1ZBA1

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
191
Chain Sequence
TTTTGESADPVTTTVENYGGDTQVQRRHHTDVGFIMDRFVKINSLSPTHVIDLMQTHKHGIVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKAPFTRLALPYTAPHRVLATVYDGTNKYSTQLPASFNYGAIQAQAIHELLVRMKRAELYCPRPLLAIKVTSQDRYKQKIIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
total genus 36
structure length 191
sequence length 208
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba100
2R063 3CJIB 1C8M2 2MEV3 2WZR1 4YVSB 1PIV3 4CDQB 3VBSB 5CFCC 2WLPA 1QQP2 1AL21 2WFF1 5A32A 1QJX3 2RR12 1K5MB 2R073 2RS51 2RS33 2WZR2 4N43C 1RUC2 4RR3C 1AL22 3VDDA 2RMU3 1Z7S1 4IV1C 4IV3C 1R1A2 1HXS1 5GKAC 3VBOA 2XPJA 4EJRA 1RMU2 1Z7S2 2Y26A 4GB33 4RFT0 1ZBA3 5L7OB 5C8CA 1AYN2 5AC92 1SMVA 1QJU2 1EV13 1OHFA 1PO13 2HWC3 1NCQA 1DDLA 3VBHC 1MQTB 1HRV1 4CDXA 3DPRA 4QPGC 1RVF2 1ND2A 1ND3B 5BNPB 1AR93 1HRV2 1FOD1 4RQPB 4RS5C 5A33A 1POV0 1H8TC 4CEYC 1RUI1 5BNNB 4CEWA 1FOD2 2ZZQA 1VBC2 1RUE1 1R083 2R061 2MEV1 4CDWB 1PIV1 5ACA3 2WS91 5CFCB 1RUE2 4FTEA 3J8F3 1COV3 1TMF1 1VBA2 2R071 2RS31 4WM7C 1FMD2 4WM8A 1TME1 5C9AA 1HRI2 2WS92 4AEDC 2RMU1 1VBE2 4IV3B 1TMF2 1X36A 5D8AA 3ZFGB 1TME2 5CFDB 2RS12 1AR63 1ASJ2 2PLV3 1ZBE3 3ZFEA 1AR83 4GB31 4CDUC 1ZBA1 1VRH2 1GFF2 2HWC1 3JBG3 1RUG2 1WCDJ 4YVSA 3DPRB 1R093 3VBSA 4CDQA 3JD71 3VBHB 3JB8A 4QPGB 4RHV3 3JD72 2HWF3 1EAH3 4YVWC 1NG0A 4RS5B 4CEYB 1PO22 5J96B 3NAPB 2RM22 1R081 1D4M2 4N53B 5L7OA 4GMP1 2ZAHA 5ACA1 2HWE3 1QJY3 1R082 3J8F1 1COV1 1PGL1 1FPN2 5D8AB 4WM7B 2XBO3 1F8VA 4AEDB 1MQTA 2GH8A 3VBFC 1QJZA 1OOPC 1VBD3 4JGZC 3JB4C 1VBB3 1RUJ3 1ND3A 4QPIC 1BMV2 2PLV1 4RQPA 1ZBE1 1AR81 4CDUB 1X33A 2BFUS 3IDEA 1RHI1 5BNNA 5DDJ3 4JGYB 2BBVA 4Q4V3 2DF7A 1RHI2 3JBG1 4SBVA 4CDWA 1RUH1 4GH4C 1R091 5CFCA 1AR73 2WFF2 1VB2A 1AYM3 2X5IC 1RUH2 3ZXAC 4RHV1 4N43A 2RS52 2HWF1 1EAH1 4FSJA 1BEV3 4IV1A 4IV3A 1V9U3 5C4WB 4PDWC 3ZFGA 1HXS2 5CFDA 2HWB1 1A6CA 2HWB2 5ABJB 1QJY1 1C8NA 1NOVA 2BFUL 2XBO1 3S6PA 1F2NA 3VBHA 2XBO2 1VBD1 4JGZB 1MEC3 4QPGA 5JZGC 1B35C 1RUJ1 4QPIB 1POV1 4RS5A 5K0UC 1RUF3 1NCRB 4CEYA 5FMOS 3TN93 1RUI2 3NAPA 3ZFFC 4CDXC 5FOJB 5DDJ1 4Y4YA 2R062 4Q4V1 2BUKA 4N53A 2MEV2 1QJX1 4GH4B 4FTBA 1NA1C 1PIV2 4N43B 1AR71 4RR3B 2HWD3 4IV1B 1QJX2 4WM7A 2R072 1PVC3 2RS32 5BNOC 4AEDA 2RMU2 1V9U1 4Q4Y3 4PDWB 3LOBA 1RUD3 4Z92B 4Q4W3 4CDUA 4GB32 1ZBA2 1PGW1 1EV11 1PO11 5FMOL 2R043 4Q4X3 4JGYA 1AUYA 3ZFEC 1M06G 1EV12 1PO12 2HWC2 2WWSA 4NWVA 1C8M3 1AR91 2VQ0A 5JZGB 1B35B 1H8TB 1QQP3 3CJIC 1AR92 2RR13 1RUF1 5C4WA 1RUC3 4CDQC 1AL23 3TN91 3VBRC 1R1A3 1K5MC 1RMU3 1BBT3 5ABJA 5ACA2 1IHMA 2HWD1 3J8F2 1COV2 1AYN3 1PGL2 3VBUC 5AC93 1PVC1 5BNOB 1AR61 1QJU3 5L7OC 4Q4Y1 3VBFA 1OOPA 4JGZA 1AR62 4QPIA 1RUD1 1HX6A 2PLV2 1HQNA 1ZBE2 4Q4W1 1AR82 1NCRA 5LK7B 1RVF3 1MQTC 1NY71 1HRV3 1W39A 2R041 4Q4X1 1ND3C 5BNPC 4RQPC 4GH4A 3JBG2 4BCUA 1VBC3 1R092 4RR3A 4YVWB 1RUE3 1QQP1 4RHV2 1CD3G 2HWF2 1EAH2 1VBA3 2RR11 4CDWC 1FMD3 1RUC1 4NWWA 1HRI3 4PDWA 2WS93 3VDDC 1VBE3 3VBRB 1R1A1 1TMF3 1TME3 2HWE1 3VBOC 2RS13 1ASJ3 1RMU1 1BBT1 2GSYA 3ZFGC 2HWE2 5CFDC 1QJY2 1AYN1 5C8CC 3VBUB 5AC91 1BBT2 1VRH3 3VBFB 1OOPB 1VBB1 1QJU1 1RUG3 5JZGA 1VBD2 1B35A 1H8TA 1NCQC 1VBB2 2FZ1A 1RUJ2 5K0UA 1AL0G 3DPRC 1RVF1 3FBMA 3JD73 1ND2C 3ZFFA 5DDJ2 1PO23 2FZ2A 2RM23 4Q4V2 1AYM1 4Y5Z0 4CEWC 2X5IB 1VBC1 1NA1A 2IZWA 1D4M3 1AR72 1BEV1 3NAPC 1AYM2 5BNOA 1VBA1 4N53C 5A32B 1BEV2 1FPN3 1FMD1 1V9U2 4GMP3 1HRI1 5C9AC 4WM8C 4FTSA 2ZTNA 1VBE1 3VDDB 5D8AC 1E57A 3VBOB 2RS11 1ASJ1 1VAKA 3HAGA 1PGW2 2QQPA 5C8CB 1VRH1 1MEC1 1RHI3 4YVWA 1RUG1 1OPOA 5K0UB 2BPA2 2WZR3 4YVSC 1MEC2 1NCQB 4JGYC 3VBSC 3CJIA 2TBVA 2WFF3 3ZFFB 4CDXB 1RUH3 1RUF2 2RS53 1ND2B 3VBRA 3TN92 1Z7S3 1K5MA 5A33B 1NA1B 1HXS3 1PO21 1VB4A 2RM21 4CEWB 4LLFA 5C4WC 1D4M1 2HWB3 2HWD2 3VBUA 1PVC2 4GMP0 1FPN1 5ABJC 5C9AB 4Q4Y2 4WM8B 1RB8G 1RUD2 4Q4W2 1BMV1 1NY72 1FOD3 5J98B 3ZFEB 2R042 4Q4X2 1C8M1 5BNPA 1POV3 1RUI3 5BNNC 2X5IA 1NCRC 3M8LA 1CJDA
chains in the Genus database with same CATH superfamily
3AZWA 4A3XA 1H1MA 4UYBA 3JUUA 3HQXA 4QQHA 1V6NA 4YVSB 5JPMB 4MLOA 3VZNA 4CP2A 4AI2A 3KF3A 1F5JA 1QQP2 2WLPA 2WFF1 1QJX3 4KWLA 1S1AA 2VO5A 4YZ3A 3WCSA 2WZR2 2QBXA 2RS33 4SLIA 1HV1A 4RR3C 4QHOA 1AL22 1CONA 5IJRA 2RMU3 4GAZA 4UOJA 4IE7A 1ZM1A 5FZLA 3PTYA 4FPYA 4L2NA 2XWBB 5GKAC 3VBOA 2XPJA 3RZKA 2IXKA 4DFSA 3ES4A 2DUOA 3EBRA 2ZABA 4XEZA 1RMU2 4XXAA 2VCBA 2XQRA 5HV4A 2QQOA 1OVSA 1MZ5A 2JB8A 4QXBA 3LEMA 5DZEA 3N9MA 1J59A 4HMZA 5L7OB 2WO7A 4XTMA 2B4KA 1QJEA 1AYN2 3U10A 5D1IA 3I54A 3LEKA 4MGSA 2JG8A 3J26N 1J3PA 1REFA 3AC0A 5FUIA 2W47A 3LIGA 3NJVA 3BCWA 3FZ3A 3ZXDA 3SC7X 4WVVA 1DDLA 2BYVE 1SLTA 3ACFA 2BEOA 2V4AA 2GMMA 4PBOA 2WWUA 1JMUB 4QPGC 4OI1A 2HLEA 1OH4A 1XYOA 2VTFA 3A23A 3F95A 3MUY1 4BLIA 1XB9A 3AVSA 3U1XA 4YM2A 4JKKA 5DUWA 2OVUA 4COZA 3BALA 4CCOA 3WX5A 3W20A 1DU3D 3DKQA 2AH2A 2PAKA 2WSVA 4QX1A 5BNNB 4UWDA 4CRQA 5A7WB 1LENA 2X8KA 4P9YA 1R083 5IT6A 3C7OA 3FE5A 3LCPA 5HXVA 1WCKA 1LULA 4UFIA 1JI6A 4TXWA 3M70A 1URXA 2WS91 3GZTB 3MDPA 4ISQA 3ACGA 4FTEA 1UL9A 4LBJA 3WINE 1UYYA 2P2KA 3UJQA 1JS9A 2RS31 4WM7C 1HRI2 2QQNA 1GV9A 1LHVA 1IQAA 1SEFA 1Y4WA 2J1RA 2RMU1 5F3IA 4ZS2A 1VLNA 5FZ1A 4AEDC 1E5IA 1OFSA 4IV3B 5D8AA 4C91A 3M3EA 4KI5M 3DYOA 1Z0HA 3KCXA 4W8JA 4YWAA 2CY6A 3IMNA 3D82A 1S0FA 1ASJ2 2DURA 4I0BA 5JOXA 3LSDA 4GA9A 2PLV3 4S2HA 2QQKA 3WHTA 3ZFEA 5I8SA 3K4ZA 2VNOA 3LF7A 1EUUA 1PMHX 3AKSA 2VNGA 4MGZE 1O3SA 1GKBA 2GN3A 1UZWA 1GFF2 3AZXA 5FREA 4P02B 1WMFA 5C3PA 3D0SA 1Y3TA 2WT0A 3H8UA 3N7KA 1RINA 4MO3M 1DGRA 1WCDJ 3HVDA 4NROA 4AEKA 3DPRB 3J7HA 1JUHA 4OHXA 5JDBA 2JG9C 4FBFA 1U5XA 4HANA 2QQIA 4G9SB 1AZDA 3BU7A 4RHV3 4JKLA 2EF6A 1LGBA 3JD72 2CDOA 2HWF3 2XVGA 3C7GA 4YVWC 4RS5B 1W28A 1JYWA 3H1MA 5DABA 1MS8A 2Z69A 5JIAA 4AFDA 5G04L 5D21A 1GZWA 2DU0A 3PDQA 1GNHA 4XIKA 1D4VB 3IIAA 1R081 3O1OA 1S4CA 2PHWA 5J1XA 2WYFA 2QDRA 3OPWA 4J1XA 2F6BA 4N53B 1OI6A 3A21A 3I2OA 1CAWB 2CGNA 5FYHA 2ZAHA 4QX5A 2D44A 1CAVB 2XGXA 3A0KA 3WVJA 4B4RA 4UBGA 1W2NA 2CGOA 3J9SA 4QX8A 1V70A 1JU3A 2WQZC 4PCRA 3IDBB 4LULA 1W05A 1DGWX 2VE1A 3I8TA 1MQTA 1W8HA 2Y38A 4A45A 3WCRA 3KCCA 1QJZA 4JGZC 1VBD3 4Z07A 5EYYA 3JB4C 3MLKA 1RUJ3 1BMV2 2PLV1 3OG2A 4X6RB 2VCMA 2E26A 1E5HA 4EYUA 4Y1ZA 2FD8A 4UW6A 1G9DA 1UO9A 3I7DA 1RHI1 2I45A 2VZ3A 5FZ7A 1CIWA 2B8MA 4PBPA 4UI9L 1DFQA 4IGPA 3NVCA 4Q0QA 2ZGPA 2YYOA 2BBVA 1NXMA 3O0VA 1NE6A 4SBVA 4ZXEA 5JXGA 3AMMA 3FHQA 2W08A 3I2HA 3V0BB 4JDMA 2WFF2 2XQXA 1OH3A 5IVYA 3PJQA 4X8PA 4RHV1 2VQAA 1HIXA 1ULEA 2HWF1 3ETQA 2FDIA 3T4HB 4XUPA 3DEMA 1GWMA 5FZKA 2NN8A 3ZFGA 4NHYA 1BK0A 4XABA 2JEMA 5EFUA 1LOCA 4TLFA 4LKSA 5ISLA 4COVA 1N47A 1OA4A 1X82A 2JDHA 3RRDA 4ARXA 5LBEA 2B45X 2QQMA 1SLCA 4NHKA 1LHOA 2ATFA 4BA6A 1LR5A 2WL1A 4XXPA 2ZACA 4PLMA 4Z2AA 4B7EA 5ABJB 3TBDA 3APBA 4XFHA 3KHCA 4F8AA 1JN2P 4HSJA 2K46A 3MUZ1 4XJ8A 4M4RA 4D6SA 1ENXA 2Y34A 2EALA 1F2NA 2EXJA 3S6PA 2G9ZA 5J3UA 2W2IA 3MZHA 2VMGA 1LEDA 4L92A 1GMMA 4IEZA 1CWPA 1CX1A 3SEPA 1VBD1 4I01A 4XTPA 1W8ZA 4QPGA 3IT8A 5GZFA 1RUJ1 3SLIA 5FK7A 3H0OA 2GAUA 5LEKA 2Y6GA 2EXIA 4P9JA 4IGOA 2V73A 4RGKA 2F17A 1NE4A 2XDVA 3NMBA 1JHNA 5FMOS 3HQUA 1UF2C 1F15A 2JDUA 3HT1A 5F5CA 3WNMA 1YEWA 4NUBA 4CDXC 5AFEA 3AXDA 1H6YA 3NW4A 4BE3A 1UZVA 2WNUA 2VOTA 2XJRA 5LWBA 2VXRA 2X09A 1H6XA 1IKQA 4HPKA 4AHZA 3I3MA 4Q0VA 4BWOA 2A75A 2CNAA 2HWD3 5FMBA 1S0IA 4E8DA 1YQCA 4XJWA 1BK1A 1QJX2 4IV1B 1XBFA 2D3SA 4WM7A 3WHUA 5FO9B 1BLZA 2RS32 2YBSA 4BM8A 2ZX1A 2PELA 4AEDA 2CAUA 2IUWA 1VP6A 2VPVA 4MV2A 2CSGA 2RMU2 1H9PA 2YDEA 4XURA 4Q4Y3 3AVRA 3Q8EA 4PDWB 3VZLA 3HQRA 3MFAA 4XMAA 4B4QA 4R52A 1EPWA 3VHPA 2QZ2A 4QX3A 2PHFA 2W1QA 4LORA 1GQGA 4CUCA 2J1UA 2JE7A 5LA9A 1SG3A 2ZOEB 3VD3A 5LA1A 4HFSA 4YM1A 1EV11 1PO11 1YJLA 2NLRA 3LAGA 4H2AA 4FPHA 5A3UA 4Q4X3 4Y20B 4BMEA 1W6OA 2XJVA 3HNMA 4BQ4A 5F39A 3RZLA 2HBTA 4QMAA 4XFBA 5LBFA 2XOMA 1O3RA 3QH6A 5JWPA 1ULFA 2WWSA 5F3EA 5IK4A 2RJKA 3E6DA 3THTA 2CGPA 4QB2A 1CAUA 1AR91 4KGGA 4XC9A 2A3WA 2YU1A 1VMHA 3GDBA 1B35B 1H8TB 2JIGA 2WUHA 1UAIA 3ACLA 3IBMA 4XZPA 3VN4A 4C90A 3PU3A 2RR13 2G9FA 5FXZA 4EWEA 1PX4A 5C4WA 1U12A 4D6RA 1RUC3 1YYNA 5FKBA 1EPZA 2XXZA 5FLHA 2VOKA 1LOEA 1XE0A 1X50A 2Z5WA 3VBRC 5FZEA 2R1BA 4Y1YA 2DVFA 3NKTA 1QMJA 3VHNA 2BU9A 3VLBB 3KV9A 4RN5A 5FPBA 4XFAA 1J83A 1BBT3 4NHLA 1IHMA 3LDRA 1LGNA 5GZGA 2ZKLA 2HWD1 4LHKA 5L19A 3AMPA 3IWZA 4OVEA 1FT9A 1QF3A 3K4DA 4Y4RA 4MXWB 5BNOB 2W9XA 2WIIB 1QJU3 5L7OC 1C1LA 2Q8CA 4Q4Y1 4V2VA 2BRTA 4JGZA 4LBNA 2DTWA 1EP0A 1UW8A 1S2EA 3FC0A 5L9VA 1OUSA 5JPNB 2PLV2 3O0XA 3UNPA 2NZ9A 1NCRA 3MPPG 3MW2A 4U2AA 1HRV3 4BZ4A 3KGZA 5T52A 4DS0A 4Q4X1 2BQPA 1SQ4A 2ET7A 2GN7A 2OZ6A 2GC1A 3USUB 5BV6A 2XMLA 4FPFA 2W91A 1ZRCA 4P5HA 4XMIA 5F1RA 4D0QA 4DZGA 5SV5A 2SBAA 3SHRA 1WMXA 3K51A 1X9TA 3FHAA 4BPZA 4XJ9A 4RHV2 3LQCA 4FO9A 2HWF2 3PL0A 2RR11 1YFUA 2OX0A 5EHDA 1FMD3 1RUC1 3R6SA 1LGCA 1WLDA 3ELNA 3VUOA 4R9CA 5JMOA 1D0HA 3ZPOA 1VBE3 1NLQA 1IG0A 1NZCA 4LR4A 4RYDA 4KNCA 1UZZA 5C3OA 1TME3 2W46A 1QXJA 2FMYA 4I0WB 5JMCA 5FRAA 5DUVA 2LTNA 4NIIA 1MS1A 2LALA 5JUVA 4M3CA 1BBT1 4Y1UA 5DXDA 3AP7A 2WZPP 4LKDA 2YROA 3CEWA 1UOBA 3RWKX 4ZU4A 3AFGA 2R32A 5C8CC 2VW2A 4ARYA 4HK8A 3BGAA 1D7PM 2JDPA 2XH6A 1GNZA 1QJU1 1UNBA 3I2GA 2PHRA 2FDGA 4F7ZA 1WLTA 3WNLA 1VBD2 3AFKA 1RUJ2 5HCAA 4YGEA 4YG0A 1KJLA 2V5YA 5G05L 2VW1A 1XPWA 3CZJA 3EQEA 5LZ6A 1DLCA 2BOJA 3DPRC 3BUCA 1BZWA 1NT0A 1H2LA 3H3LA 1OXCA 1UY0A 1DG6A 3H42B 2VMEA 3OUJA 3W5MA 1WW5A 2PYTA 5IYYA 4NN0A 4FFFA 4R4ZA 3PURA 1ZRIA 5FUPA 3ZYBA 4YGCA 4JCKA 2QQLA 4CEWC 1AYM1 4Y5Z0 5IK5A 2WDBA 3VZKA 2VQUA 2Q4SA 5FZBA 1ENSA 1ZRDA 1D4M3 2WC2A 4B1MA 1BEV1 2SLIA 1D0GA 5IUQA 1JXNA 4GWMA 3ILFA 3KV4A 4N53C 5I93A 5DUXA 1FMD1 1GZ9A 3KWVA 4WM8C 3WQ7A 5A6ZA 5C9AC 4FTSA 1LCLA 3SCGA 1HW5A 1VBE1 2VNRA 2JECA 3SKVA 3VDDB 2X29A 2BP6A 1VE0A 3QOPA 1E57A 1ZVFA 1F5FA 3HJRA 3POEA 5T5OA 3B01A 5A3WA 5AVPA 1V6LA 1WKYA 3VD5A 3KHBA 2TNFA 1IS4A 3P1IA 4HKWA 4YW7A 3TEXA 4Q27A 5CVRA 4HKOA 2LM3A 1WZXA 3ZSEA 1W8NA 5C33A 1CR7A 1PZ8A 3WNPA 4D94A 1YUDA 2P4EA 1YCIA 2ZX0A 1XJAA 4OLLA 2FDFA 2E7QA 2WZR3 4XOGA 3M3QA 1CAXB 2WABA 3VBSC 4W6YA 1UN1A 3I59B 1HB4A 1S0JA 4PLNA 3ALQA 3O1SA 2XL7A 3AZYA 4AK3A 1W03A 2D6KA 4Q8LA 4PIYA 2Q8DA 1PNFA 1ND2B 3VBRA 5F2SA 3ZSLA 1MZEA 1NA1B 3OD0A 3BKZA 4O65A 2RJ2A 2IVIB 1US2A 1WGPA 4QKBA 3ON7A 5CISA 3ACIA 4CUGA 1D4M1 1S0DA 1NQDA 4BB3A 4C0BA 2HWB3 2HWD2 4Y24A 2QCSB 5FLIA 4IE6A 3LDBA 2JDZA 2VUDA 3RYKA 4Q8KA 4NIHA 4AVSA 3FWEA 1K3IA 1QDOA 3WV6A 3VZJA 4YSFA 5ABJC 4Q4Y2 3PVBB 3KCYA 2D93A 2CWMA 3M1HA 1C28A 2XJQA 3S7IA 4CE8A 4HOOA 4ITCA 4AGGA 5JCTA 2VZTA 1ZZ8A 2RE9A 1KQRA 4PIXA 3MIBA 4HN1A 4XZUG 3OY8B 1OLMA 1SBDA 1VAMA 2IXLA 1JOPA 4UFJA 3URFA 4BQYA 1I3HA 5H9PA 4Q4X2 4W65A 5KHJA 2P1BA 5B4NA 2IXHA 3T0DA 1POV3 1RUI3 2PAMA 3FHIB 4LE3A 4LHLA 2X5IA 2WLQA 4CXWA 3LGRA 2R063 3CJIB 4QB6A 5FOBB 3GJBA 1VR3A 2VUJA 3OUIA 4DEVA 4DINB 4DMIA 2WZR1 3Q8AA 1RL3A 4RGGA 2Z79A 4CDQB 5KR7A 3POSA 3OYWB 1AL21 2ZEXA 3MIHA 2RR12 1K5MB 5IATA 1WBFA 5FXXA 1GNYA 1RUC2 4HVOA 5H9RA 2DCJA 4GKYA 4ORFA 2B39A 2L9LA 4IV1C 4WZCA 3L2YA 4GJZA 3WOGA 2NPIA 1NZIA 1SFNA 3E5UA 5LY2A 5LY1A 2JICA 1UYXA 1WA6X 2Y26A 5FZ8A 5A6QA 2VW0A 1HLCA 3GBGA 3BN6A 5GM0A 4EN9B 4RFT0 5FZ3A 2KD7A 5LATA 1Y43B 3PNAA 2CL2A 4QHZA 3RI8A 5C8CA 1OMIA 1GOHA 1QIQA 5FP7A 4AI1A 2D97A 2EVXA 2ZGUA 4BQWA 2UY8A 1QJU2 1W0PA 2RJLA 4OMCA 3WF4A 3FBYA 3H8RA 1OHFA 5FMDA 2B46X 3A7QA 3ZMOA 1W06A 4JQTA 4RFRB 3WF0A 4COUA 1D2QA 3FFQA 4KG8A 4QB1A 3I2DA 4AHYA 3T1LA 3B5LB 4Q1RA 4QGNA 3PUAA 3GZUC 3DPRA 4S2GA 4Y5TA 1MS4A 1ODMA 3POYA 1ND3B 1F35A 2C0ZA 1OFNA 1HRV2 4DOUA 1IKPA 1H8TC 4CEYC 2YC0A 1DQ5A 2DCYA 1AVBA 4IEUA 4L97A 4N8MA 4XF1A 3WDXA 1RUI1 3OGSA 5A3TA 1HJFA 2JIJA 4CEWA 4TWTA 3KV5A 3AMHA 2VBPA 1N3QA 2R061 1POQA 3U14A 4CUBA 5FQ0A 2JDAA 1JH5A 1SDWA 3RSJA 5CFCB 1GU3A 1CZVA 3O1UA 3N9PA 3J8F3 3T2OA 2A6ZA 5FPZA 1CAWA 4HETA 5DAXA 5C9AA 1FMD2 4IEPA 4WM8A 1JZ3A 5A1FA 5DN2A 2VNVA 5E88A 1VBE2 5DAQA 4ZPIA 2ZCWA 1BKZA 1TME2 1WD3A 4Q2FA 5C5UA 4JRAA 1AR63 2GP5A 1FV3A 1GOGA 2YGLA 4ZZ5A 3I2KA 1W3XA 1RTVA 1ZBE3 2OUHA 3N36A 3VD9A 4P9GA 3S5AA 3G6JB 4CDUC 1GOFA 2XL9A 2YGMA 1CZTA 5FXWA 1S2BA 5FY9A 5CKQA 4EN8B 4HLTA 3MPBA 1WMDA 4OHVA 5LA0A 3UK9A 3D3AA 3JBG3 4BK5A 1H9WA 1Q8QA 4O7XA 3U11A 3WSOA 3VBSA 3JD71 3VBHB 3ATGA 4XUNA 1IZ3A 4QKFA 4D7YA 4NIGA 3BB6A 1DHKB 1GUIA 4M0HA 1W6PA 1YFWA 3P3NA 4YG6A 4MGTA 3BTAA 4ZZ8A 4LJHA 5FWJA 1T6BX 3J7LA 4J1WA 1NG0A 3N7JA 1LOAA 5FZOB 3W59A 4K6BA 3B69A 4FQ4A 4E27A 2YPDA 3J7NA 3NAPB 1PGSA 3IZOA 3Q8BA 4CP9B 1CQ9A 4XBQA 4KU8A 2J22A 1D4M2 2W39A 4AEJA 2ZX2A 2Y60A 3OTFA 2ZZJA 3AKPA 1QJY3 4OQ9A 1LESA 3J8F1 4UW5A 4I02A 1R64A 4LBKA 3RNSA 1LODA 1V00A 3AP6A 4XVHA 1T6GC 1HV0A 3ZYHA 4CYDA 3WLUA 4TTGA 4LIUA 5HPOA 5HI0A 1UYPA 5BYNA 1QNWA 5DAVA 4URTA 3ZDSA 4GIQA 2OIIA 4XE9A 1QU0A 1MPXA 2NMOA 4PT6A 4YW3A 4LO5B 3ZMNA 3OBAA 1SLBA 3KQRA 1LEMA 2D3PA 5K8SA 4I30A 3O5SA 4D6QA 3HIFA 4MX3A 2J1AA 4QPIC 3ST7A 3ZYPA 4RQPA 1ZBE1 1TVGA 4LIVA 5IHRA 5FZ9A 5FZ4A 3NRUA 2Y6LA 3U78A 1X33A 2BFUS 3ZDVA 3IDEA 3ZIXA 2BWAA 5DDJ3 4JGYB 1HKDA 1UZYA 4AR2A 4CUAA 4FPOB 3POJA 4Q4V3 4CDWA 2ZBJA 3JBG1 1GYKA 1PK6B 4Q0UA 4URAA 2RV9A 2KM2A 4L99A 3EMRA 4DO0A 1O8PA 4WV8A 1MACA 4ZKTB 3CO2A 5HCFA 3ZXAC 2WN2A 3DUIA 3TEZA 5LA2A 1SLAA 2OA2A 3T2PA 2QUOA 3OGRA 4IV1A 3VD4A 4NPMA 3K2OA 5JR7B 2A6YA 2XHNA 2JE9A 2BWCA 3MGUA 4LBQA 4LBQD 5CFDA 5T5JA 4COWA 3H8XA 3BPSA 1W9FA 3SKJE 4LQRA 2FDKA 4LT5A 5H9QA 4D7SA 2RG4A 2MNGA 2HWB2 4E4SA 1N1YA 2WNOA 1P8JA 1QJY1 2GNDA 3OF1A 1C8NA 2HEYF 5F2WA 4CCEA 1O6UA 2W3JA 2VL4A 3R4DB 1N1SA 5LEJA 1XOYA 3MIDA 3RMYA 1OSGA 4Y20A 5L36A 1DQ2A 2VZUA 2E7TA 5ANNA 2YMZA 1MEC3 2WT1A 3PUQA 5EPAA 5C5TA 2ZAAA 4R4XA 3MI8A 2OUJA 5FZIA 1RUF3 3KZ4C 5FYVA 2OKXA 4CEYA 1YQ2A 4HT1T 1S2KA 2NP0A 3H9AA 4XJAA 3TN93 1RUI2 2W1UA 1KS4A 5FOJB 1RXFA 4O9GA 5DDJ1 3WW3A 2X05A 2YC2A 2XJTA 2EICA 2R062 4Q4V1 1BVVA 1QJX1 1QKQA 4QDSA 4GH4B 5GLZA 3S57A 4FTBA 1YXWA 2W68A 1AJKA 1NA1C 4FVVA 5T5PA 4N43B 5HV0A 1UOFA 5JXIA 4G4FA 4MGKE 3ORJA 5IVFA 1KRIA 2YY1A 3MLLA 1C5IA 5FAXA 4IQPA 3U37A 4QQ2A 3RDIA 4AVBA 1Q8PA 1F4AA 1RJ8A 1I6XA 5LBBA 3WDWA 4LNVA 5FJHA 2XUEA 3OGJA 5E89A 1DYOA 1M4WA 4CDUA 3KVBA 3I49A 1WCSA 1C4RA 1H4HA 3N9NA 4ASLA 5FMOL 2R043 4DY5A 2O14A 2WR9A 1W6MA 2WRAA 1XYPA 4EWDA 2PHUA 4AGVA 4I3GA 4MXVA 4MVTA 1O7FA 2I07B 5EYXA 3USUA 2ENRA 2J1TA 2VD7A 3IPVB 4B3NA 4IE4A 2D7FA 4LTAA 4QHBA 3U75A 2VQ0A 2WZEA 5JZGB 2PMWB 3HWJA 3CJIC 4AQ6A 2XLFA 3Q9OA 3FFZA 2GC2A 1IS3A 2P37A 4UF0B 1RUF1 2XHKA 3LPFA 2DFCA 2O0OA 4CDQC 5B2GB 1SZBA 1S0GA 1JUIA 5FK8A 2FDJA 5LASA 3AYEA 3N7LA 1KXGA 2ZHLA 3TN91 1R1A3 4ZY9A 4BDVB 1K5MC 5E6HA 3RYRA 1YJKA 2WAOA 2VECA 1O5LA 2WN3A 4I0AA 4A7KA 4DXTA 1FYUA 4BU2A 3AP4A 3LE0A 5A1AA 2BBAA 1KFUL 3IB3A 4LMFA 3CIHA 1DBNA 1SFPA 4Q0PA 1G6NA 3J8F2 2E32A 4AFCA 2OT7A 3VBUC 1OLME 2R49A 2VCCA 5AC93 2A6XA 4JHTA 4Y22B 1SBFA 3NQHA 4NRPA 3TNQA 3NNGA 2Y8KA 3HN1A 3H8OA 3HEIA 4AE2A 2HJIA 4E8CA 2ERFA 1AR62 2QTWB 5JOWA 3ITQA 4QPIA 4IE0A 4AVCA 4CCLA 3UGFA 3LD8A 4OI4A 5ERLA 4MG2A 3IIIA 1ZBE2 3NV3A 1GP5A 5E8AA 4B4PA 2FCUA 5LK7B 1RVF3 1RYYA 4ZS3A 1NY71 2VULA 1PZ9A 1Q8SA 1NYWA 2R041 3MIFA 5FZDA 3PUSA 1ND3C 5J7MA 3PIJA 4M3CF 5DZFA 3H50A 3JBG2 5JOZA 1VBC3 2XB6C 4D8MA 4QX7A 4RR3A 5IFTA 2Y6FA 3QLQA 3VD7A 4YGDA 3WP5A 4AXOA 3UETA 1US3A 5CYYA 1Q43A 2VZPA 1RUE3 3CKHA 3GZEA 2Y0IA 1G9CA 2WA4A 5DUUA 1VBA3 4IW3A 4IDZA 3HMYA 4YRDA 5C7GA 1KFXL 4NWWA 5F5QA 2WSUA 1U0AA 3DGTA 4QWNA 3WP4A 1SCRA 5I0SA 4XF3A 4O61A 1R1A1 1TMF3 4KMQA 4C8DA 2N7GA 4K1YA 3V0AA 4HKLA 1IQDC 1ZYBA 3JU9A 1LHUA 2Z4FA 4ES8A 4QKNA 2W95A 2K0GA 2IXJA 3ES1A 3FLTA 4ZU7A 2ZMNA 1QJY2 3IKWA 3K46A 2PA7A 4YZ2A 5AC91 1VRH3 3VKMA 4FT8A 1OOPB 1W6QB 1V6IA 5JR2A 2AUYA 3D0JA 2D5HA 4K3UA 3UYJA 1DQ1A 1OBNA 3ZN6A 4UFKA 1WW4A 3GF6A 2A71A 3OCPA 4ATEA 1NCQC 3B94A 2FZ1A 2BGOA 3A22A 1K45A 4JVAA 1AHSA 2BNNA 2OPKA 4X6QB 3LIHA 1H2MA 3DYPA 2ZGMA 1J3RA 1RVF1 2DDUA 4ZHNA 1W8OA 4XDPA 5FY5A 5BUVA 1GQPA 1OD5A 5F5IA 4N7UA 4BQ5A 3E5QA 3ILNA 4XUTA 5AVAA 2Q0AA 3AM2A 5DDJ2 1OPMA 1VIWB 1RGSA 4KQ7A 4XFIA 4XHBA 3WQ0A 1PO23 4RL7A 4Q4V2 2AEYA 4OMDA 4Y1VA 1VBC1 1NA1A 1L7QA 1SPPA 1F4HA 4EN6B 2IZWA 4XW3A 3OBTA 1GZCA 3NAPC 2AACA 3AL6A 5IK8A 2QQUA 4Q29A 4EZ4A 2C9AA 1NUKA 1G9AA 1W2TA 2Q8OA 1VBA1 4IEQA 3AKRA 4GMP3 5FP3A 2FCVA 4B8EA 3DXTA 1X9PA 4L0PA 2PHTA 4A6SA 2DCZA 3GHNA 2OPWA 3HN3A 3NV1A 4FOWA 4QU2A 1U5YA 4HL0A 3VBOB 5C3SA 3VZMA 1V6OA 3NV4A 1WW6A 2JWPA 1A8MA 3T4VA 2XONA 3VV1A 1VAKA 4ONUA 4YW6A 1LTEA 1STMA 3HOBA 3WD5A 4OZOA 4CP1A 2JG9A 1PVXA 1CX4A 1GWLA 1VRH1 2LROA 3HBKA 3WG2A 4FAHA 2JG8B 4NIDA 1XQNA 3OOXA 4FI9A 4YVWA 5KC6A 2YZ4A 3KM5A 1OPOA 2UYBA 2WZ8A 1H1IA 1ZRRA 1BCXA 3ETPA 4IEXA 4YVSC 3WF3A 1MEC2 4JGYC 4Y3OA 3CJIA 2TBVA 4O9EA 4CU8A 2XR4A 3GZAA 1RUH3 1ULOA 4UW3A 3FX3A 4XILA 1RUF2 2RS53 4OCTA 2HKXA 1ULCA 1UQXA 2I74A 1O5UA 3EXUA 3I3EA 3TN92 1SLLA 3HNYM 1K5MA 4OQ8A 2BVVA 1HXS3 1XU1A 1PO21 1VB4A 3MW4A 3T1MA 3QACA 2OYZA 2C1FA 4DXRA 1YO8A 5FZ0A 3UL2A 2W87A 1JZ2A 4NPRA 3T0BA 4XCAA 3VBUA 3BIEA 4CU9A 4S2FA 1OD3A 3ASIA 3EJKA 4QM9A 2GALA 3L9JT 3VKNA 1MVQA 2Q1ZB 3KV6A 3SH3A 4NAOA 5L9BA 2G4IA 1O3TA 4KBBA 1JYTA 1LOBA 3KS7A 4F3JA 5JOYA 2ARCA 5C3QA 3SNMA 5H9SA 3RZMA 1ZA7A 3S7EA 2DV9A 4CTEA 3ZR5A 1MZ6A 2GU9A 3E6BA 4WVMB 3OD4A 1NY72 5JXJA 3WF1A 3ZFEB 3O12A 2GNTA 2R042 3MIGA 2NM1A 1Q56A 3R4SA 4NAMA 4YYOA 4E2SA 3V65A 1XE7A 5BNNC 3WUCA 4AFMA 1W6NA 4K21A 2BGPA 2RVAA 4KG0A 1CJDA 1YHFA 3MFCA 1HJGA 4MSVA 1UMIA 1LHWA 3RS6A 5AFBA 4P14A 2JD9A 2YBPA 3E5XA 4AOCA 3NWKA 1LNSA 3LPGA 2Y6HA 4DPNA 1G86A 3RYPA 5A32A 3T30A 1YQ6A 3RZZA 2KR2A 2R073 2RS51 4AHWA 1J3QA 1KS5A 4N43C 3CZUA 2EXHA 1KGYA 3LZZA 3O7OA 2P5BA 4IV3C 1R1A2 1HXS1 4UAPA 4IGQA 4X8NA 4RGAA 1GR3A 3ZO0B 2WWJA 3VGIA 1KEXA 1GZWB 4EJRA 2ILMA 1Z7S2 3FUQA 5IFPA 3QD6A 3WR0A 2WQ8A 4DEQA 1W8FA 4GB33 1QJFA 4MHUA 1ZBA3 4NIAA 1V6KA 4NHMA 4EE2A 3SEEA 5GZEA 4QXKA 5GJ6A 5AC92 1UU6A 4DNYA 3ZM8A 1SMVA 4TZDA 1ZZCA 5B4XA 3ZYRA 1XRUA 2X10A 2PN5A 3RWNA 4NJ4A 5F37A 4Z82A 4PF5A 1NCQA 4P08A 1ULGA 1MQTB 1RIRA 1W9SA 4IESA 1HRV1 4AQSA 1UXZA 4C0HA 4CCKA 4CDXA 4AFBA 3AB0A 1FI2A 2VZRA 3N35A 4MH0E 4A7ZA 1O4ZA 1J84A 1RVF2 3BOPA 3WY6A 4RS5C 1MS0A 2QFEA 5FV3A 5A33A 3WW1A 5IK7A 1YWKA 5GZDA 3SMHA 2DTYA 5T5LA 3M7AA 3AXEA 1SDDB 4JHZA 1FOD2 1B09A 1JOJA 3POFA 2Y64A 2BV4A 4DB5A 2ZZQA 1VBC2 5FZOA 3MHZA 4GWIA 1N1VA 2BW8A 4BXFA 5C70A 3GHMA 1CZSA 1G7YA 3K4AA 1CPMA 4Q5OA 5EXOA 3I4IA 1ZZ6A 4H14A 4AHXA 4OHYA 3D5OA 5ACA3 3O1TA 1RUE2 1CGPA 3RZJA 5EWSA 4QT6A 1COV3 4MOAA 1H30A 4JZRA 3ZN5A 2EIEA 1VBA2 2HEWF 2R071 4LPLA 3ZOIA 3ZYIB 1TME1 2F4PA 1OQDA 1UOJA 3NNMA 3OPZA 4DUXA 1TMF2 1X36A 2Y0OA 4V1PA 3ZFGB 2VBDA 3W58A 1XE8A 2R30A 4HVQA 4NR1A 5A7QA 4IXLA 3NSTA 4CCCA 4XDQA 4E2QA 5LCWL 3FLRA 1AR83 5FZCA 1G8WA 4K8RB 3DXUA 5IAXA 4GB31 1GP4A 1ZBA1 3M3CA 3SQOA 1DYPA 3ZKUA 3I3QA 3VHRA 1VRH2 4R9DA 4DQAA 1FX5A 3WG4A 4ZU5A 2WFPA 1XU2A 2DYCA 4L9BA 4F83A 2VR4A 2BJSA 3B9CA 4RSUA 4FPJA 1ZREA 2CDPA 3VL8A 2H0VA 1W0OA 4YVSA 2BZDA 3PVEA 4PIZA 1K5JA 1UZ0A 4KWKA 4BIOA 1HN0A 4TN7A 1PZ7A 2HYXA 4QPGB 3AJYA 4XQWA 5ANQA 5FP4A 4FPCA 4E4ZA 4A41A 3AZZA 2QQJA 1TG7A 4XCBA 1EAH3 5HXMA 1JOBA 2OQ7A 4LO4B 1LB2A 1QH7A 2PHXA 4H7MA 4PJYA 3UGHA 4ASKA 5FP8A 1LAJA 1XC6A 1VPHA 1GICA 2A7AA 4Q26A 1PO22 1QGLA 3AJZA 3DECA 3OUHA 1ENRA 1YLLA 2A6WA 5JIUA 1YQ5A 1RXGA 2O1QA 1DQ4A 1GZTA 1UKGA 2D98A 5J09A 2WNUB 5CEHA 5L7OA 2GMPA 4GD4A 5I8TA 5ACA1 5FDBA 4HPKB 2R0FA 5T54A 2HWE3 1NQJA 1COV1 3E1F1 5KXEA 3MW3A 3BTXA 5FYTA 1PGL1 3I3DA 1UPIA 2EIGA 2YPJA 5JI7A 1F8VA 4WM7B 2YG0A 3ZXFA 2ZGSA 3VKOA 2PQQA 4AEDB 2WO2A 1C5HA 3A0NA 3JXSA 1O4YA 2PHLA 2XKOA 4WVWA 1ENQA 3RVHA 5A80A 2GH8A 1M06G 1OOPC 5KHIA 4GULA 2VBBA 4QDRA 1VBB3 2ETEA 4L11A 1IPSA 1V6MA 2YU2A 3WNNA 1GSLA 1SLIA 2W52A 2D6LX 1AR81 1JYIA 1IG3A 1PMJX 2ID4A 3PHMA 4H3WA 1OA2A 4LE4A 1R1ZA 3OEAA 3P3PA 4DXZA 5BNNA 3GBFA 4V2WA 1KD7A 2A1XA 3AP5A 1XSQA 3J7MA 5A7WA 3NKGA 2VXJA 1CESA 3POIA 1W6OB 2HBUA 3FN9A 2RDRA 2DF7A 3WZ1A 3TOJA 1SFYA 5CG8A 4CZSA 3OEBA 1O3QA 2AYHA 5T3NA 1AR73 2AGSA 1CAUB 2CHHA 3CHXA 2UURA 4XAAA 2K9ZA 3RI9A 3PVNA 4K7JA 1S0CA 1RUH2 1OA3A 4GXLA 2RS52 4N43A 5IVVA 4AAPA 2AENA 1EAH1 4FSJA 3QBQA 1UIKA 3JQXA 4IV3A 1LHNA 5LRSA 4INDA 5C4WB 4ISRA 1OF3A 4PDWC 1HXS2 2D6NA 5EV7A 4LEJA 4JAAA 4AGRA 3WNXA 2HWB1 4LA2A 5FYZA 1PM4A 2JKBA 5LRRA 2FQPA 4META 4DY3A 2WKKA 4XQDA 5DZGA 4Q0SA 3W9AA 1AX1A 3AK0A 1QOOA 1VRBA 5KXBA 2JD4A 4EN0A 5BY5A 2P3KA 1APNA 2VVDA 3B7MA 3NNFA 4IEYA 4QU1A 5EP9A 5F9TA 1NOVA 2BFUL 2C5DA 4YW5A 3MICA 2V09A 5DAWA 2Z42A 1W99A 2ARBA 4XJZA 1AXYA 1FATA 4YNIA 2AREA 3RFRA 4NPLA 3DF0A 2GNMA 4JX0A 1JTZX 3H3UA 5EIYB 2DCKA 1NKGA 2JDMA 2JENA 2XKPA 3WG1A 2XBO2 4JKMA 1VMJA 4JGZB 1B35C 1UY1A 4RD7A 1POV1 1S55A 1TNFA 3MBWA 4AYUA 4RS5A 1AF9A 2BNOA 2R6QA 5JVVA 1NCRB 2BGCA 3DV8A 4W6WA 3TEYA 4XACA 5A3OA 4LITA 3K77A 1UU5A 1PX3A 2VG9A 3JQWA 2YC4A 5FPLA 4Y4YA 2E9QA 2GP3A 1AJOA 3I2JA 3KT7A 2B5HA 1Y9MA 2HH9A 4N53A 5I0RA 1JZ7A 1LOGA 5C3RA 4W6XA 3VZOA 3WP6A 1CAVA 4QQPA 5FFOC 3BIWE 1AR71 2DVGA 3CQOA 3ZVXA 5FO8B 1WBLA 2KA3A 1RUOA 5C71A 1I9RA 2ZHKA 2R7EB 2R072 3MIEA 1PVC3 4R9AA 4FAGA 5BNOC 3IDAA 1ZNPA 2LRPA 3ABZA 3PMEA 2ZGQA 4UBHA 3WG3A 2XVKA 2WO1A 1V6JA 4TSVA 1NAEA 4EQVA 3WNKA 5I8YA 1QXRA 3WXPA 1RUD3 3C7EA 4COYA 5FYMA 3RQ0A 4Y26A 5FYSA 1UX7A 4LBOA 4Q4W3 5FP9A 4OHZA 4BK4A 4XIOA 4GB32 3B02A 4KU7A 5A1LA 1ZBA2 4BXSV 3ACHA 1QH6A 4M3CB 4CU6A 2PXJA 1OKOA 1TZOA 1YFYA 4QDQA 1OURA 4NE9A 3QCWA 4EN7B 4QQOA 4BQ1A 3BTYA 3ZFEC 4NWVA 5IVBA 4NO4A 3RJ2X 3V0BA 1C8M3 3KMHA 2BNMA 2VUCA 2MHFA 4UW4A 5CADA 5D2AA 2WYSA 5FY8A 4AI9A 3GNEA 1L3JA 3ZXEA 2WNVB 3TYJA 3BU0A 1ONAA 4A44A 4IERA 5DPNA 1DF0A 2ARAA 2WA3A 5FBZA 3PMSA 4ATFA 3RJRA 3MV01 4MGQA 5BNQA 4D69A 5T50A 3VDAA 5I0DA 1JZ5A 1YQ8A 2C9KA 2ZX4A 5KBFA 2RDSA 1MR5A 2VC9A 1GLHA 2VZVA 1OQ1A 1H2NA 1BXHA 4JDNA 5ABJA 5ACA2 4HZFA 1MZFA 2V72A 1O59A 1COV2 2E6VA 4QM8A 4XFGA 1PGL2 3D6EA 3AYAA 4EROA 4RA0A 1PVC1 2AZ5A 3HNBM 5JSRA 2VZSA 1AR61 3THDA 1UY2A 2J1VA 2WO3A 1OOPA 4AFAA 2QQVA 4AQ2A 4HONA 3LDKA 3T08A 3I2IA 1RUD1 1HQNA 3PJYA 1E5RA 2UYAA 1XNCA 1AR82 4Q4W1 1JZ4A 4LA3A 1MQTC 3KB5A 3THCA 4XF4A 4IL7A 2VQTA 1LKNA 3IAQA 5JSPA 3WQ1A 2IC1A 2GDFA 3GXUA 1UKRA 1LU2A 2G19A 4M3CE 1AXZA 1ACCA 1REEA 2W0XA 1DZQA 3FJSA 2E51A 5GALA 1XXNA 2WQ4A 4FXKB 3S30A 2VTXA 2PTMA 4BISA 1CD3G 2CYFA 4AI8A 1EAH2 1N1TA 3AX4A 1EYBA 5F3CA 2WAAA 4PDWA 1CIYA 2WS93 1KDMA 1BYHA 3KLSA 3I3BA 3VDDC 3VBRB 1W90A 5FPXA 4IEWA 4XHXA 4PI0A 1FNYA 3WW4A 2VVFA 3LKJA 3U4XA 1SHWB 2RS13 3C7FA 1K42A 1QOTA 3QH7A 2P3IA 4LKEA 5SV8A 4Y5SA 5FY1A 2YFZA 3CNAA 3ZFGC 1W2UA 2HWE2 5FO7B 5DQ0A 2YV8A 1J58A 2W1SA 4KBZA 4FOYA 3NJZA 1Q5OA 1H2KA 3VBFB 4QGMA 3B9IA 4Z8BA 2EAAA 2AR6A 3UGGA 3N9QA 4FP2A 4JQRA 1J1LA 4QX2A 4JTNA 1RUG3 2FCTA 1WUVA 1DGLA 2CAVA 2ZGLA 2VMFA 1B35A 1H8TA 4BYYA 4TYSA 1VBB2 3OBRA 1VAVA 4QPYA 1OLRA 3WNOA 3MYXA 3BODA 2ZPXA 5I0TA 3CDZB 4FOQA 3FBMA 1I5ZA 1ALYA 1EY2A 1ND2C 2GH2A 4XBLA 3BI3A 2XWJB 1N3OA 1HN1A 2A6VA 2K2SA 1A8DA 1REDA 3M4FA 3M3IA 2FDHA 1IPJA 2OXBA 1T2XA 2TUNA 2D43A 2RM23 4LO6B 2FZ2A 4QX0A 2X5IB 3H3ZA 3ZN4A 3RZGA 3A4UA 2J1EA 4H55A 4YW4A 4WZFA 1AR72 2XLAA 2R0HA 2ZS6B 4YARA 2E53A 4E4DX 5KXCA 3BVCA 4MXWA 2E63A 5BNOA 1IPKA 2DCTA 2A73B 2WNUC 3B00A 4YLZA 3PTRB 1FPN3 5EJZB 5LK5A 1ZZ9A 5A3MA 1JW6A 2ZTNA 3POWA 1A3KA 4UT5A 2UY9A 3GALA 3H7YA 4DRRA 2RS11 2VMIA 3AL5A 3BPZA 2JE8A 4NVPA 4R9BA 4LXLA 3T2QA 5LW9A 4HBNA 4KGQA 1QHDA 2DWRA 3H7JA 1HB3A 4YW1A 1JZ6A 1LRHA 3ZXJA 5A70A 2ZX3A 2XG3A 4FQZA 5GLVA 3KD4A 3LA7A 3ZLIA 4HN0A 4ET7A 4LK7A 1PMIA 4WVMA 4E9KA 2D6MA 3KQ4B 5C8CB 3FLPA 3UESA 1MEC1 1ZZBA 3EO6A 5L9RA 2DVBA 3ZSJA 4K20A 3ZR6A 1DGWA 5FR3A 4PHZA 1RHI3 3CJXA 4N9IA 4YZ4A 4CXXA 1RUG1 5FYBA 3R4UA 4CCJA 5K0UB 1G9BA 3KVAA 4LK6A 4BHPA 5FTTC 1VJ2A 3CU7A 3AP9A 3O1PA 3ZFFB 4YZ5A 2PFWA 2G9GA 1UWWA 1E5SA 4TLGA 4W50A 4XJUA 3K3OA 4B1LA 2ZMLA 1Z7S3 4D7TA 4JDOA 4GJYA 4W4ZA 2OW4A 4M0NA 4NOTA 4JC1A 4CA9A 4GWJA 4C1WA 2RM21 5FYIA 1XNTA 1UCXA 4CEWB 5K9YA 2NYYA 3H1YA 5L73A 5C4WC 3AMNA 5A3LA 4A6OA 4E2GA 5E1RA 3JCIA 2QDNA 3KT4A 2QQWA 3NNLA 5FQ0B 2VMDA 2QE3A 2ZGNA 3R0RA 5J36A 2HEVF 1PVC2 4OI2A 2O8OA 4BMBA 1YIPA 2KXLA 3V56A 1FPN1 1OQEA 5C9AB 4QPWA 4WM8B 4LOSA 1F9KA 1RB8G 1W8WA 2F4LA 3IM0A 1RUD2 3D4KA 4C1XA 2WBKA 3MV11 4Q4W2 4I3PA 3NJYA 2EAKA 1UXXX 2JB4A 1FOD3 1TEIA 4PQQA 3AMQA 4YW2A 5IAVA 1JU4A 4A3ZA 4N7IA 1TE1B 4UFHA 2DVAA 2UWBA 5C6CA 5FZHA 3E6CC 4LUMA 1RUNA 1NCRC 4FPEA 3R05A 4B29A 3IDCB 1C8M2 1OLQA 2MEV3 3KSCA 2B9VA 4H7LA 5CKNA 4P9IA 4AVTA 1PIV3 3VBSB 2Q8EA 5CFCC 1JBCA 4K40A 3WUDA 5FXVA 1ST8A 1W6PB 2QNKA 4KWJA 3VDDA 4LOTA 2A70A 1Z7S1 2LW8A 2QJVA 5CIRA 5FUNA 5A7PA 2CU5A 3GCXA 4G3YC 3POBA 5EZWA 4BIFA 2TEPA 3SISA 1YFXA 3ZXKA 5FWEA 2IWGB 2YXSA 2C4XA 5J48A 2EA7A 2I2SA 4D3WA 4KH9A 1WCQA 2P17A 2Q1FA 5DMYA 2PAEA 1EV13 1PO13 2HWC3 5C8WA 2PHDA 1CAXA 1WW7A 3I59A 1C1FA 3INAA 4MGIE 3VBHC 1KJRA 1JHJA 2LUWA 3EB7A 3UKNA 3VHOA 5F6LB 1ND2A 2DUQA 5BNPB 3TAYA 3P5BA 1AR93 4P9XA 1FOD1 1XYNA 3H1WA 4RQPB 2P34A 3HT2A 1POV0 1MVEA 2ADDA 2W92A 3PU8A 4DUVA 1PNGA 2WNVC 2ZGKA 5CG9A 1QEXA 4OZXA 1ODNA 1U5IA 2B42B 2VM9A 3BOWA 1RUE1 1H8VA 4OHWA 1Y9QA 2AC1A 2IVJA 1VMFA 2MEV1 4HG6B 4OULA 4CDWB 1KDKA 1W2OA 1PIV1 4YFZA 1JYNA 1Y9GA 4YM0A 4AVVA 1S0BA 5FZ6A 4EZHA 1UMZA 5I91A 1TMF1 2P3YA 5F3GA 4AEMA 2WS92 4FFHA 2JKXA 1UY4A 4E4HA 5CA6A 5FLJA 4NHXA 1HB2A 1UU4A 2XJSA 4IEOA 2VZOA 4LBQB 2NMNA 2RS12 5CFDB 3WF2A 1DYKA 5GLUA 3DKWA 2P6HA 2E33A 3OY8A 1OT5A 4JRLA 4P5YA 1ZX5A 4PQ9A 2JX9A 4IEVA 3N9OA 2UWAA 1X8MA 2HYKA 3BYWA 5APAA 5FZMA 5A3NA 4CU7A 4GWNA 3VKFC 1CJPA 1YIFA 2BERA 2DUPA 3Q8FA 5FMCA 4LO7A 2HWC1 1UPSA 1PK6C 2ZMKA 1RUG2 3LEIA 4LBMA 5F6KA 4CDQA 1R093 3C2UA 3OYWA 5BXXA 2VMHA 1QXPA 4PLOA 3UJOA 3JB8A 2FMDA 4OYUA 5T55A 1S0EA 1A78A 3EHKA 3AKQA 3LSEA 4EWAA 2Q1MA 2VZ1A 4LBLA 4M00A 2Y33A 4FP3A 5EJ3A 5K4LA 1KITA 4UXAA 4OUEA 4CEYB 1OUXA 2XJUA 2GMEA 4AVAA 5J96B 3WDTA 2RM22 5FZAA 2DU1A 2ZHMA 2VCAA 3O1MA 4LHSA 4OUMA 2DVDA 4GMP1 1SCSA 1J1TA 2D40A 2OS2A 4ES9A 3KT1A 5HCHA 1I1EA 1R082 3C3VA 2JXAA 4YM3A 1FV2A 3OB8A 4KL1A 4BQXA 4GQ7A 2BOIA 1FPN2 2E7AA 5D8AB 1RC6A 2XBO3 1HQWA 4Z1VA 5IVCA 1C3HA 2VAUA 1W3VA 3PLQA 4MYEA 2VH9A 1DGRN 3ECQA 3VBFC 4XQ4A 2PQSA 4R8HA 4DXSA 4ASMB 5HBAA 1ND3A 2XLGA 5IW0A 4YZ1A 1MS5A 4MGYE 2ZEZA 4AQTA 4L8QA 3GJAA 4CDUB 2Q5TA 2O8QA 4A7YA 4A4AA 1GQHA 4K8FA 2VOWA 3VL9A 3ZX7A 4DRVA 1JYVA 2IXCA 1TQ5A 2QVSB 3OGVA 2YB7A 5E16A 3S5QA 4Q1PA 1W6MB 1RHI2 3O1VA 2ZEWA 1RUH1 4GH4C 4WBBA 5F8PA 2DBNA 1R091 2VGDA 5CFCA 3DCQA 2XUMA 5JI9A 4CCMA 3G7DA 1UMHA 1VB2A 1AYM3 2VY0A 2X5IC 3N4MA 1D2SA 1LJ7A 1Z78A 4CCNA 2IFRA 2BTVC 3ILRA 3M2MA 4FFIA 1BEV3 5CNAA 2P3JA 1V9U3 1L7LA 3K3NA 5I0UA 2RDNA 1YI9A 1DQ0A 4IUGA 3T0AA 5FPUA 4QXHA 3J4UH 1BHGA 1OF4A 5LB6A 5A7NA 1FXZA 3X29B 3ZXLA 3ZYJB 1JZ8A 3NO8A 3PIGA 4LHNA 4CVUA 4XPVA 1A6CA 3O1RA 1GBGA 4M4PA 5KWRA 2MPFA 4GALA 3ZYFA 1OKQA 1SACA 4I09A 1U5ZA 3CLPA 4QGLA 5FBJA 1W8TA 1IS5A 3B3QE 2P6CA 4UFMA 3ZSKA 2XBO1 3CMGA 3IMMA 3FUOA 1CVNA 3I97A 1NXD1 3MEPA 5KHHA 3VBHA 3PVOA 4QAWA 4LO8A 4A2UA 4CPBA 4CPBD 1L7RA 4BQ3A 5JZGC 5CU1A 3TEWA 4QPIB 3L2HA 1CPNA 1UX6A 1AX2A 2Y6JA 2ZGTA 3W21A 5K0UC 4XUQA 2ES3A 1BJQA 1OVPA 3K75B 2WNVA 1LOFC 3KF5A 3ZFFC 3NAPA 3EYPA 1HB1A 1HDKA 2WNEA 1PHMA 4ZONA 2B9UA 4CP9A 3ZSMA 5FJKA 2VMCA 1DP0A 3NL1A 4CP0A 2Y6KA 2BUKA 2MEV2 4LKFA 5BPXA 5FYCA 1PIV2 1AX0A 1NLSA 4RR3B 2D5FA 3WEZA 2ZGOA 5FY0A 3RGBA 3W5NA 3N7MA 4J25A 1ZA4A 1G9FA 3U4SA 1N3PA 2A3YA 2Z2SB 4XYXA 1V9U1 1X8EA 2W1WA 4IE5A 2FHRA 5FYYA 2ADEA 2BVBA 2GZWA 3AYDA 3LOBA 3LA3A 5IVEA 3V0AB 4QXCA 2ZGRA 4P9WA 4Z92B 5M0TA 3TWIA 2C6SA 4IETA 3JZVA 1PGW1 2EXKA 2C26A 3N3HA 3VDBA 3V64A 3WQBA 2DBIA 3C8XA 4JGYA 2GNBA 5HCBA 1QOSA 2VVEA 4OI0A 3D8CA 3UT0A 1AUYA 5CB7A 1PK6A 4U36A 1HQLA 2VOXA 1EV12 1PO12 1CN1A 2HWC2 5FZFA 5FZGA 1UD1A 3T09A 3P6BA 1BQPA 4BOWA 2UU8A 4NMIA 5A7OA 3ZN6B 2CV6A 1EUTA 1RITA 4N90A 2JDKA 1QQP3 3ZXGA 3AKTA 1DZRA 4MHRA 1W04A 1AR92 4AI3A 2ORXA 3USSA 3IAPA 5KC5A 5GLWA 1AL23 1QWRA 4AZZA 3U0ZA 4AG4A 2YHJA 2OZJA 4JTOA 2JDNA 2JJ6A 1ULPA 3CL1A 1DZTA 2J7MA 2VTXJ 2YBKA 4NRMA 5KXDA 1C57A 1RMU3 2CTVA 2ORZA 4BH9A 4MUVA 1SPPB 4K9SA 1H1AA 3SH4A 2EIDA 2QZ3A 2V5DA 5A6XA 3TB0A 2W94A 1Q8OA 3LOIA 3ZPYA 1AYN3 5IWFA 2H6CA 2WT2A 5GZCA 1MS3A 4AWDA 5JLVA 3AZVA 2G1MA 3O14A 5A3PA 1XSRA 5A6YA 4XUOA 1ULDA 3VBFA 2D6OX 3RG0A 3LEGA 3WT3A 4HXCA 2VU9A 5FCCA 2A3XA 1HX6A 3OBZA 4YG3A 1FAYA 3HR9A 4GKXA 2XJPA 3M3OA 2UWCA 4FXGB 3GBWA 3HBZA 1W39A 1XNAA 3VB9A 1W9TA 1YC61 1YRZA 3HPNA 1NLRA 1O8SA 2OQ6A 2VOVA 2VZQA 5BNPC 5FPAA 2JG9B 4RQPC 4NRQA 4GH4A 4P9LA 4BCUA 2WJSA 3HD8B 3CF6E 1R092 2C24A 1QY4A 2RHPA 1Q8VA 4FPKA 5KHKA 4YVWB 2ET1A 3T2TA 1H4GA 3N9LA 4OUSA 3PUHA 3SITA 1QQP1 1QDCA 1XNBA 5F7UA 3K48A 3RZHA 5DAPA 2GC0A 5FPVA 4CDWC 2B7YA 2R1DA 1VALA 1K12A 3F2ZA 1HRI3 4XFCA 1W2AX 2D3RA 5GLTA 3GCWA 3NV2A 3ROUA 4EV0A 5JAXA 1JYXA 4HSLA 2GC3A 2HWE1 4JV4A 3THPA 5DG2A 1XNKA 3VBOC 1ASJ3 1F31A 5FYUA 2FBEA 1RMU1 4K1ZA 4WVZA 4YFWA 4QD2A 1O91A 4A42A 4AL9A 1WD4A 2GSYA 4S2DA 1BVP1 4XAEA 3TNPB 5TSWA 5EQUA 1DIWA 5CFDC 1H0BA 4YGBA 1YNAA 3GGLA 2RDQA 1AYN1 4XFFA 3Q8CA 3VBUB 4LUKA 1BBT2 4MADA 4ZXKA 5FIXA 2W5FA 1UYZA 3B93A 3DYMA 4XETA 4YPJA 3U07A 1V0AA 1VBB1 2JG8C 3PUIA 3IPVA 2YFUA 3C7HA 2YUEA 3NNJA 3WDYA 2ZXQA 5DG1A 4BQ2A 5JZGA 4N9HA 4HK9A 4HVRA 2ZEYA 1GP6A 1UY3A 4UFLA 2DFBA 3RPQA 4XF0A 3S0MA 5K0UA 4UF0A 3WW2A 3MF9A 1AL0G 3JD73 5CZKA 1LOFA 1TNRA 3ZFFA 3E97A 3IN9A 2ZA9A 3MO4A 1NX9A 4XDOA 5CKMA 2QKDA 4Y33A 5FY4A 3SXWA 1GWKA 1W6NB 3MF6A 4DIQA 2H6BA 5K7PA 3T3YA 2E31A 1JYCA 4KWUA 3WP3A 1AYM2 5KHGA 1WWYA 3OJBA 1JODA 3LWCA 3OGGA 4Y22A 1WA4A 5FY7A 2R16A 4PI2A 5A32B 1BEV2 2A5ZA 1V9U2 1HRI1 1UIJA 4XF9A 3GYDA 3ZIWA 3LA2A 2ZKNA 5A7SA 2BPA2 2WINB 1W0NA 2JDYA 3WDVA 4B7KA 1UOGA 5D8AC 1W8UA 5CAZA 2Q30A 4BJ0A 5J37A 3RMXA 1ASJ1 1QNYA 3VDCA 4Z2WA 3FL7A 1WCUA 1WLWA 3FMGA 3POGA 3LFIA 1DLLA 3DL3A 2NQYA 3HAGA 1PGW2 1SBEA 4MZUA 2J42A 2QQPA 3UKVA 1WMEA 2H0BA 2ZHNA 1FNZA 3DN7A 1W9YA 2IFWA 2J1SA 3ME2A 4AI0A 3KGLA 5LBCA 3ENRA 3O0WA 5CBLA 1NCQB 2CWSA 3OSDA 2WFF3 4FOVA 4CDXB 4AF9A 2BDRA 1O4TA 2AEZA 4CCDA 3MLJA 3SH5A 4LLOA 1MS9A 4GZ9A 3TRSB 3VKLA 4DUWA 4BLJA 1GANA 5A33B 1Q3EA 1Y7BA 1LU1A 5EJ1B 1WLCA 1W9WA 4FFGA 4QQLA 5JXHA 3AYCA 4LLFA 4AAXA 1RJ7A 2V4VA 4XBNA 4QKDA 1A34A 2ZJCA 1IOAA 4PF1A 3ZYGA 3UKTA 3BTZA 4I2OA 1IS6A 4M01A 1XNDA 1ZRFA 2IXIA 1W6QA 4GMP0 5JSOA 3LFMA 4J6GA 3NJXA 5F32A 1LECA 1IGOA 2D6PA 1ZZ7A 2EIBA 3CBNA 4Y1XA 4P00B 1DCSA 4CXYA 4FPGA 1YI7A 3SCHA 5FKCA 3SCFA 1X7NA 3GM8A 4FCAA 1DQ6A 2X53S 2VJXA 1AXKA 3ZKYA 3LB9A 3OPTA 4AW7A 4CSWA 1BMV1 1PM7A 2XVLA 5F5AA 2LS6A 1I5PA 5J98B 4FPLA 4OFGA 2ARXA 1C8M1 1OC1A 2VUAA 3WDUA 5BNPA 5IVJA 3UV9A 3I2FA 3M8LA
chains in the Genus database with same CATH topology
3AZWA 4A3XA 1H1MA 3JUUA 3HQXA 4QQHA 1V6NA 4YVSB 5JPMB 4MLOA 3VZNA 4CP2A 4AI2A 1F5JA 1QQP2 2WLPA 2WFF1 1QJX3 4KWLA 1S1AA 4YZ3A 3WCSA 2WZR2 2RS33 4SLIA 1HV1A 4RR3C 1AL22 1CONA 2RMU3 1ZM1A 3PTYA 4FPYA 4L2NA 2XWBB 5GKAC 3VBOA 2XPJA 2IXKA 4DFSA 3ES4A 2DUOA 3EBRA 2ZABA 4XEZA 1RMU2 4XXAA 1MZ5A 5DZEA 1J59A 4HMZA 5L7OB 4XTMA 3U10A 1AYN2 5D1IA 3I54A 2JG8A 3J26N 1J3PA 1REFA 3BCWA 3FZ3A 3ZXDA 4WVVA 1DDLA 2BYVE 1SLTA 2BEOA 2GMMA 4PBOA 4OI1A 4QPGC 1XYOA 4BLIA 4YM2A 5DUWA 2OVUA 4COZA 3BALA 3WX5A 1DU3D 2AH2A 2PAKA 2WSVA 5BNNB 4CRQA 1LENA 2X8KA 4P9YA 1R083 5IT6A 3FE5A 3LCPA 5HXVA 1WCKA 1LULA 3M70A 1URXA 2WS91 3GZTB 3MDPA 4ISQA 4FTEA 1UL9A 4LBJA 3WINE 2P2KA 3UJQA 2RS31 4WM7C 1HRI2 1GV9A 1LHVA 1IQAA 1SEFA 4AEDC 2RMU1 4EN0A 4C91A 1VLNA 1OFSA 4IV3B 5D8AA 3M3EA 1Z0HA 3KCXA 2CY6A 3IMNA 3D82A 1S0FA 1ASJ2 2DURA 4I0BA 5JOXA 3LSDA 4GA9A 2PLV3 4S2HA 3WHTA 3ZFEA 5I8SA 2VNOA 3AKSA 2VNGA 4MGZE 1O3SA 1GKBA 2GN3A 1GFF2 3AZXA 5FREA 1WMFA 3D0SA 1Y3TA 2WT0A 3H8UA 3N7KA 1RINA 1DGRA 1WCDJ 4AEKA 3DPRB 1JUHA 4OHXA 5JDBA 2JG9C 4FBFA 1U5XA 4HANA 4G9SB 1AZDA 3BU7A 4RHV3 2EF6A 1LGBA 3JD72 2HWF3 2XVGA 4YVWC 4RS5B 3H1MA 1MS8A 2Z69A 5JIAA 4AFDA 1GZWA 2DU0A 1GNHA 4XIKA 1D4VB 3IIAA 1R081 2PHWA 4J1XA 2QDRA 4N53B 2F6BA 1OI6A 1CAWB 2CGNA 2ZAHA 4QX5A 2D44A 1CAVB 2XGXA 3A0KA 3WVJA 4B4RA 4UBGA 2CGOA 3J9SA 1V70A 2WQZC 4PCRA 3IDBB 4LULA 1DGWX 3I8TA 1MQTA 2Y38A 3WCRA 3KCCA 1QJZA 4JGZC 1VBD3 4Z07A 5EYYA 3JB4C 3MLKA 1RUJ3 1BMV2 2PLV1 4X6RB 4Y1ZA 4UW6A 1G9DA 3I7DA 1RHI1 2I45A 1CIWA 2B8MA 4PBPA 1DFQA 3NVCA 4Q0QA 2ZGPA 2YYOA 2BBVA 1NXMA 3O0VA 1NE6A 4SBVA 3AMMA 2W08A 3V0BB 4JDMA 2WFF2 3PJQA 4X8PA 4RHV1 2VQAA 1HIXA 1ULEA 2HWF1 3ETQA 2NN8A 3ZFGA 2JEMA 5EFUA 1LOCA 4TLFA 4COVA 1N47A 1OA4A 1X82A 3RRDA 2B45X 4NHKA 1SLCA 1LHOA 2ATFA 4BA6A 1LR5A 2WL1A 4XXPA 2ZACA 4PLMA 4B7EA 5ABJB 3TBDA 3APBA 4XFHA 4F8AA 1JN2P 4HSJA 4XJ8A 1ENXA 2EALA 1F2NA 2EXJA 3S6PA 5J3UA 3MZHA 2VMGA 1LEDA 4L92A 4IEZA 1VBD1 4I01A 4XTPA 4QPGA 3IT8A 5GZFA 1RUJ1 3SLIA 3H0OA 2GAUA 5LEKA 2EXIA 4P9JA 2V73A 1NE4A 5FMOS 1JHNA 1UF2C 5AFEA 3HT1A 4CDXC 3AXDA 3NW4A 4BE3A 2WNUA 2XJRA 2VXRA 4HPKA 1IKQA 4AHZA 4Q0VA 4BWOA 2A75A 2CNAA 2HWD3 1S0IA 4XJWA 1BK1A 1QJX2 4IV1B 2D3SA 3WHUA 4WM7A 5FO9B 2RS32 4BM8A 2ZX1A 2PELA 4AEDA 2CAUA 1VP6A 2VPVA 4MV2A 2RMU2 1H9PA 2YDEA 4Q4Y3 4PDWB 3VZLA 3MFAA 4XMAA 4B4QA 4R52A 1EPWA 3VHPA 2QZ2A 2PHFA 1GQGA 2JE7A 2ZOEB 4HFSA 4YM1A 1EV11 1PO11 1YJLA 2NLRA 3LAGA 4FPHA 4Q4X3 4Y20B 4BMEA 1W6OA 2XJVA 4QMAA 4XFBA 1O3RA 3QH6A 5JWPA 1ULFA 2WWSA 5IK4A 2RJKA 3E6DA 3THTA 2CGPA 1CAUA 1AR91 4KGGA 2A3WA 1B35B 1H8TB 4XZPA 3ACLA 1UAIA 3IBMA 3VN4A 4C90A 2RR13 2G9FA 4EWEA 5C4WA 1U12A 1RUC3 1YYNA 1EPZA 5FLHA 2VOKA 1LOEA 2Z5WA 1X50A 3VBRC 2R1BA 4Y1YA 2DVFA 3NKTA 1QMJA 3VHNA 3VLBB 4XFAA 1BBT3 4NHLA 1IHMA 5GZGA 1LGNA 2ZKLA 2HWD1 4LHKA 5L19A 3AMPA 3IWZA 4OVEA 1FT9A 1QF3A 4MXWB 5BNOB 2WIIB 1QJU3 5L7OC 1C1LA 4Q4Y1 4LBNA 4JGZA 2DTWA 1EP0A 1UW8A 3FC0A 5JPNB 2PLV2 3O0XA 2NZ9A 1NCRA 3MPPG 3MW2A 4U2AA 1HRV3 4BZ4A 3KGZA 5T52A 4DS0A 4Q4X1 2BQPA 1SQ4A 2ET7A 2GN7A 2OZ6A 2GC1A 3USUB 5BV6A 4FPFA 1ZRCA 4P5HA 4XMIA 5F1RA 4DZGA 5SV5A 2SBAA 3SHRA 3K51A 4BPZA 4XJ9A 4RHV2 4FO9A 2HWF2 2RR11 1YFUA 1FMD3 1RUC1 3R6SA 1LGCA 1WLDA 3ELNA 3VUOA 4R9CA 1D0HA 1VBE3 1NZCA 4LR4A 4KNCA 1UZZA 1TME3 1QXJA 2FMYA 4I0WB 5JMCA 5FRAA 5DUVA 2LTNA 1MS1A 2LALA 4M3CA 1BBT1 4Y1UA 5DXDA 3AP7A 2WZPP 2YROA 3CEWA 4ZU4A 3AFGA 2R32A 5C8CC 2VW2A 4HK8A 2XH6A 1GNZA 1QJU1 2PHRA 4F7ZA 1WLTA 1VBD2 3AFKA 1RUJ2 5HCAA 4YGEA 4YG0A 1KJLA 2V5YA 2VW1A 3EQEA 3DPRC 1BZWA 1H2LA 1DG6A 1WW5A 2PYTA 4NN0A 4R4ZA 4YGCA 4JCKA 5IK5A 4CEWC 1AYM1 4Y5Z0 3VZKA 2Q4SA 1ENSA 1ZRDA 1D4M3 2WC2A 1BEV1 2SLIA 1D0GA 5IUQA 1JXNA 4GWMA 3ILFA 4N53C 5I93A 5DUXA 1FMD1 1GZ9A 5C9AC 4WM8C 3WQ7A 4FTSA 1LCLA 3SCGA 1HW5A 1VBE1 2VNRA 2JECA 3VDDB 2X29A 3QOPA 1E57A 1ZVFA 1F5FA 5T5OA 3B01A 5AVPA 1V6LA 2TNFA 1IS4A 4HKWA 4Q27A 5CVRA 4HKOA 2LM3A 3ZSEA 5C33A 1CR7A 1PZ8A 4D94A 1YUDA 2ZX0A 1YCIA 4OLLA 2E7QA 2WZR3 4XOGA 3M3QA 1CAXB 3VBSC 4W6YA 1UN1A 3I59B 1S0JA 4PLNA 3ALQA 2XL7A 3AZYA 4AK3A 2D6KA 4Q8LA 4PIYA 1PNFA 1ND2B 3VBRA 3ZSLA 1MZEA 1NA1B 3OD0A 1WGPA 1D4M1 1S0DA 1NQDA 4C0BA 2HWB3 2HWD2 4Y24A 2QCSB 5FLIA 2JDZA 3RYKA 4Q8KA 4AVSA 3FWEA 1QDOA 3WV6A 3VZJA 4YSFA 5ABJC 4Q4Y2 3PVBB 3KCYA 2D93A 2CWMA 3M1HA 1C28A 2XJQA 3S7IA 4ITCA 4AGGA 5JCTA 1ZZ8A 2RE9A 1KQRA 4PIXA 3MIBA 4HN1A 3OY8B 1VAMA 1SBDA 2IXLA 3URFA 1I3HA 5H9PA 4Q4X2 4W65A 5KHJA 2IXHA 1POV3 1RUI3 2PAMA 3FHIB 4LE3A 4LHLA 2X5IA 2WLQA 3LGRA 2R063 3CJIB 5FOBB 4DMIA 1VR3A 2VUJA 4DINB 2WZR1 1RL3A 4RGGA 2Z79A 4CDQB 3POSA 3OYWB 1AL21 3MIHA 2RR12 1K5MB 1WBFA 1RUC2 4HVOA 5H9RA 2DCJA 4GKYA 4ORFA 2B39A 4IV1C 4WZCA 3L2YA 3WOGA 2NPIA 3E5UA 1SFNA 2JICA 2Y26A 2VW0A 1HLCA 3GBGA 4EN9B 5GM0A 4RFT0 1Y43B 3PNAA 2CL2A 3RI8A 5C8CA 1OMIA 4AI1A 2D97A 2EVXA 2ZGUA 2UY8A 1QJU2 1W0PA 2RJLA 3FBYA 1OHFA 3ZMOA 2B46X 4COUA 1D2QA 3FFQA 4KG8A 3I2DA 4AHYA 3T1LA 3B5LB 4Q1RA 4QGNA 3GZUC 3DPRA 4S2GA 1MS4A 3POYA 1ND3B 2C0ZA 1OFNA 1HRV2 4DOUA 1IKPA 1H8TC 4CEYC 2YC0A 1DQ5A 2DCYA 1AVBA 4IEUA 4L97A 4XF1A 3WDXA 1RUI1 4CEWA 4TWTA 3AMHA 1N3QA 2R061 5FQ0A 1JH5A 1SDWA 3RSJA 5CFCB 3J8F3 2A6ZA 5FPZA 1CAWA 4HETA 5C9AA 1FMD2 4IEPA 4WM8A 5E88A 1VBE2 2ZCWA 1BKZA 1TME2 1WD3A 4Q2FA 4JRAA 1AR63 1FV3A 2YGLA 1RTVA 1ZBE3 2OUHA 3N36A 4P9GA 3G6JB 4CDUC 2XL9A 2YGMA 1S2BA 4EN8B 4HLTA 3MPBA 1WMDA 4OHVA 3UK9A 3JBG3 1H9WA 1Q8QA 3U11A 3VBSA 3JD71 3VBHB 3ATGA 1IZ3A 4D7YA 3BB6A 1DHKB 4M0HA 1W6PA 1YFWA 3P3NA 4YG6A 3BTAA 4J1WA 1NG0A 3N7JA 1LOAA 3W59A 4K6BA 3B69A 4FQ4A 4E27A 3NAPB 1PGSA 1CQ9A 4XBQA 4KU8A 1D4M2 2W39A 4AEJA 2ZX2A 3OTFA 2ZZJA 3AKPA 1QJY3 1LESA 3J8F1 4UW5A 4I02A 4LBKA 3RNSA 1LODA 1V00A 3AP6A 1T6GC 1HV0A 4CYDA 3WLUA 5HI0A 5BYNA 1QNWA 3ZDSA 4URTA 4GIQA 2OIIA 4XE9A 1QU0A 2NMOA 4YW3A 4LO5B 3ZMNA 1SLBA 3KQRA 1LEMA 2D3PA 5K8SA 4I30A 3O5SA 3HIFA 4MX3A 4QPIC 3ST7A 3ZYPA 4RQPA 1ZBE1 1X33A 2BFUS 3IDEA 3ZIXA 2BWAA 5DDJ3 4JGYB 1HKDA 1UZYA 4FPOB 4Q4V3 4CDWA 2ZBJA 3JBG1 1GYKA 1PK6B 4Q0UA 2KM2A 4L99A 4WV8A 1MACA 4ZKTB 3CO2A 5HCFA 3ZXAC 3DUIA 1SLAA 2OA2A 2QUOA 4IV1A 5JR7B 2A6YA 5T5JA 2JE9A 2BWCA 3MGUA 4LBQA 4LBQD 5CFDA 4COWA 4LT5A 5H9QA 4D7SA 2MNGA 2HWB2 4E4SA 1N1YA 1QJY1 2GNDA 3OF1A 1C8NA 2HEYF 3R4DB 1N1SA 5LEJA 3MIDA 3RMYA 1OSGA 4Y20A 5L36A 1DQ2A 2E7TA 2YMZA 1MEC3 2WT1A 2ZAAA 4R4XA 3MI8A 2OUJA 1RUF3 3KZ4C 4CEYA 4HT1T 1S2KA 2NP0A 3H9AA 4XJAA 3TN93 1RUI2 5FOJB 1KS4A 4O9GA 5DDJ1 3WW3A 2XJTA 2R062 4Q4V1 1BVVA 1QJX1 1QKQA 4GH4B 5GLZA 4FTBA 1YXWA 2W68A 1AJKA 1NA1C 4FVVA 5T5PA 4N43B 4G4FA 4MGKE 1KRIA 2YY1A 3MLLA 1C5IA 5FAXA 4IQPA 4QQ2A 3RDIA 4AVBA 1Q8PA 1RJ8A 1I6XA 3WDWA 4LNVA 3OGJA 5E89A 1M4WA 4CDUA 1WCSA 1C4RA 1H4HA 4ASLA 5FMOL 2R043 4DY5A 1W6MA 1XYPA 4EWDA 2PHUA 4AGVA 4I3GA 4MXVA 4MVTA 1O7FA 2I07B 5EYXA 3USUA 2ENRA 3IPVB 4B3NA 2D7FA 4LTAA 4QHBA 2VQ0A 5JZGB 3HWJA 3CJIC 4AQ6A 2XLFA 3Q9OA 3FFZA 2GC2A 1IS3A 2P37A 1RUF1 2XHKA 2DFCA 2O0OA 4CDQC 5B2GB 1S0GA 1JUIA 3AYEA 3N7LA 1KXGA 2ZHLA 3TN91 1R1A3 1K5MC 3RYRA 1YJKA 2VECA 1O5LA 4I0AA 4A7KA 1FYUA 3AP4A 1KFUL 4Q0PA 1DBNA 1G6NA 3J8F2 4AFCA 3VBUC 2R49A 5AC93 2A6XA 4Y22B 1SBFA 3TNQA 3HN1A 4AE2A 2HJIA 2ERFA 1AR62 5JOWA 4QPIA 4AVCA 4OI4A 1ZBE2 3NV3A 5E8AA 4B4PA 5LK7B 1RVF3 1NY71 2VULA 1PZ9A 1Q8SA 1NYWA 2R041 3MIFA 1ND3C 5J7MA 4M3CF 5DZFA 3H50A 3JBG2 5JOZA 1VBC3 2XB6C 4RR3A 3QLQA 4YGDA 3WP5A 4AXOA 1Q43A 1G9CA 1RUE3 2Y0IA 2WA4A 5DUUA 1VBA3 3HMYA 4YRDA 1KFXL 4NWWA 5F5QA 2WSUA 1U0AA 3DGTA 3WP4A 5I0SA 1SCRA 4XF3A 1R1A1 1TMF3 3V0AA 2N7GA 4K1YA 4HKLA 1ZYBA 3JU9A 1LHUA 4ES8A 2K0GA 2IXJA 3ES1A 3FLTA 4ZU7A 2ZMNA 1QJY2 3IKWA 2PA7A 4YZ2A 5AC91 1VRH3 3VKMA 4FT8A 1OOPB 1W6QB 1V6IA 2AUYA 3D0JA 2D5HA 4K3UA 1DQ1A 3ZN6A 1WW4A 3GF6A 2A71A 3OCPA 4ATEA 1NCQC 3B94A 2FZ1A 4JVAA 4X6QB 1AHSA 2BNNA 2OPKA 1H2MA 2ZGMA 1J3RA 1RVF1 5BUVA 1OD5A 4N7UA 3E5QA 3ILNA 5AVAA 2Q0AA 3AM2A 5DDJ2 1OPMA 1VIWB 1RGSA 4KQ7A 4XFIA 4XHBA 3WQ0A 1PO23 4RL7A 4Q4V2 4Y1VA 1VBC1 1NA1A 4EN6B 2IZWA 4XW3A 3OBTA 1GZCA 3NAPC 5IK8A 4Q29A 2C9AA 1G9AA 2Q8OA 1VBA1 4IEQA 3AKRA 4GMP3 4B8EA 2PHTA 2DCZA 3GHNA 3NV1A 4FOWA 4QU2A 1U5YA 4HL0A 3VBOB 3VZMA 1V6OA 3NV4A 1WW6A 1A8MA 3VV1A 1VAKA 4ONUA 1LTEA 3WD5A 4CP1A 2JG9A 1PVXA 1CX4A 1VRH1 3WG2A 4FAHA 2JG8B 1XQNA 4YVWA 5KC6A 2YZ4A 3KM5A 1OPOA 2UYBA 4IEXA 1H1IA 1ZRRA 1BCXA 4YVSC 2BPA2 1MEC2 4JGYC 3CJIA 2TBVA 4O9EA 3GZAA 1RUH3 4XILA 4UW3A 3FX3A 1RUF2 2RS53 2HKXA 1ULCA 2I74A 1O5UA 3EXUA 3TN92 1SLLA 1K5MA 2BVVA 1HXS3 1XU1A 1PO21 1VB4A 3MW4A 3T1MA 3QACA 2OYZA 2C1FA 1YO8A 3UL2A 4NPRA 3VBUA 4S2FA 3ASIA 4QM9A 3EJKA 2GALA 3L9JT 3VKNA 1MVQA 2Q1ZB 3SH3A 2G4IA 1O3TA 4KBBA 1LOBA 3KS7A 4F3JA 5JOYA 3SNMA 5H9SA 3S7EA 2DV9A 4CTEA 1MZ6A 2GU9A 3E6BA 4WVMB 3OD4A 1NY72 3ZFEB 3O12A 2GNTA 2R042 3MIGA 2NM1A 1Q56A 3R4SA 4YYOA 4E2SA 3V65A 1XE7A 5BNNC 3WUCA 4AFMA 1W6NA 4K21A 4KG0A 1CJDA 1YHFA 3MFCA 4MSVA 3RS6A 1LHWA 5AFBA 4P14A 3E5XA 3NWKA 4DPNA 1G86A 3RYPA 5A32A 3RZZA 2R073 2RS51 4AHWA 1J3QA 1KS5A 4N43C 2EXHA 3LZZA 3O7OA 4IV3C 1R1A2 1HXS1 4X8NA 4RGAA 1GR3A 3ZO0B 3VGIA 4EJRA 1GZWB 2ILMA 1Z7S2 3FUQA 3QD6A 3WR0A 4GB33 1ZBA3 1V6KA 4NHMA 5GZEA 4QXKA 5GJ6A 5AC92 1UU6A 4DNYA 1SMVA 4TZDA 1ZZCA 3ZYRA 1XRUA 3RWNA 2PN5A 4Z82A 4PF5A 1NCQA 1ULGA 1MQTB 1RIRA 4IESA 4AQSA 1HRV1 4C0HA 4CDXA 4AFBA 3AB0A 1FI2A 3N35A 4MH0E 4A7ZA 1O4ZA 1RVF2 3BOPA 3WY6A 4RS5C 1MS0A 2QFEA 5A33A 3WW1A 5IK7A 1YWKA 5GZDA 3SMHA 2DTYA 5T5LA 3M7AA 3AXEA 1FOD2 1B09A 1JOJA 4DB5A 2ZZQA 1VBC2 1N1VA 2BW8A 3GHMA 5EXOA 1G7YA 4AHXA 1CPMA 4OHYA 3I4IA 1ZZ6A 4H14A 3D5OA 5ACA3 1RUE2 1CGPA 5EWSA 4QT6A 1COV3 1H30A 3ZN5A 1VBA2 2HEWF 2R071 3ZYIB 1TME1 2F4PA 1OQDA 3OPZA 1TMF2 1X36A 2Y0OA 4V1PA 3ZFGB 3W58A 1XE8A 2R30A 4HVQA 4NR1A 4IXLA 3NSTA 4XDQA 4E2QA 3FLRA 1AR83 1G8WA 4GB31 1ZBA1 3M3CA 1DYPA 3VHRA 1VRH2 4R9DA 4DQAA 1FX5A 3WG4A 4ZU5A 2WFPA 1XU2A 2DYCA 4L9BA 4F83A 3B9CA 4RSUA 4FPJA 1ZREA 3VL8A 2H0VA 1W0OA 4YVSA 3PVEA 4PIZA 4KWKA 4BIOA 1PZ7A 4XQWA 4QPGB 3AJYA 4E4ZA 4FPCA 3AZZA 1EAH3 1LB2A 4LO4B 1QH7A 2PHXA 4H7MA 4PJYA 1GICA 2A7AA 4Q26A 1PO22 1QGLA 3AJZA 1ENRA 1YLLA 2A6WA 5JIUA 2O1QA 1DQ4A 2D98A 1UKGA 5J09A 2WNUB 5L7OA 2GMPA 5I8TA 5ACA1 5FDBA 4HPKB 2R0FA 5T54A 2HWE3 1NQJA 1COV1 5KXEA 3MW3A 1PGL1 1UPIA 2EIGA 2YPJA 5JI7A 1F8VA 4WM7B 3ZXFA 2ZGSA 3VKOA 2PQQA 4AEDB 1C5HA 3A0NA 1O4YA 2PHLA 2XKOA 4WVWA 1ENQA 2GH8A 1OOPC 5KHIA 4GULA 1VBB3 2ETEA 4L11A 1V6MA 1GSLA 1SLIA 2W52A 2D6LX 1AR81 1JYIA 4H3WA 3PHMA 1OA2A 4LE4A 1R1ZA 3P3PA 4DXZA 5BNNA 3GBFA 1KD7A 3AP5A 3NKGA 1CESA 1W6OB 2DF7A 3WZ1A 3TOJA 1SFYA 5CG8A 4CZSA 1O3QA 2AYHA 5T3NA