RWU A;  2BTQ A;  4JYC A;  4NTX A;  5HFM A;  4A5U B;  1V54 C;  1FKA O;  1CQJ B;  1HNX O;  4PA9 A;  3K5O A;  4MV1 A;  5BY1 A;  1YTF B;  3TJT A;  5DM6 V;  1AR5 A;  4O83 A;  5EIB C;  1ULZ A;  2Q4P A;  3E8H A;  1CS0 A;  1GM9 A;  1RFY A;  4CS3 A;  1IOV A;  1TVK B;  4FFL A;  1BCC H;  1S5H C;  3FD9 A;  1ZL8 B;  2LGQ A;  3OUF A;  4Q4C A;  3IC7 A;  3BA9 A;  4FFR A; 
#chains in the Genus database with same CATH homology
 3SR2 C;  2QB5 A;  4LF7 B;  4ZI7 A;  3JSL A;  1IBL B;  3U0G A;  1KT8 A;  4DK0 A;  3JAL B;  3RYC A;  2EIY A;  4LFA B;  4TV9 A;  2ZIM A;  4YJ2 A;  3JSN A;  5I5V A;  4DR5 B;  3OTF A;  1TVK A;  5I5W A;  5JQG A;  1G6U A;  3K5M A;  3VQX A;  4ZOL B;  3QTC A;  4UCT A;  5BMV A;  1G2W A;  4DV4 B;  1O9H A;  5FNV A;  1JFF A;  4TQF A;  4RCN A;  5JVD A;  4L8J A;  5FPO A;  4AIL C;  5BWX A;  3N2G A;  3RYI A;  1Q43 A;  4GLW A;  4GKK B;  5JJJ B;  1O9G A;  4I50 A;  3RWR D;  4O4I A;  4CMD A;  1SA0 B;  2OYQ A;  5K3W A;  2P5O A;  2EJ0 A;  1HNZ B;  4LFB B;  1JJO A;  3ETQ A;  5IJ9 A;  2HDK A;  3N2K B;  1XI1 A;  3UQ8 A;  5LOV B;  4CC6 A;  4CMF A;  5LP6 C;  2ZCE A;  4CS2 A;  5I5X A;  1XHZ A;  1WNS A;  1EKF A;  5FPR A;  5GON B;  2ZIN A;  3T9E A;  1JMK C;  5JJE B;  3BPZ A;  5KHJ A;  4I4T A;  5LXT A;  4M0J A;  4IWX A;  1L8D A;  4I9Q A;  2ABJ A;  2XHB A;  1B04 A;  2F1M A;  4FLZ A;  1HR0 B;  4DAA A;  4O4J A;  1SQF A;  5EYP B;  5BR8 B;  4FLT A;  5K2M A;  4DV2 B;  4DV1 B;  4BWA A;  4X62 B;  2R9A A;  2DAB A;  4DUZ B;  4DV0 B;  4CKE A;  2Q7G A;  2CAZ C;  3JAL A;  4TOI A;  2ODT X;  4DV5 B;  2QM4 A;  1ET0 A;  4X1K A;  2IM9 A;  4DRX B;  4U3J A;  1EKV A;  1SQG A;  4X1Y A;  5LA6 B;  1I94 B;  5GON A;  3CEB A;  3B2E E;  2PYJ A;  4Q4D A;  4NXM B;  4DR3 B;  3THO A;  3JAW B;  5EZY B;  2JVD A;  4KL1 A;  1WRV A;  4B3S B;  2R72 A;  4PHZ A;  4X1I B;  3BAA A;  1VF7 A;  4DK1 A;  5ITZ A;  2HHH B;  4CH3 A;  3BRC A;  3A2F A;  5CA0 B;  1QQC A;  3HKB A;  3T54 A;  4CKC A;  2DAA A;  4DRX A;  2UU9 B;  4K6N A;  4X65 B;  1NT2 B;  3JAT B;  1EKP A;  4JI3 B;  5CB4 A;  4NXN B;  4O4L A;  5EIB D;  2P22 C;  4CKB A;  4AQY B;  3JAR A;  5IYZ A;  4TV8 B;  5IJ0 A;  4O2A A;  4LH6 A;  3K57 A;  3ZS8 C;  4UCS A;  5DGH A;  3HKD A;  4EB6 B;  4DQN A;  2VWJ A;  4F6R A;  4FLX A;  2PUS A;  4LF8 B;  2F66 C;  1QHT A;  3QQM A;  3CSX A;  4F6R B;  1JFF B;  5DGI A;  1I2K A;  4CS4 A;  2RJZ A;  4DR2 B;  1FJG B;  4ZHQ B;  2E3C A;  3BA8 A;  4HNA A;  4O4H A;  4CH5 A;  1DGS A;  1A0G A;  4PBC A;  5LOV A;  5BWT A;  4CHI A;  1TUB A;  3UZB A;  3K59 A;  5CA1 A;  3K5L A;  4PI0 A;  1XHX A;  1KU9 A;  1T5E A;  4UCR A;  4LF6 B;  1I1M A;  1Q8I A;  4CH6 A;  4YY3 B;  2PTM A;  1HNX B;  4WBN B;  2PGG A;  5LXT B;  4X1K B;  5LP6 B;  4DR1 B;  2F93 B;  5I5T A;  1M93 A;  4IIJ B;  2COI A;  2ZGI A;  4O2B A;  4X66 B;  5JCO C;  3UYY A;  5BYB A;  3RYF A;  4EFB A;  5CR5 A;  5LYJ B;  2UUC B;  2PY5 A;  1DAA A;  5JH7 B;  4FFB B;  2HHF B;  4D7S A;  4O4J B;  1XMQ B;  3SJB C;  2VQF B;  4JV5 B;  2ZNI A;  4ZHQ A;  3DTF A;  4LF4 B;  3SJA C;  2UUB B;  3SNO A;  4K0K B;  4JXU A;  4O2B B;  3LUL A;  4JI8 B;  4YJ3 B;  4CH4 A;  5BWV A;  4JI6 B;  3U0Z A;  1IBK B;  3JZ6 A;  4DV7 B;  1XMO B;  4JI2 B;  1A3G A;  1HW7 A;  1TAE A;  2BTO A;  4LNU A;  4X1I A;  3JAS A;  2PYL A;  3T9A A;  1FFX B;  1ZAU A;  3ICX A;  3JAK A;  2JS5 A;  4O4H B;  4NZO A;  4O4L B;  4HNA B;  2X5R A;  5LYJ A;  4TV9 B;  3U10 A;  5LMN B;  4LFC B;  5FR9 A;  1M4U A;  4B3T B;  4I4T B;  4ZI7 B;  4LR3 A;  3SGI A;  1IYD A;  3DAA A;  3T1Y B;  2BTQ B;  5J2U A;  2F95 B;  2COJ A;  4LF9 B;  1IYE A;  4FM0 A;  5KS8 A;  3TEK A;  3K58 A;  4FLV A;  3U11 A;  3HT5 A;  5CA1 B;  4UUG A;  3T99 A;  2Q7E A;  1WN7 A;  5EYP A;  2Q0A A;  3WWI A;  3N2K A;  2PZS A;  3VQV A;  4ZOL A;  4TV8 A;  5KHH A;  4JI0 B;  3E22 B;  3IAY A;  4FFB A;  2HHF A;  3K5N A;  3PFF A;  5BYA A;  4JYA B;  2RQ6 A;  1N33 B;  2UXB B;  3T9D A;  5KX5 A;  4B08 A;  3UT5 A;  5D5Q A;  2VQE B;  4GYC B;  4NZM A;  3M7M X;  2Q7H A;  3WB0 A;  5JVD B;  1UC8 A;  2A1H A;  2ZNJ A;  3HKB B;  5FNV B;  5CA0 A;  4NVP A;  5J2T B;  5K1X A;  3E22 A;  3VPD A;  3BAB A;  1KTA A;  2EJ2 A;  3FFQ A;  3T9F A;  1I1K A;  4ZIB A;  4YJ2 B;  4EEQ A;  5JCO A;  2Y4R A;  4TQD A;  4TUY A;  2HGX A;  2E5L B;  1RSO A;  3UT5 B;  4YHH B;  4BW9 A;  4UCU A;  5ITZ B;  2GV9 A;  2Q7D A;  3WB1 A;  1FFX A;  2UXD B;  4O2A B;  4TVI A;  5I47 A;  4EFE A;  4PI2 A;  5LMU B;  1D5A A;  2YIB A;  5KHI A;  1N32 B;  5KMG B;  1J5E B;  3JAT A;  5HNE A;  1WPB A;  5I5Y A;  2KKW A;  4UCO A;  4KHP B;  4D7T A;  2VWK A;  4WBN A;  1YEW A;  3DTG A;  1I7F A;  4FLU A;  3RYH A;  2JGU A;  3QG5 A;  1HNW B;  3BAC A;  3LNN A;  4HBN A;  5BWU A;  3PN1 A;  4B3M B;  3SJC C;  4I55 B;  3JAK B;  4LH7 A;  2UUA B;  1M5I A;  4DV3 B;  2OWO A;  4FM1 A;  5C8Y B;  4HN2 A;  5DAA A;  3MAQ A;  5IWA B;  3RYH B;  3RYF B;  1X4T A;  1SA0 A;  3RYC B;  3HKE A;  4DR6 B;  1TA8 A;  3T1H B;  4YJ3 A;  4JI5 B;  4UCV A;  4JI7 B;  1Z5V A;  1XNR B;  4DUY B;  3HKD B;  4EB6 A;  4K8X A;  4FVM A;  5I60 A;  2ZM6 B;  5IJ0 B;  4LNU B;  3JAW A;  3CSW A;  3OTO B;  1XNQ B;  2EJ3 A;  4DR4 B;  4X1Y B;  5LA6 A;  4AHC A;  4I50 B;  4FLW A;  4GLX A;  2YI8 A;  5J2U B;  2HG8 A;  4UFZ A;  2F4V B;  4IHJ A;  4IIJ A;  3N2G B;  3RYI B;  2COG A;  2QJ1 A;  1I1L A;  2YIA A;  1V9P A;  4X20 A;  5K1P A;  3CHX A;  4JI1 B;  4TUY B;  4FM2 A;  2YIB D;  5E25 A;  2UXC B;  4GKJ B;  5JJN B;  3ZED A;  1Q3E A;  3QF7 A;  4OX9 B;  1TUB B;  5IJ9 B;  4DV6 B;  5EZY A;  1I2L A;  3WB2 A;  5CM0 A;  4CE5 A;  5BWW A;  3WWH A;  4IWY A;  4TM5 A;  2V4D A;  3UZO A;  4NZN A;  3T9B A;  4IHJ B;  5BWR A;  1KMI Z;  3HKE B;  4K8Z A;  5KHG A;  5KX5 B;  1XQ8 A;  1SKV A;  2R70 A;  3DSQ A;  3VQW A;  1S5J A;  5BMV B;  4I55 A;  5KHK A;  5D5P A;  4FLY A;  3JAS B;  4DR7 B;  3VQY A;  3BHP A;  3WWJ A;  3LQS A;  1TGO A;  3JAR B;  5IYZ B;  1UC9 A;  5I5U A;  5JQG B;  1Z5W A;  5J2T A;  3CB2 A;  4WHX A;  3RFR A;  4CC5 A;  4LF5 B;  5CB4 B;  4X20 B;  1H2S B;  4Q6G A;  5CE8 A;  2BTQ A;  5KMG A;  1IBM B;  2ZIO A;  3TW7 A;  4X64 B;  5LP6 A;  1N36 B;  5I5S A;  2EX3 A;  2HGW A;  3HKC A;  4B3R B;  3K5O A;  3RGB A;  3T7A A;  4JI4 B;  1P49 A;  5EIB C;  5C8Y A;  2HEP A;  5JH7 A;  4CS3 A;  1TVK B;  2YXL A;  1N34 B;  2YI9 A;  4Q4C A;  3T9C A;  1Q5O A;  3BA9 A;  4O4I B;  3HKC B;  4U3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...