1ZAYA

Purine repressor-hypoxanthine-modified-purf-operator complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Roles of Exocyclic Groups in the Central Base-Pair Step in Modulating the Affinity of PurR for its Operator
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*TP*(1AP)P*TP*TP*TP*TP*CP*
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zayA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA02
2IPMA 3OLWA 3UUGA 4KREA 2BNOA 1JF8A 1PEAA 3OQMA 1ZZ8A 3HZHA 3OLZA 4JOQA 1LCCA 6ABPA 1S7EA 2PUFA 3F6WA 2IPNA 2RJOA 3TRBA 3D8UA 3FFWA 3LUFA 3Q15C 3DNVB 3EQZA 3B7HA 2X7XA 4PZ0A 1P6UA 3OLVA 4JB0A 5EWJB 5F64A 2E4XA 3KZ3A 3O1IC 1WH8A 1JFSA 1E3OC 1D5WA 4FN3A 4KK4A 4NICA 4PYRA 2P9HA 1Z15A 3G1WA 3RH0A 1MVOA 4PU8A 5JNUA 4IWRA 1OXBB 1NXSA 2MSWA 1QKKA 1KGSA 1D1PA 3RVRA 2CHFA 5JNSA 3I42A 1LBIA 3H6HA 3ZKCA 1ZESA 5JS1A 1APBA 2FEWB 4WT7A 1ZUGA 4RK7A 3QLTA 2NT3A 4G0OA 3EUSA 1QQBA 2XJ3A 4RY8A 2E4VA 3NHMA 1EFAA 3KXAA 1ZGZA 1SXGA 3H75A 5KWSA 1O4XA 4XARA 4G97A 2MEZA 1H9CA 2FKAA 4YBAA 1EAYA 4X4IA 2L2QA 1P2FA 2WJAA 3NNSA 2XSDC 3KLOA 3HCWA 2VYCA 1EHCA 2B5AA 2LBPA 5KC8A 4JCXA 4Z4IA 1LK0A 4G86A 1GT0C 4KMRA 4RK6A 3D1NI 2AYZA 1JWLA 2VUHB 4Z99A 4FB4A 3OQNA 3C3MA 2WMYA 3GT7A 3VNAA 2R63A 1ZZCA 1T34A 2XCJA 2O20A 1Y9QA 1WETA 2WRZA 3O2QB 4LE1A 3CRNA 3QQ6A 2MQKA 1JX6A 3QX8A 4YV7A 1Z18A 1UDRA 2RGYA 3KS9A 4IA8A 4PU4C 2PIJA 2GRMA 1QO0A 1A04A 4H3HB 4E7PA 4EUKA 4Y9TA 1KRXA 5TE9A 4EYKA 1JBEA 1SQ8A 3CU5A 2PUDA 1M5TA 1GLGA 5KQMA 3QF3A 4YRZA 1GUBA 3P9YA 1DRKA 3KCNA 2FEKA 2P4UA 3KHTA 4WXMA 4MR8B 1QPZA 3MQ4A 4MQFB 1JFVA 1W9HA 1ZH2A 2IPLA 2QU7A 4ZYLA 1PHRA 3KLNA 3OO0A 1IC8A 2QV0A 4MS1A 3H1EA 3H5VA 2HSGA 3BBLA 1RXEA 2AYXA 4Z5CA 3F73A 3FGZA 2ZAYA 4RS3A 2KEKA 1LQCA 5C5EA 3GWGA 3FYAA 3CS3A 1JYFA 3K4HA 1PRVA 3GN5B 1BA2A 1I3CA 2NT4A 5DKFA 3OQOA 4YWHA 4YG4A 3SM9A 4YLEA 2IOYA 5FWXA 3DLBA 3BD1A 3RVMA 9ABPA 5TPWB 1LBHA 3O1HB 4QYMA 2WWVD 2CD7A 4KVFA 2BNMA 3N53A 5CNKA 4RK0A 5DGCA 3RZZA 3H5IA 4E7OA 1TM2A 2FSPA 2PMCA 4O8BA 5GOTA 1ABEA 1MAVA 4GNRA 3LFPA 2BNNA 3O2SB 3HJFA 4JASB 3SCHA 3IPAA 1VRVA 2FMFA 3BREA 4ZMSA 2QZJA 2DRIA 3F6PA 3L1PA 3KTOA 4MCXA 3QLVA 1P8AA 1CQTA 1DC8A 4Z4GA 1E2BA 4F3TA 1EWVA 3O2JA 1L1MA 1M2EA 2MSLA 2R48A 4WZZA 2JVJA 3VNBA 3PXPA 2QW1A 2O38A 1YVUA 1SD5A 2JRLA 1ZPQA 2VUIB 3D02A 3SY8A 1R63A 2JCGA 2IV1A 1BAPA 1E6LA 1Z13A 3QEKA 4YG1A 1LJLA 2FQXA 3R1FA 2GWRA 4NV3A 2TMYA 1J56A 2V0NA 4RDCA 5CNMA 3N8IA 2FN9A 1ZY2A 4Z9BA 1ZZ7A 4KV7A 1KRWA 4YS6A 4PU7A 4EVRA 4Y42A 3L6UA 4RXTA 4X4BA 1EWKA 2IYNA 4G0ZA 3MM4A 1MB3A 5K98B 1YK0A 1Z26A 1JDPA 1FFSA 2FMIA 4N0QA 3O75A 4Z4FA 3C3KA 4O1HA 1NEQA 3CLCA 4EGSA 2LYJA 1DP4A 1SRRA 3EODA 4IILA 4I6TA 4Z4HA 4RXMA 1PNTA 3HSYA 5EWLA 3IVPA 4LE2A 1P6QA 1NXPA 1Z2DA 1K66A 1SXHA 4RK5A 1RIOA 1DBPA 2FQYA 3NBMA 3CG0A 4DQDA 3EQ2A 1RZRA 2MYUA 1LMB3 2PUGA 1CHNA 2ID9A 1VPWA 3QK7A 4MR9A 1BVHA 2FLKA 4KPYA 2OFYA 3F52A 1BDHA 5T3YA 3RVKA 3HVRA 2PUCA 2IUOA 4NDWA 3RQIA 2HJ9A 3IP6A 3FMVA 4G0MA 2LP4Y 5FBHA 1RPEL 2H8RA 4ETNA 1U2PA 3URMA 3I45A 3KG2A 3FYMA 3R0JA 2R47A 2YHAA 3N0WA 5JNRA 5A7LA 1XWWA 3CLKA 5BRAA 2HINA 3EDCA 2Q5CA 2IU7A 2ID7A 1XHFA 4EYOA 3EAFA 4LDZA 1DW9A 4HNRA 4JB2A 3K9CA 5TPZD 2LYKA 4X4GA 3Q7SA 2H3HA 5HSGA 3QEMB 4PICA 2GRLA 2WUSR 4RK1A 4ZJPA 5GQSA 4W5RA 2PL1A 2GKGA 4MR8A 3FMYA 2IDMA 2GX6A 2AW6A 1PEYA 4I8TA 1VKRA 3E3MA 3LUCA 1USGA 2KPJA 4RZSA 4OLBA 4X4HA 3LUDA 3ZHIA 1L5YA 2WJWA 3OMXA 1ISRA 4MRMA 4MS1B 4RKQA 4KZKA 2KZ8A 3OO1A 3CTPA 1DWKA 3TD9A 3N6VA 2L49A 2NZUG 1NXWA 3LUHA 3GL9A 5CNIA 2LCVA 4YO7A 3KKEA 2ZWMA 2FLWA 4FBIA 1RZSA 5PNTA 2EBYA 2PAFA 2QVCA 4MCTA 2FW0A 3G85A 3O74A 4MS4A 4P1ZA 2WIUB 1S8NA 4ETMA 3SCGA 3O1JC 2QR3A 4MLCA 5CHYA 5JNTA 4XXHA 3A0RB 3QWGA 3HS3A 2KYRA 3OP9A 2FJRA 2OENG 4FE4A 4S05A 5TQ2B 3RVPA 2MSKA 3IDOA 4OTZA 4XASA 5DCLA 2XIUA 1C0EA 5TPWA 5IEJA 1ZVVA 5TQJA 3HXMA 1Z2EA 4G0QA 2HPHA 4J1WA 4L4UA 4X4DA 5FBKA 4Z4CA 3UFDA 5IUJC 1M5UA 3Q7RA 2BGGA 4GHJA 3GBVA 4P98A 1EWTA 1U2QA 3IPCA 1C4WA 2L19A 3OM1A 1ABFA 1DC7A 5KC9A 3Q9SA 4XAQA 3N75A 3KYIB 2R1JL 4KQCA 3FFXA 3M9XA 4G0PA 4N03A 3BILA 1RNLA 4OBBA 2ICPA 2B1JA 4XFKA 1KMIY 2I6FA 5B3JA 4LX8A 1ZZBA 3T95A 2GBPA 2L18A 2PE5A 3LKBA 4EVSA 1YTUA 3DZDA 4KNYA 3BRQA 2AXUA 1DZ3A 2NUBA 4Z58A 1E6KA 1DBQA 1X57A 1HEYA 1URPA 2HQOA 4F06A 2VK2A 5DLEA 1ZITA 2XI8A 1BDJA 1Z17A 2PL9A 3GA5A 3MIZA 3HK2A 4Z4EA 1M2FA 2QSJA 3JPWA 4UHJA 1ZZ6A 2GI4A 5IEBA 5E3JA 2AXVA 5KQLA 5D2CA 4Z5DA 3LTEA 1RPJA 1ZZ9A 4EY3A 3HZIB 4MR9B 3TX6A 4F12A 1QNLA 1Z25A 3CZCA 1DRJA 4ZMRA 1F51E 4W5TA 1E6MA 2M1ZA 4RU1A 4RKRA 3HUTA 4MR7B 4EYQA 1ZGGA 3EULA 3H5WA 3QX9A 4B09A 2PUAA 2PUBA 3LKVA 3LUAA 3HDVA 4LZLA 2LYQA 1GCAA 4ZPJA 4G0XA 1PRUA 2L8NA 2LIVA 4N41A 4F11A 4MYRA 4MPTA 4G0YA 1NY5A 4YR7A 3HM9A 2KEJA 1QMPA 1DCMA 3NHZA 4O1IA 3JVDA 3SG0A 5IULC 3LISA 3SAJA 3M9WA 3F6CA 3Q7TA 5I4CA 1QP4A 1FQWA 1K68A 4JA2A 1ZAYA 4D6YA 3F7NA 2JBAA 3FDFA 3E61A 4JCYA 5JNVA 3C97A 3DGFC 1NERA 2O4AA 1YS7A 3EGCA 4LE0A 1IIBA 4WWHA 3OM0A 2M98A 4YARA 4N47A 5HM6A 2LYSA 1PERL 5TQ0B 2FTKE 1LJUA 2IVGA 2PUEA 3OLYA 4N0PA 2BJCA 5DTEA 2W42A 4HNSA 1JL3A 4Q6WA 3T8YA 3MMNA 3T38A 4EYGA 2OR1L 4QPJC 1JDNA 4JP1A 4RWEA 4GPAA 4OATA 1DBWA 5EWJA 3GBFA 3H6GA 4UHKA 3RVNA 5HKOA 3G7DA 1TMYA 4YCSA 1YIOA 4RV5A 1JFTA 2A9OA 2QVGA 4QICA 5B3JC 1D2AA 1USKA 2AUWA 1UXCA 2EF8A 1ADRA 3G5GA 4KFCA 4YP9A 4H3KB 4MS4B 3JXDL 1QQAA 1ZH4A 1QO0D 3SQNA 2MYTA 3RVQA 3C3WA 2WB4A 2WY2D 4MS3B 3DLHA 3QLVC 5BR1A 3TB6A 4W5QA 2R25B 1YSEA 2JK1A 2A9PA 4IMIB 1XHEA 5EWMB 4MQEB 2L17A 4GQMA 1CYEA 4KQ9A 3C6QA 4Z5HA 2JVIA 3IP7A 2LYRA 2FMKA 3QLUC 4MQEA 3CZ5A 1TJYA 1YMVA 5FWYB 4OLAA 3A10A 4DADA 2LYPA 3JXCL 2XDYA 5BQ3A 4L85A 4WUTA 5C5CA 5FWYA 3I5AA 2MYNA 3CNBA 3ROFA 3DGEC 1A0OA 3QELB 3ILHA 4HNQA 1SXIA 5IUNC 2FN8A 1USIA 1DJMA 4OG2A 4F8JA 3JTEA 2JB9A 1FFGA 3LUKA 3QLUA 2PJUA 3CROL 3HV2A 3LUJA 2PLNA 1AB6A 3MA0A 4Q6BA 6CHYA 4RK4A 3TMYA 3GV0A 3UK0A 1Z12A 2MYPA 5CNJA 2RJNA 3NNDA 1PNRA 3KJXA 1OXKB 7ABPA 1QP0A 3CKMA 5KQPA 1CJGA 2D5VA 1GUDA 5EWLB 4N76A 4IGAA 4IF4A 3B2NA 1AU7A 2HQRA 4XLTA 1HF0A 3QYXA 5FWXB 4RSMA 4YGXB 1WIZA 1D1QA 1DG9A 3OMTA 1TLFA 2QXYA 2CROA 3Q41A 4IMJB 4Z59A 2O49A 3ZHMA 2N9UA 4MGEA 4NQRA 4RY9A 5IX8A 5T7BA 4S04A 1PUXA 1VLZA 1JYEA 4Z0NA 2FEPA 3A0UA 3LFTA 3HDGA 2FMHA 4PU3C 4I6UA 4LDAA 3DBIA 4MR7A 4JAVC 4OB4A 3N0XA 3CG4A 3UKJA 5KQGA 4X4EA 4IRXA 3BRSA 2E4ZA 1XWRA 1LCDA 2HQBA 3M6MD 4PEVA 1BDIA 3F51A 2IPAB 1U8TA 5IUKC 1OSLA 3TO5A 1QP7A 2RDMA 3H5OA 4MAAA 3S8QA 2E4YA 5IC5A 2GZUA 2LYLA 1POUA 1ZDMA 1DCFA 3JS5A 1ZN2A 1MB0A 3O21A 4HYEA 1FSPA 3O9XA 3GBPA 3GYBA 3LOPA 3S99A 3HO1A 2A6CA 3KSMA 2PPXA 3MYYA 5ABPA 2LPMA 4O5AA 1OCTC 3NNNA 3RVJA 1X2LA 4MRMB 4D6XA 3SCFA 3CECA 1GCGA 3RVOA 3H5LA 4TN5A 1AB5A 1ZS4A 5TQ0A 3HEBA 4YG7B 1F4VA 3LUGA 3QELA 4D74A 3CHYA 4ML3A 1ISSA 1NXOA 1JH9A 4W5NA 4MQFA 1W25A 1UTXA 3CFYA 4F8DA 3GN5A 4QYWA 4KRFA 3GRCA 2J48A 2AXZA 2JBAB 5JS2A 3OMWA 1MIHA 2IVQA 4JQDA 2NZVG 1Z16A 2E4UA 3MF4A 1DCKA 2YHBA 4MLDA 1NXXA 2A9QA 3U3WA 4EVQA 3A3KA 2CSFA 1LLIA 1WH6A 3JPYA 5TQ2A 1NATA 4W5OA 2B4AA 1YK1A 1ZHHA 1NXTA 2FQWA 2JVKA 2FXIA 2JVLA 3FFTA 3IP9A 3RVSA 4ETIA 2KEIA 3VK0A 3H5TA 2CWDA 3BS3A 1JLKA 3JVIA 4DN6A 2OQRA 1L5ZA 3H1GA 5IBQA 1B00A 4X4FA 3HUUA 2LUOA 2PKXA 4Z9AA 3BDNA 2AWIA 4KK3A 2CHEA 3N0RA 4FE7A 4TLMB 4Q7EA 5KI6A 1CEYA 4X4CA 1NXVA 4RXUA 3LMKA 4TMYA 3T6KA 5ED4A 1Y1LA 2A9RA 2R4QA 1YS6A 3SNKA 5BRJA 1YMUA 1TVMA 2IKSA 3RVLA 4J1XA 2E4WA 5JNWA 2F8SA 3MLFA 4CBVA 4TLLB 1A2OA 1NTRA 1RXIA 2ICTA 3H1FA 4NCAA 1JHZA 4LRQA 5TPZA 1U0SY 4IVZA 2FVYA 3L49A 1Y7YA 1FFWA 3I09A 5EWMA 1D4ZA 3JXBC 2IVBA 4NCBA 2F8TA 1RZRD 1R8JA 3IP5A 4I6RA 3OLXA 4H60A 4RY0A 4WXEA 3W9SA 3EJWA 3KYJB 3ILYA 3JY6A 1PRAA 4MS3A 8ABPA 1R69A 3QEMA 2H0AA 4PE5B 2EWTA 1UXDA 5HQJA 3ROTA 1U04A 4M88A 1B0NA
chains in the Genus database with same CATH superfamily
5E2BA 2CK3D 3OQMA 4REOA 5BORA 1LCCA 5D7BA 1J0DA 1DX9A 3LUFA 4RD0A 4ABYA 1HO3A 3D8UA 4FXPA 2XTJA 4ZI2A 1OYOA 2OP1A 3OU7A 2GZAA 2IU4A 4F71A 1DCTA 2XUFA 2UZ1B 3PQ3A 4EPTA 4Z3KA 1SKAA 2PXCA 5JH7B 4Z8YA 5LWHA 3HRHA 1CUYA 5AVVA 3H04A 3T3MB 5LQKA 2HA5A 2W9XA 3C6BA 1Y5IA 5ALGA 3ROEA 1SPBS 1XN1A 1NMXA 2GYYA 5FI5A 3KR9A 5GONA 3TZHA 2JIDA 2EATA 3I42A 2VJQA 4DM7A 3DMDA 1U2SA 3WK6A 2XVMA 3OPQA 1ISGA 2GN2A 3O4JA 3H5RA 1E63A 2XJ3A 1RWNA 2E4VA 1Z88A 4OKIA 4UQOA 5AIAA 4IUDS 1U7XA 3OD1A 4J6FA 2YASA 9ATCA 3INNA 2O5VA 4QYSA 2C5BA 2ZWPA 1VIAA 1C3EA 4JC0A 4M8SA 3DC7A 3U7GA 2ATCA 3ZOZA 4IH1A 4NDAA 2LDXA 3R7BA 3HZZA 4EIWA 1EHCA 3AONB 3NTLA 1GPDG 2Z6VA 1GT0C 1JXOA 2WD7A 4JEUA 1Q3KA 2OEPA 4IFBA 3N07A 2WOJA 3OQNA 3COVA 5KQRA 3C3MA 2PBFA 2WD9A 4OQZA 1N92A 1CUDA 1FEZA 2PX8A 3DAFA 3EPRA 1ZI6A 3EUWA 4N0MA 1PRYA 1DLJA 3AU8A 1ZS9A 4L76A 4DDUA 4BMZA 2YS6A 2UZIR 3SZGA 1L6IA 4JBWA 4DLVA 3O83A 4U63A 3THXA 3QX8A 3G17A 5CFRA 1Z18A 1ZQ1A 5E1BA 5TS2A 5HKAA 4OB6A 2QAJA 3GJ5A 1U2EA 4EPRA 3FPEA 2HFZA 2A1TS 3OMLA 4CG1A 4O4LA 5U1PA 3L1VA 3VI4B 5IXJA 2OHHA 3W2IA 4HVLA 5K7SA 3AF2A 4B81A 1CY8A 1B3BA 3EVFA 2EIHA 3MCTA 3T3PB 4L02A 4EY5A 1RAEA 5DXFA 3WGHA 1SCJA 3FLEA 1CUZA 1IULA 4MR8B 2B2XA 1K08A 1OLXB 1GPAA 3RYFA 1NLFA 3IP1A 4JP2A 3NS7A 4V0MA 3SS7X 4B9EA 2RG1A 4AJ4A 2FMUA 2BGLA 1CETA 5HF6A 1AKEA 3IOYA 1KORA 4X71A 1EGQA 4ZDWA 3FGZA 4Q4AB 4E21A 1RM5A 1R4NB 4N3CA 3TFQA 3ZU6A 3GWGA 1JEJA 3I1JA 421PA 3MTEA 1P2GA 4HDSB 3OH8A 3NORA 2ZJZA 3UK1A 4FDUA 5BSEA 1K6XA 1XAJA 3QV2A 3TS1A 1XJWA 3W3AH 1FTWA 3EW7A 3DB1A 2QD3A 1WMEA 3RZZA 3JU3A 3ZE2B 1BC5A 4P0QB 2C8JA 4IXDA 4HUQA 3T7KA 2AC2A 4H27A 4IHJF 1OD6A 3EXHC 2E87A 1VRVA 1YRLA 2QZ4A 3FPSA 3FTFA 1BG6A 4PO1A 2CGEA 3QLVA 3SYMA 2OBXA 1L5LA 1GCIA 3DD5A 3IBCA 4WZZA 4HADA 2AEFA 5HBGA 1PFVA 3R23A 5LQAA 1K7FB 1NIJA 4DLSA 1HGXA 4G1CA 4RJJA 3TTTA 4F46A 3GP8A 1KFKB 4JUBA 1W85B 4DMRA 2IVZA 4KAJA 5B5SA 1BAPA 1Q3HA 2EW8A 2IDZA 3ROPA 1HV8A 4X7RA 4BC1A 1EVYA 1TMGE 1VSUA 3ANSA 4TLEA 4Z9BA 4F21A 3O84A 3RUDA 1AG9A 3MTDA 1F0PA 3WE7A 2C31A 4DFDA 3EOAI 1MOZA 3LM8A 3EGVA 1GPNA 1Y4DE 3SLRA 1N0IA 4J0FA 1NBHA 4FZ3A 4AKSA 3EC1A 2IH5A 1XL0A 1FTSA 1MKYA 4TMTA 1AGYA 3HNOA 3WWCA 3K30A 1LB1B 3HUDA 2COUA 4P4SB 4XD7A 2PGDA 3DBHB 3TLYA 4CMKA 1P33A 4QQKA 5EMHA 4K81B 1QZTA 1NN1A 1P6QA 3LYHA 1ML4A 1NXPA 1ZJ5A 2HRCA 2JKYA 1BQ3A 2EFDB 5TDHA 1L1FA 2GN6A 3MTAA 4EPXA 4F2GA 2A5LA 5DE3A 1N5RA 2JPDA 2PUGA 1XQ9A 2P41A 4LYDA 2YUIA 1ZGJA 5IC4A 3WKAA 2OD9A 1Z8DA 2PUCA 1EP2B 1PGNA 2UV8A 2HUPA 3CPEA 2C2MA 3EHEA 5KYYB 2R8XA 1GFIA 3A3NA 3QWIA 4FUTA 4Q3LA 4EPVA 4O4JA 1UT6A 1SKYE 2P4EA 2YXPX 5AH0A 4YMUA 2B21A 1YGYA 1M6WA 2FE1A 2QENA 4Y6GB 4GF5A 2BGIA 2C88A 1NI4A 2WIKA 3CZAA 2BEJA 1BKYA 4LZWA 3Q7PA 2ZIUB 5C2JB 1L3CA 3E7DA 3TL3A 3IBFA 2JF0A 3K6SA 1MO6A 4I9NA 2J4FA 3IMKA 1ZXXA 4MR8A 1XR3A 2I1WA 1EDBA 5CM9C 1JQEA 1PEYA 3E3MA 4IJKA 4OGGA 2O2EA 1TTPB 2P1RA 3BORA 4I50F 5EC8A 4ZC8A 2QX9A 1LSOA 3OMXA 1NI5A 4MRMA 1P5RA 5JARA 1B1CA 1D0VA 3LLSA 4NU5A 4GRDA 1V45E 3N6VA 4LNHA 4AYWA 1DAGA 2O6LA 2R8BA 4MMXB 1O9GA 1XA3A 3RTEA 4IGFA 3S70A 4C4XA 4C7VA 4D42A 5JWOA 4DNOA 1U8YA 5J1TB 4W8GA 5PNTA 2EBYA 4RPCA 1V7CA 1A27A 1C81A 1JDSA 3IAUA 4JBXA 1GTMA 4Y0VA 5A7HA 4BFWA 2FU5C 3H13A 4L4SA 4DA7A 4EKNB 1EUYA 3I62A 4NQZA 2QV7A 3AERA 5CHYA 4UHFA 3MTIA 1RADA 3BD8A 4I66A 4QOFA 2ECPA 4LQLA 4TTSA 5A3RA 3EA0A 4MGIR 4CLOA 3QPBA 3E22B 1RP7A 1W4BA 3S2FA 4UUAA 2E85A 1F0YA 3BSFA 1UK6A 3FSEA 3G0GA 3BT7A 2FSVC 2LGJA 2ZFUA 4Y98A 3M82A 3ZDRA 4LC1A 2A5YB 3ZW9A 1WCYA 1XPOA 3HU2A 4H3SA 5DP1A 3GLHB 1JHDA 1Z5ZA 1W5AA 3CXUA 1DX6A 1K3FA 2P5SA 2B7LA 4D96A 4DLRA 4PLWA 2PRSA 1SXJA 3RARA 1W0KD 2B1IA 3P2MA 1RQRA 4JUCA 4XR4A 3VDMA 5BSWA 3GLQA 1XC7A 3O4RA 3K71B 3FR7A 1W4LA 3Q5GA 2FDRA 3MGAA 1ZJYA 4M46A 2ZW9A 4DL9A 3C74A 3RT9A 4MDHA 3WGMA 3H9GA 3K2BA 1ZWKA 1C4XA 4P3OA 4QO7A 4R8LA 2YMMA 2L18A 4W7IA 4ZEWA 4EA9A 4Z5XA 5C7OO 4JI0B 3AUYA 2GM5A 4B46A 1PU2A 1DZ3A 4FJ1A 4MUNA 4C2UA 3WYEA 2Q3JA 2W2LA 1JEOA 3ICCA 5DLEA 5C1BA 2XUKA 1P2VA 1Z6GA 2YUTA 3MIZA 3MT8A 5DF1A 4E2FA 1TXGA 2QNRA 1SBNE 1S3SA 3GVHA 1HZZC 4MGYR 2I6UA 1LNSA 2Y2VA 1U5BA 1MO3A 3MFYA 1T15A 3MUOA 5E3JA 1A9RA 1P4GA 2HZBA 2KI5A 3EG5A 2IYPA 4MR9B 1SBQA 3FNBA 1LW6E 3OZDA 4N8SA 1E69A 4IRUB 1ZBDA 4BNLA 1RXSA 4EFNA 1K89A 4Y3UA 4IUBS 4M53A 3FSGD 3HY4A 2G9VA 2KHZA 3QTLA 1T2UA 2EJCA 4AIRA 2GZHA 5LA6B 3O8CA 2VP6A 2ZJBA 5DU2A 4DILA 3NOVA 2LIVA 3RADC 1OXUA 3G7SA 4QJ4A 1KARA 2W2KA 4N82A 1XWFA 3E15A 4UEWA 2F67A 3GJ7A 3BIFA 3O91A 4I5IA 4KH0A 3QBJA 1JB9A 4LWPA 1N4AA 2H0RA 3SG0A 4QZVA 5HE8A 1HA3A 1YS1X 2BFDB 5REQA 2RAFA 3WNBA 1NVXQ 1WP4A 3Q7TA 5JSYA 2ORWA 3T4XA 4CM4B 1T2FA 3NUZA 2LLWA 3FCCA 1Y82A 2JBAA 1BX0A 4DDVA 4PCUA 4MV7A 3R7AA 3LX5A 1E66A 2VF8A 2IODA 3OFSA 3OVMA 4BP3A 3ZD8A 5CMLA 5J4YA 3OZAA 4QDKA 5DFAA 5FX2A 4G23A 5J43A 1JNYA 5KAPA 3HCBA 1SBZA 3T06B 3W9BA 2C9OA 2WWFA 5KNDH 4XM2A 1AHNA 2ZCJA 1JLLA 1LRKA 4HDMA 1V37A 4PBRA 4Q6WA 4I6GA 1I6MA 1ORRA 1TL7C 2X2EA 4B8WA 3V1KA 3TVDA 3WK5A 2ODRD 3QVKA 3ZW8A 4UQLA 2BTOA 2OGWA 3R3ZA 4HQ0A 2VHXA 4NESA 1G7TA 4H16A 1S9HA 4PCVA 3P9QA 1R4NA 4B0PA 4IKOA 2ZUSA 3I73A 4C0KA 1R0KA 2H2GA 5FUBA 3RG8A 4UQPA 1XZJA 1OLUA 1I51A 2DHRA 3RYCB 1Y1TA 5EY5B 2CMGA 4R1TA 4JC8A 4G4IA 2CYAA 1TUBA 1R66A 4HLUC 1T8WA 4LXYA 1E1CA 1NNUA 3E9CA 4P82A 4HC4A 4AUMA 3PI7A 2IEGA 5DLQC 2C5LA 2WAAA 2X3UA 5EFZA 4C0WA 3L82B 1TJYA 3GXOA 4M9SA 1WPGA 4U7TB 5BSFA 1PCXA 2FE4A 5HRUA 1C8KA 2AC4A 4ZVSA 4ZOLA 2M6SA 4TUYB 1GR0A 1IJFA 3EDMA 3ZD6A 4IOJA 4YJDA 4C3VA 3VHXA 1H0HA 1TZBA 3QELB 1S7GA 2R7AA 2VXOA 4QYIB 3HR8A 4MUFA 1NF2A 3HB0A 1N3LA 5MN5A 5J2TA 4GXRA 1X86B 1C2TA 4HR7A 4DRXA 3H2BA 4JR1A 1LPPA 2NQ8A 2CV0A 4R2JA 2WMOB 3G5UA 4GM4A 4MVJD 5BXYA 1V2HE 2XJ9A 2R1VA 1Q0QA 3EZ6A 4BLSA 3DZIA 3QVMA 1Z12A 5BSKA 5LXTB 3P97A 3L0ZA 2JKVA 5LLDA 4BFSA 1LDMA 2HMYB 5K99A 5CB4B 1M6VB 4HDQB 5EE5B 3V7FA 2HU5A 2W2QA 4ZIRA 4DIOA 2BMVA 2IZ5A 1CJGA 4HEA6 5ICCA 2ZYWX 5FTMA 3TNDA 1R0ZA 3NT5A 3K8QA 1C1XA 4OKSA 4RSMA 1M66A 3ABRB 4HDMB 3GMIA 4U39A 2CUZA 5LMNB 10MHA 2IY7A 1GRCA 2OPBA 2X5KO 4U5QA 5H4GA 5IWAB 1RABA 3JWEA 2ZULA 3WLPA 2G77B 1H66A 3PUIA 3QIAA 2C2HA 4QTZA 3I9OA 3F7TA 4V0RA 2DFLA 2I54A 2Q6VA 3GC6A 4E2XA 4LF6B 2YWCA 1EFVA 3FPKA 4B4WA 3WGIA 1TZ2A 5E9AA 3CPSA 5B7GA 3JYHA 3CLTD 2BRUA 1BFDA 3HZRA 3PITA 3IUYA 1Z4IA 3VHRA 2CXHA 2FHPA 4WK2B 3RK4A 3UEOA 1U8TA 3JASA 1G59A 3DHNA 4RKEA 1VPLA 4BJHB 1DFHA 2C7OA 2D1FA 1QGDA 2E4YA 2A33A 1Q5PA 3QKRB 4PPFA 3QKIA 3EZLA 4KIFA 2NO9A 1CRWG 4UTRA 2EJVA 1BCRA 2QW8A 3DZHA 3QEJA 4BPRA 2BUAA 3NEAA 3ONDA 4DSOA 3KSMA 3UJAA 3IAAA 4PINA 2VDVE 3TKAA 3VR1A 3ZHOA 2ZSEA 5I7EA 1GAQA 2CEAA 3CX8A 4YR9A 1IZYA 1P3Y1 3KYCB 4GP6A 4UDXX 3B38A 1QLHA 1N7IA 1QKIA 4L57A 1QQTA 4IY1A 3V55A 3HI6A 3JAWB 2WFAA 1N1EA 4XOIA 4CKBB 2ZUWA 1BE8A 3FNRA 3CIFA 1RIFA 1TEHA 3F71A 4RELA 4AF7A 1CUVA 2O2JA 3B7WA 3OTOB 4AS1A 1Q14A 1W25A 3H2ZA 5IJAA 3KAJA 3R6GA 1YFKA 2P68A 3B36A 4HV4A 4M1SA 1RZUA 3KD3A 2XYGA 1KMNA 4MV9A 5DZSA 3T5BA 1MJFA 4XE5A 4W1PA 2KMLA 3NDIA 1Y48E 3WBJA 5E7JA 3CWQA 3GP5A 2B30A 4KODA 4HBGA 2CFSA 3HWSA 3JD1A 2OK7A 4L16A 3K6KA 4L6AA 4TTAA 5A62A 3IT2A 2JVLA 2Q0XA 3C48A 2ZYDA 4FC6A 1BQ4A 1IC6A 1E1DA 2ET6A 1P0IA 3QYFA 4JNCA 5ALZA 3HKEB 1NR5A 4O02B 5HZKA 4UAGA 1Y98A 2O5EA 1G16A 4LJKA 3DWGA 4Z9AA 2CL6X 4HB4A 4E46A 2P2DA 4LPSA 1A8PA 3RC9A 4CDRA 5AK3A 3AX6A 4Q3DA 1NHWA 4TVKA 2NGRA 2PH3A 3BXFA 3TTSA 3OAAA 3L2OB 3F5QA 4J1XA 5J4VA 1U11A 1YQUA 2P9GA 4UPDA 3BH6A 2VJKA 3L9XA 3OZGA 1Q95A 1JHXA 2GNPA 3AERB 3STWA 2A8YA 4TVOA 1BMDA 2FVYA 1BMTA 4G0NA 1YJBA 4FDLA 4MVCA 5FOXA 1G21E 4IW3B 4EDHA 1YDFA 2VP9A 4DBLC 4DVJA 3MNFA 3VKVA 3I04M 3K31A 3K9HA 5ECYA 2C5HA 3U4IA 2WUVA 3V3KA 3W9SA 3JY6A 2QR5A 4XI9A 3IVCA 2Q50A 5JRDS 3L43A 2H0AA 1QOPB 3L6CA 1YC5A 2HMSA 3OLWA 4R1QA 3UUGA 3D4PA 3ZDCA 5SY6A 5I01A 3V8BA 5E9WA 5PGMA 4S0XA 4MINA 3H1PA 4AQDA 3TZCA 4EJMA 2IS1A 1B3RA 1Z5UA 2W22A 3IUSA 3KJQA 6GPBA 5LLSA 4BHTA 5CIWA 1A8IA 2I9PA 3KAQA 4KWHA 5KYVA 4JJGA 2Y0PA 4BJ1A 4IHAA 1OFVA 1AGRA 3KQHA 2DR2A 4NARA 4M37A 1PN3A 4TMFA 3WLQA 4FN3A 3LC7O 3V46A 4DMUB 1XG5A 2ANCA 2O1XA 1V11A 4F5ZA 2ROQA 4JLKA 1N2SA 5K3CA 1NXQA 3HMQA 4ZTBA 3ZGOA 1CEQA 2LR0A 1EA7A 3BWEA 4GL4A 4MA0A 3RU7A 1YR2A 3WHLA 4ZQFA 1JPJA 5EUQB 2PXTA 4FYWA 3CUKA 1IRIA 1APBA 1UT5A 2XUDA 4MICA 4CTJA 1NZFA 3E0XA 3NROA 1TJ3A 3P94A 5E6UA 2FSHA 2PWAA 1TCUA 2AG0A 2G8NA 3E5RA 3H75A 4WX2B 4B6JA 3PLRA 1AGXA 4BS9A 1Z2OX 2A0KA 4G97A 5SV2A 4DJAA 1A71A 1ETUA 1UBOS 5DB4A 3DBHA 4EJ6A 3O4FA 1WMDA 2AOUB 4YACA 4BUJA 5ALTA 1GPH1 3Q3IA 2QZSA 1CULC 2QUBA 4WZAA 2WKRA 3GO4A 1BE0A 1LK0A 1KYVA 4IDPA 5LD2C 4Z4IA 2Q8PA 5D87A 2FUKA 3LQXA 2E5WA 4Z9YA 1MFPA 5IAEA 1WD5A 2GH1A 3C8HA 4DWVA 1A1VA 4NFLA 4UJ3A 3W1WA 4FE3A 2E7ZA 3GT7A 1DAIA 3ZDBA 2NTVA 4I4CA 3RRZA 1U8CB 3ZWYA 4A8TA 1YHZA 5ICEA 1VJ0A 1ODFA 1BO6A 1BJKA 1QE5A 1FDOA 3CRNA 2EBUA 3SIXA 2Z9BA 1XWIA 1I4TD 1VL0A 1YBFA 3UICA 2H2HA 4DDWA 4NZOA 1W7AA 4Y2TA 3ZJUA 1L4HA 5LLTA 2WSSD 3ND8A 4H3HB 4IOMA 3ADDA 1RFGE 1N0VC 1TQ8A 4L5YA 1JDVA 1SQ8A 3ZLJA 1WMBA 4FSHA 4DZRA 4QFCA 1QNFA 2PRZA 4P58A 5HKBA 4MTCA 1S0UA 4QVKA 2FEKA 1QZZA 3R7WA 3TKYA 3FKSD 4ZYWA 1ODLA 4H1UA 5IVPA 1X0XA 1YHYA 2H7VA 3N0VA 5B1EA 3CWZA 4L3WA 5E6RA 5ANRB 3DH0A 4ZDIA 4X54A 4RD3A 5E4FA 4CKWA 3GT3A 3UK7A 3D8HA 1RYFA 2NV2B 3ZHZA 1KIFA 5G0SA 3CSDA 4IIJF 5AOVA 5EXPA 3ILSA 5F33A 5DI9A 3R7LA 4L8YA 5C31A 1DOAA 1F0KA 4A0QA 3RVMA 4PGFA 4AXBA 3DLBA 1A9XA 1S4MA 1TCBA 2SKEA 3TOCA 4X66B 2JL1A 1CJVC 2NQ2C 1XDWA 4TM7A 3ZLBA 1PL8A 1TPZA 2UVQA 1AS2A 4J4TA 1CRQA 1Z6QA 3R6WA 1UDWA 2UXBB 4PZ9A 1Z33A 2N1MA 5JBNA 1A4RA 1AQUA 1AZWA 1L4MA 2ZZMA 4GGOA 3E9MA 2QZJA 3ND5A 3RW9A 5JPCA 2ZRIA 2ZJ5A 4H0NA 3DS8A 5JDCA 1HDCA 1VPEA 2QVBA 3KQNA 2VAXA 5EJ4A 3T5AA 2Q07A 4AJOA 1BMFD 2RHWA 3BMNB 1SD5A 2C3MA 2Q49A 2ZOSA 5JZOA 2ZRGA 4H4DA 1BOFA 2JGDA 3W77A 4BZZA 2O8EB 3FXAA 3R7DA 3X2EA 1I3LA 3VYTB 3TXAA 2HIAA 3GAMA 1QR2A 2BFOA 3N8IA 1NNSA 4N6OA 4AJLA 1UXHA 4GYYA 3U62A 2IYLD 4PVCA 4HDNB 4FBLA 2BLLA 1GLNA 2ZYRA 3NT2A 1HBJA 1ZK2A 4K87A 3RREA 4R0VA 1UJNA 4D9GA 1FYEA 3QU7A 3GLFE 1XA0A 3IBSA 2P2NA 4I2VA 4O1HA 2ZRNA 2E5FA 4IX9A 4NBKA 4QASA 1XRJA 5CTAA 1E98A 1PNTA 2NACA 4Q7KA 1U1IA 5JADA 2GR9A 5HMMA 3U6KA 2X23A 3S8MA 3AJAA 2GPWA 4W8HA 1OH6A 2F3SA 5B6IA 5E1OA 2CBGA 4LCJA 2BVNA 4GI3A 2WJ4A 2XDQB 3OC0A 2ZKIA 3UO8B 2X6QA 3QVJA 4CKEB 2BM0A 2ZB4A 1D4FA 2IZ6A 3IP6A 3KAPA 4DLPA 4Q4CA 2QMQA 4QYXA 2BFMA 5FUWA 2DTXA 4ESHA 5KKNB 4XVUA 2L69A 1RU3A 1WCIB 4LYFA 1SQ0A 3WYCA 3D6NB 3BX1A 3ESDA 3UWOA 4H7PA 2N0SA 3OHMA 1BHSA 1OLSA 2VYFA 2VHTA 3ERCA 1BKSB 2YHUA 3MBOA 5BWLA 1QLJA 5KNLA 1BHQ1 1RKVA 2Q3HA 3R44A 4FI3C 4MQ5A 3N39C 4U02A 2ZPUA 1NDUA 4TV8F 2YY7A 2GX6A 4ZJYA 4QAQA 4P36A 4J0DA 3DE4X 4URUR 1CQZA 1EKXA 5EP1A 3J81k 1UC9A 2RJ3A 4NEHB 1TM1E 4R2MA 5F2KA 1Z4LA 2BHTA 2FJ0A 2YWFA 2VHQA 3TD9A 3RLFA 2L49A 5DEIA 1NUAA 3AVYA 2X4DA 3LUHA 5IZCA 1NPDA 5CNIA 4HQOA 5CVEA 3G88A 1T9AA 4FBIA 4B3RB 1RZSA 1DZIA 2X7JA 1D3AA 5JEEA 4ASUA 1XZCA 4QXOA 1VLMA 1N2CB 2NYUA 1P72A 3F98A 3SCGA 4UXHA 3AY3A 4X65B 5AVXA 1PFUA 3ST7A 4OBMA 3RVDA 3ZK9A 4B87A 4S05A 2WJJA 2FPPB 4RHFA 1XQ1A 4CMIB 5K3FA 5TPWA 2EU8A 4MROA 1M0TA 3MPOA 3NC0C 2K5UA 3F0TA 3TZLA 4M0MA 5K3FB 4G0QA 4EUSA 4J1WA 2YS7A 4X4DA 3TCNA 3BFVA 3S8EA 2V55B 5AJYA 5SZIA 2BHRA 2KBEA 4HVCA 3WLHA 3AF0A 2WUGA 3OSUA 4OHOA 5DSTA 4B6EA 4E5KA 1B74A 1CK4A 3HWX1 1WY5A 3OJOA 2KWIA 2O2ZA 3A3YA 4E5MA 2BYTA 1EK5A 2JGMA 4HLUA 1XK7A 4WASA 4HKTA 2RCYA 4OYLA 1I33A 5AESA 2OO5A 1G8YA 4QFDA 4RGQA 1EDDA 5IVHA 1NLMA 4P32A 2GJAA 2PLFA 2QTTA 4H6WA 4IBOA 3TUIC 1HFKA 4JMLA 3BXPA 3ETHA 4X91A 1Z29A 3RSZA 1E8NA 4MP3A 4YUWA 3ZBUA 3JQ8B 5FULA 5KMGA 4M36A 4IFTA 3L9WA 4A23A 3C6XA 3CRZA 5BO5A 1B15A 4DZTA 3I1FA 1W52X 3QMWA 3N86A 4NCHA 2VK2A 2HIGA 1CZNA 1F8YA 4YAJA 4EPWA 4H08A 4JL5A 3PZBA 4PGHA 3HB9A 1ZZ6A 2OO3A 3KT6A 4AZ0A 2CFCA 3VGPA 1QK5A 1RPJA 2XTAA 2SBTA 1I4LD 4U7PB 5IAOA 1DRJA 1Z7YA 4G5HA 1CIVA 1OT3A 2QRZA 2V4ZA 3ZY3A 4IXNA 2JLRA 1INLA 3AL0C 1M9NA 3ENWA 4BV8A 1N25A 4IKPA 4KO2S 4MVJE 2PUBA 4CMJA 1DQYA 4K28A 1NBOA 1SUAA 4TQUS 4G0XA 4C4AA 1PRUA 1ST2A 3BM5A 2F3PA 3N8KA 4AUEA 1ZCAA 4G0YA 3CMCO 4IIUA 1CUAA 2KEJA 1LBEA 4N3AA 4REMA 4CF4A 5DTMA 3JVDA 4RULA 1LZLA 4H59A 4LRUA 1EXDA 3SC3A 1R88A 5G2OA 4S1OA 4CEJB 3M9WA 3O8BA 1USVA 3GZ4A 3SD7A 1OI3A 4I9GA 4ZVRA 5JYDA 1QRRA 1MXFA 3UWPA 1WA5A 5CFLA 4QDJA 1BCSA 2GO7A 1Y80A 3EGIA 5KOHB 4WKCA 2XHEA 1F5NA 2HF8A 4M0FA 1PSZA 2OKGA 4P7BA 3GFPA 3QXXA 1CJSA 3RYIB 4F4DA 1A4UA 1MMFB 3PVZA 1QVWA 2WW8A 1NDHA 2X8BA 1Z36A 4KMOA 4MVJG 4RANA 3SXPA 2QMHA 3QEBZ 2PY6A 5F9HA 2IP4A 2OR1L 3HH8A 4X6YA 4E0BA 4EYGA 1FNDA 2O7QA 2QY6A 3IUQA 3RFVA 3DMYA 3CEPB 5HP4A 3KUKA 5D5HA 2ATIA 2X4LA 4C3ZA 1FC0A 4GQBA 1Y0BA 1VJRA 4J0EA 2ONYA 1TQDA 1J0AA 4IV5A 3X2SA 3G5GA 1DHRA 2HW8A 2EV9A 2J3DA 4H3KB 4HDCA 3G0TA 3WHPA 4XWKA 2A78A 2GEKA 1M73E 2O2XA 2W00A 2WSSA 4GMGA 4OIFA 4P80A 3U7RA 1S1CA 1I36A 5LNK6 1T6XA 5LUAA 2NTYC 3IPLA 1JXMA 3QWAA 1FP4B 1JH8A 1UJ5A 2V7VA 5BR1A 4L5IA 5JI2E 1AN0A 4M1KA 1K8ZB 4GBJA 4PG7A 1XHEA 2P2YA 4M6WB 5AICA 5BSUA 4KQ9A 4RJKA 2FRVA 4UVHA 2WNSA 4CR7A 4X1KA 1UM9B 4I5EA 4XTRA 5EKXA 5G02A 3WL6A 1H65A 1JEAA 1DAKA 2E6UX 1WMSA 3LT4A 1YI1A 2QORA 4BY9E 5CHEA 5FWYA 1T0BA 2ZSDA 2XQFA 1FRVA 3H8WA 2AI3A 3NM4A 5WRFA 1K06A 4IQGA 5DYIA 3ADCA 4P35A 3M3DA 2TYSB 1GGHA 2GD1O 2VDMB 1FLNA 2DBZA 4D80A 1RWWA 1Z5VA 3COYA 4HAWA 3O7WA 2PJUA 3TEJA 5KQSA 2DQ4A 3HV2A 2IS2A 3L02A 3AVQA 4M1OA 4R1UA 5AD1A 2OCYC 3AF4A 4K03A 4E2YA 1NUPA 2MYPA 2IX3A 1I3NA 2XNDA 2FYTA 4FGWA 3VR5H 3DDUA 1NYRA 2CJYA 4NMMA 4FMDB 5CEJA 5ALLA 4CXMA 5NULA 3TLJA 2YQ5A 5EWLB 4PIVA 5LQDA 1P2UA 3R2JA 2JLQA 1XNQB 5EKSA 2PU5A 5BQXA 2D4AA 2HQRA 4TZ0A 4Q1VA 4Q1DA 1E6UA 1QCCA 3RHZA 5I4KA 2AF3C 2E9SA 2D62A 3WLMA 3OQ6A 3U40A 1RMQA 1AK9A 2Y1LA 2YJ6A 3MOIA 4WZ6A 2ZANA 1OAKA 4NEGA 3IRUA 4MGKR 4KDCA 3W5CA 3ZQJA 1GZ6A 4PU3C 5E6RB 4BFVA 5HYVA 2FZKA 2VDQB 2BT4A 3LXUX 4JBYA 2KE5A 4O29A 1SQ6A 1DPFA 2UDPA 4YAGA 1ILWA 4MW4A 4L8WB 3QSGA 5JAOA 2Z6QA 2R6GA 1DO0A 4DF3A 5IUKC 3LK6A 2B3TA 3EMDA 4LJ8A 5IC5A 1CC1S 4FCWA 2I87A 2Y92A 1EZ4A 4QOHA 3D8NA 3HYCA 3SDZA 5M5BA 1IL0A 1WHTA 3OHPA 1B93A 4X20B 3GYBA 5DN6A 3S99A 3KXLA 4FDAA 4Y6QA 4BO1A 1BCRB 2PPXA 1I4WA 1L7BA 1R4MA 1RKUA 2TMDA 4GMKA 4QDXA 3SFVA 1SU7A 3GGOA 3KP1A 5L3SA 3WGZA 1TAHA 3NBAA 1EK1A 3LOUA 5CJ2A 3MLEA 3KZOA 2CF5A 4HGYA 2O2SA 1KERA 5GJVC 5K3DA 4H35A 1K4MA 4QE3A 4DGQA 1F4VA 1D04A 4UAJA 1PAUA 3ZC3A 2ADMA 2QMUA 3BHNA 2V6BA 4DR4B 5FNZA 3GN5A 1RM0A 2I65A 3NWJA 4H17A 2DWQA 4INPA 1KYTA 1JAIA 3C14C 3RU3A 2R8RA 3AM3A 3S1AB 1Z0SA 4IAOA 4MLDA 5FPKA 2P79A 1LLIA 1RKXA 2HJRA 3AM5A 3HCNA 3TOZA 1G2IA 2YOGA 3EPHA 1KPGA 1R8XA 5ES3A 1K6MA 3ORQA 2XVZA 3G2HA 1NYTA 1V5GA 3G59A 4HVTA 2XY4A 3T3HA 2ONCA 2O5CA 2GCIA 1J2JA 4O2AB 3H5TA 3QQPA 2JJ1D 2IS4A 3RANA 3H11B 3C6ZA 4F9EA 2W6IA 3DBRA 3Q3GE 1H94A 4ATNA 2PM8A 3CUWA 4IYJA 2LKDA 3AEYA 3DJFA 3RIMA 3N0RA 5KI6A 2UU9B 4BL5A 3DR5A 4EYKA 2D0PB 3LMKA 1NVMB 2RKBA 3T6KA 3LTNC 2JLUA 2BKAA 4OI0A 1VE7A 3I8SA 2NU7A 4Q93A 4IS3A 4U9UA 3PFFA 4MUGA 3JYQA 5TRTA 4GE0A 2ZJFA 4RHXA 4OI1A 3BVPA 3D0QA 4KMSA 3WYNA 5A4MS 1H93A 2IV2X 2BFFB 4FFNA 3UAOA 2P91A 1T2VA 1U94A 1IN4A 4NNJA 3VSCA 1N2CE 1UDXA 3OICA 3O4IA 2YC4C 2IWRA 1NUSA 5H5JA 4L0MA 3WS7A 2CL0X 2H5JA 1N6LA 2I4OA 2O50A 2BCGY 2RHTA 3B1JA 1ODIA 3MGGA 3IR6A 2VPTA 1BD4A 2ZJ1A 1ZI8A 4I4IA 1D7OA 1UC8A 3BG5A 3W4JA 3WLEA 4OHVA 2OL4A 3C3AA 3DG9A 5K8UA 1G7SA 1E4EA 1N2BA 1UKAA 4C4ZA 4C4PA 5IDXA 3BD9A 4HTAA 2V7QD 2YZKA 4N8EA 3K05A 1R6BX 2ZJ3A 4RCVA 2P30A 3C6KA 3D8BA 3DDCA 4D25A 1WXGA 1KZ9A 2DLDA 3M5CA 4OBXA 4ZYZA 4ZOAA 3OLVA 3RHFA 3ESBA 3USZA 2JFGA 2QSUA 3EQ8A 5IVKA 5EESA 5TXGA 1VIMA 3CLTC 1G2QA 1Y5LA 1E3OC 4NICA 4CCSA 5JNUA 3A6DA 3VU9A 1T9BA 5J2UA 3CINA 1Z08A 1VDMA 3UK6A 3CVYA 2KX7A 3ANTA 1CR2A 3N2EA 3ZGYA 4XIFA 3TJRA 3IR5A 1JI0A 2B4TO 4NLLA 4YRFA 5DNVA 3VPXA 4M1WA 3V4FA 3EEOA 3QKRA 3CO0S 1JI3A 4GSYA 4JUIA 2DWPA 3DJYA 1UKEA 2JAUA 3IAM6 2HCSA 2FZLA 2XE4A 3HR7A 3JRWA 5G0VA 2QVZX 2RFLA 4LAFA 2RGBA 4F5WA 1V8FA 2IU3A 2WIDA 3G6WA 5BMVB 4X4IA 1JKIA 2XSDC 4WPGA 4WL0A 4RVUA 1PW7A 3VJRA 4B6RA 1GGVA 1F8UA 3F5MA 4QDZA 4WEQA 1EVLA 1J21A 1C9DB 2Z04A 4WOBA 4CKBA 2ISQA 3IMGA 4YJ3A 1E5DA 1HWYA 4H77A 2H65A 3ORFA 1PD1A 3A2MA 1XTBA 3E8SA 5JJCA 2ZAOA 1JTEA 4BZWA 2LV8A 5ESXA 1F6DA 1QK4A 3IQHX 3PDIB 1SBHA 4GRIA 2AVNA 4W82A 1WETA 4LJRA 4BNTA 4QWWA 3MJEA 2ZSAA 3BL5A 4D46A 1R00A 4JVMA 5ALKA 1FJHA 3KOUA 4MUYA 3RTBA 3KS9A 3ESQA 1TAQA 3GZNB 4EFLA 4YXFA 3NO4A 1QO0A 3AUUA 2D2VA 4W9NC 4Y2RA 2I2WA 4AMBA 4G8BA 5BWMA 2BL4A 3BWXA 4ZGWA 3JRNA 1FCJA 1LTHR 1RVDA 3U5ZB 3CZQA 2GSWA 3R3VA 1ODTC 2ZXFA 5LQRA 4ZZ3A 1FXWF 1AKVA 3A27A 3IB6A 4PHFA 4BKPA 2BHLA 3ZLVA 4E13A 4UUOA 4JI8B 1JFVA 3FUXA 2I55A 2VJLA 4UAUA 3WMEA 1KZYC 4LTDA 4CL3A 1ONNA 1THMA 3KWFA 5KSWB 5AJWA 4GM1A 4CJXA 2HSGA 2WV9A 2DVMA 3I76A 3M6WA 5JD5A 1DAPA 3F73A 1BD3A 4OX9B 4HRVA 4CGYA 4YJHB 1FZTA 1BGVA 1E3EA 1VG1A 3CS3A 3Q8WA 4FLEA 4TV9F 4EBBA 1YVRA 4YWHA 1FUUA 1OJ7A 3SKYA 3C7DB 3K9QO 1DT3A 1F3OA 2AXPA 4ENPA 1F8GA 1RAGA 1RXUA 3CKYA 2A0XA 4FCVA 4J0QA 4E4RA 1KJ9A 1I2CA 3AGQA 1XZGA 2DSTA 3WMFA 4LCBA 2BFBA 3MJFA 4RVNA 3G3EA 4HX9A 1XVLA 1VZ2A 3EWNA 2JW5A 3EBPA 2R65A 4R98A 3SCHA 3DTNA 4DUYB 5HM8A 2QRGA 3PT9A 4IIXA 2WAOA 3IAFA 1E2BA 1CQTA 3K2EA 3WWOA 3FSGA 1JKMA 1M2EA 1J06A 2VEOA 2YW2A 3LQ2A 5JDIA 3A8TA 1CNFA 1QAOA 5HW0A 3OX4A 4MRRA 4XM0A 2I1LA 4AN0A 1Y9JA 2DJ5A 2WSLA 4I14A 5FUVA 2V1UA 3JQAD 1DHTA 1U9ZA 2IXTA 2OSBA 3WRYC 1NONA 3QEKA 2JATA 4YJFB 1P2SA 3S3TA 4CMAA 2C9CA 4IZ6A 1CR4A 2X5OA 5FQOA 1H2WA 1ZNXA 3Q3JB 1QTQA 4Y2YA 4KV7A 3P9CA 4OKNA 2C03A 3S1AA 3VYUB 3EF1A 4I19A 2DJIA 4NMWA 1AOXA 2G9UA 3F6RA 3VR5D 1FYXA 4A8JA 3Q9UA 2IYNA 4D43A 4TTPA 2RGNC 1RCUA 4D3FA 4Y1FA 3D3QA 2YRXA 1VCHA 4HDKB 3ZHBA 4CM4A 2WTUA 2IUUA 5CCEA 3CZ9A 3UJ9A 4LE2A 2GILA 3AF5A 3PFCA 4JOSA 5H82A 5B57C 1VI6A 5T4EA 2GD2A 1W36C 4TS1A 3RRYA 4OQFA 3LFUA 1XL1A 2PZGA 2GASA 3EIHA 5LZ9A 2DPGA 1QHHB 3L5KA 4S2UA 5M2QA 2Z1NA 4Q24A 3G2JA 2OM6A 5AM1A 5AKLA 1EGHA 5EHNA 2FN3A 2Q9BA 2FSUA 1S4QA 3VR6A 5BYBA 2LP4Y 5FBHA 3QXCA 1FFBA 2H8RA 1G5RA 1MH9A 2HWUA 4H1TA 4K9OA 4K6FA 1XWWA 4UE2A 3V33A 4DCTA 3PTAA 4YMSA 4Y2HA 5B12A 1LPAB 1RWKA 4P3KA 3ROMA 2BDTA 1XHFA 1O0BA 3K8ZA 3K1ZA 2X41A 1VLHA 4IJQA 5SZHB 1U3VA 3QP9A 3PGVA 3W04A 1TOAA 3FOBA 2DPMA 2JI7A 4PLGA 4PHCA 4KX3A 1G0OA 3AFMA 1J2UA 3DT8A 1L8QA 2A86A 3RBZA 1P9LA 1SHUX 3VC3A 2AOXA 2IV3A 3K15A 3DO6A 4NOJA 3AGPA 1TF2A 3OO1A 1LY1A 2G5PA 1MT3A 1QIMA 3BMQA 3K1AA 2CHGA 2PMWB 4YQEA 3I8XA 2B1RA 4HRYA 3HM9A 4GI2A 3W7VA 3DKIA 4TKVA 1O0CA 4DCOA 3ZU5A 5J9FA 4G4SP 1E2KA 4R2HA 4S1VA 5B37A 1GXSA 3QWGA 4Q19A 5HRCA 4UM7A 1CG6A 1OYYA 1K3TA 3FMGA 4X3PA 2ZVQX 1MENA 3SZMA 2PJRA 2HT6A 3IDOA 2XB8A 1YDEA 4DPMA 3WGVA 3MCWA 4UCXA 3EDOA 2HC9A 4P4UA 2DKNA 3FPFA 1WUIS 2FWIA 2HGZA 2R60A 2W6PA 2YBEA 1XB2A 3A05A 4IIYA 2AMFA 3ZIDA 3GJQA 3N8NA 1QIGA 3AESA 1HNZB 2B4KA 1T9DA 1YH3A 3H2HA 4CEIB 2L19A 4WKOA 3JQRA 3OM1A 1ZMOA 4XZ3A 5D00A 2GAOA 2DBVO 2G67A 3KYIB 3JV7A 4BKOA 3FFXA 4LZZA 4G0PA 3TX2A 1E79D 1REQB 3L7NA 3FCAA 5C8ZA 1SK8A 5KYXB 1CY6A 4XOUA 1SUFA 1ZOPA 3HB7A 3VX4A 1G4HA 4BKRA 3U3KA 5AM2A 6REQB 3UMRA 2W2VA 2AXEA 1GZ5A 2MMCA 3H05A 1XRSB 1URPA 1U0BB 3ABZA 1QORA 2GLXA 3DYBA 4UCQA 3BWBA 3NPMA 1HTTA 1LLCA 2VATA 3GFRA 1XBTA 4GC5A 3EB9A 4D9CA 3HK2A 2VDKB 2HCBA 1EH5A 3I2IA 4M0DA 4JBLA 3UJNA 2P75A 4PHTA 1YCGA 2J0QA 3KQYA 2I03A 4NECA 4EY3A 1W30A 3DBRB 4ON9A 4YN3A 3TX6A 1PJAA 3CZCA 3Q2OA 4CLRA 4MR7B 3E6AA 1AXEA 2FCAA 3UOAB 5CAEA 4L78A 3G0HA 1KEVA 1I1OA 1DTWA 3JYOA 3N2GA 4ZPJA 5KTPA 1GGJA 4WOPA 4RL4A 4WLVA 3F8WA 1II8A 3E03A 4Z86A 1JPNA 5AFSA 3M33A 2HHAA 3FDZA 2BTQA 2Y67A 3ZCTA 1IHUA 1MX3A 4LKOA 3NHZA 5DEOA 4O1IA 2O7RA 4AB1A 2ZETA 2JLYA 2Z9DA 4H7IA 1SCBA 2CDNA 3O82A 2OY0A 1CLEA 1K5PA 1QB7A 5JJLA 1BU5A 2OVFA 3KOMA 4JI5B 5HF5A 3KR1A 1SB8A 2V9ZA 3LGSA 4QHSA 4R5MA 5EIXA 3LLVA 2L0XA 5FBQB 1IOZA 4N5DA 1NMYA 1B76A 3I0MA 3B1XA 3EGCA 2CB0A 4GKKB 1IIBA 3UWMA 3MT9A 5BN3B 5IANA 1CIPA 1XZNA 3SEQA 1GQSA 5JXIA 3GLGA 3BH0A 4KB5A 1VRWA 3HXQA 4RE6A 1F3LA 2CXPA 2FTKE 3RTGA 2BD0A 2GRAA 1UR5A 2C1EA 4RTJA 2H9YA 5JCOC 1E1KA 5I7SA 5K8CA 4GOMD 5F1KA 1JLMA 2OV3A 2JCSA 4HEA1 4QUJA 3X1JA 1XLTC 2CYBA 4CQJA 4QXAA 1AF4A 1DIAA 2C8LA 3P5BA 4L7VA 3SSAA 3MGCA 3U2QA 3ZHVA 2GBLC 2JAPA 2Y68A 3KJFA 4ZI7A 5HFJA 5C3MA 4IDHA 5A4IS 2J7KA 1O8CA 3ZIAD 3Q6IA 3A9RA 4HS9A 5EQFA 2IK8A 3IBYA 1YAHA 4R3WA 2OZPA 3PDJA 2RD2A 1XIVA 2IZZA 3T7CA 5FADA 1OW3B 1CVIA 5IJ0A 1X7GA 4XSVA 2IYYA 2QHXA 1MAUA 2RK4A 4GQMA 3EXEB 4MQEB 3A1DA 3ME5A 4QUAA 2YJZA 3GJ3A 2WFLA 5FL7A 2EGGA 2JVIA 1JZSA 2Q3FA 4GZ5A 5EJAA 4ZAYA 3H65A 1YRBA 2K4MA 1M2GA 2C2OA 4UCWA 4AMGA 2F6RA 2YZ2A 4NP6A 2HWXA 2XDYA 3DP7A 1ORDA 3GLRA 4XCQA 5FYDA 5A04A 3G2KA 1Z45A 1RM3A 4FMBB 3W8NA 3ROKA 1A0OA 3D3NA 5FNVA 4ETWA 3EZFA 4YRGA 1OKKD 3AETA 3JCZA 2F43B 3PYXA 4IDAA 4ZCQA 1PGQA 3MA0A 3VR4D 4N0EA 3T0GA 2PUHA 3IALA 2G36A 5B1YA 4KQXA 3D7NA 3K2IA 5AOBA 4CNBA 1G3UA 1KEKA 5BUCA 3CEHA 5THQA 2NVUB 3VC2A 2Z2XA 3L41A 4JLWA 3PV0A 3M2PA 4ZCSA 5JS6A 5KOIA 1QP0A 1WTAA 1Z73A 1TEXA 1XTPA 4U6NA 1L4NA 5D84A 1GNQA 3FBTA 4RZIA 5TR9A 4DDTA 1P7VA 1UFOA 4FT2A 5G1NA 5TS3A 1Y7LA 1TRHA 3DL0A 4AJKA 3WB0A 1DG9A 2CCKA 2Y05A 3FOAA 2QXYA 3K4PA 1DEKA 2HDHA 1FU7A 5JCJD 2EFHB 2ZVJA 5E0KB 3FVRA 3TW0A 2WQ7A 4AJNA 3HBFA 3EG9A 1YZUA 4POOA 3DDOA 1E4OA 4WOCA 1A50B 1CHDA 3QG5A 2FN7A 4JP5A 2WD7B 1CZUA 3A25A 2DUUA 3BSYA 3OT1A 4PPGA 1CR6A 1IEWA 3HRKA 5GY7A 3ZI0A 1U2GC 5I7RA 1YONA 4NKRA 3MOGA 4Y2VA 5KQGA 2CK3A 3IHWA 2A5DA 3OURA 1ZHOA 2B4RO 1N33B 1KAOA 3MB8A 3GH1A 5JHHB 4KBYA 4V1CB 3UFXB 2PRYA 2ZDQA 5D6NA 4LEIA 4BQSA 4LNUB 3ZV6A 2LRHA 2CCJA 3ELUA 2O0JA 4F3RA 1G7RA 4RH0A 1POUA 3ORYA 1RBMA 1U5CA 1XDZA 4AJHA 4LF5B 3INYA 1EFKA 5FPSA 5KTNA 1GSOA 4D0GA 4X85A 4EHFA 4GLJA 4UVIA 4D02A 5ABPA 1IEVA 2VT2A 5LYJF 2I8LA 3CUVA 3C4QA 4RIGA 2A14A 4O5AA 5L3ZA 3WNQA 4S1WA 1KETA 2TRSB 1NJGA 3GOHA 3HYTA 4R05A 1H8HD 2I6GA 3C3DA 4JI7B 3LWDA 4M89A 4LIPD 1AB5A 1NVEA 3JR3A 3ETJA 2FGJA 2I80A 3N7TA 1WZNA 4J1SA 2PSHA 3LQKA 3CHYA 4HFNA 4BGUA 1VIDA 4NU8X 4WBNF 2IBSA 3MVEA 1M83A 3ZUPA 2YVKA 4CEJA 1GUZA 3KBBA 1UIMA 1P29A 3V1LA 1KBOA 2QTZA 2NSJA 4DJEC 4DNQA 2NUPA 4WXPA 3VFDA 4PY2A 4JQDA 4BNHA 3ESCA 4ZOCA 3ZDDA 3MHPA 3G1UA 2J3QA 4ZOLF 4BMPB 3R8CA 1VM6A 4HZUB 4BNMA 4OP2A 4UBNA 1W5FA 3OJWA 1MGPA 1WS6A 1T4CA 1SU6A 2J5BA 1UBCA 2QRVB 2QTAA 1D6JA 1NXTA 3GNQA 3L4BC 3ROGA 3AR5A 121PA 2R6CA 4N5IX 4RWZA 3THWB 2HA7A 2IBTA 2AW5A 1RI3A 2O3RA 2X5NA 4ZV9A 3FYUB 1IN5A 1V43A 5KVCA 3X3HA 1E32A 4GGMX 5HRAA 5IBQA 5LZ4A 2DQSA 1N8TA 3BGSA 2AWIA 1I1HA 3GNLA 4M8KA 5JQGB 4KP7A 1WXHA 2ZYUX 4P53A 2EZUA 4YJGB 1WDLA 1UBTS 1HX7A 3JAKB 4ARBA 3IMFA 4DUGD 1K6EA 2F8SA 2XOEA 3EK2A 3QI2A 4KW7A 1G9TA 4AF6A 4IEIA 1A2OA 2IIQA 4TLLB 5KINB 4D8UA 4LRQA 4YCLA 2NZ2A 5ESDA 1Y7YA 1JMVA 1OZGA 4CG0A 3A58B 4X61A 4LJ7A 4N6NA 1RJDA 3P26A 4J0HA 2PFGA 8ABPA 3Q7EA 3EJWA 4EL0A 1CDOA 2B98A 4YXWA 2R96A 1LVHA 4JUDX 1N8SA 5IKXA 3A1NA 2B5OA 5HTKA 1GPMA 2AK3A 1IXZA 1F2TA 1QRSA 4GQIA 1OB2A 2N3ZA 5CX1A 4IFEA 6ABPA 2E5LB 3SJ7A 3EARA 5L7WA 1GA6A 3NHKA 2P40A 2JIZA 1PWYE 3HEMA 1ZK0A 2CB9A 1FFDA 2VWGA 1QF7A 1XZIA 2WVGA 3KE8A 5DLDA 4ZGBA 1P5JA 2YXBA 2APJA 4F91B 4J9VA 3G9UA 4Z7NB 3CBQA 4P38A 3I37X 3KZ3A 1D6MA 1E0DA 1MTZA 4KK4A 4TKVB 3RJ5A 4TTRA 4O4IF 2GM3A 1KYXA 1T2NA 4B34A 4C5CA 4EKYA 1RYZA 4TLAA 4RD2A 1HKHA 3TAHA 3U39A 4C04A 1CJUC 4CM8B 5JXGA 3DLAA 2NVBA 2RC5A 2DECA 5CXSA 4JVNA 2YVLA 5D3KA 3TOXA 2ZIEA 5JDIC 1DDIA 3OCJA 1BH2A 2YMQA 2DC1A 2GCEA 2IXDA 5FI3A 4YYZA 2ZYAA 3K0AA 4JYAB 1Z4JA 1TYEB 5HOQA 3OQIB 2O9JA 2JS7A 4RMNA 2W6NA 2Q5OA 2X9NA 3RJMA 2CD9A 3KXAA 2GEUA 1H05A 4LQ4A 5F4BA 2B92A 3DTYA 2X0IA 4G9EA 5BV2P 2D0DA 3UBTA 2PYZA 1X1TA 3A6HA 5DHRA 5I7VA 1P2FA 4PR3A 4BEBA 2PS0A 2P6UA 5GPBA 1WHSB 3IE1A 4TXNA 1AF7A 1SC6A 1SR8A 1UK8A 2CMHA 4F3NA 4AUNA 3CF6R 3D1NI 1M54A 2SCUB 2OBFA 1J5PA 1DWOA 1GUFA 1OXXK 1UBGA 1WKVA 1YASA 2P3OA 2VJMA 3KE9A 3GCWA 5FPHA 5BSRA 1RAAA 1WCIA 2GAAA 4KACA 4MZDA 5EXXA 4BP9A 3QHPA 2XCJA 2C00A 3A1WA 4WK6A 4ZKEA 5K0BA 1G3RA 2DKOA 1XKXA 3UT5B 3N2YA 4KBFA 1L4LA 2V6IA 3ET5A 4C2AA 1QF6A 4I1YA 2BV3A 3FRJA 1EEXB 4F1KA 3ENZA 4ZT5A 4YJKA 5DH9A 1KRXA 4XVCA 4GDFA 5AP9A 4PX9A 4TT8A 2ASVA 2OCLA 3B70A 4WADA 1JEQB 2F3UA 3BSSA 3O93A 1N8NA 5BPFA 1C8LA 1FDUA 2WJIA 1J9GA 3IIJA 5FXMA 1P1BA 2AQ8A 1AUPA 5DOVA 3FRIA 1Z5WA 2CF6A 1NMEA 2NSDA 1EGAA 3HDHA 5F12A 2XB6A 1TM3E 1E9CA 3OIDA 3LQ4A 2UZ3A 3BEDA 4I50B 2RIPA 4TXLA 4M9ZA 2HSEA 1LC0A 1PJBA 1RXEA 2AJBA 5DX1A 2JJ1A 3PWSA 4J7XA 4KQMA 4UHDA 3TLBA 3O1LA 1T6YA 1VJTA 2E55A 4YONB 2XTNA 4ZCLA 2ZIVB 5DP2A 4HO1X 1SHZA 2QVXX 2IOYA 3I5UA 4IDQA 4Y9UA 2JGKA 5FWXA 4BV2A 4AKGA 4D44A 1LBHA 2GFHA 4UTZA 4XQ9A 2VPIA 4WHMA 1CEXA 2Z5LA 1DIRA 1NW9B 2PMCA 2QJOA 4O8BA 4CF3A 4Q7QA 2PR2A 4MJXA 3RC7A 2OT3B 3K35A 5BQOA 1KJYA 2JFHA 3AW9A 2FSSA 3KWMA 4U7FA 3W7BA 5CA0A 3FNGA 1T1JA 2FEAA 1J33A 5EJ5A 1ZN8A 3ROQA 2OFFA 3GQVA 4EENA 3C3CA 5C7IO 2CSXA 5KYXA 4DV4B 4TUYA 5AKGA 2EXXA 4B35A 1JJBA 1XZLA 1VLJA 4MVJI 1QG2A 4PFSA 3ZQ6A 2ON6A 4C3OB 5CB4F 3THYB 4DR2B 4I8IA 4B3MB 1R63A 1ARZA 2Y1FA 2A9JA 3H8VA 3V80A 1M33A 2AFVA 4X6XA 4EI9A 4OXNA 3W78A 2FN9A 1UBFA 3KLBA 4O2AF 4OHRA 4Q0MA 3BWDD 5DGIA 4TGLA 1RS0A 1UKZA 2XB9A 2Z5FA 3UCFA 1DRVA 1GL6A 1G8SA 2QTVA 2GKSA 3CNLA 3CWCA 2IHUA 1G1MA 3IVGA 1NW7A 1X8JA 1XCPA 5BMVF 2Q62A 3R7WB 1NFQA 4GP9A 3HTXA 1NI3A 1SUWA 3SVLA 2XWQA 1FFCA 3JVVA 4MW7A 2XB2A 4QULA 3IVRA 5IN5A 5F1YA 5LMUB 3ZG6A 3BTUA 3B9PA 3DMTC 5ER6A 2JD1A 3AHIA 5MN4A 3IEXA 5DBOA 1OFUA 2OYSA 2Z83A 5JYBA 1T43A 2YJ4A 2XBLA 1YCDA 1SK9A 1I6WA 4UZEA 1U2PA 4IM7A 3URMA 2NP7A 3V1MA 4UHEA 2R47A 2WA1A 2DR3A 4HDRB 1DMRA 2QLMA 1O94C 3ADPA 1CQIB 1I7DA 4OU5A 1ZUHA 2CUNA 1Q2UA 3IUPA 4F3YA 5IM4F 5DNCA 2QRKA 5JMPA 1X15A 1ESCA 1F60A 2VOEA 4LBVA 2JLCA 2M2IA 4G25A 3JQ9C 3HABA 1PS8A 4OL0A 5TMEA 3V8MA 3AIIA 1TZJA 1KVUA 1T13A 2FB9A 5ALFA 3WK8A 4RSRA 3R20A 5HCNA 5C80A 1Q74A 4GW3A 2VRWA 1G2OA 1F20A 4I8XA 2AJCA 4KXMA 2E0IA 3KV1A 4JJ7A 3OZCA 4LECA 2W8ZA 2HA3A 1JJVA 5CT6A 4OFWA 3V3TA 3MSXA 4RGBA 2MDTA 2J09A 2VAMA 2OV4A 1FX0A 1YQWA 3KD2A 2H2IA 2WABA 1E1QD 4PAWA 2JI6A 3KIPA 3M6FA 4LRWA 1O8BA 1NBIA 4R1MA 1B0ZA 5JQGF 2AK2A 5LJLA 2OCAA 5L3RA 4UTVA 1QWSA 3GFVA 1TNDA 4DYHA 1NMQA 4A82A 4ANFA 4F9GA 1VE3A 2EGUA 5DM0A 3O1JC 4JJEA 2G8LA 1RPTA 2V7WA 4PQFA 5J40A 3M1IA 3RIXA 4DCMA 1YF3A 1G2PA 3PHHA 4BMYA 2FJRA 2FPMA 2YYSA 3EA4A 5LM3A 3T3IA 1Z0DA 4BKUA 2MSKA 3LNTA 1C0LA 1YJXA 3LW7A 5BSTA 1PSWA 3RJ9A 5IEJA 1Q44A 5JTUA 3HXMA 1U8XX 2D1RA 3AIOA 4D9JA 1HI9A 1KQPA 3TAXA 1NSFA 3CTMA 1CZRA 2H4WA 2WPNA 1IUOA 2BGWA 1HYGA 3IDZA 4DLTA 2H59A 1EWTA 4HXEB 4CWAA 1UBMS 2JLWA 4Q4JA 1ILEA 4MAMA 2CXOA 1NJ6A 2F3TA 3IVAA 4W8OA 4WFIA 4X95A 1YBVA 1SXJB 1TKBA 2B0JA 3U4HA 5IAAA 4OO3A 2R1JL 5TEVA 3ZDAA 1OWNA 5FRDA 1GPUA 4WNIA 2A94A 2Q41A 4QUBA 4XFKA 2LKCA 5H16A 5JZVA 2R6DA 4ZO8A 3KXDA 4TL9A 5ALPA 2CNNA 1TUBB 2GBPA 2PEZA 1UJCA 1W4AA 3BK1A 3DZDA 4I5GA 3PS9A 1O96A 3OE7D 2R1VB 4U3JB 2F1OA 3U3RA 1AKUA 1I2AA 1Y9EA 2JNWA 1IZ9A 4I8DA 4L08A 1I0IA 2B7CA 2IXAA 5TT1A 3SHTA 1MBZA 4HB0A 1G21A 1O97C 3NBZC 1I4OA 1X7ZA 1M2WA 2IIBA 2XT9A 5YASA 1H2RS 1OFUX 4ZMRA 5AJZA 1Z6YA 3WWPA 1YRAA 3P2IA 4HWGA 2BSXA 1T4BA 4CKCA 4WKPA 3K9GA 3QH4A 4GR9A 4ZVKA 2PVPA 2QTMA 3EULA 1R9JA 3C1OA 3LUAA 2ES4A 2GERA 1H5NA 1MC5A 4FNOA 3UC9A 1LPBB 2WU0A 1DE0A 4M83A 4ZCPA 3UV3A 1JB1A 4QXRA 1J0XO 2RI1A 2LCFA 1GZHB 1QV7A 1P5FA 3CW8X 3FG9A 3BRWA 2GZRA 3OQJA 1BRTA 4KQ2A 4QIHA 3ZXSA 4XJVA 4CIVA 1L5QA 4WCFB 5KREA 1IY1A 4Q3BA 3BAFA 1K2WA 1X7HA 4B5KA 4E1BA 1SY7A 3KKNA 1VBKA 2AI1A 2R4TA 3DE5X 4G0WA 3NXKA 3LVQE 4URVR 2BKLA 2BM1A 5TVGA 4HLDA 1DIGA 2W37A 4U2DA 3N2IA 3SK0A 2ZI4A 1DQRA 3TIFA 3VZCA 3ZX4A 3DGFC 3VOTA 4CU5A 2WM2A 3GZNA 1CRZA 4YHBA 4EJSB 3JXEA 5G0WA 4C76A 3FZGA 4CT5A 3INGA 2IYTA 3AHCA 2M98A 5GWXA 1U1CA 5K2MA 4W9MC 5KDLA 2OYCA 2O57A 3DOHA 1NT4A 5HUHA 4C0BA 3ICOA 4UTOA 3SC6A 3ZEAA 3A11A 1JUDA 1W93A 4BNWA 2PH1A 2XWJI 4ZTUB 1SJ9A 1Q7TA 4R2LA 1U0TA 1LD3A 3GPIA 4A10A 1DBWA 1G9SA 1QONA 1Z4OA 2RARA 2GNAA 4QM7A 4FGLA 2GEDA 3JYNA 2A9OA 1MU0A 2IYUA 3AH8A 3JASB 4DMMA 5JAMA 4LJ9A 1F2UA 2P0EA 2QTWB 3DW3X 5BN5A 3DEYX 1XXHA 2AG8A 2OXEA 3SKXA 1K8YB 3ZVRA 2WB4A 2X13A 1LWNA 4LV6A 5LA6F 4DTCA 5IS2A 3RHTA 3MEQA 1KGDA 3TB6A 1QHSA 2EWWA 3H16A 3IRVA 5A4KA 4A36A 4AZTA 1MR3F 2ZAGA 5EWMB 5DNEA 5BOSB 2L17A 1UJMA 5I7HA 1KZ6A 4R0NA 5BR4A 1B2RA 4J0GA 4ASUD 4QFMA 2H1WA 4MHSA 2OAGA 2GK4A 1RSZA 4J90A 1C8BA 1ZIXA 1EEHA 2LYPA 3G8DA 2XF8A 1KO7A 1QYCA 3JX9A 3DE7X 4HB3A 3KLPX 2PV7A 5BQ3A 3I5AA 5LVAA 1V8ZA 1EUZA 1YO6A 4PNHA 3VWSA 1XQYA 5DYTA 3AR2A 1AGNA 4L8FA 2YQZA 3EZNA 3RS2A 1Y3DE 2IA5A 4RMJA 1T5IA 2HLPA 4BFXA 1S02A 5DYWA 4F8JA 1YUNA 1D2MA 1XCOA 4E09A 3RAPR 3EF0A 1JIQA 2WG0A 3KELA 2RBGA 4EP1A 1JGTA 4J49A 1EHIA 1EFCA 3A4MA 3M1AA 1B0UA 2HBYA 5FLEX 1M2HA 3WKCA 1TPYA 3QWBA 3TZ6A 4FBMA 4LOLA 1IK6A 2XNJA 4Q15A 4HPXB 3U3DA 2VDRB 1UWCA 2A0YA 2BDEA 2REQA 4EG6A 2RSLA 4I4TA 1XJQA 2OBMA 2CMDA 2IXBA 2FWNA 1N77A 2Z3ZA 2P9ZA 3BULA 3MK31 1HLDA 3KALA 4R8KA 1Q22A 5BSHA 1AQNA 5T7BA 2EWMA 4S04A 1L3BA 1SUEA 2WHYA 3LS2A 1L7DA 4M8IA 1P2BA 3BH7A 5I9TA 3DEKA 4QTUB 3UTCA 1GADO 1XTKA 4DCGA 4JSTA 4RD6A 5ARBA 4JYZA 4LDAA 1JV2B 5LP1A 1K7SN 4A15A 2VZ9A 3FIUA 1JHOA 2B61A 3DW1X 4HQNA 1X39A 1PLKA 4NZNA 1NGSA 3BRSA 1XWRA 5G1OA 2ISCA 2C3OA 4DPLA 1T3HA 2W93A 4TUYF 2FP3A 4ZT3A 2OXFA 3CW9A 4KOAA 1ZK1A 2WINI 3HKDA 3EFBA 1B8NA 4GEKA 2X8LA 1OI4A 1LX7A 4KXXA 2CJPA 4JT2A 3AVUA 1KDPA 2PH7A 1E60A 4O2AA 4OSPA 4EHIA 1KDZA 1YWGO 3GEHA 3LCJA 3HO1A 3H5AA 4CKXA 3LBFA 5KUTA 3L7KA 1XMOB 3ECSA 2HNBA 3H2SA 16PKA 1CNMA 3D4NA 1QDEA 1HEIA 3VKHA 1J2RA 4GXQA 4OHBA 4KFUA 4R9NA 4B6GA 3S8YA 1R18A 3RSFA 4MRMB 1BMFA 1JS1X 1V7QA 2D5AA 2XGSA 1GV0A 3A4IA 4HLCA 4IO1A 2XTZA 3GJSA 1YA8A 5EP3A 1GCGA 2XKAA 3F2VA 4ALMA 4E31A 5CCBA 2BZ1A 4XSGA 2F90A 4CKYA 2OGTA 4HWKA 4YG7B 3H9EO 3AOGA 2VJCA 3LUGA 4UREA 3VNUA 5CA1F 4WLEA 2VHYA 5FBVB 1D2GA 3VJMA 1YFLA 1UTXA 4I1RA 2W0MA 3WL5A 1KAHA 4RPIA 5ENZA 2GZSA 3OQVA 4KO4S 1SUCA 2VYVD 4H2DA 1X80A 4F5DA 4ZPXA 1RWXA 1MIHA 2IVQA 5LIRA 5C81A 2XUOA 4DE5A 3PDCA 2C1XA 1A5AB 4NE7A 3JPYA 4HDAA 2QLTA 5KX5A 1ZHHA 2JHAA 4PPYA 3PEFA 2HI0A 3PZRA 4DRYA 2IL1A 3LD9A 5IM4A 3V2UA 5HNKA 2WICA 4HTFA 3VK0A 5ALEA 3JVIA 1RQXA 1JLKA 3L7MA 3MD0A 5DCUA 4PX5A 4QBFA 2W70A 1XLTA 2LUOA 3QKSB 3L79A 3QFTA 1LWOA 2CHEA 3ESAA 5KNCD 2H5IA 1TVEA 3EGEA 5JY6A 3FKSA 4N5NA 1MZVA 2Y1GA 4QG7A 2AOTB 2XH8A 4US0R 4AM8A 4BO6A 5IKOA 4P4GA 4P0TA 4G0VA 1N3IA 2Q5LA 3KYDB 1I1NA 4RKYA 5EE0A 1PS0A 2VJOA 4DDMA 3WADA 3CUSA 1D07A 1UBHS 1W6UA 3L7CA 4WK0B 1YB1A 2Z4RA 3VDXA 1CRLA 2CHQA 3WLRA 1D4ZA 4IDCA 3KBOA 4BLWA 4C6RA 1NRIA 3DV0A 2NAPA 4LWOA 4JNKA 1GPJA 1D8TA 3FZQA 1HEUA 3OJXA 3F46A 4H60A 4IJUA 5A1TA 1NWHA 4LXUA 1CLUA 1PR3A 4RNDB 5IVIA 2C3PA 3W1VA 3K7EA 5E2AA 5FEUA 2P9BA 4REQB 5FDFA 2Q27A 4JLVA 4OQDA 4FFMA 1JF8A 1P31A 3NAGA 5EVCA 4ARZB 1IXRC 4P7FA 4MA4A 3N7AA 3EPLA 2B78A 2XZTA 3KDSE 2P69A 5CG2A 2ZB3A 2X7XA 3B51X 2WZCA 3L4KA 5JOQA 4YIKA 1MVLA 2X0KA 4NNPA 1OWPA 4R2XA 4HRXA 1SXJE 3QI7A 1QGUA 5F64A 3O1IC 4C6SA 4ENTA 1O4WA 3V8QA 1EUCB 2P9HA 2A57A 5IC6A 2A9FA 3JWGA 5FLKA 3D2CA 3EGOA 1OXBB 4D4HA 4XR9A 4O3MA 5G1PA 2XCTB 4OXIA 4J0IA 2JQEA 1O5IA 1ZH6A 1Z37A 5JNSA 2J9XB 3E23A 2ZZNA 2BFCB 1SWWA 3KAKA 3HA2A 1Y3AA 3DA8A 3WDMA 5BR8B 2C97A 3TLXA 5IJZA 2O0KA 3KOWA 2VRNA 4DS3A 2BUBA 1ZGZA 5KWSA 4C2TA 3IOMA 4G5QA 4HQLA 3KC2A 1OCEA 4TTIA 1OLXA 3RFCA 1LVUA 4FMCF 4RPHA 3RYFB 2EZ9A 1CUXA 3RUIA 2L2QA 2X1MA 3RYTC 4S2EA 1RT9A 2G9ZA 3TPCA 4ETNA 4RS4A 2YJ5A 4MK4A 4BQOA 1Y8CA 3GLIA 2B5AA 3EY4A 3KKZA 3ES9A 2NLOA 1B73A 3OEYA 4YRLA 5LC1A 2C58A 3TINA 3ZCXA 4CT0A 3NTUA 1EE1A 2BGUA 3UMCA 4YCAA 3OTQA 1C7JA 1RRFA 2NO7A 3KYBA 3OF3A 5EJ7A 2JCYA 5L4NA 1ZM9A 2O20A 1YR3A 2WP8J 1KI4A 2GN4A 3H2YA 4ZQCB 5ELMA 2VBGA 4YRIA 5JBIA 1L7PA 2QP4A 4WAUA 3DD1A 2PKWA 2AZXA 3PKJA 3ICEA 4K9DA 1RWVA 4UPVA 2MCFA 4O4LF 1AZLA 2E3JA 5I9LA 1VIVA 3HCDA 3R3WA 4PLYA 5HEKA 1W29A 5EHGA 4EUKA 2XCIA 2FZ4A 1ESDA 1SIOA 1TUEA 2PUDA 1NLZA 2ZBRA 4PGMA 5FIUA 1I2MA 1Q1ZA 1THZA 2VTBB 4G5XA 1I3OA 3IUEA 4XTCS 1BROA 4PONA 4YLGA 5B1HA 2F55A 1Y4UA 5DBGA 1NKVA 2H2AA 4PTZA 1NNI1 4P4SA 1L2TA 4FIDA 3P20A 2HNKA 3MQ4A 1QVVA 4V24A 5ALIA 1W9HA 5IM5A 3VVCA 4RTQA 1KVSA 1PHRA 2VJYA 1UXIA 1ESMA 2OG2A 2QV0A 2JZNA 1QVRA 4LFBB 1BXRA 3BGDA 3C7KA 4BUZA 2QNBA 3VHQA 2RHMA 4DARA 3MWJA 3WISA 2J1LA 3FGNA 2KLHA 3QFCA 1MC8A 4YPVA 5HIMA 4DRZA 4XCVA 2E49A 3IKVA 3UWSA 3STYA 2O8BA 3WLJA 3BD1A 5ERXA 1NX6A 1NYQA 2WK1A 3SZOA 3RYIA 1Z3IX 3N2KA 3MQFA 3UZUA 1EZZA 4GX2A 1LJ8A 5CB8A 4KAXA 1XKLA 5LZ5A 4YDQA 1UFVA 3GOQA 5ADHA 1RJWA 1T2DA 5JS7A 2C94A 2GEJA 3BTOA 5A4DA 5CB0A 2W83A 3O2SB 2JG3A 3DYVA 2C95A 2R5WA 3K9NA 3TB4A 1MN6A 3OIYA 3A28A 4ED9A 4BLUA 4BNUA 2OCBA 2WF8A 2XBMA 2MSLA 2A9VA 3EGXB 3PJEA 4X8LA 4DA9A 4BMCA 4N3BA 3MWGA 3NP7A 3VQTA 2DT8A 2EJWA 4JB3A 5JXJA 1D2EA 2C77A 2PGAA 3OEHD 1E6LA 2QE7A 4HMQA 2WLSA 1P81A 1X92A 3NLLA 5I5EA 1AS3A 4Q4AA 4ZVQA 1TKAA 1IQPA 4Q3AA 1QR6A 4YS6A 3CE6A 1TVCA 3C98A 4Y42A 4JT4A 1PK7A 3FIJA 4QX6A 3TW4A 3DT6A 3R5KA 5C8XA 4DC0A 3D4LA 4ND8B 4FD2A 4QOEA 2WTAA 2G5TA 2LYJA 1IBRA 4MQBA 3GFSA 4I6TA 3Q6NA 4EL5A 5DW3A 3IQDB 3HN2A 2A92A 5ELXA 2GSDA 3I72A 2YZMA 2ZS8A 3BXZA 2IPXA 1YKGA 2FLKA 2CNBA 3DE3X 1Y42X 1U6IA 3N76A 1XD2A 4MWDA 4FZRA 5CGQB 4R81A 2IUOA 1X1BA 1HLPA 2HJ9A 4HWOA 2I3AA 4IIVA