1ZAUA

Adenylation domain of nad+ dependent dna ligase from m.tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
321
structure length
321
Chain Sequence
QTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGHVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRAPRWAIAYKYPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD+-dependent DNA Ligase (Rv3014c) from Mycobacterium tuberculosis: CRYSTAL STRUCTURE OF THE ADENYLATION DOMAIN AND IDENTIFICATION OF NOVEL INHIBITORS
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords DNA ligase
total genus 61
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1zauA01
3.30.470.90 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1zauA02
1HNZB 3JSLA 4B3SB 4X62B 2VQFB 4DV3B 1N33B 4DV5B 5FPOA 3UQ8A 1V9PA 4DR1B 1XMQB 4UCVA 2UXDB 4LF8B 3BAAA 3T1YB 4YY3B 1J5EB 1IBLB 4JI6B 4EFBA 4UCOA 3BACA 4LFAB 4YHHB 1HNXB 4DV7B 2HHHB 5BR8B 4LH7A 2OWOA 4OX9B 4UCUA 4AQYB 2UXBB 4B3RB 1N36B 4CC5A 2UXCB 1DGSA 4DV4B 2E5LB 4KHPB 1N34B 4JYAB 4EEQA 1B04A 4X64B 1IBMB 4UCSA 4LFCB 1ZAUA 2VQEB 4GLXA 3BABA 2ZM6B 2UUAB 4EFEA 4JI1B 4DR2B 4DV1B 1I94B 4X65B 4GKJB 4DUZB 4JI8B 4UCTA 4JV5B 1TAEA 1IBKB 4GLWA 4NXNB 4JI7B 1TA8A 1HR0B 4LF5B 4JI2B 3JSNA 4DR5B 1XNQB 4LF7B 4B3MB 4UCRA 3SGIA 5LMUB 4DR3B 4DR4B 4GKKB 1XMOB 4CC6A 4JI4B 5IWAB 4JI5B 3OTOB 4DUYB 4DV6B 4NXMB 2F4VB 3PN1A 4JI3B 4LFBB 1FJGB 4DV0B 4TOIA 4UFZA 2UUBB 4DR7B 1HNWB 4X66B 2UU9B 4LF6B 1N32B 5FPRA 5LMNB 4JI0B 2UUCB 4LH6A 3BA8A 4LF9B 4LF4B 4DV2B 3T1HB 1XNRB 4B3TB 3BA9A 4DR6B 4K0KB
chains in the Genus database with same CATH superfamily
2QB5A 5CA0B 3FFQA 4B3SB 4FFKA 1M90W 4XDKA 3OUZA 4MV7A 3QO7A 2YYAA 4O7RA 4AILC 5JH7F 4K35A 4O4HB 3GDEA 1AI6A 3ABTA 2K9PA 3ZMSA 1KECA 3ETGA 1I1LA 4GKKO 4GX5A 2EBOA 4FFNA 2LFSA 3OGCC 4FLZA 3OMNB 5CA1F 1NQTA 5DGHA 1M56C 2WLHA 1YJWV 4NZNA 3T54A 5H6QA 2WLKA 3SPGA 4DK1A 4J80A 1G6UA 4MTFA 2YXYA 5FLXN 3BPZA 2ZXWC 2Q7EA 3B09A 4I55F 2BE3A 5D1OA 2JS3A 1Y76A 1AILA 2R9RB 2EJ7A 2OIEA 3JATA 3ABKB 4UXNA 5LP6B 3KALA 2FMLA 1YITV 1SRYA 1TAEA 3DXRB 4O4LF 1GRJA 3FKSG 2PF4E 2KQXA 3L2PA 4NXNB 2E75B 1TVKA 3B77A 1QVFU 5DISC 1L0NH 4LFBO 3CJHB 2YUAA 1Z5VA 4MA0A 1CKMA 3L75H 3VQXA 4DW1A 2AZ2A 4KUMA 1RM1C 1R3KC 1IYDA 3E8BA 3JD0A 1CE8A 1XL6A 5K3WA 5KX5B 2PZSA 2IM9A 4B3SO 5K1XA 1OZ0A 2LO1A 1JKJB 4X66B 3LP8A 4MVQA 2CGOA 3CYOA 4GX1A 3ETEA 3W7SA 4HR7A 5KUMA 3TK1A 3HB3B 1KMIZ 1Q5OA 1KUTA 2QM7A 2ITDC 3JD1A 3VPDA 2VQFO 3SYPA 1P84F 1H2GA 1B6SA 5KA6A 3UQ8A 2NR5A 2WLMA 4KXRA 1M0TA 4PZ8A 3RFCA 2P67A 2XOKG 2DYSB 5LGNA 1YTFB 5LP6F 1F7YA 2DYRB 3JAKA 1V55C 2X6BA 5IE9A 2CAZC 2UUBO 3K5IA 2YS7A 3SJBC 4UCUA 2DWEC 4P9PA 5K1PA 4B3RB 2OYQA 1RPRA 3OW2U 3IGAC 1JMKC 1F51A 4NXMO 2XCLA 1WP8A 2HVQA 3HKDA 4AHCA 3K59A 1Q86W 1YSCA 2WPDG 1MG1A 4BW5A 2YI9A 3OR6C 1MZEA 1H2KA 3ZMTA 1K9MW 1OBDA 3E86A 1YJ9V 1WPBA 2P4KA 1AP6A 2EX3A 1GM9A 3ETHA 2YS6A 4ZKIA 1NH2B 4MT8A 3RFRA 3PFFA 2Q2UA 1VF5B 2R86A 4PI0A 3ZMVA 1DF5A 2DAAA 2P06A 3QVNA 2MW2B 3AG2B 4HAMA 1HWYA 4DV4O 1NKDA 4IT5A 3ASNC 4Q4CA 3K9SA 3RW0A 1T36A 2H8PC 3SYCA 1DV1A 3KCXA 1P4RA 2EZOA 3CB2A 4DUZO 1Z2OX 5HNEA 5KA5A 2COGA 4J7ZA 1SC5B 1JQ0A 4LFBB 5C8YF 3JRXA 1SA0B 4FIPC 2YXHA 2OT5A 1Q43A 2A06H 3SYAA 3T9DA 1Y6XA 1ZX3A 3SR2C 3NC0B 3FYEB 2P22C 2UXDO 2CTRA 1M4UA 1VP7A 1N32O 1HDJA 4O7WA 5CMUA 3CCUV 3WG7C 2NN4A 1Z2GA 3HKBA 2HKOA 1L1FA 1ZL8A 1NVPB 4LP8A 4GZRB 2B1IA 4MW3A 4TV9F 4ZHQB 5ITZA 1Q6HA 1RPOA 3CCSV 3CC7V 1X59A 4TSFG 4KHPO 3U9TA 4LF8B 3TIIA 2X0SA 1CKNA 2M6YA 3ZMZA 5IJ9A 1I08A 2EIJC 1BHAA 3OEEG 2PYLA 1AJPA 1NTKH 3GWOA 1KQSU 5IYZF 2ZDHA 2F4VO 5B1NA 1DGSA 3JARA 1F4NA 5KMGB 1XNRO 1VQ9V 5KHHA 1K5SA 3W7WA 4DR4O 4KHPB 1RSOA 1FXKB 5LHGA 1SCUB 1IURA 5LGTA 1WR2A 2FPGB 2ZGIA 3LNMB 4DW0A 5L3BA 3JZIA 3F5TA 2EJ0A 1XDCA 2UUAB 2QTSA 2YI8A 3BHPA 3STLC 4O7ZA 4DAAA 2DWCA 1I1MA 4RAIA 1M57C 5DEDA 1OCOC 1KBLA 4X64O 1AR4A 2EJ2A 1IBKB 3L70H 1NBMG 3AW8A 3CHXA 1S3JA 4D7TA 1KC8W 4OPHA 1A48A 5KLVH 2CTWA 3K3WA 2HJWA 1TA8A 3CRAA 4N23A 3BFRA 3JSNA 1OCRC 1R1BA 2RJZA 4JI5O 1EHIA 3P32A 2IP4A 2EINB 1VEWA 1CKOA 3WG7B 4EGQA 2W6OA 4FK5C 4DR5O 5J2UA 3PN1A 2FL4A 1WP7A 4HQ6A 2IH1C 4J7JA 4FLYA 4UV8A 1CEZA 1WAZA 3FB7C 4DO2A 5BR8O 1K97A 5KS8A 5FPRA 4ZI7B 4JI0B 4JI6O 3G6EV 4O81A 5D1PA 1JCHA 3H1JH 3DF7A 3K3PA 3JD3A 5EBWC 4JASA 2V7QG 2VQDA 5IYDO 1XDNA 4HNAA 1UPGA 4LBEC 3SDLA 1EZVH 1FJGO 1GN6A 5GW7A 2HJFC 3X2QB 3VNNA 1XMOO 5I5SA 3BAAA 5BPFA 1GO3F 1NZ6A 1QR8A 1PL0A 2ILMA 4MTOA 1B6QA 1DK1A 2DJVA 2GSMB 4IIJF 5B66Z 1N0JA 2R7NA 2XTAA 4O83A 4JI7O 4PJ0Z 2DQ0A 3K58A 3RBZA 1LUWA 1XK5A 2PBZA 1XREA 3K0GA 1VQ6V 3JATB 2P90A 3W1GA 4JAAA 4FFMA 4UCSA 1SS3A 2OCCB 4DV1O 1DIKA 5FR9A 3RR5A 4FVMA 1PP9H 1EUCB 2LJ2A 2RN9A 3AG1B 5B1AB 1AUXA 3E22A 2W6IG 3J7AU 2HDKA 1I2KA 3GB7C 5HV6A 3QFFA 1K7DA 4JI8B 1S5LZ 1GSOA 2A79B 2F93B 1ZL8B 3W5OA 4M9UA 2GQRA 1QLNA 2JDIG 1FXHA 1H8HG 3D3QA 3UZOA 4Y8VB 1IVSA 3IAYA 3FD9A 3WO0A 2X0LA 4JTAB 4JI2B 1S76D 4B3MB 4DV7O 1VBHA 1ZTEA 1IBKO 3TXSA 4YB8B 1SESA 3TW7A 2CGNA 2CUGA 2CDYA 4MS2A 4CS2A 3FB6C 4PZ6A 4C5AA 3LDDA 1YVWA 1M9NA 5L3DA 3K57A 5CA0F 4TOIA 5HFLA 1P7GA 2EIKB 4JYAO 1OCRB 3JZ6A 4FLVA 4FJCC 1XNRB 1B06A 4O4JB 3ZHRA 5JQGF 3T9CA 4I4TA 2GBOA 3CCRV 4GCZA 2DLNA 1SETA 1G4YB 4X62O 3SPCA 4RZQA 5FPOA 2N05A 4IZOA 5B1BC 1EN5A 4YY3B 5KAFZ 1TUBA 4EFBA 4PHZA 4Z2WA 1GAXA 1M0WA 2V58A 4PDMA 1SERA 3JAWA 2OCHA 2QE7G 3JYCA 3A0RA 2WA4A 2UXBB 1LUVA 1OCOB 4GYCB 4OGQB 1CS0A 4RUEA 3JAKB 3N8DA 4FZ1A 1YEWA 3R23A 3RYIB 1ENVA 3AK3A 3ABMB 1N34B 3CWBH 4QNHB 3LNNA 4Z1MG 1IBMB 1JLLB 2EJ3A 2DOSA 4BR6A 1F4MA 1FXKC 4MVRA 4ZI7A 4IGGA 3LSUA 3CS5A 4GLXA 4O2AA 4O7TA 3TY5A 1MOFA 5A9GA 4X20B 1YCIA 4X1YB 3CD6V 1KT8A 2YRWA 1SQXH 4WFAV 4H33A 1I94B 3JD2A 1IDSA 3R66A 1PL4A 1SQQH 4IIJA 5JH7B 4O4HF 4PELA 2X6AA 3IC7A 1JPXA 4LWSA 1QVGU 2ZQMA 4PDRA 4O82A 4IHJF 5JJNB 1P8LA 1OCCB 2ZE7A 3NBYB 3K03A 3JZFA 3AK2A 2QWPB 1TUBB 2HHFB 2OTJV 1AR5A 2Y0IA 5EZYB 4CH6A 2Y69C 4TVIA 3T1CA 4UCRA 1E1RG 3WB1A 1N34O 5KKNB 5JVDB 1AP5A 3M8AA 3HR0A 4F6RB 4UVBA 1Q3EA 5CA1A 3OTOB 2F4VB 4DRFA 2PI4A 3CEIA 3KAJA 5LGUA 2WLIB 3LUTB 2ADPA 1ZWIC 4YJ3F 4ME6A 5L3EA 4O86A 4U3JB 3THOA 2UU9B 3GIDA 1EM1A 5IY5C 2UXNA 3EVKA 3FX7A 2K1EA 4J41A 2R87A 3BA8A 4MVZA 2HGWA 1AJQA 1NI8A 4JF3A 4P9OA 1E1QG 4LF8O 1KKDA 2E5LO 3LQSA 5J2TF 3ZS8C 5IJ0A 4DR6B 4K0KB 1BHBA 4IWYA 3CE2A 1VBGA 5JQWA 1SZXA 1WB8A 2A7WA 2YIBA 1PPJH 4NTWA 2O57A 2IBZH 2XUMA 3K0DA 1VMGA 3HPLC 1I2LA 1V9PA 2N04A 2UXDB 2HEPA 4XZ3B 3T1YB 3CPWU 5D8DA 3ASNB 4UCOA 4LFAB 3I55V 3UZBA 4B3MO 2HG8A 3B8MA 1KUQA 1VARA 3SYQA 1GM8A 2Q0OC 2V5AA 4AQYB 3L71H 1IXMA 3PJSK 5I5YA 2JK5C 3ZHSA 3SPIA 1ORQC 1A9XA 1EKFA 5E1AC 2QK4A 1QCEA 2YEVB 3D3IA 4YIPA 3OUSA 2KB1A 4PD4F 1ZAUA 3E89A 2EILB 4QPKA 4HNUA 2E74B 4E2LA 3ZHVA 5BMVF 3SJQC 3H1KH 2F95B 4DR2B 1FXKA 1K4DC 1YXBA 4TV8B 5LXTF 3K5NA 3OMAB 3ZN1A 2NNUA 2EILC 2YS8A 4JV5O 1V55B 2XAGA 1IYEA 4GKJO 2DYRC 2LW7A 1J95A 1A0IA 4DR7O 2QWRB 3CSWA 3JALA 3RYHA 3Q4HB 2WA3A 4JI7B 1R6NA 3VOTA 3EXAA 4FLWA 1HR0B 1KTAA 4IYHA 1BXRA 2JEUA 3E35A 1OV9A 4CH3A 5EIBD 2Y69B 2HHHO 4H13B 4CBCA 1SQPH 1TVKB 2WLLB 3CCEV 3SYOA 4IYIA 2EULA 4DUYB 4DV6B 4P30A 3WO1A 5H80A 4JI1O 2QWQB 2ODTX 3R5HA 1VF7A 1B3QA 5J2UF 4PA6A 1IOVA 5DMXA 1GTOA 2IJIA 2HIVA 1VF6C 2HVJC 2UUBB 4ZI7F 2ZCEA 1BE3H 5KHKA 2ZDIC 3T9FA 2YEVA 2QTOA 1MZFA 2ODMA 5GONF 2CK3G 3RYCB 3RWRD 2GUZB 2NLJC 2YSUB 1W59A 4DV2B 4LF4O 2LFRA 4J7KA 2R72A 3MAQA 4NR1A 2HLDG 3BA9A 5L3CA 1I94O 1EN4A 5DM6V 1FPOA 4DXWA 2HP8A 3FB8C 2MK3A 2GTSA 2XD4A 2VQFB 1GSHA 4O4IB 4DV3B 3R5XA 4E6NA 1WN7A 5LP6C 2LW1A 4JPRA 5GTHZ 2JGUA 3J81N 5CA3A 3OTOO 1QBZA 2CH7B 4B7EA 1IBLB 2F43G 4FM2A 4ZOLA 5BR8B 2CNUA 1VQ4V 5D5PA 2X6CA 4HNTA 2RCVA 1GKFA 5BWWA 1S5HC 4O4IF 2Z5UA 1N36B 3L73H 5JQGA 2ZXWB 5I5XA 4QPJA 3SJAC 4U3JA 4PA3A 2QDOA 2QM8A 3CCLV 3GVMA 4FZ0A 2EIJB 1BNCA 1FD9A 2W6JG 2ZDQA 5BXZA 3B2EE 3APQA 2KG7A 3R5FA 1WB7A 4JI1B 5CE8A 4WFHA 3WU2Z 1TGOA 3HKEB 4O4LB 5J2TA 5JWPA 3VA7A 3IC9A 2M7WA 1NJIW 3OUFA 1K34A 4FE2A 3H1LH 1NR7A 4LF7O 1JA8A 2LGWA 2ZR2A 3DSQA 3EFFK 1VQ7V 3RT3C 3D8CA 3WFVA 4F4LA 2GV9A 4O2AF 3T9AA 1D2DA 1VIBA 5IYBO 3WB0A 4ZIBA 5C93A 2EIMB 3SGIA 1WA8A 1VQNV 3GLKA 3FAVA 4NTXA 3K5LA 1Q81W 4L8JA 2DN9A 4I50B 4FFOA 2R7MA 2UXCO 3AG3C 4K3AA 5JQGB 4DR2O 5LXTB 4MV6A 3CCJV 5I47A 2GDSA 1V54B 4UVCA 3QG5A 1NH2D 1XBLA 3GJXB 3SE7A 4H37A 4O4JA 2QA4V 4DR7B 1K8AW 4C5BA 2F1MA 3DTFA 1XOUA 1PX2A 2YWVA 1DAAA 1MABG 2JGDB 3B8NA 1GN3A 2OCCC 1A3GA 3A8TA 4QE7A 2DWDC 1HNZB 1R6TA 5EYPA 2I80A 1THZA 2R84A 2X5RA 3CRQA 3P3PA 4QSHA 3OR7C 4HYOA 3K08A 3CXCU 2AHZA 2RDCA 4DR1B 1XEQA 1J5EB 2XAQA 2A0LA 1EBOA 3CJHA 3HKBB 3VQWA 5IDJA 3RV3A 3V4ZA 3N2KB 4H0LB 3MJFA 4DV7B 3DTGA 2CFMA 5BY1A 4AQYO 2W6NA 4OX9B 5I60A 3FAVB 1C30A 4MTXA 2CNQA 1FS0G 4MSWC 2YIBD 2H94A 4K8XA 4O2AB 4MAMA 1R73A 3MD0A 1P7BA 1I1KA 5KX5A 2HJDA 4EEQA 4J42A 3QF7A 4FPPA 2L35A 4DQNA 3ZRXA 1COWG 2P4VA 3OFNG 5B3SB 3ZX6A 2Y4UA 3K04A 3ZIAG 1QHTA 5HBRB 2ATKC 5JVDF 5EZYA 4X20A 3CSXA 2ZNJA 2AGAA 1PD3A 5I5VA 3UT5A 5EZYF 3BY6A 2CH7A 3ML0A 4DYLA 2NU6B 1K5QA 1JJOA 2N74A 3KG2A 5BWXA 2WLIA 4NKGB 2Y48A 4ZOLF 4BIZA 5GONA 2Z3YA 3TXQA 4YJ2A 1YHQV 1KP3A 3ZRVA 1G1XB 3HO8A 1XMOB 2I87A 4JZ2A 2R9IA 3R65A 4CH4A 5C8YB 5LL6Y 2HR3A 5EK0A 2HGSA 3CEBA 1QR9A 3TCUA 2HG5C 3CMEV 1M57B 3LSQA 4KL1A 3RGBA 4D6TH 5I5UA 3KYHC 2P0AA 1Q8IA 1JFFB 1DF4A 3K5OA 2L6LA 2YZNA 4LNUA 2WSSG 3ETDA 4DV5O 5CAEB 1FFTB 1BMFG 1XUQA 3APOA 3T99A 3F7YC 1H2MA 4O2BB 5KUKA 1S5JA 1PK8A 2XNDG 1BS3A 4UVAA 1LNQA 4JYYA 2WLNA 1H2NA 4FMTA 4TUYF 3CRCA 1NTZH 1AI4A 1XMQB 1IBLO 4YY3O 4Q6GA 2W71A 4MV4A 3H1HH 1GGOA 2D2CB 2G38A 3CCMV 1KJQA 1GK9A 5GONB 3U0GA 1VQMV 2W70A 4I50A 1P49A 4TWKA 4CC5A 2UXCB 4C5CA 2OTLV 1W2BU 5LOVF 4NB5A 4C7UA 5H5NA 5CBFA 5C8YA 3CC2V 2ZE8A 2Q7GA 3G4SV 5K2MA 3U10A 2C2AA 1M56B 1SQFA 4X64B 1SA0A 4MVOA 2HFEC 2ZKOA 3BRCA 2ZM6B 1EYZA 4EG0A 3ZHQA 4R50A 1VS0A 3DC6A 3WWIA 3RYHB 3T7AA 4JI4O 2RQ6A 5CA0A 1I0HA 2ZD9A 4LR3A 1AB3A 3H1IH 3ABLC 1ZUQA 2KSDA 3G8CA 3OM3B 2HGXA 4GLWA 1YIJV 4GX2A 4FFRA 2Q8VA 2P5OA 3CCQV 3DGEA 3S3XA 1AI7A 1H2LA 4TV9B 1N0NA 1WPXA 3E5NA 4U3FH 3T9BA 5DN6G 1PNMA 3QO5A 3ZRWB 3Q4HA 2BTQB 2VWJA 3ETJA 4MV1A 4JI8O 5IYCO 2EZPA 4OPAA 3SPJA 3JARB 3VPCA 5FL7G 3RYFB 2B1GA 1MNGA 2COJA 2Z02A 1UC9A 1RSOB 1DTOA 3RVZA 4X9QA 1QLEB 2JS5A 2FKXA 5A2QN 3QWUA 1N32B 3P3NA 3TJTA 4D7SA 4O4IA 3C3SA 1XMQO 2YL2A 1JR9A 5LMNO 4B3TB 3SPHA 3C90A 3ZMUA 5FNVA 4LCUC 2IJJA 3K06A 4DV0O 1MMMA 4PI2A 1HW7A 4Q4DA 1N33B 1NT2B 5DAAA 1A0GA 3OUUA 4LFCO 1Q6IA 2GHYA 2QWOB 3CRRA 1GN2A 4LF9O 4BIOA 1Y74A 5B1OA 3Q1KA 4B3RO 1XNQO 3TQTA 4MV8A 4PBCA 1KB9F 2BTQA 4DUYO 2YC0A 4DRXA 4DV4B 3VOUA 4JTCB 3JAWB 2DMXA 2Q7HA 3AG1C 5D5QA 1M5IA 1JDEA 4PA9A 1PV0A 1C3OA 3AK1A 4O7NA 1ROPA 4O84A 3ZJZA 2R7KA 2XAHA 5LYJF 4GT1A 2IU0A 5TISZ 3ETQA 4XBFA 4X65B 2NUAB 1YZBA 4O2BA 4WFGA 4IHJB 2UUCO 3T4ZA 1Y66A 4JI0O 4KFMA 1GLVA 2KG7B 2DE0X 4RQEA 2CZGA 2YRXA 3SJCC 4FM1A 4X1YA 3T9EA 5JVLA 5ITZB 4O4LA 2R70A 3WWJA 4CKBA 2WLJA 4YAJB 3ZHUA 1XNQB 5LXTA 3AG4C 5IT9N 4PA7A 5IYZB 4BAYA 5F2VO 2P7TC 4DR3B 3O9OA 4JYBA 1H38A 5BYAA 2XASA 1J5EO 4DIMA 4JI5B 3V4SA 3AG3B 4R6ZA 4CE5A 4JI3B 1KD1W 2NU9B 2IH3C 5JJEB 3SNOA 3ICXA 1DLBA 4DV0B 5IJ0B 2R85A 4IWXA 5L3GA 4LF6B 1VKZA 3L72H 1S68A 5BWTA 1S0VA 5LMNB 4B3TO 2CTPA 3T1YO 2R82A 4CHIA 3HT5A 1BCCH 2AHYA 5LP6A 4X66O 1ET0A 5CM0A 2QWNB 1OHHG 3DXRA 3CP1A 3B40A 3TETA 5LYJB 2JGDA 2LP7A 1NR1A 5H6RA 2BCCH 4UCVA 4O7SA 3UYYA 5JCOC 1U96A 4FLTA 3BACA 2SCUB 3TY8A 3CRMA 1XL4A 1AJNA 3ZRWA 1M1KW 3HKCB 4FM0A 1VF6A 4ASUG 3DAAA 3ABMC 1A32A 2A3QA 1F23A 5J2UB 4BWAA 4WF9V 3E83A 1Z2NX 3U11A 1L8DA 1Q6UA 4WBNB 4E4TA 4JAUA 4JYAB 1G8MA 2C00A 1SKVA 1I5XA 5BMVB 4UUGA 1Z2PX 5BYBA 4FFBA 3IFXA 3CXHF 4O7VA 3R9RA 4MA5A 1KYOF 4M0JA 2VR1A 4EB6B 2CNVA 5CBGA 1VQOV 2QKSA 1KJJA 2OLSA 4MV9A 3ZHTA 3K5MA 2NU7B 2ZR3A 4O7YA 1AI5A 4YJ2B 1R6KA 4TV8A 2BTOA 5KAIZ 5GTIZ 4F6EA 1CKNB 4EKWA 1Y74B 2ZE6A 5IJ9B 3Q2OA 3TY9A 3JALB 5EIBC 1JX9A 4GKKB 1CP9A 1OBGA 3MDSA 4JAVA 1EZ1A 4FGRA 2V59A 4CMDA 2ABJA 4I7ZB 2FB9A 4I4TF 1L0LH 2J9GA 3B4SA 4L1KA 4U7OA 2JRIA 2Q68A 2FYUH 3KZIZ 4XYMB 1PNKA 2WAMA 1HNWB 4I55A 1FFXA 3ABUA 3LSSA 5BMVA 1VQ5V 4YHHO 5EBLC 4FFBB 2UUCB 2YDEA 3E22B 3JCUZ 3N2GB 5J9PC 2YICA 1Q7YW 5JH7A 4DV3O 2PGGA 3MHHC 3VQYA 4MW8A 3QQMA 4LWSB 3G71V 3TW6A 1JFFA 2AZ0A 4LNUB 2H3OA 1E4EB 2YXLA 5LOVB 4X1IB 4MV3A 5LBQA 4ZBMA 4UUJC 3EHBB 3G6BA 4WBNF 1VQPV 2JIZG 4TT3G 1XI1A 1YI2V 3UKMA 1QQCA 4K6NA 2PTMA 1WLEA 2IU3A 4XDLA 1HR0O 5JVDA 1KKCA 3TINA 4LC1A 1AROP 3H01A 4Q20A 5CA1B 2YW2A 4TQDA 2DZDA 4QJFB 2Q69A 3AG7A 5B1AC 3P30A 1I5YA 2GTAA 2DQ3A 1PNLA 3F7VC 3K9AA 5LHIA 5LMUO 3K79A 2PI5A 5E25A 4I55B 4LFCB 3AG2C 2VS0A 2QSAA 2FPPB 2COIA 2VQEB 4CH5A 5D1OB 3TGUH 4IL6Z 5KHIA 3AX6A 5CB4A 5B5EZ 2F23A 2OIGA 1SZTA 2VRZA 4I4TB 4HN2A 1D5NA 2PUSA 4GKJB 4JXUA 4JV5B 1BSMA 2UXXA 3S3WA 4TV9A 2A1HA 4RCNA 4PA4A 2JJ1G 2VWKA 1EKPA 4X1KA 4LF5B 5JJJB 4OX9O 2PY5A 2XAJA 2EIMC 1VQLV 1BQ0A 4U7NA 3N6RA 3DTUB 4EGJA 2JVDA 1W0KG 2YIDA 5CBHA 3W1BA 4WFEA 3ORQA 2DYSC 1JDBB 4I9WA 1ZSPA 1FKAO 4I0XB 4DLKA 2ZM6O 4CMFA 1SF9A 4UFZA 3OAAG 4XX0B 3U55A 1HNXO 4LFAO 5C1OA 4DR6O 2XAFA 3LWBA 3U0ZA 4LH6A 4GX0A 3RYFA 4JGSA 3FB5C 1OCCC 1WNSA 1CXZB 3KKYA 2EIYA 2WYOA 3ZCCA 1RFYA 5LA6B 1GSAA 1W96A 5AG2A 2HIXA 1K3EA 2EINC 4NYEA 1QLEC 1K92A 1CQJB 4MTGA 4K0KO 4NZMA 2ZNIA 1ULZA 4CKCA 4JI6B 4YHHB 2DW4A 3UO2A 4LH7A 3ABLB 3OT7A 4ABMA 2ZE5A 4H44B 4PV1B 3G8DA 4F6RA 5CB4F 3S24A 2BSKA 4GUNA 3JAMN 5IWAO 3VQVA 3UFXB 1AUVA 1US6A 3RUPA 2IJKA 4TM5A 1FFXB 3G80A 4G2KA 1B6RA 2QM4A 3AEIA 3D36A 4RO2A 4E4EA 4QIWF 1M93A 2GUZA 1SQVH 4RQFA 5EC1C 3A2FA 3OMIB 1NVPD 3RVYA 3M7MX 4WHXA 4HNAB 3MWEA 5I5WA 5LA6A 4DUZB 3O65A 3WWHA 4DR3O 3E8FA 1RP3B 2Q5ZA 1MA1A 1R3JC 3ZRSA 2ITCC 5EC2C 2EJRA 3NR7A 3JRWA 1H2SB 4IHJA 3ZBHA 1N8RW 2JEXA 5BWVA 1GM7A 3E8HA 2QEXV 3K5HA 1VQKV 4P2ZA 3UT5B 4I50F 3UM7A 4DR4B 5LHHA 2LGQA 4CC6A 5IWAB 2W6QA 3MWDA 4X65O 2BSKB 3UO3A 4YJ3A 1BQZA 4FFLA 2FPIB 2B9ZA 1EFRG 2BOBC 5IYZA 2UXBO 1GN4A 1K4CC 3OGIB 4CZZA 1XQ8A 4NVPA 1E79G 4XYLB 1OCZC 2FB5A 3OEHG 1EUDB 5CB4B 4DV2O 4LF4B 3KREA 2E3CA 3T1HB 1U97A 2RNBA 3JSLA 2Q73A 2Q67A 3UCSC 2HVSA 2QGNA 4X62B 2I8CA 4CS3A 5C1PA 2VUGA 3BG5A 3E8GA 3HKCA 4RWUA 2PN1A 2CTQA 2YZLA 1I7NA 1HNXB 2HHHB 3LDEA 4L87A 4LF6O 3LULA 3CCVV 3U54A 4ZHQA 2Q9LA 1Y76B 3I56V 4HBNA 4YBZB 4JI2O 4LF5O 4JYCA 4XDJA 3VPBA 1CPYA 2XT9A 2B5UA 4NYKA 3NXSA 5KHGA 1P16A 3HBLA 4I0XA 2HVKC 3OE7G 5B3SC 3RTXA 1GH6A 3BCCH 3WB2A 1VQ8V 2BOCC 3NUAA 3TIGA 1I7FA 4EB6A 1B04A 4TQFA 1FYJA 1EN6A 1YJNV 2HVRA 2E76B 1YDXA 1KC7A 4CS4A 1PM9A 4EFEA 1BZKA 1HNZO 4WBNA 2ZT9B 3IJ4A 4DV1B 3JD4A 1UJWB 3D36C 4DK0A 2Y0PA 2W6MA 4A5UB 4G27B 2YZGA 1BT8A 3FYIB 1KBHA 1HP8A 4MVUA 4B7KA 3STZC 4I5SA 4O7LA 1KJ8A 1AVMA 1YF2A 3ZEDA 5BPHA 1UFIA 3ASOB 4G28B 2IJHA 4ZOLB 1BL8A 1R3IC 1OJHA 4JZGA 4LF7B 2QR4A 2D3OW 5LMUB 1ZLZA 2W0XA 1IZ3A 3HB9A 1KJ9A 1XILA 4JI4B 4PDVA 4NXMB 3NBZB 4X88A 2JJ2G 1I7LA 3L74H 1K73W 1RM1B 3F5WC 3DC5A 1AR1B 1FJGB 1M6VA 2PVPA 2QKCA 3N2GA 1O9GA 1DV2A 5FNVB 5KX5F 4OXSA 1QNMA 3A0BZ 4LF9B 3RV4A 2QF7A 1S77D 3VMMA 1V54C 2Y4TA 4HZ3A 3RN4A 5LOVA 1N36O 3KAKA 2DIKA 1HNWO 1NTMH 1CQIB 1OCZB 4FLXA 2Q7DA 4X8AA 4K8ZA 2W6ZA 4R8CA 5IY5B 4FLUA 1JJ2U 4MVMA 3VBBA 3A0HZ 1KJIA 1R3LC 4W4LA 2R7LA 3LDCA 4WCEV 2X7RB 2HHFA 4TUYA 4BIUA 2W6PA 2FP4B 4WFBV 2WLLA 4R7CA 2KKWA 5B1BB 2LQTA 4QE9A 5HFMA 1Y67A 1WJZA 2V1DA 2AW9A 1X9NA 1UC8A 1FVIA 1FXVA 4YIOA 1JOYA 4J9YB 1TUEB 3RYCA 4EQ5A 4YJ2F 2UUAO 2DABA 2QJ1A 3OTFA 5CN0A 4NXNO 4X1KB 3T2MA 2EIKC 4UCTA 1KEEA 4KP4A 2YZMA 1JVMA 4YXWG 5CR5A 5I5TA 5H2FZ 3C3TA 5BWRA 2R9AA 2W0FC 3WNZA 1IXBA 4N21A 4UB6Z 4I9QA 4TUYB 4DV6O 4MVSA 5FNVF 4B08A 1SQBH 4UB8Z 4UV9A 4FU0A 2ZINA 3M99B 2XHBA 2Z04A 2YIAA 1FAFA 1WRVA 4ICGA 1YTFD 1W0JG 2CE4A 3AG4B 1Y4MA 2Y4RA 1MSDA 1URFA 3QO8A 2PYJA 1IX9A 1Q82W 3ORRA 1X4TA 3E2EA 1GMGA 2Q6AA 1W93A 3HKEA 3QNEA 5J2TB 2VPQA 3J80N 1IOWA 1NU1H 3KCYA 3JASB 3GB8B 4FFPA 5H9CA 2VQEO 5BZBA 4PZ7A 4JI3O 4DV5B 3N27A 3T4DA 4BW9A 3CMAV 3I12A 4ZHQF 2GPSA 2GQSA 1T5EA 4DR1O 2ZDGA 1N4CA 5KMGA 3RYIA 5LYJA 2V4DA 1WA8B 3G67A 2Q0AA 2OWOA 4X89A 4NZOA 4NTYA 3ASOC 4W4KA 1K33A 2Z0AA 4JTDB 3T1HO 2P6JA 2E5LB 3CC4V 1XHZA 4YAKB 5EBMC 2Q2TA 3BEHA 1BGYH 2ADQB 1LR1A 2GPWA 3W7XA 4IIJB 2RMKB 2ZDIA 3W7UA 2UU9O 2F66C 3ZN0A 2NU8B 3BABA 3MHSC 3H9VA 4O2BF 4J10A 2ETNA 2Q4PA 2AXTZ 5EYPB 2A9HA 3BVOA 3GWKC 4J9ZB 3JASA 2FTKA 4HNVA 4TV8F 1NS1A 4Z1VA 2ZIOA 4AI8A 4O4HA 1Q90D 5KHJA 1KP2A 1SQGA 1MSWD 4CKEA 1XHXA 5BWUA 4RUFA 3W7TA 4WFFA 5L3FA 1O9HA 2QKAA 1QU7A 3N2KA 5E79Z 4DR5B 1G2WA 4O4JF 3JCZA 3TEKA 4QGPA 3CX5F 5JCOA 1Z5WA 2ARHA 3L9DA 1PKXA 4J11A 4DRXB 2WWWA 1H8EG 3HKDB 3OD4A 4PDLA 1N33O 5LA6F 3X2QC 3I5DA 3QTCA 4ZQIA 2GLTA 1IBMO 2IW5A 4YJ3B 5DECA 3ABKC 5DGIA 1D5AA 1S72V 1EKVA 2ZIMA 1E4EA 3U9SA 4X1IA 1EZJA 1KU9A
chains in the Genus database with same CATH topology
2QB5A 5LA6B 5CA0B 3FFQA 3T99A 4B3SB 4O2BB 1S5JA 4AILC 4O4HB 5FPOA 4NZMA 1XMQB 1I1LA 4YY3B 4Q6GA 2ZNIA 4CKCA 4JI6B 1TUBA 4EFBA 4PHZA 4YHHB 3JAWA 4FLZA 4LH7A 5DGHA 4NZNA 5GONB 3T54A 3U0GA 2UXBB 4DK1A 4GYCB 1G6UA 4F6RA 4I50A 1P49A 4CC5A 2UXCB 3BPZA 2Q7EA 3VQVA 3JAKB 5C8YA 1YEWA 3RYIB 2Q7GA 5K2MA 3U10A 1N34B 4TM5A 1SQFA 1FFXB 3LNNA 4X64B 1IBMB 2EJ3A 1SA0A 2QM4A 4ZI7A 1M93A 3BRCA 4GLXA 4O2AA 2ZM6B 4X20B 3A2FA 4X1YB 3JATA 1KT8A 1I94B 3WWIA 3RYHB 3T7AA 3M7MX 4IIJA 5LP6B 5JH7B 2RQ6A 4HNAB 4WHXA 5I5WA 5LA6A 5CA0A 4DUZB 4LR3A 3WWHA 1TAEA 2HGXA 4GLWA 4NXNB 1TVKA 5JJNB 2P5OA 1H2SB 4IHJA 1TUBB 4TV9B 2HHFB 5BWVA 5EZYB 1Z5VA 4CH6A 3T9BA 4TVIA 4UCRA 3WB1A 3UT5B 4DR4B 2BTQB 3VQXA 2VWJA 5JVDB 4F6RB 4CC6A 1IYDA 5IWAB 1Q3EA 5CA1A 3OTOB 4YJ3A 2F4VB 3JARB 5K3WA 3RYFB 5IYZA 2COJA 1UC9A 5KX5B 2PZSA 4U3JB 2IM9A 5K1XA 3THOA 1XQ8A 4NVPA 2JS5A 4X66B 2UU9B 1N32B 4D7SA 4O4IA 3BA8A 5CB4B 4LF4B 2HGWA 2E3CA 3LQSA 3T1HB 3ZS8C 4B3TB 1KU9A 5IJ0A 4DR6B 4K0KB 4IWYA 1KMIZ 1Q5OA 5FNVA 3JSLA 2YIBA 3VPDA 4X62B 4PI2A 1HW7A 4Q4DA 1N33B 1NT2B 4CS3A 1A0GA 5DAAA 3UQ8A 1I2LA 1V9PA 3HKCA 2UXDB 2HEPA 3T1YB 4UCOA 4LFAB 1HNXB 2HHHB 3LULA 3JAKA 3UZBA 2HG8A 4ZHQA 2CAZC 4PBCA 3SJBC 4HBNA 4UCUA 4AQYB 2BTQA 5K1PA 4B3RB 5I5YA 2OYQA 5KHGA 1JMKC 4DRXA 4DV4B 3JAWB 3HKDA 2Q7HA 3WB2A 5D5QA 1M5IA 4AHCA 3K59A 1I7FA 4EB6A 1EKFA 1B04A 4TQFA 2YI9A 1ZAUA 4CS4A 4EFEA 4WBNA 1WPBA 3ETQA 2EX3A 4DR2B 2F95B 4DV1B 4X65B 4DK0A 4TV8B 3RFRA 3PFFA 3K5NA 4O2BA 4PI0A 4IHJB 2DAAA 1IYEA 3SJCC 4FM1A 4X1YA 3T9EA 5ITZB 3CSWA 3JALA 3RYHA 4Q4CA 4O4LA 2R70A 4JI7B 3ZEDA 3WWJA 4FLWA 1HR0B 4CKBA 1KTAA 4ZOLB 1XNQB 5LXTA 4LF7B 4CH3A 5EIBD 5IYZB 5LMUB 4DR3B 1TVKB 5BYAA 3CB2A 5HNEA 4JI4B 4DUYB 4JI5B 4DV6B 4NXMB 2COGA 4CE5A 4JI3B 2ODTX 4LFBB 1VF7A 1FJGB 5JJEB 3SNOA 3ICXA 4DV0B 5IJ0B 2UUBB 2ZCEA 1SA0B 1O9GA 3N2GA 5KHKA 4IWXA 5FNVB 4LF6B 3T9FA 1Q43A 3T9DA 3RYCB 5BWTA 3RWRD 3SR2C 5LMNB 4LF9B 4DV2B 4CHIA 2P22C 2R72A 3MAQA 3HT5A 1M4UA 3BA9A 5LOVA 5LP6A 1ET0A 4FLXA 5CM0A 2Q7DA 3HKBA 2VQFB 4O4IB 4DV3B 4K8ZA 4FLUA 1WN7A 5LP6C 2JGUA 5LYJB 4ZHQB 5ITZA 4UCVA 4LF8B 3UYYA 1IBLB 5JCOC 2HHFA 4FLTA 4FM2A 3BACA 4TUYA 5IJ9A 4ZOLA 5BR8B 2PYLA 3HKCB 5D5PA 4FM0A 3DAAA 5BWWA 2KKWA 1N36B 5J2UB 4BWAA 5JQGA 1DGSA 3JARA 5KMGB 3U11A 5KHHA 5I5XA 1L8DA 4WBNB 3SJAC 4KHPB 1RSOA 4U3JA 1UC8A 4JYAB 1SKVA 2ZGIA 5BMVB 4UUGA 5BYBA 3RYCA 4FFBA 3B2EE 2EJ0A 2UUAB 2YI8A 3BHPA 2DABA 4DAAA 2QJ1A 3OTFA 4JI1B 4M0JA 5CE8A 4EB6B 1I1MA 1TGOA 3HKEB 4O4LB 5J2TA 4X1KB 4UCTA 2EJ2A 1IBKB 3CHXA 4D7TA 3K5MA 5CR5A 5I5TA 3DSQA 4YJ2B 5BWRA 4TV8A 2R9AA 1TA8A 2GV9A 2BTOA 3JSNA 3T9AA 2RJZA 4I9QA 4TUYB 5IJ9B 3WB0A 4ZIBA 3SGIA 4B08A 3JALB 3K5LA 5EIBC 2ZINA 4GKKB 2XHBA 4L8JA 4I50B 5J2UA 5JQGB 2YIAA 5LXTB 4CMDA 2ABJA 3PN1A 5I47A 3QG5A 1WRVA 4FLYA 4O4JA 4DR7B 1HNWB 4I55A 1FFXA 5BMVA 5KS8A 2Y4RA 2F1MA 5FPRA 4ZI7B 3DTFA 4JI0B 4FFBB 2PYJA 2UUCB 1X4TA 1DAAA 3E22B 3N2GB 1A3GA 3HKEA 5J2TB 1HNZB 5EYPA 4HNAA 5JH7A 2X5RA 2PGGA 3JASB 3VQYA 3QQMA 1JFFA 4LNUB 4DV5B 2YXLA 5LOVB 4X1IB 4DR1B 5I5SA 4BW9A 3BAAA 1J5EB 3HKBB 3VQWA 1T5EA 3N2KB 4DV7B 5KMGA 3DTGA 1XI1A 3RYIA 1QQCA 5LYJA 4K6NA 2V4DA 2PTMA 2Q0AA 2OWOA 4OX9B 5I60A 5JVDA 4NZOA 5CA1B 2YIBD 4TQDA 3K58A 4K8XA 4O2AB 2E5LB 3JATB 1XHZA 1I1KA 5KX5A 4EEQA 4UCSA 3QF7A 4I55B 4IIJB 4LFCB 5E25A 2F66C 2COIA 2VQEB 5FR9A 4DQNA 4FVMA 4CH5A 3BABA 5KHIA 5CB4A 3E22A 4I4TB 4HN2A 2PUSA 2HDKA 4GKJB 1I2KA 5EYPB 1QHTA 4JI8B 4JV5B 4JXUA 3JASA 2F93B 4TV9A 2ZIOA 5EZYA 2A1HA 4X20A 4RCNA 4O4HA 5KHJA 3CSXA 1SQGA 2ZNJA 5I5VA 2VWKA 3UT5A 3UZOA 4CKEA 3IAYA 1XHXA 5BWUA 1EKPA 4X1KA 4LF5B 4JI2B 5JJJB 1JJOA 1O9HA 2PY5A 1G2WA 3N2KA 4DR5B 4B3MB 3TEKA 5BWXA 5GONA 5JCOA 4YJ2A 1Z5WA 2JVDA 3TW7A 1XMOB 4CS2A 4CH4A 5C8YB 4DRXB 3HKDB 3CEBA 3K57A 4CMFA 4TOIA 4UFZA 3QTCA 3RGBA 4KL1A 4YJ3B 5I5UA 3U0ZA 4LH6A 3JZ6A 1Q8IA 1D5AA 3RYFA 4FLVA 1JFFB 5DGIA 3K5OA 1WNSA 1EKVA 2ZIMA 4LNUA 1XNRB 2EIYA 4O4JB 4X1IA 3T9CA 4I4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ B;  3JSL A;  4B3S B;  4X62 B;  2VQF B;  4DV3 B;  1N33 B;  4DV5 B;  5FPO A;  3UQ8 A;  1V9P A;  4DR1 B;  1XMQ B;  4UCV A;  2UXD B;  4LF8 B;  3BAA A;  3T1Y B;  4YY3 B;  1J5E B;  1IBL B;  4JI6 B;  4EFB A;  4UCO A;  3BAC A;  4LFA B;  4YHH B;  1HNX B;  4DV7 B;  2HHH B;  5BR8 B;  4LH7 A;  2OWO A;  4OX9 B;  4UCU A;  4AQY B;  2UXB B;  4B3R B;  1N36 B;  4CC5 A;  2UXC B;  1DGS A;  4DV4 B;  2E5L B;  4KHP B;  1N34 B;  4JYA B;  4EEQ A;  1B04 A;  4X64 B;  1IBM B;  4UCS A;  4LFC B;  1ZAU A;  2VQE B;  4GLX A;  3BAB A;  2ZM6 B;  2UUA B;  4EFE A;  4JI1 B;  4DR2 B;  4DV1 B;  1I94 B;  4X65 B;  4GKJ B;  4DUZ B;  4JI8 B;  4UCT A;  4JV5 B;  1TAE A;  1IBK B;  4GLW A;  4NXN B;  4JI7 B;  1TA8 A;  1HR0 B;  4LF5 B;  4JI2 B;  3JSN A;  4DR5 B;  1XNQ B;  4LF7 B;  4B3M B;  4UCR A;  3SGI A;  5LMU B;  4DR3 B;  4DR4 B;  4GKK B;  1XMO B;  4CC6 A;  4JI4 B;  5IWA B;  4JI5 B;  3OTO B;  4DUY B;  4DV6 B;  4NXM B;  2F4V B;  3PN1 A;  4JI3 B;  4LFB B;  1FJG B;  4DV0 B;  4TOI A;  4UFZ A;  2UUB B;  4DR7 B;  1HNW B;  4X66 B;  2UU9 B;  4LF6 B;  1N32 B;  5FPR A;  5LMN B;  4JI0 B;  2UUC B;  4LH6 A;  3BA8 A;  4LF9 B;  4LF4 B;  4DV2 B;  3T1H B;  1XNR B;  4B3T B;  3BA9 A;  4DR6 B;  4K0K B; 
#chains in the Genus database with same CATH topology
 2QB5 A;  5CA0 B;  3FFQ A;  4B3S B;  4FFK A;  1M90 W;  4XDK A;  3OUZ A;  4MV7 A;  3QO7 A;  2YYA A;  4O7R A;  4AIL C;  5JH7 F;  4K35 A;  4O4H B;  3GDE A;  1AI6 A;  3ABT A;  2K9P A;  3ZMS A;  1KEC A;  3ETG A;  1I1L A;  4GKK O;  4GX5 A;  2EBO A;  4FFN A;  2LFS A;  3OGC C;  4FLZ A;  3OMN B;  5CA1 F;  1NQT A;  5DGH A;  1M56 C;  2WLH A;  1YJW V;  4NZN A;  3T54 A;  5H6Q A;  2WLK A;  3SPG A;  4DK1 A;  4J80 A;  1G6U A;  4MTF A;  2YXY A;  5FLX N;  3BPZ A;  2ZXW C;  2Q7E A;  3B09 A;  4I55 F;  2BE3 A;  5D1O A;  2JS3 A;  1Y76 A;  1AIL A;  2R9R B;  2EJ7 A;  2OIE A;  3JAT A;  3ABK B;  4UXN A;  5LP6 B;  3KAL A;  2FML A;  1YIT V;  1SRY A;  1TAE A;  3DXR B;  4O4L F;  1GRJ A;  3FKS G;  2PF4 E;  2KQX A;  3L2P A;  4NXN B;  2E75 B;  1TVK A;  3B77 A;  1QVF U;  5DIS C;  1L0N H;  4LFB O;  3CJH B;  2YUA A;  1Z5V A;  4MA0 A;  1CKM A;  3L75 H;  3VQX A;  4DW1 A;  2AZ2 A;  4KUM A;  1RM1 C;  1R3K C;  1IYD A;  3E8B A;  3JD0 A;  1CE8 A;  1XL6 A;  5K3W A;  5KX5 B;  2PZS A;  2IM9 A;  4B3S O;  5K1X A;  1OZ0 A;  2LO1 A;  1JKJ B;  4X66 B;  3LP8 A;  4MVQ A;  2CGO A;  3CYO A;  4GX1 A;  3ETE A;  3W7S A;  4HR7 A;  5KUM A;  3TK1 A;  3HB3 B;  1KMI Z;  1Q5O A;  1KUT A;  2QM7 A;  2ITD C;  3JD1 A;  3VPD A;  2VQF O;  3SYP A;  1P84 F;  1H2G A;  1B6S A;  5KA6 A;  3UQ8 A;  2NR5 A;  2WLM A;  4KXR A;  1M0T A;  4PZ8 A;  3RFC A;  2P67 A;  2XOK G;  2DYS B;  5LGN A;  1YTF B;  5LP6 F;  1F7Y A;  2DYR B;  3JAK A;  1V55 C;  2X6B A;  5IE9 A;  2CAZ C;  2UUB O;  3K5I A;  2YS7 A;  3SJB C;  4UCU A;  2DWE C;  4P9P A;  5K1P A;  4B3R B;  2OYQ A;  1RPR A;  3OW2 U;  3IGA C;  1JMK C;  1F51 A;  4NXM O;  2XCL A;  1WP8 A;  2HVQ A;  3HKD A;  4AHC A;  3K59 A;  1Q86 W;  1YSC A;  2WPD G;  1MG1 A;  4BW5 A;  2YI9 A;  3OR6 C;  1MZE A;  1H2K A;  3ZMT A;  1K9M W;  1OBD A;  3E86 A;  1YJ9 V;  1WPB A;  2P4K A;  1AP6 A;  2EX3 A;  1GM9 A;  3ETH A;  2YS6 A;  4ZKI A;  1NH2 B;  4MT8 A;  3RFR A;  3PFF A;  2Q2U A;  1VF5 B;  2R86 A;  4PI0 A;  3ZMV A;  1DF5 A;  2DAA A;  2P06 A;  3QVN A;  2MW2 B;  3AG2 B;  4HAM A;  1HWY A;  4DV4 O;  1NKD A;  4IT5 A;  3ASN C;  4Q4C A;  3K9S A;  3RW0 A;  1T36 A;  2H8P C;  3SYC A;  1DV1 A;  3KCX A;  1P4R A;  2EZO A;  3CB2 A;  4DUZ O;  1Z2O X;  5HNE A;  5KA5 A;  2COG A;  4J7Z A;  1SC5 B;  1JQ0 A;  4LFB B;  5C8Y F;  3JRX A;  1SA0 B;  4FIP C;  2YXH A;  2OT5 A;  1Q43 A;  2A06 H;  3SYA A;  3T9D A;  1Y6X A;  1ZX3 A;  3SR2 C;  3NC0 B;  3FYE B;  2P22 C;  2UXD O;  2CTR A;  1M4U A;  1VP7 A;  1N32 O;  1HDJ A;  4O7W A;  5CMU A;  3CCU V;  3WG7 C;  2NN4 A;  1Z2G A;  3HKB A;  2HKO A;  1L1F A;  1ZL8 A;  1NVP B;  4LP8 A;  4GZR B;  2B1I A;  4MW3 A;  4TV9 F;  4ZHQ B;  5ITZ A;  1Q6H A;  1RPO A;  3CCS V;  3CC7 V;  1X59 A;  4TSF G;  4KHP O;  3U9T A;  4LF8 B;  3TII A;  2X0S A;  1CKN A;  2M6Y A;  3ZMZ A;  5IJ9 A;  1I08 A;  2EIJ C;  1BHA A;  3OEE G;  2PYL A;  1AJP A;  1NTK H;  3GWO A;  1KQS U;  5IYZ F;  2ZDH A;  2F4V O;  5B1N A;  1DGS A;  3JAR A;  1F4N A;  5KMG B;  1XNR O;  1VQ9 V;  5KHH A;  1K5S A;  3W7W A;  4DR4 O;  4KHP B;  1RSO A;  1FXK B;  5LHG A;  1SCU B;  1IUR A;  5LGT A;  1WR2 A;  2FPG B;  2ZGI A;  3LNM B;  4DW0 A;  5L3B A;  3JZI A;  3F5T A;  2EJ0 A;  1XDC A;  2UUA B;  2QTS A;  2YI8 A;  3BHP A;  3STL C;  4O7Z A;  4DAA A;  2DWC A;  1I1M A;  4RAI A;  1M57 C;  5DED A;  1OCO C;  1KBL A;  4X64 O;  1AR4 A;  2EJ2 A;  1IBK B;  3L70 H;  1NBM G;  3AW8 A;  3CHX A;  1S3J A;  4D7T A;  1KC8 W;  4OPH A;  1A48 A;  5KLV H;  2CTW A;  3K3W A;  2HJW A;  1TA8 A;  3CRA A;  4N23 A;  3BFR A;  3JSN A;  1OCR C;  1R1B A;  2RJZ A;  4JI5 O;  1EHI A;  3P32 A;  2IP4 A;  2EIN B;  1VEW A;  1CKO A;  3WG7 B;  4EGQ A;  2W6O A;  4FK5 C;  4DR5 O;  5J2U A;  3PN1 A;  2FL4 A;  1WP7 A;  4HQ6 A;  2IH1 C;  4J7J A;  4FLY A;  4UV8 A;  1CEZ A;  1WAZ A;  3FB7 C;  4DO2 A;  5BR8 O;  1K97 A;  5KS8 A;  5FPR A;  4ZI7 B;  4JI0 B;  4JI6 O;  3G6E V;  4O81 A;  5D1P A;  1JCH A;  3H1J H;  3DF7 A;  3K3P A;  3JD3 A;  5EBW C;  4JAS A;  2V7Q G;  2VQD A;  5IYD O;  1XDN A;  4HNA A;  1UPG A;  4LBE C;  3SDL A;  1EZV H;  1FJG O;  1GN6 A;  5GW7 A;  2HJF C;  3X2Q B;  3VNN A;  1XMO O;  5I5S A;  3BAA A;  5BPF A;  1GO3 F;  1NZ6 A;  1QR8 A;  1PL0 A;  2ILM A;  4MTO A;  1B6Q A;  1DK1 A;  2DJV A;  2GSM B;  4IIJ F;  5B66 Z;  1N0J A;  2R7N A;  2XTA A;  4O83 A;  4JI7 O;  4PJ0 Z;  2DQ0 A;  3K58 A;  3RBZ A;  1LUW A;  1XK5 A;  2PBZ A;  1XRE A;  3K0G A;  1VQ6 V;  3JAT B;  2P90 A;  3W1G A;  4JAA A;  4FFM A;  4UCS A;  1SS3 A;  2OCC B;  4DV1 O;  1DIK A;  5FR9 A;  3RR5 A;  4FVM A;  1PP9 H;  1EUC B;  2LJ2 A;  2RN9 A;  3AG1 B;  5B1A B;  1AUX A;  3E22 A;  2W6I G;  3J7A U;  2HDK A;  1I2K A;  3GB7 C;  5HV6 A;  3QFF A;  1K7D A;  4JI8 B;  1S5L Z;  1GSO A;  2A79 B;  2F93 B;  1ZL8 B;  3W5O A;  4M9U A;  2GQR A;  1QLN A;  2JDI G;  1FXH A;  1H8H G;  3D3Q A;  3UZO A;  4Y8V B;  1IVS A;  3IAY A;  3FD9 A;  3WO0 A;  2X0L A;  4JTA B;  4JI2 B;  1S76 D;  4B3M B;  4DV7 O;  1VBH A;  1ZTE A;  1IBK O;  3TXS A;  4YB8 B;  1SES A;  3TW7 A;  2CGN A;  2CUG A;  2CDY A;  4MS2 A;  4CS2 A;  3FB6 C;  4PZ6 A;  4C5A A;  3LDD A;  1YVW A;  1M9N A;  5L3D A;  3K57 A;  5CA0 F;  4TOI A;  5HFL A;  1P7G A;  2EIK B;  4JYA O;  1OCR B;  3JZ6 A;  4FLV A;  4FJC C;  1XNR B;  1B06 A;  4O4J B;  3ZHR A;  5JQG F;  3T9C A;  4I4T A;  2GBO A;  3CCR V;  4GCZ A;  2DLN A;  1SET A;  1G4Y B;  4X62 O;  3SPC A;  4RZQ A;  5FPO A;  2N05 A;  4IZO A;  5B1B C;  1EN5 A;  4YY3 B;  5KAF Z;  1TUB A;  4EFB A;  4PHZ A;  4Z2W A;  1GAX A;  1M0W A;  2V58 A;  4PDM A;  1SER A;  3JAW A;  2OCH A;  2QE7 G;  3JYC A;  3A0R A;  2WA4 A;  2UXB B;  1LUV A;  1OCO B;  4GYC B;  4OGQ B;  1CS0 A;  4RUE A;  3JAK B;  3N8D A;  4FZ1 A;  1YEW A;  3R23 A;  3RYI B;  1ENV A;  3AK3 A;  3ABM B;  1N34 B;  3CWB H;  4QNH B;  3LNN A;  4Z1M G;  1IBM B;  1JLL B;  2EJ3 A;  2DOS A;  4BR6 A;  1F4M A;  1FXK C;  4MVR A;  4ZI7 A;  4IGG A;  3LSU A;  3CS5 A;  4GLX A;  4O2A A;  4O7T A;  3TY5 A;  1MOF A;  5A9G A;  4X20 B;  1YCI A;  4X1Y B;  3CD6 V;  1KT8 A;  2YRW A;  1SQX H;  4WFA V;  4H33 A;  1I94 B;  3JD2 A;  1IDS A;  3R66 A;  1PL4 A;  1SQQ H;  4IIJ A;  5JH7 B;  4O4H F;  4PEL A;  2X6A A;  3IC7 A;  1JPX A;  4LWS A;  1QVG U;  2ZQM A;  4PDR A;  4O82 A;  4IHJ F;  5JJN B;  1P8L A;  1OCC B;  2ZE7 A;  3NBY B;  3K03 A;  3JZF A;  3AK2 A;  2QWP B;  1TUB B;  2HHF B;  2OTJ V;  1AR5 A;  2Y0I A;  5EZY B;  4CH6 A;  2Y69 C;  4TVI A;  3T1C A;  4UCR A;  1E1R G;  3WB1 A;  1N34 O;  5KKN B;  5JVD B;  1AP5 A;  3M8A A;  3HR0 A;  4F6R B;  4UVB A;  1Q3E A;  5CA1 A;  3OTO B;  2F4V B;  4DRF A;  2PI4 A;  3CEI A;  3KAJ A;  5LGU A;  2WLI B;  3LUT B;  2ADP A;  1ZWI C;  4YJ3 F;  4ME6 A;  5L3E A;  4O86 A;  4U3J B;  3THO A;  2UU9 B;  3GID A;  1EM1 A;  5IY5 C;  2UXN A;  3EVK A;  3FX7 A;  2K1E A;  4J41 A;  2R87 A;  3BA8 A;  4MVZ A;  2HGW A;  1AJQ A;  1NI8 A;  4JF3 A;  4P9O A;  1E1Q G;  4LF8 O;  1KKD A;  2E5L O;  3LQS A;  5J2T F;  3ZS8 C;  5IJ0 A;  4DR6 B;  4K0K B;  1BHB A;  4IWY A;  3CE2 A;  1VBG A;  5JQW A;  1SZX A;  1WB8 A;  2A7W A;  2YIB A;  1PPJ H;  4NTW A;  2O57 A;  2IBZ H;  2XUM A;  3K0D A;  1VMG A;  3HPL C;  1I2L A;  1V9P A;  2N04 A;  2UXD B;  2HEP A;  4XZ3 B;  3T1Y B;  3CPW U;  5D8D A;  3ASN B;  4UCO A;  4LFA B;  3I55 V;  3UZB A;  4B3M O;  2HG8 A;  3B8M A;  1KUQ A;  1VAR A;  3SYQ A;  1GM8 A;  2Q0O C;  2V5A A;  4AQY B;  3L71 H;  1IXM A;  3PJS K;  5I5Y A;  2JK5 C;  3ZHS A;  3SPI A;  1ORQ C;  1A9X A;  1EKF A;  5E1A C;  2QK4 A;  1QCE A;  2YEV B;  3D3I A;  4YIP A;  3OUS A;  2KB1 A;  4PD4 F;  1ZAU A;  3E89 A;  2EIL B;  4QPK A;  4HNU A;  2E74 B;  4E2L A;  3ZHV A;  5BMV F;  3SJQ C;  3H1K H;  2F95 B;  4DR2 B;  1FXK A;  1K4D C;  1YXB A;  4TV8 B;  5LXT F;  3K5N A;  3OMA B;  3ZN1 A;  2NNU A;  2EIL C;  2YS8 A;  4JV5 O;  1V55 B;  2XAG A;  1IYE A;  4GKJ O;  2DYR C;  2LW7 A;  1J95 A;  1A0I A;  4DR7 O;  2QWR B;  3CSW A;  3JAL A;  3RYH A;  3Q4H B;  2WA3 A;  4JI7 B;  1R6N A;  3VOT A;  3EXA A;  4FLW A;  1HR0 B;  1KTA A;  4IYH A;  1BXR A;  2JEU A;  3E35 A;  1OV9 A;  4CH3 A;  5EIB D;  2Y69 B;  2HHH O;  4H13 B;  4CBC A;  1SQP H;  1TVK B;  2WLL B;  3CCE V;  3SYO A;  4IYI A;  2EUL A;  4DUY B;  4DV6 B;  4P30 A;  3WO1 A;  5H80 A;  4JI1 O;  2QWQ B;  2ODT X;  3R5H A;  1VF7 A;  1B3Q A;  5J2U F;  4PA6 A;  1IOV A;  5DMX A;  1GTO A;  2IJI A;  2HIV A;  1VF6 C;  2HVJ C;  2UUB B;  4ZI7 F;  2ZCE A;  1BE3 H;  5KHK A;  2ZDI C;  3T9F A;  2YEV A;  2QTO A;  1MZF A;  2ODM A;  5GON F;  2CK3 G;  3RYC B;  3RWR D;  2GUZ B;  2NLJ C;  2YSU B;  1W59 A;  4DV2 B;  4LF4 O;  2LFR A;  4J7K A;  2R72 A;  3MAQ A;  4NR1 A;  2HLD G;  3BA9 A;  5L3C A;  1I94 O;  1EN4 A;  5DM6 V;  1FPO A;  4DXW A;  2HP8 A;  3FB8 C;  2MK3 A;  2GTS A;  2XD4 A;  2VQF B;  1GSH A;  4O4I B;  4DV3 B;  3R5X A;  4E6N A;  1WN7 A;  5LP6 C;  2LW1 A;  4JPR A;  5GTH Z;  2JGU A;  3J81 N;  5CA3 A;  3OTO O;  1QBZ A;  2CH7 B;  4B7E A;  1IBL B;  2F43 G;  4FM2 A;  4ZOL A;  5BR8 B;  2CNU A;  1VQ4 V;  5D5P A;  2X6C A;  4HNT A;  2RCV A;  1GKF A;  5BWW A;  1S5H C;  4O4I F;  2Z5U A;  1N36 B;  3L73 H;  5JQG A;  2ZXW B;  5I5X A;  4QPJ A;  3SJA C;  4U3J A;  4PA3 A;  2QDO A;  2QM8 A;  3CCL V;  3GVM A;  4FZ0 A;  2EIJ B;  1BNC A;  1FD9 A;  2W6J G;  2ZDQ A;  5BXZ A;  3B2E E;  3APQ A;  2KG7 A;  3R5F A;  1WB7 A;  4JI1 B;  5CE8 A;  4WFH A;  3WU2 Z;  1TGO A;  3HKE B;  4O4L B;  5J2T A;  5JWP A;  3VA7 A;  3IC9 A;  2M7W A;  1NJI W;  3OUF A;  1K34 A;  4FE2 A;  3H1L H;  1NR7 A;  4LF7 O;  1JA8 A;  2LGW A;  2ZR2 A;  3DSQ A;  3EFF K;  1VQ7 V;  3RT3 C;  3D8C A;  3WFV A;  4F4L A;  2GV9 A;  4O2A F;  3T9A A;  1D2D A;  1VIB A;  5IYB O;  3WB0 A;  4ZIB A;  5C93 A;  2EIM B;  3SGI A;  1WA8 A;  1VQN V;  3GLK A;  3FAV A;  4NTX A;  3K5L A;  1Q81 W;  4L8J A;  2DN9 A;  4I50 B;  4FFO A;  2R7M A;  2UXC O;  3AG3 C;  4K3A A;  5JQG B;  4DR2 O;  5LXT B;  4MV6 A;  3CCJ V;  5I47 A;  2GDS A;  1V54 B;  4UVC A;  3QG5 A;  1NH2 D;  1XBL A;  3GJX B;  3SE7 A;  4H37 A;  4O4J A;  2QA4 V;  4DR7 B;  1K8A W;  4C5B A;  2F1M A;  3DTF A;  1XOU A;  1PX2 A;  2YWV A;  1DAA A;  1MAB G;  2JGD B;  3B8N A;  1GN3 A;  2OCC C;  1A3G A;  3A8T A;  4QE7 A;  2DWD C;  1HNZ B;  1R6T A;  5EYP A;  2I80 A;  1THZ A;  2R84 A;  2X5R A;  3CRQ A;  3P3P A;  4QSH A;  3OR7 C;  4HYO A;  3K08 A;  3CXC U;  2AHZ A;  2RDC A;  4DR1 B;  1XEQ A;  1J5E B;  2XAQ A;  2A0L A;  1EBO A;  3CJH A;  3HKB B;  3VQW A;  5IDJ A;  3RV3 A;  3V4Z A;  3N2K B;  4H0L B;  3MJF A;  4DV7 B;  3DTG A;  2CFM A;  5BY1 A;  4AQY O;  2W6N A;  4OX9 B;  5I60 A;  3FAV B;  1C30 A;  4MTX A;  2CNQ A;  1FS0 G;  4MSW C;  2YIB D;  2H94 A;  4K8X A;  4O2A B;  4MAM A;  1R73 A;  3MD0 A;  1P7B A;  1I1K A;  5KX5 A;  2HJD A;  4EEQ A;  4J42 A;  3QF7 A;  4FPP A;  2L35 A;  4DQN A;  3ZRX A;  1COW G;  2P4V A;  3OFN G;  5B3S B;  3ZX6 A;  2Y4U A;  3K04 A;  3ZIA G;  1QHT A;  5HBR B;  2ATK C;  5JVD F;  5EZY A;  4X20 A;  3CSX A;  2ZNJ A;  2AGA A;  1PD3 A;  5I5V A;  3UT5 A;  5EZY F;  3BY6 A;  2CH7 A;  3ML0 A;  4DYL A;  2NU6 B;  1K5Q A;  1JJO A;  2N74 A;  3KG2 A;  5BWX A;  2WLI A;  4NKG B;  2Y48 A;  4ZOL F;  4BIZ A;  5GON A;  2Z3Y A;  3TXQ A;  4YJ2 A;  1YHQ V;  1KP3 A;  3ZRV A;  1G1X B;  3HO8 A;  1XMO B;  2I87 A;  4JZ2 A;  2R9I A;  3R65 A;  4CH4 A;  5C8Y B;  5LL6 Y;  2HR3 A;  5EK0 A;  2HGS A;  3CEB A;  1QR9 A;  3TCU A;  2HG5 C;  3CME V;  1M57 B;  3LSQ A;  4KL1 A;  3RGB A;  4D6T H;  5I5U A;  3KYH C;  2P0A A;  1Q8I A;  1JFF B;  1DF4 A;  3K5O A;  2L6L A;  2YZN A;  4LNU A;  2WSS G;  3ETD A;  4DV5 O;  5CAE B;  1FFT B;  1BMF G;  1XUQ A;  3APO A;  3T99 A;  3F7Y C;  1H2M A;  4O2B B;  5KUK A;  1S5J A;  1PK8 A;  2XND G;  1BS3 A;  4UVA A;  1LNQ A;  4JYY A;  2WLN A;  1H2N A;  4FMT A;  4TUY F;  3CRC A;  1NTZ H;  1AI4 A;  1XMQ B;  1IBL O;  4YY3 O;  4Q6G A;  2W71 A;  4MV4 A;  3H1H H;  1GGO A;  2D2C B;  2G38 A;  3CCM V;  1KJQ A;  1GK9 A;  5GON B;  3U0G A;  1VQM V;  2W70 A;  4I50 A;  1P49 A;  4TWK A;  4CC5 A;  2UXC B;  4C5C A;  2OTL V;  1W2B U;  5LOV F;  4NB5 A;  4C7U A;  5H5N A;  5CBF A;  5C8Y A;  3CC2 V;  2ZE8 A;  2Q7G A;  3G4S V;  5K2M A;  3U10 A;  2C2A A;  1M56 B;  1SQF A;  4X64 B;  1SA0 A;  4MVO A;  2HFE C;  2ZKO A;  3BRC A;  2ZM6 B;  1EYZ A;  4EG0 A;  3ZHQ A;  4R50 A;  1VS0 A;  3DC6 A;  3WWI A;  3RYH B;  3T7A A;  4JI4 O;  2RQ6 A;  5CA0 A;  1I0H A;  2ZD9 A;  4LR3 A;  1AB3 A;  3H1I H;  3ABL C;  1ZUQ A;  2KSD A;  3G8C A;  3OM3 B;  2HGX A;  4GLW A;  1YIJ V;  4GX2 A;  4FFR A;  2Q8V A;  2P5O A;  3CCQ V;  3DGE A;  3S3X A;  1AI7 A;  1H2L A;  4TV9 B;  1N0N A;  1WPX A;  3E5N A;  4U3F H;  3T9B A;  5DN6 G;  1PNM A;  3QO5 A;  3ZRW B;  3Q4H A;  2BTQ B;  2VWJ A;  3ETJ A;  4MV1 A;  4JI8 O;  5IYC O;  2EZP A;  4OPA A;  3SPJ A;  3JAR B;  3VPC A;  5FL7 G;  3RYF B;  2B1G A;  1MNG A;  2COJ A;  2Z02 A;  1UC9 A;  1RSO B;  1DTO A;  3RVZ A;  4X9Q A;  1QLE B;  2JS5 A;  2FKX A;  5A2Q N;  3QWU A;  1N32 B;  3P3N A;  3TJT A;  4D7S A;  4O4I A;  3C3S A;  1XMQ O;  2YL2 A;  1JR9 A;  5LMN O;  4B3T B;  3SPH A;  3C90 A;  3ZMU A;  5FNV A;  4LCU C;  2IJJ A;  3K06 A;  4DV0 O;  1MMM A;  4PI2 A;  1HW7 A;  4Q4D A;  1N33 B;  1NT2 B;  5DAA A;  1A0G A;  3OUU A;  4LFC O;  1Q6I A;  2GHY A;  2QWO B;  3CRR A;  1GN2 A;  4LF9 O;  4BIO A;  1Y74 A;  5B1O A;  3Q1K A;  4B3R O;  1XNQ O;  3TQT A;  4MV8 A;  4PBC A;  1KB9 F;  2BTQ A;  4DUY O;  2YC0 A;  4DRX A;  4DV4 B;  3VOU A;  4JTC B;  3JAW B;  2DMX A;  2Q7H A;  3AG1 C;  5D5Q A;  1M5I A;  1JDE A;  4PA9 A;  1PV0 A;  1C3O A;  3AK1 A;  4O7N A;  1ROP A;  4O84 A;  3ZJZ A;  2R7K A;  2XAH A;  5LYJ F;  4GT1 A;  2IU0 A;  5TIS Z;  3ETQ A;  4XBF A;  4X65 B;  2NUA B;  1YZB A;  4O2B A;  4WFG A;  4IHJ B;  2UUC O;  3T4Z A;  1Y66 A;  4JI0 O;  4KFM A;  1GLV A;  2KG7 B;  2DE0 X;  4RQE A;  2CZG A;  2YRX A;  3SJC C;  4FM1 A;  4X1Y A;  3T9E A;  5JVL A;  5ITZ B;  4O4L A;  2R70 A;  3WWJ A;  4CKB A;  2WLJ A;  4YAJ B;  3ZHU A;  1XNQ B;  5LXT A;  3AG4 C;  5IT9 N;  4PA7 A;  5IYZ B;  4BAY A;  5F2V O;  2P7T C;  4DR3 B;  3O9O A;  4JYB A;  1H38 A;  5BYA A;  2XAS A;  1J5E O;  4DIM A;  4JI5 B;  3V4S A;  3AG3 B;  4R6Z A;  4CE5 A;  4JI3 B;  1KD1 W;  2NU9 B;  2IH3 C;  5JJE B;  3SNO A;  3ICX A;  1DLB A;  4DV0 B;  5IJ0 B;  2R85 A;  4IWX A;  5L3G A;  4LF6 B;  1VKZ A;  3L72 H;  1S68 A;  5BWT A;  1S0V A;  5LMN B;  4B3T O;  2CTP A;  3T1Y O;  2R82 A;  4CHI A;  3HT5 A;  1BCC H;  2AHY A;  5LP6 A;  4X66 O;  1ET0 A;  5CM0 A;  2QWN B;  1OHH G;  3DXR A;  3CP1 A;  3B40 A;  3TET A;  5LYJ B;  2JGD A;  2LP7 A;  1NR1 A;  5H6R A;  2BCC H;  4UCV A;  4O7S A;  3UYY A;  5JCO C;  1U96 A;  4FLT A;  3BAC A;  2SCU B;  3TY8 A;  3CRM A;  1XL4 A;  1AJN A;  3ZRW A;  1M1K W;  3HKC B;  4FM0 A;  1VF6 A;  4ASU G;  3DAA A;  3ABM C;  1A32 A;  2A3Q A;  1F23 A;  5J2U B;  4BWA A;  4WF9 V;  3E83 A;  1Z2N X;  3U11 A;  1L8D A;  1Q6U A;  4WBN B;  4E4T A;  4JAU A;  4JYA B;  1G8M A;  2C00 A;  1SKV A;  1I5X A;  5BMV B;  4UUG A;  1Z2P X;  5BYB A;  4FFB A;  3IFX A;  3CXH F;  4O7V A;  3R9R A;  4MA5 A;  1KYO F;  4M0J A;  2VR1 A;  4EB6 B;  2CNV A;  5CBG A;  1VQO V;  2QKS A;  1KJJ A;  2OLS A;  4MV9 A;  3ZHT A;  3K5M A;  2NU7 B;  2ZR3 A;  4O7Y A;  1AI5 A;  4YJ2 B;  1R6K A;  4TV8 A;  2BTO A;  5KAI Z;  5GTI Z;  4F6E A;  1CKN B;  4EKW A;  1Y74 B;  2ZE6 A;  5IJ9 B;  3Q2O A;  3TY9 A;  3JAL B;  5EIB C;  1JX9 A;  4GKK B;  1CP9 A;  1OBG A;  3MDS A;  4JAV A;  1EZ1 A;  4FGR A;  2V59 A;  4CMD A;  2ABJ A;  4I7Z B;  2FB9 A;  4I4T F;  1L0L H;  2J9G A;  3B4S A;  4L1K A;  4U7O A;  2JRI A;  2Q68 A;  2FYU H;  3KZI Z;  4XYM B;  1PNK A;  2WAM A;  1HNW B;  4I55 A;  1FFX A;  3ABU A;  3LSS A;  5BMV A;  1VQ5 V;  4YHH O;  5EBL C;  4FFB B;  2UUC B;  2YDE A;  3E22 B;  3JCU Z;  3N2G B;  5J9P C;  2YIC A;  1Q7Y W;  5JH7 A;  4DV3 O;  2PGG A;  3MHH C;  3VQY A;  4MW8 A;  3QQM A;  4LWS B;  3G71 V;  3TW6 A;  1JFF A;  2AZ0 A;  4LNU B;  2H3O A;  1E4E B;  2YXL A;  5LOV B;  4X1I B;  4MV3 A;  5LBQ A;  4ZBM A;  4UUJ C;  3EHB B;  3G6B A;  4WBN F;  1VQP V;  2JIZ G;  4TT3 G;  1XI1 A;  1YI2 V;  3UKM A;  1QQC A;  4K6N A;  2PTM A;  1WLE A;  2IU3 A;  4XDL A;  1HR0 O;  5JVD A;  1KKC A;  3TIN A;  4LC1 A;  1ARO P;  3H01 A;  4Q20 A;  5CA1 B;  2YW2 A;  4TQD A;  2DZD A;  4QJF B;  2Q69 A;  3AG7 A;  5B1A C;  3P30 A;  1I5Y A;  2GTA A;  2DQ3 A;  1PNL A;  3F7V C;  3K9A A;  5LHI A;  5LMU O;  3K79 A;  2PI5 A;  5E25 A;  4I55 B;  4LFC B;  3AG2 C;  2VS0 A;  2QSA A;  2FPP B;  2COI A;  2VQE B;  4CH5 A;  5D1O B;  3TGU H;  4IL6 Z;  5KHI A;  3AX6 A;  5CB4 A;  5B5E Z;  2F23 A;  2OIG A;  1SZT A;  2VRZ A;  4I4T B;  4HN2 A;  1D5N A;  2PUS A;  4GKJ B;  4JXU A;  4JV5 B;  1BSM A;  2UXX A;  3S3W A;  4TV9 A;  2A1H A;  4RCN A;  4PA4 A;  2JJ1 G;  2VWK A;  1EKP A;  4X1K A;  4LF5 B;  5JJJ B;  4OX9 O;  2PY5 A;  2XAJ A;  2EIM C;  1VQL V;  1BQ0 A;  4U7N A;  3N6R A;  3DTU B;  4EGJ A;  2JVD A;  1W0K G;  2YID A;  5CBH A;  3W1B A;  4WFE A;  3ORQ A;  2DYS C;  1JDB B;  4I9W A;  1ZSP A;  1FKA O;  4I0X B;  4DLK A;  2ZM6 O;  4CMF A;  1SF9 A;  4UFZ A;  3OAA G;  4XX0 B;  3U55 A;  1HNX O;  4LFA O;  5C1O A;  4DR6 O;  2XAF A;  3LWB A;  3U0Z A;  4LH6 A;  4GX0 A;  3RYF A;  4JGS A;  3FB5 C;  1OCC C;  1WNS A;  1CXZ B;  3KKY A;  2EIY A;  2WYO A;  3ZCC A;  1RFY A;  5LA6 B;  1GSA A;  1W96 A;  5AG2 A;  2HIX A;  1K3E A;  2EIN C;  4NYE A;  1QLE C;  1K92 A;  1CQJ B;  4MTG A;  4K0K O;  4NZM A;  2ZNI A;  1ULZ A;  4CKC A;  4JI6 B;  4YHH B;  2DW4 A;  3UO2 A;  4LH7 A;  3ABL B;  3OT7 A;  4ABM A;  2ZE5 A;  4H44 B;  4PV1 B;  3G8D A;  4F6R A;  5CB4 F;  3S24 A;  2BSK A;  4GUN A;  3JAM N;  5IWA O;  3VQV A;  3UFX B;  1AUV A;  1US6 A;  3RUP A;  2IJK A;  4TM5 A;  1FFX B;  3G80 A;  4G2K A;  1B6R A;  2QM4 A;  3AEI A;  3D36 A;  4RO2 A;  4E4E A;  4QIW F;  1M93 A;  2GUZ A;  1SQV H;  4RQF A;  5EC1 C;  3A2F A;  3OMI B;  1NVP D;  3RVY A;  3M7M X;  4WHX A;  4HNA B;  3MWE A;  5I5W A;  5LA6 A;  4DUZ B;  3O65 A;  3WWH A;  4DR3 O;  3E8F A;  1RP3 B;  2Q5Z A;  1MA1 A;  1R3J C;  3ZRS A;  2ITC C;  5EC2 C;  2EJR A;  3NR7 A;  3JRW A;  1H2S B;  4IHJ A;  3ZBH A;  1N8R W;  2JEX A;  5BWV A;  1GM7 A;  3E8H A;  2QEX V;  3K5H A;  1VQK V;  4P2Z A;  3UT5 B;  4I50 F;  3UM7 A;  4DR4 B;  5LHH A;  2LGQ A;  4CC6 A;  5IWA B;  2W6Q A;  3MWD A;  4X65 O;  2BSK B;  3UO3 A;  4YJ3 A;  1BQZ A;  4FFL A;  2FPI B;  2B9Z A;  1EFR G;  2BOB C;  5IYZ A;  2UXB O;  1GN4 A;  1K4C C;  3OGI B;  4CZZ A;  1XQ8 A;  4NVP A;  1E79 G;  4XYL B;  1OCZ C;  2FB5 A;  3OEH G;  1EUD B;  5CB4 B;  4DV2 O;  4LF4 B;  3KRE A;  2E3C A;  3T1H B;  1U97 A;  2RNB A;  3JSL A;  2Q73 A;  2Q67 A;  3UCS C;  2HVS A;  2QGN A;  4X62 B;  2I8C A;  4CS3 A;  5C1P A;  2VUG A;  3BG5 A;  3E8G A;  3HKC A;  4RWU A;  2PN1 A;  2CTQ A;  2YZL A;  1I7N A;  1HNX B;  2HHH B;  3LDE A;  4L87 A;  4LF6 O;  3LUL A;  3CCV V;  3U54 A;  4ZHQ A;  2Q9L A;  1Y76 B;  3I56 V;  4HBN A;  4YBZ B;  4JI2 O;  4LF5 O;  4JYC A;  4XDJ A;  3VPB A;  1CPY A;  2XT9 A;  2B5U A;  4NYK A;  3NXS A;  5KHG A;  1P16 A;  3HBL A;  4I0X A;  2HVK C;  3OE7 G;  5B3S C;  3RTX A;  1GH6 A;  3BCC H;  3WB2 A;  1VQ8 V;  2BOC C;  3NUA A;  3TIG A;  1I7F A;  4EB6 A;  1B04 A;  4TQF A;  1FYJ A;  1EN6 A;  1YJN V;  2HVR A;  2E76 B;  1YDX A;  1KC7 A;  4CS4 A;  1PM9 A;  4EFE A;  1BZK A;  1HNZ O;  4WBN A;  2ZT9 B;  3IJ4 A;  4DV1 B;  3JD4 A;  1UJW B;  3D36 C;  4DK0 A;  2Y0P A;  2W6M A;  4A5U B;  4G27 B;  2YZG A;  1BT8 A;  3FYI B;  1KBH A;  1HP8 A;  4MVU A;  4B7K A;  3STZ C;  4I5S A;  4O7L A;  1KJ8 A;  1AVM A;  1YF2 A;  3ZED A;  5BPH A;  1UFI A;  3ASO B;  4G28 B;  2IJH A;  4ZOL B;  1BL8 A;  1R3I C;  1OJH A;  4JZG A;  4LF7 B;  2QR4 A;  2D3O W;  5LMU B;  1ZLZ A;  2W0X A;  1IZ3 A;  3HB9 A;  1KJ9 A;  1XIL A;  4JI4 B;  4PDV A;  4NXM B;  3NBZ B;  4X88 A;  2JJ2 G;  1I7L A;  3L74 H;  1K73 W;  1RM1 B;  3F5W C;  3DC5 A;  1AR1 B;  1FJG B;  1M6V A;  2PVP A;  2QKC A;  3N2G A;  1O9G A;  1DV2 A;  5FNV B;  5KX5 F;  4OXS A;  1QNM A;  3A0B Z;  4LF9 B;  3RV4 A;  2QF7 A;  1S77 D;  3VMM A;  1V54 C;  2Y4T A;  4HZ3 A;  3RN4 A;  5LOV A;  1N36 O;  3KAK A;  2DIK A;  1HNW O;  1NTM H;  1CQI B;  1OCZ B;  4FLX A;  2Q7D A;  4X8A A;  4K8Z A;  2W6Z A;  4R8C A;  5IY5 B;  4FLU A;  1JJ2 U;  4MVM A;  3VBB A;  3A0H Z;  1KJI A;  1R3L C;  4W4L A;  2R7L A;  3LDC A;  4WCE V;  2X7R B;  2HHF A;  4TUY A;  4BIU A;  2W6P A;  2FP4 B;  4WFB V;  2WLL A;  4R7C A;  2KKW A;  5B1B B;  2LQT A;  4QE9 A;  5HFM A;  1Y67 A;  1WJZ A;  2V1D A;  2AW9 A;  1X9N A;  1UC8 A;  1FVI A;  1FXV A;  4YIO A;  1JOY A;  4J9Y B;  1TUE B;  3RYC A;  4EQ5 A;  4YJ2 F;  2UUA O;  2DAB A;  2QJ1 A;  3OTF A;  5CN0 A;  4NXN O;  4X1K B;  3T2M A;  2EIK C;  4UCT A;  1KEE A;  4KP4 A;  2YZM A;  1JVM A;  4YXW G;  5CR5 A;  5I5T A;  5H2F Z;  3C3T A;  5BWR A;  2R9A A;  2W0F C;  3WNZ A;  1IXB A;  4N21 A;  4UB6 Z;  4I9Q A;  4TUY B;  4DV6 O;  4MVS A;  5FNV F;  4B08 A;  1SQB H;  4UB8 Z;  4UV9 A;  4FU0 A;  2ZIN A;  3M99 B;  2XHB A;  2Z04 A;  2YIA A;  1FAF A;  1WRV A;  4ICG A;  1YTF D;  1W0J G;  2CE4 A;  3AG4 B;  1Y4M A;  2Y4R A;  1MSD A;  1URF A;  3QO8 A;  2PYJ A;  1IX9 A;  1Q82 W;  3ORR A;  1X4T A;  3E2E A;  1GMG A;  2Q6A A;  1W93 A;  3HKE A;  3QNE A;  5J2T B;  2VPQ A;  3J80 N;  1IOW A;  1NU1 H;  3KCY A;  3JAS B;  3GB8 B;  4FFP A;  5H9C A;  2VQE O;  5BZB A;  4PZ7 A;  4JI3 O;  4DV5 B;  3N27 A;  3T4D A;  4BW9 A;  3CMA V;  3I12 A;  4ZHQ F;  2GPS A;  2GQS A;  1T5E A;  4DR1 O;  2ZDG A;  1N4C A;  5KMG A;  3RYI A;  5LYJ A;  2V4D A;  1WA8 B;  3G67 A;  2Q0A A;  2OWO A;  4X89 A;  4NZO A;  4NTY A;  3ASO C;  4W4K A;  1K33 A;  2Z0A A;  4JTD B;  3T1H O;  2P6J A;  2E5L B;  3CC4 V;  1XHZ A;  4YAK B;  5EBM C;  2Q2T A;  3BEH A;  1BGY H;  2ADQ B;  1LR1 A;  2GPW A;  3W7X A;  4IIJ B;  2RMK B;  2ZDI A;  3W7U A;  2UU9 O;  2F66 C;  3ZN0 A;  2NU8 B;  3BAB A;  3MHS C;  3H9V A;  4O2B F;  4J10 A;  2ETN A;  2Q4P A;  2AXT Z;  5EYP B;  2A9H A;  3BVO A;  3GWK C;  4J9Z B;  3JAS A;  2FTK A;  4HNV A;  4TV8 F;  1NS1 A;  4Z1V A;  2ZIO A;  4AI8 A;  4O4H A;  1Q90 D;  5KHJ A;  1KP2 A;  1SQG A;  1MSW D;  4CKE A;  1XHX A;  5BWU A;  4RUF A;  3W7T A;  4WFF A;  5L3F A;  1O9H A;  2QKA A;  1QU7 A;  3N2K A;  5E79 Z;  4DR5 B;  1G2W A;  4O4J F;  3JCZ A;  3TEK A;  4QGP A;  3CX5 F;  5JCO A;  1Z5W A;  2ARH A;  3L9D A;  1PKX A;  4J11 A;  4DRX B;  2WWW A;  1H8E G;  3HKD B;  3OD4 A;  4PDL A;  1N33 O;  5LA6 F;  3X2Q C;  3I5D A;  3QTC A;  4ZQI A;  2GLT A;  1IBM O;  2IW5 A;  4YJ3 B;  5DEC A;  3ABK C;  5DGI A;  1D5A A;  1S72 V;  1EKV A;  2ZIM A;  1E4E A;  3U9S A;  4X1I A;  1EZJ A;  1KU9 A; 
#chains in the Genus database with same CATH homology
 2QB5 A;  5LA6 B;  5CA0 B;  3FFQ A;  3T99 A;  4B3S B;  4O2B B;  1S5J A;  4AIL C;  4O4H B;  5FPO A;  4NZM A;  1XMQ B;  1I1L A;  4YY3 B;  4Q6G A;  2ZNI A;  4CKC A;  4JI6 B;  1TUB A;  4EFB A;  4PHZ A;  4YHH B;  3JAW A;  4FLZ A;  4LH7 A;  5DGH A;  4NZN A;  5GON B;  3T54 A;  3U0G A;  2UXB B;  4DK1 A;  4GYC B;  1G6U A;  4F6R A;  4I50 A;  1P49 A;  4CC5 A;  2UXC B;  3BPZ A;  2Q7E A;  3VQV A;  3JAK B;  5C8Y A;  1YEW A;  3RYI B;  2Q7G A;  5K2M A;  3U10 A;  1N34 B;  4TM5 A;  1SQF A;  1FFX B;  3LNN A;  4X64 B;  1IBM B;  2EJ3 A;  1SA0 A;  2QM4 A;  4ZI7 A;  1M93 A;  3BRC A;  4GLX A;  4O2A A;  2ZM6 B;  4X20 B;  3A2F A;  4X1Y B;  3JAT A;  1KT8 A;  1I94 B;  3WWI A;  3RYH B;  3T7A A;  3M7M X;  4IIJ A;  5LP6 B;  5JH7 B;  2RQ6 A;  4HNA B;  4WHX A;  5I5W A;  5LA6 A;  5CA0 A;  4DUZ B;  4LR3 A;  3WWH A;  1TAE A;  2HGX A;  4GLW A;  4NXN B;  1TVK A;  5JJN B;  2P5O A;  1H2S B;  4IHJ A;  1TUB B;  4TV9 B;  2HHF B;  5BWV A;  5EZY B;  1Z5V A;  4CH6 A;  3T9B A;  4TVI A;  4UCR A;  3WB1 A;  3UT5 B;  4DR4 B;  2BTQ B;  3VQX A;  2VWJ A;  5JVD B;  4F6R B;  4CC6 A;  1IYD A;  5IWA B;  1Q3E A;  5CA1 A;  3OTO B;  4YJ3 A;  2F4V B;  3JAR B;  5K3W A;  3RYF B;  5IYZ A;  2COJ A;  1UC9 A;  5KX5 B;  2PZS A;  4U3J B;  2IM9 A;  5K1X A;  3THO A;  1XQ8 A;  4NVP A;  2JS5 A;  4X66 B;  2UU9 B;  1N32 B;  4D7S A;  4O4I A;  3BA8 A;  5CB4 B;  4LF4 B;  2HGW A;  2E3C A;  3LQS A;  3T1H B;  3ZS8 C;  4B3T B;  1KU9 A;  5IJ0 A;  4DR6 B;  4K0K B;  4IWY A;  1KMI Z;  1Q5O A;  5FNV A;  3JSL A;  2YIB A;  3VPD A;  4X62 B;  4PI2 A;  1HW7 A;  4Q4D A;  1N33 B;  1NT2 B;  4CS3 A;  1A0G A;  5DAA A;  3UQ8 A;  1I2L A;  1V9P A;  3HKC A;  2UXD B;  2HEP A;  3T1Y B;  4UCO A;  4LFA B;  1HNX B;  2HHH B;  3LUL A;  3JAK A;  3UZB A;  2HG8 A;  4ZHQ A;  2CAZ C;  4PBC A;  3SJB C;  4HBN A;  4UCU A;  4AQY B;  2BTQ A;  5K1P A;  4B3R B;  5I5Y A;  2OYQ A;  5KHG A;  1JMK C;  4DRX A;  4DV4 B;  3JAW B;  3HKD A;  2Q7H A;  3WB2 A;  5D5Q A;  1M5I A;  4AHC A;  3K59 A;  1I7F A;  4EB6 A;  1EKF A;  1B04 A;  4TQF A;  2YI9 A;  1ZAU A;  4CS4 A;  4EFE A;  4WBN A;  1WPB A;  3ETQ A;  2EX3 A;  4DR2 B;  2F95 B;  4DV1 B;  4X65 B;  4DK0 A;  4TV8 B;  3RFR A;  3PFF A;  3K5N A;  4O2B A;  4PI0 A;  4IHJ B;  2DAA A;  1IYE A;  3SJC C;  4FM1 A;  4X1Y A;  3T9E A;  5ITZ B;  3CSW A;  3JAL A;  3RYH A;  4Q4C A;  4O4L A;  2R70 A;  4JI7 B;  3ZED A;  3WWJ A;  4FLW A;  1HR0 B;  4CKB A;  1KTA A;  4ZOL B;  1XNQ B;  5LXT A;  4LF7 B;  4CH3 A;  5EIB D;  5IYZ B;  5LMU B;  4DR3 B;  1TVK B;  5BYA A;  3CB2 A;  5HNE A;  4JI4 B;  4DUY B;  4JI5 B;  4DV6 B;  4NXM B;  2COG A;  4CE5 A;  4JI3 B;  2ODT X;  4LFB B;  1VF7 A;  1FJG B;  5JJE B;  3SNO A;  3ICX A;  4DV0 B;  5IJ0 B;  2UUB B;  2ZCE A;  1SA0 B;  1O9G A;  3N2G A;  5KHK A;  4IWX A;  5FNV B;  4LF6 B;  3T9F A;  1Q43 A;  3T9D A;  3RYC B;  5BWT A;  3RWR D;  3SR2 C;  5LMN B;  4LF9 B;  4DV2 B;  4CHI A;  2P22 C;  2R72 A;  3MAQ A;  3HT5 A;  1M4U A;  3BA9 A;  5LOV A;  5LP6 A;  1ET0 A;  4FLX A;  5CM0 A;  2Q7D A;  3HKB A;  2VQF B;  4O4I B;  4DV3 B;  4K8Z A;  4FLU A;  1WN7 A;  5LP6 C;  2JGU A;  5LYJ B;  4ZHQ B;  5ITZ A;  4UCV A;  4LF8 B;  3UYY A;  1IBL B;  5JCO C;  2HHF A;  4FLT A;  4FM2 A;  3BAC A;  4TUY A;  5IJ9 A;  4ZOL A;  5BR8 B;  2PYL A;  3HKC B;  5D5P A;  4FM0 A;  3DAA A;  5BWW A;  2KKW A;  1N36 B;  5J2U B;  4BWA A;  5JQG A;  1DGS A;  3JAR A;  5KMG B;  3U11 A;  5KHH A;  5I5X A;  1L8D A;  4WBN B;  3SJA C;  4KHP B;  1RSO A;  4U3J A;  1UC8 A;  4JYA B;  1SKV A;  2ZGI A;  5BMV B;  4UUG A;  5BYB A;  3RYC A;  4FFB A;  3B2E E;  2EJ0 A;  2UUA B;  2YI8 A;  3BHP A;  2DAB A;  4DAA A;  2QJ1 A;  3OTF A;  4JI1 B;  4M0J A;  5CE8 A;  4EB6 B;  1I1M A;  1TGO A;  3HKE B;  4O4L B;  5J2T A;  4X1K B;  4UCT A;  2EJ2 A;  1IBK B;  3CHX A;  4D7T A;  3K5M A;  5CR5 A;  5I5T A;  3DSQ A;  4YJ2 B;  5BWR A;  4TV8 A;  2R9A A;  1TA8 A;  2GV9 A;  2BTO A;  3JSN A;  3T9A A;  2RJZ A;  4I9Q A;  4TUY B;  5IJ9 B;  3WB0 A;  4ZIB A;  3SGI A;  4B08 A;  3JAL B;  3K5L A;  5EIB C;  2ZIN A;  4GKK B;  2XHB A;  4L8J A;  4I50 B;  5J2U A;  5JQG B;  2YIA A;  5LXT B;  4CMD A;  2ABJ A;  3PN1 A;  5I47 A;  3QG5 A;  1WRV A;  4FLY A;  4O4J A;  4DR7 B;  1HNW B;  4I55 A;  1FFX A;  5BMV A;  5KS8 A;  2Y4R A;  2F1M A;  5FPR A;  4ZI7 B;  3DTF A;  4JI0 B;  4FFB B;  2PYJ A;  2UUC B;  1X4T A;  1DAA A;  3E22 B;  3N2G B;  1A3G A;  3HKE A;  5J2T B;  1HNZ B;  5EYP A;  4HNA A;  5JH7 A;  2X5R A;  2PGG A;  3JAS B;  3VQY A;  3QQM A;  1JFF A;  4LNU B;  4DV5 B;  2YXL A;  5LOV B;  4X1I B;  4DR1 B;  5I5S A;  4BW9 A;  3BAA A;  1J5E B;  3HKB B;  3VQW A;  1T5E A;  3N2K B;  4DV7 B;  5KMG A;  3DTG A;  1XI1 A;  3RYI A;  1QQC A;  5LYJ A;  4K6N A;  2V4D A;  2PTM A;  2Q0A A;  2OWO A;  4OX9 B;  5I60 A;  5JVD A;  4NZO A;  5CA1 B;  2YIB D;  4TQD A;  3K58 A;  4K8X A;  4O2A B;  2E5L B;  3JAT B;  1XHZ A;  1I1K A;  5KX5 A;  4EEQ A;  4UCS A;  3QF7 A;  4I55 B;  4IIJ B;  4LFC B;  5E25 A;  2F66 C;  2COI A;  2VQE B;  5FR9 A;  4DQN A;  4FVM A;  4CH5 A;  3BAB A;  5KHI A;  5CB4 A;  3E22 A;  4I4T B;  4HN2 A;  2PUS A;  2HDK A;  4GKJ B;  1I2K A;  5EYP B;  1QHT A;  4JI8 B;  4JV5 B;  4JXU A;  3JAS A;  2F93 B;  4TV9 A;  2ZIO A;  5EZY A;  2A1H A;  4X20 A;  4RCN A;  4O4H A;  5KHJ A;  3CSX A;  1SQG A;  2ZNJ A;  5I5V A;  2VWK A;  3UT5 A;  3UZO A;  4CKE A;  3IAY A;  1XHX A;  5BWU A;  1EKP A;  4X1K A;  4LF5 B;  4JI2 B;  5JJJ B;  1JJO A;  1O9H A;  2PY5 A;  1G2W A;  3N2K A;  4DR5 B;  4B3M B;  3TEK A;  5BWX A;  5GON A;  5JCO A;  4YJ2 A;  1Z5W A;  2JVD A;  3TW7 A;  1XMO B;  4CS2 A;  4CH4 A;  5C8Y B;  4DRX B;  3HKD B;  3CEB A;  3K57 A;  4CMF A;  4TOI A;  4UFZ A;  3QTC A;  3RGB A;  4KL1 A;  4YJ3 B;  5I5U A;  3U0Z A;  4LH6 A;  3JZ6 A;  1Q8I A;  1D5A A;  3RYF A;  4FLV A;  1JFF B;  5DGI A;  3K5O A;  1WNS A;  1EKV A;  2ZIM A;  4LNU A;  1XNR B;  2EIY A;  4O4J B;  4X1I A;  3T9C A;  4I4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...