1ZAWA

Ribosomal protein l10-l12(ntd) complex, space group p212121, form a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
b'VMLTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L10
publication title Structural Basis for the Function of the Ribosomal L7/12 Stalk in Factor Binding and GTPase Activation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural protein
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zawA01
4NWBA 3J7YI 4UY85 1ZAWA 1ZAVA 1ZAXA 5GAEI 3JSYA 3J7Z5 5GAGI 5GAHI 5D8HB 5GADI 2QA4G 5D6GA 3A1YG 4V19J
chains in the Genus database with same CATH superfamily
1T9VA 2QJ3A 2G0CA 5D3GB 1X4EA 3K5MA 4OI2A 3MUMP 1NB2A 2RQ4A 2VG6A 3QIPB 4CO3A 4YUDA 4I56A 5HQLA 4X4SA 3ZFVA 1TV6A 2FZCB 1R6VA 3OL6A 4DPUA 1AYEA 4ZA1A 4YMEA 1T05B 4DR7F 2JEJA 1HWIA 2MDAA 4HI1A 3D6TB 5T7LB 1AUSL 2EI5A 2VICA 1IKYA 1HI8A 2CG8A 1U7LA 4RBVA 5HVFA 1OPIA 4XAKA 2BXJA 2E9TA 1BWEA 4HACA 4QIGA 9ATCB 2YKQA 2HVDA 3H2LA 1TAUA 1T95A 2Y1LB 5EGYA 5KT4A 1YJWS 3CJKA 3Q86A 2LEAA 2ZVIA 2HFOA 1FKAF 2MKYA 1WEYA 4F67A 1L3TA 5BYRA 2OFHX 1BQXA 2DHGA 2R9LA 3T41A 1HYSB 3OD2A 4ZP7A 1KLNA 3GB0A 3RBEA 4A8WA 4ZPTR 2V8DA 2LXUA 1HMVA 1T8EA 2EFVA 1FE4A 1KBRA 2F63A 1I3OB 1QM9A 2HFNA 4DXLA 3CNQP 1HLWA 3PDNA 2X1FA 3CCTA 1B0VA 1F3VA 3DRRA 2FDNA 3QGIA 2FYXA 1WF0A 2V94A 4YHHF 2EFQA 5IQQA 1CC8A 1VHIA 4OZ2A 2ZJRQ 4YDXA 3JTOA 3OPKA 3QPIA 3FDSA 1RE1B 4N47A 1TL1B 4U95A 3LP2A 5EDWA 3GU0A 1QSYA 3Q22A 1FJCA 4YFUA 2DYAA 1S7HA 3GE9A 4FKYA 3RG6A 4K4ZA 1KKHA 1F3FA 3FBFA 3GLJA 4DOZA 1JNRB 4J9MA 3JS9A 3HFKA 3MM6B 1TUGB 3MDFA 1QAJA 4DX5A 1HI0P 3R2CJ 2LP4A 3CJRA 1UW4A 1X4GA 1HWJA 4GC7A 4PG6A 2YPZA 4LIRA 3DI6A 1JLGA 1JQGA 3P3DA 3KJVA 4USTA 4ZVPB 3H5YA 3HHEA 3PKMA 1CULB 4B9LA 4GVBB 3K5PA 4P52A 3VGVA 1HR0F 4TN2A 3V81B 3H98A 3KLFA 2FJAB 3GTYX 4DQRA 2XCAA 2KYXA 3M8QB 5LMUF 1MWQA 3DC2A 4CLUA 3W7BA 3AHPA 4LMZA 4OI1A 4KRWA 3DGPB 4YEAA 1HBNA 3W2VA 2GC8A 3G87A 2ZM6J 4A47A 4UZCA 2J76E 2AIRB 2VFSA 2D3O1 2CPDA 2KI2A 3VR1A 1X5TA 2M5YA 1DURA 2C3YA 2YKNA 5HANA 3CWJA 3QJLA 1W25A 3EPIA 3ILIA 1R89A 3C15A 3G8TA 1N33J 2DGXA 1YG0A 2CPIA 2C2NA 2W9BA 4Q45A 2J0QD 4NA1A 2XHWA 4FXVA 2RNEA 3CGIA 1VQPS 2BRLA 4GO7X 3HPOA 2OGUA 1U6FA 2FC9A 4NYZA 4EZ9A 3W9JA 1S4EA 2CQ1A 2IPOB 3O8WA 3C16B 3S01A 4QR1A 3VWSA 1E6VA 1K44A 1HHSA 4N56A 1SKRA 3DOLB 2R7TA 1J5EJ 1SC1B 3BKFA 1FFSB 3G82A 2W4PA 1KONA 5JVHQ 3W2WA 1SPBP 1R0BG 4DN9A 1X0PA 4F0MA 3UDCA 4DFJA 1X4HA 2DHXA 3JYTB 2HHUA 1P1TA 3LPEA 3R3TA 1P6TA 2W24A 4HDHA 2XSFA 4I7FA 2HRTA 2XC9A 1FTRA 2R7WA 1JKHB 5M2UA 1DFDA 5CYMA 4NCGB 2E5GA 1CSJA 2XMKA 3HJFA 3FUYA 4EBEA 3HULA 5JMNA 2B0GA 1CPZA 3AOCA 2XMJA 2H54B 3L7OA 3MMCB 1GH8A 3ET6B 2XULA 1RWXB 1F9HA 2E1MC 2DO0A 4USUA 5D4PA 5DLGA 4X62J 2JC0A 3T9ZA 4QPTA 3PYGA 3ZXWA 2KHDA 1Y11A 1M0SA 2CQHA 4QIWD 2EBEA 4ECUA 1NHVA 2O1PA 2XMAA 2DPIA 1ZA2B 2QLFB 3KDOA 2B56A 1B7FA 1SI9A 4AE5A 1IBCB 1Y5NB 4ECQA 1R31A 1FWPA 2YWEA 3QO9B 4FZVA 4GKKJ 1C0UA 4ZPWR 3TWZA 3KHHA 2YY3A 2W25A 4CT9A 5K14A 2ZBRA 2B9WA 3FGVA 4KKOB 1FXRA 3OFHA 3MM8B 5GVQA 1IKXA 1X9MA 4MK8A 4R0EA 1ZM3A 5D3GA 3CC4S 1P1LA 1WF1A 1T9YA 1OY9A 1FRMA 3QIPA 7AT1B 1HNXJ 1NSAA 4CLPA 4EUVA 3GJSB 5GMKa 1U0SA 2QV6A 4DBQA 1TMJA 5DM7Q 5LMNF 2QEXS 1RAHB 1JLAA 1DJ0A 3KK2B 1T05A 5L8RC 1UVIA 3GR1A 3IAM9 4QR2A 4WFNQ 4LFAJ 3OLAA 5FJ4A 1YBTA 1RYSA 1SJRA 4PCQA 3R7SB 3AOAA 5F3ZA 3ILOA 3M2UA 1X8DA 4Z2XA 3LGMA 2HIYA 1R8CA 4M95A 1SQFA 4J5OA 1RLCL 3CD5A 4OZJA 3HFZB 2RE1A 2HHSA 3GIRA 4ALZA 1GMWD 3MXHP 2MKJA 1UVKA 2F8MA 2CJAA 3N5BA 3M2VB 3RYLA 1DQ8A 1N5SA 4PABA 1XNRF 2YQ0A 4IOCQ 2Y1IA 2VV5A 3PVXA 2CAJA 3PHEA 9RUBA 3QFHA 1RT4B 3EPGA 4RWXA 2UP1A 1SUQA 3EZUA 2DEJA 3VAIA 3MMJA 4JI4F 4DR5F 1PO6A 5AE3A 2DNZA 4NYOA 4ZK7M 2JC1A 3BR8A 4DSEA 1NH8A 4KHPF 2W9CB 3DU5A 4WU3A 2QFJA 2EK1A 5AXLA 2E7XA 3PYEA 1BLUA 4OV1A 2HBRB 3ELHA 4M1KA 4CZCA 2JX2A 3DYAA 2FC8A 2R7UA 4MMOA 4N8NA 1R8PA 2CVEA 4B9VA 2M2BA 2VKZG 4WFBQ 4JI8J 3QSIA 1TL1A 2GGPA 4C97A 2AZ1A 1GQEA 1JIHA 1SIZA 4IFYB 2N7YA 2R7SA 1HHQA 4OFZA 4RUHA 3JSMA 4J9QA 2AWZA 2YKMB 2UXDJ 2ZH8A 1DQAA 3FC9A 2QC3A 4L72B 1LFWA 2DNLA 3T6BA 3MM6A 2DNYA 1FKPA 2FGOA 2AJ4A 3OR2B 4EEYA 3LH2S 4USVA 2W7OA 4GC6A 1UW9A 1HPZA 2POKA 3MMBA 4U7UK 1C1BB 3NGDA 3CB4A 2F8EX 3NMAA 5THWA 2QA1A 4DL0C 4JI1F 5KFFA 4QW8A 4D3GA 2IDEA 1HNIB 3CCJS 4NLXA 1MG7A 1KC8T 4ZLNA 2GA7A 2ROGA 2GIQA 4MAKA 4Y2IA 3TAQA 3IGVA 1JLFB 3V81A 4BCAA 4NASA 3W8PA 3ZC4A 1R0AB 5LJ3Y 3MOZA 5LM7E 2Q43A 5E3CA 3LO3A 3C3LA 2GAHC 2XYPB 3M8QA 3O6QA 3OUYA 2XLIA 3V6DA 5D4NA 4HTIA 2Z8QA 1N32J 1QAIA 2I9SA 3PRBA 1TK0A 1NPRA 2DBBA 3OW2R 5L9NA 5ETOA 1RT5B 2KT3A 3DGVA 1UEVA 4USKA 4A8QA 3OFEA 3QWPA 4IG0B 3M32B 4LR8A 4I4BA 1GEHA 1VQKS 2HHWA 4Q2MA 3Q2TC 4RWWA 1HR0J 2F9JA 4WBFA 2Y3YA 2FJEB 4ED3A 1WTFA 2VPXB 3LWLA 1WHXA 3MOJB 4OZ1A 5LMUJ 1TR0A 4E2FB 3C16A 4CT8A 4B3TF 3NGTA 3U02A 1JWWA 2DIUA 1H2UX 5ETSA 2RILA 1VJWA 3HD2A 2ROPA 1H2TZ 2OMOA 3HLUA 3QT7A 3WHIA 2RDIA 4ID5B 3DHXA 2AEFA 2C3PA 3ETMA 1RWVB 3FBBA 3PIPQ 4K0KJ 1YJTA 2WOMB 4DSFA 3J81j 3MPUB 3MCSA 3CW2C 4DQPA 3HO1A 1KQKA 4TY8B 4NCGA 4C0BA 2HRUA 4OX6A 2MZSA 3ZO7A 2DNGA 4Y00A 2K7KA 1ICEB 2AYEA 1MSWD 2VC0A 4OJHA 2FY8A 2HQFA 2LQJA 2JEFA 3DLGA 3DDNA 1PYTA 1D09B 4CLZA 4WIIA 2FVQA 3HJVA 2CJKA 3HVWA 1FX2A 2WSCC 4DX7A 3P96A 1O6XA 2CPZA 2D7SA 2FLNA 3LF0A 4R25A 3IGNA 3SV3A 5EWFA 2QA4G 3NCQA 2KXHA 2YQ3A 4ZVGA 3HT3A 3MM8A 1GAOA 2B4OA 2DRDA 3NWRA 1UAWA 2SXLA 5HMYA 4DHVA 3M6VA 3KLIB 5KFIA 4J37A 5KFGA 1AROP 2F1FA 3MD1A 2DY9A 3R6GB 1SL1A 1X7VA 4A8FA 3LGHA 3Q8RB 1WWHA 1K9MT 2FVRA 2HNDA 3KDNA 3QATA 3MEKA 4C8ZA 1M5HA 1S1UB 4MIWA 3KLGA 4K59A 4U6PA 3NNAA 3HDSA 2D3OR 2VG7B 4P2SA 3OT9A 1WORA 3ICLA 2RB7A 2ZKTA 3PX6A 3ENQA 1S59A 4QWDA 4N7TA 4IG3B 2UV8A 1REGX 3KUGA 3I0RB 1RTZA 4WXWA 5M2PA 1CJTA 2OP5A 2LKZA 1TL5A 3EJMA 4RO0A 4OZ3A 3QNWB 3NGSA 3NP5A 3IWLA 3M2VA 5GAGU 2CRLA 1Y10A 1JJ2R 3UO0A 3CCLS 1WKLA 3L7PA 3AB4B 3DRPB 1SH2A 4FNIA 1NHKL 5I4MA 1S48A 4ECWA 2W9CA 3B82A 4A8YA 4HYKA 1P9QC 1FFWB 2PI5A 4TLRA 2JLEA 3NXZA 1S99A 1RISA 3BN7A 4C0HA 2HHXA 2BOAA 4ED0A 1AT1B 4U7UD 2RF2B 4X4UA 1S1VA 4K50A 2BMBA 5JVGQ 4AT1B 5IV3A 1JLEB 2BE2B 5DM6Q 4IFYA 2V2QA 4P10A 5C5JA 3WX4A 1Q0NA 2ILZA 2CPXA 4WYWA 1Y3JA 3IXQA 4Y2AA 4K4YA 3W1YC 1TKZB 2UVUA 3V6KA 3WDOA 1FX4A 2YXLA 1DTQB 3DLBA 2R2UA 2ZE2A 3GIMA 1ZYQA 1O0PA 1ULRA 4Z37A 3DMJB 3X1LB 3EX7B 4X66F 4DL7A 1C1BA 2FQQB 2M0GB 4M5KA 5MLCV 2C2MB 3UR0A 2CPFA 1B99A 4Y34A 3GCWP 3RBZA 3HSDA 2ZEJA 2GS8A 4X4PA 4OLPA 4EWTA 1Q79A 1QY7A 1T03B 2ATCB 4WIQA 4YY3J 2V67A 1VJQA 3MM9A 1R8HA 3GG1A 4DS5A 5J2NA 2HMIB 3MURP 2Z56B 1Q82T 1JLFA 3Q8PB 4WJBA 1ZBTA 3FEXB 1NDLA 1R0AA 4X65F 1VRTA 1OQ6A 5E3RA 2HZCA 4PUOA 2BKOA 3H20A 2CYYA 2XZWA 4DG1B 1EX8A 4DV5J 4G65A 1U0HB 2XYHB 1VQ6S 1KDNA 3Q89A 1YJVA 1VQYA 1KN6A 5IZHA 1RT5A 3O5TB 3M8SA 4LSNB 8ATCB 2HAFA 4DV7F 2VPYB 1T3OA 3ZTRA 3HHDA 5KFPA 1Q86T 4QWCA 3Q24A 2W4DA 2F7VA 1XJWB 2G2OA 3MPYA 3MEDB 4YB5A 4YB1P 4UW2A 4F02A 2PFFB 4NLVA 1F0XA 4KJIA 4OYXA 2AD9A 4MKYA 1VC6A 3VF0B 2WBRA 2VOPA 4OI4A 4P75A 3SCKE 5KG7A 3KK3A 4FYWB 1PYOB 2DCLA 2AYMA 2XBPA 2ZH6A 3M8PB 1DLOB 4E8UA 3D0GE 3PG9A 2WOMA 2HS3A 3DRSB 4TNOA 3IAS9 5KT6A 2Z2LA 3PW5A 3FBEA 3UDVA 1DRZA 3LW5C 2CQ3A 4URGA 2HK2A 3KTQA 1NKCA 1FRIA 5BJRA 3G9CA 1ZAWA 4F3OA 5L1JA 4J9PA 4B3RF 4F4ZA 2CG4A 4G1QA 3D7SB 1HBOB 2HNZA 3DHWC 5CYJA 3NMRA 1S1TB 5DLFA 4EI2A 1IQTA 5E3QA 5J1EB 4GMKA 3N4WA 2BM1A 1BGXT 1TKDA 1MN7A 4DUTA 5F8JA 2H4YB 4M63A 1AUDA 2KT2A 3AJDA 3M9OB 2RD5C 1U1KA 3Q8SB 2K1RA 2UU9F 4UF4A 4FBTA 1SH0A 2GO8A 1N36F 1TVRB 1S10A 1HNWF 3CJ4A 4J90A 1RAJA 4ED6A 3NG8A 4DF4A 1U8SA 1ZAXA 2F40A 4DL6A 2YNHB 1KLMA 3DOMB 3FQKA 1QVFR 2IYGA 2H4WB 3PM9A 2IHR1 3D1QA 3QGPA 2QLXA 5H9FK 1HW8A 4OLOA 1NDPA 2MZRA 1B0PA 2Z2ZA 5KFBA 1QAYA 2F9DA 2A6OA 1HKAA 3HHNB 4CNZA 1REVA 3KLIA 4HR2A 3B4DA 2OPPB 4F7VA 5H9EJ 4QYRA 1UL3A 3BREA 4M5GA 3TQ1A 3J7ZT 2VZ9A 2J9DA 4B3MF 4X4OA 4DSKA 1S6PB 2LCWA 3BPDA 1S1UA 2RRBA 1E6YB 1XIQA 3BBCA 1FNMA 4LF2A 4USHA 3NCPA 2AX1A 1OSDA 4D3HA 4QWAA 1IJFB 2Q1LA 3TZXA 2ZHBA 4DFKA 1UFLA 3C46A 5HROA 1Z4UA 4IKAA 4ELTA 1ZZNA 1SV5B 1HNZF 4KT0C 2KDOA 2QIFA 1RHJB 4I68A 3I0RA 2M7SA 1NUEA 3GMGA 5K8MA 1VQ7S 4MFBA 3DN9A 3M7VA 3SCJE 2DNPA 2VQEJ 1H0HB 1NO8A 1SXLA 1NJXA 4U67Q 3TP2A 3VQTA 3DRPA 3R5AA 2MZTA 3BH7B 1I94J 1Q8LA 4QOTA 1S7IA 1PIEA 1HI1A 3DNCA 3D54A 1WNEA 2WSFC 3UNYA 3J80U 1HHTP 1VBXA 4ILMA 4CTAB 1RT2A 4OJ3A 2KM8C 4LF6J 4E0DA 4P9SA 3TANA 4LF1A 2UVVA 3ZZPA 3H4DA 2GQCA 3RBDA 1RT1B 2F4VF 2CZVC 2A6MA 1HQEB 1JLEA 2BE2A 1GMWA 2GMJA 3NOGA 1NSQA 2ASLA 2WHOA 2JVRA 3R97A 1HIYA 5AT1B 4IH5A 3PX4A 2EFGA 4BC7A 4NLOA 2E5JA 3T19A 4NLWA 4K4UA 4RW9A 2DEIA 1DTQA 2H3EB 3GIJA 4DV6F 4DEZA 1Y0HA 4OJ1A 3GFXA 5KFEA 3NOCA 3BBFA 5DJBA 4YB6A 4B3SF 3NBPA 1RT6A 5KFUA 5HQ8A 4DR2F 3AJ1A 1SL2A 1PAUB 1SC3B 1WC1A 2B51A 4DCPB 2GMHA 5D6GA 4KH1B 2DY1A 2M88A 3P8BB 5A8RB 3CCUS 1U1QA 2KFNA 5F41A 3RGIA 1ITPA 5CD4H 2DR5A 2UXCF 3UQSA 2YWGA 2V8HA 4NLDA 4HHJA 1FD8A 1N48A 1VLYA 1RWWB 1W2BR 4ZN1A 4CO0A 2FLLA 1T11A 4F0HA 3CCSS 5LOQA 3D1OA 4AFFA 1LXJA 4DG1A 4TU9A 4HL9A 3HVAA 2NUUG 3W63A 3FSYA 2XB2D 3KJNB 4DV0J 3E8OA 1S9FA 4DL2A 4NRUA 4LSNA 3I5BA 4F4AA 1D9DA 1TFWA 2IVFB 2K06A 2JEGA 3W5YA 5A76A 1TQLA 4RUAA 4RNMA 3WC2A 1TL4A 1VOMA 3QAUA 2W2NP 4X65J 2NS1B 1KVIA 1N4LA 2V0NA 3GCXP 3MEDA 3CJQA 4ZPAA 3X3UA 3FFIB 4JI7F 5E0OA 4RW4B 2MSTA 4B08A 1UFWA 2ZOGA 4C8KA 2IC3B 2HW3A 5ETLA 3M8PA 3BEGB 2Q3PA 2ZOMA 1R27B 2DNRA 1QUVA 3M1VB 4WZMA 2AYGA 5RUBA 4PWUA 3CCMS 3DRSA 2MGZB 2P5VA 1RBOB 3EGWB 3W66A 1S1XB 3PFEA 1R6YA 5DG7A 4O3OA 5KFKA 4ZN3A 3CTRA 4DR3F 2BACA 4TY9A 1HBOA 2IAJA 1VRUA 2FD2A 3TAMA 5I3UB 3VZIA 1N34F 1S0OA 2B9EA 3IS9B 3PX0A 4RL1A 2DB1A 1MROB 2DH7A 2XM3A 3UPFA 1YQHA 5IT9U 3DLLQ 3PXGa 3UFCX 1WG4A 2Y1JA 3PW0A 4ZS6A 1WDDA 4QBUA 3P49B 2V9KA 2W8LA 5C7PA 1U8WA 1IVZA 2RHSB 1IBLF 2HWTA 2VL1A 2M9KA 5HI7A 3BM7A 1WDTA 1NCLA 4FYXB 2ZZTA 1PILA 3BKTA 2GIRA 4M5IA 1YJRA 2ZUAA 4B3OA 5K9FA 1FFGB 3S1TA 1ZH5A 1M5OC 1N52B 3K17A 3SXLA 1FJGF 2FB0A 3HMJG 1S6PA 3CJ2A 3EGZA 3QRQA 2X3GA 1YBAA 4CM2A 5HP1B 1VISA 2APOA 1V3RA 2JJ4D 2RUGA 4AXIA 1BQNB 1UCNA 1BHNA 2GHWA 2HQDA 4JP8A 3VALA 1JXEA 4Q43A 1V9OA 1WEXA 5E3PA 1UWBB 1IM4A 4C8OA 2MQQA 4ES1A 1Y5IB 3CMQA 2KH9A 3HVTA 2NSBA 4JV2A 4Q0BA 2RU3A 4C9DA 4IQMA 3W3SA 2R7QA 1HBUB 1ROFA 2HEKA 4LSZB 4OV6A 5HBMB 1UVLA 1YBUA 4CWBA 4CH0S 1V5VA 1N0UA 1FKOA 4JI3F 3TEHB 2MY8A 3EXYA 1NK0A 3ZNUA 1D9FA 2BQ3A 2BE7D 2ZFHA 1EP4A 4ZLPA 1FA0A 3SQOP 2ROEA 2I2YA 4IR1A 2YX7A 5KAKA 2HQCA 1KVKA 1FXLA 4LVOP 1RT1A 1H7WA 3L7UA 1HQEA 5DGBA 2KFYA 3FEZA 4F26A 1XR7A 2F5GA 4P7VA 3SZ2A 4ZPCA 2L3MA 3HP6A 5I42A 3RB3A 1N5VA 5J2MA 2RS2A 2F3JA 3OL9A 2MZJA 3SI8A 3JQJA 3Q8UA 1K73T 3J80Y 3TAPA 4CI0B 3TJAA 3OBIA 1LFPA 3ENVA 5JJBA 1HQUB 4LRDA 1YZ7A 1QE1B 2HS0A 4DJBA 2YWKA 1KWMA 1S97A 3MZIA 4OYIA 4HI2A 5EWEA 3K5NA 2LMIA 4M5LA 1K0VA 3OTBA 2ZH3A 3P5BP 4CLTA 3MAQA 4NMXA 4DSIA 2NXCA 2OPQA 1DTTA 4NLGA 3OTCA 4ZHRB 3NNHA 2ZH9A 4GVLA 1T9XA 3FQLA 4ZVTB 3CEDA 1T9WA 2M8HA 1CLFA 3UDEA 3IBFB 1N6QB 4B3SJ 2VJVA 1VC5A 2VU5A 1L3UA 3FK4A 1VQNS 2HPUA 5EUHA 1SB6A 3PW4A 5CA5A 2KN4A 2XYGB 4JV5F 1IXKA 3NLCA 2BEFA 2QA2A 4C2MA 3UCGA 3IMQJ 3CD0A 1RTJA 2JLGA 5A8KB 2YNIA 2M4MA 2CNNB 1IUJA 1JLCB 3M8WA 2FGCA 3R1LA 1WI8A 2B9XA 5J2PA 1UJ5A 3A1YG 1FWKA 3JTPA 1WJ9A 4OHYA 3F44A 2PMWA 4Y3CA 1XQIA 2U2FA 3K2YA 5HSPA 2W7AA 1JK9B 2G1DA 2IRXA 2MGZA 1XBWA 8RUCA 3M2RB 2FHKA 1PYSB 1TL3B 2I38A 1S1WA 2ZDPA 3K5OA 1YSJA 2NREA 2MZQA 2W01A 5CXTA 2IM0A 2JDJA 2PMHA 3TX8A 2OH2A 2VG6B 5AJ3J 2GVDA 5A2QU 2HK3A 2CDRB 4ZLJA 1UJ4A 3TA2A 2GFFA 1TV6B 2AQ4A 5KFZA 3LP0B 4W98A 2XWXA 2D9PA 4CLWA 4U7CA 2PA3A 3RAMA 4I67A 2IMOA 3H8YA 1GMVA 1EETB 5ETVA 2DNMA 2ZNYA 1Y4ZB 4L3KA 4ERDA 1IKYB 1UMJA 1F2GA 4MH8A 2XNQA 4YR3A 4HH1A 3V4IB 4HACB 1SCJB 1UEUA 2DKOB 2KTQA 5T14A 1R7IA 3OXGA 4ZJLA 1GK8A 2DGSA 4CLSA 1F5CA 4J9LA 4KGMA 2NSCA 2R8HA 4DR4F 4F4XA 5IQ6A 5E2QA 5HVGA 2DPJA 4RW8A 4FPRA 1J5OA 3B78A 4DN0A 1WSRA 4O4GB 5IT9Y 3ZZOA 5E41A 5HMWA 2AJ1A 1YLXA 3EXCX 1Q7YT 3KUHA 1F2HA 2OEJA 1NBEB 5KT2A 4X4NA 4DU8A 5KG4A 4RBUA 1UETA 3GFHA 1SBRA 1YDLA 1T9TA 4OZ0A 3HHLC 1Z2ZA 2BW2A 2BJEA 3Q0AA 1ZPWX 2QA4S 2B4UA 7FDRA 4CM0A 3HFVA 2OKQA 3AXMA 3SCIE 3DLEB 2CNOB 1TP7A 5KFTA 3DOKA 4DUZF 3G86A 1VBKA 3ZZYA 2ERRA 3D2WA 1CJUA 3IG1A 3LP2B 2CQIA 4PXBA 4DX8H 1UPPA 2DRAA 4FBUA 2PT0A 2GNKA 1F9FA 3ZZZA 1HBUA 2B9YA 4I0WA 3H90A 4HLBA 5DDRC 2AF6A 4C8NA 1XMOJ 2HVZA 1LWFA 2VFVA 3MI7X 1RLDA 2XS5A 3D3BJ 4WP3A 1S6UA 2ATLA 3RU0A 4R5PB 2ZM6F 2RRNA 3MR2A 3MR7A 3DI6B 2QE5A 4DL3A 2HS4A 2XWYA 1QSLA 2G0JA 4PWDA 4O3PA 1N33F 4FF4A 2A2CA 3M30A 5KT7A 1DZ5A 2EKYA 3MEGA 5G0RA 3DXSX 1LW2A 3B54A 4XDDA 1XNQJ 5KFNA 3VVTA 3KLFB 3OXLA 5D15A 3VAMA 3POTA 5BR8J 1OO0B 2Z2MA 2Q6CA 5AXNA 3KWMA 3W2VB 1HBNB 1Y7PA 3DDKA 4FN5A 6FDRA 2LU1A 3UWTA 3VAKA 2VQFJ 1X31C 4X2BA 3CVKA 3PFOA 1J5EF 1RWNB 4PR6A 2YKNB 4ZPVR 2KVQE 2PA8D 1U1NA 1RK8A 1FWLA 1QE1A 3BS9A 2JWNA 2WAQD 2PGCA 2CQ2A 4R8UB 4WFXA 1OY6A 3UD3P 3HXMA 1JXLA 1RAIB 1B3TA 3NAHA 2BRKA 1FE0A 3BR9A 3AY0A 1C0TB 1WC0A 2NZCA 1F5AA 5LXYA 2CFXA 1E6VB 3VGSA 1YK9A 1OY8A 3BN4A 3IWNC 3ENAA 1PAEX 4X62F 4DPOA 2X3DA 2VPZB 4OI0A 3C14A 3PKYA 1GNKA 1I1GA 2DTJA 2DNNA 1J27A 4MTPA 1AB8A 3G82B 1KS2A 4M5DB 3N28A 3QGGA 3IN5A 4ECZA 1HWKA 5D0GA 4WPAA 4NRTA 3RRHA 4FF3A 3BGFA 3GYGA 4I7FB 4OYPA 4DR6J 4OI3A 4GKKF 5AE1A 2RMLA 3BQ1A 4NLUA 4DR1J 1RAOA 3EYZA 4V1Ak 3HT0A 3QLHB 2VASA 2FHMA 3I5AA 3WZ0A 4ZJOA 3NS5A 1PKUA 1M5KC 1JLCA 3BB5A 3R8YA 2ZC4A 1G3OA 5D4LA 4OHVA 4TU7A 4KE5A 5B7WA 3BGRB 2E5LJ 4K4SA 2IBKA 1HNXF 2DO4A 1CS4A 4DUYJ 4TQSA 4FYVB 3E51A 2ABYA 4IOBA 1C1CB 2L48A 4WE1A 2AKWB 2ACYA 5L1LA 1V3ZA 5A6WA 1VCTA 4FVCA 3W9IA 1S6QA 2AGOA 4JUZA 4K4VA 1RTDA 3G6XA 5FDLA 1U25A 4JV5J 4H4MA 1NEEA 2WW8A 4JI5J 5K14B 3M2RA 1PC5A 1KEKA 2DGQA 2KVIA 2VBZA 4K4TA 1S79A 4XPEA 1RTHA 2ALYB 3VAJA 2P8IA 1IKXB 4EYHB 5IM0A 4DLEA 4ID8A 3BKUA 5B09A 3DLHA 5LJ5Y 1U24A 3GSDA 4MIBA 1VQ8S 1H2VZ 4ZVEA 1B64A 5IC6B 2OSQA 4W90B 1F9EB 3MR5A 3LP0A 3GP9A 2XSJA 3ULHA 2FTRA 1HBMA 1VI7A 1JLAB 4DPYA 2WBMA 3KKFA 3R5DA 3ZTOA 1MW7A 2KFZA 2Q79A 1EETA 2A3JA 2E7VA 3G71S 3PTWA 3OFGA 3PACA 5CZVA 4QZVB 1VDHA 3MPVA 4DFMA 4I6AA 2D9OA 3CXCR 2VBYA 2RU9A 3M2UB 3V4IA 4AL7A 1GTHA 4C11B 5A2QY 3EDRB 2VBXA 3JQMA 3M8RA 3AOBA 3QJPA 4OYAA 4NLQA 3MAHA 4A46A 4DSJA 1D3WA 3R6LB 2PDAA 2BA9A 2F8HA 3CO0P 4JI8F 4O4GA 3HSJA 3UE2A 3BV8A 3GFZA 5KFMA 3H2VE 2IBOA 4NA3A 2GW8A 2R7XA 2UXDF 5H1SV 1SUQB 2VDIA 2JEIA 3GJQB 4IH6A 3ISND 4LBPA 2NR0A 2MKCA 1WOPA 2BJ8A 4UZBA 4JI2J 1YJ9S 2FJDB 1TKXA 1RYRA 4M5NA 3HHLD 4KSEB 3DLEA 2H48B 3H25A 1TZ0A 4J9VA 4KC5A 3HK2A 4KIAA 1WC4A 3EICA 3V2UC 4ECSA 2J7UA 5MAOA 4KFBB 4DR4J 3DYAB 1K47A 3G8QA 4IO1A 1VYAA 2GGPB 4DMZA 2DR7A 4QIEA 2M3DA 4OHWA 2YTCA 1WF2A 4AYBD 2LYVA 5EX0A 3JSMB 2EG1A 5L1IA 1LWEB 1P9YA 3D4JA 2AGQA 3KHLA 1XMBA 3GPAA 4ITSA 1FKPB 3K59A 1YTYA 2ASDA 4O3NA 4JI6J 4CH7A 1O5JA 1N32F 4LFBJ 1HPZB 2B5JB 2W2PP 4R5PA 4NYPA 3MMBB 4K8RA 1LK7A 3H7HB 5AE2A 1U02A 4DUZJ 3KUEA 4Q8FA 1KVJA 3QT6A 3SBMA 1Q53A 1TAQA 2IVMA 2DRBA 1D8YA 1M1GA 1EHWA 4V19J 2FZGB 2HGMA 1OS5A 1NJZA 2KXFA 1X5SA 4RPFA 1FDDA 2PE8A 1LW0B 3IA0A 3TQEA 2KJWA 5F8NA 4A4JA 3FRZA 1QAXA 3T1YJ 3OUYB 1U09A 4BHQA 3V6DB 4QU6A 4DV1J 2L9WA 4O4RA 1Z2LA 1YZ6A 5D4OA 3THTA 5ITHA 4O23A 4ER8A 2EFPA 4CIOA 1X9SA 3ETOA 1FJEB 1NK9A 1U1LA 2Z0GA 4OZ5A 4FPIA 3V6HA 4C3KA 1XR5A 4K0KF 1XMQJ 2GJIA 4RUCA 1RGVA 1IM6A 2OLWA 3A8JA 4ES3A 3R7BB 2P9EA 4R8UA 1FF2A 1W26A 2LDIA 4X84A 4USIA 2A18A 3TR5A 4EBCA 5KFSA 2X1AA 1C0TA 2KL8A 3MGJA 2AV5A 4LQ3A 2Z30B 4NXMJ 1X5OA 3ILLA 2N3LA 4KGZB 4OMFG 2C1EB 2O01C 2K8GA 2DNOA 2JZ5A 3M05A 4NZ0A 3EVMA 1NPKA 1FRKA 4Y65A 4CP5A 5K20B 2N82B 4M5DA 2FHOB 2XGPA 3IRXA 4ZJQA 4P73A 3UCUP 3A13A 4PZVA 3K8WA 2IVYA 4HVZA 4X64J 1TUWA 4KQZA 5HL7Q 4LF5J 3D0HE 4IR9A 4AQYJ 4ES2A 3ITHA 3QLHA 1RTIA 5HMZA 1CJVB 4P7TA 1F1BB 3OTDA 4QR0A 1HW9A 3CCES 2OPRB 3PY8A 2NYIA 2J6SA 3CDEA 3CSKA 4UOCA 4KHMA 2VG5B 3BGRA 1FCAA 4YDDB 4EMDA 3DLGB 3OFFA 4RLEA 3I56S 1U1MA 1EKRA 3TUPA 1C1CA 5LL6d 3MECB 4USJC 1GXTA 3BH6B 2L41A 3MR6A 1Q8IA 5KFQA 3AODA 3FKBA 3QYYA 4F8RA 3BQ2A 1KFSA 3PR5B 2X1GA 1A6LA 4WFZA 1H98A 1U1RA 2FY1A 3R5JB 3RB4A 4L6V3 4UUWA 2I5JB 4EYIB 4WCEQ 1K0TA 3K89A 4CYUB 3ZTQA 5DDPC 2YQ1A 1RI7A 3EE3A 1DHMA 2NCKL 4G6VB 1RHUB 8AT1B 2LXIA 4L74A 3DLJA 3US5A 3KLHB 1Q8KA 2WW4A 4TXSA 1TMMA 2HNDB 3GONA 1OWXA 4NWBA 3KLGB 2WSEC 3NS6A 3GR0A 1QVGR 2CQ0A 1P8GA 2NPIA 3LWMA 1HD0A 1U45A 2HGNA 2IA0A 4C11A 1X0FA 2AJ0A 1FDAA 1U26A 4QU7A 3HKWA 2VIHA 5HLFB 1CJTB 1WOOA 2GAGC 1F5BA 3BQ0A 2WVBA 2X7IA 3BSAA 4WWSA 3B6BA 3SFUA 4C4WA 2JNJA 4PAAA 1S12A 4ELVA 1BC6A 1K1QA 4ED1A 1URNA 3NS7B 1NK8A 2ZC3A 4KGXB 4ILLA 3CT9A 2U1AA 3HZEA 3MEEB 1U4BA 3F41A 2C2RA 4EO8A 2O67A 2AGPA 4ECYA 4WP9A 3W8GA 3M9MB 3PW7A 3HZGA 3H0PA 2OHDA 3CPWR 2ZWPA 4KFBA 2WK4A 1MMDA 1WKJA 2AX0A 3R7NB 4EU0A 4LF9F 1S1VB 1LKZA 3VAHA 4F3MA 1SQGA 4P72A 5E3AA 4YY3F 5F9LA 3GIKA 5EHHA 5E7OB 2KRBA 2XMMA 4PQUA 2G9OA 2OO4A 5KFVA 1S4FA 1HARA 2EC2A 2W7PA 4NE9C 2CQGA 4LT6A 3NL0A 3Q23A 1LWEA 2CPEA 1EKSA 4A48A 3S8SA 5SZTA 2ZZNA 2PN6A 2MKSA 3HHKA 5B0BA 2R4FA 2ZE2B 2DGWA 4DV5F 2B5JA 4IOAQ 2P9GA 2ASJA 2ZNZA 2KZMA 2JFKA 1KQFB 3D6HB 1RB0A 5C42A 5I3PA 3G8SA 1RQ0A 1IBMJ 3JXOA 4ECXA 1V5IB 2ZZMA 1IKWB 3MM9B 5J2NB 5HQMA 3JAMU 2GIFA 2OJ3A 1LW0A 2JOQA 3VAGA 4PYDA 3OQ2A 1EAYC 4KB7A 2F4FA 2K2PA 1VRTB 1ZM9A 2QTWA 3B4MA 4PUOB 2BJ3A 2HFUA 3T1HF 1XWLA 3ADAC 4TVAB 4DCOB 2IJFA 2E7WA 4F4WA 3DLKA 4PKDB 3MAAA 2E1PA 2MLZA 4IFVB 4DDFA 4NCAA 5C24B 2OD6A 4P71A 4N77A 2V63A 1RDRA 1TK8A 1ZETA 1NKEA 1RBAA 5SUHA 2ADCA 2BQUA 5DQIA 3NNCA 1PJ7A 1X5PA 5DZ6A 4F50A 3CDUA 2AW0A 4K5RA 5CYQA 3AH6A 1EIYB 1VQMS 4WK1A 5CABA 5J1NA 1ZTTA 3CC7S 2RH3A 2YNGA 2UUAJ 1YRUA 1RUSA 2NXEA 3A8EA 3UVJB 2HVIA 1WTBA 5B0GA 4AXJA 3EVWA 2HBYB 4I2QA 4CLLA 2H5IB 2MPUA 3IBCB 1CJKA 1G1XA 4Q44A 1V3SA 2BR0A 1LK5A 4BDPA 4MK7A 3Q8YA 3KK3B 3KHGA 1OYEA 3K5LA 5F8HA 3F73A 4DQSA 3M6XA 3JSRA 3MUTP 3DRXA 4QWBA 4KYZA 2AEMA 3KNGA 2ZBIA 2XTJP 2NLWA 2R7OA 2NYHA 3I6PA 1UVMA 3PYDA 4URQU 2HHHJ 3QQCD 3C66A 5JXSA 1GXLA 2MQLA 1UTAA 3I96A 3C6UA 2JLFA 4F0KA 3KMQA 5H9EK 3ILJA 1CJVA 1YVFA 4G1QB 2NUHA 1NJYA 2HNZB 2L9NA 5KFRA 3THPA 2OPRA 4JI0J 3BBBA 1N56A 2ACMA 2PSZA 1YRTA 4LRBA 2VG5A 4YP3A 4DZ6A 1ELOA 2V50A 1K8AT 3CCVS 1QTNB 4DV2J 2J6TA 1FO1A 2HHPA 5ETTA 2K1RB 2PI4A 4I1TA 4FS2A 3AT1B 3C6TA 2PIIA 3MECA 4DLGA 2RQKA 2HG4A 4DPTA 1NU4A 2CJBA 5EWGA 1WOSA 2DR6A 3OL8A 3KOAA 3PHTA 2N3OA 4ZKAA 2P9CA 2R2TA 2H5JB 4NL5A 1Z1ZA 1KLMB 1TU0B 3I31A 3CE8A 2AU0A 1FI4A 2YKPA 2C2ZB 3OJUA 1HWLA 1RZMA 3MM5A 2HAIA 4ZVUB 1RWKB 1MN9A 3M6WA 4KPYA 1UVNA 5GAHI 4GKJJ 3TEGA 3L4BC 4ETZA 4M5MA 2I5JA 4TLQA 1REVB 2OPSA 1ZS6A 2YKOA 5T41A 4C48A 3FBCA 3IBWA 1R0CB 4PPZA 4CYUA 3PO4A 2G4BA 1UKUA 2VQEF 4ETXA 2BKPA 2J8AA 4NLTA 3R5CA 3KLHA 2HHVA 1N88A 2OI2A 2ZKUA 2ZBPA 3IFEA 3FMWA 1VR6A 3H59A 1I94F 2VONA 1TL7B 1Q7LB 4PG5A 2LFVA 2X51A 5HROB 2XMVA 4NEZA 1UFKA 3G2XA 3CDAA 2HWHA 5ETPA 5KTQA 2AZ3A 2ZUGA 2XS2A 2ASYA 3QAEA 1KFDA 4LF6F 2V4QA 3KLEB 2QL7B 5HLFA 3HD1A 1MWZA 2Z4PA 2MJNA 4MFBB 1Y5LB 1JLBB 2D3UA 5CAAA 2E1RA 3MM7A 1NJWA 2I1RA 1NAQA 4OIXA 3GYXB 5BYQA 2K3IA 1RABB 4J91A 3CMES 2KG1A 2V2KA 4DV3J 4ED8A 3MEEA 4HHUA 1ZPVA 2XG8A 4C8YA 2CNKB 2J7WA 3LP1A 3QT8A 1VHFA 3GIIA 3T5JA 2DGOA 3IR6B 4N76A 2HKEA 4OX9J 3OR1A 4DI6A 1N0VC 1RT2B 5GAEI 1C4AA 4ZMMA 4YR2A 1UWAA 3O3LA 2DJWA 2FZKB 4CDIA 7FD1A 3J7YI 4J9NA 3PW2A 3DM2B 2DIVA 4OL8A 1IKVA 1VQSA 1G7CB 5HATA 2V4JA 2HWIA 1UVJA 3KK1B 4A8MP 4QCLA 1Q1KA 2QLBB 2ZBQA 4OJGA 3NGUA 3GV7B 2HHQA 4RW9B 3IC1A 2K3KA 5KG1A 2BJ7A 2CNLB 3BSNA 2CA9A 3D66A 3HHLA 1X60A 3NWGA 2ZBCA 1WG5A 3HSGA 5ETMA 3NBPB 4DV0F 1RT6B 1RT7A 5B0EA 4MK9A 4OZLA 4LSLA 3SSQA 3E2EA 4LF9J 2CZ4A 3PEHA 2N7CA 2EPIA 2CJQA 3N6MA 1IKWA 4HH0A 1LOUA 2WVDA 4NXNJ 3IWXA 4HEA9 4Y2KA 2FLPA 2RSQA 3L09A 2EWHA 4C8LA 1BY9A 2NPFA 4AD6A 3CJ0A 2Y8WA 3TVKA 1AZSB 4FYDA 3R9LA 2RUSA 3W60A 1H38A 3Q2SC 2O66A 2KRRA 4ZPDA 3I9V9 1D0EA 4IFVA 1U47A 4QYZK 2QZ8A 5C24A 1TFYA 1FNOA 2CWXA 1V6HA 1WACA 2V8VA 1FXDA 2Q66A 2A10A 5F8LA 4O0IA 3T5HA 2WVFA 4WKYA 4IRCA 4M8LA 2N4DA 3JAMY 3BGUA 1U6BA 4NZ6A 3D6MB 2R8IA 2WTFA 2X1BA 3HX9A 1X4FA 4GRSA 2CZ9A 4CCHA 5A0YB 4N8OA 4I2PA 4MKVA 4ZVSB 4BBYA 4QQBA 3UVJA 3MCNA 2KB2A 2EXUA 3UCZP 2OAUA 5ETKA 3BO4A 3TVYA 2E1CA 1RA6A 4M5HA 2UUCF 3DDIA 5HVHA 5KG6A 3ZNJ1 1AXQA 3GV8B 3T1HJ 3CDWA 3Q83A 3CUNA 1VRQC 2V8PA 3R5BA 1JLQA 3KJFB 4ILRA 3G4SS 4L3NA 3UDLA 3WQPA 3CF5Q 1VFJA 1N5TA 4KV8A 3VTIA 3UNGC 4ED7A 4MYUA 4JYAF 1TTHB 4DL4A 3VV2B 1CQMA 1WD6A 1U2RA 4LRFA 4MKBA 2DISA 2BANB 3D5MA 1QTMA 2LU2A 5KOWA 3S7RA 5KFDA 2VFRA 1N5QA 1OSCA 5I3QA 2B8PA 4LVNP 2HVHA 4WTYA 1FDBA 2IAJB 2YWFA 1VRUB 4RX6A 4RU9A 3A3OB 3TAMB 3I4HX 4DF8A 4H4KC 2EBGA 1SC6A 2L08A 5J1PA 4IH7A 5LT5A 2EEYA 2I0XA 4U8VA 3CJ3A 3TO8A 2R2SA 3UN5A 4RKUC 1UZDA 1KRPA 2OTJS 2V6AA 1MU2A 4L73A 1GTEA 4PWWA 1FERA 1BUXA 3P45B 5B0AA 4PPDA 1RBLA 2JVOA 2B4VA 2LEPA 3SSSA 1I6JA 2KT5A 3CD6S 1S49A 5IS2A 5F8GA 4UTGA 3C2PA 4P6QA 2UUBJ 2HQIA 2OEMA 1FJ7A 4QWEA 1QUPA 1VK3A 1W2IA 2A0FB 4B3OB 2RIJA 3H4BA 4JV0A 3AA9A 3WX8A 1KP6A 2LXFA 2V2VA 3D6FB 1FK9B 2DCUB 2JL9A 4DV4J 4WZQA 2DHAA 3BF4A 2J0XA 1GT8A 2XMUA 2MKHA 4NOHA 2VHGA 2MLXA 2QL5B 1TL7A 1KOOA 1S9GB 4KO0B 4L75A 1S9EA 2UXBJ 4N5SA 1NHUA 1MLAA 2QX0A 4BS2A 3RR7A 1U6ZA 2V2ZA 3KLEA 2GHVC 2LQ5A 1DARA 4USWA 3QRRA 1JNZB 5KFJA 1G2EA 4A8SA 3JB9k 3I32A 1JLBA 2CUYA 1FRHA 4Q8EA 3HVTB 4Q0BB 1NSPA 3BGLA 1MNEA 1JJ4A 3G6YA 1MMLA 4AL6A 2HSEB 2XMWA 1EQMA 3IR7B 4LF4F 2PFDA 1FKOB 3KG4A 1FEHA 2M70A 2GO9A 4ANEA 2LQBA 1WHYA 3TW0A 4OHXA 3PNIA 4F4KA 3EMTA 3ENWA 3BDEA 4RW7A 3MHYA 2AYBA 4KGKA 5HMXA 2DR9A 3O2IA 4MKAA 1EP4B 2AMCB 4ZVFA 3D3CJ 5KFAA 2VBWA 4Q7AA 4M5JA 3DM2A 5EN1A 2AJFE 1S6OA 2HNYB 3UN2A 3N01A 4M94A 2UUTA 1Y9OA 4ZCMA 1NB7A 1JB0C 5I42B 3MCOA 3RAQA 5J2MB 3KK1A 4W4MA 2XCPA 4K5SA 3RZAA 4YB7A 5T7LA 4YOEA 4CO4A 1IR1A 1PG5B 4TQRA 1YI2S 3EM1A 3GJRB 1RWMB 2ZHOA 2FJXA 3I5CA 2HVEA 2MQPA 3AD9C 1DBDA 3CIZA 4RU2A 4NX9A 4Z7YA 1H7XA 2IJRA 2WB1D 1HYSA 5K5MA 1L3VA 4ZOSA 5U47A 3TOQA 1D9AA 1FRLA 2PO4A 3I82A 4DR7J 3BSCA 3MD3A 4OYMA 4ZCIA 4WFAQ 2J9EA 3LQVA 2OPQB 1FNXH 2H1YA 2J0SD 1LWCB 1DTTB 2KYZA 3OVAA 1AZSA 3ISZA 3OSPA 2DXFA 4CLYA 4LR9A 1PSDA 4ZCLA 1RAFB 2BW7A 3QBCA 3SQGB 5CZXA 2COLA 3D0IE 1VK8A 4FVMA 3DXBA 1S0NA 2R8GA 4LJMA 2CPYA 4O44B 1LWXA 4N41A 4PXDA 2CJYB 3UD4P 5A0YA 3K7RA 2HZVA 4J9OA 2BABA 1RTJB 3EDQB 2NQPA 2YNIB 4ECVA 2ZH5A 5LXRA 2YH0A 4DPWA 5FLXU 2XQCA 1S76D 4LIWA 4KTQA 3WBZA 4KPCA 4EGLA 3Q8VA 3SFGA 5AJ3F 5J2PB 1H3DA 1J2VA 1TELA 2J5AA 4HHHA 2G13A 4YHHJ 1KTQA 5M2RA 3RRKA 2WVEA 3VCDA 2MHEA 4IUFA 1FT8A 1R3NA 2C22A 2B6AB 3M9NB 2HURA 2NXUA 1B70B 4RW6B 4O3SA 1OJ4A 1CULA 1G4CA 1VC0A 4GVBA 5GADU 4QYZJ 5DDOC 1RKIA 1LXNA 2BANA 1GFWB 2LECA 2MYFA 1S1WB 1IBKF 2HRYA 1SQEA 1K1SA 2FVCA 2UUCJ 5IXUA 4LF8F 3D28A 3MF5A 2CQBA 3OJSA 4ZCKA 1DAXA 2HYIB 2GVDB 3DGPA 4LQ9A 4X4RA 2BX6A 2LQ9A 1IR0A 2QL9B 4FXWA 4NPOA 2IFXA 5DO2A 3TVZA 1CC7A 4P2FA 4F25A 4WK3A 1HQ2A 2IIHA 4CLFA 3MFHA 2QYGA 2CADA 1NK7A 3JQKA 1VQLS 2DD8S 2R42A 4OHZA 3IM9A 4JYAJ 1WI6A 3OVSA 4PQAA 3I87A 1MMNA 2EKNA 1QD1A 3QMQA 2LA6A 1Y00A 3H5XA 1JX4A 1W7WA 2DNKA 2E5HA 2H51B 3PJWA 2PD1A 4BWJA 2ADBA 3WIUA 1FEEA 4OX7A 4RW8B 4WTOB 1J5OB 2J6UA 1SVDA 1HFEL 3NEKA 2WRMA 1AW0A 4K4XA 3EWGA 4O3RA 1H74A 3LA0A 3DOLA 1HD1A 2EFOA 3HI9A 3BO3A 3CJ5A 1RKJA 1SKWA 4PG7A 2BZ2A 1FK9A 1ZA1B 1Q81T 4FF2A 4KHRA 1BMQB 3UN3A 4C0OC 3CMAS 3JYTA 3U1MA 4BC9A 3CC2S 5D0HA 1XMOF 2EG2A 4RNFA 1JKHA 5HJYA 3TARA 2A1BA 1KQSR 2GHPA 1DY3A 5KFXA 1S9GA 4KO0A 3OV7A 1KTVA 1SL0A 4WF9Q 2R7VA 3DOKB 4NI2B 4S0MA 3HM9A 5K8PA 2VC1A 3MMCA 5GMEA 3LAKA 4ED5A 3ET6A 3A3PB 1CJUB 2MQNA 2D69A 4DQIA 1IWGA 3IG1B 1KR4A 5HJXA 2BDPA 4C8MA 3TUJC 3NAIA 2DVIA 2GVZB 4Y6IA 1BD6A 1XNQF 5DQGA 3IR5B 1RU1A 3VAFA 1RT3B 4U8YA 1NM2A 3O1LA 3QO9A 5A8WB 4Y2CA 3VZHA 5BR8F 5L1KA 1QSSA 2E29A 4LREA 1LWFB 1SKUB 2AHOB 3IP0A 3FZ2A 3EZ5A 1B0TA 3NRBA 4KKOA 1JJCB 1HWUA 2VQFF 2HFZA 5K8OA 2B7BB 4FNHA 1B7YB 5IT0A 4FKXA 3RW6A 2IY5B 2V4RA 2IA6A 4PWDB 3U1NA 2DGUA 1N5YB 3M30B 2O5DA 3I55S 3LALA 2HNYA 3MEGB 5G0RB 1LW2B 2XO6A 2R2RA 1CBKA 2R7RA 3T6JA 4MIAA 2VOOA 1IR2A 1SH3A 1H6KX 3KK2A 2MSSA 4XDCA 3POTB 5CCMA 4LF4J 5L39A 1UPMB 4KGVB 3W64A 2RT3A 3SMZA 4HKQA 2OD4A 3D67A 2C3MA 4B17A 3CJ8A 1FVQA 3PIOQ 1SJFA 3CDBA 3JTNA 4WFYA 2HZAA 5F0WA 4KR0B 2UVWA 1QLNA 4J9KA 4ECTA 2MXYA 3IO1A 4ZVHA 1EQ0A 2NZ4A 4QIFA 3PEJA 1SC4B 3D68A 4ENOA 3CCWA 4J9RA 4DR6F 4NMLA 2VA3A 1JJHA 2W4CA 1F6TA 4DR1F 5LMNJ 5HAOA 2WVCA 1NRKA 1RT4A 1AA1B 3M4XA 4F36A 4AL5A 3BSOA 1M5VC 2BJ1A 1M5PC 2I8EA 1LWCA 4MJKA 1SJ3P 2QGFB 4WU2A 1YKWA 1X4CA 2KU7A 3RB0A 1VQ9S 2E5LF 3N9UC 3LGNA 2YVSA 1UA1A 3C14B 4DUYF 3V6JA 3SQGA 6FD1A 1RHRB 2HBZB 1WHWA 3MMAB 3TA1A 1I5OB 2MEWA 3KHRA 2VFUA 4O44A 3EGVA 5J2QB 1FRXA 1S5ZA 4JI5F 2B4PA 4J7CA 1XNRJ 1P27B 2FJVA 2YKMA 4A8KA 1KOHA 2G2ZA 4QIVA 2RJZA 4JI4J 4DR5J 5IT4A 1YWXA 3RTVA 4KHPJ 2WONB 2NXNA 3OXFA 2IJNA 1CQNA 5LSRA 3OR2A 4ZVQB 2V68A 2VKRA 6AT1B 4DCJB 2QMXA 1CS4B 4C3LA 2CXEA 1FHTA 1ZTWA 2ZITA 3W65A 3OVBA 4WE1B 3KYLA 4LBHA 2QLJB 2YH1A 5DGAA 4F2RA 1KQGB 2B6AA 1HNIA 1URRA 2IM3A 3MR3A 4RW6A 2QYCA 1S6QB 4RJVA 3UI3A 2D3ZA 3KG0A 1RTDB 3RUBL 5FDLB 4MT1A 4H4MB 2BQRA 2YX1A 1I51B 5FLXY 2AJQA 2DNQA 2ZHAA 2KJVA 2G2YA 1RTHB 3NGRA 2BE9B 2YX4A 3N0VA 5IM0B 1FTCA 3U7JA 3SDEB 1H72C 2DGTA 3RW7A 4ZDNA 2R8JA 4ED4A 5ETNA 2IDLA 4RNNA 2XY7A 3EVOA 2XSJB 1HBMB 4JI1J 5L38A 3HSZA 1QDUB 4DQQA 1OQ3A 4IG0A 1TKTB 3M32A 1JXVA 4LRAA 5DG9A 1RAEB 2V5HG 5KT5A 2RS8A 4JI2F 5IFMA 2QN6B 1IBKJ 2ZWOA 4JB8B 2QMWA 1FD2A 4J9SA 3H5SA 1A9NB 1XC9A 4LF8J 1RJJA 4UT4A 2ZD1B 4USMA 3TUZC 2J8SA 5DG8A 1OMSA 1S0MA 3GJTB 2MZ1A 1SJ1A 2R3VA 1RA7A 2CJXB 3L95X 2BOPA 3HF5A 3GSIA 1CVJA 4AUKA 4ZVOB 4FYYB 5L46A 1PBUA 1X4BA 2DHHA 2QO3A 4ID5A 2VPWB 2Z58B 3LUYA 4EK2A 1PGZA 2J0WA 4WKRA 1Q4RA 4DWIA 1SKSA 3FCHA 3FCVA 4TU8A 3I4PA 4OYOA 1OPZA 2G1HA 2FHJD 2H9ZA 2HBQB 4CRJA 2CWKA 2MKIA 4TY8A 1RWPB 4JI6F 1TKXB 4B9UA 4LFBF 5D0EA 1YGYA 3LPYA 4EFAC 3ZTSA 1IJEB 3R5GA 4NI2A 3OHAA 1ACMB 4B3TJ 4YQWA 1EJ7L 4NLYA 5B0DA 3BJYA 4CO1A 2GVZA 3AD8C 4DPXA 5HN0A 2YNFB 1NPPA 4ZVRB 4R0JA 5IWAF 1LNQA 1RXOB 2C2OB 1RT3A 1IQZA 2KHCA 5A8WA 3T1YF 3FSXA 3THVA 1YITS 1Q5YA 2AJ2A 4CQ1A 4DV1F 3CD7A 3TUIC 3BZQA 3OTOF 4UY8T 5A6PA 5F9NA 3VVUA 3CIMA 2ZOFA 3RBXA 3H40A 4IRDA 3U27A 2KZZA 3TA0A 5CCLA 2CQCA 2OSRA 5FD1A 1XMQF 4F3QA 1N5YA 4P2MA 3W9HA 4XPCA 3PRVA 3FMBA 1VIXA 4CO2A 2HGLA 3AFGA 3T3FA 4YS2A 4TKTA 1RACB 2OIHA 3GWCA 3G6VA 2RQCA 5ETRA 4NXMF 2VG7A 1NZ8A 1EARA 4RNOA 2CPHA 2XZTB 3M6UA 4B9MA 4IG3A 2HQ3A 2VJUA 2MKKA 2H5EA 3A12A 4C6AA 3AQOA 4H54A 4ZIVA 2BV3A 2HFSA 2KM8B 1OIAA 4LFCF 1X4DA 1U49A 3CULA 2B8QA 4KBIA 3QRPA 5F8IA 4X64F 4U96A 4LF5F 3CCRS 4AQYF 2MY7A 1C4CA 3DFEA 5ETQA 2DR8A 3QWUA 1BE4A 2GJFA 3EZOA 4ZITA 3SEOA 4KY3A 3DRYA 2N4CA 4ATNA 5CD4A 2LQ8A 5DETA 4KH0B 2K7JA 5KOXA 2LA4A 3DCAA 2Y0BB 2H65B 4LR7A 2RF2A 3Q8QB 3MMAA 2CDQA 2ILYA 3SSRA 3FEYB 3IRXB 2C2DA 2C28A 3M8YA 4Q2LA 1WSVA 1XEZA 4OQJA 1T0TV 2LEBA 5J2QA 3FVYA 4P74A 2FVPA 1RHQB 2XLKA 5ADZA 2C42A 3ITHB 1RTIB 5DZ7A 4BWMA 4IRKA 2XNRA 4K2XA 2AP6A 1TK5A 1SIWB 3MCMA 1TKZA 1U1OA 2WONA 1FDNA 2B7CB 1NJIT 1PJ6A 2E9RX 5BXIA 1R8BA 3J81U 3DMJA 2DITA 3BO2A 4Y2MA 2HLUA 3RRGA 4ZIWA 4A8XA 2RDDA 1Q8BA 1FESA 2O3DA 1S77D 1RWOB 5GAHU 5FIIA 2FJWA 1T03A 3F0NA 3B8HA 1RAAB 3SYZA 2UV8G 1LEOA 3RJMB 2HMIA 3P6YC 1T02A 1YJUA 4ZP8A 3BYRA 2EVZA 3FNNA 4PRFA 2CVIA 1H73A 2XY6A 3SDEA 4XTTA 1APSA 2OUGA 5C2CA 5GADI 2GJ2A 4WXOA 4NCBA 4ZPBA 1U0HA 5IC4B 3RAXA 4X66J 4EO6A 2VFTA 5KFCA 3PRDA 1WEZA 2FVSA 2FPHX 1YX2A 5AXKA 1U48A 2RAQA 1PBAA 2NXJA 1TKTA 2WB4A 2VDHA 3U1LA 2BVZA 1RCOB 3CCZA 5K8NA 1Q16B 4GO5X 5B0FA 3MFIA 3RR8A 1A0OB 2VUGA 2JRSA 3EUNA 2F65A 2VF3A 3PYFA 2E5IA 3I0SB 1PCAA 2ZD1A 1Y3KA 2ZH7A 1WUUA 2Y1RI 1RSCA 4YN3B 3TJ9A 2XY5A 1NMEB 5AXMA 3AXKA 2MQOA 5IV4A 1N54B 2XLJA 4H4KA 3MUVP 3V4MA 1BQMB 1SJQA 1DLOA 3JSYA 4LF7F 2LVWA 3VGTA 5GAEU 2E9ZA 4ANDA 1HNVB 3NCRA 2CQPA 2JFDA 4DV7J 4KAIA 1Q5VA 3GV5B 3S6EA 4UY85 3J7YU 5DQHA 4B9TA 2C3OA 4H4OB 4NLPA 2C2KB 2KO1A 4NA2A 3MPWA 4C7QA 1S1TA 2QT7A 2BUNA 2BJDA 4FS1A 5J1EA 1M90T 4PG4A 1IBMF 1NNDA 5DS7A 2QMUB 4I64A 3J7Z5 2OMLA 3TZWA 3N5FA 4PQUB 2C3UA 2E1AA 5KFOA 2YNFA 1IWAA 3O44A 3LTOA 2YBVA 4X4TA 2E44A 4UOFA 5KT3A 1TVRA 4QW9A 4PXCA 2YPYA 4DSLA 2XGQA 3ONQA 2IM1A 4CH1A 3TI0A 2VD3A 1D1UA 3J7AN 5BYSA 5D77A 1NK4A 3D9BA 2LDYA 2YNHA 3DOMA 2ZDOA 2M52A 2ALZA 1AFJA 2GV1A 2UZAA 1ZM4A 2AT1B 4B3RJ 4W92B 4XK8C 1HA1A 2HHTA 2IRUA 3N6NA 3MTJA 5F8MA 5C42B 2P6SA 3ZZRA 2W8KA 2BM0A 3VGUA 2BBEA 3UD5A 2OPPA 3A8KA 2MQ8A 4OZNA 2D41A 3K57A 1VLOA 2B3TB 2GQQA 2MQMA 2UU9J 2UUAF 3L9ZA 4EBDA 5IWAJ 5KFLA 1N36J 5G4DA 4C98A 1HNWJ 3AQPA 4WYLA 2P2CB 2G0IA 2J9DE 1X4AA 2GMLA 4V19X 5CH7B 1E6YA 3A3NB 4K2JA 4DFPA 3DLKB 3MAAB 1YRXA 3K8VA 3OTOJ 5JUMA 2MLYA 3T1AA 1RCXB 5KFWA 1SV5A 3E01B 1RAGB 4E98A 4OYWA 2W2OP 4UOGA 3QFWA 2CKWA 2PEHA 3TJ8A 5CYQB 3CJSA 1NZAA 5B08A 2PC6A 4OX8A 1GX6A 3JSBA 2C2EA 2HHHF 4CNYA 3QJJA 2I6WA 5H9FJ 2YNGB 2R8KA 4DZDA 2W1BA 4B3MJ 3R1HA 3DKDA 4NLRA 4I2QB 5GMDA 2B43A 3WC0A 3H5UA 4JI0F 1CJKB 2CIMA 3TZZA 4ELUA 1VS3A 1NXIA 2PEBA 2PMZD 3QSYB 3TX0A 1KSPA 4DV2F 2UUWA 3LOUA 5GAGI 1HNZJ 1JMTA 4CTAA 3R2DJ 4EZ6A 1GMUA 1VMBA 3FRYA 3T5KA 4LFCJ 3UW1A 1T9UA 3J7A1 3NY0A 2RKIB 3NKYA 3C6UB 3VQSA 2MB0B 3ZTPA 4NEYA 2A2DA 1UJ6A 1O51A 4OYZA 2Z57B 5KG5A 1L3KA 3AD7C 4GKJF 1WG1A 2VB6A 4MYTA 4XO0A 3P5TL 2V69A 4RBTA 2QFIA 2E66A 2EW9A 3L3CA 3PV8A 3AB2B 1NK5A 4LRCA 1SJ4P 3AAWB 3BYPA 4NZ7A 2EC0A 3ZZ0A 1ZAVA 2QG9B 3H42A 3C6TB 1AFIA 4DS4A 2OELA 4URSA 4PYAA 2DGVA 3MTKA 2F4VJ 1L3SA 5A8RA 5HK4A 4IDKB 5D8HB 5CHCB 3HVRA 4O0NA 3NGKA 4TYAA 1S72S 1UEKA 3QIDA 3MM5B 1QJHA 1RHKB 3J81Y 3FZBA 3GFYA 1Q95G 1TUVA 3QZ7A 2Y0SD 2YKAA 3KLVA 1DQ9A 2OPSB 3GG0A 4DV6J 5F3TA 3SV4A 2W9AA 1C2PA 2DH9A 5KFYA 1OYDA 3QGHA 2ZH4A 1IN0A 2CPJA 4I6YA 4TYBA 4DR2J 2OFGX 2ZVSA 3PO5A 4F04B 2MMYA 4XIUA 4CO5A 4DV3F 2DXDA 1NKBA 3IM8A 5C25B 4FXDA 2UXCJ 1N8RT 4PEOA 4K4WA 4OX9F 4Y28C 2ZH2A 3I0SA 5E33A 3WIVA 4G1IA 2CJ9A 1RADB 3FFIA 1ZOTA 3T9NA 2MHNA 4RW4A 3LAMA 3MM7B 1EZZB 3BDPA 3IRWP 4F4YA 4ICLB 1LQ9A 2IC3A 2W2QP 3GZ7A 1S57A 1BQMA 5IOLA 2DHSA 4B9NA 2BJ9A 2FLOA 4RZRA 5E5NA 4YR0A 1WHVA 1HNVA 4FP9A 3M1VA 4RUBA 1PJ5A 3LANA 1M1HA 2ZJQQ 2QRRA 2GX8A 2DXEA 3LP1B 2WZ1A 1S1XA 3TYTA 3E3XA 4H4OA 4FF1A 4PXEA 3ZZUA 4HDGA 3OR1B 4K7QA 5LSLA 1T7PA 4UOHA 1NSKL 1WELA 2D1CA 2OEKA 5I3UA 4JI7J 2V34A 1LV5A 3QZ8A 1UP1A 4ZLLA 5KG2A 2XS7A 3W61A 3IS9A 3PZPA 3FSIA 2GQ2A 1MROA 4NXNF 3D1HA 3PJ9A 3G96A 1IKVB 1R43A 3GQCA 1S0VA 4LF7J 3MPDA 2V4JB 1FVSA 5CQGA 1U1PA 2JHEA 1RHMB 1KD1T 1KNZA 2FHJA 2LLZA 4HT5A 1VBZA 3TRGA 1NK6A 3HHLB 4DR3J 3KFWX 2ZJPQ 4O3QA 3N79A 3SCLE 3KMSA 3AJ2A 1RT7B 3CJKB 1XN9A 4J9UE 4LSLB 4ZP6A 4IO9Q 2Q6BA 1XTZA 1N34J 1KHVA 3PJXA 1RWUA 2CQ4A 4HTJA 1YIJS 2GCFA 2UVRA 1U2FA 3DU6A 2EK6A 1HMVB 3W62A 2Z2YB 4HT7A 3ISNC 4B02A 2JSXA 2XEXA 3HKZD 2MJUA 3KXDA 2VODA 3I9ZA 1WC3A 4ECRA 2RHQB 5HP1A 4L76A 3DRRB 5C2GA 4LUBA 3V5RA 1XK8A 1IBLJ 4DL5A 1NLKL 1BQNA 3CO9A 4OYBA 3QT5A 4RR5A 1M1KT 5L9XA 3C19A 3PR4A 3E01A 1UA0A 3HCXA 1B4SA 1WC6A 3H2UB 4C3MA 1BWVA 3KNAA 1UWBA 3K0JA 1M5SA 2RVJA 3SIPB 4FDFA 2ZH1A 1GX5A 2HLTA 1XR6A 4UQTA 4I2PB 4X4QA 2DNHA 1EB0A 4P2XA 3OTEA 4NLSA 3TNVA 1FJGJ 2BKNA 2XI3A 3VHQA 4I6WA 4U9RA 5HBMA 3GILA 4ED2A 4UUXA 1F60B 3F56A 2IYIA 5D0RA 3BPSP 5B0CA 1JLQB 3CCQS 3K58A 1VQOS 1RU2A 1VBYA 3A8IA 2IM2A 2XHCA 4DX6A 1JLGB 4WP8A 2EFNA 5DRKA 5KFHA 2YWHA 3KJVB 5EX3A 2CQDA 2J7KA 4CLKA 4KV8B 2RRAA 2XI2A 3TZYA 1YJ7A 4Z7CA 1L5UA 2RDJA 3T5LA 2HFVA 3M8ZA 1HL6A 2RKIA 1A7GE 4Y0FA 4G3IA 4JV1A 2YWWA 4JI3J 2W2MP 1T3NA 2XZDB 2UUBF 2D74B 1UZHA 2KKHA 2FJBB 1VIOA 1NH7A 4QPXA 2L9DA 4QJVA 4Q5VA 1D8ZA 1NDKA 3RB6A 2XMTA 3MWBA 4DV4F 1ZM2A 1HQUA 3C15B 4RNHA 1MU2B 2IRYA 3C8YA 1ZZFA 2W9BB 1YJNS 1GXUA 4IDKA 2BYCA 4OI6A 2FIUA 3KG1A 3EGNA 4JBCA 2HQGA 2RQMA 3UR3C 2UXBF 3OL7A 2OTLS 3R27A 2Y8YA 2VH7A 1X9WA 4ZHRA 2JH3A 2IMWP 2DK2A 3KJQB 1WKKA 4B9SA 1O8BA 1Q78A 3CJTA 1CG2A 4DU7A 1N6QA 4X4VA 2DT9A 2KG0A 1BXNA 4JOUA 4PG8A 1YHQS 1VQ4S 3W2WB 4I69A 4IQXA 2GZOA 1CEZA 1WC5A 5DDQC 5KG0A 2HIQA 1U2CA 2M8DB 4ZP9A 3A4TA 5CYMB 1XERA 1KHWA 5C25A 1S9EB 4IYQA 2V9WA 1NDCA 3G6ES 5D78A 5A8KA 3W5XA 4G1PA 4ANCA 1MWYA 2VA2A 3N6LA 5KG3A 3W5ZA 1T94A 1RP5A 2MTLA 4BLGA 3OSNA 1VQ5S 2QSFA 2QLWA 2QSWA 3OHBA 4ICLA 3OLBA 2WCXA 2Y9HA 4LBIA 1G6BA 3BGOP 2DH8A 3P4UB 1PC4A 3FCWA 3PCOB 1VGYA 2XO7A 5F0UA 1R8AA 2FUG9 4LFAF 2J9CA 1C0UB 3FJ2A 3GYNA 3ZZTA 2KXNB 1FRJA 5HO4A 3AA8A 2P6TA 4F2SA 1TL3A 2V8GA 4UQGA 2AEJA 4RW7B 5LSOA 4A8OA
chains in the Genus database with same CATH topology
1X0FA 2M88A 3KHRA 2VFUA 4O44A 5A8RB 2G0CA 3CCUS 5D3GB 1X4EA 2AJ0A 1FRXA 1FDAA 3K5MA 5J2QB 4OI2A 1U1QA 2KFNA 3MUMP 1U26A 5F41A 4JI5F 4QU7A 2B4PA 3HKWA 5CD4H 1P27B 5HLFB 2FJVA 2DR5A 2RQ4A 2UXCF 3UQSA 2VG6A 2YKMA 3QIPB 4A8KA 4CO3A 4YUDA 2YWGA 1KOHA 4I56A 4X4SA 2V8HA 1F5BA 4NLDA 3BQ0A 4HHJA 1FD8A 4QIVA 1N48A 1VLYA 2RJZA 3ZFVA 1TV6A 3BSAA 1W2BR 4CO0A 5IT4A 2FLLA 1YWXA 3RTVA 2WONB 3SFUA 4C4WA 3OL6A 3CCSS 3D1OA 3OXFA 2IJNA 1CQNA 4ELVA 5LSRA 3OR2A 4AFFA 1LXJA 1BC6A 1K1QA 4DG1A 4TU9A 4ZA1A 4HL9A 3HVAA 4YMEA 4ED1A 1T05B 4DR7F 2JEJA 2VKRA 2NUUG 1URNA 1HWIA 2QMXA 3FSYA 1NK8A 2ZC3A 4C3LA 2XB2D 1FHTA 4ILLA 3CT9A 2U1AA 2MDAA 4HI1A 3HZEA 1ZTWA 5T7LB 3MEEB 2EI5A 2ZITA 1U4BA 3OVBA 4WE1B 3F41A 2C2RA 3KYLA 3E8OA 1IKYA 1HI8A 2YH1A 5DGAA 4EO8A 1KQGB 1S9FA 4F2RA 1U7LA 4RBVA 2B6AA 1OPIA 2O67A 4XAKA 2BXJA 1HNIA 4DL2A 1URRA 4ECYA 2AGPA 4NRUA 2IM3A 3M9MB 3PW7A 2E9TA 3HZGA 3MR3A 4RW6A 1BWEA 4LSNA 2QYCA 1S6QB 3I5BA 4QIGA 3UI3A 1D9DA 1TFWA 2D3ZA 3KG0A 2IVFB 1RTDB 2YKQA 5FDLB 2JEGA 3CPWR 4H4MB 2BQRA 1TQLA 3H2LA 2YX1A 4RUAA 1TAUA 1T95A 5EGYA 5KT4A 1YJWS 3CJKA 5FLXY 4KFBA 2WK4A 4RNMA 3WC2A 2LEAA 2HFOA 1FKAF 2AJQA 1TL4A 1MMDA 1VOMA 2AX0A 2DNQA 1WEYA 4F67A 1L3TA 3QAUA 2OFHX 5BYRA 2ZHAA 2KJVA 1BQXA 4EU0A 4LF9F 1S1VB 1RTHB 1LKZA 2DHGA 2R9LA 4F3MA 3VAHA 1HYSB 2NS1B 2YX4A 3N0VA 5IM0B 1KVIA 4ZP7A 5E3AA 4YY3F 5F9LA 3GIKA 5EHHA 5E7OB 1KLNA 3GB0A 2KRBA 2XMMA 1N4LA 1FTCA 3RBEA 3U7JA 3SDEB 4PQUA 2G9OA 4A8WA 2V0NA 4ZPAA 3MEDA 3X3UA 4ZPTR 2DGTA 2V8DA 2LXUA 2OO4A 1HMVA 3FFIB 3RW7A 5KFVA 1T8EA 4ZDNA 1S4FA 1HARA 2R8JA 2EFVA 2W7PA 1FE4A 2CQGA 4LT6A 3NL0A 3Q23A 1LWEA 4JI7F 2CPEA 5E0OA 4A48A 3S8SA 4RW4B 2MSTA 5SZTA 1QM9A 4RNNA 2HFNA 4B08A 1UFWA 2XY7A 2ZOGA 2ZZNA 2PN6A 2XSJB 2MKSA 4C8KA 2IC3B 3PDNA 1HBMB 3HHKA 2X1FA 2HW3A 3M8PA 3CCTA 3BEGB 5L38A 5B0BA 1B0VA 2Q3PA 2ZOMA 2R4FA 3DRRA 2ZE2B 1R27B 2DNRA 4DQQA 2DGWA 1OQ3A 1QUVA 2B5JA 4IG0A 1TKTB 4DV5F 2FDNA 3M1VB 3M32A 4WZMA 4IOAQ 2AYGA 3QGIA 4PWUA 3CCMS 2P9GA 1WF0A 3DRSA 2V94A 5DG9A 4YHHF 2ASJA 2EFQA 2MGZB 2V5HG 2ZNZA 5IQQA 1CC8A 2P5VA 5KT5A 2KZMA 2RS8A 4JI2F 2JFKA 1KQFB 2ZJRQ 4YDXA 3EGWB 3JTOA 3OPKA 5IFMA 3QPIA 3FDSA 1S1XB 3PFEA 5C42A 5I3PA 1R6YA 3G8SA 5DG7A 1RQ0A 2QMWA 4O3OA 1FD2A 1TL1B 4N47A 5KFKA 4ECXA 3CTRA 3LP2A 4J9SA 5EDWA 3H5SA 2ZZMA 1A9NB 1QSYA 4DR3F 1IKWB 2BACA 3Q22A 3MM9B 1XC9A 1FJCA 4TY9A 1RJJA 4YFUA 1HBOA 2IAJA 2ZD1B 1VRUA 5J2NB 3TUZC 1S7HA 2FD2A 3GE9A 5DG8A 3TAMA 2OJ3A 1LW0A 1S0MA 2MZ1A 2JOQA 5I3UB 4K4ZA 3VAGA 1SJ1A 3VZIA 1RA7A 3L95X 3OQ2A 1N34F 4KB7A 2BOPA 4DOZA 1S0OA 1JNRB 2K2PA 3HF5A 1VRTB 1ZM9A 1CVJA 4AUKA 3IS9B 4J9MA 3PX0A 3B4MA 4PUOB 2DB1A 1MROB 3HFKA 3MM6B 2DH7A 1X4BA 2QO3A 4ID5A 3T1HF 2VPWB 3MDFA 1XWLA 3LUYA 1PGZA 3UPFA 2IJFA 2E7WA 2J0WA 1QAJA 4F4WA 3DLKA 4PKDB 1YQHA 1HI0P 4WKRA 1Q4RA 4IFVB 4DDFA 1SKSA 3DLLQ 4DWIA 3PXGa 4NCAA 3FCHA 5C24B 3UFCX 1WG4A 4TU8A 2OD6A 2Y1JA 1UW4A 3I4PA 1X4GA 4N77A 3PW0A 4ZS6A 1HWJA 4QBUA 1OPZA 4GC7A 1RDRA 4PG6A 1ZETA 1TK8A 2FHJD 1NKEA 3P49B 2V9KA 2W8LA 5SUHA 4LIRA 2ADCA 3DI6A 2BQUA 2H9ZA 1JLGA 2MKIA 4TY8A 5DQIA 3NNCA 4JI6F 1TKXB 3P3DA 4B9UA 4LFBF 1X5PA 3KJVA 4F50A 3CDUA 2AW0A 1IBLF 1YGYA 2HWTA 3LPYA 4K5RA 4EFAC 5CYQA 3H5YA 3HHEA 3AH6A 3PKMA 4B9LA 2VL1A 2M9KA 3K5PA 5HI7A 1IJEB 1VQMS 4WK1A 3BM7A 3OHAA 1HR0F 5J1NA 4TN2A 1ZTTA 1PILA 3CC7S 2RH3A 2YNGA 3V81B 4YQWA 1YRUA 3A8EA 2HVIA 3H98A 4NLYA 5B0DA 3KLFA 3BJYA 2GIRA 1WTBA 5B0GA 4AXJA 2FJAB 1YJRA 4I2QA 4DQRA 2XCAA 4B3OA 4CO1A 2KYXA 2MPUA 3M8QB 5LMUF 3DC2A 5K9FA 3W7BA 5HN0A 2YNFB 3S1TA 3AHPA 1ZH5A 4LMZA 4OI1A 1M5OC 4KRWA 3W2VA 4YEAA 1HBNA 1N52B 3SXLA 4R0JA 5IWAF 1FJGF 2GC8A 2FB0A 1G1XA 3HMJG 1S6PA 1RT3A 3CJ2A 4Q44A 1V3SA 1IQZA 3EGZA 2BR0A 2KHCA 1LK5A 4A47A 5A8WA 4BDPA 2J76E 4MK7A 3T1YF 2X3GA 3KHGA 3KK3B 1YBAA 3FSXA 2VFSA 3K5LA 2CPDA 5F8HA 3THVA 2KI2A 5HP1B 3VR1A 3F73A 1X5TA 2M5YA 1DURA 1YITS 2C3YA 4DQSA 2YKNA 2APOA 3M6XA 1V3RA 4CQ1A 3JSRA 3MUTP 3CWJA 3DRXA 4DV1F 3CD7A 4QWBA 3QJLA 3TUIC 1W25A 3BZQA 2JJ4D 2RUGA 3KNGA 3OTOF 2ZBIA 3EPIA 4AXIA 1R89A 2NLWA 2R7OA 5A6PA 5F9NA 3G8TA 4UY8T 1BQNB 3CIMA 3I6PA 1UVMA 2ZOFA 2DGXA 1YG0A 2CPIA 3H40A 4IRDA 2W9BA 3U27A 4URQU 2KZZA 2GHWA 3TA0A 4Q45A 5CCLA 3C66A 5JXSA 1GXLA 2MQLA 2J0QD 4NA1A 2XHWA 4FXVA 1JXEA 3VALA 2RNEA 4Q43A 1V9OA 3CGIA 2BRLA 3I96A 3C6UA 2CQCA 2OSRA 4GO7X 1WEXA 3HPOA 2JLFA 5E3PA 1UWBB 5FD1A 1XMQF 1IM4A 1U6FA 3KMQA 2FC9A 4NYZA 4C8OA 4EZ9A 4F3QA 1N5YA 1YVFA 4G1QB 2NUHA 4ES1A 2MQQA 1NJYA 2HNZB 4XPCA 2CQ1A 1Y5IB 2KH9A 2L9NA 3HVTA 3FMBA 3O8WA 5KFRA 3THPA 2NSBA 4JV2A 4Q0BA 2OPRA 3S01A 2RU3A 4C9DA 4QR1A 1N56A 1VIXA 4CO2A 3VWSA 1E6VA 4IQMA 2HGLA 2PSZA 3W3SA 1YRTA 3T3FA 2R7QA 2VG5A 1HHSA 4TKTA 1HBUB 1ROFA 4N56A 4YP3A 1ELOA 5HBMB 1K8AT 1UVLA 1SKRA 3DOLB 2R7TA 3CCVS 4CH0S 2OIHA 2J6TA 1N0UA 3GWCA 1FO1A 1FKOA 3G6VA 2HHPA 2K1RB 2PI4A 4JI3F 2MY8A 4I1TA 3EXYA 2RQCA 4FS2A 4NXMF 1NK0A 3C6TA 2PIIA 3MECA 2W4PA 1KONA 5JVHQ 4DLGA 2RQKA 3W2WA 2HG4A 2VG7A 1D9FA 4DN9A 1X0PA 1NU4A 2CJBA 3UDCA 5EWGA 1X4HA 2DHXA 4DFJA 3JYTB 2HHUA 1P1TA 3OL8A 3KOAA 3R3TA 1P6TA 2W24A 4HDHA 2XSFA 4RNOA 4I7FA 2N3OA 2CPHA 4ZKAA 2P9CA 2R2TA 2BQ3A 3M6UA 4B9MA 2XC9A 1FTRA 4IG3A 2HQ3A 1Z1ZA 1JKHB 1KLMB 2ZFHA 4NL5A 1EP4A 5M2UA 2MKKA 2H5EA 1DFDA 5CYMA 3I31A 4NCGB 4ZLPA 1FA0A 3CE8A 2E5GA 1CSJA 2YKPA 2AU0A 2ROEA 2XMKA 3HJFA 3AQOA 2I2YA 4EBEA 4H54A 3OJUA 1HWLA 2BV3A 4IR1A 2KM8B 1OIAA 4LFCF 2YX7A 5KAKA 3MM5A 1X4DA 2B0GA 1FXLA 4LVOP 2HAIA 1U49A 1RT1A 1CPZA 1H7WA 3CULA 4KBIA 2XMJA 1HQEA 3M6WA 5DGBA 2KFYA 3L7OA 3MMCB 4KPYA 5F8IA 1GH8A 1UVNA 3FEZA 5GAHI 4X64F 2XULA 4F26A 4ETZA 1XR7A 2E1MC 4LF5F 4P7VA 3CCRS 2DO0A 2I5JA 4TLQA 3SZ2A 4ZPCA 4AQYF 1REVB 2OPSA 2L3MA 2MY7A 1C4CA 2YKOA 5D4PA 5T41A 5DLGA 3HP6A 2JC0A 5I42A 3RB3A 3T9ZA 4QPTA 3DFEA 2KHDA 1N5VA 5J2MA 1M0SA 2CQHA 3IBWA 4QIWD 4PPZA 2RS2A 2EBEA 2F3JA 1NHVA 3QWUA 4ECUA 2O1PA 2DR8A 3PO4A 2G4BA 3OL9A 2MZJA 2DPIA 1UKUA 2VQEF 4ETXA 3SI8A 2J8AA 4NLTA 1K73T 2B56A 3J80Y 3R5CA 3TAPA 1B7FA 3SEOA 3KLHA 4CI0B 1SI9A 3OBIA 4AE5A 1Y5NB 4ECQA 2HHVA 1R31A 3DRYA 1N88A 2YWEA 3QO9B 2N4CA 1LFPA 3ENVA 4ATNA 2ZKUA 3IFEA 4FZVA 3FMWA 5DETA 3H59A 1C0UA 5JJBA 1I94F 4ZPWR 2VONA 2K7JA 3KHHA 2YY3A 2W25A 4CT9A 5KOXA 1Q7LB 5K14A 2LA4A 2B9WA 3FGVA 3DCAA 4PG5A 4KKOB 2RF2A 3Q8QB 1HQUB 2X51A 3MMAA 5HROB 2CDQA 2ILYA 3SSRA 1FXRA 2XMVA 3FEYB 3IRXB 3OFHA 2C2DA 1QE1B 3MM8B 2C28A 5GVQA 4Q2LA 2HS0A 1XEZA 3CDAA 2HWHA 5KTQA 1IKXA 1X9MA 4MK8A 4DJBA 4OQJA 4R0EA 2YWKA 2LEBA 2ZUGA 1ZM3A 1S97A 5D3GA 5J2QA 3MZIA 2XS2A 3CC4S 4HI2A 1P1LA 3FVYA 2ASYA 5EWEA 3QAEA 1KFDA 2FVPA 3K5NA 4LF6F 2LMIA 5ADZA 1WF1A 2XLKA 2C42A 2V4QA 1K0VA 3KLEB 5HLFA 1MWZA 3OTBA 1FRMA 2Z4PA 3ITHB 2ZH3A 3QIPA 2MJNA 1RTIB 4BWMA 4IRKA 4MFBB 2XNRA 1Y5LB 1JLBB 4K2XA 2D3UA 2AP6A 3MAQA 1TK5A 2E1RA 3MM7A 4DSIA 2R7WA 1SIWB 2OPQA 4EUVA 1NJWA 1TKZA 2I1RA 1U1OA 1DTTA 2WONA 4NLGA 1NAQA 4OIXA 5GMKa 1FDNA 2B7CB 3OTCA 4ZHRB 3NNHA 3GYXB 5BYQA 2ZH9A 2QV6A 4DBQA 2K3IA 3FQLA 5DM7Q 1NJIT 5LMNF 2QEXS 1JLAA 1DJ0A 3KK2B 1T05A 3CMES 3CEDA 5L8RC 2KG1A 2E9RX 1R8BA 2V2KA 2M8HA 1CLFA 3DMJA 1UVIA 3GR1A 3IAM9 2DITA 1N6QB 4QR2A 3BO2A 4ED8A 3MEEA 4WFNQ 4Y2MA 2HLUA 3OLAA 1ZPVA 3RRGA 5FJ4A 2XG8A 4C8YA 4A8XA 1Q8BA 1RYSA 1VC5A 1SJRA 2J7WA 3LP1A 4PCQA 1L3UA 1FESA 2O3DA 5F3ZA 1VHFA 3GIIA 1S77D 1VQNS 5GAHU 2HPUA 5FIIA 3M2UA 5EUHA 3T5JA 1X8DA 2DGOA 3IR6B 4Z2XA 2FJWA 1SB6A 3LGMA 3PW4A 4N76A 3OR1A 1T03A 3B8HA 1R8CA 5CA5A 4M95A 2KN4A 4J5OA 1N0VC 1RT2B 5GAEI 4JV5F 1IXKA 1C4AA 2UV8G 4ZMMA 4YR2A 3SYZA 3NLCA 2QA2A 3O3LA 2HMIA 3CD5A 2DJWA 4C2MA 3P6YC 1T02A 4OZJA 3UCGA 1YJUA 4ZP8A 3CD0A 1RTJA 2EVZA 2RE1A 3FNNA 2JLGA 5A8KB 7FD1A 4PRFA 2YNIA 2HHSA 4ALZA 2M4MA 2CVIA 3J7YI 3MXHP 2MKJA 1UVKA 4J9NA 2F8MA 3DM2B 2XY6A 3PW2A 1IUJA 2CJAA 3N5BA 1JLCB 3M2VB 2FGCA 2DIVA 3SDEA 3RYLA 4OL8A 1APSA 1IKVA 1VQSA 1DQ8A 1N5SA 3R1LA 1XNRF 4IOCQ 2Y1IA 2VV5A 3PVXA 3PHEA 1WI8A 2B9XA 1G7CB 2V4JA 5GADI 5J2PA 1VQPS 1RT4B 2HWIA 1UVJA 3EPGA 2GJ2A 3KK1B 4A8MP 4QCLA 4WXOA 1UJ5A 4RWXA 2UP1A 1SUQA 3EZUA 4ZPBA 4NCBA 1Q1KA 4OJGA 3RAXA 3VAIA 3MMJA 3A1YG 4JI4F 4EO6A 2VFTA 5KFCA 3PRDA 4DR5F 1WEZA 1PO6A 2FVSA 3JTPA 5AE3A 2DNZA 4NYOA 4ZK7M 3GV7B 2JC1A 3BR8A 4DSEA 2FPHX 1NH8A 4KHPF 4OHYA 2W9CB 2HHQA 4RW9B 3F44A 3IC1A 2K3KA 5AXKA 3DU5A 1U48A 4Y3CA 5KG1A 4WU3A 2QFJA 2EK1A 2U2FA 3K2YA 5AXLA 3BSNA 1TKTA 2E7XA 2WB4A 2W7AA 3HHLA 3NWGA 1BLUA 2ZBCA 4OV1A 1JK9B 3U1LA 1WG5A 2G1DA 2IRXA 3NBPB 4DV0F 2MGZA 1RT6B 4M1KA 2BVZA 1XBWA 1RT7A 3CCZA 4CZCA 5B0EA 3M2RB 4MK9A 5K8NA 1Q16B 2JX2A 4GO5X 3DYAA 2FC8A 2FHKA 4OZLA 4MMOA 5B0FA 2R7UA 4N8NA 1R8PA 4LSLA 3SSQA 3MFIA 3RR8A 3E2EA 2CVEA 1TL3B 2I38A 4B9VA 2M2BA 1S1WA 2VUGA 2JRSA 2ZDPA 2VKZG 3EUNA 2CZ4A 3PEHA 4WFBQ 2N7CA 1TL1A <