1ZBA1

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
191
Chain Sequence
TTTTGESADPVTTTVENYGGDTQVQRRHHTDVGFIMDRFVKINSLSPTHVIDLMQTHKHGIVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKAPFTRLALPYTAPHRVLATVYDGTNKYSTQLPASFNYGAIQAQAIHELLVRMKRAELYCPRPLLAIKVTSQDRYKQKIIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 36
structure length 191
sequence length 208
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba100
1BEV2 1AR83 1FPN1 4CEYB 1K5MC 1QJU3 1RMU3 4BCUA 1PVC2 2WZR1 4NWVA 3VBHA 4CDUC 1VBD3 2GH8A 3JBG1 5C8CA 1QQP1 4CDWB 3TN92 1QJU2 1RMU2 2QQPA 5L7OB 4N43C 3VBHB 1V9U3 1IHMA 1RUI3 5A32B 3ZFGB 1DDLA 5C4WB 2FZ1A 1OOPA 1QJY3 5CFCB 5L7OA 1VRH3 1M06G 1D4M3 4QPIB 1ZBE1 1PIV1 1B35C 1R1A2 2HWC1 2X5IB 2WZR3 4PDWB 1RHI1 4RS5B 1EAH3 5D8AC 3ZXAC 5AC93 4FTEA 1AR61 5FMOS 5D8AA 1V9U1 2WS92 1BBT3 4JGYC 1BMV2 5CFCC 1NA1B 2BFUS 1POV3 4WM7C 1H8TB 4Q4V3 1RUE2 3J8F2 3VBUB 2RS53 1NA1A 4GB32 1PIV2 1VBA3 3VDDA 1VBB1 4RQPA 1ASJ2 2WS93 4RQPB 1VBC1 4RR3A 1RUD1 1ZBA2 4RHV3 2R042 2WZR2 4CDXA 5K0UA 4IV1A 1BEV1 4YVWA 1R091 1W39A 1BBT1 4CDUA 1EV13 1RUI1 2HWF3 2RMU1 1C8M2 1FOD3 4CDQA 2WFF3 1AR92 2PLV1 3JD71 1C8NA 2X5IA 1FMD3 1PIV3 1VBE2 3CJIC 1AR93 2HWB1 4YVSC 4N43B 3VBHC 2MEV2 4EJRA 1AL22 5ACA1 1PO12 1RUC3 5FMOL 1FMD1 3DPRC 1RB8G 4Y4YA 4QPIC 4AEDB 1F2NA 1OOPC 1ZBE3 3ZFEC 1MQTC 3NAPC 1NY72 1QJU1 1RMU1 4AEDA 2ZZQA 4WM8C 4WM8A 4YVSB 3J8F3 1QJX2 5D8AB 1ND2B 4RR3B 5ABJC 1V9U2 1RHI2 2HWD2 2WS91 1RUH1 4Q4Y3 1RUF1 3VBUC 3VBFC 2ZAHA 1H8TA 1NA1C 2HWC2 1VBD2 1FMD2 1H8TC 1TMF3 5BNPB 1AR72 4Q4Y2 2RS33 1PO21 3FBMA 1R081 1ZBA3 2IZWA 2RR13 3HAGA 1RUJ1 3VBSB 1AL23 1VBB3 1ND3C 1VRH2 3TN91 1RUJ2 3VBFB 1PVC1 1PO13 1F8VA 3JD72 3ZFFC 2ZTNA 5DDJ3 2HWC3 1RUI2 5L7OC 2VQ0A 2RS31 4Q4W2 3VBRC 1COV1 4IV3C 1A6CA 1AUYA 4GH4C 1VBE3 2TBVA 4Q4W3 1RUE3 4N53B 4JGZC 4Q4V1 4CEWB 4N53A 1FOD2 1NCQB 3JD73 4GMP3 2R071 4IV1B 4CEYA 1ND2A 5DDJ2 2RR12 1PGW1 1PGL1 1CJDA 1AR63 2RS13 1VBB2 1ZBE2 3JB8A 4CDUB 4AEDC 4CEYC 3DPRB 1K5MB 1NCQC 5ACA3 1RUF3 5CFDB 1QJY2 4FSJA 2PLV3 1AR81 1FPN3 3DPRA 5ABJA 2HWB2 3VBOB 1SMVA 5C8CB 1QQP2 1R082 5ABJB 1HXS3 2XBO1 2HWB3 1ND2C 2RMU2 1BBT2 2WFF1 2R062 2HWF1 1PVC3 2R061 5CFDC 1RUF2 4RHV1 2HWD1 4Q4X2 1Z7S1 4LLFA 2XPJA 5A33A 1ZBA1 1HRV3 4QPGA 1CD3G 3VDDB 3VBSA 4CDXC 3VBRA 3VBUA 4Q4Y1 1NG0A 2R063 4IV3A 1PO11 4GB33 2RS51 1RVF3 4GB31 2RM23 4JGZA 2MEV1 2WFF2 1PGW2 1Z7S3 5DDJ1 4IV3B 5J98B 5JZGA 1R083 2RR11 3J8F1 1PGL2 1K5MA 1RVF2 2XBO2 4QPGB 3ZFFA 1QJX1 4YVWB 4GMP0 1EV12 3VBOA 1AR82 3ZFGC 2RS12 4N53C 4SBVA 2WWSA 3ZFGA 5BNOA 2GSYA 1NCRC 1TME1 2HWE1 4Q4X3 1ASJ3 5ACA2 1ND3B 1R1A1 1VB4A 1R1A3 5C4WC 3JB4C 2BFUL 4CDWA 4PDWA 1RUG3 1HRI2 3LOBA 3ZFEA 1POV1 4CEWC 1MEC2 4RFT0 1FOD1 4FTBA 4QPIA 1VRH1 5BNNC 1B35B 2RM22 1MEC1 2R073 4Q4X1 1ASJ1 1Z7S2 3VBSC 1AR91 2PLV2 1QQP3 1BEV3 1COV2 2R043 1AR71 1AL0G 4Q4W1 1RUC2 3ZFEB 2HWE2 3NAPB 1RUD3 1RUH2 1MQTA 1E57A 1AYN1 1B35A 4WM7A 1EAH2 5AC92 5JZGB 5BNNA 5FOJB 5BNPA 1RUD2 4RR3C 2RM21 4GMP1 2MEV3 3JBG3 1PO23 2WLPA 1NY71 5K0UB 1VB2A 5LK7B 4Y5Z0 4CDQC 5GKAC 1AYM3 4IV1C 1VBA2 1AYM1 1AYN3 1ND3A 4WM7B 5C9AB 2BBVA 1TME2 2DF7A 1HXS1 1HRI3 1RHI3 5K0UC 4Q4V2 1HRV1 3M8LA 4QPGC 1BMV1 3JBG2 1EAH1 1RUJ3 1HRV2 3IDEA 5AC91 3CJIB 1RUH3 2BUKA 3ZFFB 1AR62 4RHV2 5C4WA 3VBRB 1NCRB 1X36A 3VBOC 1R092 2BPA2 4RQPC 5BNOC 1TME3 1HX6A 1NCQA 1POV0 4RS5A 1OHFA 2XBO3 3NAPA 2R041 1MQTB 1RUG1 4NWWA 4CDWC 1OPOA 1VBE1 1QJX3 1VBC2 5BNNB 5CFCA 2RMU3 1RUG2 1QJY1 1GFF2 1AYN2 1PO22 1FPN2 1MEC3 2Y26A 5CFDA 1X33A 5BNOB 2HWF2 4YVWC 4WM8B 1VBD1 4YVSA 3VDDC 4PDWC 1WCDJ 5BNPC 4RS5C 2RS11 5JZGC 1RUE1 2X5IC 5C8CC 4Z92B 1EV11 2HWE3 3VBFA 1RVF1 1TMF2 4JGYB 1OOPB 1HXS2 1HRI1 1AYM2 1VBA1 1COV3 1AL21 5A33B 2RS52 1VBC3 3TN93 4FTSA 1R093 1C8M3 1HQNA 1NOVA 1VAKA 2R072 4CDQB 2FZ2A 5J96B 4GH4A 5C9AA 4CDXB 1TMF1 5C9AC 4JGYA 4JGZB 4GH4B 3S6PA 4N43A 1AR73 1C8M1 3CJIA 5A32A 2RS32 1D4M2 1RUC1 4CEWA 1QJZA 1D4M1 1NCRA 2HWD3
chains in the Genus database with same CATH superfamily
4XQ4A 1JYNA 1LEDA 3WCSA 1ALYA 4HOOA 2VO5A 3KVAA 1S0DA 3MW4A 4YW7A 1JOJA 1WW6A 1CAVA 3R4UA 3NV4A 2GH8A 3JBG1 2ZXQA 5E6HA 1J83A 1WKYA 5IYYA 4BQ5A 5LA0A 3TN92 3HNMA 4XPVA 1LHWA 2ZGNA 4IUGA 1Q8QA 2GAUA 2XKOA 4COYA 1RUI3 2V5DA 4JKKA 1CZVA 5A32B 4K6BA 4EZ4A 1STMA 3USSA 1GANA 3AZYA 4K8FA 1GZTA 3FWEA 5C4WB 4C0BA 4JQTA 2VZ3A 3E1F1 1LJ7A 5H9PA 5CFCB 1DQ1A 4S2DA 1L7RA 2B4KA 2IXLA 4P14A 3WHUA 4MGSA 3WQBA 2VR4A 4LE4A 1WMEA 2X5IB 2ZA9A 3MF6A 3DL3A 3AJZA 2EA7A 1HKDA 1RHI1 1W99A 5FREA 3S7EA 3DKQA 3ZXAC 2G9ZA 3DUIA 5FMOS 1CJPA 1V9U1 1WMXA 1V6KA 1UXZA 4L97A 3WDVA 4CCKA 2WZPP 2RJLA 2CV6A 4MUVA 4E4ZA 1BMV2 1REEA 3M4FA 5KHJA 3D0SA 1G8WA 4GWMA 3N9LA 1DYOA 1GZ9A 3EB7A 4WM7C 4ZU7A 3I3QA 5EJ1B 5JMCA 4GD4A 5CG8A 1QEXA 4XXPA 4IQPA 1F5JA 2RS53 2YDEA 3PVBB 1NA1A 4OUMA 5K8SA 1XYNA 1LGCA 1O3QA 3T0BA 2JEMA 3N3HA 5LBEA 3O1UA 1G9AA 3VDDA 2YYOA 3MIFA 1VLNA 4RQPA 1LULA 1CAWA 1N1SA 1G86A 1REFA 5EFUA 5FZ9A 5FZ4A 5A7PA 4DINB 2RVAA 2WS93 2E7QA 2H6BA 4D6SA 1J3QA 1SLCA 4QGNA 5FJKA 3D4KA 2NP0A 3GZEA 2WNVA 3ZKUA 2DVAA 2ZABA 4HPKB 4I02A 3Q8BA 4MZUA 1RUD1 3OG2A 5FY0A 5IVFA 2BDRA 2NLRA 4OCTA 3T2OA 1JODA 2H0VA 2XWJB 5C3QA 1W2OA 1ULOA 1S0BA 3DXTA 4L2NA 1UZVA 1KQRA 2ZGQA 3H3UA 2AEZA 2LROA 2VUAA 4PCRA 3WLUA 1LENA 4QQ2A 5LBFA 3QOPA 4EE2A 4XZPA 4KG0A 4Y20B 3USUA 3JCIA 4CDUA 1GZCA 1XBFA 3N9PA 3MUY1 1RUI1 1KDKA 4HKLA 3K51A 2NPIA 4QU2A 1TVGA 3ZXGA 2GC2A 1SLAA 1TQ5A 1XRUA 1URXA 1UZYA 3JD71 1AXZA 2D40A 4P9GA 1TE1B 2OS2A 5E16A 3URFA 1PIV3 1YWKA 3ETPA 2PHLA 2DU1A 1VBE2 2YGMA 5EXOA 4XHXA 4YVSC 4ARYA 4OI0A 4XXAA 4N43B 2VBBA 2CDPA 2A73B 3MW2A 2UY8A 4OI4A 1UPSA 5A3OA 2DVFA 2Y0OA 2O8QA 2WABA 3CO2A 3VD7A 3GDBA 4UAPA 5K9YA 3VD5A 1MZ6A 3THDA 5FMOL 1FMD1 1G9DA 2D43A 1U5YA 4QPIC 1F2NA 5T3NA 2XVGA 4HSLA 3KB5A 3AC0A 1D4VB 2DUQA 4D69A 1NY72 3FN9A 5GLZA 1RMU1 3MFAA 3WP6A 4Y1ZA 2D44A 2ET7A 2JDKA 3OPTA 3Q8EA 4NE9A 1NZCA 3J8F3 4C1WA 1IS3A 3E6BA 1JZ3A 2VUDA 1V9U2 3ZYPA 2NMOA 4IESA 3THPA 4O9EA 4DPNA 1RUF1 4NN0A 3IMNA 5FYMA 2JKBA 4YARA 2ZHLA 4MHUA 1QDOA 2VZQA 5A1LA 4XBLA 5C5TA 1H8TA 1MS4A 2CGOA 1QJEA 2VZVA 3PU3A 4W4ZA 1UIKA 4Q0UA 2WO3A 3J26N 4YG3A 1CAUA 3ZYHA 2Q8OA 4RL7A 1QDCA 1R081 2RR13 2J42A 4O61A 4BA6A 2ADEA 5FZ0A 5I93A 3VBSB 1ND3C 1R1ZA 2DDUA 1HJFA 4JHZA 3E5XA 4PHZA 4A3ZA 1PVC1 4MHRA 5B4XA 1V6NA 4UT5A 1W6QB 4ZU5A 3JD72 1UY4A 5FYZA 2XHNA 4EQVA 1CIWA 2VL4A 2EXJA 3VKLA 1GOGA 2ZTNA 4W65A 4DB5A 4Y1UA 2HWC3 1RUI2 3WF0A 1KDMA 3A7QA 2ZMNA 3P3NA 3UNPA 1IPJA 4Q4W2 2PQQA 1MZEA 4UFIA 4XJZA 1BZWA 2J1VA 5FPXA 1WW5A 2JG8C 2WNUA 4AG4A 4DUVA 4FFIA 3WD5A 3WF4A 5FY7A 1ULDA 1V6LA 3OUJA 4GH4C 1KRIA 3HR9A 1UMZA 4EN9B 1YFYA 3SHRA 2EIDA 5A1FA 1JU3A 5KHHA 4Q4V1 1W6PA 3DECA 3BOPA 4FBFA 1L3JA 3MO4A 4B4QA 2W1WA 2MPFA 3B7MA 3LCPA 3OBTA 2VNOA 5CAZA 1BJQA 1PVXA 1SHWB 2UWBA 4CEYA 1PGL1 4AQTA 1CJDA 2C6SA 4QKFA 1SZBA 5IWFA 3DV8A 2X53S 3RJ2X 2W1UA 3ACLA 4LUKA 1A34A 1H8VA 1WUVA 3FFQA 2ORXA 4FOYA 4M0NA 2CWSA 1LHUA 3BTYA 4CEYC 5FZFA 1K5MB 1YQCA 2VNVA 5FYYA 3ZN5A 5FZ7A 1W6MB 2DVGA 1E5RA 1GP6A 1S55A 4FSJA 1ENXA 1ZM1A 1XXNA 1CPMA 2EVXA 2PLV3 2W1SA 3DPRA 3I4IA 2HWB2 1YJKA 2J1EA 3VBOB 2WC2A 3DKWA 3KD4A 3I3MA 1FATA 3BALA 5F6LB 2C0ZA 3ORJA 3DXUA 1R082 4XDPA 1YFXA 5ABJB 2QQVA 2BV4A 4GJZA 2ORZA 4LBMA 2HWB3 1ND2C 2WNEA 4HFSA 4PJYA 3UKNA 4PLOA 5JR7B 3VHRA 3WW2A 3SLIA 2BNMA 1XYPA 4KWLA 4B3NA 4CCOA 1UWWA 2ZKNA 3N36A 4WBBA 2WFF1 3POFA 1ULGA 2C26A 2K2SA 3WDXA 4AHYA 1PVC3 1WWYA 4Y22A 4ISQA 2FCUA 3I2KA 4P5YA 3WT3A 5CFDC 4XAAA 1RUF2 3NNGA 3W5MA 2D93A 1K3IA 1F31A 1LR5A 5FO9B 2FHRA 4XUOA 2QZ3A 2Y64A 4AI0A 2W08A 4YW3A 4TTGA 1ZBA1 4LE3A 1WCQA 1HRV3 3KQ4B 1CD3G 2QZ2A 5GALA 2A75A 4KGQA 3ZIXA 3GM8A 4Y3OA 1IS6A 4PLNA 3VBRA 1C4RA 5JPMB 2PHXA 1OUXA 4FAGA 4XC9A 1U5ZA 5FMCA 4QDRA 1J3RA 1DGRA 4GB31 1CAXA 1C5IA 3IN9A 3O0XA 4JGZA 4QB2A 3UV9A 4PF5A 2WFF2 1C1FA 1NT0A 2P3KA 5JZGA 5JVVA 4JRLA 2JG8B 2VM9A 4FOWA 2DCTA 3L2HA 4LTAA 4XZUG 1BVVA 4LHLA 4CUCA 1W8ZA 4ORFA 3ZFFA 1QJX1 2VTFA 1WMDA 3B00A 4M01A 2JDMA 1VRBA 3OGGA 1IOAA 3WNOA 3H3ZA 5JXHA 4V1PA 2JD4A 3ZFGC 4DNYA 4YZ2A 3V65A 4CU7A 3A4UA 4AAXA 3A22A 1HQLA 4L92A 2G9GA 2UURA 2JD9A 3BCWA 1GUIA 1ND3B 1YIPA 2K0GA 3D8CA 5A3PA 5ACA2 3BOWA 3NQHA 4IGQA 3JUUA 1E5HA 4NPMA 2BFUL 2JG9C 3B02A 2E26A 5DZGA 5C4WC 3EYPA 3LSEA 3T2QA 3BU7A 1X9TA 3ATGA 4YG0A 3VZMA 1POV1 1W2AX 1LGNA 2AREA 4OFGA 4RFT0 4QX0A 4D94A 5JUVA 4KGGA 4FTBA 3HMYA 4XDQA 4E9KA 1Y4WA 5IVVA 4M3CB 1KS4A 5LB6A 5J48A 1B35B 3O0VA 5FP4A 1JOPA 1MEC1 1OA2A 1SPPB 3L9JT 4YM3A 1RINA 3MFCA 3ES1A 4Q4X1 4M4RA 5HXMA 1Z7S2 3VBSC 5KR7A 2YBKA 3FBYA 3OEAA 3LIHA 4YLZA 3ACGA 1QQP3 4JQRA 3VDCA 1W8TA 4XF4A 1X50A 5FZCA 5J7MA 2DYCA 4D7YA 4Q4W1 1W28A 2YU2A 5IVCA 5F5IA 1F9KA 1ST8A 1RUD3 4HVOA 4HKOA 1TNFA 2L9LA 1JYIA 4BB3A 3LEGA 4IEOA 5FLIA 1B35A 2DV9A 4WM7A 4DOUA 2A5ZA 2VW2A 4LBQD 2Q1ZB 1CWPA 1PHMA 2P37A 2RM21 2WNVC 4E8CA 3DEMA 2DVBA 2MEV3 1UU5A 3MPPG 3GJBA 1YQ8A 3ZPOA 5FPBA 4DXTA 1PO23 2E63A 4ATFA 1UO9A 3NV2A 1JN2P 3KV6A 3SEEA 2VMGA 4P08A 1VB2A 2MNGA 1Z0HA 2Y34A 4AQSA 1LOGA 2IXIA 1SLLA 3C7EA 4XTPA 3WXPA 4CUBA 4BIOA 4CDQC 2CGNA 1Y9QA 4CTEA 5JOWA 3N7KA 4IGPA 1AYM3 1DIWA 3OGRA 2E6VA 2EXIA 3OGVA 5L73A 1AYM1 3BIWE 4WM7B 2JDUA 1RGSA 4ARXA 2BBVA 1TME2 4O7XA 2QQMA 3HNYM 2W2IA 1UZ0A 1H9WA 1Y7BA 1KD7A 4K8RB 4TLFA 1H2KA 2IFWA 4MADA 3PHMA 5LRRA 1RHI3 4Y20A 4XFIA 4L8QA 3M8LA 4QPGC 2VXRA 1BMV1 3JBG2 1K42A 4JZRA 3I59B 1HRV2 5H9SA 1QIQA 5ANQA 3WW1A 2BUKA 1BQPA 2ARXA 2WYFA 3RGBA 4K40A 2WIIB 4BWOA 3BTXA 2QVSB 4LOTA 3LDBA 3GCXA 1F35A 2JB4A 1NCRB 5LASA 5A6QA 2EAAA 3VBOC 4KBBA 5DAWA 1R092 3KGLA 1TZOA 2WUHA 4HL0A 4LORA 3RZKA 3NO8A 2A6WA 3RNSA 3SCHA 1HX6A 3KZ4C 4HSJA 3RYPA 2P17A 2A3XA 2VUCA 2WWUA 3OUHA 2WT2A 1LCLA 3V0BB 4B7EA 1CONA 1MQTB 1J58A 1D0GA 1RUG1 1GNYA 2D5FA 2EIGA 2PHUA 1UY2A 3LFMA 4C1XA 1VBE1 2Y33A 3ON7A 3AXDA 3ZXKA 1QJX3 3WUCA 4FPYA 2JKXA 5FZKA 1S2BA 3W9AA 5FLHA 4IE5A 1QJY1 2JECA 5IVBA 1HV1A 2X8KA 5A3MA 1AYN2 3CBNA 4F7ZA 2VAUA 3LD8A 1MS8A 5CFDA 2UU8A 4CCJA 4A6SA 1ULFA 2PHWA 3GZUC 2A6YA 1NLSA 2IXCA 5IFTA 4AFCA 5LZ6A 2ETEA 4AI2A 3K2OA 5A3LA 2W5FA 3RZZA 5GZFA 3MIHA 4D7SA 1WCDJ 1V6OA 3VV1A 4OQ8A 1X82A 2PHDA 5FYIA 5DZEA 2XJSA 1CAUB 4XJUA 2X5IC 3F2ZA 4XIKA 4C91A 2VZ1A 1XQNA 1XOYA 3LPFA 4FPCA 4XETA 3POBA 5FZ8A 1NUKA 2CTVA 3AFKA 2AUYA 2FCVA 2GNMA 4PLMA 5A3NA 4QXCA 1NAEA 4YW6A 5FPLA 3KV5A 4E4DX 1OUSA 1TMF2 1OOPB 4XF3A 4AWDA 3DYMA 5EHDA 3TNPB 3NNFA 4MGYE 2OW4A 2EALA 1HRI1 1QXRA 1UPIA 1VBA1 2YC0A 3C8XA 1OURA 1EY2A 3CF6E 3K46A 3LF7A 2E7TA 4R4XA 4LT5A 3RZHA 1Y9MA 4XBNA 4PQ9A 4QX3A 1I3HA 2RS52 4JDMA 1W0OA 4FTSA 4H55A 5FXZA 3R05A 4HONA 2FDFA 1YUDA 1AXYA 4NHLA 2PFWA 4XCBA 2FZ2A 2H0BA 4GH4A 3ZPYA 3N9OA 4CDXB 2YXSA 2DVDA 4IETA 1DGRN 5GLTA 2VW0A 2DBNA 4LQRA 4OUSA 3AYDA 2DUPA 1N1VA 4QM8A 2VCCA 3TEYA 4OYUA 3K4ZA 2VG9A 1DBNA 3KCYA 1O5LA 4GQ7A 3RZGA 1C8M1 4IE7A 2IVIB 2ZGTA 3CJIA 4LKFA 4BMBA 2PN5A 4I01A 3IAPA 1RUC1 1W6PB 4K9SA 4QB1A 1DGWA 3QH6A 2VOWA 1UU6A 5A70A 4CEWC 3D6EA 1AJOA 1CAVB 2JE8A 2HWD3 3U14A 1FPN1 2RE9A 3RJRA 1ACCA 4CEYB 1PK6B 1QH6A 1SCSA 2BNNA 1K5MC 1QJU3 4LBJA 5HXVA 1MVEA 1N1YA 2WZR1 5FYTA 4B4PA 1VBD3 2J1SA 2ZX2A 4Y24A 1W3VA 4PBOA 3IAQA 4NIDA 4N43C 1W6MA 3I3BA 3V56A 3ABZA 3N9QA 2GP5A 3KQRA 1YIFA 1DDLA 2XHKA 2ZMLA 4Q0VA 4K7JA 4QX8A 3I2IA 3RVHA 3PJQA 4XF0A 3OYWA 5JOXA 1M06G 4GZ9A 2ZACA 4PQQA 2CSGA 2Y6GA 1ZBE1 3FUQA 1PMJX 1B35C 5KXEA 2Z42A 1R1A2 2HWC1 1RUOA 3W59A 1D7PM 4G4FA 4QQLA 2WZR3 4PDWB 3ENRA 5SV5A 4RS5B 1IS5A 1EAH3 4H2AA 4OHZA 5A6YA 5AC93 5D8AA 2WS92 3K4DA 3X29B 2ENRA 2JE9A 1BBT3 1DQ5A 4F83A 3NV3A 1US3A 1Y3TA 2GN7A 4NHXA 1YYNA 5ANNA 1NA1B 1POV3 4Q4V3 3UK9A 4LHNA 1Q8SA 2D6LX 4HN1A 4AI1A 4QDQA 5JOZA 3IKWA 2BVVA 3SISA 4E8DA 4ES9A 1O6UA 3J7HA 2QUOA 1VP6A 4UW4A 1VR3A 3TWIA 1JW6A 4FFHA 4A2UA 5JLVA 1T2XA 3SC7X 1VBA3 4F3JA 2QQUA 2ZX1A 5FZOB 2VMDA 3BPZA 4FO9A 3N9NA 4KU8A 1VBB1 4IXLA 3O7OA 1RITA 1JYXA 4HPKA 3LEMA 1DZRA 4IEUA 1J1TA 1VIWB 2PHRA 1C5HA 5F3EA 3ZN6B 2RHPA 1VBC1 1YEWA 1O7FA 1ZZBA 3WOGA 1E5IA 3W21A 4UXAA 1ODMA 4NPRA 2VNRA 3HEIA 2R042 2WZR2 1S0JA 1V70A 1W8UA 2PELA 4IV1A 4JCKA 2D6MA 5TSWA 1IKPA 1BEV1 2CHHA 2V4VA 4AEKA 5T5OA 1OBNA 2NZ9A 1JZ4A 1OF4A 3ETQA 3CIHA 4CVUA 1I1EA 5FP7A 1PX3A 4CCMA 1G9BA 5FK7A 3ZSEA 2X10A 1C8M2 1GOFA 1QOOA 4CDQA 5K7PA 1AR92 3OY8B 2XONA 4ISRA 4XW3A 1QHDA 2OT7A 2OKXA 2N7GA 4Z1VA 1YQ2A 1FMD3 1YI9A 3B5LB 3UJOA 4QQPA 1CQ9A 4K1YA 2WNUC 4MH0E 2A6XA 5GLUA 3ZO0B 1JZ5A 3CJIC 4XCAA 3NJXA 5E8AA 1KXGA 2XVKA 4NR1A 1FT9A 3QACA 1N47A 2JDZA 2R0HA 3VBHC 3OPWA 4QKNA 2XDVA 4Z82A 1ZRCA 2V73A 5FKCA 1GKBA 4YZ1A 1WMFA 2MEV2 2BJSA 1CN1A 2YB7A 4Q5OA 2OIIA 4B1MA 2A6ZA 2BZDA 3NKTA 4XIOA 4A45A 4FXGB 4AEMA 5CYYA 2E51A 4Q0QA 4Y4YA 1RB8G 1NX9A 2Q1MA 2WSVA 4U2AA 4AE2A 3O1RA 1OOPC 4NO4A 4RYDA 4UFJA 5FYVA 1UY1A 1QWRA 3EHKA 2Y6FA 3OBAA 4E2QA 1QJU1 1PX4A 4DFSA 3UGGA 4P5HA 4WM8C 4GKYA 1OKQA 2JG9B 1TNRA 4RR3B 3BKZA 3SH5A 3KS7A 3T08A 3VD4A 2NYYA 2WS91 1RHI2 3PVNA 4HXCA 1LU2A 4LOSA 3OBRA 4GWNA 4R9CA 3R4SA 2WN2A 1UF2C 3AMQA 4I0AA 4W6YA 1NA1C 2PQSA 5DZFA 1VBD2 1TMF3 5BNPB 1AR72 4I30A 3S57A 1Q3EA 3ZX7A 4KI5M 2D3PA 3BI3A 2XLGA 1BLZA 1PO21 3POGA 5CNAA 3MLKA 1T6BX 4Q0PA 2AZ5A 1CGPA 2J1RA 2IZWA 5JI7A 5T5JA 2Q5TA 3V0AA 1Q5OA 5FO7B 1AL23 1VBB3 1HDKA 4OHYA 4NHKA 3ZSMA 1AF9A 2Q1FA 1O59A 2WRAA 5KXDA 1DP0A 1APNA 2IUWA 2VXJA 4FQZA 1Z78A 4XUTA 5FRAA 1JZ8A 5GLWA 5DPNA 5EV7A 3ZFFC 3VUOA 3BTZA 2WA4A 2WQ8A 3S5AA 4PI2A 3T0AA 4URAA 3O5SA 4LO4B 4QAWA 3AKPA 3LSDA 2RS31 1OT5A 2A70A 3WW4A 2BERA 1COV1 4MGIE 1GWLA 1CZSA 2A1XA 5F5CA 4NRPA 2TBVA 3GGLA 4C90A 1OQDA 2FQPA 2GC3A 1O8SA 2ADDA 2CYFA 1Y43B 2OQ6A 4JGZC 4MXVA 4XBQA 5JSPA 4OHVA 1C3HA 3OCPA 2VOVA 5LEJA 1GYKA 3LAGA 1OLRA 2ZCWA 4N53A 5FJHA 4UF0B 3FLPA 4GMP3 4TSVA 4X6QB 4E2SA 4GULA 5ISLA 2R071 3I2JA 4N7IA 5FXXA 1ND2A 5DDJ2 5A1AA 2XJUA 1F4AA 2Y0IA 2RS13 1VBB2 1LOEA 3RWNA 2YHJA 2ARAA 4IW3A 1O91A 3IDBB 2YROA 4AEDC 1GOHA 4CDUB 4CCNA 1XE7A 4YM0A 1FAYA 3C7GA 3DPRB 4AOCA 1CZTA 1W8NA 2ZBJA 1DZTA 3OD4A 3LQCA 1RUF3 4K1ZA 5FP3A 5ACA3 3POIA 5CFDB 1N3PA 3QH7A 5DUWA 4MV2A 1GR3A 3RS6A 1FPN3 5HV0A 5ABJA 5I0SA 2RDRA 1JYTA 3MYXA 4XQWA 5C8CB 1AX2A 4MGZE 1LHNA 1VE0A 3C7HA 4QGMA 4HMZA 2OA2A 4M3CF 1IPKA 1UW8A 4XFGA 4CYDA 4AF9A 2BP6A 2ZX0A 4LNVA 4AVSA 1R64A 4FPOB 5A7QA 4ZKTB 3TEWA 1I9RA 2XBO1 4ASLA 1GLHA 4Y22B 5M0TA 2DURA 2FCTA 3HIFA 2WT0A 2W92A 3GXUA 3PU8A 4YGEA 5DN2A 5BY5A 1CX1A 2R062 4DS0A 1LEMA 5FQ0A 2HWF1 2PXJA 1SBFA 2ZGOA 3MDPA 4TWTA 2OVUA 1Q56A 1DHKB 4YW2A 1JZ7A 3KWVA 3AFGA 1YLLA 5C3PA 4QX2A 4LLFA 1OQEA 1REDA 5LATA 3U10A 4WVWA 4IDZA 3TOJA 2XPJA 4AVAA 5FYBA 4JDNA 2VQAA 3T2PA 2EICA 3VBSA 2D5HA 2XL9A 2GMPA 4CDXC 4B1LA 4ONUA 4BK5A 2Y6JA 4H3WA 2B5HA 4Q4Y1 5FZBA 1NG0A 3DYOA 4NMIA 4EN8B 1PO11 2WT1A 1NKGA 4GB33 4UW3A 2OUJA 2RS51 1RVF3 5KXCA 3NNLA 4BQYA 2MEV1 3EBRA 1Z7S3 2LALA 4J1WA 5DDJ1 4IV3B 1NQJA 3MIGA 2HBUA 5J98B 3POJA 1O8PA 4ZXKA 1PGL2 1N1TA 1GNHA 4OHWA 2P1BA 2J7MA 2XBO2 1RVF2 3RYRA 4FQ4A 4Q8KA 4PT6A 1H1AA 4YVWB 1OKOA 1ZX5A 4GMP0 5FY4A 1EV12 2LRPA 4B8EA 4CP1A 1IS4A 3LKJA 4BK4A 4FT8A 2BOIA 2QQOA 4PI0A 5LY2A 5BNOA 2GH2A 4CA9A 1TME1 2HWE1 2WFPA 4QU1A 5FP9A 4CZSA 2RJ2A 4R9DA 3UT0A 2ZEZA 1VB4A 1GQPA 3GZTB 4AQ6A 5T55A 1EUUA 4AFDA 5EP9A 3VZNA 2XQXA 1JMUB 3IB3A 4QMAA 4OZOA 2BQPA 4PDWA 3WNKA 1HRI2 5T50A 1DF0A 3MV01 4LPLA 3ST7A 3WQ7A 5LY1A 2DU0A 5FMBA 4P9XA 3WDTA 3K3OA 1FOD1 5IATA 2AEYA 5BNNC 3G6JB 4IEWA 1KFUL 2RM22 2ZAAA 2DCYA 2OX0A 1GP5A 2R073 5L9RA 3AZZA 2BWAA 3AZXA 3CZUA 3DF0A 2AACA 3MUZ1 1ENSA 3NMBA 3RZMA 1V00A 3TEXA 1AR91 1ZYBA 1RXGA 5GM0A 1B09A 4MSVA 4YG6A 1LHOA 3AP9A 1OC1A 1YHFA 4URTA 5IK7A 1AL0G 3E5UA 2CAUA 4Q27A 3SMHA 1SG3A 1RUC2 1CVNA 2WR9A 3GHMA 3HNBM 4MO3M 2VOTA 4UBGA 3NAPB 2BRTA 1E57A 2D3RA 3B93A 3D0JA 5LBBA 3SH3A 3T30A 1S2KA 2ID4A 2LUWA 3H8XA 4N7UA 1V0AA 4CU6A 1UYYA 1H2NA 2VZUA 2WYSA 5SV8A 3JBG3 2D97A 3BU0A 4WZFA 3GJAA 2BGPA 4AGGA 1DZQA 2VQTA 4FP2A 4CP2A 4PF1A 1OLMA 2YPJA 4MG2A 3R0RA 3M70A 4RFRB 3VB9A 5IK5A 3AP5A 3HN3A 1VBA2 1AYN3 3ZYJB 4NIGA 1UYXA 2IXJA 4MVTA 1AJKA 4N9HA 4E4HA 3B94A 4LBQA 2FMYA 3K75B 3M3EA 4GA9A 2BW8A 2YBSA 4BPZA 4Z07A 5F2WA 3I2OA 3ZYBA 5JDBA 3KMHA 3POYA 4AXOA 2QCSB 1EPZA 1SDWA 1WA6X 3TYJA 2JDNA 3N7MA 4LO8A 1PMHX 2VOXA 3IIAA 1HW5A 1RUH3 3ZFFB 4MXWB 5KC5A 4RHV2 2WL1A 3VBRB 4QM9A 3WNMA 4C8DA 3S30A 2XGXA 5KHKA 1W9SA 4YZ5A 1FV2A 5CKMA 1OVPA 3LEKA 4V2WA 4TN7A 1CAXB 4RQPC 4YM1A 4LBQB 5A7OA 1X8EA 1W05A 2E32A 4HKWA 4BXSV 3H7JA 4J1XA 4QGLA 3T2TA 2YG0A 4P9JA 4ET7A 3ELNA 4DY5A 3N35A 2LM3A 2JXAA 2BNOA 4CDWC 4OI2A 3BIEA 4OHXA 4U36A 4FOQA 1WA4A 4IE0A 5FUNA 5BNNB 2I07B 1RUG2 2XJVA 2Z5WA 2BGCA 1KFXL 1QF3A 5FZ1A 3RRDA 4W6WA 1W8WA 3IT8A 2QBXA 5FY1A 1QXJA 2D6KA 3LEIA 5FV3A 4XUNA 2QDNA 3LZZA 4JTOA 2DCKA 3LOIA 5C6CA 4YVWC 2JG9A 4N9IA 1G6NA 1BXHA 1DLLA 1UOJA 5GZDA 5I0TA 3PVOA 5FZIA 3ZKYA 5BNPC 3O1OA 4D0QA 4RS5C 4YW5A 1WBFA 2VMHA 2RS11 5FYCA 1XJAA 2W1QA 1LTEA 2Q8DA 1WW7A 1XNCA 4FCAA 1T6GC 4UI9L 2B39A 4HBNA 3AL6A 2JB8A 1G9FA 4DIQA 1U0AA 3NW4A 2P2KA 3RI9A 4I2OA 3DN7A 2K46A 1UCXA 3ZYRA 3N9MA 4YGCA 4UFKA 3ZM8A 2HKXA 4RA0A 3K4AA 1IPSA 4LK6A 4OMDA 1CR7A 4XMIA 1A3KA 3THCA 1UMHA 2FMDA 1AL21 4XFFA 2B9VA 3TN93 3BTAA 2V72A 3AM2A 5DUVA 3SCFA 2VZTA 1OH3A 1R093 1MS1A 3AVSA 4X8PA 2VOKA 2R072 5DAVA 3H0OA 4XFAA 5GJ6A 3I97A 5J96B 2Z79A 5HCFA 5I8YA 3M1HA 1TMF1 1RXFA 4LULA 2R30A 2EF6A 3AYCA 4NPLA 1RIRA 5FP8A 5A80A 3VZKA 4Q29A 1MS9A 1ZA4A 4D8MA 5BPXA 2E7AA 2XL7A 3U78A 2UWCA 3FFZA 1PMIA 1VMHA 3B3QE 3AB0A 1KS5A 4BISA 3H8RA 1W8HA 3VHNA 3PL0A 3T1LA 4KNCA 4AW7A 2J1UA 2KD7A 2VNGA 5EQUA 2RS32 4ZU4A 3M3IA 1H30A 4XABA 4B7KA 4ZXEA 1DCSA 2GDFA 3ZLIA 5CBLA 3O1TA 3AYAA 1OFSA 5L9BA 3OBZA 1FNZA 1NCRA 4LBOA 3K77A 4WVZA 2ZMKA 4NRQA 3WNLA 4CPBD 2ZHNA 4EWAA 1RMU3 2Z69A 4CU9A 4GXLA 1SEFA 2B7YA 4W6XA 3TB0A 1UL9A 3CKHA 4CDUC 5EJ3A 4ATEA 3WR0A 5C8CA 1OI6A 1QQP1 1BCXA 3AJYA 1JYWA 4PIYA 4XEZA 4CDWB 3I3EA 5FZDA 1AX1A 1MZ5A 1RMU2 2QQPA 5FPUA 3VBHB 1V9U3 1SLTA 4W50A 1NE6A 5DUUA 5LA9A 5GZEA 5J1XA 5H9QA 2VE1A 5I8TA 2RJKA 2WZ8A 2XLAA 4CP9A 5L7OA 1D4M3 2EXKA 3AMMA 4JKMA 3GF6A 1O3RA 5FQ0B 3WDUA 4MGTA 4XAEA 4AI3A 5JIUA 2ZX4A 1QMJA 3AYEA 5A7WA 1OA4A 2TUNA 1XNAA 2W47A 4TYSA 2O0OA 2ARBA 1PM4A 5D8AC 1YXWA 5LA2A 1AR61 3ILRA 1WCKA 4Y33A 2Q8CA 1IG0A 2DFCA 4BQ4A 3POSA 5KHGA 1W0NA 3PNAA 1SFYA 1VMJA 4HT1T 1HJGA 3GCWA 4JGYC 3VD9A 1JBCA 1UKRA 2D7FA 5CKNA 2BFUS 4LHSA 4KL1A 4LKSA 4WVMA 5G05L 1H1IA 1VMFA 1S0FA 5F5QA 4Y1VA 2B42B 2O8OA 3QCWA 1CESA 3WW3A 1C28A 4XJAA 4GB32 3SQOA 5CEHA 1PIV2 3VN4A 4BJ0A 3WG4A 5FY8A 4DO0A 3TBDA 5F5AA 2C4XA 4LMFA 5F9TA 3UL2A 4KG8A 1W03A 3KV4A 1ASJ2 1XB9A 5ERLA 4TZDA 3GHNA 3VKFC 1Q8OA 5FYSA 3P1IA 1D0HA 3CQOA 3HPNA 2A3YA 1O4ZA 1ZBA2 3W5NA 1FXZA 1XU2A 5A6XA 5F3IA 4AI9A 1Q8PA 3HT2A 4CDXA 2PMWB 4KWUA 2W52A 3M3CA 3KCXA 3U0ZA 1VAVA 5F6KA 4J25A 2JG8A 2OUHA 3VZJA 1YQ5A 2BBAA 4H7LA 1F5FA 1OF3A 3POEA 2CWMA 2W0XA 5EWSA 1W39A 5EZWA 2HWF3 2RMU1 2VMIA 1M4WA 1LESA 2RDNA 2VH9A 1UZWA 3Q9OA 2PLV1 1PZ8A 4XILA 5FUIA 4QB6A 1C8NA 2X5IA 3C2UA 2JE7A 4XACA 2Q0AA 1OSGA 4ES8A 5L9VA 4YGBA 2J22A 3I2GA 5DG2A 1WLWA 4Q2FA 4O9GA 4HANA 4JAAA 5T54A 4NHYA 2HWB1 3D5OA 4P00B 3UKTA 2PHTA 3A0NA 5DAPA 4CXWA 3H3LA 2KA3A 4G9SB 2OZ6A 3WSOA 1HB1A 4COVA 3ROUA 1ONAA 3ITQA 5FPAA 1QGLA 2WNUB 3ILNA 5ACA1 1RUC3 3O12A 1JTZX 3MF9A 1ZBE3 1CX4A 4XF1A 2CAVA 4DRVA 1IZ3A 2J1TA 1SFNA 1XNTA 4WV8A 4NAOA 4AEDA 1WLDA 4LKEA 2ZZQA 2BEOA 4FI9A 4YVSB 5JSRA 1XPWA 2DTYA 2ES3A 3AP6A 5D8AB 1QJX2 5F3CA 5LCWL 2WNVB 2VQUA 5JXIA 4CP0A 4LUMA 4BU2A 4YPJA 3ZSJA 4IEQA 4AAPA 4JHTA 4XFHA 4D6QA 1HN1A 3VBUC 1ODNA 3T1MA 3PMEA 1Q43A 3PMSA 2WO2A 2C5DA 4E27A 1FMD2 1H8TC 2KM2A 5FFOC 1GP4A 1W9YA 3HQXA 4ZPIA 3MV11 4YZ3A 2RS33 3I54A 5KWRA 2XWBB 4NIHA 3FBMA 3WEZA 1WLTA 3MEPA 5FZOA 2P3YA 2ET1A 1PNFA 2VZSA 1GV9A 1W0PA 1RUJ1 1D2QA 3MIEA 3CHXA 2X05A 5JOYA 1I5PA 3TN91 1QY4A 3RZLA 1RUJ2 4LXLA 4YZ4A 3VBFB 1YCIA 1XSQA 1PO13 2JIGA 2VVEA 3AZVA 3I8TA 5J3UA 1F8VA 3NJYA 4R8HA 4NIIA 4L11A 5APAA 2KXLA 4OULA 4TLGA 1IQDC 5DDJ3 1NQDA 1W9FA 3GBGA 1KITA 1VAMA 3L2YA 2GP3A 2A3WA 3K3NA 2VQ0A 1H1MA 1OH4A 1S0CA 4IE4A 1ENRA 3BB6A 2JX9A 3CL1A 3IWZA 4LO6B 3VBRC 4BE3A 2FBEA 5BUVA 1XNDA 5FDBA 4Y1YA 4M00A 1A6CA 1UU4A 2Y6KA 3ZMNA 4Q4W3 3MW3A 1W6OA 4N53B 3KF5A 3V64A 4Q26A 1NLRA 3QD6A 3ZSLA 1DGWX 2YGLA 2WAAA 1PGSA 3R4DB 4BLIA 4L0PA 4CEWB 2MHFA 2X09A 2WDBA 3BPSA 4XVHA 5L19A 1NYWA 2IVJA 1DYPA 3PVEA 1O3SA 4IV1B 2QTWB 4AFMA 2UYBA 2RR12 1PGW1 2B46X 3LDKA 1X8MA 2VY0A 3MPBA 2VU9A 2QQJA 4CE8A 5HCBA 3JB8A 3AVRA 4FVVA 5EIYB 2I45A 1MS0A 4XQDA 2HJIA 4AVVA 1AX0A 2Y8KA 1PK6C 3SH4A 5FR3A 4K3UA 5DUXA 4CCLA 4P02B 5FCCA 4A4AA 4CUGA 1EP0A 4P9WA 1DU3D 4XJ9A 3TRSB 3G7DA 1MZFA 2PAKA 2W9XA 1S2EA 3FUOA 3AK0A 5K4LA 3FHIB 1RUNA 1SMVA 4EN6B 3NJVA 5GZCA 2P3IA 1QQP2 2Y6LA 4FP3A 1U5IA 2LS6A 1SACA 5D2AA 2A71A 4YSFA 5LA1A 2YV8A 5A3UA 2XG3A 4I3GA 2RMU2 4R4ZA 4UOJA 3RI8A 1DFQA 1W8FA 3MICA 1UNBA 3SEPA 2CL2A 2JDPA 5FYUA 4UFLA 4BHPA 3VKNA 4D7TA 3IPVA 2R061 2ZPXA 1OPMA 4BMEA 4RHV1 2WQ4A 3HQRA 4Q4X2 4BZ4A 4RGAA 4ASKA 4F8AA 1HQWA 3J9SA 2NN8A 5T5LA 3RMXA 4A42A 5HCHA 3ACIA 2XOMA 5FZMA 4KH9A 4YWAA 1HIXA 2VECA 3HN1A 4QWNA 5EJZB 3RMYA 1K5JA 4RGKA 4MLOA 2R6QA 3M2MA 1NZIA 1GSLA 3VBUA 3GNEA 3WQ0A 3WDYA 5DQ0A 2XLFA 3AXEA 2R063 4IV3A 2VTXA 2VZOA 3VHPA 5JAXA 3I49A 5KXBA 1JHNA 1SBDA 4LBNA 1EYBA 1PGW2 4AVTA 5FO8B 4DY3A 1IQAA 1NE4A 3OF1A 4ASMB 3HT1A 1WW4A 1W9TA 2VMFA 3PLQA 1K5MA 2WINB 3T0DA 3Q8AA 4QT6A 4DRRA 3U4SA 1I6XA 2PHFA 2CDOA 4INDA 1J3PA 4IEYA 4YFWA 3VBOA 1L7LA 4DXSA 2F4PA 5F2SA 2E9QA 2RS12 3AP4A 4N53C 1BYHA 5FTTC 1H2MA 2GSYA 1NCRC 1OLME 1ZRDA 4QX7A 3WQ1A 4FPGA 1YQ6A 5C3SA 2VMEA 3AKRA 3GBFA 3WV6A 4GKXA 1N3OA 4XFCA 1XC6A 3U11A 2GC0A 3NNJA 4HETA 5J37A 3U1XA 3RYKA 1W90A 3ALQA 2VCMA 3KT1A 4IERA 1UXXX 1MPXA 2FDJA 4JTNA 2HYXA 5JIAA 5I0DA 5FWEA 1UMIA 2CU5A 2ZX3A 1S4CA 2AC1A 4BIFA 2X29A 4R9AA 3LOBA 1O3TA 3ZFEA 3VKMA 4IGOA 3S5QA 4IEPA 4OI1A 4QXKA 2DWRA 1VJ2A 5I0UA 3VDBA 4AL9A 5LWBA 2OYZA 4SLIA 1A78A 1WGPA 2GMMA 4AHXA 2AR6A 3WG3A 1ASJ1 3PUHA 2PLV2 2YC2A 2H6CA 2YU1A 1C57A 1NLQA 2B45X 1YFUA 5IT6A 2O14A 4BDVB 1BEV3 4YNIA 1AR71 4ZHNA 2Q30A 3ZFEB 2HWE2 5JCTA 4EYUA 2WO1A 4K20A 2NMNA 4WZCA 5DG1A 5FY9A 1UQXA 1MQTA 1ZNPA 2P3JA 3AMHA 4MGKE 3IBMA 4N90A 5GZGA 5JZGB 1ENQA 2ERFA 3TNQA 3H42B 1RUD2 2P5BA 2ZGKA 3FLTA 3H1MA 5EYYA 3LA7A 2W87A 1JH5A 4FFFA 3ZXEA 1UKGA 4FPJA 2WLPA 3HBKA 3NVCA 4QKBA 2W68A 2XKPA 5F3GA 3RDIA 4CRQA 2HLEA 3WG2A 3A0KA 2OPWA 1HB3A 2VMCA 5LEKA 3H1WA 2ZGMA 1H0BA 3JZVA 5GKAC 4Q1RA 2HEYF 5A3TA 5A7NA 4NAMA 5FZHA 5IAVA 5C9AB 1L7QA 1ND3A 2OXBA 5FIXA 1OD3A 2E31A 4L9BA 2B9UA 1H6YA 5FBJA 1HRI3 1ZZCA 1DYKA 3ZXFA 3ZR5A 4ZY9A 5I91A 5K0UC 4Q4V2 3H8OA 1JI6A 4HVQA 1NXD1 1UIJA 4P9LA 4XFBA 4M4PA 1EAH1 3IDEA 5AC91 1OA3A 1FX5A 3B9CA 4KMQA 4ZS2A 4EN0A 4JKLA 2QQWA 1AR62 5C4WA 3BN6A 1SPPA 3KF3A 5L7OC 3OY8A 2UYAA 3ZIWA 4FPKA 4QD2A 1OD5A 3LDRA 3O1MA 3E6CC 1S1AA 2WWJA 2ZZJA 1O4YA 4XOGA 2SBAA 5C3OA 1FI2A 3U75A 1IKQA 1NCQA 1POV0 1QNWA 1W2TA 2WN3A 1OHFA 3A21A 2XBO3 3NWKA 4JRAA 4PBPA 3ZDSA 4B4RA 3DCQA 5FYHA 4W8JA 2TNFA 3ZYIB 1DG6A 4NWWA 1KJLA 3LIGA 4HVRA 1W06A 1ULPA 4E4SA 4CCEA 4NRMA 5BV6A 5C3RA 5CFCA 2HYKA 1OLQA 4BH9A 3LA2A 5JSOA 1JZ2A 2C1FA 4YW4A 4IEXA 3H9AA 1JUHA 4UYBA 4AQ2A 5BNOB 5A6ZA 5KC6A 3LWCA 5C5UA 2D6PA 4YVSA 4A3XA 1E5SA 3R6SA 3ILFA 5F37A 2GNTA 4HZFA 2NM1A 4PDWC 1LNSA 1CPNA 1UN1A 1ZZ7A 2YUEA 5FLJA 5JZGC 1RUE1 1W2UA 2FD8A 2D3SA 5C8CC 3B9IA 5FPZA 4BQXA 4Z92B 1EV11 2A7AA 1VALA 3EQEA 4QXHA 2PTMA 5HV4A 2HWE3 3OSDA 3RWKX 3ES4A 3VBFA 4O65A 5C8WA 1RVF1 4GWJA 2XB6C 2DTWA 3OYWB 4JGYB 5DAXA 1HXS2 1K45A 2ARCA 1NXMA 3KSCA 4XJ8A 1H4GA 1UYZA 1COV3 4MYEA 4JX0A 3ZDVA 4E2GA 1HV0A 3I2DA 3I2FA 2QDRA 1XE0A 4V2VA 5IVYA 3WCRA 3VGIA 4EN7B 5A33B 5F7UA 2IXKA 2ZHKA 1C8M3 1MACA 4AR2A 1AHSA 1VAKA 1GQHA 4PIZA 3CMGA 4XHBA 4BQ3A 1PNGA 3WP5A 3KLSA 5C9AC 4JGYA 3FLRA 1YRZA 4I3PA 1RL3A 2EIEA 4JGZB 4LO7A 5FZEA 1KEXA 4QQOA 4GIQA 5LBCA 1G9CA 2GC1A 3S6PA 4N43A 2XQRA 1AR73 5DABA 5IVEA 4GALA 2VBPA 4A41A 5DMYA 2VVFA 1J1LA 2XJTA 1D4M2 3PUAA 5JXGA 1U5XA 4CEWA 1PZ7A 1MVQA 1D4M1 3ZN6A 2WNOA 5EYXA 1BEV2 1AR83 1W04A 2RDSA 3ZXJA 3HWJA 4CCDA 1UOBA 1JOBA 4BCUA 1PVC2 3WUDA 1BK1A 1OQ1A 1Q8VA 4NWVA 3VBHA 4LA2A 3OD0A 4IEZA 4A7KA 2D98A 4DZGA 3KT7A 5IK4A 2WA3A 4Y4RA 4KWKA 1ZZ6A 5FZ3A 5T5PA 1QJU2 3TEZA 3NNMA 4CP9B 5L7OB 1JHJA 4XMAA 1IHMA 4QHZA 3ZFGB 5A3WA 3KGZA 4FFGA 3AKTA 4QX1A 2VGDA 2FZ1A 3IDCB 1OOPA 1QJY3 2SLIA 1VRH3 4M0HA 3RPQA 1WD3A 2HEWF 2FDIA 1JS9A 3FL7A 4QPIB 5FBZA 1SBEA 1PIV1 5IUQA 4CPBA 2VVDA 1FV3A 3O14A 3FMGA 4FTEA 4FPLA 2ZEWA 3OGSA 4P9YA 4AK3A 1LAJA 3J7MA 5F32A 3WHTA 5C71A 1N3QA 1H6XA 1UOFA 3WDWA 5CFCC 4LK7A 5FPVA 3LA3A 1DQ0A 2P6HA 4WVVA 2P6CA 3CNAA 1H8TB 4BXFA 1W6QA 5FKBA 1RUE2 3J8F2 3VBUB 5C33A 3UESA 4LHKA 4OQ9A 4XURA 5HI0A 1TEIA 4KBZA 3PUSA 2F4LA 3ZXLA 3AKQA 5FXWA 2B8MA 2RDQA 3P3PA 2I74A 3BYWA 5CIRA 5I8SA 1W9WA 2VW1A 2WLQA 4COUA 5IVJA 4I09A 2F17A 1HB2A 5HPOA 1YO8A 1AZDA 4UFHA 1S0GA 2JDHA 4NOTA 1WBLA 4RQPB 1XYOA 4AEJA 4XUQA 4RR3A 4Y1XA 3ZYFA 2BTVC 2Z2SB 2GU9A 4XUPA 3LE0A 5FK8A 2C9AA 3MHZA 4GAZA 3NKGA 2I2SA 1AXKA 1LOCA 3F95A 5E89A 3SITA 1RJ8A 4D6RA 2R1DA 4RHV3 2ILMA 2UWAA 1LGBA 3APBA 5K0UA 3PTYA 3NJZA 4Z2WA 3HBZA 1IGOA 4P9IA 5AVAA 1XSRA 4S2HA 1RJ7A 4GWIA 1MS5A 1U12A 4COZA 5FOBB 3MLJA 3EO6A 4YVWA 5FZGA 4Z8BA 1R091 1BBT1 4QQHA 4FOVA 1V6IA 1EV13 4AZZA 2D6OX 1AVBA 1XNKA 2IFRA 3DYPA 2WBKA 2XVLA 3N7JA 1FOD3 3ME2A 2WFF3 1LOAA 1LB2A 4BQ2A 3UYJA 4C0HA 4DEVA 1D2SA 2PAEA 5C7GA 1AR93 3PIJA 4NIAA 3VZLA 1A8DA 2ZGRA 3KHCA 3BUCA 2XR4A 3M7AA 3SKJE 2VCBA 3OOXA 4EJRA 1LKNA 2VULA 4UFMA 3PUQA 1LRHA 4IE6A 3RQ0A 1AL22 3CLPA 3T09A 1YI7A 2ZGSA 2HEVF 1PO12 3AKSA 2TEPA 1BVP1 5D1IA 3HVDA 3DPRC 4DUWA 3CU7A 3KHBA 2O1QA 4AEDB 4AHWA 2FDHA 1GICA 3PIGA 3IM0A 2GALA 3ZFEC 1ZRFA 1MQTC 3NAPC 1OMIA 5I0RA 1QOSA 1X7NA 4FPHA 3VL9A 4OLLA 5A7WB 1WZXA 3U37A 2K9ZA 2CNAA 3WP4A 2W39A 3P5BA 1WLCA 1PZ9A 4WM8A 4AGRA 2G4IA 3FC0A 2VZPA 5EPAA 4IL7A 1ND2B 3W20A 2YMZA 1V6JA 1ZZ8A 1OXCA 5ABJC 4BYYA 2WQZC 2HWD2 2ZEXA 3GBWA 5H9RA 1RUH1 3Q8FA 4Q4Y3 1DLCA 4COWA 1DQ2A 2G1MA 3VBFC 2ZAHA 4QKDA 3J4UH 3KV9A 2OQ7A 4WVMB 4YM2A 2HWC2 3I7DA 4Y26A 1XE8A 1GZWB 2ZEYA 2R32A 4YW1A 5JMOA 3OUIA 4Q4Y2 3BVCA 2V5YA 3ZYGA 3VL8A 3KT4A 4FPEA 2FDGA 2ZKLA 5CU1A 4AYUA 1GQGA 3OTFA 4ZONA 3EJKA 1ZBA3 1WCUA 3WZ1A 3HAGA 4AGVA 3VLBB 4GJYA 1VRH2 3UGFA 3ZN4A 3WF1A 4AFAA 5A7SA 4XDOA 3JQXA 2GNBA 4A7YA 3VHOA 3ZR6A 3JQWA 2VJXA 3OJBA 2QQIA 1X9PA 4Y5SA 3AMPA 2JIJA 5DAQA 4YGDA 4EROA 2IC1A 1P8JA 2ZOEB 1W3XA 2J1AA 5E1RA 5FMDA 3T3YA 1DQ6A 2V09A 4Q8LA 5FWJA 3O1SA 4LEJA 1BKZA 4DXZA 1LU1A 3DGTA 2DBIA 1W6OB 3E6DA 2BGOA 4LIUA 1RTVA 3POWA 3CEWA 1GBGA 2XJRA 4XYXA 4B29A 4IV3C 1H9PA 1AUYA 2BVBA 2G19A 2W91A 4MXWA 1VBE3 1RUE3 2OZJA 2Z4FA 1UAIA 2DCZA 2XUEA 2Y6HA 4ZS3A 2AGSA 2XUMA 2V4AA 2R16A 1SCRA 4FPFA 4M3CA 4N8MA 2YPDA 4S2FA 3O1PA 1FNYA 2XJPA 5IFPA 3GZAA 1FOD2 1NCQB 3JD73 2BOJA 1F15A 1OFNA 2VD7A 5IW0A 1WCSA 1US2A 3J7NA 4Q1PA 1AR63 3MIBA 3HJRA 1JUIA 1QNYA 4UW5A 1ZBE2 2BU9A 3VZOA 1S0EA 1UD1A 4L99A 3IZOA 2LW8A 5FY5A 1NCQC 3PUIA 3ACHA 1QJY2 4NHMA 1YC61 3J7LA 4R52A 2DUOA 2ATFA 1AR81 1ZRIA 4RGGA 2XMLA 3INAA 1MR5A 4EWEA 2R0FA 4MOAA 5B2GB 1SQ4A 2DFBA 3ASIA 3OGJA 4TXWA 4CU8A 2YY1A 4CXXA 3V0AB 3CZJA 1C1LA 1HXS3 2QNKA 3THTA 2GZWA 4LJHA 1CIYA 4QDSA 5LRSA 3RFRA 1BBT2 3UGHA 1POQA 3KM5A 2ZGUA 3JXSA 4JV4A 2AH2A 1IG3A 1JXNA 2OPKA 5CZKA 1UX6A 2DCJA 5CVRA 4DMIA 5CISA 2YC4A 3C7OA 2HWD1 4RD7A 1Z7S1 4ITCA 4LLOA 3FJSA 4HG6B 2EXHA 5A33A 3H7YA 3WNPA 1KGYA 4QPGA 5IHRA 1HB4A 3K48A 3VDDB 1ZREA 3HD8B 5AVPA 5JI9A 1QH7A 4X6RB 2QFEA 3FHQA 5DXDA 3T4VA 4AVBA 4EV0A 4M3CE 5BYNA 5J09A 5JR2A 1LODA 3JU9A 1CAWB 4UF0A 2A6VA 1H2LA 4J6GA 5BXXA 4KWJA 2R49A 2VC9A 1HN0A 3WVJA 2RM23 4H14A 2VPVA 4MX3A 5LW9A 3LB9A 1R083 1LOBA 2RR11 3IDAA 3J8F1 1GMMA 1JU4A 4OZXA 4DUXA 3I59A 4OVEA 4QPGB 2Y38A 3PURA 4PIXA 2EIBA 1WD4A 3S7IA 3SXWA 1H4HA 1UX7A 1UY3A 1SLIA 4AVCA 2Q4SA 4A44A 2UY9A 3O0WA 2PAMA 3WF3A 4IEVA 3KVBA 4YYOA 4RN5A 1YFWA 2HBTA 1AR82 4HN0A 3I2HA 4SBVA 3UETA 2WWSA 4QPYA 2GMEA 3ZFGA 1JZ6A 4LKDA 4META 4R9BA 4Q4X3 3RZJA 1ASJ3 4BM8A 4H7MA 1R1A1 3USUB 2QQKA 3H8UA 4JVAA 1GWMA 1R1A3 3JB4C 4CDWA 1SDDB 3EMRA 5CG9A 3ZMOA 4A7ZA 1RUG3 4KQ7A 1HLCA 4QX5A 5JWPA 1MEC2 2C24A 5CA6A 3HOBA 4LIVA 4QPIA 5AFBA 3MZHA 5F8PA 1VRH1 2FDKA 3WINE 5FZLA 3PJYA 1W2NA 3C3VA 4HK8A 4EZHA 1GWKA 1ZZ9A 3HQUA 2QJVA 4X8NA 3B69A 5IJRA 4XJWA 5J36A 2LTNA 2XXZA 2QQNA 1BK0A 2RV9A 3NV1A 3WNXA 4CXYA 3WNNA 2CY6A 5KHIA 4QHBA 2W3JA 5FUPA 1W8OA 2YFUA 3W58A 1COV2 1SLBA 1XNBA 2R043 1RYYA 1LHVA 4FXKB 5F39A 3AP7A 4XTMA 2JICA 1MS3A 1ULEA 1RUH2 1UZZA 3U4XA 2HH9A 2QQLA 4NROA 2VTXJ 1AYN1 1QXPA 2QE3A 5KBFA 1EAH2 3QLQA 5AC92 2IXHA 5BNNA 5FOJB 2JENA 4RSUA 5HBAA 5BNPA 4RR3C 4GMP1 1JYVA 1VPHA 3FX3A 5B4NA 4UW6A 3N4MA 4Z2AA 2GN3A 3GALA 2YBPA 4AFBA 1NY71 1OVSA 5K0UB 3A23A 3VKOA 5LK7B 4Y5Z0 1ZVFA 4BLJA 2QKDA 4YFZA 3WX5A 2BYVE 3OPZA 3WP3A 4CUAA 3IPVB 2PA7A 3VD3A 4IV1C 1F4HA 4OMCA 2ZJCA 3MIDA 2E33A 2C9KA 2DF7A 1PK6A 1W6NB 4Q0SA 3D3AA 5CB7A 5LK5A 2EAKA 1HXS1 2WZEA 1YNAA 3BODA 2W46A 1SFPA 3E97A 3Q8CA 3OB8A 1RC6A 1HRV1 1UY0A 2NQYA 3PTRB 2Q8EA 2ZGPA 4QPWA 4QHOA 2JWPA 1O5UA 1O4TA 1RUJ3 3AZWA 3CJIB 4DEQA 5JXJA 2VZRA 3O1VA 1QJFA 3SNMA 1ZRRA 2R041 3GYDA 3FE5A 3AX4A 3LPGA 4LO5B 1K12A 4LITA 2ZHMA 1X36A 3LFIA 2YZ4A 4HLTA 1LECA 4G3YC 2WO7A 4UBHA 4HK9A 2BPA2 2ZGLA 3M3OA 5BNOC 1W6NA 3ACFA 2WKKA 4EWDA 1TME3 3OEBA 1DGLA 4UWDA 4LBKA 1DQ4A 1J84A 4RS5A 2D6NA 3SCGA 2VCAA 2RG4A 3MBWA 5AFEA 3AL5A 2IWGB 2W95A 3NAPA 3NSTA 4AI8A 3M3QA 4S2GA 4BQ1A 5BNQA 1OPOA 2VBDA 4Y5TA 3RG0A 1VBC2 2GNDA 5E88A 5IAXA 3EXUA 2RMU3 4AHZA 4QXBA 4D3WA 3V0BA 3CJXA 4ZZ8A 2WAOA 3PDQA 5F1RA 1GFF2 1PO22 1FPN2 1MEC3 2Y26A 3H50A 1X33A 5FXVA 3U07A 1QKQA 2JDYA 3VDAA 3RSJA 3AMNA 2HWF2 4WM8B 1VBD1 5IK8A 4A6OA 3NL1A 1GZWA 2R7EB 3I3DA 1LOFC 3VDDC 4NVPA 3E5QA 1G7YA 3ZOIA 4JDOA 4DQAA 2JDAA 4OUEA 2F6BA 3WF2A 1ULCA 4XE9A 1LOFA 4BOWA 3MI8A 1TG7A 1I5ZA 3TAYA 5T52A 4YRDA 3FHAA 1A8MA 5FAXA 3ZXDA 5C70A 2E53A 2PYTA 1FYUA 2WJSA 4DXRA 5L36A 1GNZA 1JYCA 3IMMA 1XU1A 5FZ6A 3N7LA 2P4EA 3UKVA 3CDZB 1AYM2 4CCCA 4BQWA 2JJ6A 3NRUA 2YFZA 4I0BA 3WY6A 1KJRA 4NUBA 5JPNB 4I0WB 1QOTA 3FZ3A 1VBC3 1J59A 1EUTA 1PM7A 3ECQA 2Y60A 4LR4A 2AYHA 1HQNA 2W94A 5HCAA 1NOVA 3H1YA 2XJQA 3LGRA 3B01A 4CDQB 1ZA7A 4JC1A 1EPWA 4LBLA 3D82A 5GLVA 3BGAA 1YJLA 3WG1A 3MLLA 5FZAA 5C9AA 4CSWA 1S0IA 4LA3A 1QU0A 2R1BA 1UOGA 4MGQA 2VUJA 2BWCA 3MGUA 5CADA 4XF9A 3ZVXA 2ZS6B 3C7FA 4GH4B 3T4HB 3KCCA 2XH6A 1V6MA 4NJ4A 1GU3A 2P34A 1Y9GA 3S0MA 3SKVA 4FAHA 2G9FA 1UYPA 2WSUA 4K21A 4KU7A 5G04L 3ZSKA 3UJQA 5A32A 2CGPA 2KR2A 1QJZA 3P6BA 3QBQA 5CKQA 4ZZ5A 1BHGA 2AENA 3IIIA 5D21A
chains in the Genus database with same CATH topology
4XQ4A 1LEDA 3WCSA 1ALYA 1S0DA 3MW4A 1JOJA 1WW6A 1CAVA 3R4UA 3NV4A 2GH8A 3JBG1 3TN92 4XPVA 1LHWA 2ZGNA 1Q8QA 2GAUA 2XKOA 4COYA 1RUI3 5A32B 4K6BA 3USSA 5C4WB 1GANA 3AZYA 4K8FA 3FWEA 4C0BA 5H9PA 1LJ7A 5CFCB 1DQ1A 4S2DA 2IXLA 4P14A 3WHUA 4LE4A 1WMEA 2X5IB 2ZA9A 3MF6A 3DL3A 3AJZA 2EA7A 1HKDA 1RHI1 5FREA 3S7EA 3ZXAC 3DUIA 5FMOS 1CJPA 1V9U1 1V6KA 4L97A 3WDVA 2WZPP 2RJLA 2CV6A 4MUVA 4E4ZA 1BMV2 1REEA 3M4FA 5KHJA 3D0SA 1G8WA 4GWMA 1GZ9A 4WM7C 4ZU7A 5JMCA 5CG8A 4XXPA 4IQPA 1F5JA 2RS53 2YDEA 3PVBB 1NA1A 4OUMA 5K8SA 1XYNA 1LGCA 1O3QA 2JEMA 3N3HA 1G9AA 3VDDA 2YYOA 3MIFA 1VLNA 4RQPA 1LULA 1CAWA 1N1SA 1G86A 1REFA 5EFUA 4DINB 2WS93 2E7QA 2H6BA 1J3QA 1SLCA 4QGNA 3D4KA 2NP0A 2WNVA 2DVAA 2ZABA 4HPKB 4I02A 4MZUA 1RUD1 2NLRA 2H0VA 2XWJB 1S0BA 4L2NA 2ZGQA 1KQRA 4PCRA 3H3UA 2VUAA 3WLUA 1LENA 4QQ2A 3QOPA 4XZPA 4KG0A 4Y20B 3USUA 3JCIA 4CDUA 1GZCA 1RUI1 1KDKA 4HKLA 3K51A 2NPIA 4QU2A 3ZXGA 2GC2A 1SLAA 1TQ5A 1XRUA 1URXA 1UZYA 3JD71 1AXZA 2D40A 4P9GA 1TE1B 5E16A 3URFA 1PIV3 1YWKA 2PHLA 2DU1A 1VBE2 2YGMA 5EXOA 4XHXA 4YVSC 4OI0A 4XXAA 4N43B 3MW2A 2A73B 4OI4A 2UY8A 1UPSA 2DVFA 2Y0OA 2O8QA 3CO2A 5K9YA 1MZ6A 5FMOL 1FMD1 1G9DA 2D43A 1U5YA 4QPIC 1F2NA 5T3NA 2XVGA 4HSLA 3KB5A 1D4VB 2DUQA 4D69A 1NY72 5GLZA 1RMU1 3MFAA 3WP6A 4Y1ZA 2D44A 2ET7A 1NZCA 3J8F3 4C1WA 1IS3A 3E6BA 1V9U2 3ZYPA 2NMOA 4IESA 3THPA 4O9EA 4DPNA 1RUF1 4NN0A 3IMNA 2JKBA 4YARA 2ZHLA 1QDOA 4XBLA 1H8TA 1MS4A 2CGOA 1UIKA 4Q0UA 3J26N 4YG3A 1CAUA 2Q8OA 4RL7A 1QDCA 1R081 2RR13 4BA6A 5I93A 3VBSB 1ND3C 1R1ZA 3E5XA 1PVC1 1V6NA 1W6QB 4ZU5A 3JD72 1CIWA 3VKLA 2EXJA 2ZTNA 4W65A 4DB5A 4Y1UA 2HWC3 1RUI2 1KDMA 2ZMNA 3P3NA 1IPJA 4Q4W2 2PQQA 1MZEA 4XJZA 1BZWA 5FPXA 1WW5A 2JG8C 2WNUA 4AG4A 3WD5A 1ULDA 1V6LA 4GH4C 1KRIA 3HR9A 1UMZA 4EN9B 1YFYA 3SHRA 5KHHA 4Q4V1 1W6PA 4FBFA 3BOPA 1L3JA 4B4QA 2MPFA 3B7MA 3LCPA 3OBTA 2VNOA 5CAZA 1BJQA 1PVXA 2UWBA 4CEYA 1PGL1 4AQTA 1CJDA 3DV8A 2X53S 3RJ2X 3ACLA 4LUKA 1H8VA 1WUVA 3FFQA 4FOYA 4M0NA 2CWSA 1LHUA 4CEYC 1K5MB 3ZN5A 1W6MB 2DVGA 1S55A 4FSJA 1ENXA 1ZM1A 1XXNA 1CPMA 2EVXA 2PLV3 3DPRA 3I4IA 2HWB2 1YJKA 3VBOB 2WC2A 3DKWA 3KD4A 1FATA 3BALA 5F6LB 2C0ZA 1R082 5ABJB 1YFXA 4LBMA 2HWB3 1ND2C 2WNEA 4HFSA 4PJYA 3UKNA 4PLOA 5JR7B 3VHRA 3WW2A 3SLIA 2BNMA 1XYPA 4KWLA 4B3NA 2ZKNA 3N36A 4WBBA 2WFF1 1ULGA 2K2SA 3WDXA 4AHYA 1PVC3 4Y22A 4ISQA 5CFDC 3WT3A 1RUF2 2D93A 1F31A 1LR5A 5FO9B 2FHRA 2QZ3A 4AI0A 2W08A 4YW3A 1ZBA1 4LE3A 1HRV3 1CD3G 2QZ2A 5GALA 2A75A 4KGQA 3ZIXA 1IS6A 4PLNA 3VBRA 1C4RA 5JPMB 2PHXA 4FAGA 1U5ZA 1J3RA 1DGRA 4GB31 1CAXA 1C5IA 3IN9A 3O0XA 4JGZA 3UV9A 4PF5A 2WFF2 1C1FA 2P3KA 5JZGA 5JVVA 4JRLA 2JG8B 4FOWA 2DCTA 3L2HA 4LTAA 1BVVA 4LHLA 4ORFA 3ZFFA 1QJX1 1WMDA 3B00A 4M01A 3OGGA 1IOAA 3H3ZA 4V1PA 2JD4A 3ZFGC 4DNYA 4YZ2A 3V65A 3A4UA 1HQLA 4L92A 2G9GA 2UURA 3BCWA 5ACA2 1ND3B 1YIPA 2K0GA 3D8CA 3BOWA 3JUUA 5DZGA 5C4WC 2BFUL 2JG9C 3B02A 3LSEA 3VZMA 3BU7A 3ATGA 4YG0A 1POV1 1LGNA 2AREA 4OFGA 4RFT0 4D94A 4FTBA 4KGGA 3HMYA 4XDQA 4E9KA 4M3CB 1KS4A 5J48A 1B35B 3O0VA 1OA2A 1MEC1 3L9JT 4YM3A 1RINA 3MFCA 3ES1A 4Q4X1 1Z7S2 3VBSC 3FBYA 4YLZA 4JQRA 1QQP3 5J7MA 4XF4A 1X50A 2DYCA 4D7YA 4Q4W1 1F9KA 4HVOA 1RUD3 4HKOA 1TNFA 1JYIA 4IEOA 5FLIA 1B35A 2DV9A 4WM7A 4DOUA 2A5ZA 2VW2A 4LBQD 2Q1ZB 1PHMA 2P37A 2RM21 2WNVC 2DVBA 2MEV3 1UU5A 3MPPG 1PO23 2E63A 4ATFA 3NV2A 1JN2P 2VMGA 1VB2A 2MNGA 1Z0HA 4AQSA 1LOGA 2IXIA 1SLLA 4XTPA 3WXPA 4BIOA 4CDQC 2CGNA 1Y9QA 4CTEA 5JOWA 3N7KA 1AYM3 1DIWA 5L73A 2E6VA 2EXIA 1AYM1 3BIWE 4WM7B 1RGSA 2BBVA 1TME2 1H9WA 1Y7BA 1KD7A 4TLFA 1H2KA 2IFWA 5LRRA 3PHMA 1RHI3 4Y20A 4XFIA 4L8QA 3M8LA 4QPGC 2VXRA 1BMV1 3JBG2 3I59B 1HRV2 5H9SA 3WW1A 2BUKA 1BQPA 2ARXA 4K40A 2WIIB 4BWOA 2QVSB 1NCRB 2EAAA 3VBOC 4KBBA 1R092 3KGLA 4HL0A 3NO8A 2A6WA 3RNSA 3SCHA 1HX6A 3KZ4C 4HSJA 3RYPA 2P17A 2A3XA 2WT2A 1LCLA 3V0BB 4B7EA 2R041 1CONA 1MQTB 1J58A 1D0GA 1RUG1 2D5FA 2EIGA 2PHUA 4C1XA 1VBE1 3ZXKA 3AXDA 1QJX3 3WUCA 4FPYA 1S2BA 3W9AA 5FLHA 1QJY1 2JECA 1HV1A 2X8KA 5A3MA 1AYN2 4F7ZA 5CFDA 1MS8A 2UU8A 1ULFA 2PHWA 3GZUC 2A6YA 1NLSA 2IXCA 4AFCA 2ETEA 4AI2A 5A3LA 3RZZA 5GZFA 3MIHA 4D7SA 1WCDJ 1V6OA 3VV1A 1X82A 2PHDA 5DZEA 2XJSA 1CAUB 4XJUA 2X5IC 4C91A 4XIKA 1XQNA 4XETA 4FPCA 2CTVA 3AFKA 2AUYA 4PLMA 2GNMA 4E4DX 1TMF2 1OOPB 4XF3A 4AWDA 3TNPB 4MGYE 2OW4A 1HRI1 1QXRA 1UPIA 1VBA1 2EALA 2YC0A 3CF6E 1EY2A 2E7TA 4R4XA 4LT5A 4XBNA 4PQ9A 1I3HA 2RS52 4JDMA 1W0OA 4FTSA 4H55A 3R05A 1YUDA 1AXYA 4NHLA 2PFWA 2FZ2A 2H0BA 4GH4A 3ZPYA 4CDXB 2YXSA 2DVDA 4IETA 1DGRN 5GLTA 2VW0A 4OUSA 3AYDA 2DUPA 1N1VA 4QM8A 3KCYA 2VG9A 1DBNA 4GQ7A 1O5LA 1C8M1 2ZGTA 3CJIA 4BMBA 2PN5A 4I01A 4K9SA 1RUC1 1W6PB 1DGWA 3QH6A 2VOWA 1UU6A 4CEWC 3D6EA 1AJOA 1CAVB 2HWD3 1FPN1 2RE9A 3RJRA 4CEYB 1PK6B 1QH6A 1SCSA 2BNNA 1K5MC 1QJU3 4LBJA 5HXVA 1MVEA 1N1YA 2WZR1 4B4PA 1VBD3 2ZX2A 4Y24A 4PBOA 4N43C 1W6MA 3V56A 3KQRA 1YIFA 1DDLA 2XHKA 2ZMLA 4Q0VA 4K7JA 3PJQA 4XF0A 3OYWA 5JOXA 1M06G 2ZACA 1ZBE1 3FUQA 5KXEA 1B35C 2Z42A 1R1A2 2HWC1 1RUOA 3W59A 4G4FA 4QQLA 2WZR3 4PDWB 3ENRA 5SV5A 4RS5B 1IS5A 1EAH3 5AC93 4OHZA 5D8AA 2WS92 3X29B 2ENRA 1BBT3 2JE9A 1DQ5A 4F83A 3NV3A 1Y3TA 2GN7A 1YYNA 1NA1B 1POV3 4Q4V3 3UK9A 4LHNA 1Q8SA 2D6LX 4HN1A 4AI1A 5JOZA 3IKWA 2BVVA 3SISA 4ES9A 2QUOA 1VP6A 4UW4A 1VR3A 3TWIA 1JW6A 5JLVA 4A2UA 4F3JA 1VBA3 2ZX1A 3BPZA 4KU8A 4FO9A 1VBB1 4IXLA 3O7OA 1RITA 4HPKA 1DZRA 4IEUA 1J1TA 1VIWB 2PHRA 1C5HA 3ZN6B 2RHPA 1VBC1 1O7FA 1ZZBA 3WOGA 4UXAA 4NPRA 2VNRA 2R042 2WZR2 1S0JA 1V70A 2PELA 4JCKA 4IV1A 2D6MA 5TSWA 1IKPA 1BEV1 4AEKA 5T5OA 2NZ9A 3ETQA 1I1EA 1G9BA 3ZSEA 1C8M2 1QOOA 4CDQA 5K7PA 1AR92 3OY8B 4ISRA 4XW3A 1QHDA 4Z1VA 2N7GA 3B5LB 1FMD3 1YI9A 3UJOA 4QQPA 1CQ9A 4K1YA 2WNUC 4MH0E 2A6XA 5GLUA 3ZO0B 3CJIC 5E8AA 1KXGA 2XVKA 4NR1A 1FT9A 3QACA 1N47A 2JDZA 2R0HA 3VBHC 4Z82A 1ZRCA 2V73A 4YZ1A 1GKBA 1WMFA 2MEV2 1CN1A 2OIIA 2A6ZA 3NKTA 4XIOA 4AEMA 4FXGB 2E51A 4Q0QA 4Y4YA 1RB8G 2Q1MA 2WSVA 4U2AA 4AE2A 1OOPC 4NO4A 4E2QA 1QWRA 3EHKA 1QJU1 4DFSA 4P5HA 4WM8C 4GKYA 1OKQA 2JG9B 1TNRA 4RR3B 3SH5A 3KS7A 2NYYA 2WS91 1RHI2 3PVNA 1LU2A 3OBRA 4GWNA 4R9CA 3R4SA 4I0AA 1UF2C 3AMQA 4W6YA 1NA1C 5DZFA 1VBD2 1TMF3 5BNPB 1AR72 4I30A 1Q3EA 3ZX7A 2D3PA 2XLGA 1PO21 5CNAA 3MLKA 4Q0PA 2AZ5A 1CGPA 2IZWA 5JI7A 5T5JA 2Q5TA 3V0AA 1Q5OA 5FO7B 1AL23 1VBB3 1HDKA 4OHYA 4NHKA 3ZSMA 1AF9A 5KXDA 1APNA 4FQZA 1Z78A 5FRAA 5GLWA 5EV7A 3ZFFC 3VUOA 2WA4A 3O5SA 4LO4B 3AKPA 3LSDA 2RS31 2A70A 3WW4A 1COV1 4MGIE 2TBVA 4C90A 1OQDA 2FQPA 2GC3A 4JGZC 4MXVA 2CYFA 1Y43B 4XBQA 5JSPA 4OHVA 1C3HA 3OCPA 2VOVA 5LEJA 1GYKA 3LAGA 1OLRA 2ZCWA 4N53A 4X6QB 3FLPA 4GMP3 4TSVA 4E2SA 4GULA 2R071 4N7IA 1ND2A 5DDJ2 2XJUA 2Y0IA 2RS13 1VBB2 1LOEA 3RWNA 2YHJA 1O91A 3IDBB 2YROA 4AEDC 4CDUB 1XE7A 4YM0A 1FAYA 3DPRB 2ZBJA 3OD4A 5ACA3 1DZTA 4K1ZA 1RUF3 5CFDB 1N3PA 3QH7A 5DUWA 4MV2A 1GR3A 3RS6A 1FPN3 5I0SA 5ABJA 3MYXA 4XQWA 5C8CB 1AX2A 4MGZE 1LHNA 4QGMA 4HMZA 2OA2A 4M3CF 1IPKA 1UW8A 4XFGA 4CYDA 4AF9A 2ZX0A 4LNVA 4AVSA 4FPOB 4ZKTB 1I9RA 2XBO1 4ASLA 1GLHA 4Y22B 2DURA 4YGEA 3HIFA 2WT0A 5BY5A 2R062 4DS0A 1LEMA 5FQ0A 2HWF1 3MDPA 1SBFA 2ZGOA 4TWTA 2OVUA 1Q56A 1DHKB 4YW2A 3AFGA 1YLLA 4LLFA 1OQEA 1REDA 3U10A 2XPJA 4WVWA 3TOJA 4AVAA 4JDNA 2VQAA 3VBSA 2D5HA 2XL9A 2GMPA 4CDXC 4ONUA 4H3WA 2B5HA 4Q4Y1 1NG0A 4EN8B 1PO11 2WT1A 4GB33 4UW3A 2OUJA 2RS51 1RVF3 5KXCA 2MEV1 3EBRA 1Z7S3 2LALA 4J1WA 5DDJ1 4IV3B 1NQJA 3MIGA 5J98B 1PGL2 4ZXKA 1N1TA 1GNHA 4OHWA 2XBO2 1RVF2 3RYRA 4FQ4A 4Q8KA 1H1AA 4YVWB 1ZX5A 4GMP0 1EV12 4B8EA 4CP1A 1IS4A 3LKJA 4FT8A 5BNOA 2GH2A 1TME1 2HWE1 2WFPA 4CZSA 4R9DA 1VB4A 3GZTB 4AQ6A 5T55A 4AFDA 3VZNA 4QMAA 2BQPA 4PDWA 1HRI2 5T50A 1DF0A 3WQ7A 3ST7A 2DU0A 4P9XA 3WDTA 1FOD1 5BNNC 3G6JB 4IEWA 1KFUL 2RM22 2ZAAA 2DCYA 2R073 3AZZA 2BWAA 3AZXA 3DF0A 1ENSA 1V00A 1AR91 1ZYBA 5GM0A 1B09A 4MSVA 4YG6A 1LHOA 3AP9A 1YHFA 4URTA 5IK7A 1AL0G 3E5UA 2CAUA 4Q27A 3SMHA 1RUC2 1CVNA 3GHMA 4UBGA 3NAPB 1E57A 2D3RA 3B93A 3D0JA 3SH3A 1S2KA 2LUWA 4N7UA 1H2NA 5SV8A 3JBG3 2D97A 4WZFA 4AGGA 1DZQA 4FP2A 4CP2A 2YPJA 3R0RA 3M70A 5IK5A 3AP5A 1VBA2 1AYN3 3ZYJB 2IXJA 4MVTA 1AJKA 4N9HA 3B94A 4LBQA 2FMYA 3M3EA 4GA9A 2BW8A 4BPZA 4Z07A 5JDBA 3KMHA 3POYA 4AXOA 2QCSB 1EPZA 1SDWA 3TYJA 3N7MA 4LO8A 2VOXA 3IIAA 1HW5A 1RUH3 3ZFFB 4MXWB 5KC5A 4RHV2 2WL1A 3VBRB 4QM9A 3S30A 2XGXA 5KHKA 4YZ5A 1FV2A 1CAXB 4RQPC 4YM1A 4LBQB 1X8EA 4HKWA 3H7JA 4J1XA 4QGLA 3T2TA 4P9JA 3ELNA 4DY5A 3N35A 2LM3A 2JXAA 2BNOA 4CDWC 4OI2A 4OHXA 4U36A 4FOQA 1WA4A 5BNNB 2I07B 1RUG2 2XJVA 2Z5WA 2BGCA 1KFXL 1QF3A 3RRDA 4W6WA 3IT8A 1QXJA 2D6KA 5C6CA 2QDNA 3LZZA 4JTOA 2DCKA 3LOIA 4YVWC 2JG9A 4N9IA 1G6NA 1BXHA 1DLLA 5GZDA 5I0TA 3PVOA 5BNPC 4RS5C 4YW5A 1WBFA 2VMHA 2RS11 1LTEA 1WW7A 1XNCA 4FCAA 1T6GC 2B39A 4HBNA 1G9FA 4I2OA 1U0AA 3NW4A 2P2KA 3RI9A 3DN7A 3ZYRA 1UCXA 4YGCA 2HKXA 4RA0A 1CR7A 4XMIA 1A3KA 2FMDA 1AL21 4XFFA 3TN93 3BTAA 3AM2A 5DUVA 3SCFA 1R093 1MS1A 4X8PA 2VOKA 2R072 3H0OA 4XFAA 5GJ6A 5J96B 2Z79A 5HCFA 5I8YA 3M1HA 1TMF1 4LULA 2R30A 2EF6A 3AYCA 1RIRA 3VZKA 4Q29A 1MS9A 1ZA4A 5BPXA 2E7AA 2XL7A 2UWCA 3FFZA 1PMIA 3B3QE 3AB0A 1KS5A 3VHNA 3T1LA 4KNCA 4AW7A 2VNGA 2RS32 4ZU4A 3M3IA 1H30A 4B7KA 5CBLA 2GDFA 3AYAA 1OFSA 1FNZA 1NCRA 4LBOA 4WVZA 2ZMKA 2ZHNA 4EWAA 1RMU3 2Z69A 4GXLA 1SEFA 2B7YA 4W6XA 3TB0A 1UL9A 4CDUC 5EJ3A 4ATEA 3WR0A 5C8CA 1OI6A 1QQP1 1BCXA 3AJYA 4PIYA 4XEZA 4CDWB 1AX1A 1MZ5A 1RMU2 2QQPA 3VBHB 1V9U3 1SLTA 1NE6A 5DUUA 5GZEA 5H9QA 5I8TA 2RJKA 5L7OA 2XLAA 1O3RA 1D4M3 2EXKA 3AMMA 3GF6A 5FQ0B 3WDUA 4AI3A 5JIUA 2ZX4A 1QMJA 3AYEA 1OA4A 2TUNA 4TYSA 2O0OA 2ARBA 5D8AC 1YXWA 1AR61 3ILRA 1WCKA 2DFCA 3POSA 5KHGA 3PNAA 1SFYA 4HT1T 4JGYC 1JBCA 1UKRA 2D7FA 2BFUS 4WVMA 4KL1A 1H1IA 1S0FA 5F5QA 4Y1VA 2B42B 2O8OA 3QCWA 1CESA 3WW3A 1C28A 4XJAA 4GB32 1PIV2 3VN4A 3WG4A 3TBDA 5F9TA 3UL2A 4KG8A 1ASJ2 4TZDA 3GHNA 3VKFC 1Q8OA 1D0HA 2A3YA 1O4ZA 1ZBA2 1FXZA 1XU2A 1Q8PA 3HT2A 4CDXA 2W52A 3M3CA 3KCXA 3U0ZA 1VAVA 5F6KA 2JG8A 2OUHA 3VZJA 4H7LA 1F5FA 2CWMA 2W0XA 5EWSA 1W39A 5EZWA 2HWF3 2RMU1 2VMIA 1M4WA 1LESA 2VH9A 3Q9OA 4XILA 2PLV1 1PZ8A 1C8NA 2X5IA 3C2UA 2JE7A 2Q0AA 1OSGA 4ES8A 4YGBA 5DG2A 1WLWA 4Q2FA 4O9GA 4HANA 4JAAA 5T54A 2HWB1 3D5OA 3UKTA 2PHTA 3A0NA 2KA3A 4G9SB 2OZ6A 4COVA 3ROUA 1ONAA 1QGLA 2WNUB 3ILNA 5ACA1 1RUC3 3O12A 1JTZX 3MF9A 1ZBE3 1CX4A 4XF1A 2CAVA 4DRVA 1IZ3A 1SFNA 4WV8A 4AEDA 1WLDA 2ZZQA 2BEOA 4YVSB 5JSRA 2ES3A 2DTYA 3AP6A 5D8AB 1QJX2 2WNVB 4CP0A 4LUMA 3ZSJA 4IEQA 4XFHA 3VBUC 3T1MA 3PMEA 1Q43A 3PMSA 2C5DA 4E27A 1FMD2 1H8TC 2KM2A 5FFOC 3HQXA 4YZ3A 2RS33 3I54A 5KWRA 2XWBB 3FBMA 1WLTA 3MEPA 2ET1A 1PNFA 1GV9A 1W0PA 1RUJ1 1D2QA 3MIEA