1ZAYA

Purine repressor-hypoxanthine-modified-purf-operator complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Roles of Exocyclic Groups in the Central Base-Pair Step in Modulating the Affinity of PurR for its Operator
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*TP*(1AP)P*TP*TP*TP*TP*CP*
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zayA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA02
1TM2A 4B09A 1AU7A 2LP4Y 2L8NA 2CHFA 3QLUA 1M2FA 2RDMA 4Q6BA 2FKAA 3N6VA 5K98B 3Q7SA 3O2QB 3BRSA 4IRXA 1RPJA 3C3MA 4LX8A 4X4DA 5FWXA 4I8TA 5I4CA 2PIJA 3D02A 2H0AA 5TQJA 5TPZA 1YS7A 1YTUA 3MF4A 5EWLB 1ZGZA 5HKOA 3I5AA 4I6TA 1YK0A 3HUUA 2IU7A 4Z99A 4X4IA 1ZZBA 1E2BA 3LUGA 3MYYA 4Y9TA 1ABFA 3QYXA 2JK1A 5TQ0B 1VLZA 4GHJA 4G0OA 1JX6A 2PUFA 1LJUA 3SM9A 2WJWA 2QZJA 3LFTA 5IEBA 1RNLA 4EGSA 3A0RB 4IVZA 1PHRA 3LOPA 4MQEB 2B5AA 3BDNA 2R48A 4OB4A 1DG9A 5CNKA 3CG4A 4JB0A 1BAPA 3OM1A 4JP1A 1FSPA 3DBIA 2QSJA 4RWEA 1AB6A 4F8JA 3EAFA 4YS6A 1Z26A 3C3KA 2OQRA 3KSMA 6ABPA 1VRVA 3NHZA 4YO7A 4D6YA 4ZJPA 1U2PA 1ZHHA 2CROA 2CSFA 5KC8A 4LDAA 3G5GA 1Z2DA 3VK0A 2FLWA 2NT4A 2GX6A 2NZVG 3HSYA 3KLOA 4QYMA 1W9HA 3RVRA 2IV1A 1JDNA 3KS9A 4RS3A 4OTZA 2WUSR 1QO0A 1BA2A 2EF8A 4X4BA 4ZMRA 1YSEA 2GRLA 4PZ0A 2QVGA 3KKEA 5IUKC 1ISSA 4UHKA 3QLVA 4JCXA 2H3HA 1M2EA 4MR9A 4RXTA 4YR7A 4ETIA 2ID7A 1Y1LA 3KJXA 5HQJA 1EWVA 4N0PA 4MYRA 2AW6A 3H5WA 3H75A 2O20A 1RZRD 1JFSA 4OATA 4YG1A 3F51A 5HSGA 2LCVA 1DW9A 4Q6WA 1ZPQA 1ZS4A 2V0NA 3CLKA 5IEJA 4RDCA 1RZRA 4IWRA 5TQ2B 4O8BA 3NNSA 4P1ZA 5JNRA 4J1WA 1D4ZA 1B0NA 2LUOA 3KYIB 4ETMA 2HQBA 3ROTA 1K68A 5TPWA 4RXUA 1EAYA 1SD5A 2VYCA 3LFPA 4J1XA 1P8AA 3QWGA 2PUGA 2PAFA 2R25B 2PUAA 3C3WA 3EULA 4KQCA 2JVKA 2XIUA 1POUA 3SCHA 3OLWA 5IC5A 1DP4A 1ZZ7A 1MVOA 2E4XA 4FB4A 1GCAA 1QKKA 2FEKA 2O49A 3OO0A 2WY2D 1A2OA 2FXIA 1Z18A 4RZSA 3OP9A 4EVSA 3GA5A 4IILA 1Z25A 3OQMA 2L17A 4OBBA 1TMYA 4EYGA 5KQGA 1E3OC 5EWJA 3FMYA 1NXTA 4KZKA 1BVHA 2FMIA 3CECA 3M9WA 3URMA 2XJ3A 4Z9BA 4N76A 4KRFA 1LBIA 4JA2A 1WH6A 2BNMA 2KEKA 4XXHA 3TD9A 3H6GA 3C6QA 2L19A 4QPJC 2HSGA 2WIUB 1ZN2A 1DCMA 1DRKA 4EY3A 3NNDA 2QU7A 4MS1A 2JVJA 1ZZ8A 4TLLB 2R47A 3HDGA 2X7XA 2LYRA 2GBPA 4FBIA 1D1QA 2YHBA 2MSKA 4RXMA 4TN5A 3F6WA 1DCFA 3L6UA 1PNRA 2WB4A 3F52A 4W5OA 2FMFA 1ZZ9A 3JVIA 4GQMA 4CBVA 1E6MA 2WJAA 3GT7A 4ZMSA 4RK5A 1PRUA 4MRMB 2GI4A 1M5UA 4EYOA 3GRCA 3IPCA 4MR7B 1KGSA 5BRAA 4IMIB 2IVGA 5JS1A 5CNJA 3QEMB 2PUCA 2LYQA 3QX8A 4RK6A 3S8QA 1SXIA 1QP4A 1Z12A 2JBAA 1NATA 3H5OA 3H6HA 1A0OA 3FDFA 3IP9A 4MS4A 3BBLA 4RY8A 1SQ8A 3MM4A 4WWHA 3KHTA 3M9XA 2MYUA 4OG2A 4F06A 3H1EA 2VK2A 4YCSA 2KEIA 2BJCA 3JXCL 4Y42A 2D5VA 2LYSA 1ZESA 2E4UA 3H1FA 3GBFA 3H5TA 4Z58A 1CHNA 3QELB 1U8TA 4IGAA 4PU7A 4NCAA 1ADRA 1BDJA 1TVMA 3EGCA 2FEPA 2OR1L 3P9YA 2HINA 1ZH4A 3DLBA 4KREA 1Z2EA 4X4GA 3FFWA 3GL9A 3BS3A 3CHYA 1D1PA 4OLBA 4RK1A 1CYEA 1H9CA 2JRLA 1UDRA 1FQWA 2JCGA 1B00A 2AYZA 1WIZA 2FN8A 2FQYA 4YWHA 3ROFA 4Z4HA 2A9QA 4RKQA 1O4XA 5JNSA 2O4AA 2PLNA 2RJNA 7ABPA 1WETA 4GNRA 3RVLA 1C0EA 1EWTA 1YS6A 2GKGA 1M5TA 2JVIA 3H5IA 1EHCA 3O75A 3JXDL 4XLTA 5EWMA 1E6KA 4F12A 3RZZA 2P4UA 4N41A 3H5LA 1ZGGA 4MGEA 4W5QA 5TPZD 4KPYA 4KV7A 4RK4A 4NICA 2BNOA 3S99A 3OMWA 3EUSA 2N9UA 1LJLA 2CD7A 3LKVA 2AYXA 1JWLA 3HVRA 4Z4FA 2E4VA 4YV7A 3CRNA 1QP0A 3KG2A 3L49A 4JASB 3BD1A 2A6CA 4MR7A 1VPWA 3RVPA 1DZ3A 2MQKA 4P98A 2F8SA 3FMVA 4MS3B 3LTEA 3MIZA 2Q5CA 1NXSA 2IKSA 2ZWMA 3OQNA 1DRJA 1JL3A 1CEYA 4Q7EA 1EWKA 3Q9SA 2AWIA 1PRAA 1YMVA 3W9SA 2W42A 1UXDA 2E4ZA 2GRMA 3QLVC 4O5AA 4YGXB 3RVOA 1Z16A 4YARA 1AB5A 1P6QA 3OM0A 1GT0C 1LCDA 3JPYA 4QICA 5EWMB 3O21A 4EVQA 2LPMA 4Z9AA 4S04A 1R63A 3N8IA 3N75A 3H1GA 2FLKA 2IPLA 3IP5A 1FFWA 3KYJB 1MB3A 4GPAA 2FSPA 3CS3A 5TE9A 3RVJA 3TRBA 1KRWA 4M88A 1NY5A 4FE4A 3T38A 5ED4A 3SQNA 3KLNA 3FFXA 3DNVB 5EWLA 1RZSA 2M98A 3MMNA 5KQLA 1ZZCA 1JFVA 4G0XA 5T3YA 4XFKA 2R63A 5GOTA 3I09A 4N47A 3EQZA 2ICPA 1GUDA 3JS5A 3RVKA 1QP7A 3O9XA 2VUHB 3BRQA 3HS3A 4LE2A 4X4FA 4S05A 1DCKA 4IMJB 4PEVA 2MYPA 4TLMB 3SCGA 1NXWA 5DKFA 2PL1A 2AUWA 3OLVA 3LISA 3E61A 3LUJA 4D6XA 2R1JL 1DBPA 4G0PA 4RY9A 3SNKA 5FWYA 5JNTA 2P9HA 3K4HA 1SXHA 1NEQA 2IYNA 4L85A 3JTEA 1P2FA 1U0SY 5TQ0A 2XDYA 3CU5A 1GUBA 2FW0A 3E3MA 4G0QA 1Y9QA 6CHYA 1JFTA 2IOYA 3KXAA 2ICTA 4G86A 5DLEA 2AXUA 3VNBA 3SCFA 3ZKCA 4MLCA 1ABEA 3Q7TA 5BRJA 3RVNA 4ETNA 4N03A 3CLCA 1YK1A 2FMHA 4E7OA 2IPMA 3UK0A 1PEYA 3CNBA 1I3CA 3GWGA 1NXOA 4O1IA 5IUNC 2PJUA 2NT3A 4G0YA 1S8NA 4HNSA 5DGCA 1GLGA 3MLFA 4YLEA 3O2JA 3D8UA 3IVPA 3TO5A 3QELA 4F3TA 4KQ9A 1JBEA 1NTRA 4TMYA 5E3JA 4JAVC 4PE5B 2EBYA 5KQPA 2F8TA 3ILHA 3PXPA 4KNYA 2KYRA 2MYTA 2HQRA 1JYFA 4HYEA 3NBMA 4H60A 2AXVA 3GV0A 4Z4CA 4G0ZA 2QXYA 4L4UA 2AXZA 3CG0A 5DTEA 2FTKE 5KI6A 3JPWA 4MR9B 3T95A 1OXKB 3T8YA 3O1IC 4OLAA 4MAAA 1YMUA 1DC7A 1F51E 1HEYA 4Z4IA 1JYEA 2MEZA 3OQOA 2QV0A 3RVQA 1QMPA 4RSMA 2LYJA 3UKJA 8ABPA 4JB2A 5GQSA 1ZUGA 3L1PA 1QQBA 3EQ2A 2A9PA 2IDMA 3IP7A 5TQ2A 3OLXA 4Z5DA 2NUBA 2EWTA 1CJGA 1E6LA 2LBPA 1MIHA 3LUAA 3IP6A 1MB0A 1U2QA 2FQWA 2GWRA 4I6UA 3QX9A 1VKRA 1ZZ6A 3VNAA 4F11A 5B3JC 4O1HA 2MYNA 3KCNA 4EVRA 5IUJC 4LZLA 1KRXA 3KZ3A 2YHAA 4JQDA 3FGZA 4G0MA 3LUFA 5D2CA 3LUCA 4JCYA 1ZH2A 3SY8A 4WXMA 3HZHA 4MQFB 1CQTA 1QNLA 4YG4A 2E4YA 2OENG 1ZITA 4RU1A 3RVMA 1XHEA 1USGA 4UHJA 1F4VA 3F7NA 1Z15A 2CWDA 3N53A 3NHMA 2L18A 5F64A 1S7EA 3A0UA 2XCJA 4EUKA 2A9OA 4LE1A 4FN3A 4NCBA 3QEMA 3HZIB 1NXXA 2RJOA 3HV2A 4H3KB 4WUTA 1DBQA 1APBA 4YP9A 2PMCA 4MQEA 4NQRA 1MAVA 3A10A 5BQ3A 4W5NA 5IULC 1OXBB 3UFDA 4WT7A 4Z4EA 3HEBA 3KTOA 2IUOA 5CNMA 3G7DA 4DADA 4ZYLA 1FFSA 1U04A 2LYPA 3ZHIA 1EFAA 4FE7A 2O38A 1SXGA 1RXEA 2DRIA 3LUKA 5PNTA 3QLTA 1DJMA 4MS4B 2QW1A 2JVLA 5T7BA 1PRVA 1QQAA 4YG7B 1RIOA 1XWWA 5JS2A 1JLKA 3NNNA 3JY6A 3MQ4A 1RPEL 2H8RA 2LYLA 2HJ9A 3CROL 2QR3A 4RV5A 3Q41A 1PNTA 4W5RA 5B3JA 1R69A 1D5WA 1SRRA 2XI8A 3A3KA 1DWKA 1K66A 3CFYA 3EJWA 2L49A 3H5VA 1ZDMA 3QF3A 5TPWB 4E7PA 3CZ5A 5C5CA 4H3HB 4MQFA 4KMRA 3ILYA 5CHYA 1YVUA 1USKA 5C5EA 4KK3A 5IBQA 4I6RA 1D2AA 1HF0A 3B7HA 2MSWA 2NZUG 2BNNA 5KC9A 3CKMA 1KMIY 1TLFA 3OLYA 3QEKA 3HJFA 5FBKA 2PUEA 4NDWA 3RVSA 1JF8A 4W5TA 3F6PA 3LUDA 2KEJA 3QQ6A 1QO0D 1ZVVA 3TB6A 5HM6A 1X57A 4MS1B 1XWRA 1OCTC 1ZY2A 1LCCA 2WWVD 5FWYB 4KFCA 2PUDA 4N0QA 1LQCA 5JNUA 4QYWA 1L1MA 4EYKA 3HM9A 2J48A 2FMKA 4LRQA 2JB9A 3O74A 5A7LA 2PPXA 3UUGA 4HNRA 4IA8A 4X4EA 1IC8A 3O1HB 3GN5A 1PUXA 1YIOA 3BILA 1NERA 1A04A 3SG0A 2B1JA 9ABPA 3HO1A 4XAQA 4YBAA 2WRZA 1GCGA 1NXPA 3I45A 4PU8A 4X4HA 3IPAA 3R0JA 4ZPJA 3M6MD 4XARA 1P6UA 2ID9A 4KVFA 4IF4A 3T6KA 4PU3C 1X2LA 3FYMA 1BDIA 1W25A 1Z13A 1JHZA 3RQIA 5KQMA 1UXCA 2GZUA 1WH8A 1XHFA 4Z5CA 2HQOA 1C4WA 4MRMA 3TX6A 3D1NI 3N0WA 2FEWB 3CTPA 2A9RA 1OSLA 1DC8A 4RK7A 5BR1A 1L5YA 2FVYA 4PU4C 2LIVA 1LMB3 2PKXA 3Q7RA 3N0XA 4DN6A 3MA0A 3HCWA 4RK0A 3I42A 4LE0A 1LBHA 1USIA 3EDCA 3IDOA 3OLZA 2PUBA 2FQXA 3C97A 1JDPA 1R8JA 3GN5B 4Z0NA 5FBHA 2IPAB 1LLIA 3LMKA 5KWSA 1RXIA 4MCTA 2M1ZA 3HXMA 3HK2A 2FN9A 5FWXB 2IPNA 2CHEA 3DZDA 2VUIB 3G85A 4F8DA 4PYRA 5IX8A 3TMYA 3ZHMA 1QPZA 3BREA 3GBVA 3HUTA 5EWJB 1J56A 3RH0A 3K9CA 4D74A 3GYBA 5JNWA 4JOQA 4MPTA 2FJRA 3JXBC 3DGEC 3CZCA 4RKRA 1TJYA 4WXEA 2QVCA 3JVDA 1IIBA 2IVQA 3QLUC 4MLDA 4MCXA 2LYKA 3R1FA 3N0RA 1ISRA 2PL9A 2XSDC 1LK0A 4Z59A 4KK4A 1L5ZA 2PE5A 1T34A 4XASA 3OO1A 2BGGA 5CNIA 5JNVA 1Y7YA 2I6FA 4MR8A 3FFTA 2B4AA 4NV3A 2KPJA 4Z5HA 3O2SB 4LDZA 4RY0A 3EODA 4HNQA 1ZAYA 1DBWA 1PEAA 3F6CA 4Z4GA 2TMYA 3GBPA 3Q15C 2MSLA 2R4QA 1JH9A 4PICA 2HPHA 2L2QA 4WZZA 4MS3A 2OFYA 3OMXA 3LKBA 4ML3A 2ZAYA 3O1JC 3SAJA 4MR8B 3F73A 2KZ8A 3QK7A 4DQDA 4EYQA 1FFGA 1UTXA 5DCLA 2IVBA 3FYAA 3U3WA 3LUHA 3DGFC 4YRZA 3G1WA 1URPA 1Z17A 2WMYA 3B2NA 2RGYA 3HDVA 4G97A 4X4CA 3OMTA 1PERL 1NXVA 2JBAB 1BDHA 2E4WA 5ABPA 3DLHA
chains in the Genus database with same CATH superfamily
3RTCA 3L4BA 1XLVA 2BHSA 2NXJA 3DCNA 2L8NA 5EG5A 3ZV3A 2P7IA 4O4JA 4BRZA 3HJGA 3N0TA 3OTGA 1SUDA 5FOUA 1ELOA 4KPUB 1TD1A 1Z0ZA 1QHEA 2FWIA 2O14A 4BFYA 1ZEJA 3PC2A 4F60A 1RPJA 4HAIA 3ZTWA 4X4DA 4RGQA 4DXDA 1FTQA 4IZIA 3BD6A 3UJ6A 3HYTA 1NI4A 4D57A 2RHTA 3EFEA 1SCJA 3OUZA 3PUIA 4E31A 1IH8A 1YK0A 1SA0A 2W6QA 2W6ID 2X7JA 3H5RA 3GZDC 3HSSA 3PFCA 3OTHA 1X3SA 1XCLA 1ESMA 3DD5A 3O8OB 4RL4A 2PZLA 5JZBA 1ORTA 4K7JA 2PIDA 4KXNA 1OGIA 3OZAA 4REQB 4XJTA 5K3BA 4F2WA 1HYQA 1A7UA 4J1NA 1SWWA 1GOTA 4S1PA 3AIOA 3A06A 3JWIA 3OESA 3IH5A 2B5AA 1E6CA 2AEJA 2WYHA 1QF7A 4HQ6A 3HVUA 3ZDDA 2NTEA 4B3SB 1EQ2A 3X1ZA 4RWEA 3WK8A 1NFRA 1ZNQO 1GQQA 5L6MB 2F9FA 5F9FA 1Z26A 4ZT7A 4I8DA 1ZVQA 6ABPA 4ZYXA 4OQNA 1WEHA 5CYPA 4BC1A 3ASVA 1U31A 4CCAA 2ZM6B 1AE1A 3O93A 2G9QA 4OO3A 4UHEA 1CU1A 4Y2PA 5BMVB 2NZVG 1QTQA 3EEOA 4UHHA 3S8MA 4BNNA 1EK0A 3DEAA 4MO9A 1NQXA 3IAEA 4TRRA 5GZ1A 4S0ZA 4CFSA 2FW8A 1ISSA 3M6FA 3W3AA 3CINA 3E9QA 2HSWA 1OA0A 2CVQA 3ODPA 1M2EA 3IP1A 3TN7A 1U0HC 2CLSA 3H05A 1ZKDA 2JLSA 2VIIA 4YB8A 1Y8QB 3LP5A 4LHYA 2O20A 1UPAA 4I4NA 1NPDA 3GFFA 2XIQA 5E0OA 3WDLA 3COPA 3Q0TA 4YHBA 5G4KA 2ACKA 2D0OB 4LOKA 2ZUEA 1TJ4A 2AC7A 5BN3B 4BQEA 1WHSA 2QG6A 1W2WB 1IZ0A 1XZAA 2ZZNA 1Z06A 3NRCA 3U7QB 1J24A 2YWRA 3DWFA 3WL4A 3ME5A 1ULSA 1I80A 2Q50A 1J1ZA 1S2NA 2IXFA 4TGLA 4DV4B 4PVDA 3RUAA 2WAYA 2PUGA 1XD8A 1BCSB 1BJKA 3PJGA 1H2WA 1N8NA 5KNBH 4C3VA 5IDXA 4FR2A 3LPAA 4AAYA 1X42A 5BWOA 3AP2A 4HRYA 3OD1A 2E82A 4KYVA 4N5IX 5SZJA 1DI0A 3GELA 4M1SA 4M99A 5B2EA 4TTAA 3KT6A 3SSNA 3MWFA 2JGFA 1TDJA 3B9QA 4ODIA 4DXHA 2GCPA 1CCWA 5HF9A 3VHRA 1KK3A 4IWYA 1ADFA 4JITA 4PZPA 5KQSA 3BJRA 2FV8A 4TLDA 421PA 5JXHA 4N76A 3HBJA 3FI9A 1VB3A 1XQXA 3BOSA 4PTZA 1G9XA 4RVNA 4TLAA 3TGWA 2O8BA 4RD4A 1B2RA 4QM6A 1U7WA 5AESA 1VA5A 2PKCA 3VU9B 1DWPA 4EY3A 3U49A 1V43A 3ICOA 4FDUA 2R65A 4EY7A 4YAUA 1ZJYA 4UEKA 1TADA 1YB4A 2OV6A 5K8JB 2CNNA 4L4ZA 4V1CI 1IG3A 4RF2A 1V16A 1NT2A 2VPQA 5C1DA 3GROA 1UC4B 3EVDA 1RZ3A 3LPDA 1OJ7A 1B74A 3EGWA 3FOWA 1KHTA 3M33A 1RBMA 1J0DA 3OQHA 1K7FB 2AK2A 2J3LA 2A5LA 3LK7A 5FEUA 3BFXA 2OAP1 4IOJA 4MROA 1PVDA 1VSUA 3C6XA 4ON9A 2DBRA 5BRAA 2VHCA 3NALA 1DO0A 1IQUA 3GGDA 4D8WA 3CW2A 2B8JA 5B7GA 1L5HA 3OC0A 3H5OA 1RVV1 4QPNA 3WGZA 1PWXA 4R31A 1SQ8A 1J6UA 4WWHA 2GN4A 3N07A 4II7A 4CM4B 2PXQA 2MR5A 4D80A 2H5EA 4K05A 3LBFA 1U81A 1NA5A 3OQPA 1M83A 2XE7A 1G5TA 1VOTA 2YQ5A 4IWNA 4CR7A 5CEEA 4C7VA 4CTOA 1E77A 3PFNA 5CVUA 1VCMA 3E4CA 2Z9BA 3PPIA 4FOTA 1Y4AE 1MFZA 2GTIA 3TRIA 4C22A 4UVEA 4XWOA 5DLDA 5IW8A 2X2FA 1U7TA 3P0FA 1ZIDA 5H83A 1XRLA 1GXSB 5ALXA 1HLFA 2O7RA 3OT5A 4XDYA 2BM9A 3NGLA 1WETA 2A67A 4RGVA 5AUNB 4WVLA 3KEMA 1BS2A 1A9TA 2A1UB 4ZAVA 3SQMA 3J7AC 2YC4C 1JWBB 2XBMA 4F3YA 2JFWA 2QDKA 3VKVA 1NW4A 1I51A 4X54A 4CF6A 5C1BA 2O2DA 2COUA 3W4JA 2WINI 4W9NC 5AW2A 1JPVA 1YJ5A 4WLUA 3K6RA 5EJEA 5CVEA 2R6GA 3GVCA 5BR8B 1TUBA 5HVNA 2Q3JA 3PXXA 1TJ5A 3S99A 2RG7A 2QJFA 4NBKA 3OMWA 5E7JA 4DG8A 2N9UA 1YNSA 2PX6A 2IVZA 3H9CA 3P9SA 5D00A 2GXUA 5AW5A 1GPH1 2J0VA 4MHOA 2A5JA 2VJNA 4LC9A 4QDTA 4XIYA 1OJLA 3G2IA 1OU4A 4UBMA 2GK6A 4P2BA 5LSAA 3HM2A 4QGGA 3RVPA 4P3OA 1KHHA 2QTLA 3ZH9B 3ZCRA 4X90A 3REFA 2LCFA 1JFLA 2ISQA 3BTSA 1Z2PX 3HA5A 1L7EA 1ZD9A 1YS9A 2BR4A 3GGOA 3GJRA 2DFLA 1J8VA 2EEPA 4G56A 1N2ZA 3W3AD 1Z6PA 2I99A 2H2HA 4R16A 4ASUD 1TVKA 4GVPA 4GEKA 5EN4A 2H1OA 3M6VA 1Z83A 1U02A 1JIQA 5L95A 2NYUA 1B7GO 5M29A 1LX6A 1UOOA 4LGVA 1HK7A 2QRKA 4HDNA 3ZZ0A 5K8TA 4N18A 1Z16A 2E48A 3T1HB 1VYHA 3GFQA 3MPUA 2VAXA 5J5AA 2HNKA 4V0RA 3N75A 4M1EA 3ESRA 3NDIA 2JFVA 1USVA 2ZRBA 3KKZA 1KRWA 2XZPA 1KDZA 1FFEA 4GZMA 3W7VA 1RZSA 1H6AA 1LBEA 2M98A 5MF6A 4AICA 1BSVA 1U99A 1UJ4A 5E9AA 5BN4A 4Q7QA 3ZV4A 5K3OA 2ZJ3A 1RSZA 1QOZA 2RBEA 1UDAA 1E98A 4LHSA 3VR6H 3OE4A 5H70A 3O9XA 3A6LA 2H1IA 4IHKA 4LXXA 2XLCA 5IN5A 3HHEA 2XKJE 3E1KA 1YA8A 1T3SA 2I4LA 1YR3A 4ESHA 2F43A 3OLVA 3SIXA 3VR6A 1OB2A 1E8MA 2R751 4I1SA 4RY9A 1HUQA 3G1UA 1P6XA 5DHSA 4H1VA 4HSGA 2IIQA 2I9KA 4MWEA 4QBFA 2H54A 2P30A 2NPIA 1UANA 2FCAA 3C3JA 4NL4H 2DX7A 2CXHA 5KPDA 4UHDA 3FNHA 1U9CA 1TTHA 3FPHA 2GN8A 4R6XA 5E1OA 3C8MA 1T9CA 2JZOA 5DLEA 3DVAB 3SE0A 4UQPA 4KWCA 1FEZA 4QWWA 2WYOA 3D5EA 3P19A 1J9EA 1DX6A 3PVZA 2VBCA 4ENQA 1S4QA 3CNBA 1I3CA 3OBIA 1FSSA 2Z4TA 2O8VA 2ZBRA 5ECYA 3QV1A 1BS9A 1IEXA 1WHSB 1A9YA 2QL5A 1GLGA 2RH9B 3CIOA 4W63A 1FFXA 1KTVA 5ADUS 3E58A 3WQQA 5FH9A 2EFHB 2EBYA 1YZQA 4E5KA 4ZCQA 1ACJA 4MYHA 3TPZA 4JD5A 1JFRA 4KMSA 1MEOA 1OX4A 4KG7A 1VI5A 4NG5A 3HYRA 3NBMA 3AF6A 2HA4A 1F3LA 1MHTA 1RMTA 5KI6A 2FTKE 4NY1A 3JPWA 4J75A 2QSUA 3GLFB 4OLAA 3E23A 5CLLA 1IM5A 1F51E 1VKHA 3L7IA 4BLOA 3MMXA 4HDOB 2FWBA 4FGZA 3UB4A 4TRNA 4WBSA 4FYXA 1OI7A 3M2TA 4FI3F 4FIDA 4RSMA 1SKUA 3RU2A 2LYJA 3UGJA 1Q0HA 1RKVA 1Y3HA 2ZDHA 3NW9A 4MWTA 5F3RA 4ZVRA 3RSHA 8ABPA 1G7TA 1X74A 2Z5LA 3BFVA 3GLRA 4YCLA 3AX6A 3IP7A 1QZTA 3E0XA 4KXQA 4QG7A 4XVRA 4C4ZA 2AQKA 5GJBA 4PIMA 2O2HA 3F7TA 3OJWA 5A05A 3UGTA 2FQWA 2XTAA 3KTDA 1RYDA 3W34A 4DPLA 1VKRA 3HNRA 1XN1A 2QS9A 1NTOA 1CW2B 1M0TA 4P0TA 2R8OA 5AVKA 2PZAA 1Z7WA 4URHA 4LY0A 4CDMA 1ZK3A 1CJSA 1BH2A 1ICIA 2PGOA 3O47A 1ANKA 2BE9A 4IHJF 3QNMA 4QOIA 1XRMA 1GQFA 1CJCA 3G2QA 2ZIUB 4UTRA 4B0PA 4LFBB 2Y1GA 4KR0A 2DBZA 2W93A 3EVCA 4KVGA 3O9ZA 5E0KB 2Q1UA 4DRXA 4ZN6A 4BFCA 3PJRA 2HW8A 4RJTA 2YWDA 2P5UA 1JE0A 3DMRA 1APBA 4DJ5X 1LA2A 4YAWA 5F3DA 3IVMA 2OQVA 3TAUA 3QVMA 4KSYA 4ND8A 5DCUA 2QIOA 1M7HA 5F1OA 2UDPA 2ZT7A 2VQEB 1COZA 2RGRA 4JYAB 4DADA 1QIIA 1GNLA 2BFMA 2F3PA 2I78A 2QRMA 4Z1OA 4QYXA 1IEQA 3F3MA 2IYXA 4ONEA 4WX2B 3V3TA 5THXA 4ARBA 1DJMA 2G08A 4PCAA 5BN5B 4NFLA 2JVLA 3Q5GA 2RI0A 1NIJA 3KV1A 3OQBA 4QFDA 3KLBA 1UPXA 5JCPA 3J81k 3OZRA 3JQ8A 2IXBA 3JQ9C 3WLKX 1P9LA 2OHHA 1G5FA 4I0WB 1BQEA 1V11A 4GGMX 2XI8A 1TMKA 3H42B 3C24A 2A3NA 4OBEA 4E6PA 3OX1A 1F12A 2IHKA 3GZCA 4HMOA 3IDFA 4ZU1X 3T52A 4QELA 1KKLA 4E5SA 3GG9A 4P83A 3EVEA 2C1ZA 3NT4A 3ILYA 1V6SA 2CJFA 4TWIA 5CLHA 4N7RA 5ES4B 5IAOA 3GFTA 5B3KA 3AUFA 4XVQA 3GJZA 4O4JF 1FCJA 3CKMA 4A8TA 5CT5A 3TQCA 3KYDB 5A6SB 2ZVQX 3D2AA 2PXDA 3EVNA 4BEWA 3ENVA 4IS2A 5G02A 1X57A 1EJBA 1LW7A 4Z2YA 3DZCA 3ZD6A 2PGDA 1NURA 3I73A 4HL6A 4K6FA 5JD6A 4V38A 5H80A 4UARA 4QYWA 1RJ9A 3ON5A 2MT9A 4DBZA 4BNYA 5LBIA 3IYLW 2JFHA 3ZV5A 5JQGA 4IA8A 4U3JA 2QGFA 1OE0A 7AT1A 3GN5A 4V03A 2B6HA 2G5TA 5LU8A 4KPFC 4RVGA 3KQUA 3H2HA 4YBAA 1U2SA 3DMNA 3KQTA 2BUCA 1QHIA 3MIIA 2F9LA 3G49A 3WWZA 3G7SA 1FQJA 1LBQA 3T6KA 1T9AA 2OP0A 10MHA 4EO9A 5AM2A 2QJRA 2GPNA 2XXPA 1GL7A 3ITEA 4KKXB 2ZT5A 2HB6A 3GI1A 4OHXA 3WGGA 5ENZA 4RH1A 2M2IA 3KU4A 4KQ1A 1T8RA 1JWAB 1SHLA 3P2KA 4M8KA 1HI9A 2D8AA 2PS9A 4PAMA 5LUBA 3QVJA 3HCWA 1PZMA 1EFUA 1N2CE 2H63A 3IAFA 4HDKB 4QUEA 2NU8A 4RBNA 3TRHA 4NVRA 3HH8A 2Y71A 3PWTA 4UM9D 5EUQB 5FBHA 2IPAB 2VHEA 1YOVB 1IMJA 3IULA 3TL6A 5TJ9A 3P0HA 1TZKA 4LF9B 2XCQA 3G5LA 4Z5XA 3JAKA 3T9DA 2ZBFA 2LV8A 1JLRA 3LKZA 3SC4A 4P84A 3IOCA 4FUQA 1P8JA 1YCDA 2C5HA 4HEQA 1MO2A 2OZEA 4WDRA 5D1NA 1P91A 1E99A 3GDWA 3HJUA 3IOMA 3ZHMA 4ZHSA 1EVJA 4OUDB 3K9CA 4J0GA 4JGIA 1Z3IX 5E1DA 1FSGA 1Z8HA 2PBRA 1JMKC 1RIFA 3DGEC 4MPTA 3LHSA 4PZYA 2Q27A 3EOAI 3M5CA 1PJRA 3O26A 1GZ7A 4MCXA 3QLUC 3ZW7A 4TPKA 3X2FA 2V55B 1E1KA 1RKXA 1ZMRA 2PE5A 2GO7A 5DW3A 5BXYA 1G2IA 5B1DA 4G07A 1OAKA 3BJMA 5G41A 4C14A 3A6JA 2NZYA 4EKNB 3FROA 4FGUA 2KPJA 1AXRA 1WULS 4BQQA 3HXPA 1Y8RA 2J3MA 2ILVA 1DBRA 2PXXA 3MCWA 1SOVA 1SQGA 3DO6A 3F1KA 4KWIA 1GAJA 3RJMA 5FX2A 1AA9A 5JMTA 1CLUA 1FFXB 2QZPA 2DR0A 4MS3A 4A2QA 2P2ZA 1TKCA 4N3CA 1YXMA 1F1BA 1R6UA 1TAHA 3HWX1 4HWPA 1EX9A 1ACLA 2W9XA 1FFGA 3QI2A 4RS4A 1KQNA 3W06A 2OB1A 3NIFB 3B8EA 5DCLA 1TOAA 3ABZA 3IUYA 1CR0A 3PIIA 1E2DA 5TJHA 4DRYA 3USES 4YV1A 3LXXA 1R3UA 2B30A 1PERL 4YRIA 1ESZA 1FLDA 1XTSA 3O5AA 4I50F 1MDBA 3ZCSA 4ESVA 3AUKA 4ZAGA 1GQRA 1U7OA 4HAZA 2MWMA 3F4KA 3MPOA 4JYZA 1EX6A 1V5IA 2CLCX 1KIFA 4GZ6A 3HKDB 3LI2A 1IJBA 1QWSA 1CUVA 4HXYA 4D96A 1P61B 3QE2A 2QZ4A 4WFQA 3VH2A 1O6GA 4H7KA 4DGQA 4B3BA 2JRCA 1IC6A 2VT7A 4EHNA 4W7IA 2PL3A 3K8OE 4KDFA 4XA8A 4S2UA 4X4IA 3Q3JB 2W22A 1UOPA 1N34B 1YRHA 1R0RE 3EG5A 3VNUA 3F3KA 1JB9A 1KTIA 1WCIA 2EWVA 4TV8B 4RTOA 2D3WA 2CL0X 3QVUA 2A4MA 2QZJA 1QDUA 3D6FA 1XK6A 1V1RA 5DGIA 3X1WA 3H8JA 3ZTTA 4EGSA 2XCTB 3F9RA 1KS2A 1NP6A 2LTAA 4GX0A 3HLTA 3RRXA 4F91B 2ETVA 2QMHA 1H6CA 3KR1A 3LYLA 3KTFA 4L8LA 1PR6A 1LDMA 1FSPA 1B26A 5KIAA 2ATVA 1B0PA 2W83A 4F9GA 3SYTA 4WN9A 3EHEA 3TM5A 3UWPA 2QDXA 2O0MA 4YS6A 1A71A 2C92A 3W5HA 5HYVA 1SUPA 3PGXA 4IZ6A 3T0GA 2YR0A 2BCEA 2Q6IA 4JL5A 4UD6A 5T4EA 4EQZA 6CHYA 3OZVA 1ZOLA 2Z1MA 5JC8A 3ZHCA 1TECE 4BX2A 1II8B 3JWGA 5D5QA 4P3XA 4YRPA 2GRLA 4XWGA 1DIRA 1VIDA 1JXMA 1NM5C 4XJVA 3SC2B 2XGGA 3DP7A 2I6UA 4FNAA 4Y6SA 4KQWA 4KQJA 3ONDA 4XM1A 2NO9A 3KBBA 1AS2A 2GVDC 3P0IA 3B1XA 3PEVA 3OICA 5FNVB 3TINA 3H75A 5BSUA 1OVMA 2J59A 3E2PA 3KALA 5SY9A 3N3AC 1G21A 1THTA 4A1FA 1CEEA 3VDXA 3OP4A 2OAQ1 1XZHA 3PITA 3IP8A 4JVSB 4V0LA 1FYWA 1RU3A 2PSDA 3G2MA 4LXQA 2FPKA 4U7DA 3AOEA 2YZNA 4MKHA 2Q5IA 4IWRA 3O7WA 4JBNA 3K9GA 3DZGA 4NK4A 1I3MA 1MIOB 1OROA 1L4MA 1RFGE 2P9GA 2PKEA 3DW3X 3FPAA 4FLMA 2OXRA 4ZODA 1E20A 4KKVA 5DBEX 1MT0A 1NVAA 2VYCA 3SOPA 2BEVB 1VMAA 2HADA 5JJIA 1PKEA 4Y1RA 4DWWA 3M1IA 3J81A 4O4IB 3AONB 4NZMA 3PZRA 1SCNE 2VWQA 4ZVTA 2FEKA 4HVTA 1BU8A 2WY2D 5H4GA 1BG6A 4NFHA 4ZO9A 3WSWA 1AJEA 4HLNA 4RZSA 3SC3A 3MAJA 3CEMA 1AO3A 1Z25A 1X0XA 1U28C 4WXPA 4ZVMA 5E6RA 1PG2A 4EYGA 5AFSA 2DC1A 2VOJA 1TKRA 2MSNA 3NORA 4OAQA 3VKGA 1BEUB 2C9YA 2DHDA 1OLOA 4DLWA 2VDVE 1LBIA 2AE1A 4FD3A 4WBXC 5B53A 4B4VA 1XJ5A 5AW6A 3ZBQA 4H7IA 4ZYYA 2L19A 4NHOA 1I1NA 2QXUA 4H4EA 3K1YA 1KU0A 1CPYA 4BQNA 2ZSUA 2QU7A 4EY6A 1TO2E 1OTXA 3MT0A 4TLLB 1P0MA 1NN0A 2CJPA 4H9GA 1O97C 3GW8A 1ZJJA 2NADA 1SBTA 4D9NA 4P58A 3F52A 4WLOA 4XIIA 3GUHA 3VR4H 1LFAA 4JHXA 1EK6A 3D3QA 5HGXA 1F7UA 1EVLA 3QYPA 1EAMA 2AI2A 2GFQA 3F6BX 4J90A 4MKZA 3SXUB 3T3GA 4ENTA 4P0PB 1XVAA 3IXQA 1FYDA 2OHIA 4MPPA 2ENWA 1VC2A 1Y1PA 3HV0A 2ETXA 3EZ6A 4JR1A 4IMIB 3E8XA 4JXXA 1D4FA 2LYQA 1LLQA 1EDZA 2ZYTX 4XPIA 4C7OB 1CEXA 5KYUB 4TZ6A 3RGGA 1Q1AA 4N0EA 3W5DA 3EH1A 4BFZA 4BYMA 3TR0A 2O3SA 3ULKA 4A0QA 5CB4A 5AI8A 2VK2A 3UWSA 2OCGA 1CB7A 1JKJA 3LLMA 4DF3A 5JBNA 3PLAE 1T6NA 1G6HA 1ADRA 1GPMA 2VQ3A 2QTAA 4FINA 5BWLA 3P9YA 1U98A 3QBVA 2XIJA 4X6LA 3X1JA 1DULA 2ZYUX 1JA0A 2FN3A 4ND4A 4RV9A 1PGOA 3NGXA 4UBIA 4DHWA 2DCUA 4JC0A 3DO8A 1G3QA 1DIGA 1T2DA 2FN8A 2YVLA 4QQRA 3AJ8A 4UPVA 2A9QA 4BX0A 2O4AA 1Q17A 1VG1A 9MHTA 4TKLA 3DBHB 2HF8A 1YE3A 5TDHA 4HBZA 5FFFA 5JPDA 2ZEJA 2EDAA 4GMFA 2JZNA 3JXDL 4K6HA 3MRVA 1U9YA 2VK8A 1J21A 1CZOA 3EMDA 4TM8A 3RZZA 1P4JA 1AKWA 1BFKA 2IYYA 2PRKA 2XF2A 3KR2A 4YLGA 2Q0QA 3BBPA 1A8QA 1RXUA 1SVWA 2PFSA 2BSXA 2P90A 2HU2A 4RK4A 1CERA 3PE4A 2OBFA 3CEHA 1Z08A 3AI2A 5CG2A 3TJZA 1AHHA 3K0HA 4BNUA 4HQOA 1R8XA 1G5PA 3NH9A 2CLDX 3HDTA 4JB3A 5J40A 5KNDD 2ZU6A 2FCRA 4CL3A 2BH9A 3L49A 4OKIA 1X70A 1IL0A 4MLZA 2PXAA 1E9RA 4JP5A 1X2EA 1O57A 1NYQA 3FMVA 3PWSA 2GM9A 4FDVA 4RAOA 5GWXA 4I8IA 1TPYA 1ZBQA 5H82A 5LQSA 2H1CA 1EWYA 2HWKA 4AY4A 1AHPA 1WHTA 2R7AA 3VKWA 1G9TA 3RWMB 3PFGA 2RHGB 3BMCB 2UV8A 5LKRA 1PR5A 1CEYA 1GP2A 3TNYA 2WNSA 5IAEA 2AEFA 1J2YA 3OWOA 4AS3A 3EE6A 1PRAA 3IKLA 5EZQA 1J5EB 3DQPA 3H1AA 2QW8A 1IY9A 4CNBA 2I7DA 2FZEA 1JEJA 3Q6IA 1TXGA 3C3BA 2FR8C 3QLVC 2ZTMA 4H7FA 4Z3KA 4MRPA 5IZ4A 4GLOA 1OFIA 3CH6A 3JQCA 3TAHA 3TUIC 5HDBB 1K8ZB 1SHKA 1ECJA 1TUGA 1ZL0A 4L4XA 4XSHA 1A1SA 2BGMA 5DEIA 1NY5A 3K09C 4A73A 1UZAA 3JD1A 5IF3A 3GLIE 2ZDGA 3IO3A 4RO0A 1L8XA 3CLRD 1X7YB 1G8SA 3I09A 4N47A 1Q20A 3HJNA 4Q01A 1IWPB 1U0BB 2HA7A 4GP7A 3RBVA 4I5GA 2REQA 3FCEA 1SN7A 5K0FA 1XZCA 4M0KA 5FT9A 3WIBA 2ESRA 2OGWA 3H11B 2GCOB 2X22A 2K5UA 3GLQA 1DFGA 4LXIA 4QU9A 3TOXA 2ZJ5A 4I1YA 4LNHA 4O5OA 3TEJA 1Y4SA 4XM2A 4PFJA 4S1TA 4D99A 3C7DB 1WF6A 2QQFA 3DNMA 4PNZA 4DCNA 1XTZA 4E21A 621PA 5IJAA 3THYB 1FDRA 3HN7A 5AW0A 5AW1A 1RM0A 3RVNA 2BBOA 4EUEA 2CMKA 1W36C 4R4JA 4TTJA 1YK1A 2XD9A 5IKXA 2V6GA 5EEGA 4I50A 3DPSA 4GLLA 1K63A 3K0CA 2PQMA 2XYRA 3X1DA 4B4DA 5THKA 5EKUA 4Y0NA 5ALYA 3RAEC 5JG7A 2V97A 1YQWA 2ZBQA 3IR5A 4N41A 1F5SA 3TAXA 5AI0A 4JAVC 2KMLA 1N6HA 1Z3CA 3L8YA 4JB8A 1E96A 4O2AB 2WTNA 1JHUA 3ILHA 4B2LA 2JFPA 1W1UA 5IDVA 1FMJA 3A4MA 4TRJA 4H60A 4TZ0A 1JHRA 4L4UA 3V8RA 4JUAA 4J6FA 2AE2A 4KVAA 4XYGA 3UN1A 1X80A 1H3FA 1BHQ1 5C8VA 4JSTA 3T8YA 3BWBA 3L5OA 1N3BA 1RRGA 2B6NA 5G4LA 4DMRA 3R41A 5C8XA 5LM3A 3CF4A 2QV0A 4IIDA 5FA5A 2GYYA 2FRVA 4MGKR 1ZUWA 1RC0A 2W2PA 4TUYA 2R79A 3UKJA 3KXPA 1BTOA 2ZAMA 3HXTA 1CUSA 4MAFA 1UDCA 4MARA 5ALOA 4GM1A 4P4TA 2D4HA 4G84A 4UXHA 3A2MA 3ELWA 3B1ZA 4HS9A 4E5MA 3LY9A 2FR1A 4UCWA 4U6QA 1JN0A 5TT1A 4E1BA 2WWFA 3IDZA 1M9NA 1TKBA 5KYWA 3W5UA 2H1LA 4F11A 1P17A 4O1HA 1SO8A 2RI6A 4UBJA 4EVRA 4Z53A 3KZ3A 4AUMA 1LPBB 1ZD4A 1R10A 2X9VA 2Q2WA 3FGZA 2W6OA 4MUFA 3BZBA 3HR7A 2GEBA 4O8ZA 4I5DA 4XGRA 3HZHA 2AXNA 3UGQA 2O1SA 3NASA 1CQIA 5L40A 2OENG 2UZ1A 1NRJB 1T36A 1WW2A 4S1NA 5KNBA 4BKRA 4BO3A 2O8DB 1HOXA 1N5KA 4TRMA 1CJUC 1SKMA 3PE6A 3NHMA 5E9JA 4IOMA 1I9CA 4M2LA 4AJNA 2XCJA 2H8KA 2BGRA 3FH0A 2LWIA 3PGKA 5F2KA 2I66A 4GWGA 1X38A 1R8QA 2GM4A 1WPQA 1L4LA 5K8IA 2XHZA 3RHSA 2COKA 1FLAA 1Z2AA 4YT8A 5LBTA 4QXQA 5IULC 1OXBB 1SY7A 2ZETA 3WWYA 4Z4EA 1EK2A 2J9FB 3EEBA 3DFMA 3I9MA 2E0IA 3EXG2 2GVZC 4KWHA 4W5HA 5T4BA 2I1QA 3ITDA 5K3FA 1LU9A 1JDJA 2OWEA 2VG8A 3LPLA 5JIBA 3NXSA 3GPCA 1ID1A 4NEQA 4B48A 2PY6A 5BY2A 5JQGF 1CB0A 3JY6A 2QMUA 3GPLA 3VKUA 3E7XA 4PG8A 3C4VA 4QUGA 1XZQA 3KPWA 3G82C 3OZWA 4G1CA 5JSZA 5DASA 3CVOA 1R69A 1TO1E 1W581 2VHYA 3TQSA 2D0PB 2IZ0A 3BXZA 3CV3A 3H97A 2EJWA 2GUGA 3EJWA 5FUWA 2L49A 4KIGA 4A03A 2UYOA 4Q7LA 5HHTA 1Z62A 1WBJB 2HGZA 3P2YA 4X1KA 3GZTB 5F4BA 5SYAA 2C5LA 4WK2B 3U39A 2C98A 1Z2NX 5C5EA 3NVMB 4OGKA 4P4UA 1O0CA 2C9CA 3HRKA 3EYAA 4OU5A 3GDGA 4TXLA 3K0FA 5KC9A 2OOSA 1MW9X 2ISCA 2FYTA 3OEEA 2VNJA 4OFXA 2YRXA 3F78A 2ID8A 3F96A 1BROA 1C0LA 2Q3BA 2QMZA 2W7TA 3R3SA 2H5IA 4HWSA 4JLVA 5T3UA 3SXJA 4MQ5A 3DE1X 4YMIA 4A0FA 4G5HA 5IK2D 1KEKA 4RMIA 3NVAA 4O0MA 2AF4C 4DPKA 3OJCA 4GPBA 4DCTA 4RHFA 4FMDB 1V1RB 2XTZA 1L1EA 4RF3A 3EASA 4ZU3A 4OOFA 3I53A 3S5JA 2JCXA 1YO6A 3V1LA 1ZUIA 2P3OA 4YRNA 1R5OA 3C39A 3CC8A 1M8FA 4YP7A 1UFKA 1G42A 2EERA 4AF8A 2D2IA 3OY7A 3HO1A 5AJTA 1GCGA 1WUIS 2XF8A 1E2QA 2RGNC 3BL8A 3QMVA 4LRTB 4LBZA 1H8HA 3U5TA 3N2IA 2WM8A 3R5SA 2PH7A 4M0MA 3PYMA 4JVOA 4ZI7A 4KVFA 4WBNA 3KVYA 4L07A 2OC9A 3G59A 4XWKA 1E60A 3ZY5A 3FLEA 4NBVA 3VAAA 16PKA 4HLQB 1OX6A 3VHXB 1A9XB 2XZOA 5MHTA 2YY5A 1Y82A 3UANA 3UMFA 2QPAA 5K05A 4HPWA 4RK0A 1XJCA 4HDSB 1KU6A 3AI7A 1Y6GA 3L7MA 2JLWA 1AVTA 2PUBA 1G41A 1QH9A 2P4EA 4LJKA 4YCBA 2IV3A 4GS5A 1CVIA 2GXQA 3AUTA 3PHJA 3FYHA 4EZBA 2AEMA 3A6PC 1QC5B 1Q1BA 1PWEA 3Q7QA 1AU9A 1T9KA 1GNPA 5J2UA 1ATZA 2V59A 3RU3A 2IIPA 1PGPA 1T0PA 2X8JA 3EIWA 2P9YA 4JQZA 4PXAA 1S2DA 5FR2A 3UMYA 5F9HA 1F20A 3MHPA 4HWOA 4XX0A 2O8EB 3L8MA 1SXQA 4Q9NA 4Y2TA 3F3SA 3HUEA 1G21E 3K2BA 4HCJA 2H48A 5CDFE 3A9UA 1YR2A 3M0EA 3P97A 3B78A 1DJOA 1CQJB 5E6SB 6REQB 1YJ8A 3R9KA 3U6KA 3U4QA 5HMLA 1ECFA 4BNZA 1MB9A 2V96A 4A8PA 2IIBA 2JEYA 2X4GA 4LZAA 4W1RA 1UXKA 2J30A 1GZ4A 2GAOA 2EX4A 2WUEA 3DKVA 3V4LA 3NAZA 5J23A 3T5AA 2PGLA 3H9QA 4YXWD 1L7DA 3IEXA 3UYLA 1Y3CE 2P9ZA 2PZEA 3F6CA 5CX1B 2CBXA 1W7AA 3I62A 1W46A 5EGSA 2PX2A 4GFDA 2G09A 3MEQA 3M4ZA 1GIAA 2VP2A 3RYIB 3CO0S 3WOVA 4PG5A 4CLHA 4DLNA 4V1CB 3P9RA 4OHRA 2C2WA 2ZAYA 3O1JC 1A27A 4YJ3F 4ZOBA 3WRYC 1YBFA 3EWIA 5E7IA 5TR9A 3H84A 7MDHA 1TT7A 4GBJA 5FPTA 3NWOA 2WJVA 3WR5A 1E2EA 2C29D 2QV7A 4R1NA 1K2WA 5LZ9A 4HB3A 4NCXA 5LQNA 2C4HA 2L42A 1E2IA 5JAZA 2JBAB 2C4UA 3GH3A 2E4WA 4PC7A 3H4VA 1NE7A 4D3SA 2ZJ4A 3LT1A 2IF0A 4P7JA 1KMHB 2AOTA 5CYGA 2XCRB 4UBKA 1PJSA 4KGXA 4MUBA 5CRIA 2UXBB 4GECA 3HLKA 3TQHA 3RLFA 2C77A 3TEPA 1I7PA 2AK3A 2REOA 2YN2A 3ANYB 3C3MA 4GGPA 4CUZA 4DR3B 7REQB 1KAQA 1T1EA 2WAXA 1JI3A 1D04A 2AKAB 2B4KA 1CUFA 1Q7TA 1TYEB 2Y27A 1XMJA 2NZ8A 2OORA 1V4NA 2ZSEA 4OB7A 3MF4A 2H7VA 3AEQB 1W35A 3QE0A 1IAQA 1H2XA 2BZ1A 3IEPA 4IVNA 3FW1A 1NRWA 4QTZA 4LSMA 2X3YA 3VHLB 4Z86A 1CV2A 2QJOA 5FBLB 2ZE5A 4ZO6A 3BZUA 2IHVA 3UMCA 2JIDA 2GSWA 2WU1A 5BW6B 1I8TA 4HRVA 3WHKA 1DJNA 1L9KA 2X3UA 3M4YA 1AURA 3WDMA 3MWYW 1T5OA 2GRJA 3VC1A 1KVUA 3KYBA 1ZXLA 4DXAA 2XMGA 3DUWA 3JZIA 3EN0A 2QQGA 3MQ2A 5E7QA 4FT2A 2ZJAA 4M9CA 1G4HA 4J2TA 1VRVA 2H52A 1U2PA 1M34E 3DULA 4MWOA 3A1SA 4YUXA 1ZJZA 4OOEA 3WYGA 5KQPA 4CKYA 4CT0A 4ER0A 1GL6A 4QYSA 2IHZA 2GCIA 4UZFA 2ZQYA 4BQPA 1M8JA 3C5WP 1ZIXA 3DOJA 4LGYA 4LHWA 3WKAA 4B3CA 3URKA 3V80A 4ALMA 1WCIB 1BEZA 2NZJA 2XYGA 4NLLA 4TV8A 4UHKA 4JCXA 3SOZA 2WJIA 5DWQA 3E03A 1KZ1A 4K40A 4B75A 4JKYA 3DLPX 1YKSA 521PA 3T9BA 2ZUFA 1TYAE 4BZWA 3CWZA 2Z09A 3UVEA 4KV9A 2ZAOA 2Z9DA 3ISVA 4H16A 5AM4A 4YUZA 4BJ6A 2BCJQ 2CF6A 3DDSA 1VI2A 2JHFA 2LW7A 4Q12A 4BNFA 3KD2A 1DW9A 3PYXA 1XNGA 4Q48A 1QP8A 2EP8A 2ZRPA 3CJTA 3SXPA 3ZLTA 1NC3A 5IEJA 1VG8A 3K15A 3WK9A 5JJKA 4Y6QA 1Z8NA 4RIIA 2VP3A 3OOJA 4JLPA 2GOYA 4YRTA 2J85A 2NVUB 3BG5A 1JQKA 5LXTF 2UZAA 2ZTHA 4EB8A 1EAYA 3AXSA 4ECEA 1YB6A 1QK5A 1RKQA 3WLTA 1IN8A 3FUCA 3NBXX 4Z9XA 3ND8A 1ZINA 2XIUA 3FNBA 3JQ8B 2YUIA 4X1YB 2WIAA 4DWVA 2AC4A 4IX9A 2R3SA 3N87A 1GCAA 4PX2A 5JSKA 1KXJA 4MQUA 1G3RA 2O4UX 4PPFA 5CH8A 4BX8A 1J39A 4JI2B 4RVHA 4BATA 2NU7A 2ZRCA 4Y6RA 3LWDA 4EHAA 2OECA 1I13A 1KK0A 2NV2B 1OXMA 4MX8A 1ONBA 2W90A 3UH1A 3STXA 3BB4A 3C7AA 5EPEA 4DDHA 1O89A 5DBFA 3FB1A 3D1JA 1QZUA 4HN9A 3SYMA 3B7WA 1NNI1 4DEXA 2R8BA 4DG5A 3QIAA 1W59A 3H6GA 4EELA 2TMKA 5J5CA 4V0KA 3L7CA 4DKXA 1A9ZA 3WFIA 5IDWA 2XNSA 2OZLB 5H5JA 4B3FX 2QM0A 2F64A 1JJ7A 1ZZ8A 5TEWA 4QASA 1TZJA 2C9OA 4FNMA 1TVCA 2JEZA 2X5XA 4MKXA 3KSUA 4RXMA 4UVHA 5HK9A 2J45A 4YREA 2ODPA 3OZUA 4GXTA 1QCZA 4LY6A 5D5HA 1S1MA 4OB6A 3CJRA 4Q21A 1XROA 3W3AH 2YIJA 4GQMA 3AVVA 7MHTA 4ZMSA 1DV1A 2FK7A 4RK5A 5FOVA 3ZY2A 4BGEA 1C0KA 2FPGA 1YL6A 3CUEF 1WVGA 4XWYA 1CF4A 1WDKA 2WT8A 1AKUA 5CT9A 4RA6B 4DTIA 1WABA 3AV0B 4EDHA 2KM1A 3ANNA 3VDQA 3CPSA 4MS4A 5AQ1A 2XECA 1W96A 1ICEA 2NU8B 5MFPA 2YFQA 4DE5A 3WQHA 4X7PA 1ZN9A 5H3CA 1GV1A 5LA6F 4EARA 2ZZMA 2GZ2A 2VF2A 3ASUA 3NX4A 1IJFA 3B82A 1O5OA 3SZLA 4DA8A 3WLLA 3OHPA 3C41J 2GPSA 3OZIA 3H5TA 4GLFA 1FDOA 2WSYB 3DAHA 4JT4A 4BZXA 4FSDA 4ER5A 1DAHA 1R9JA 5F5XA 3VVMA 3L46A 3OHSX 4BUJA 5IT4A 2FP4B 2EW2A 1S2OA 4XLZA 3GUVA 4D8XA 1OVGA 1AQNA 1FXSA 3NKVA 3EXIA 4RK1A 1CYEA 4OK3A 4JX8A 3EDRA 3G9XA 4XJXA 1ZD3A 4AJ2A 3OPNA 4BY9E 4P93A 2QPTA 3CWCA 1PTJC 3P32A 4GL4A 2YXPX 4N8SA 4ROTA 2D1YA 3KOZA 3O1LA 2JFZA 1X9IA 4F9EA 5L4SA 1KI6B 1IK6A 3CZ4A 3U17A 2X42A 4GUAA 1DX9A 4KQEA 2NXEA 1Q0RA 4ADSG 3WLNA 4FQ5A 3SR4A 1R15A 1TF7A 1KSHA 1ZXBA 2EJUA 1F14A 2VJPA 3KV3O 4MRRA 2VP9A 2BFOA 2B1GA 3T1OA 1Q12A 3D5QA 4IO0A 2IS2A 3NM5A 5IJ9A 1EU1A 1W29A 3QEOA 4OREX 5MGBA 3X44A 2GBCA 2AYXA 3KUCA 3GGSA 2OCAA 4GR5A 4RH3A 2NUTA 2G82A 1QP0A 1AQIA 4TLEA 3BDIA 4DEYA 2HDWA 2AJBA 4TUYB 5AI5A 5KHLB 1DZ3A 1RJ9B 3U48A 3WNQA 4CMEC 4QZVA 1YI0A 2HQSA 4MVJE 1ZI9A 1ZA2A 4FC7A 3UHAA 1W36D 4RGYA 3R5TA 2O50A 4IEFB 4RFSA 2WOOA 4ZYWA 5AICA 4UTPA 2G70A 1X86B 2AXPA 1X1TA 2QYHA 2XITA 3N39C 1Q22A 2HCSA 1C1HA 4K46A 4I3GA 2BONA 4YBZA 3Q9SA 4P31A 4D2IA 4CV3A 3E6AA 1I2AA 3GZNA 1YCGA 3HJTA 3TSWA 3ZY3A 4NR0A 2WYWA 2V7XA 3PXEA 1G60A 1UJ6A 3G2NA 3KXIA 1NX6A 3RS7A 3EZ9A 4JEMA 4Z9AA 3LTNC 4BIIA 3ZU4A 1LZLA 2R00C 1Z68A 3H1GA 4RC9A 4ZOLA 2J33A 3N7AA 4WZAB 4BEJA 4WIAA 3KEQA 4D97A 1QIMA 1GTL1 1VP3A 4R2WA 3CLUC 1T6ZA 4E2ZA 5ALQA 1YI1A 2AW5A 4WGFA 3ZDBA 1SXJD 5FAXA 4FXPA 1DADA 1GA6A 2HA5A 1J23A 1DKRA 1V7PC 1DEAA 2YJ5A 3RADC 2H65A 3BRQA 3HS3A 5ALEA 3HWRA 1RPZA 3TCNA 4MUHA 2FRDC 1K9VF 1NXWA 3S28A 2D1FA 3LISA 1XMPA 3KQHA 2FZGA 2WKWA 2VN8A 3AKCA 2KBEA 2QMOA 1JMVA 5AM5A 2X1VA 1CUIA 2WZBA 4BDSA 4G5XA 5EQTA 3CH4B 2E49A 4CQJA 4ZVPA 3R3WA 4K2HA 1K2VN 4II3A 5TQ0A 4E88A 2AFHE 4G0QA 4ID9A 2EKBA 3BQMB 3EWSA 1JFTA 4TL7A 5DNEA 4D9GA 2IOYA 4G01B 2ANCA 3KQQA 3H5AA 4R1MA 2O4CA 1P5RA 1F60A 2QI9C 2UAGA 1GKLA 3SS8A 4H4DA 4EA7A 2GBGA 3UC9A 4EG3A 1MA3A 4IRUB 5T8KC 2PXTA 2BEWA 2PJUA 4J0EA 3ZTYA 2I2WA 1OLUA 2D06A 2Q4RA 4B80A 4C0HA 2OCKA 3C7CB 4EJ2A 3SCZA 5SZIA 4Z6KA 1XZBA 2ECFA 1LD3A 2G3YA 4KQFA 5HIJA 3RRBA 1FY2A 3A4TA 3N7UA 1Q0UA 4YAGA 1XMQB 3SM3A 2R5NA 3U7EB 2HUNA 3JQFA 3KT8A 4AJJA 2HQRA 2FSVA 1IHUA 3BZWA 1PV1A 1Q77A 4ER6A 4MQBA 4ZQGA 2CLOB 3QFFA 3D4BA 4R84A 4G1UC 1KAHA 2OPBA 3T95A 2PXFA 2YV5A 2NG1A 4K81B 3ZVKA 4UAVA 4KE9A 3OZ7A 4NS4A 3ZJYA 3F46A 2ZYSA 1E94E 4QLAA 2V54A 1PLJA 1WZUA 3E82A 1E3TA 5THQA 4K8OA 3SQDA 4UM9B 3C8DA 5A4MS 3EDMA 2ZM5A 1N7IA 3B85A 1EFCA 3RW9A 1R64A 1W4BA 1TIPA 5EL0A 5LZ8A 3EIQA 3ZDAA 2IEYA 2X76A 1I1HA 1Z4QA 4WKCA 1NX9A 1CY8A 4MLPA 5KYVA 3WQBA 2AI1A 1DTSA 1G5QA 2H06A 2KWIA 3NTQA 3Q72A 3T7KA 4B2YA 4YAFA 1PR2A 3QQPA 1B73A 3AFGA 2CJXA 3HA7A 4OK6A 2SKEA 4R8VA 1JW9B 2DETA 4C2TA 4RNDB 2YHAA 4GPTA 2I8AA 1PGNA 2B92A 2R7NA 3IT2A 4N5MA 3O92A 4LJLA 1TUBB 2P77A 4FFLA 4IJ5A 3DBRA 2Q9CA 3KQLA 4EBFA 2PH3A 4ZZ1A 1YB2A 1OIXA 4JT2A 3HU5A 1NYTA 3N8GA 4LE1A 3NANA 4NCBA 3E9RA 3VPSA 1PWHA 2RJOA 3AEUB 3IQIX 5ES3A 1X7ZA 3IRUA 5BT9A 1W4LA 5K3FB 4JWTA 1V37A 3CVXA 2RGUA 4DLPA 2P9BA 5BQ3A 2W6PA 4FE3A 1SZCA 2XB4A 1Q19A 1XBTA 4IJWA 1JR3D 4JLMA 4DNPA 4JI0B 5MN5A 4XOUA 5SICE 5DMHA 1VL1A 2PYZA 3A4YA 4JXZA 1DUVG 2O3RA 1Z73A 2V9PA 3E3OA 1WVIA 1XDSA 2R6CA 3KTAA 4FP9A 4H1UA 4TYQA 3UY4A 4DLTA 1L7MA 2XTNA 3BKWA 1SUSA 5BR7A 1PTKA 4D4GA 2RHHA 2B8EA 1UMBB 5K0CA 2O7QA 1CETA 4CM4A 2V58A 5BN4B 4F7WA 3M70A 1KL7A 1Z4NA 4XIFA 2AJLI 1K4YA 1MC5A 3W6OA 1WF3A 4W5RA 3JD0A 3A3KA 4BHTA 1VLMA 5IC4A 1Y9AA 1NUHA 3QENA 3PNYA 2PLWA 1I2CA 4O1MA 3TFQA 5JJCA 1HNXB 5CYFA 4X61A 8MHTA 3F4BA 3NFRA 1CQIB 4PSVA 1F3OA 2DQYA 2UYGA 4YC7A 4C4SA 2R8XA 3GCGA 2JLVA 1KDRA 4GQAA 3RVDA 5J4YA 1BXGA 2Y2UA 2COEA 3DV0A 1JDVA 4Q3EA 2Q1SA 3ZGXA 3OLYA 3OX3A 5BOSB 2BFBA 4C0BA 1ZCZA 2ZXFA 2AMVA 4AP9A 2G8NA 2OGZA 4N01A 5CXUA 4L6AA 3HXOA 4Q3NA 4D92A 3SD7A 1ZVVA 4NBNA 1U3GA 1LRKA 5HM6A 5LN1A 3F90A 1XOIA 4AK9A 1U2DA 3DAGA 1WUTA 3F8TA 4JBHA 1ZISA 4PLWA 4QGHA 4WFIA 3PUVA 1MV5A 2MHCA 4Q4DA 3EVGA 4WOBA 3P9IA 4PCLA 3TZLA 5KWEA 3HM9A 3JQFC 4CYMA 1A82A 2OSBA 4PIPA 5DM1A 1NU8A 2FGJA 4QQKA 3GOQA 5BSRA 1QLHA 3NIBA 1IPFA 2YICA 4II2A 1E79D 4J2HA 1HE8B 4NKRA 4PSUA 4XAQA 1BMQA 1WSBA 1ZIYA 3SLKA 3VNRA 3WLPA 5LQAA 5KX5F 1T0UA 3IPAA 5H7XA 2F1JA 3O3NB 1K6IA 1NVTA 2ERCA 4W8HA 4UU8A 2XTMA 4WPGA 3G9QA 2V3VA 2DLDA 3FZYA 3MTJA 1VMKA 2DKFA 1VCOA 2XMDA 2IYFA 1DC8A 1Q7RA 3N0XA 2I34A 2ZSDA 3THXA 4XOIA 4DYDA 2QP3A 3JQEA 4YV0A 5BO5A 3FDZA 4BO6A 1U0JA 2V6BA 3MERA 4URZR 4WXRA 2Z2JA 1DXOA 1CIVA 1RWOA 4ARVA 3KKPA 4RQBA 4IUBS 4YRBA 3LMKA 2ZITA 5I47A 4S2EA 1QCDA 4NNJA 3W8NA 1RLUA 2WP0A 3ZI0A 3U44B 2B9EA 2CZCA 1CRQA 3WMGA 2I7VA 5B36A 2GVNA 4RKEA 2XDWA 2B7LA 4PRKA 2FPLA 4WZAA 2WSLA 3PXCX 4EYEA 5I7UA 5K09A 5JFTA 4LF6B 4OX9B 5JDIA 2VHZA 1T25A 3HYNA 3UZUA 3AINA 4F5EA 5AM3A 1WY5A 1ZC3A 3RH0A 5KYYA 4DV0B 1E6WA 2H57A 1FLNA 4M1OA 2BMEA 2RGCA 4JODA 3W1WA 2JI6A 4I9UA 3JVDA 1GYRA 1MZVA 1JG4A 2AMLA 4UTOA 3VPBA 4H7PA 4C3ZA 1P0IA 3H9BA 2IFTA 1KSJA 3A9ZA 4TMTA 5I7RA 3U7HB 2H4ZA 5CM2Z 3B20A 2D54A 2DPXA 4CCSA 1QYDA 2NO5A 1NPTO 1RBQA 3BWMA 4MGYR 2P62A 3GEHA 4NV3A 4O2BF 4ZXPA 2CCGA 4ZCMA 1EFLA 1ZAYA 2EJCA 3GBSA 3JZMA 3M3HA 4FGWA 4L7QA 4F4CA 4JT8A 2R4QA 1XT6A 4PICA 2QNRA 4NU5A 4UQLA 5J4KA 2HXGA 1JSRA 3M6UA 2JI8A 1V4BA 4CETA 2XSZD 3OU6A 4MEBA 2PSHA 3C4JA 3IQEA 1NBEA 3L79A 1QXSA 4LC1A 3ZJUA 3BFKA 3NONA 2IVBA 4F5DA 4IIUA 3H4TA 1RZVA 4RD0A 4PAQA 3SF8B 3DHNA 1IBSA 3ECSA 4G97A 3MGCA 4J0IA 1JRLA 2P65A 3PI7A 4NYIR 4KIUA 5FO1A 1N33B 1OLUB 1PF7E 4KAFA 4QEZA 1AU7A 3VTZA 1L4GA 1XD2B 2VR1A 4LYAA 2CZGA 4BV9A 5EOVA 1VFNA 1GUZA 5AH0A 5EIOA 5CURA 1ZD8A 3CVWA 4R7TA 4OY3A 3AKYA 3PCRB 5AM0A 1S2LA 4GKKB 3G0GA 3D6HA 1XCBA 1I5OA 1NSTA 2Y0BA 2HBQA 3CNOA 5T64A 3RIGA 2F1KA 4HZUB 5A2QA 4FWIB 4JS0A 3L84A 1H93A 1XD9A 1L4BA 3KB6A 3PQ6A 3ZXIA 2WVJA 1YTUA 4MITA 4QHTA 2YMMA 1Q0LA 3LYUA 1DEKA 3D3WA 5H9VA 4BVGA 4C7JA 5L3SA 2BP7B 5ALZA 1ZZBA 1XNRB 1P5HA 1TRHA 2PYDA 4WK4B 1B93A 1J5PA 2P3LA 4XR4A 4M36A 1G6Q1 2AZDA 2FSHA 4B4WA 3FVVA 1G64A 2FPXA 2OVFA 1F9AA 5DGHA 1RHKA 5FYDA 1AN0A 5CR9A 4BMZA 4QJ4A 3T3IA 2F8LA 1Z0JA 2HI0A 4QYTA 5KOIA 4FR0A 1YE8A 2XXQA 3AT1A 1TA9A 3GAAA 3JZDA 4CMIA 1JB1A 2D2XA 2D13A 4DMKA 2H0QA 5GP1A 1XNQB 3USCS 3DBIA 1VYTA 3EZNA 1M1NB 3PZBA 1W49A 4XRRA 1FTNA 3Q0EA 1ULBA 5HCNA 1KDYA 3SGLA 3KR9A 3A3PA 1BE1A 2BEUA 5F2OA 8LDHA 2XGMA 5H9WA 3IAM6 3REOA 3UQZA 3PXAA 1BX3A 5LA6A 4F4DA 3Q2OA 4B74A 5JAOA 3QXJA 2Q8PA 3PV0A 4CJXA 1UWCA 2JI9A 4A6EA 4EY5A 1MT3A 3WTCA 1RT9A 1JKMA 3KKEA 5IUKC 4YRLA 1JPNA 2W6ZA 3HVHA 1QAQA 4XD7A 4L5CA 1BQ4A 2Q6OA 1YZLA 4MYRA 4UDYX 3KAPA 1ZYUA 4IDAA 4AJ1A 4EW2A 2C61A 3MNFA 4Y6LA 3ZWCA 2QTWB 4YDSA 3NXHA 4N5HX 2E5LB 1YV9A 1X6VA 4M7PA 2WMDA 2D1SA 4JJGA 2C5SA 5AVJA 3Q3GE 1D03A 2ZS8A 3W1VA 1D4ZA 4ZTBA 5GMOA 4TQUS 3DYVA 1HRDA 1PJLA 3SVTA 3UCXA 1UK7A 5KTTA 1P74A 1QBGA 4B46A 3G13A 3FWZA 1X1RA 1MTOA 5K6AA 3QFCA 3D6TB 1ZRSA 2PAFA 3ZGOA 3C3WA 1RYYA 2ZBGA 5U4XA 3TZKA 2BJHA 2Q2NA 5IC5A 3DT8A 1O8CA 3LNTA 1Z0SA 5FRDA 3MILA 2E4XA 4R0VA 2F3QA 1QS0B 1W5EA 1DMSA 2F3UA 1LI7A 4H2DA 2VF5X 2PKYX 1A2OA 4NBLA 4R98A 5ED0A 2EU8A 2NO1A 4W9MC 4OFWA 1G9SA 3OF2A 5KQGA 3KZMA 4RA9A 5E9WA 5EJ9A 2YWEA 4RACA 2EFEB 4X41A 3CECA 2QUIA 5ICFA 1CSEE 1H9BA 1V8OA 3B1VA 2XJ3A 2WA2A 1TZ2A 2YVQA 5JVDB 5LZ7A 1Z5UA 4NCHA 2BJWA 2KEKA 3UMJA 5E9QA 2VJAA 4CL2A 1U2GC 3C6QA 2JAOA 1WDTA 3RCBA 4RZIA 5K8VA 1WV1A 1Q92A 3ILVA 3C15C 1Y34E 3V48A 4X24A 1QCCA 5ERXA 1L6IA 1X94A 3VYRB 4XVHA 4Q4HA 2W4IA 1ESDA 2H4YA 3WB9A 5FAKA 2XGJA 4UHBA 2F6RA 2IEDA 4QNRA 1Q84A 4JSRA 1HQKA 2V7TA 2IUYA 4GM4A 4JUCA 4Y2SA 3A6KA 4WADA 1FJHA 3DZIA 221PA 1PR3A 1LRLA 2JANA 2V0CA 4MJ3A 4ZD6A 4DNXA 4EMSA 3OFND 3AHEA 2OYRA 3K6SB 3OCWA 3PXUA 4KHPB 4MV8A 2FPSA 1PDWA 1SBIA 4QGSA 5CAEA 3IBSA 1Z38A 4HNHA 4H6PA 4Q9AA 4CF7A 3G8YA 5DHTA 1YI8A 2HK7A 2YZMA 5JD5A 1R4ZA 3HCOA 2ZSBA 1YCHA 1XWFA 4YRKA 4JLOA 1US8B 5JBQA 2L82A 4C9BA 1A0OA 5C32A 3KQNA 3RIMA 3AUAA 3OX2A 2RGAA 3COJA 1JAYA 3X1XA 4E09A 4XDZA 5AD1A 5HE9A 3ZHZA 4F2GA 4ARIA 1V26A 1N2GA 1KJWA 3ZDYB 3T94A 4DIMA 4KH0A 1QR6A 3CBQA 4RSGA 3V33A 1E3LA 4G4SP 1MB4A 2HL6A 4DCOA 5EZYF 3T5GA 1SC3A 2RONA 1E4EA 1BDJA 4MAMA 4ZOEA 4RTRA 2YYSA 3C0KA 3IAUA 1VHWA 3GJTA 2F43B 2I71A 3LVRE 5ENVA 3BS3A 2V0GA 1SXJA 2QTCA 2YY6A 1BO6A 4RF5A 3F49S 3CXRA 3IAHA 1AZLA 4MGHA 4CU2A 1O4XA 1GGFA 1IXZA 4DGSA 5C7YA 4YRSA 1J2RA 3NWPA 2SCUA 3RRNA 2FEMA 2NO4A 4HUQB 1JLMA 3AB8A 2HJRA 1QVAA 3FKQA 4Q3LA 4C7MA 3KP1A 1O77A 4EM6A 3AILA 1OZGA 1LJ8A 1B4DA 3AM3A 3UJ7A 1QF9A 2Q9UA 4CLXA 3EQ7A 3ETLA 3L4SO 3EUSA 3PHHA 5U4QA 4CR8A 4MUYA 3HB9A 1N2CB 1A9OA 3GZ4A 2INGX 4RVSA 4YV7A 3IDQA 2GPBA 4WDQA 5DLYA 3QVWA 4DT1A 4Q1CA 1N9ZA 3LCVB 3LGAA 1FFHA 4OHPA 1AXGA 1YKGA 3PA6A 1W88A 4B3IA 3RYIA 4XYBA 5D51S 3AF3A 3CGWA 3GLTA 3EG9A 3KXKA 1ADJA 3N5CA 3QUAA 1IE3A 2WJPA 4FEGA 4DCMA 3L8DA 1FRNA 2H7YA 2PO7A 5CB4B 2D4AA 1FMFA 1XWIA 5A0TA 3X3HA 2GN9A 3D1VA 3CNHA 2Q49A 4FILA 2WJHA 4GXRA 2VQ6A 4L2IA 1A2KC 1FP7A 1XCJA 1ZCAA 2RAUA 1ULTA 2ZRFA 3A4VA 3C45A 4JQYA 3VO2A 1UMBA 4OI2A 3W9SA 3W6ZA 4EG6A 1H8HD 2EKLA 4IDEA 5LUAA 4LJ8A 1CIJA 2FY8A 2Q6LA 4R9RA 5GZ6A 2R5FA 1RD4A 2JS7A 4OSPA 4OHMA 2PZBA 4UNNA 1T3LA 4OHBA 4D82A 3ICEA 2ZWIA 3GAMA 1KNXA 3N8IA 4N3AA 2HR1A 2CXTA 2ZUUA 3R1IA 1HG1A 4Y9SA 4KL8S 3CS3A 5FUVA 5IEBA 2O8EA 2G4LA 1QIKA 5JZMA 3UJNA 2ODWA 4YAEA 4FMCB 3MMNA 1TLLA 2CLIB 1ND5A 5A9SA 4HJRA 1UBLS 2EP7A 1QG2A 3ILXA 3TLBA 4C3OB 2NW6A 2ICPA 1CUXA 2PCJA 5CB4F 2VUHB 4G1VA 1QIDA 4PLFA 5ISMA 1V0JA 3JR3A 3ZD8A 2VWHA 3TTUA 3CUSA 3ABQB 1HFJA 2J0UA 2PL1A 4WJKB 5H3HA 4D9CA 2GM3A 2VJOA 3HJBA 2B21A 3BGWA 2CC2A 2L1PA 4DS3A 3SSAA 2WFLA 2XUAA 2G6BA 4IIBA 2XDYA 3NZEA 2CYBA 4WUVA 4AF7A 5M34A 3WV4A 4UOZA 5B57C 1AV6A 1G8YA 3QBEA 2BFEA 4UJ5A 3ML1A 3OKPA 4JKIA 3VR3D 3ZG6A 3CX8A 4E7OA 1R6DA 2Q41A 2WG1A 2WJ6A 4FHGA 2R1VB 5DOVA 3UMVA 4Y98A 4IIXA 3MLFA 2VPIA 4H7EA 2JI7A 4OHFA 3WAGA 2BSQA 2CVPA 2H16A 2Z0MA 3AJEA 2C5FA 1T3ZA 5BV0A 5HNKA 2VNHA 1H2HA 4XSGA 4EPYA 4FS8A 9GPBA 2CHGA 1YHYA 4H15A 3OE1A 4JH0A 2Y1KA 2C04A 2Q2OA 3TXYA 5BSGA 2YHSA 3WDKA 2PZ8A 1KBOA 3FDZB 2BMFA 1L7QA 1YONA 4FBGA 4BN5A 1ZO8A 4A23A 2FN4A 4QX6A 1OXKB 4HZIA 3F2IA 3P5BA 4D43A 5JQGB 3ROQA 3R4CA 3OBBA 2OFPA 3H13A 4FFRA 4PR3A 3ZWPA 5KVCA 1XI2A 3SC6A 1NVEA 2BEWB 4YRMA 2ZRJA 4QRHA 4X91A 2CNBA 2Z6VA 2AWNA 1IVSA 4RPIA 3ZZNA 4EZEA 3R09A 1OIVA 1ZI8A 1PEDA 2NUBA 1NQTA 1QVWA 2VYFA 3R6WA 4NOJA 2Q45A 4RPHA 3U44A 4G0UA 5EIBC 2BEKA 1EP3B 5BNFA 5IUJC 1XZFA 5FBQB 3TGPA 2GUWA 1YASA 3FPKA 2DQ4A 4TYMA 2QOEA 2C57A 3FPSA 3I8OA 5JDIC 4AY5A 2QX6A 3A26A 3BFJA 2P4HX 2R2GA 4KPGA 5FI3A 1CQTA 2W8BB 3ROKA 1X7XA 1ZITA 1LDGA 3B2QA 4TT8A 4BTVA 1T29A 4B3JA 3EDQA 4M76B 1HYBA 2C00A 3D54D 3QJGA 3G88A 1N2CA 3AHGA 4GXQA 2NUAB 4AJ9A 4G24A 2E21A 2DFVA 1DQYA 1N57A 1Z6QA 4FN3A 5HBGA 4EUKA 2CXOA 1KC3A 4RCYA 1A8IA 1NVKA 2X0EA 1O9HA 3UWMA 5K3CA 3FNFA 1C5KA 5DMXA 2QLFA 3HU1A 1ZBDA 1FFDA 1OYYA 1QJ4A 2ORIA 3TEFA 4KR6A 2Z1DA 4JLNA 2R4TA 1E79A 2I03A 4BLTA 2GN1A 1V5FA 3DT6A 2VDKB 3OZDA 4K9KA 1KVQA 2HMUA 3EBLA 1SU8A 3M6IA 4P4SA 4B5LA 3TYXA 1OFHA 3RASA 2Y1EA 1U04A 4LI0A 4AW9A 2IKQA 3L8FA 2QXTA 1CYDA 5PNTA 1ZM7A 1MV8A 1SBYA 4K6MA 4ZYUA 4TZKA 1RIOA 2BN4A 1HC7A 3CZ9A 1YQQA 2BZSA 3TDMA 3NBFA 2HJ9A 4J7CA 4EMBA 5KJ1A 1EG2A 1UBKS 3CWQA 4A0RA 1D5WA 1D6SA 1O95C 2LVBA 2B5OA 3KTAB 1R0XA 1ONSA 3GRAA 3UHOA 5AVRA 5CDHA 1RYNA 2QBYB 1PQPA 4RFSB 1ZUNB 5JO9A 5BORA 1NUPA 1P7WA 1ZDMA 3FDJA 4QRIA 1RXWA 1TQHA 3L1JA 4EHKA 1W76A 1R5JA 1NLMA 2ONKA 4MQFA 3VM6A 3F5FA 3N2LA 1CE8A 5H59A 2YN4A 2G1KA 4M22A 1TM5E 3NQ41 4RPJA 3LP8A 2CJYA 3TBFA 5EIBD 2JJ1A 5ALWA 2X0RA 3N59A 2A58A 3HP1A 3PQCA 4PVCA 1V45E 2EJVA 4EITA 5CA1F 2Y2VA 2H9IA 4UJ3A 2ZYIA 3RKRA 5H1YA 3UAOA 4PG6A 4AG3A 2EBWA 1HTWA 2BBWA 1QO0D 3O91A 4MINA 2WD8A 4X8MA 5DN9A 2GK3A 1AGRA 1WD5A 1YUNA 4KACA 1FIUA 1WMDA 4YRQA 4AG6A 4LF5B 4U2FA 4BP3A 3ZVRA 2QAGB 5KSYA 3MJFA 1LQCA 3L01A 1RWNA 2IP2A 3E5HA 4C7KA 4QWMA 1LH0A 4B3GA 4LUCA 1I94B 3M49A 1BFUA 4O6VA 1DWUA 1TTTA 5I9BA 3B51X 4KQKA 4JLDA 2SCUB 2FE4A 3BVPA 3AR2A 2JGLA 1PUXA 2WWWA 2YS7A 2ZBVA 3DUFA 3R40A 1A04A 2Q3CA 3IHLA 3V5NA 2BPOA 1AF4A 1I10A 4JN6B 4B47A 2VZ8A 3ZLBA 3WGMA 3R20A 3LX6A 5BVGB 3P8ZA 1ZUD1 3R0JA 2NTVA 3V00A 3H3JA 2G6TA 3KZVA 4MV7A 2UKDA 1YZVA 2NZ2A 4A6XA 2QAIA 4WE3A 1UFVA 3DL2A 3UHFA 3BMNA 5A3SA 3H9UA 4OQXA 4GSLA 4NBUA 3DXYA 3TX6A 1U8CB 1XQVA 1Z5NA 3AEYA 2A9RA 5ALKA 4L15A 4EAQA 1YZYA 4G65A 5K0ZA 3EEYA 2FZLA 2ZCJA 1K92A 4KCGA 1USIA 3QSGA 4RL6A 4L02A 5IHXA 4HQRA 1O6ZA 4MIKA 3TFOA 1JDPA 3OZBA 5KREA 3QWIA 4JEUA 4HNAA 3ZPXA 3V42A 4CDRA 1FNMA 1W47A 2V3WA 2P0EA 2A35A 3CZMA 4GC9A 4D0RA 3PU6A 4QEKA 1MX1A 4ES6A 1CJKC 4XKJA 2PWAA 4TKUB 4ND1A 4F45A 1OH7A 5EWJB 4JFRA 4IAOA 2N46A 4AM8A 4E70A 5L4LA 1BD4A 3CZCA 2PA3A 2BR5A 4LOLA 3TQQA 3DZFA 3KE9A 5JANA 4RIEA 1MU0A 3R1FA 1TO6A 3N0RA 5K51A 3FHTA 3MOIA 3TE6A 4HN4B 1TZCA 4PCUA 1A9SA 3DEZA 4P4GA 3CR8A 3CM0A 3D4NA 4XVUA 5CFQA 3T99A 1XEWY 3BHIA 4BKUA 1KI1A 2GN2A 3EODA 3FJ1A 3GU3A 3HLYA 3HB5X 1ULAA 5GADl 4LWPA 2HLDA 2HXYA 2W00A 3MBKA 4EI9A 3K9QO 1I1QB 3CXUA 3T3HA 2GDZA 4WZ6A 3I72A 2PKQO 2YMLA 2P69A 2VSNA 2IXAA 3ZDRA 1UPFA 3KR0A 3VZSA 2QORA 4NCKA 2J9ZB 3JYQA 3A1UA 3MBOA 2WF5A 5EESA 1OIWA 3KLMX 5BSWA 2XPCA 5JWOA 3LX5A 3R3UA 3QUBA 4KEAA 1RI4A 2GD0A 2IXGA 3CUUA 4K6CA 3GCWA 4PLVA 3DWGA 5E6UA 4J0DA 2H8GA 2C7BA 4ZKEA 5TX7A 3ZWYA 4D7AA 4O4IF 5DEOA 5AIBA 2K2QB 1U5AA 3MTBA 3IEVA 1OXUA 1PQUA 2RB4A 1EBBA 4L4YA 4DLXA 1MF7A 1VLVA 4EUNA 4F86A 4YIHA 2I1WA 5IN4A 3BXEA 4XUCA 2G7ZA 2HLHA 1UBOS 3DOFA 3MLBA 5IH3A 2FUCA 1ZL2A 5F7XA 3MFQA 1LPMA 2DUNA 1BC5A 3D02A 3EF1A 3L1IA 4JQCA 4R01A 5TPZA 5TQJA 5ELXA 2IGBA 3B3GA 1Z6YA 5F5NA 1ZRHA 1QFMA 4JSYA 4X6UA 5IP5A 3TM4A 1WRBA 2B5VA 4K9MA 3KQSA 2F67A 1TTQB 4DJFC 5DTMA 3NH6A 1SEVA 1M76A 2FWJA 2XUPA 3C3XA 3SBEA 4JJ6A 3WLSA 1T4CB 4DDTA 4M0PA 4DW8A 1E3QA 4J4TA 1E92A 5JFGA 1ML4A 4D26A 1GZ6A 1D9XA 1E3DA 3G5UA 4LECA 3JYHA 1IDN1 4ZQBA 2B25A 2GESA 3VVLA 4OB4A 4JEHA 5HQ3B 1ISJA 1VLJA 1IM2A 3IV9A 3TCKA 3L0BA 2D5BA 1B0ZA 1KQ3A 4BKPA 4ZRDA 3SQLA 4BUCA 4EPXA 2DB3A 4LQDA 1T5BA 3ORRA 2FJ0A 4QVGA 2DKNA 2IDJA 1UL1X 1Z8FA 2OXCA 3AZOA 3L5KA 2KI5A 4YO7A 1CUDA 1NG9A 1TM1E 4FDAA 4CEJB 1FVOA 3WWCA 3OF3A 4LF7B 3KSZO 1V8DA 4O3FA 1L5VA 1W9HA 1MX3A 4AUEA 5ICMA 4OQFA 1HNZB 4I4CA 1EXMA 1RYZA 1GSAA 2AR9A 2ASEA 4XJSA 1QAMA 5K1ZA 2JLZA 2EBUA 1TVEA 2M6KA 4RXTA 3RYCA 1RJWA 3DLHA 5EMJA 1Y1LA 2X4DA 1E9FA 1X8XA 1EWVA 1QE0A 1S2IA 4HJXA 1NYLA 1TCUA 1O1YA 4JBWA 5CX4A 1PHPA 2HMTA 2LCVA 4XQGA 1W4ZA 1MP0A 4WEQA 2FPOA 4MV5A 2C9MA 4UUMA 3L0ZA 4OI1A 4IFIA 4QAJA 4INJA 2QMYA 1XU9A 4RDCA 1QGYA 1C1YA 2NUAA 2OLEA 3G5TA 1W0JD 3R3VA 1KR5A 2QD5A 3AL2A 3ZWNA 5KKNB 2Q4EA 1NBAA 2QLMA 5FBVB 1XMOB 2ZJ6A 3ITKA 5C5DA 2X4LA 2VHXA 5TC4A 1PJBA 2DH5A 1KI3A 5JLAA 4F5YA 3NKLA 2ARKA 1GG2A 2WDPA 5IXSA 2I91A 2O2CA 4L9SA 4HYQA 1EB8A 5KKAA 1KPGA 5JJBA 3NPMA 3NTOA 5KBYA 1LEHA 4AKTA 3U4GA 3GCDA 4B79A 2XDQA 4DV7B 1UKEA 3OUUA 3AEKB 4YONB 3TLGA 1T4BA 2HFJA 3PUKA 1QRDA 3QUSA 4NOMA 1JHQA 1Q1QA 1RYEA 2FSVC 3KOUA 1FJGB 1JJIA 3BPSA 4UU1A 1L3CA 1B3BA 1KOJA 1ND6A 3DF9A 4OBBA 5AHOA 4BAGA 4BNDA 3AVWA 3FMYA 1ORRA 2XMSA 3EUEA 2FMIA 4X7MA 2YASA 1ACMA 1W9MA 4DJJA 2I29A 4O59O 5EQFA 2BMAA 3VO1A 1BIFA 1UZLA 3ELBA 5I4IA 1D2MA 1L5MA 1UFOA 4TMFA 2MOKA 3VR5A 5T8KA 2I2FA 1IBCA 2P41A 4H7HA 1FUUA 1HLDA 2VNSA 4FEEA