1ZAYA

Purine repressor-hypoxanthine-modified-purf-operator complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*TP*(1AP)P*TP*TP*TP*TP*CP*
publication title The Roles of Exocyclic Groups in the Central Base-Pair Step in Modulating the Affinity of PurR for its Operator
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zayA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zayA02
2XCJA 2PUEA 4QICA 3DNVB 4H60A 1R69A 3JXDL 3ZKCA 3S8QA 1JFTA 1NTRA 3Q7TA 4HNSA 1XWRA 1ZS4A 1M2EA 3ILYA 2WY2D 4EYKA 4ETNA 2BJCA 5TQJA 5BR1A 1DP4A 3RVMA 1E2BA 5EWJA 3R0JA 5JNWA 2NT4A 2YHAA 3QELB 2L49A 4MYRA 4WXEA 4EGSA 1B00A 3CS3A 2M1ZA 5EWMA 2PL1A 3P9YA 3U3WA 1JDNA 3H5TA 3A0UA 4RXUA 1BVHA 4TN5A 5TQ0A 3BD1A 3E3MA 5KQPA 3LUJA 3W9SA 2JCGA 2KYRA 3QX9A 3N75A 4RK7A 2QU7A 1KGSA 3K4HA 3VNBA 3DBIA 3EQZA 4MQEB 3H5WA 4N47A 3QEMB 3I5AA 1EAYA 1KRWA 1XHFA 3DLHA 3UK0A 3QLUA 2FQXA 2IUOA 3SAJA 4I6TA 3GN5A 3EGCA 4FE7A 4W5RA 4Z4EA 4MS3B 4PU7A 1DZ3A 2ID9A 3G7DA 2NZUG 2XIUA 3NHZA 4P1ZA 1EWVA 1LJLA 2B5AA 2QR3A 4M88A 3UKJA 5B3JC 2MEZA 1YK1A 2LYKA 1P2FA 3GWGA 1YS7A 3QEKA 4O1IA 1S7EA 1VKRA 5B3JA 2AXZA 4YG7B 3UFDA 3H1GA 1JFVA 1GUBA 5CNJA 5EWMB 1EFAA 3GBVA 1F51E 3LTEA 3CG0A 4TMYA 3GT7A 3MA0A 3QX8A 4RKQA 3RH0A 5TPWA 3JXBC 3OQNA 1E6LA 3ILHA 3JVIA 1AU7A 3SCHA 3TB6A 2LYSA 1DC7A 3ROFA 2J48A 2IPLA 1RPEL 2RGYA 4JOQA 4YS6A 3TD9A 3URMA 2PJUA 1WH6A 1ZAYA 3FFXA 3KS9A 2MSLA 3GRCA 3OO0A 4EYQA 1FFWA 4NV3A 5DLEA 2QXYA 1JFSA 2X7XA 1QPZA 5E3JA 1ZHHA 3IP6A 3OMXA 3QWGA 2GKGA 2QVGA 2WJAA 2GI4A 3KSMA 5BRAA 4PU8A 3QF3A 1TJYA 4RY8A 2OENG 1ZDMA 1T34A 8ABPA 5JNUA 3JY6A 2FMKA 4YV7A 1EWKA 2MYUA 2PUGA 3N6VA 3O1JC 4UHJA 3TO5A 4W5QA 2PMCA 4G86A 4LZLA 4MCTA 3A10A 3FDFA 3NNDA 5PNTA 1GT0C 3LOPA 1YK0A 2MSWA 4KNYA 4MS4A 3F73A 3ZHIA 4MR8B 3SM9A 1JDPA 2JVKA 4JP1A 1CQTA 4JQDA 4WT7A 1Y1LA 2GRMA 1U2PA 1D5WA 3HZHA 4Z58A 3SCGA 1MIHA 1RNLA 4IF4A 3HEBA 1ZVVA 2FXIA 5KC8A 2CSFA 1DG9A 3NBMA 2CROA 4RU1A 3Q7RA 2M98A 3RVOA 1BDJA 2ZAYA 2WIUB 4UHKA 2FJRA 3HO1A 5IULC 1ZPQA 1PHRA 1W25A 4KMRA 4S04A 1B0NA 3GYBA 2FTKE 1JLKA 1DWKA 2PUFA 4LDAA 4EVQA 1AB5A 1A04A 2AYXA 3QK7A 4GQMA 1DRKA 3KYJB 1ZZ6A 4IRXA 5BRJA 3CZCA 3D02A 1DJMA 3EQ2A 2E4ZA 3OP9A 3Q9SA 3EULA 3BILA 4KK3A 3EUSA 1C0EA 1NY5A 2FKAA 3FFTA 1M2FA 3Q41A 4QYMA 1ZN2A 3T38A 3G1WA 4EYGA 5JS1A 3T8YA 4WZZA 4P98A 4PEVA 2FEPA 2PUDA 2R47A 1ABEA 3BRSA 4YRZA 4LE0A 1VPWA 1JBEA 1W9HA 4GHJA 2CWDA 5KQMA 2FMFA 5FWXB 3HXMA 2GZUA 3HDVA 3LKBA 2NT3A 4XFKA 2E4VA 4KV7A 3C6QA 6ABPA 5CNIA 1IIBA 4RDCA 2OFYA 4FE4A 3QLTA 2GX6A 1U0SY 5JNVA 3DZDA 5GOTA 2WWVD 4I6RA 2ICPA 1FQWA 4RV5A 5IEBA 4EVRA 1QQAA 3I09A 2LCVA 1BAPA 3C3KA 1RZRA 1Z12A 2N9UA 3CFYA 4Z9BA 1PRVA 1TM2A 1USGA 3HM9A 2MYTA 3GL9A 5KI6A 3O2QB 1QP7A 4Q6BA 2PUCA 4D6XA 1POUA 2OR1L 2IPAB 2MYNA 3Q15C 1YIOA 1O4XA 1KRXA 5C5CA 1APBA 3H75A 2IU7A 3CLCA 2EBYA 2L8NA 3F52A 2YHBA 4G0ZA 1NXXA 3IP5A 4F12A 3OLYA 4PYRA 2FLWA 4XAQA 1BA2A 5EWLA 5HKOA 2R25B 2EWTA 1RZSA 1USIA 4IMJB 4KZKA 3TRBA 1R63A 3FYAA 4JASB 2FN8A 4Z4IA 4CBVA 2HSGA 2DRIA 3HZIB 2QW1A 5CHYA 1PRAA 1GCAA 3SNKA 1KMIY 1MB0A 3CU5A 4W5NA 2P4UA 1LCDA 4JB0A 4WUTA 1P6QA 3IDOA 5TQ2A 1WETA 1RIOA 4OLAA 1DCMA 4YARA 2VK2A 3D1NI 2IPNA 3IP9A 1DW9A 3B7HA 3JPYA 3QLUC 5DKFA 2BNMA 3MIZA 4GPAA 4TLMB 2L2QA 1E6KA 3OLWA 4MPTA 3JTEA 5JNTA 4KREA 2H0AA 4RK1A 2JBAA 1LBHA 1OXBB 1R8JA 4PE5B 1FFSA 5C5EA 4DN6A 1QO0A 4YP9A 3DLBA 3GBFA 4QPJC 4I6UA 3FFWA 2AUWA 2O49A 1Y7YA 3JXCL 5EWJB 3B2NA 3ROTA 4RZSA 4IILA 4RKRA 2R1JL 2IOYA 4YWHA 1Z17A 4PU3C 4F8JA 3N0WA 1S8NA 5TQ0B 2ICTA 4ML3A 2FQWA 1X57A 2LPMA 4Z5DA 3HSYA 4JAVC 2WJWA 4N41A 3LUCA 5JNSA 2WRZA 1YMUA 5FWYA 1LBIA 2P9HA 3I42A 3H5VA 4MRMA 4J1WA 1PEYA 1YMVA 1SXGA 3CLKA 5F64A 5T7BA 2FEWB 1ZH4A 1I3CA 1SXIA 1NATA 4Q7EA 4Z9AA 1DBPA 4MAAA 2LIVA 4X4EA 1E3OC 3GN5B 2IVGA 4X4FA 2JBAB 3K9CA 4QYWA 2WUSR 4DADA 2V0NA 4X4CA 3LUKA 4G0PA 4Z0NA 2KZ8A 2E4WA 1JF8A 3VNAA 2A9PA 4G97A 3ZHMA 2E4UA 2MSKA 3HDGA 3OLVA 2A9QA 4PU4C 1Z15A 2HPHA 3C3MA 1ZUGA 4HNQA 3O2JA 3KLOA 4OLBA 2FMHA 4KPYA 3LMKA 4N0PA 2LYLA 2QVCA 5TPWB 3SQNA 4MLCA 1U2QA 3FGZA 1ZZCA 3RQIA 3CECA 5JS2A 3KLNA 4LDZA 1M5UA 1LJUA 4ETMA 4RY9A 4O1HA 2IVBA 2FEKA 4MRMB 3RVLA 1OCTC 4W5OA 3OMTA 1ISSA 3TX6A 3H6HA 3KTOA 3LUGA 5HSGA 1CEYA 1P8AA 3CZ5A 2HQRA 5CNMA 5KQGA 4MR7A 3OQOA 3I45A 1JHZA 2E4YA 1ADRA 3OMWA 4KVFA 4H3KB 1DRJA 3S99A 2AWIA 2L18A 3RVKA 3D8UA 3HV2A 3MYYA 4FN3A 1JYFA 3JS5A 4F8DA 4JCYA 1DCKA 1QP0A 1NXOA 7ABPA 4KRFA 3NNNA 2JVIA 1YS6A 1NXPA 1ZITA 4X4IA 3E61A 2FSPA 5IC5A 5ABPA 3FYMA 1JH9A 3LISA 2W42A 4NDWA 3HUUA 3C3WA 1OSLA 1OXKB 1ZY2A 4MS4B 2RDMA 3KYIB 4MGEA 1TLFA 2LUOA 4Z99A 1QP4A 3OLXA 4EY3A 1ZZ9A 4X4GA 5JNRA 3QYXA 5FBKA 5HM6A 1M5TA 1PEAA 2JRLA 4MR9A 1D1QA 2ZWMA 4YGXB 5KQLA 2FN9A 2JVJA 3IP7A 3L6UA 1L5ZA 2PL9A 3OM1A 1X2LA 4MS1A 2PE5A 5IUJC 2B4AA 2CHFA 3KZ3A 1NXVA 2R4QA 1A2OA 3LFTA 4N03A 1DBQA 4ZPJA 1SD5A 1K66A 1PRUA 4X4DA 4H3HB 4KQ9A 5ED4A 1JYEA 4IGAA 1PERL 3A3KA 2PUAA 3T95A 1Z25A 4FB4A 1JL3A 1USKA 1D2AA 2AYZA 3EODA 1UXCA 3LUDA 5GQSA 3LUAA 5CNKA 5DGCA 4N76A 3CTPA 3LFPA 2VUIB 3FMYA 3IPCA 3H6GA 1RZRD 1L5YA 2KPJA 1DC8A 1E6MA 4RSMA 2OQRA 1DBWA 1YTUA 3FMVA 4MR9B 4RK5A 2O4AA 1MAVA 4YG1A 2GBPA 2VUHB 4LE2A 4LE1A 3QELA 1SRRA 3OO1A 4Q6WA 2KEJA 3M6MD 4RK6A 3RVQA 1ZESA 4S05A 2WB4A 2XJ3A 1Y9QA 3PXPA 3L1PA 3CNBA 4W5TA 2IV1A 3H5IA 1QQBA 1QMPA 3HUTA 4WWHA 5BQ3A 4RS3A 2XDYA 4X4HA 1ZGGA 4ETIA 3OM0A 4L4UA 2B1JA 4OATA 2IYNA 3H1EA 5DTEA 4MQEA 1GUDA 2QSJA 3L49A 3N53A 4YCSA 3QEMA 1BDIA 3MF4A 4Z4CA 4F06A 4Z5CA 4TLLB 4YO7A 1XHEA 3BREA 3F6CA 3BDNA 3BS3A 2WMYA 1FSPA 3MQ4A 4ZMSA 3SY8A 2F8TA 2FVYA 2AXUA 2O38A 3DGFC 4MS3A 3KCNA 2PPXA 4EYOA 4Z5HA 1NXSA 4RK0A 4NCBA 1SQ8A 1U04A 1J56A 4IA8A 3CHYA 4NICA 1NXWA 2L17A 3HS3A 3KKEA 4X4BA 1NXTA 1BDHA 3H5LA 1NEQA 3MM4A 1JWLA 2FLKA 5IX8A 1PUXA 3O74A 5EWLB 1K68A 3M9XA 4RXMA 3RVNA 4PICA 4E7PA 3H1FA 5T3YA 1AB6A 2IKSA 1YVUA 1PNTA 1MVOA 3MMNA 3O75A 1QO0D 3GA5A 4Y42A 3EDCA 4OBBA 3T6KA 4HYEA 2HJ9A 1P6UA 1Z26A 5HQJA 2KEKA 1CHNA 2ID7A 2VYCA 3LKVA 3F7NA 2R48A 5TQ2B 2HINA 4Y9TA 1DCFA 2RJOA 4ZJPA 4OB4A 3RVRA 4EUKA 3OQMA 3BRQA 4OG2A 3A0RB 2LBPA 3M9WA 4NCAA 3DGEC 3H5OA 3IVPA 4L85A 2H8RA 3GBPA 3Q7SA 5KWSA 1ZZ7A 4Z4HA 2D5VA 3N8IA 1XWWA 3O9XA 2PAFA 2LYJA 4G0MA 5TPZA 4YR7A 2LYPA 1LLIA 2GRLA 4G0YA 2FQYA 3HVRA 2TMYA 3F51A 3RVJA 4I8TA 3QLVC 2PUBA 4PZ0A 4FBIA 3R1FA 4NQRA 4JB2A 5TPZD 4G0XA 3HK2A 1PNRA 1TMYA 1QNLA 2NZVG 3QLVA 3JPWA 4MR8A 1L1MA 2LYRA 2BNOA 1TVMA 4B09A 4JA2A 1D1PA 3F6PA 5FWYB 2A9RA 1WH8A 4HNRA 1D4ZA 3OLZA 5A7LA 3C97A 4RWEA 4WXMA 4E7OA 1F4VA 2FW0A 4GNRA 2F8SA 2PLNA 4F3TA 2JK1A 1CYEA 3RVPA 2AXVA 4EVSA 4Z4FA 1RXIA 2KEIA 4JCXA 3UUGA 3KJXA 4MLDA 4J1XA 3O2SB 2GWRA 1LMB3 4KQCA 2EF8A 3EJWA 3KHTA 1LCCA 3VK0A 1EWTA 1GLGA 5KC9A 9ABPA 4DQDA 6CHYA 3EAFA 1LQCA 3CROL 1HEYA 1ZGZA 2AW6A 3G85A 4YBAA 2XSDC 4XARA 4YLEA 4KK4A 1ABFA 3N0RA 3TMYA 3CRNA 5DCLA 3GV0A 4MCXA 3JVDA 3LUFA 3G5GA 1VRVA 2H3HA 1YSEA 2IDMA 3CKMA 2QZJA 1ZZ8A 1LK0A 3BBLA 3NNSA 5D2CA 5I4CA 2LYQA 3LUHA 3O1HB 2IVQA 4XXHA 1IC8A 2E4XA 4LX8A 3IPAA 2Q5CA 1MB3A 5FBHA 4IWRA 5FWXA 2CHEA 2MQKA 1URPA 4KFCA 3RZZA 4Z59A 1ISRA 4IMIB 1QKKA 1Z2DA 4MR7B 3NHMA 2O20A 2L19A 4YG4A 2CD7A 3QQ6A 4LRQA 3O21A 4IVZA 2FMIA 1ZZBA 2RJNA 1RPJA 4OTZA 1Z13A 3KG2A 4RK4A 4XASA 1Z18A 3O1IC 2IPMA 1CJGA 4RXTA 2MYPA 3CG4A 4MQFA 2BGGA 1UDRA 1U8TA 4Z4GA 5IEJA 1Z2EA 5IUKC 4ZYLA 2HQOA 1HF0A 2A6CA 4F11A 1H9CA 4N0QA 2XI8A 1JX6A 1WIZA 2PKXA 4RY0A 3HCWA 3SCFA 4O8BA 2A9OA 4XLTA 1GCGA 5K98B 3F6WA 2HQBA 2I6FA 1NERA 1RXEA 4MS1B 4D74A 2NUBA 4D6YA 5IBQA 1EHCA 3MLFA 3KXAA 3N0XA 3SG0A 3HJFA 3RVSA 1SXHA 4O5AA 4G0QA 1C4WA 4ZMRA 2JB9A 4G0OA 1VLZA 2R63A 1UTXA 1A0OA 2JVLA 2BNNA 1UXDA 1ZH2A 2LP4Y 5TE9A 5IUNC 4MQFB 2PIJA 2QV0A 1Z16A 1FFGA
chains in the Genus database with same CATH superfamily
2XCJA 2JHCA 5I4KA 2J7PD 1PTKA 2R1VA 2RMKA 5JNLA 2A5GA 3VMMA 3T4EA 1GARA 2VHWA 4CMKA 5K0SA 3LU1A 2O2HA 3G7SA 5B1IA 2WJ4A 5HOEA 3FUCA 3PHJA 3HRKA 4M1SA 4OA8A 2SCUA 2XEXA 3HCOA 2XJ9A 5HGJA 1JLRA 3DYIA 4X8MA 3SFVA 3P52A 3B82A 1DWOA 4UOZA 3G0TA 2WYIA 1AA6A 2WJYA 4QBKA 4R3UC 1QUEA 2FZ5A 3RHSA 1NVMB 1Z0SA 2J0SA 4QXQA 4Q05A 3AQIA 4BEWA 2D2EA 4MW0A 4AX4A 3KQSA 5CB4B 2NPFA 3W9SA 2HEIA 4WCFC 5AVKA 2OCLA 4A82A 1V11B 1US8B 3GRZA 1G42A 2XNDD 2HXSA 2ZDHA 3S27A 1ZUIA 1CQZA 3I76A 1BYIA 3UW3A 4DXHA 2HMSA 3IO5A 4WOBA 1FMTA 5BXYA 2GDJA 1NE7A 1C7ZA 1MW9X 4XYLA 4AMYA 3CLSC 1SBZA 1D5CA 1JDVA 2XIUA 2GKSA 3H0CA 1O89A 2GFHA 3UKJA 4B35A 2XWPA 5BPFA 4HB0A 1E6EA 4KL8S 2QRMA 2DEUA 4DLRA 3QA9A 4O29A 2AXZA 1C9NA 1JQAA 4P3NA 1G20A 1YZVA 4FSDA 1QK5A 3UJDA 1GP2A 1PZGA 2OV8A 3GLHA 3BCHA 3KB2A 1NJ8A 3NHPA 4KRXA 3DD5A 5IW8A 5HWSA 2XNHA 4JEIA 1MORA 2PT5A 2JIRA 5B53A 3TUZC 1SOAA 3FWPA 1ZM4A 1LV7A 1QHYA 1KEEB 1XXHE 2Y1OA 1NASA 1RHMA 4CFSA 1TA0A 5ICMA 1L5HB 3NFRA 4JJ8A 2RK4A 2NP7A 1RZUA 5E3JA 1M2VB 1S4MA 2B2NA 2QN9A 3BE6A 4PLYA 1S8AA 2GBCA 4ZQIA 3T5BA 4KPGA 1M0WA 1NT2A 2WJAA 1OBCA 1E4YA 1U11A 3EHEA 4RZQA 2XVZA 5JDCA 1NQXA 3OQJA 5IJAA 2Q21A 3K6SA 3QSYA 3QF3A 1CRLA 1KSJA 1U3CA 2BELA 2O2CA 5GADl 1EX9A 4R8KA 5BYJA 2FMKA 4CT0A 4HDMA 1S2NA 2R7NA 4LZLA 4HB4A 4OREX 2ABWA 1C80A 2XNSA 1QE3A 1X94A 3EISA 3WGOA 2OXEA 5LBUA 4RJLA 4ZOAA 1SIUA 4YAOA 3UFXB 3W4JA 3FPKA 1J6UA 1K7SN 3GOHA 3NTVA 5EUMA 3ZYCA 2VTBA 4MR8B 1BCSB 2WKPA 1NUSA 4FS3A 4HDQB 1NJFA 4BAUA 1W19A 3H2ZA 2FHPA 1T8TA 1U0HC 4H15A 3UJ7A 1CCWA 3EMVA 1VMIA 1UBCA 2A1TS 4BB5A 1NPDA 5G3YA 4ENWA 3P19A 3I8XA 4C4TA 4PAWA 4F6RA 2WPDA 1XZDA 1AZSC 3GH1A 3N2YA 1OCEA 1DG9A 1ST3A 1TQ8A 2W2KB 3D6FA 2FWPA 3A9UA 4QARA 3TI7A 4K9RA 5LM3A 1ULUA 2Q7XA 3K1ZA 4H27A 3GMTA 2ET6A 4FX2A 1W7AA 2PGDA 2PXVA 3HY6A 3WL5A 3AK4A 3OOYA 4LDAA 4YX9A 5G0UA 5BSGA 3KPYA 1ZU5A 2O8BB 1V9LA 3QVXA 2MOKA 4BKUA 5A6SA 3ADBA 3FBWA 4Y2SA 1EGAA 1IEWA 4MUYA 1VMEA 1YR7A 1JIIA 2E4ZA 3OUTA 3I58A 3WGZA 3ZYZA 3FFTA 3LWNA 4IBOA 2ZRCA 2DECA 5FV7A 5B58T 2FJPA 3WLFA 1ZXBA 1V5IA 3REOA 1C2TA 4XB1A 4WFQA 4EKDA 4ER6A 2ZZNA 2IS6A 2Q1TA 2O7VA 3C14C 3I9MA 2FNAA 4JCCA 4GC5A 1TTPB 4HDOB 4JKIA 4XD2A 2VAXA 1KE2A 4P5PA 2YRWA 3N8KA 4H7IA 2GM4A 4L2IA 4BUJA 1QU2A 3H3XA 3KIPA 3WO0A 1LTKA 4KPFC 4DLVA 4EB0A 4W6QA 4ZHQF 5DPMA 3FMGA 4DC0A 2P2DA 4BLPA 2GF0A 1I7DA 4HD8A 2VN8A 5J4YA 3TF5A 5EZYF 3WDMA 4DIMA 2DPXA 2EF0A 1VYHA 4W6ZA 4QTUB 2HU5A 3TFOA 2XQVA 1CUIA 4ZVUA 2EGGA 1PJBA 3I6ZA 4JR2A 4WTOA 5A3SA 3KP1A 1A4XA 9LDBA 3I3SR 4B3SB 4RPIA 2IPXA 3HG7A 1Z4MA 3T7TA 4RESA 4M1MA 1T3HA 1ZVQA 2B21A 3UJCA 1SZJG 3FKSA 1MA0A 1X3SA 1OI2A 4ZEOA 3C24A 3I04A 5D3ZA 2GASA 3KFXA 3GCDA 3R3VA 2WICA 3CF4A 3RB8A 1T6ZA 2QW8A 4PLVA 5CLFA 5BSUA 4Y6LA 5CXUA 4P4SB 3V4FA 1YS1X 3QFCA 4MWGA 3U0VA 2PEYA 5A9SA 2FN8A 1THZA 4P3KA 1BEZA 4BS9A 4ID3A 4YHBA 5TC4A 4AJJA 5JSQA 2OOSA 2R85A 4PX3A 3LPAA 1MVNA 2W71A 4U6SA 3WK4A 3Q3IA 3QNMA 5A0TA 4BFYA 1HORA 2PL5A 5AKXA 3KSRA 4OLAA 13PKA 1OA0A 3PD1A 4OU4A 4TTQA 2EZTA 3LCVB 1CIPA 1H8HD 1DW9A 1FDVA 1T5OA 3MJFA 1B74A 1WD7A 2CJXA 3KJEA 3QLUC 2D3WA 4TLMB 1G9SA 4EJ0A 5BNTA 2Z8YA 5BSFA 4YPOA 4OP1A 3E15A 2PFSA 3L7AA 4KODA 1QX4A 1EMDA 3A31A 1CJBA 4ZTBA 2QYSA 2JFZA 5CURA 5DYTA 1QQ5A 3ZWXA 4QYIA 4M9UA 4LVOA 3ZDFA 1NVTA 2JS7A 1KI7A 1PZXA 3VH2A 3NAQA 4FILA 2ERXA 4DR6B 3HDTA 2MTBA 4IG9A 4R84A 5JY6A 2BH9A 3P2JA 1M72A 3L4BA 5JR3A 3LWDA 3CSDA 4O4HF 2ZJ7A 1Y8RA 1ECCA 2P69A 3GFQA 4WZAA 5B7NA 3D8HA 2PEZA 4Z5DA 3TQOA 4OMCA 2WRZA 1H4QA 2V6GA 5C5DA 4J03A 4EB3A 2XIQA 5FWYA 1XPUA 2FPLA 4NBNA 4UEOA 5FOSA 3SF8A 5LQMA 1HL3A 1BXGA 3CLKA 5F64A 2XB8A 2QD2A 2WT8A 4KDFA 1RFGE 4CMCA 3G0HA 4Q4DA 4WZBE 3MWYW 4Z0NA 4RJKA 1H3NA 5FH9A 2J3MA 2JGDB 4GBGA 1XZNA 2DULA 1SVMA 2EFCB 2M1XA 4ATNA 3L0CA 3KZKA 3CZQA 5KKAA 4MH0R 4RKYA 2I5PO 3DMRA 3BTUA 5EJ2A 2OFWA 3ZKWB 3BWDD 1XP8A 3I12A 4OAPA 2CKDA 2G9RA 4C5BA 3OJFA 1VCIA 1YXMA 2JJ2A 3DW1X 5LB2A 4MUBA 4BJ1A 1NE2A 1ORTA 4INPA 4OXIA 3RYHB 4JXXA 3CUYA 1FXSA 4FKZA 5JROA 3B8HA 4NF2A 4ETMA 3AVVA 3R3ZA 5TR9A 3MJSA 2IXGA 2HY7A 2CBGA 2YVUA 4EI7A 4PLTA 4O0MA 4EEXA 1XZQA 4DUPA 5BMOA 1NFQA 3OCCA 2GSWA 2P3QA 3L4SO 2R44A 2NM0A 1ECGA 1DRJA 2YCLA 5AW9A 4Q3NA 3HV2A 4GP9A 4ZICA 2W2MA 5BUCA 5BYBA 3KXLA 2NXJA 1O94D 4RDXA 3O3MB 4RQAA 3QFSA 1KK0A 1A2BA 1G59A 4AYTA 3L9WA 5B6IA 1NOIA 2CZGA 3E61A 3SOZA 4HH4A 3K70D 1JH9A 1YR6A 2CNDA 3GY0A 3KJGA 4RTLA 2Q2OA 1WQ1R 2ZRMA 4MS4B 3R23A 4DR3B 3VJKA 3JQDA 3TRKA 4V03A 1TCAA 1X8KA 2QL7A 1Z0JA 3ZD7A 2AF4C 1SHKA 3DTVA 2R8YA 4HZUA 3KQHA 3F6RA 1QFMA 2YNMC 2D0IA 2XZTA 1XKXA 1TZBA 3G6KA 4HATA 4LYDA 3ZVKA 3USZA 4EJSC 4D9FA 4FFBB 3LG2A 1DC4A 1A7JA 1LSUA 4YI5A 3ZNOA 5U4XA 4UEWA 3FHCB 3K70B 4IUCS 2IHTA 1SQGA 3KZ3A 1MO2A 2R4QA 5BURA 3NYQA 3QXHA 5FUBA 1PRUA 5ELXA 4I1SA 1OJ7A 1SG0A 1TT7A 1V3VA 4LFCB 5KDDA 3TQSA 2H1VA 1BTOA 3CXUA 2OBXA 4D46A 1XRPA 3ICWA 1VPLA 5L51A 3DLAA 9GPBA 2RGAA 1MT3A 1CP3A 1OXTA 2ZAOA 4G1MB 1JA9A 5YASA 1I2DA 1MG5A 3RAPR 3NHJA 4FHGA 3SQLA 3RCBA 1E9FA 3GEIA 4HXYA 4UREA 3FMVA 3WLTA 1TVCA 3M4NA 1OA1A 1ZM2A 4DR7B 1KAHA 1TUEA 2W22A 3G59A 4REQB 1R10A 4GKVA 4JYPA 4RMJA 4UPDA 1V8ZA 4UD6A 4O4JB 4D41A 2C2WA 1PV4A 1Z88A 3DDCA 3QUTA 1ZCZA 3KKZA 3OWOA 3M5WA 3QBDA 3ZBQA 3HUTA 3PVCA 4ND5A 3ENWA 4YRDA 1T4CB 4KVZA 1DJOA 3TVTA 2JI9A 2HDNB 3TNLA 1XMSA 2BGJA 3JW8A 1Z0IA 3PNLA 3N53A 5AVRA 5EHQA 2NNWB 2AH5A 3DXYA 2GO7A 5GAHi 3DWGA 2ZDQA 1NKSA 1JEYB 5TRTA 1IBSA 2QM8A 1XZIA 4Y2VA 1K0UA 4U2GA 1LUAA 1NJ5A 1U28C 2TRSB 5BT8A 2XGJA 2OO3A 1KA9H 1XZFA 2XUQA 1LDNA 2H29A 3GQBA 3OJEA 4GLBA 4I4TA 2DE0X 4O5OA 4PRZA 3NH9A 1SQ8A 2FJ0A 1M34E 1ADFA 4AZTA 1MTZA 4L7VA 4KR7A 2JAQA 3L07A 4UCQA 5KDOA 5LA6A 2PU5A 3HYLA 3EDMA 1R6XA 4CV0A 3SC6A 3HN6A 1DE0A 1VE1A 3EH1A 4LBVA 1H1DA 4E4YA 3LA6A 4FWBA 1Z83A 5BSRA 1HX7A 1GPUA 1EUDA 2WHRA 4OHMA 4OQMA 4IIYA 5HQJA 3M5DA 4BTVA 3D6MA 4JP2A 4CLOB 2W6PA 3PQ5A 2XE6A 3VZDA 4KBFA 4D43A 4YCDA 2Y99A 3RQSA 4BYMA 4D3SA 1HDZA 3M1IA 3BHJA 2MSEB 4EHDA 1XFDA 4XTRA 1YHYA 1UDCA 2VCYA 4H3VA 3I6IA 5FT9A 2V1UA 5IYZA 1U3WA 3GBPA 2YVKA 4M7OA 4WKGA 1XWWA 3O9XA 4O2AA 5DIFA 1FK8A 4N0EA 2O8FB 2BZGA 4HWRA 1Y8AA 1FRNA 3DKRA 1CUDA 4TN1A 2W6ID 2DJ5A 1Z6XA 2FQYA 5HA5A 1ZVKA 2E37A 3C45A 4PYLA 2P30A 3AESB 4MUGA 4PNPA 1EWQA 2LLWA 1F8XA 3QOXA 2PGLA 2PSFA 1GM5A 1P1BA 4CVNA 3HK2A 3ONVA 3PLAE 1SVUA 1XG5A 2OCAA 3Q4GA 4I8IA 5CGZA 2P6OA 2FH5B 3VSDA 2Q5JA 4HCJA 3U9LA 1KHHA 5JEEA 2ZM5A 1TYDE 2ADFA 2C9OA 5K05A 1IDN1 3ZV3A 4CL2A 2YWBA 4UUOA 3JD3A 3G1UA 3TL6A 3TSAA 2V6MA 2A9RA 1XP5A 2F64A 3NIFB 4KNVA 1ZNWA 5KCZA 1ST2A 2VTKA 3IFSA 3P0EA 3QPCA 4ZCQA 4TSKA 3Q6IA 2F8SA 3W5VA 3ADOA 2ZDGA 3H05A 4ARZA 2YOHA 3PA6A 1ZRMA 4PYQA 2A59A 3V8BA 2GLUA 1M6YA 2JK0A 4LVCA 2GJAA 4Z6KA 4YCBA 2H06A 3F4LA 1DIRA 5TT0A 4RLHA 1SA0B 5KVQA 5EUBA 1QDUA 1XQ9A 2Z9CA 3MRVA 3JD2A 3N5KA 2HM7A 4FFVA 4WL0A 1Z4JA 2W6JD 4QODA 6CHYA 5AW0A 4IJUA 3UMVA 4XARA 4D79A 3FH0A 2YJ3A 2Z1DA 3DOEA 4ALJA 2GBIA 4MCXA 1BS2A 4G5YA 2ZR0A 4MROA 4W8OA 3LDUA 2HRDA 1O96A 4FTWA 2NO0A 4QOGA 3TR5A 4U8GA 4R9RA 4BEVA 1WXDA 3QKUA 2LYQA 2EP8A 4OPMA 3KOXA 3VUFA 3WDSA 1B8NA 3ZY3A 3L5OA 2V0GA 3GGPA 2MQKA 4NLLA 4U7TB 1B8UA 3UWKA 4Z59A 1ZJYA 2FUNB 3P9IA 4WECA 3DT6A 4P5EA 1VJRA 5LOVA 1E1KA 1E1CA 2IW1A 3PFCA 1XJQA 1I33A 2EFDB 2OK7A 4IEEA 1P3Y1 4K6OA 2J7WA 1X86B 2PLRA 2QD5A 1G60A 2MSNA 2XAAA 3SCZA 4ARSA 3O8NA 3CRW1 3GZNA 4IJVA 3EFOA 4F9FA 3MQ2A 4GWKA 1JR4A 4JI8B 1Y6GA 2H17A 3OKFA 1L5RA 1KXZA 2X76A 2QMQA 1QFYA 1KZ7B 2R751 4MQFA 1LEHA 3FNRA 5A5EA 1J0BA 2V7TA 3T5MA 4JHXA 2JIOA 1UZNA 3U40A 4JB3A 1P33A 2OUKA 1AS3A 2GESA 3B3FA 1QBKC 2X42A 1HF0A 3COYA 5K6AC 3U4AA 2BWJA 1U8YA 1DELA 4ZAZA 3GZ4A 4QUEA 2WZQA 1B43A 3CLRD 3PHHA 1SXJB 2J07A 4O3FA 4PLGA 3SHOA 1JVNA 2ENUA 3OZWA 4XLTA 4CMGA 1MOQA 4JQCA 2HQBA 1VIAA 2GPAA 4L9SA 4RZHA 2DUUA 2XODA 3ZDBA 2GPJA 2PH1A 3Q88A 4O5AA 1ZXXA 2QAGA 3LZ6A 2J7PA 1Q6YA 1UBEA 2UZAA 3EWSA 3GA0A 1HF3A 3DEAA 2JFBA 2H1CA 2ZSJA 3MHTA 5CVVA 4PM4A 5HBGA 1W48A 5KTKA 3RI3A 1WDKA 1N77A 3VWSA 4CEHA 1QVRA 3IIJA 1E8DA 2F1OA 2PUEA 3ABIA 3N2NA 1A2QA 2N75A 2VBCA 3ETNA 4BWVA 2NMVA 2N1BA 1J5PA 1XV5A 2I2AA 2F9LA 4HNSA 4M1QA 3IAAA 3P5SA 1ZQ1A 3FLAA 4B6RA 4YCAA 2GCPA 3VYRB 4Q01A 4WNAB 5EWJA 4Q9NA 3FYUB 2YHAA 4F7DA 3GUYA 4NYMR 5LBIA 3OX2A 3WLLA 2HBQA 5JFOA 5JYCA 3OFSA 2VQDA 1P31A 4RSHA 2MIIA 4U3JB 1A5SB 1H93A 3COJA 1R0ZA 2BDEA 5TQ0A 1LNSA 1T9HA 4MUEA 2HV8A 2PUTA 3CM0A 4MGZR 4Y2UA 1KDPA 1KC1A 1JDUA 3DEHA 2VK4A 3OFNA 5ICSA 1KOGA 2W90A 1ZUNA 5C1OA 3LHKA 3QEMB 1I01A 2BP7A 2AFIE 2W2LD 4QT0A 1X1QA 3DHWC 2PJZA 3M6VA 4UARA 3T0GA 1T0JB 2ZRIA 4EW6A 4HNVA 2OSVA 4RABA 1PAUA 1D1TA 3BHMA 2H4FA 4GKBA 3H9GA 3GN5A 1Z3CA 3AEXA 2W83A 3G2QA 3CEAA 1W94A 3IPLA 3DH0A 1LJLA 4EABA 1AZTA 2B0JA 2DBRA 2P5UA 1Q44A 1YE3A 4MW4A 4AAYA 1B3BA 1CUHA 5LP6A 4C07A 1SM4A 3ME5A 1S7EA 4CCAA 5IJ0B 1XZJA 3GBVA 1UPUA 1I10A 4ES6A 4IWXA 1TGYA 1V4BA 5DN9A 1JMKC 2HKIA 1EPUA 3MA0A 3HI6A 3HH8A 5KYWA 2I3BA 1VTKA 2AFVA 2WE7A 1Q14A 3EYWA 1HQKA 3G9UA 2NXNA 4BMPB 3FYSA 4FFMA 1N0UA 4JBYA 4OK3A 5IVDA 1FFYA 3LQQA 5BNWA 1HK7A 3FNEA 1W1UA 2OGSA 3NBXX 4IJWA 4KLZA 4KQKA 1QVZA 1N2JA 2BBOA 2BLNA 4ZO4A 3V6LA 4B6GA 4DRYA 4DR4B 3L1JA 4PN7A 5DHQA 4B4KA 1NFRA 5AI9A 5A5FA 5I6DA 2I6QA 2ISSD 2VPTA 2WOOA 3G0IA 4OGLA 4AKEA 4XLLA 2JAPA 1ZN7A 1JHVA 3CUVA 2J32A 3HKBA 3EVGA 3O3CA 4J0FA 2ZS7A 3ECCA 2ANBA 3I0NA 2V8OA 5FI5A 4EARA 1LC0A 4MULA 4KMOA 2PS0A 2PMCA 4PPGA 2O8BA 4MZXA 1Q1ZA 3SJ7A 3WWCA 2ZRDA 5DBGA 1C1DA 2V7BA 3MD9A 4U7GA 5CW2A 2PGNA 1GT0C 2WJJA 2Y27A 4Q9KA 5AKKA 2G7MC 2G28A 4E94A 6REQA 5C1IA 5FIUA 5BXQC 3A25A 2J46A 3OZRA 1HSOA 1NULA 4YIKA 5FOTA 3B8EA 1J2TA 1Y1LA 4UHCA 1Z5NA 4JWKA 5EVJA 3S2ZA 4GM4A 1QIIA 2CDRA 2WNSA 3IO3A 4M1ZA 5IKOA 4C7XA 1ZK0A 3RIGA 2FGKA 3ABQB 2DBZA 4RIFA 5JXWA 3N8GA 4I4TF 4C2TA 1N57A 1RPAA 1R8SA 1YAHA 5CBPA 5IULC 3C3DA 1B0NA 3ODPA 1ZCAA 2B1RA 4AG5A 3GRVA 3TLJA 4BLTA 4WD3A 1XVLA 4BV2A 2HZ7A 2VSOA 4G36A 3UIEA 1M1XB 3IYLW 1PIWA 1Y5RA 1V39A 5EIHA 5LA6F 2ODBA 3RE1A 4IVPA 3UYKA 3IXQA 3FTNA 4MV6A 4WQMA 5K3DA 2PV0A 3OP9A 5D51S 3WKDA 5A2QA 2WAAA 4DR1B 3Q8LA 1VG1A 2IHBA 3I32A 3RF6A 4GDMA 4P98A 1DQSA 4G5XA 4PGMA 1NKTA 4M0EA 3FMOB 4EIWA 4OQPA 4AN4A 1RYBA 5D01A 3S2YA 4A8JB 3B1WA 4MCHA 1MJHA 1KYIA 3LKBA 2BHLA 5IYZF 4DPMA 4CEIA 1W93A 2ARKA 2X58A 2YMPA 2GBFA 1SWVA 2HCNA 1Z82A 3G5AA 4O2AF 4A6PA 2DHRA 3K1AA 3DZDA 1L5SA 1R4MB 2ZGVA 4OBXA 5JD3A 3AL3A 5EIOA 4RV5A 1HKUA 1AK2A 1SHZA 2EBWA 3I09A 3P20A 4RL4A 4A26A 3CFYA 1V5FA 5FDFA 3EW9A 5ER9A 3SZRA 2XQGA 3CZMA 4PIMA 1DB3A 3PNOA 5I9LA 3DDNA 1XTRA 2V59A 2XVXA 4W1RA 5IPFA 4X65B 1CZNA 3IUPA 4GLFA 4M8NE 4REOA 2QTRA 4LFBB 5C5CA 1WUKS 1LPMA 1AQLA 3P2IA 3NEYA 4GD3Q 4A91A 3L7OA 3PUYA 4WY5A 4G0ZA 1V1MB 1FYFA 2VDOB 1POWA 1YI8A 1QYXA 1W46A 5B3KA 2J3QA 5K8IA 1NHGA 3C4VA 3IS3A 2O3UA 4A6EA 4OHRA 4DSUA 3DM9B 4IZ6A 1VE9A 4IMJB 4QC2A 3QKTA 3AY3A 1T2DA 1JAZA 1SBNE 1CIJA 4JZYA 1BE0A 2Q07A 5TS3A 1H8HA 1RYNA 4I4LA 4LOAA 3U13A 3VU0A 3BWYA 4CJXA 4ND8B 2GZ3A 4HNGA 4RIEA 5LXTA 4BNDB 4NPHA 5BQ5A 4FT4A 5LLDA 1DC6A 1E0DA 2PT6A 3I5YA 2Z6UA 2IPNA 5CLHA 3HGMA 3UHFA 5BQOA 2CXOA 3KL4A 1WHSA 1Z7YA 1M83A 3OEWA 1AT1A 3AF3A 1QLWA 5E6SA 4BDTA 1K2WA 2KW5A 3V2HA 5AESA 5DH9A 2H18A 1JBKA 4WGGA 3B70A 4ZJYA 1KR2A 5JNTA 1W1WA 1RJEA 1TDJA 3E3AA 2JGKA 3H7IA 3RNOA 2G40A 2WWXA 3S2UA 4G89A 3DLBA 5BN5B 2J9ZB 3Q6MA 1E62A 2QM7A 3VPGA 3HJUA 4TV9A 1NP3A 1GNPA 3AIOA 3HSKA 1N5MA 5LOVF 2WIBA 4ISBA 2O5VA 4OJTA 1W88A 4GOMD 4HNTA 4BNLA 4LTNA 2PX5A 4J4BA 1I1NA 2O6HA 2CXRA 4ML3A 1C4XA 1NHWA 4UULA 4CKCA 5DLPA 1CZUA 4JJZA 4DPLA 2HR1A 1WNTA 5AHKA 1F2TA 1GPNA 2IVZA 1X3LA 2ZT8A 5DI9A 3RIYA 1LVHA 2P9HA 1YV9A 1HTBA 4IIVA 3SJZA 4K9LA 4DMGA 4YCNA 1YMVA 1SXGA 2IZ5A 3LBNA 1UMDB 1ZIDA 1ZH4A 3MTIA 1VPEA 4FZVA 4PYNA 5K0JA 1DBPA 2NZ8A 2PPVA 1YOBA 3NPAA 2BEWB 2X8BA 2Z5LA 1MQ8B 2SICE 2JZCA 3V1UA 1RD4A 2EU8A 3DCIA 3E48A 3CPHA 2V58A 4JGGA 1UOPA 1T8WA 5GPBA 5IN5A 3UVEA 3W5IA 3ZGVA 2BFBB 4E22A 3DA8A 5JCXA 3JQGA 5KYXB 3DE4X 4OCZA 3AHJA 4YECA 4ALNA 3VGPA 2BPOA 4B09A 1RWBA 2L82A 2R1UA 3EQ9A 4R7ZA 1YOVB 1GTL1 1U8ZA 4MLCA 4MNTA 4G8CA 4ZZ2A 1UBTS 1E2EA 1T1EA 1PX2A 2JH9A 1JFRA 3U4MA 2JFGA 1NWHA 3PR1A 3IVAA 4MGIR 1I1OA 2AMJA 2MINB 2AWOA 2RHBA 3DV0A 5EJMA 3ER9A 1CUZA 5G1PA 4AMVA 3OMTA 3LT0A 4XCVA 4LV6A 2ZSUA 3MGKA 1IZ0A 4D4KA 4IGFA 1P2TA 1Z39A 2GZDA 2HQRA 2N46A 3DMPA 4FFBA 5BQ3A 3DBLA 1JHZA 1IVNA 2E4YA 1ADRA 1ZL0A 5H8WA 2DERA 3NHSA 4ER7A 4BWGA 1NMXA 4KWTA 1OZ0A 3PD7A 5FOWA 3UJ8A 5KOYA 2IUEA 2XEDA 1Y63A 4F5WA 4LWZA 4QFBA 3TLGB 4URUR 1FB5A 1YMQA 2KLBA 4BX0A 1R12A 4LYFA 3FYMA 1DAPA 2W42A 1OSLA 1T8YA 1DEAA 4HGPA 2VUSA 2P9GA 3OZVA 2ATEA 3PC6A 1K3TA 2BF7A 4J90A 1UEJA 3P9XA 2ASEA 3WB9A 3N87A 4V0LA 2GERA 5IH7A 1PF7E 3IUNA 5I7EA 2HSDA 3K09A 4FNOA 1HM5A 3GJ6A 5DCWA 4K9QA 1CEEA 2JRLA 1F8UA 4JMLA 4RTNA 3TWOA 3EC1A 2HADA 3RS0A 3GJZA 4LWQA 1SB9A 2CT8A 5IK2A 3NDJA 1X77A 5C18A 4L1KA 5DXAA 3T0IA 4AZ3B 1BJRE 4FDTA 4I4CA 3ZHQA 5LP6F 3BKXA 1E2LA 2BHSA 2JIMA 4B76A 4NJOA 2C94A 2ORVA 1DWUA 5SZKB 2BEVB 3FIJA 1JEOA 2AHRA 3DPUA 1T9CA 4Q3CA 5DNVA 3LW7A 5DWQA 2OBMA 1U7WA 4FE3A 1CNEA 4BVEA 3LFPA 1JAIA 4AKHA 1NI4B 4CW7A 4RMGA 4CUKA 4DQLA 4TMZA 5FA5A 1A5TA 1E6MA 2FVXA 4LJ6A 1YKFA 2OQRA 3B6JA 3AU8A 4RSMA 3OE4A 1IWOA 1IYZA 4ARAA 2ZYWX 1IHXA 3AQ4A 2GZ1A 2I54A 1YNOA 1PZHA 2VUHB 3FCEA 3OTHA 3PFWO 2XUOA 2OLJA 4LE1A 3RVQA 3UTDA 5C4IA 2HMTA 1KAGA 3KXDA 1JHRA 1J24A 4URZR 4RS3A 4X4HA 4DLYA 4JT4A 2GNAA 5DX0A 4TL9A 3UCXA 3ZX5A 2IBTA 2IYNA 1Y89A 4YTEA 1RQRA 3GCXA 3L49A 5TMEA 2GCNA 3AYZB 3A2MA 4YP1A 2R2AA 2BH2A 4XOUA 4Z5CA 2PYDA 4M1WA 4BKPA 3HVUA 4DRZA 4E15A 4QRDA 1NKVA 4H77A 2WZDA 1RYDA 2H1RA 2NNLD 3BS3A 4WNCA 4II3A 4C20A 5AI0A 5I7WA 4EHBA 2F8TA 1ENPA 3GFGA 1K63A 4MS3A 2PUVA 4MLZA 3HPQA 1NXSA 3HVRA 3LSYA 2P2CA 1XCMA 3GG2A 3DEFA 3RSHA 3TNDA 3KAKA 3D43A 1SIWA 3VKVA 4WKNA 3M9XA 1HDOA 4LYYA 3ZDDA 1ZHFA 3FHLA 2D1FA 3HMQA 2IJGX 3AESA 3EFEA 2GXSA 1RHRA 5IWAB 1YKSA 4I5DA 1X7ZA 1T8PA 2G88A 3GDFA 3V7WA 5B37A 4ZMBA 3A32A 3OPYI 1P6UA 1XRMA 4QATA 4ZU3A 3KVOA 4E13A 5A0FA 3X1YA 3PC3A 1V7ZA 2RJOA 1F4PA 1RPTA 2QT9A 2WSYB 3QU2A 2JJ1D 4RD6A 1GR1A 3FSGD 1UJ4A 2EV9A 4P4UA 1RP7A 3DQPA 3IVPA 2LCFA 5AVJA 2ZCVA 5JHHB 1OKKA 3CY6A 3PDHA 2WHEA 1RZVA 4MKIA 3LQ4A 1EVQA 4OQEA 3TX2A 2Y1KA 3LT1A 3JSXA 1RXSA 1T5IA 1EJBA 1KFBB 3E9QA 1UJ6A 1UKZA 1KI9A 1WCYA 2GVZC 3BZUA 4IIDA 5F9FA 4D9CA 1FP4B 2VRWA 2PXUA 1I2CA 3GRKA 4KO3S 1V9SA 1NUAA 2I2XB 4RACA 5IFLA 2Q9AA 1SC9A 5LD2B 4D9KA 4L27A 1ZD3A 4UCWA 4QTYA 5DK6A 2VP5A 2XYHA 2DKNA 1HC7A 3B53X 2CLEB 1OFGA 3HYTA 4QJBA 3F7OA 4KQIA 2EF1A 2V3VA 5IVHA 1W5SA 5BNFA 3QJ5A 3W3AA 4KLNA 2J3IA 2OVBA 1D4ZA 3QPBA 3E7DA 4CKXA 1BQ4A 4LMBA 1P5JA 2K87A 4KGVA 3TFLA 1A9PA 1IY9A 3U80A 1S1MA 1XMJA 1K3FA 1R3DA 1UWCA 1YQWA 2W6JA 1VLHA 1XNRB 4XD7D 3RKRA 2H54A 1FRFS 2AN3A 4DUGA 4HRYA 5A5GA 2EF8A 1KYWA 3LLSA 3HB5X 3KB6A 3EEQA 3OOSA 3RRMA 3RUIA 3TOXA 5CGQB 1JG3A 4MOWA 3PL1A 3EE6A 4V0MA 1WL8A 3EN0A 3PR2B 4PTYA 2D2IA 4IKPA 1XSEA 5DCLA 5B36A 1JR3E 2H8KA 4P54A 2QL9A 5LXTF 3KQTA 2Q5LA 1OTHA 3I9KA 3H9EO 5K3SA 2NSHA 1EVZA 1HZJA 2R62A 4MRRA 2HHJA 3I3OA 4MW2A 3VFDA 3WMRA 5DRYA 2RC6A 4OLFA 5LVAA 2RC5A 1LI7A 1ZM7A 1OTXA 3UG6A 5FWXA 2P0YA 1D09A 4YASA 1V95A 1JUDA 1XNGA 2QX4A 2ZKLA 2NVOA 4JOCA 3EF0A 3Q8XB 2L19A 3PYXA 4M76B 4NCJA 3GFOA 1IXSB 4JEHA 5DHFA 5ICFA 4TV9F 3TN7A 3DWIA 4B71A 5B6JA 3O8CA 1J8QA 1C4OA 2HJSA 3PE3A 4IDFA 4ZVKA 1NI5A 1H4TA 3RR2A 2V3CC 1K4KA 4JC4A 1EVKA 1EFVB 1TEVA 2BKAA 4KB5A 5AVTA 5LMZA 1WP9A 1OPXA 5D3MB 3KJIA 5FO1A 3ZQKA 4U2CA 5EN4A 5BN4A 4M2LA 3D2LA 3KR0A 3ZBPA 2P79A 2Q0QA 5E6UB 4IJ5A 2AC7A 3ANSA 4FGKA 1VHWA 3DVLA 3MLAA 3TXXA 4C0JA 3U4QB 3FYUA 3ZU2A 1MKYA 2PAAA 4P93A 3G5UA 2ZWVA 1T3GA 5H68A 1N8KA 3F6WA 4WGFA 2ZRAA 4BO8A 2FPGA 2PRKA 4LY3A 4IJMA 1HSZA 2DU8A 4HYQA 4H7JA 1XDBA 3KSAC 3T9AA 2C8LA 3LY5A 4XVRA 3RRYA 2IHZA 1L7DA 2BBWA 3OZCA 2AMYA 1GDDA 3F5MA 2R63A 1UTXA 1MDFA 4FOOA 4HDSB 1VRWA 3ONEA 4LPSA 3NV9A 4YDHB 3K4QA 3V46A 5H7XA 4A0SA 2XYGA 4NZPA 3HRHA 1LU9A 1BKYA 1CZRA 1TO6A 4UPVA 3ZKCA 3QIAA 2ECKA 3UMFA 1YKGA 3WX0A 1YDWA 1Z6YA 3ZK8A 5JAPA 4BX8A 2DM6A 2I1WA 2H4HA 2WY2D 3U26A 3FYHA 4YYEA 4ZRNA 4BIIA 1Q1EA 1O1YA 2CDBA 3I5UA 4I1VA 4F04A 5J47A 4KN6A 4IXNA 1HPLA 3QBTA 1I14A 3EXEA 4G63A 1G5PA 5I3ZA 3N2EA 4RVOA 2C29D 2W2LA 3R7BA 3RS4A 3LOQA 1UXIA 3NVMB 4AF7A 5CCEA 1Q91A 1JZSA 1Y9DA 3A4YA 3H97A 3KBBA 3Q3CA 4HH1A 4UHDA 4MQEB 1J09A 5FNVA 1K27A 5FOVA 4DCGA 1X7XB 3S7ZA 1U99A 1D2MA 3CX3A 3H2BA 3HFRA 4AECA 4BMNA 4AZ0B 1B0UA 1IOLA 4CR7A 1G8PA 1QRDA 2WYUA 2OHOA 1BE1A 1PWHA 4XIGS 5C53B 1TNDA 3WHKA 5B3JC 4UDYX 5SY9A 4FM9A 3C5VA 4U00A 4NBSA 1H85A 1JYSA 1P1JA 3NAGA 3O5AA 4G5HA 4PINA 3T7KA 1EXDA 1VG8A 1C9YA 1H94A 4EVIA 1F38A 3PF9A 3R20A 3TTXA 3M6LA 2JAHA 1PLKA 4L3WA 4MYDA 4Q4LA 5E38A 1SOVA 4TMYA 2VHUA 3NWPA 4ZIRB 3PE5A 2QDXA 1HR0B 3MWEB 3L06A 3ZHXA 1E1MA 4HDRB 1PS8A 2ETXA 2ZWIA 1ISHA 4HUQB 3S6JA 3O4IA 2PJUA 2PXHA 4WXYB 4E5MA 1JFFA 5JISA 4ZVNA 2QZ4A 5KVVA 1GZ7A 1TTHA 1JB9A 5CD9A 2OHGA 4S24A 5AK4A 5I48A 5KINB 4LK3A 3CX7A 3M7IA 2PY6A 3KE8A 1ZMRA 3UW1A 1M75A 1YJBA 5EIWA 4ZVVA 3ZTWA 2WUFA 4PU8A 2LNMA 4P5DA 5F77A 5FPHA 4U39A 3ZVLA 2HWWA 4E1VA 4EKIA 1T24A 1ZDMA 4MW7A 1KC3A 3RRJA 4WCVA 4ITRC 4DNXA 5MGNA 1E7MA 3FOWA 4PAQA 3O82A 4DB4A 2Q3EA 4L78A 1N7HA 2GXAA 1W76A 2CVOA 1VYUA 3DDUA 4JJKA 1T5BA 2FZVA 4UNNA 1O4VA 2HA5A 2UYYA 1V6AA 3LV8A 3WL7A 1NUTA 2D5BA 4X0EA 3DXFA 2CKMA 4G1BA 4KNYA 5KOIA 3HNPA 3LLUA 3VHXA 1J9GA 3T99A 1OFUX 2RB5A 4JQDA 2BFEA 1U2PA 2HLPA 4Z58A 4JD5A 4MWCA 4NC9A 1RNLA 3QXJA 3T06B 1MO5A 1V2HE 3FOZA 5H3HA 4GEKA 1ZVVA 1LK5A 3AOGA 3QUQA 5E7QA 2XMBA 3BD8A 4BAZA 5L40A 3BDVA 3NBMA 2Q9BA 3Q7RA 4II7A 3GNLA 3LQFA 1M6VB 4TVSA 2QYTA 3ANYB 3VKFA 5K8VA 4FLMA 5C31A 4S04A 1I0ZA 1GN8A 3K8OE 3GLKA 3GYBA 3QBVA 3SKYA 5C2JB 3D7MA 4YQZA 4C0BA 4DSZA 3I6BA 2IYPA 4DMHA 4YCCA 4BPBA 1OU0A 5BVGB 2C7RA 4DRXA 5F51A 1ZUHA 1C1XA 4G5RA 2I67A 1H8ED 1XEXA 2QQFA 4MYSA 1DJMA 1B8OA 3AM1A 4DV5B 2GBLA 1VHJA 2BM0A 4DARA 2F9FA 3Q41A 4DMFA 4YT8A 2WUVA 3CX6A 4ZCTA 2DYKA 2VJOA 2ADMA 5FTMA 1ZO8A 1EK2A 1N8SA 1RAFA 1FW6A 4YRLA 4X92A 4XVUA 3OZUA 4JP8A 4YRZA 4I1YA 5ALXA 3ABOB 4TM7A 1HZZA 1V1MA 2CWDA 2QR5A 2BI8A 3ASZA 3TKLA 4HVLA 3DKKA 5L4LA 1XN1A 1J0EA 1Q57A 1SCBA 3AEQA 1TF7A 1ECFA 2PD4A 1KRHA 2P90A 4U6NA 1Y8QA 3NALA 4W1PA 4JVLA 4D57A 3A8TA 1IUOA 1Z6GA 3FNQA 4M0PA 4ARUA 2X14A 3BFVA 3LK7A 3RBVA 2V4UA 3FRIA 5IEBA 3NBAA 4J0EA 4EENA 1XWIA 3HP4A 3LCCA 4RTOA 3GNTA 2IU0A 1OYWA 3JTMA 1WLYA 3K0AB 3ESQA 2Z9BA 1CE8A 3C7CB 5TB5A 4WEOA 1O5OA 1GAQA 1M2WA 3Q3GE 4BJ5A 4TL7A 5MF6A 1J8MF 4G0NA 2W4IA 1HA3A 2RH9B 2WHYA 3KOWA 3L0OA 4NCXA 5LLSA 1APBA 3PDCA 2DPLA 2Z2YA 3ESRA 3AL2A 4JQOA 3UV6A 1VKOA 3MTQA 5JZBA 2ZJYA 1MB2A 2PX2A 4JT8A 4NI5A 1QWSA 1E9RA 1NA5A 2XT9A 5AKYA 3TRJA 1CUSA 1N1DA 3DMTA 4W63A 3H8VA 2NYVA 1YVDA 2ACKA 5JALA 4D26A 2XOKD 1Z3IX 3CRVA 3IOBA 3NRBA 4S1VA 1VSVA 1FQJA 1MB0A 3OJCA 2KB0A 3UZUA 5THKA 4J0QA 1WMBA 4E5NA 2QBYB 4ZOBA 4BE7B 2C9BA 4C4XA 4Y6QA 2EATA 1QK4A 1T0PA 2A1IA 1P6QA 2B7BA 3HI4A 3PXBA 4JJAA 1KNXA 1A8UA 1ODSA 2ZRHA 4M1KA 4US0R 2LRHA 1QX3A 5EE1A 4JZKA 1LSOA 1P5FA 1TCBA 2QQ5A 3JPYA 3UT5A 2C07A 2BNMA 1E94E 2P2YA 4B8YA 4DS3A 4F85A 3ELBA 2I4MA 1DT5A 1SG9A 2IXBA 4FU0A 3MC1A 5FTWA 2GHQA 2XE8A 1ZRHA 1RQPA 1QO0A 4PHCA 4YP9A 1BXZA 1E9DA 3DZIA 2C95A 4XFJA 1IBKB 2O49A 5TSDA 2V96A 4B1FA 5BOSB 3CUKA 4GDFA 1CQIB 5ALTA 3MXTA 1L1EA 5BYAA 3LGXA 4DILA 2ZI3A 2HPAA 1Z17A 2DG2A 2R8PA 3AFGA 2R7KA 1S8NA 4DEYA 1DARA 2B35A 3RS8A 1AXEA 4CEJB 4RD1A 4N41A 2ZBUA 2XLBA 1YMUA 3BJZA 5K45A 1SG6A 1QPGA 4O2BA 5FNZA 1CUWA 2DC1A 2EFEB 1LBIA 1Z4PX 3ZS9A 3CN9A 1KJ9A 1ISFA 1E77A 3H5NA 3HHPA 4IUDS 4L5AA 2CJWB 2PH3A 4TRNA 5TY0A 4JNKA 3VRHA 4Z9XA 3M5PA 2D2VA 3WLMA 1Z38A 5JQWA 1IQUA 4BNYA 1EP3B 2JBAB 2VYQA 5FJIA 4BB9A 3I30X 3AJDA 4J1SA 3T5TA 4DADA 2V0NA 4Y6PA 1SC4A 1XOIA 3CGGA 3ETCA 3HBMA 5EEGA 4C6HA 2HGSA 1C5KA 2J9RA 3KJZA 4CDRA 1Z5VA 1FDUA 1BN6A 4QRHA 4CRWB 1PZFA 1PR2A 3L0PA 4H0FA 2HFZA 1FF9A 1YZGA 1M1YB 1OBFO 1K88A 1PJSA 4TPKA 3WNZA 4Z1MD 3O38A 1MMFB 3D7SA 3AR6A 2W8BA 4YR9A 3FGZA 4FMDB 2VYFA 3MINB 5KNDD 3MHPA 4S2UA 3CECA 3RTBA 3AOEC 1PBTA 2ECFA 3UA3A 4CTKA 2B61A 2HN9A 3DDZX 4KBYA 5CPFA 4G2TA 3EPKA 1WMAA 1PR0A 1MX5A 2WV7A 2BFDA 1R0BA 3D6AA 5IXJA 4BRSA 3UMMA 2BZ0A 4X41A 3UC5A 1VMDA 4D0GA 1U8CB 4MR7A 5HIJA 4L15A 1R6DA 4QVKA 3SC2B 2ZCUA 3NWOA 5KTPA 1GYPA 1QHEA 3EC7A 1H42A 3EMDA 3SLGA 3VOTA 4AUEA 5CLLA 3JS5A 2XADA 1DCKA 7ABPA 3R0XA 3EVTA 2BEVA 3R9XA 3Q2KA 3ZE8A 4FNMA 4ZRMA 4C22A 3CRMA 5ABPA 2I6TA 3AV0B 4CT5A 1PFYA 5AOAA 5LQAA 3ND7A 2Z2IA 4ZHSA 1OXKB 2O8DB 4W8GA 2Y71A 4L5IA 1JPNA 1SUBA 4N5LA 4POOA 10MHA 5FNVF 1QQTA 4FNGA 4IFEA 4BKQA 5JU6A 2AKYA 5HZHA 3GVXA 1SUPA 4KR9A 4REMA 1T1RA 3KX2A 3ZZ1A 4TYMA 3ZJ4A 1DAIA 4ACAA 2C84A 3CUTA 3C6XA 4HUTA 3RABA 1E89A 2INGX 2Q1YA 2QX7A 4TMFA 4JEUA 3W2HA 2Q28A 1OB2A 2IUYA 3OD1A 2HL6A 3T3HA 1TUIA 4EPTA 4DF3A 1ODJA 2CHFA 2W58A 2BHTA 1CY7A 3FLMA 4AY5A 4ZOQI 1Z8HA 2G07A 2JD1A 4QIHA 1RW4A 1C41A 5AMXA 4BMDA 3N8NA 4DCMA 3MJVA 4KFTA 4A0FA 5GV8A 3QGMA 3V7FA 4WEQA 3U7GA 2VSXA 2OMKA 4Z0PA 2PYZA 1F1BA 3THYB 5JUWA 2VDNB 5EERA 4PS0A 1K86A 1DC8A 2VWPA 4PCAA 4A0QA 4GE3A 1GPDG 4KMSA 2A0FA 4Q9LA 3FKQA 4OX9B 3NASA 3OIVA 1OV4A 1SRRA 2OSBA 3E1KA 3F71A 2BYTA 3P9NA 5EYPB 4QJ5A 4RL6A 1OXMA 3I64A 2JGEA 3IQDB 3EVCA 1Q0QA 2AQHA 4D8UA 4FYIA 4F9EA 3A6ZA 5K51A 5B12A 5DMHA 1VI2A 2XDWA 1JLSA 3HL4A 4MUFA 4RENA 2K7FA 2WEKA 1UFKA 2AG8A 2OLKA 1N25A 3MTGA 1PO7A 3FBGA 3BSYA 4NJMA 3HUFA 1DV1A 4LAFA 2C2ZA 3WKAA 2QJOA 1VL8A 2VF2A 4DA0A 5J43A 4HMPA 5EJFA 4BNGA 2J6IA 1Z68A 5DEIA 4BMSA 3D5QA 3THWA 1M2HA 1UMBA 3CW9A 2P9BA 1FFXB 4BNZA 2XI4A 5KIAA 4ZQFA 3VYUB 2P2LA 1U90A 2GEDA 2OESA 1PV1A 4JVSB 1WOMA 1XCGB 3MM4A 3T7SA 2FLKA 2H9AA 2F43A 3E58A 4M7PA 4OP2A 4TXLA 1OIXA 4YV0A 4BLUA 5ETJA 1RMYA 1M10A 4CUJA 3U60B 1AB6A 1XCPA 2P4SA 3DO8A 4WBNB 1EX6A 3HBJA 4QHTA 2Z9DA 3GA5A 2JJ1A 1V96A 1H6BA 2A88A 4OBBA 1Z08A 3L8ZA 1XRSB 1Z28A 2PKRA 3PQ6A 2KEKA 1XMIA 1M76A 1CHNA 2IOFA 3N3AC 1G8FA 3NHYA 1EJ6A 1UZLA 4RS4A 3DWEX 5CXXA 4DA9A 3C8DA 3NOQA 3TDMA 3ORRA 4PBSA 5ISMA 3GRUA 5F21A 3F3MA 2QG9A 4W7HA 3BULA 2G9NA 5T3UA 5HK8A 4UBNA 3TW4A 5BUQA 2HJVA 2VNKA 3OPNA 4Z7OB 4TTTS 1FOEB 4TLEA 1XNHA 4C43A 2DETA 1TD1A 3RSLA 3QYPA 3HY3A 3ZVNA 3IMFA 1TO1E 2I3ZA 3OX1A 2JEZA 3HQ4O 2QTMA 2TMYA 3K16A 2YMQA 3U48A 1ADBA 3CLTC 5HJ2A 1ULSA 5AUPB 4FONA 4C01A 1FX0B 1RXUA 1SU7A 4L8WB 1DG1G 4LMRA 4WLVA 3VX3A 4L4RA 1IH8A 3GGCA 2V7VA 4TOIA 3RKUA 2XRYA 2C1XA 2OM2A 3KB1A 2D7JA 2V7QD 3BTSA 4YJFB 4FK8A 4XD7A 2RAPA 1CQPA 2AT1A 3CVUA 3GJ8A 2GDZA 2OQIA 2OO5C 1YE5A 1LLUA 4P0TA 1NF3A 1UINA 4PX2A 4X7PA 1IN1A 1D2RA 3KNZA 1K6XA 3T4UA 2AXVA 1HUQA 3VTZA 4BE4A 2CFIA 1ZW1A 3EJ6A 3H3JA 4KACA 3OQVA 1P4RA 1LMB3 1RADA 1S7CA 2GMWA 4MXDA 5B30A 1EWTA 2ZP1A 4Q7MB 3NDBB 3TEJA 3BD9A 1A1VA 1FL9A 2HYDA 4FHZA 4I99A 3RLIA 3V2UA 4IXMA 1LQCA 4V0OA 2JLSA 3HDJA 2EKQA 1ISGA 2C2YA 2TMDA 3ODGA 1RM5A 1NMEA 3L1IA 3G5GA 3LUFA 2NSDA 3RRZA 3SYNA 4CQMD 1CRWG 3G0DA 3DHYA 3O6VA 3HB7A 4JJIA 4KRYA 5DM2A 5DISB 1KGDA 4FYHA 3EXHB 2IV3A 4B6FA 3K2IA 5I4IA 3QITA 2J1LA 2QNRA 3WMGA 4BO1A 4O63O 4B81A 4Q4CA 4X20A 4U7PB 4ERXA 3L7JA 4YRSA 1H2BA 4OBWA 1RJ9B 3UHPA 3RZZA 5B2FA 3V48A 2B4KA 2HA7A 3P4UA 4LV8B 2WILA 4MAMA 1D4AA 3KQKA 1DKPA 2J9YB 2CMDA 3QQ6A 1XVIA 3Q72A 1YVRA 3PGA1 4GPD1 3O21A 5A4JA 1NP7A 1VBMA 4U8HA 4XVCA 2GUWA 1V1RB 4TX1A 3DS8A 4RK4A 3H3FA 1KS9A 4K0KB 3JQAA 2IV2X 1H2RS 4MWBA 1DTEA 2MYPA 2XTJA 1YBHA 3WFJA 3CQ9A 5CAEB 2HJGA 3S0JA 5INTA 3DL0A 1UDRA 3MGCA 4YA6A 3ZKAA 1X1BA 1E66A 4I36A 1U0LA 3NT2A 3U62A 3VVBA 4O2BF 1GL3A 1W1IA 5AJHA 5T8KA 4BQNA 1MF7A 3WKBA 1I6LA 1HGXA 2G5GX 3KFLA 2QX9A 3GFVA 1TVKA 1ZD4A 2AYYA 1E2FA 3MEJA 1UANA 1UMKA 4CMJA 2KMLA 1K7FB 1Y80A 1H23A 1RXEA 2IE0A 1YCFA 3BB4A 3OFVA 4PC1A 4D74A 4P36A 1KJQA 3KXAA 4YI3A 2P9TA 5JMWA 1IRXA 2QTAA 5ER6A 3A27A 2IYUA 3BXGA 1Y4DE 3SQMA 2JFYA 3GZTB 2PXDA 2IXFA 4HN2A 1UP4A 4G0VA 5G0VA 2XUKA 1MN6A 5FLEX 4FCCA 2R3SA 1J7JA 1GQFA 3INRA 2R6AA 4NY1A 4YP0A 2B3TA 3S8QA 1BXRA 2JFQA 5ELLA 4EKYA 5JSZB 1DC3A 1EZ4A 3BJIC 3NEAA 4RHTA 2YWJA 5AJVB 1ZJ4A 3FCSB 5TQJA 2ONZA 3L8MA 1BFKA 4X7RA 1PTJA 3NORA 3R0JA 1NM5C 4MYRA 1PEDA 4MTCA 4Q48A 5DEOA 4HGYA 5GP1A 3W6NA 4YJ3A 1FYXA 1RLUA 2WIAA 4EZBA 4KR6A 4UE2A 4UDOA 3DP7A 1B6SA 1P0QA 4JLMA 4P2BA 3MWEA 1XHLA 3R7AA 5IAGA 1XA3A 1L4UA 2BFNA 4UXJA 5AQ1A 3DEJA 2F55A 1DJQA 1TXGA 1N2CE 2GN6A 2UUPA 3H5WA 4CU2A 2HF2A 2PBLA 4O08A 4WLEA 1A98A 3NZLA 3VU1A 3ZWYA 5IVPA 1KRWA 2XIJA 2ZREA 3SDZA 4P2GA 1Y3FE 3OIUA 4G8DA 1KQOA 2HWKA 2QV7A 3BWCA 4ZP1A 3TEPA 1Q1AA 2HBRA 1FW8A 2QTZA 2QOEA 3TE6A 3UT6A 2X0DA 3AI7A 2OB1A 4GPEA 3WMXA 1GWNA 2VATA 1YT5A 3KYDB 3KJNA 4HNUA 1Y5IA 1QGZA 2C9CA 1TM4E 3CF6R 3M33A 4XUGB 4IICA 2LYKA 1IOVA 5ALRA 5DX8A 5DW0A 1E1DA 2NLOA 2ZRLA 3CR7A 3JYNA 5E6SB 1JFVA 1P4SA 1U02A 3ETGA 5FQOA 2OA0A 3SFTA 2WKWA 3VU9A 1KKUA 1N75A 1O87A 3MJEA 4OA5A 1RJGA 5LZ2A 3MBIA 3TPZA 3ZGNA 1X7GA 2LGJA 3WZLA 3C16C 4BATA 3SCHA 4XRGA 5KNLA 4W9MC 3A9ZA 1DC7A 5EPOA 1RPEL 3F6EX 2WD7A 3QF4B 4JA0A 4YS6A 3FFXA 3DYVA 3OO0A 4EYQA 4DBZA 3E9YA 4KXVA 3S5UA 3N58A 5DSZA 1XVVA 2O2XA 1AE1A 1ZHHA 3E82A 2R7AA 2AOWA 5ALFA 1F2UB 1K9VF 2CZQA 2J6CA 3KSMA 2IOQA 5DLYA 3VO8A 4QBTA 3VPDA 5J2UB 1DXQA 3QKSA 1WV0A 2QUBA 2HXYA 3EY4A 2F2TA 2A0WA 1EWKA 3LQYA 3NJ4A 5JRZA 3P45A 1OBVA 4M89A 4XZ3A 1UXGA 1NJ6A 3P9CA 2W6OA 4WAUA 3U4DA 5JYDA 4IF6A 5HQTA 2IELA 5BV2P 2VT7A 3DZHA 3TS1A 1TKAA 4B3GA 4MZDA 2K2QB 2OAQ1 2COEA 1OFUA 2VJDA 1DMSA 3NHWA 1PQWA 3OZGA 4ZOCA 5E0KB 2VJNA 3RFFA 4AY6A 4LZZA 2YZMA 5G1OA 1R50A 2UVPA 1U5CA 1F0YA 4IF4A 3OEED 2PRJA 3C8UA 1JLMA 3JQPA 1IMOA 5FYDA 3CRQA 1ZCFA 4TWAA 1E58A 5G02A 4AP9A 3TFWA 2ORWA 3J7TA 3WP1B 2LV8A 3CX8A 1W25A 4DAEA 1CR1A 1H8EA 2A0YA 4AN0A 4BP1A 4CG3A 2OGTA 4OHZA 1KZ6A 1WB5A 3AUKA 4LY6A 4EVQA 1T3LA 1U6IA 3W2EA 1A04A 3K7EA 2HF7A 2ZBFA 2B7CA 3EDYA 3M6WA 4UHBA 5KNBH 4WOJA 1GNRA 1QO9A 2CLOB 2QT0A 3EQ2A 3I4LA 4R2MA 5KJEA 3ZJ5A 3M4JA 3BILA 3BZWA 3FETA 3L41A 4WKBA 3R9KA 4QYMA 4EYGA 2VPPA 1ZN2A 3NROA 2I6GA 2QRHA 4IP0A 4TS1A 3VNRA 4AIIA 2C20A 2CCGA 2FEPA 4M0DA 4MYUA 1M7HA 1XQXA 2M6LA 3NU1A 2Y1GA 4R3NA 1BGVA 3BRSA 1FRZA 2P9JA 1P45A 2XZOA 2M6RA 1KDVA 1VJ5A 4GHJA 1VJ0A 3JRNA 3E9CA 5EE9A 1KJIA 1XPOA 4NX2A 5FI0B 3AHGA 1KKLA 2NT3A 1JZTA 2X77A 1GU7A 4A2QA 3UHOA 3AR8A 3RVPA 2G8LA 1B0AA 3FTPA 2QTVB 2DUNA 5AR1A 4EVRA 4OGFA 1RZRA 1TAGA 4CKEB 1T3SA 1PRVA 4LSGA 3OQIB 4YXWA 3HM9A 1GPAA 4WLOA 1Z9BA 1IY2A 1VI5A 2OR1L 3DNFA 3WJAA 5AW7A 1MJGA 2ZTHA 4US2R 3TM4A 5DYYA 4C0XA 4FGSA 4IHJA 1PG5A 3FRHA 2XDQB 3AUYA 2EWVA 3FPBA 3Q3VA 2DR0A 4PZLA 1JEDA 3WJ1A 2ZUWA 3W8DA 2WSBA 4UMFA 3COVA 1MX1A 3ZLBA 4V24A 3OWQA 5HKOA 3H0EA 5E6RA 2CYAA 5LZ5A 1CZKA 3O4GA 2CE7A 1DUSA 3L8YA 2WJGA 4IIHA 4GKJB 2R68A 2G9VA 2II6A 4MPRA 3VC2A 4BU0A 2ZE8A 1KJ8A 3EZNA 3F5SA 5KSOA 1SPXA 2OCBA 3QTLA 2JASA 5M29A 1J5XA 1DLJA 1QR2A 2WHQA 3TRIA 3O83A 1WETA 1RIOA 1T9AA 3G8AA 2ZTSA 1SBQA 5FPQA 2VK2A 5GAJA 4D0RA 4UTNA 2GD6A 3L4EA 1A2KC 1RXYA 1RI3A 3F9RA 1G6Q1 4ACBA 4H08A 4ARIA 3AR4A 1GXSA 4J29A 4N4AA 4QGSA 3TLKA 5AVUA 2JBAA 1CU1A 1QWOA 2PA0A 4JC0A 3AF2A 3BXXA 4FOLA 4AP5A 3FFWA 3FZEA 4RPGA 4IKOA 3R41A 3G5TA 4NXMB 3VKUA 4TYWA 2GCIA 3BM5A 4WERA 1Q17A 1WB6A 4B32A 3UK1A 1HE2A 1SKUA 1SN7A 1M1YA 1Q92A 3DC2A 2ZYVX 3GR6A 2AZTA 4CCYA 1VGRA 4F9GA 2ZPAA 4JLBA 3STTA 2G04A 2Y3IA 3OA0A 1YRLA 4DCJA 1JXMA 4M60A 3LUCA 5JNSA 3ZDAA 4BGIA 3K53A 4FUTA 1BFDA 5FF9A 4LF6B 1EKXA 4S0XA 1HXHA 3KXPA 4H0NA 1H2ZA 2RGWA 3UK2A 4ZTZB 4LXIA 5JYBA 5JDCC 1GZDA 2ZBGA 1ATIA 4ALMA 4X4EA 3GRYA 2AG0A 2WU3A 4GGOA 4QYWA 4DMLA 3WA7A 2PO5A 3T1TA 5JDIC 2WWYA 4GVPA 5G0SA 4Z1MA 1M2NA 2EX4A 4I2VA 4QGAA 1L7PA 1RHQA 2VR1A 4QSMA 5EQTA 2ONKA 3S1AA 2OAP1 2NQ8A 3VC3A 4OK6A 3TQRA 2ERYA 5KNDA 3PJDA 4XLZA 2C7PA 2C2BA 4PU4C 3C3MA 3R40A 2WV9A 2PCLA 3EGDA 2Z2JA 3O8LA 5KKCA 2DAPA 3LMKA 3A6DA 4LBWA 3I1IA 5CX4A 1EGVB 1NJ1A 1PGNA 2D00A 2R8EA 4O6VA 4IV5A 1ZZCA 2YS6A 3FLBA 4GOJA 5JS2A 2KM1A 2JRCA 4BFLA 4FFDA 2GLTA 3WGQA 4FZ5A 1M5UA 2CUKA 2REXB 3BDIA 4RGBA 2XCTB 3ECSA 3BIJA 2FEKA 5LUBA 3S2IA 1OCTC 1MUUA 1YB6A 3EPPA 3TE7A 5ALLA 1ISSA 3NDRA 4PYIA 4ODIA 4K8RB 1G3IA 4LSZA 3BFXA 5MFPA 5EXEA 1HLFA 3AF1A 1E7QA 3FHOA 4BNIA 3W34A 3DOCA 2WTBA 3K92A 4GM0A 5JG7A 3WNVA 4MQUA 2L18A 3RG8A 2GAOA 4NG4A 1QHHA 4ZAXA 1VDZA 4DVJA 2NZJA 1SUSA 1QP0A 4YGYA 4L8LA 4YJ3F 2A0XA 3U49A 2WTXA 3BRWD 4ALKA 3BAFA 4MEAA 1D07A 2GCEA 4Y2YA 3IUQA 3AF5A 4HOYA 4TKUB 4EGCB 5C80A 3C3WA 4P86A 5LFAA 2ZIZA 2R4TA 2JCBA 3FYCA 3DZBA 3KYIB 2VLBA 3IDZA 3ZIAD 1NVVQ 5KKNB 1OH6A 1I36A 1NW3A 1QP4A 2YN4A 3THYA 1G3MA 1U5BA 4F0JA 3SIPA 3U1TA 3A04A 4DC1A 4JXZA 4UC0A 5LMUB 2W2NA 4XPIA 4MVJE 4MRNA 5BUSA 3KQLA 1OREA 3GJ7A 3M2PA 3RYCB 1M3SA 1MRNA 3K5HA 3EY9A 1YIAA 3L6UA 4KI7A 3W79A 3LYLA 3BQMB 5EYPA 3F97A 3PX7A 2PYIA 4AJIA 4TWBA 2IBSA 1JJAA 3ONWA 3P0FA 4I5GA 4K6FA 2EHJA 3ROQA 4EG0A 1Z5PA 2P8SA 4LJ7A 2A14A 5K0LA 1FFBA 2AVDA 3Q40A 2VDWB 5T4HA 1PERL 4RAQA 3R6GA 2C92A 1V16B 3C87A 5TGDA 4X62B 1VFPA 2FW8A 1UXCA 4JGBA 4TZKA 4BLVA 2VHVA 3E22B 3KKPA 2VI5A 5K8UA 3R5JA 5LZ9A 1CJCA 1BVRA 2H6EA 3C1TA 3PWTA 4Q7JB 1N2BA 3HBAA 2CUTA 1NF2A 3VZBA 4A73A 5IKEA 2VHXA 4B74A 1N33B 2QJWA 2B37A 2QTHA 3BL8A 4GQIA 3ICEA 1MHTA 3FHTA 4G6ZA 2QRZA 3L6OO 3MCAA 2QNIA 1TLLA 5BWMA 3UJNA 5IT9A 2KEJA 1ZINA 1YJ5A 5F7JA 1MW8X 4FXPA 2H1FA 1IM2A 4UEJA 3G9XA 4RANA 5HOQA 4RTRA 4F60A 2C4HA 3I73A 1EGQA 1J1ZA 4PHFA 3RG2A 3PFKA 4WBNA 2CLKB 4N01A 1H69A 2YIVX 4H7KA 1DJLA 4E5DA 4YCSA 4LJKA 1TK9A 2PKCA 1NQOA 1XMOB 5MFZA 3IDFA 3TXYA 5HF5A 2RHMA 4PYMA 4C0HA 2BMFA 4EELA 4TYQA 3NPMA 4AKSA 5L3QB 1A9YA 5BORA 1QF9A 2GZRA 2QTTA 2ZSDA 4WASA 1VSTA 2YWXA 3VKGA 2N3ZA 3X1ZA 5C1BA 3ROEA 1TT5B 3HWX1 4QPNA 1L7NA 1Y5LA 4JITA 1TECE 3B9RA 1T0UA 1GKYA 1XXHB 2FP4B 2C8JA 1I1QB 2QA5A 2MDTA 2VO1A 3QF7A 4PPYA 3TQFA 4AG3A 1IU9A 4PW0A 3I1JA 1QTQA 5B7PA 3RVNA 4N3BA 4XUDA 3L4BC 1QH9A 5G0WA 3O75A 3OLQA 2R87A 4PQFA 1FX0A 1FSSA 1J23A 3EDCA 4K05A 3PJFA 4JROA 1NP6A 4P4NA 4N1AA 1ETHA 3WYDA 1IB6A 1Y4AE 2GARA 2VYCA 1PWYE 4MIEA 1AY0A 3B9PA 5AK6A 1JA1A 4G0WA 3OOHA 2XX3A 4B4UA 1YC2A 1WY5A 2HSWA 2KSQA 4N8DA 3UJ6A 3N2ZB 2H7CA 4L73A 3DOFA 3KAPA 2QUZA 1ZOLA 3M9WA 4Q4AB 4XYMA 9ATCA 1JQLB 3DJYA 3TSYA 4PF1A 4DLAA 1Z29A 5A4IS 5F7ZA 3HYRA 4GWGA 3E53A 5CDGA 5JZ9A 1JQEA 5ALSA 2ZAIA 5HZGA 1H0SA 3ZLJA 1AGNA 1EUCA 5CLIA 4YEDA 1JQBA 2GO1A 1MEJA 4EY5A 2AEJA 2HREA 3MS4A 4FBMA 4GX2A 1YFZA 4LYAA 2UKDA 4URHA 5DYGA 5H82A 4X1IA 2O8CB 5E1BA 3UYLA 3IBFA 2V7QA 4WV3A 3GH3A 3JAKA 2C8KA 4Y2RA 1NF8A 1L1MA 3OJWA 3ITNA 1NR7A 4QYXA 3FFBA 3GT4A 5EY5B 1YVEI 2AS0A 3DUFB 3O3OB 1SVLA 1S01A 1VA5A 5A5VA 1YRBA 3EWAA 3V8MA 3D4LA 4TRMA 2J0EA 3HLKA 5JAMA 1D6NA 1O58A 3LHDA 1YU9A 3HJCA 3LPNA 3ND5A 4R2JA 2X9QA 4I1OA 4Q18A 1ZNYA 3BSSA 1QH8B 2HRCA 2Q50A 4WH0A 1P72A 1R2QA 4IHJF 2ZITA 2J5QA 5CR9A 1P91A 2Z6VA 1RM0A 1DIGA 1RXIA 1ZEMA 1NBAA 1Z6PA 2CNWD 1Z36A 4G67A 1YRAA 1R8XA 2YUIA 4KQCA 5B2ZA 4Z2YA 3VDRA 3WOHA 1FU8A 2I8LA 3MTAA 3LBIA 4GEGA 3ELWA 4CQMA 4I6GA 2GZAA 3D31A 3EAFA 2R11A 3CZRA 4NR0A 5BN3A 1ZISA 1TEXA 4N3GA 3Q12A 3DAYA 4IMPA 4NE9A 4RVCA 1DU4A 1DKNA 5EXPA 4I55B 3HR4A 4PRLA 2FFBA 4ZANA 3TW0A 3WQQA 5CAEA 1VP3A 3RJ5A 3NNSA 4HBGA 4KPUB 3M83A 4Z1OA 4FYPA 4HGZA 5FPTA 2QUIA 1P0FA 2C2XA 4PAOA 4RVFA 3RYTC 3E8XA 4G1VA 4HEHA 4DXDA 2VPIA 2A67A 3LF1A 2QRJA 1MB3A 4TV8A 3HJTA 1JIXA 5KTTA 3ZHZA 3D54D 2ZB2A 3H13A 4JOBA 4DCUA 5IVKA 3I2HA 1PFWA 2EL7A 2HT6A 1VL6A 4IMIB 4LQDA 2NU9A 4C87A 3TZ6A 1I7LA 1SUIA 3VZRA 4LDJA 2WIKA 3ZWPA 3I8SA 2JGAA 4KCGA 4MUJA 4IVZA 1QGED 2FMIA 3EOAI 4ENRA 4RTPA 1K98A 3S2EA 3C43A 4QTTB 1E3MA 1DQPA 5JWHA 5CD1A 4ESVA 4UAGA 3PVSA 2IPMA 4OXXA 1CEXA 4BP8A 1GA4A 2E18A 1H9BA 2QD1A 2HIGA 1WXIA 2GYYA 5L3SA 5EJ9A 3H4TA 3DBRA 2JCVA 2CLSA 4FMDF 4MUHA 2VP9A 1FP7A 2XUJA 3QBEA 4ZARA 2DJIA 2GILA 1NR1A 5HEKA 5HMMA 3BORA 4YMHA 5DXJA 3FJYA 4PG6A 1WIZA 3INNA 4C7OA 4DNPA 1L5GB 4O4LA 4HYYA 2OHJA 1KEZA 4MWZA 2VQ6A 3GD7A 4TROA 2M4HA 1VMKA 2BAGA 2BFCB 1NPYA 1OQAA 2CYBA 3HB0A 4JI1B 5E8RA 3SG0A 3ZU3A 5KOHA 1F7VA 1T5LA 4PCUA 3R9IA 1U65A 2L1PA 2WD8A 5DWDA 4ZMRA 3HUEA 1TCCA 4I9GA 3KVVA 3GLGE 1SVNA 2GKOA 5ALYA 1J25A 2JVLA 4TLDA 1A50B 5DZSA 4OJYA 5REQB 2PT7A 4LYGA 4EKEA 2QJFA 4IL5A 3WGIA 1Q0TA 2Q6VA 3V8NA 1E3TA 2HMVA 2HWYA 2NU7A 4PZCA 2P8JA 3UJPA 3A9CA 2HCFA 1CR6A 1L4FA 4FNAA 4EUHA 2NUAB 3TZQA 4RZIA 2WQ7A 1EZZA 3MLBA 2AFRA 3GFRA 3GUVA 4MVJH 1SZCA 4L3VA 4EDFA 4I9HA 4KO1S 2IH5A 1CR0A 1JQDA 1YNSA 2PHZA 4NMXB 3KC2A 3PIRA 3KALA 1A7KA 2BKLA 1N6IA 2AW3A 1SH7A 1JIQA 3HCDA 3T5GA 1BROA 1BWQA 4DEXA 4EX7A 3BN3A 3K5IA 2CCKA 4WZBB 5K0CA 5ECYA 1G5TA 721PA 4N7RA 4C4PA 1KGSA 1QG0A 3K4HA 3VNBA 4N39A 4P81A 1JZQA 1VCHA 3QF4A 1SXJE 2EGHA 2PS3A 4C1BA 4DIFA 1HMPA 4B4WA 1YDFA 1T9GR 2IEIA 3ST7A 4C88A 3UAOA 4DCTA 3DLHA 2VKTA 2W6NA 2P78A 2XUGA 3WYAA 1VOTA 3M1YA 1E8MA 4ONEA 3GGJA 3WOVA 3MAGA 3W2TA 1EVJA 1H2FA 5E9AA 2ID9A 1GUYA 4FN4A 4MP3A 4ZVMA 4F5DA 2R6CA 4EY6A 1NURA 3I0ZA 1OR8A 2RHJA 3TCKA 4AUKA 1DBVO 1YBFA 2FRVA 1CB7A 1Y9JA 3C8MA 5TLSA 3R3YA 1Z7GA 5EJIA 4F3CA 1P17A 1Q5PA 5EKUA 3FTDA 3BSFA 1MH1A 3U5TA 3BHIA 3A6LA 1GITA 1ESEA 5TPWA 3JXBC 3VYTB 3JVIA 4DT1A 1LS6A 3LDHA 3EG5A 3FCAA 2LYSA 4MWDA 4QJIA 5DI3A 1N1EA 3ROFA 2UXDB 3HR7A 2X0RA 1TM7E 2IYLD 3OF2A 4HXFB 4K81B 4O33A 2E9SA 3TIIA 4DV4B 1BWSA 1QOPB 5MN4A 5DLEA 1L4KA 2GM9A 3FPCA 2JI6A 4QG7A 5CLJA 4TUYB 1YRHA 5ALZA 4DWJA 4B82A 1HTWA 4P08A 4GBED 4I1RA