1ZBA1

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
191
Chain Sequence
TTTTGESADPVTTTVENYGGDTQVQRRHHTDVGFIMDRFVKINSLSPTHVIDLMQTHKHGIVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKAPFTRLALPYTAPHRVLATVYDGTNKYSTQLPASFNYGAIQAQAIHELLVRMKRAELYCPRPLLAIKVTSQDRYKQKIIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 36
structure length 191
sequence length 208
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba100
2X5IB 4WM7A 4CDWA 1RMU3 1V9U2 2R062 1C8M3 5C4WB 2BFUS 4Q4V3 1AR73 1AR83 4RS5C 2R042 4AEDA 5FOJB 1BMV2 1AYN3 3VBHC 2R041 1C8M2 1RHI1 4IV3B 4CDXA 2WS92 1OOPB 4N43A 2RM22 1RB8G 4QPIB 1FPN1 1V9U1 5ABJC 1MEC1 2BPA2 1VBD3 2WFF3 2RM23 2BFUL 1TMF3 1X36A 3VBRB 4CEYA 4Q4W2 1FOD3 1HRI3 4Q4X3 1RHI2 1HXS1 1X33A 4Q4W1 5BNPA 4IV3A 1HXS2 1NCQC 4QPGB 1F2NA 5BNNA 1FPN2 5BNNB 4JGZB 4QPGA 4Y4YA 1MEC2 3J8F1 5BNPB 1AR91 4GH4C 3VBFC 1WCDJ 1AL22 4N53C 4CEYB 3VBRA 1FOD2 1VBD1 2WFF1 1VBC2 1PGL2 1VBD2 2WFF2 3VBUA 4QPIA 1CJDA 4N43B 2RMU3 2XBO2 4WM8A 1OOPA 1RUJ1 4AEDC 1AL23 1R093 1RUG2 1EAH3 3VDDC 4FSJA 2RS33 1ZBA1 5CFDA 1EV13 5AC91 2HWB1 1RUD3 1AL21 1NA1A 4Q4X2 4EJRA 2RMU2 3VBSA 1HRI1 3JD72 1NCRA 1TMF2 3DPRA 3ZFEC 1VAKA 1QJX1 5A33B 1C8NA 4RHV2 3ZFGB 5D8AA 4RQPB 2HWB2 1OPOA 1R083 4N43C 3VBOA 2HWC3 1ASJ3 5L7OA 2R043 1PO12 4NWWA 5K0UB 3CJIA 4Y5Z0 1RUE1 1Z7S1 2XBO3 1AR63 4Q4Y2 2RS11 5D8AB 1V9U3 3ZFFC 3ZFGA 5BNOB 1NCRC 1H8TC 5A33A 1HRV3 5FMOL 5JZGB 1IHMA 1D4M3 4RHV1 2RS52 4GMP0 3TN93 3DPRB 1RUF2 4QPGC 1NCRB 4CDQA 1NCQB 2RS51 1HRV1 4RR3A 4Q4Y1 4GB33 1AYN2 1CD3G 1PO13 1BEV3 4CDWC 1QJU3 2XBO1 1RUE2 1RVF2 1Z7S2 5ABJB 1AR61 1VRH1 5C9AB 1BBT2 1PVC3 2RM21 1RUF1 4YVSB 1R082 1ZBE1 4WM8B 5JZGC 3ZFGC 1H8TA 1ZBA2 3VBHB 3VDDA 3VBUB 3ZFFB 5AC92 1PGW1 3VBUC 5BNPC 1POV1 1ZBE3 1RUC2 1FMD2 4CDUA 1AR62 4Q4Y3 4RS5A 1RUC1 1RUH2 5CFCC 1BBT3 1AYN1 4JGZA 1NY71 4JGYA 4BCUA 2WZR2 1QJZA 2RS31 1AUYA 4CEWC 1OHFA 1VRH2 1AYM1 4CEWB 1RUG1 2RS53 1D4M2 2RMU1 1QJX3 3VBOC 1RUH1 5L7OC 2PLV3 1TMF1 3JB8A 2XPJA 4GB31 2RS12 4Q4X1 1RUJ2 1H8TB 1QJU1 2DF7A 3M8LA 4N53B 1HQNA 1AYM2 4CDXB 5A32A 2RS32 5ABJA 3VBSC 5K0UC 4WM8C 4YVSC 3ZXAC 4AEDB 1NOVA 2WWSA 1FPN3 2VQ0A 2RR11 5C4WA 1R092 1RUG3 2HWF1 4CDWB 1HRI2 1RUH3 1VB4A 2X5IA 3VBRC 4CDQB 3NAPA 4RR3C 4RHV3 1RUC3 5CFCB 2R072 1GFF2 5BNNC 1R091 3LOBA 4IV3C 1RUI2 3FBMA 1PVC2 4PDWB 5K0UA 5D8AC 4GH4B 3VBFB 4IV1A 1AR72 1ND2B 5DDJ3 5C4WC 1R1A1 3ZFEA 1VBA3 1K5MA 5C9AC 1ZBE2 1RUJ3 1VBC3 2IZWA 3J8F2 1RUI1 1ND3A 4RQPC 5J98B 1AR92 2BUKA 4NWVA 3NAPB 4CEYC 1TME2 2HWD1 1VBC1 1VRH3 3ZFEB 1MQTC 1PVC1 3DPRC 4FTSA 1RVF3 1OOPC 4JGZC 1PO21 5DDJ1 1VBE1 1ND2A 4IV1B 5DDJ2 1EAH1 4GH4A 3VBFA 5LK7B 1FOD1 1DDLA 1A6CA 4PDWA 5BNOC 1AR81 2R063 4Q4W3 1COV3 2FZ2A 1VBE3 2WZR1 1PGW2 1TME1 2HWD2 5CFCA 1D4M1 4Z92B 2PLV2 2X5IC 4GMP3 1QJY2 1PO22 3JB4C 1FMD1 4QPIC 1W39A 1VBA2 4YVWA 1RUE3 1Z7S3 1NY72 1B35A 1RUD2 4GB32 1QJU2 1RUD1 1ASJ1 1NA1C 2HWC1 4JGYB 1COV1 2PLV1 1RUI3 1RMU1 2RR12 5A32B 2HWF2 1QQP2 1TME3 1C8M1 2FZ1A 4CDUB 1ND3C 1MQTA 2GH8A 2TBVA 1AR71 4N53A 1HX6A 2R073 2HWE2 1SMVA 1ZBA3 4RFT0 2MEV3 4CDUC 3ZFFA 3VDDB 3VBHA 2HWE1 4FTEA 5ACA3 5C8CC 1COV2 1MQTB 1PIV2 4FTBA 2R071 3HAGA 2R061 4CEWA 5C9AA 3IDEA 1B35C 1BEV2 4LLFA 5ACA1 1BMV1 1ASJ2 2HWC2 1VBB2 4SBVA 1B35B 5CFDC 1QQP1 4GMP1 1VBB1 2Y26A 1R1A2 2BBVA 4RS5B 1NG0A 4YVWB 3JBG1 1EV11 4WM7B 3TN92 1NCQA 5C8CB 2MEV1 3JBG2 1PIV3 3TN91 1HRV2 2MEV2 1BBT1 5JZGA 4WM7C 3JBG3 4PDWC 3JD73 5BNOA 4IV1C 1VB2A 1RVF1 1R1A3 4YVSA 5FMOS 1BEV1 3CJIB 1EV12 4YVWC 2RR13 1R081 5GKAC 1EAH2 2GSYA 3CJIC 4RR3B 1PGL1 4Q4V2 2WZR3 4CDQC 2QQPA 4RQPA 1F8VA 4Q4V1 2RS13 1FMD3 1POV3 1K5MC 3JD71 5AC93 1ND3B 1POV0 1PO23 1QJY1 3VBSB 1QJX2 4CDXC 3S6PA 1ND2C 1M06G 1NA1B 1K5MB 2WS93 2HWF3 1AL0G 1QQP3 1VBB3 1VBE2 1MEC3 2ZZQA 5CFDB 1E57A 5J96B 1AR82 2ZAHA 2WLPA 1PIV1 1AYM3 1VBA1 5L7OB 1PO11 1HXS3 3VBOB 4JGYC 1RMU2 2ZTNA 1RHI3 5ACA2 2HWB3 3NAPC 1RUF3 2HWE3 1QJY3 3J8F3 1AR93 2HWD3 2WS91 5C8CA
chains in the Genus database with same CATH superfamily
2PQSA 4BK4A 2ZGRA 3JUUA 3MIHA 4WM7A 1EPWA 2VUAA 5IK5A 3ZN6B 1BK0A 2C9KA 2D6OX 2D3PA 2ZGPA 4YM3A 1CX1A 2BFUS 3NNGA 2ZEZA 3KGLA 3WG2A 3CO2A 3POWA 5L9VA 3RZZA 1WGPA 2ZACA 1J3RA 3VBHC 2R041 1C8M2 4I01A 4LHLA 5APAA 3O1OA 1YNAA 3OUHA 3D5OA 1SLLA 1G9CA 2J1TA 1DGWA 2VQTA 3GBWA 1U5YA 4AVCA 1OOPB 3LDBA 2FCUA 3IIIA 1S0EA 2A75A 2IXCA 5JXGA 1LOAA 1OLRA 4QPIB 4NOTA 4QMAA 1FPN1 2MNGA 1NXMA 3THCA 5T52A 3Q8BA 5FYSA 2XXZA 4EZHA 1PK6B 1MEC1 3HJRA 4YYOA 2BPA2 4COWA 1VBD3 3IWZA 2BFUL 3Q8FA 4L2NA 4S2HA 4Z2AA 2XMLA 4Q0SA 4NROA 4D69A 1HRI3 2N7GA 5A7NA 2VBDA 3UL2A 3ZX7A 1JOPA 1JW6A 1V6OA 2TUNA 3S30A 4A3XA 5B4NA 3LD8A 5LY1A 1AX2A 1RINA 1PMHX 3RYKA 1XJAA 4AGVA 5JR2A 2ZGSA 1WLTA 2ZA9A 2ZGOA 3VN4A 2YB7A 1FPN2 2ZOEB 1Q8OA 4OYUA 4QPGA 4A45A 1MEC2 3MW4A 3ACGA 4XCBA 3OGGA 3OSDA 3J26N 2NMOA 3WQBA 3T4VA 4MGKE 4OZXA 3SHRA 1K42A 3IM0A 1QXRA 1SPPA 3NKTA 4EWDA 1S2KA 4GJZA 5AFBA 2W3JA 1ZA7A 4NIHA 2RDNA 4X6RB 1JU3A 2VMGA 2LALA 4GALA 5HV4A 5FOBB 4CP9A 4BLJA 2YPJA 3POFA 1RC6A 1VBD2 4FOYA 4R9DA 1W6OA 3VBUA 3VKNA 2DTYA 1JH5A 3ACLA 1DQ1A 4LBKA 5FZ9A 1FV3A 5FZ1A 5IVJA 1GOFA 1W0OA 3WNPA 2XBO2 1H1IA 1VIWB 1OOPA 5FCCA 4N9IA 4KNCA 3U4XA 1S0IA 4H7LA 3Q8EA 5G04L 2WWJA 4P08A 2PXJA 2WQ4A 4FXKB 4Y20B 4ZHNA 1X8MA 5DABA 5CAZA 1ACCA 4GXLA 4XVHA 2VULA 5HCHA 2DVFA 2PHXA 1W6QA 2Q8CA 1GQGA 1HJFA 1NA1A 4Q4X2 1KFUL 5H9PA 3KT4A 4CA9A 2VXRA 4HN0A 4XFAA 2YC2A 3INAA 5FQ0B 3DPRA 3PU8A 2J1AA 4OULA 5FP8A 3ZFEC 2HYKA 3THTA 5G05L 4W6XA 1HN0A 1PNGA 4BB3A 3TEYA 3SH3A 1K45A 5HI0A 1AF9A 4IEPA 1VJ2A 4BQ1A 2WT0A 3ZFGB 2XHKA 3H8UA 4ARXA 4RQPB 3WP3A 1U12A 1STMA 3GALA 4XABA 1UYXA 1JYTA 3S57A 4LT5A 1R083 5CU1A 2HWC3 4KWJA 5L7OA 3O1PA 4QWNA 2E33A 4JV4A 2R043 1JOBA 4X6QB 2X05A 3E5UA 2VUJA 2E51A 3CJIA 1UX6A 4XW3A 1Z7S1 2VNVA 3KS7A 5GALA 5FIXA 2WJSA 1Z78A 3A7QA 3JQXA 1QXJA 4Q4Y2 5IJRA 4A7KA 1YIFA 1L7QA 4FI9A 1V6MA 1LESA 2BNMA 1Q8PA 3B02A 3NJYA 4Y4RA 3DKWA 5FMOL 1XC6A 2WN2A 4BISA 1IHMA 3AVRA 1JYVA 4C8DA 2ZGTA 2VZTA 3DPRB 5F3GA 2JEMA 4XXAA 2VNOA 2FDIA 4J6GA 2RS51 1WBFA 2P5BA 3MHZA 1KS4A 3ZXKA 4LBQD 2YFZA 4KBZA 1SLTA 2A6VA 1FXZA 4E2GA 5FMDA 4GB33 2W5FA 3N4MA 2R30A 2VBPA 2GC0A 5DAQA 1BEV3 4CXXA 5FZ6A 1LGBA 3G6JB 2E7QA 5FZDA 3THDA 3I2FA 1Z7S2 2VD7A 1RL3A 3U78A 5FDBA 4DUXA 1I1EA 1XE8A 1X9TA 1PVC3 5AVAA 4UFJA 3I2KA 2VMCA 1HQLA 2D7FA 2J1SA 2GMPA 1JZ3A 1R082 1UIKA 1ZBE1 2W87A 3M1HA 3QCWA 1PM4A 1RXGA 1UY0A 1WW5A 1H8TA 2H6BA 1OD5A 1ZBA2 3LA7A 3VBHB 3VHOA 4CCEA 2PAEA 5AC92 1ULDA 5EJZB 1O4YA 5FZEA 5M0TA 1UQXA 2JDYA 3JQWA 4CP9B 1W9FA 3VBUC 5JAXA 2GNBA 4AI2A 2GNTA 3N7KA 1ZBE3 1DFQA 2IXIA 1W9WA 1SPPB 1Y43B 5LA2A 4E4DX 3POJA 4R4ZA 1RUH2 4WV8A 5FRAA 4ES8A 3MZHA 1AYN1 2QBXA 4FPJA 1NY71 3URFA 3WEZA 2WO2A 2O8OA 3MIBA 4BCUA 2NP0A 3E5QA 1YI9A 3OPZA 4IEQA 2ZAAA 3AL6A 4CEWC 5FR3A 2I45A 3LA2A 1CGPA 1S0DA 3FHQA 1W8ZA 3WP4A 4PIZA 4MGYE 2LUWA 4P5YA 1RUG1 4AGRA 2X53S 3IN9A 3FUOA 3P3PA 1D4M2 1H9PA 3FFZA 1JYXA 4QKBA 1FNZA 3ES4A 4FOWA 5L7OC 3JB8A 4DRVA 2YZ4A 3H3UA 1CIYA 2XHNA 3WLUA 2RS12 1CAVA 3PUHA 4Q4X1 4RGGA 4MGTA 2VGDA 1H8TB 2VL4A 5FZ7A 4YARA 5LWBA 1LGNA 2HH9A 3M8LA 1H4GA 3LOIA 4MGQA 2CHHA 2P3YA 3P3NA 3KGZA 3N9NA 5C5TA 1KJRA 1DCSA 2QQOA 4BOWA 1VR3A 2VG9A 1C1FA 5GLZA 4LIVA 4G3YC 1T2XA 4WM8C 4WZCA 1JYWA 1WWYA 3ATGA 5DXDA 2Q1MA 4AEDB 4O61A 5EQUA 1NOVA 1RUNA 2GALA 3NJZA 1EP0A 2WNOA 5C4WA 2YY1A 5L36A 4JHTA 2QJVA 4QX0A 4CDWB 1HRI2 3E6CC 3V65A 1UU4A 1I5ZA 1HLCA 2D3RA 2GC3A 3Q8AA 5FYVA 1UY2A 2D6PA 1OF3A 5J7MA 3K4AA 4MXWB 3KCCA 2RDQA 3L9JT 4DS0A 1AXYA 3L2HA 4QX2A 2HBTA 2Z69A 3MDPA 3A0KA 1YXWA 2IVJA 3W5MA 2HEVF 4KH9A 1KRIA 4P14A 4L9BA 5FY8A 2JDAA 3POBA 5ISLA 4QDRA 2QQKA 1H2KA 3PMEA 2XKPA 2R072 1GFF2 2ORZA 5FZLA 5BNNC 3EBRA 3D3AA 4QPYA 1W2OA 1UCXA 1W6NA 2A5ZA 3DL3A 2OA2A 2WZ8A 5EFUA 4ZS2A 4BHPA 3LOBA 4IV3C 4QU1A 3WDWA 1C57A 3I3DA 5C6CA 4PDWB 2PHRA 4YW6A 4JQTA 4NPMA 1F5JA 1Y9MA 4IV1A 5FFOC 5F3CA 5EZWA 1KD7A 4NAOA 5C4WC 5F2SA 1PMIA 3ZFEA 2JKXA 4E4SA 1YYNA 4UBGA 3AXEA 4TWTA 1UF2C 4Q26A 3AYEA 4XF9A 1ZBE2 3OPTA 1JYCA 1VBC3 2ZGUA 4XURA 2BW8A 3J8F2 4K8FA 2JJ6A 1LOGA 1AR92 2LTNA 4LO6B 2BUKA 4Q2FA 5GLVA 5FQ0A 3G7DA 4CCLA 5LZ6A 3ZR5A 4LO7A 4E2QA 1OLMA 1SDDB 2A6XA 4I0WB 5CG8A 3SCFA 1VBC1 4ZY9A 1MQTC 2B8MA 3DPRC 2ILMA 4FTSA 4JGZC 3H9AA 3W58A 1CAUB 4BDVB 4TZDA 2CYFA 3ITQA 3ZXJA 5LK7B 5DAVA 4XYXA 5F1RA 2HEYF 1DDLA 4MVTA 5A80A 4DO0A 4E4HA 4OHVA 4FVVA 1NLRA 1S4CA 3KVBA 1LODA 1O8PA 2XUMA 1NZCA 5A1FA 1PZ7A 2VZ1A 4C91A 2X8KA 2H0BA 4WBBA 2BGOA 4HOOA 4META 1C1LA 4C1WA 2CWMA 1W6OB 1XNTA 1S1AA 2C24A 2X5IC 2X29A 4LLOA 3FUQA 3HPNA 4QKDA 3OUJA 3E1F1 2GMMA 2GZWA 5HXVA 3VD7A 1US3A 4JDMA 3WDXA 1AX1A 3LDKA 3I4IA 4QHZA 1VBA2 5FZCA 3WINE 2Q8EA 1RUE3 3MIEA 4CE8A 3AM2A 4PQ9A 2VTXA 3TYJA 4HONA 5K4LA 4ZS3A 1WCQA 4LBQA 1RUD2 1ZRRA 4DPNA 2D6NA 2QE3A 3CBNA 1DGRN 2PHLA 2BERA 2WWUA 3KF3A 3QBQA 4OVEA 3TOJA 1CAWA 1ASJ1 2V09A 2ZHKA 3NVCA 2PLV1 2W0XA 5FPUA 1IS3A 4LK6A 3LAGA 1UZWA 1RMU1 2WIIB 3R4SA 3AFKA 4FOVA 3LEKA 3N9QA 3OBAA 2DUQA 3AMNA 4XJ8A 1C8M1 3RZMA 1OQEA 1KEXA 5DAPA 2GH8A 2I2SA 2GNMA 3BU7A 2E32A 2W46A 2P17A 4GWJA 4IUGA 2R073 1W28A 2TNFA 1SMVA 1Q43A 1UZVA 1W90A 2F17A 4O65A 3R6SA 3BPZA 3D6EA 3VBHA 3RMXA 1UY4A 3S7EA 2CDOA 2D5FA 2VC9A 5E1RA 2DFCA 2SLIA 5FBJA 5FYMA 3M7AA 5C8CC 3HD8B 4FTBA 1HB3A 2JG9A 2R071 3HAGA 4DXSA 3H50A 3WX5A 5FYIA 3H0OA 4IEOA 3ZO0B 2KXLA 2BWAA 3RMYA 2Z4FA 4CU7A 4XBNA 1UMIA 1BEV2 1T6BX 2PTMA 3I2GA 3JZVA 4H55A 1NXD1 4ISQA 4RA0A 1ASJ2 5FMCA 3U37A 4DIQA 2DU0A 1XSRA 1BMV1 2QQLA 1GNHA 4AI8A 2AYHA 2YMZA 5H9SA 4AVVA 5CFDC 3TAYA 4CUCA 4GMP1 1R64A 1VPHA 4AHZA 1KJLA 5CZKA 5ANNA 5EYYA 5A3NA 5KHKA 3CDZB 3I2IA 1A34A 2P4EA 3HN3A 2P2KA 1MZ6A 4K40A 3SMHA 2AUYA 2VZPA 2MEV1 1PIV3 5JXJA 1LNSA 2ID4A 4TYSA 3KZ4C 1BBT1 4AAXA 1F9KA 3FC0A 4K21A 4WM7C 4M3CA 4UFIA 2PHTA 1O59A 3I2JA 1H1MA 4YGEA 1NLSA 4C0BA 3MW2A 1UZ0A 4I0BA 5DPNA 4YVSA 5FMOS 3I49A 5HPOA 1XYPA 4D6SA 5I91A 4XPVA 4EN6B 2WNUB 4UYBA 2BU9A 4ZZ8A 4IEZA 4YGCA 2CV6A 2PHUA 1NT0A 3D0JA 1N3PA 3GZUC 4QHBA 1WUVA 4Q4V2 2VO5A 3UV9A 4RD7A 4EWAA 4FPCA 3OYWB 1JHNA 2EXHA 3C7EA 2WNVA 1V0AA 1XOYA 3I3BA 1ULFA 1ODNA 3LA3A 4XFGA 4PLOA 4B4PA 5KC5A 2VZRA 1ND3B 3MUZ1 2PFWA 1POV0 2DVDA 1PO23 4MZUA 1CX4A 5FP3A 2EXIA 5JUVA 2CGOA 3KHCA 4XBLA 1NA1B 4QX5A 3ZN5A 1W04A 2HWF3 3ENRA 1WKYA 1Q8QA 4MYEA 4BPZA 1VBE2 2NQYA 1DZRA 1O4ZA 3HNYM 2H6CA 2ZEYA 2WR9A 2BOJA 4Q29A 1POQA 1FNYA 1AR82 3LGRA 1BLZA 4Q5OA 4Y20A 1MS9A 2VUCA 4R9CA 1PO11 1HXS3 1O8SA 3AZZA 3B9IA 3CKHA 4FQ4A 4NMIA 3X29B 3HR9A 1RMU2 2W2IA 1VP6A 4LIUA 2C9AA 2WNVC 4AEMA 1H0BA 1ZZ6A 4NRPA 1YFYA 2O0OA 4GJYA 3BTYA 2C1FA 1W8TA 1WMDA 4QX3A 2J22A 1LTEA 2UURA 3HMYA 1LOFC 1QDOA 3WP6A 1DYOA 4LHSA 2HWD3 2WS91 5C8CA 1JTZX 3NQHA 4D6QA 2X5IB 1ZZCA 1JXNA 3AL5A 1X82A 2SBAA 4KI5M 1V9U2 2R0FA 2H0VA 2R062 3WW2A 1LENA 4L8QA 5C5UA 3RZHA 4Q4V3 5IAXA 3OCPA 3NV1A 5FAXA 3T2OA 2V5DA 4FPYA 1YJLA 2BEOA 1J59A 1DF0A 2FD8A 5DUXA 3O14A 1N1SA 3O7OA 3A21A 3P1IA 4IE0A 3MFCA 4LKSA 4CUBA 4U36A 3KCXA 1URXA 2UWBA 1LR5A 1S55A 2JD4A 3C2UA 3N9OA 2AEYA 2OPKA 1OH3A 4FFGA 5TSWA 3T1LA 5J48A 3T09A 3T1MA 1YQ5A 1RB8G 2J1VA 4DQAA 2KD7A 3PTYA 4AF9A 2DCTA 3WHTA 1V9U1 5IUQA 1O91A 1Q5OA 1D4VB 3MFAA 4LQRA 4N7IA 3AX4A 4BMEA 4DXTA 2A3XA 1KDKA 3AB0A 1SEFA 4YGBA 3S5QA 2NPIA 3DXTA 3NV2A 2VU9A 4DRRA 1BHGA 4LE3A 4W50A 4CEYA 5I8SA 3CJXA 1FOD3 2P6CA 2XLAA 1X33A 4D6RA 2JG8A 2E9QA 5BNPA 1VAMA 3IPVA 5T5LA 4EE2A 1HXS2 4NAMA 3U11A 1PZ8A 3ES1A 3OGJA 4HG6B 2JWPA 3LKJA 4BH9A 3ACIA 2B45X 3WDYA 5FUIA 4QD2A 2NLRA 2YBKA 2J1RA 3MIGA 3CMGA 4RGKA 4XQDA 4Y4YA 3WF0A 4CSWA 3J8F1 1JI6A 4TSVA 2JDPA 3NWKA 2JG8B 2YBPA 5BNPB 5A6QA 1AR91 3B7MA 2NMNA 1AL22 2V5YA 1H4HA 3H1WA 1MS1A 1Y9QA 5FY1A 4P9GA 1IQAA 2ET1A 3WW4A 2WLQA 1OA4A 1LECA 1VBC2 4EV0A 5FK8A 2YC0A 3RI8A 2XJQA 2Y60A 5HXMA 1FI2A 2RDRA 2WFF2 3FMGA 4QKFA 2VOVA 2ZZJA 2VCAA 4LA2A 3L2YA 5H9QA 4EQVA 5FPAA 4AR2A 3KT7A 4KWLA 4YM0A 2GU9A 1CJDA 2BBAA 4N43B 1YRZA 1KS5A 2XB6C 4P9JA 2RDSA 1D2SA 4H14A 2AREA 4OHYA 1OQDA 1AL23 2ETEA 3PVNA 2BVBA 4P9LA 3VDDC 1OLME 5FO7B 1O5UA 2B42B 2QFEA 2VZOA 3MW3A 2QCSB 3AMMA 1XE7A 5FPVA 3ST7A 1T6GC 1JZ5A 1ULEA 5CFDA 1BJQA 4CZSA 4LNVA 4YNIA 4KQ7A 2ZGKA 1NKGA 3ZKYA 4F3JA 5AC91 4JTOA 1RUD3 4AHWA 4XHBA 1AL21 3U14A 4XIKA 3U10A 5C3RA 2G4IA 2RMU2 2VNGA 5J09A 3VBSA 1H6YA 4Y1ZA 1HRI1 1NCRA 2OQ6A 1TMF2 5LATA 3WNNA 2ERFA 1YLLA 4NPLA 4KU7A 1F31A 1QJX1 2D43A 4Y1XA 2WRAA 3VHPA 4LBJA 1C8NA 1UWWA 2OUHA 3OEAA 1GU3A 1BQPA 4TXWA 1H8VA 3LFIA 1J83A 1ONAA 4XJZA 3O1VA 3NNLA 1YIPA 2BNOA 2VQAA 3ECQA 4MO3M 3VBOA 3PJYA 3GHMA 3CIHA 3POYA 2E6VA 4E4ZA 3HIFA 1ZZ9A 4CPBD 4FBFA 5BXXA 1C5IA 3C7HA 3NL1A 2OXBA 3K3NA 1GZWB 1OD3A 1RUE1 2IFWA 3OEBA 4QM8A 1ZRDA 1WCSA 2P6HA 4BQWA 1QNWA 2RS11 1GMMA 3I59A 4XFHA 4B1LA 4UBHA 1S0CA 1V9U3 4FAHA 1G9FA 3RZJA 4YZ1A 3NV3A 1XRUA 3THPA 2DBIA 5CEHA 5FUNA 2WNEA 2R16A 1HRV3 1MR5A 1XNKA 3PUIA 4YWAA 5I0UA 1REFA 4K3UA 1DQ5A 5JDBA 1G9BA 1D4M3 1UNBA 4RHV1 4GMP0 3TN93 2JDHA 4OI2A 1RUF2 2J42A 4QB6A 2HEWF 4HSLA 4Q1PA 1DLCA 4QQOA 1U5IA 1HRV1 4DY3A 4HVOA 5JPMB 4KL1A 3SC7X 1QOOA 5LBEA 4W65A 4WVZA 5A6XA 4BQ5A 2XLFA 4OQ8A 4LTAA 4HSJA 4CDWC 2XBO1 4JKKA 4XQWA 4GQ7A 2QTWB 3FWEA 2ZX1A 1AR61 5CBLA 1QJFA 3IAQA 1VRH1 3BVCA 4LO5B 1EPZA 2D44A 2ZX2A 1WBLA 3BALA 2RM21 3PUAA 4PJYA 2QQIA 2O14A 4LPLA 4Y26A 4HKLA 2ZGQA 4FFFA 4WM8B 1JZ7A 4FP3A 1J3QA 2P3JA 4JX0A 3T0AA 4HKWA 3ZOIA 4BZ4A 4FO9A 3BU0A 4M3CB 4NHXA 4Y22A 3ZFFB 3BOPA 1PGW1 3FFQA 2VCMA 1ODMA 5JI9A 3B9CA 2AEZA 4MH0E 1UPSA 2B39A 5IK4A 1QH6A 2B9UA 2WSUA 5SV5A 4XAEA 2TEPA 4CDUA 1AR62 4YW1A 4Q4Y3 4QXKA 4M3CE 3GM8A 3N7MA 1BBT3 1UPIA 2VR4A 3RS6A 4YPJA 5LCWL 4JGYA 1QJZA 4U2AA 1QGLA 3SISA 5IFPA 3CNAA 1LU2A 3DGTA 3H1MA 4FPGA 3B94A 3QH6A 4JC1A 4XTPA 3W59A 1DZQA 4E8CA 1UY1A 3WV6A 2W1QA 1BCXA 3NJXA 2G1MA 3QH7A 3MEPA 4FOQA 3WOGA 5BNOC 1AYM1 4CEWB 2Y34A 5JOWA 3WUCA 3UESA 4HN1A 2RS53 2RMU1 3LZZA 5D1IA 1QJX3 3SLIA 4BQYA 5I0SA 2ZX0A 3VBOC 2PMWB 2Q5TA 3SCHA 3EMRA 4BIOA 3GCWA 1KQRA 3RDIA 2WUHA 2Y6GA 4GWMA 2VY0A 3MI8A 4Y22B 2BDRA 4GB31 2WYFA 3I97A 5FY5A 1RUJ2 4ISRA 3OOXA 1DHKB 3VZJA 2DCZA 3N7LA 4FPFA 1W3VA 2VVEA 4XEZA 5JIAA 1CWPA 2P1BA 4LITA 1GOHA 1UKGA 2BZDA 5E6HA 3VKMA 3KHBA 4CDXB 4DXRA 5A32A 1LRHA 4WZFA 3VDCA 4B4QA 1Q8VA 3IDAA 3PHMA 3TEXA 1UD1A 4YW2A 4P9WA 3AZYA 4R9BA 3ZXAC 4UT5A 1TQ5A 2C26A 2RR11 4AZZA 5IK8A 5HBAA 2VZVA 2XOMA 3I2HA 2HWF1 3ZKUA 3V0BB 1RXFA 2WYSA 3WVJA 5D2AA 3B93A 1XNBA 1CZVA 1RUH3 1VB4A 4UWDA 3RNSA 2OVUA 3NAPA 4AQSA 5FY9A 3M4FA 4M4PA 4RR3C 4RHV3 4A42A 3PIJA 3J7NA 2WO7A 4NHMA 4JQRA 4S2FA 3GCXA 3Q9OA 3AP4A 4NE9A 5BUVA 5CFCB 1GWKA 2D98A 2EIGA 4BE3A 1GNYA 4DY5A 1DGRA 2VVDA 4KG0A 5E8AA 1W8UA 1US2A 2LS6A 4WVMA 5GLTA 1GZWA 3ZXEA 4XFCA 1KXGA 5LBBA 1WMEA 2DCJA 4BXFA 1NQDA 1GBGA 1ZRCA 1ND2B 3HN1A 4B3NA 2PYTA 5C3PA 4OI0A 4K7JA 2JDNA 4PT6A 5FPLA 2WL1A 4KBBA 1WD4A 4BYYA 3M2MA 3H42B 3KLSA 3WW1A 4R52A 1VBA3 1K5MA 1X8EA 5DG2A 4XJAA 5C9AC 1JU4A 3ZIWA 2D5HA 3WHUA 2DFBA 3K3OA 1RUJ3 2PELA 1PHMA 2IZWA 1ZRFA 1WLCA 1RUI1 4QQPA 4RQPC 1ZREA 5FZ4A 1JYNA 1V70A 2CAUA 4LORA 4XETA 3OF1A 4GWIA 4NWVA 4AVTA 1SCRA 1OKOA 1RTVA 2B5HA 1ULPA 2WNVB 2ADDA 2A73B 3HQRA 3PVEA 1TME2 3KWVA 1A3KA 3B5LB 3ZFEB 1XSQA 3KV4A 4XACA 4LKDA 5FPBA 4CVUA 5JOZA 1RVF3 1OOPC 3SH4A 3HBKA 3N36A 1W2UA 3DUIA 4IV1B 5DDJ2 4GH4A 1LOEA 2WNUA 3VBFA 1FOD1 4LKEA 4AOCA 4AAPA 2GP5A 2VOTA 1IS4A 2D6MA 4PDWA 1AR81 2R063 3AK0A 2VH9A 3AC0A 3HOBA 3AZXA 1DLLA 1GZ9A 4IEVA 4MHUA 4DUWA 5BV6A 3MLJA 3O1SA 2HLEA 1W6NB 3BTZA 1QEXA 4AFBA 4CXWA 2WZR1 2QDNA 4CCJA 2XDVA 1RYYA 2VUDA 3APBA 2HWD2 3MIFA 4PIYA 5FYUA 4Z92B 5FZHA 1RJ8A 4NJ4A 1Y9GA 3NJVA 2JDUA 4DNYA 4YSFA 2A71A 3RSJA 1YC61 3NKGA 1MZFA 4C1XA 3GJAA 1W39A 2W91A 2XWBB 4QM9A 4CUGA 1WW6A 2VMIA 2OUJA 2OZJA 4QX8A 1NY72 1YEWA 2KM2A 2WABA 2Z5WA 1SLAA 3AKQA 3ZDVA 1B35A 4AQ6A 3I3MA 1ENXA 5C3OA 3POEA 1XQNA 4JVAA 2D93A 2HWC1 2WNUC 2BGCA 3J4UH 3N3HA 2IWGB 5DAWA 3AJZA 4BQ3A 4I2OA 2RR12 4J1XA 1PX3A 1J58A 2HWF2 5FUPA 1W8OA 1Q3EA 5D21A 1MS8A 4CDUB 3VKLA 3N9MA 1OMIA 3B01A 1U5ZA 1X50A 4MGZE 1O3RA 3MPBA 2XJRA 4B4RA 2E26A 3W20A 2MEV3 4CDUC 3DEMA 5KHGA 2D6LX 2HWE1 4P02B 3PTRB 4LOTA 2ZGMA 2F4PA 3O1TA 1DU3D 4DXZA 4HANA 2XJVA 4L0PA 5FO9B 1A8MA 1LHUA 2EVXA 3K2OA 1G86A 3MLKA 1G8WA 4XQ4A 5C9AA 2DBNA 2JDKA 5LASA 5JLVA 4LLFA 3U4SA 1IS5A 2BJSA 2J7MA 2E53A 2WZEA 3ILNA 1K12A 3ZYPA 5JCTA 5FYYA 4BMBA 1V6LA 1CZTA 1OLQA 1SFYA 1QQP1 1LOCA 2A3YA 4SBVA 1VBB1 2ZKNA 4CU9A 5IYYA 1BYHA 1OC1A 1R1A2 1OA2A 1EV11 4QDQA 1WA6X 4NVPA 5A3MA 4MUVA 4KU8A 1LHVA 5C8CB 3MLLA 3K4DA 2VW1A 4LUMA 5JZGA 1E5IA 1PZ9A 1G7YA 2XR4A 5KHIA 2BGPA 2VOXA 2YU1A 2E63A 3OGRA 5LBFA 4QKNA 2JKBA 4XCAA 3Q8CA 4IV1C 1VB2A 1RVF1 1R1A3 1OBNA 2K46A 3CF6E 4OFGA 3M3EA 5GZEA 5L9BA 2FMDA 3PIGA 4YVWC 3ZYRA 4RGAA 4ASMB 5I93A 3A22A 2CTVA 1JZ6A 2P3KA 1UYPA 4PBOA 3UNPA 4MX3A 2GSYA 3AP7A 4AHYA 1MZEA 2R7EB 2WZR3 1CAXA 3USUA 4IEUA 2BWCA 4S2GA 4BLIA 4CDQC 1F8VA 1ZVFA 3WR0A 2QQWA 5CB7A 2PAKA 2VMFA 2JIGA 1Y3TA 1POV3 1MS4A 2V4VA 3JD71 3MYXA 4XTMA 4UW6A 5FXXA 3GZEA 1OSGA 2V72A 3DXUA 3VBSB 1QU0A 4CPBA 3EHKA 1S0JA 1G9DA 5LK5A 3S6PA 1ND2C 4XIOA 2WS93 3CZJA 2XQRA 1AL0G 3OB8A 4YM1A 4PF1A 5JWPA 3O1RA 4LBLA 2DWRA 1UO9A 2ZZQA 5CFDB 4ZXEA 2WQZC 3BOWA 4J1WA 4F7ZA 4GKXA 3O1UA 1SDWA 3UGFA 1LHOA 3V0AA 2WBKA 2JB4A 2WLPA 2ZAHA 4LHNA 1PIV1 5IT6A 4YZ2A 3T08A 4BA6A 4JGYC 2OX0A 3BCWA 1I9RA 4I30A 2ZTNA 3T0BA 2OS2A 5ACA2 1JUIA 4MXVA 5LW9A 2HWB3 4AI3A 3J7HA 1LHNA 3KVAA 4PCRA 3WQ0A 2Y6HA 1RUF3 4NUBA 3LQCA 4AE2A 4Y1YA 1O3TA 2HWE3 3ACFA 4HT1T 4XZUG 4UFLA 1W99A 1NUKA 3BUCA 1SQ4A 3LF7A 3LSDA 1IOAA 3O0VA 1C5HA 3GHNA 3UKNA 1S0GA 4CDWA 1OUSA 2UWAA 4XUOA 1W6MB 4M4RA 5JVVA 5C4WB 2ZABA 4XC9A 2ZCWA 2MPFA 4FPLA 2ZS6B 5A7OA 1AR73 3VLBB 2Y0IA 4F8AA 4AEDA 4RS5C 3VZKA 3OGSA 2WA3A 5FJHA 1HB2A 2PQQA 3IPVB 4LUKA 5C7GA 1V6JA 1V00A 1QWRA 4IV3B 2QQJA 4RSUA 4Y3OA 2QZ2A 3NSTA 4FPOB 1W2NA 3B69A 3OGVA 2RM22 3BKZA 3S0MA 1PM7A 2JD9A 3C7GA 4CP0A 2P34A 5ABJC 2PA7A 2EIEA 1YJKA 4JCKA 5IW0A 1K3IA 1TMF3 4ZPIA 2QQVA 4PF5A 1HB1A 3H8OA 5A6YA 1HN1A 4PI2A 5DZEA 3BIWE 1HXS1 3BN6A 1WLWA 4XDOA 4Q4W1 3T2TA 1NCQC 4QPGB 3WCRA 1UOGA 4FPEA 5LB6A 4PIXA 3ZLIA 4CU8A 3TB0A 3AYCA 4JGZB 4QGNA 5CKNA 1BZWA 4NO4A 2DVBA 3QOPA 4E2SA 3H8RA 3RWKX 5CYYA 1H1AA 1GP6A 4OQ9A 2HYXA 4FPKA 4FXGB 3WD5A 2AENA 2WFF1 1GANA 5FZGA 4QXCA 2XL7A 5F5CA 3NO8A 2BRTA 3JCIA 3F2ZA 1JS9A 1W9YA 1IPJA 4IEWA 4QPIA 3VDBA 3H8XA 2JXAA 1W8WA 3M3QA 4A6SA 1RUJ1 1W06A 2CNAA 2ZX4A 2IXJA 1JBCA 1W0NA 2OT7A 1G6NA 3JU9A 3O12A 3MGUA 1R093 1RUG2 1EAH3 5F5IA 5J37A 4CRQA 3LIHA 5JPNB 3WDVA 4BU2A 2Z42A 3ILFA 3UJOA 4FSJA 1REEA 1QXPA 3T2QA 3WF3A 2W1UA 1Y7BA 2WAAA 2KR2A 2ZGNA 2A6ZA 4JRLA 2HWB1 1B09A 1YQ6A 2FDHA 1J1LA 1DG6A 2CWSA 2YUEA 4O9EA 3CU7A 4EJRA 4NR1A 2ATFA 2I07B 2XJTA 4V2WA 1W2AX 2R49A 1SCSA 4NHYA 4G4FA 5EWSA 3WCSA 4DINB 4D7SA 2JDMA 5GJ6A 2EAKA 5FZIA 5I8TA 3KQ4B 5A3WA 3DCQA 1VAKA 3LCPA 3N9LA 4RFRB 3O1MA 1W05A 3USSA 3WT3A 4N9HA 5A33B 4W8JA 3MPPG 4H2AA 4A7YA 2UYAA 2EIDA 4UF0A 3DF0A 5D8AA 4EN8B 4P9YA 2HWB2 2ADEA 4LR4A 4UFKA 2AZ5A 4PBPA 3U1XA 4COUA 1C28A 3UYJA 4JDNA 3IBMA 2RV9A 3ZYBA 1VMJA 1FV2A 1L3JA 1WMXA 2C6SA 1PO12 2Z2SB 3GBFA 5DG1A 4ATFA 4Q8KA 2J1EA 4Y5SA 5JI7A 5FTTC 3SXWA 1JYIA 1IS6A 1MACA 5EJ1B 5JXHA 2XBO3 1WA4A 3SKJE 1AR63 2W1SA 4ES9A 1VALA 5D8AB 5DUWA 1QH7A 2CSGA 4J25A 3ZFGA 3ZFFC 2HKXA 1H8TC 4K8RB 1UMZA 4AGGA 4HBNA 5A33A 2VZSA 3HT2A 1AJOA 1R1ZA 1ZYBA 2Y6LA 2YPDA 3HEIA 1ZX5A 1QOTA 3V64A 2VAUA 3BPSA 4EYUA 3AP5A 2QVSB 5IATA 3IDBB 4QPGC 2O8QA 4CDQA 1SG3A 1NCQB 1E5SA 5A6ZA 1UOFA 3VB9A 4AVBA 4GA9A 2XUEA 1YQ2A 2JIJA 4AEKA 2Q4SA 1W03A 5FZMA 5GLWA 3SNMA 4MG2A 4Q4Y1 4Z1VA 1AYN2 1YFWA 1N1VA 1CPNA 1O4TA 1PO13 1QJU3 3U75A 2YGMA 2GMEA 2DDUA 5ABJB 3KD4A 4UI9L 5FY0A 4CCKA 4AFMA 2WSVA 4YZ5A 3F95A 5F6LB 5BPXA 3BTAA 4HZFA 4GKYA 1YWKA 3ZFGC 5FYZA 5EHDA 1HDKA 4N90A 3VBUB 5ANQA 1VMFA 1LEMA 1QF3A 1CESA 4INDA 2Y33A 2JG8C 5FLJA 5BNPC 4BQ2A 2JICA 2WN3A 4RYDA 1ZRIA 2BNNA 2W08A 5KXBA 3KV6A 4COYA 3RWNA 4BIFA 1K5JA 2EF6A 4B7KA 5K7PA 4RS5A 1RUC1 3KQRA 3OY8A 1AZDA 4JRAA 2CGPA 2G9ZA 4AK3A 4XUPA 4JGZA 1CAWB 2WO1A 3GBGA 2B46X 4K1YA 1JMUB 1OVPA 3J9SA 4W6WA 4Y5TA 1OHFA 3WUDA 3M70A 4EROA 1PX4A 1OT5A 3H7JA 4DB5A 5JZGC 2UY8A 2K2SA 3OY8B 1XU1A 2C4XA 4YRDA 1SLCA 3ZPOA 2A70A 3LFMA 2GN7A 3ZXFA 4MHRA 3QD6A 3AMHA 3MF6A 4BWOA 4ZKTB 3NV4A 4Z82A 1RUH1 4QDSA 2PLV3 2XPJA 2DVGA 2JX9A 2ZX3A 3N9PA 3CZUA 1W3XA 1BKZA 3H3ZA 4D94A 1F5FA 1SLBA 2R1DA 1UU5A 2XL9A 2JENA 4M0NA 5FZFA 2P37A 4NIIA 2DF7A 3W21A 4AVSA 4FFIA 4IE7A 3WSOA 1JODA 3T4HB 1ST8A 1HQNA 2DU1A 5DAXA 2AR6A 3FE5A 3KB5A 5ABJA 4IGQA 3VBSC 1EY2A 4SLIA 4YVSC 5FY4A 1ALYA 2WWSA 2PHFA 3ZSMA 4I02A 2B9VA 2VQ0A 4QXHA 3UK9A 5F7UA 2Q1FA 3RI9A 1N3OA 1W6MA 1IG0A 1W9TA 4I3PA 3AXDA 1XE0A 3WF1A 2XVGA 2NN8A 3HNBM 2MHFA 1E5HA 1QKQA 1SFPA 1TE1B 1W9SA 5IHRA 4CDQB 5FLHA 4BK5A 5A1AA 1OVSA 2VBBA 5C33A 3OUIA 4JHZA 4LBOA 4AWDA 4AHXA 4AVAA 1D2QA 2XLGA 3NNJA 4XOGA 3RPQA 2PN5A 4CYDA 4MSVA 1GKBA 5GZFA 3AMPA 4IESA 5CG9A 5FP7A 5KXCA 1UL9A 1JN2P 3N35A 1XNAA 1N1TA 3WF2A 3T3YA 5FP4A 1MS3A 2IXHA 3FBMA 5A7SA 3VD4A 1MS0A 1DGLA 1PVC2 3ZMNA 4GH4B 3VBFB 2Y6JA 3V0AB 1AR72 5HCFA 3T30A 3WZ1A 5CA6A 5KXDA 2YGLA 4Q8LA 3WW3A 3WY6A 4XAAA 1F4HA 1CPMA 2O1QA 4WVVA 4NPRA 2WFPA 3P6BA 4QU2A 2DV9A 3AYAA 3POIA 5LRSA 4NHLA 2ZMKA 4MV2A 2JB8A 2VCBA 4AI9A 3BODA 2LROA 4XXPA 3MV01 4EWEA 4Y33A 4KWUA 3FHIB 3RZLA 4N8MA 4D7TA 4DOUA 2W9XA 2ZMLA 3IMMA 5EP9A 2OQ7A 1F4AA 3EJKA 5CIRA 1LCLA 3PVBB 1JHJA 5GM0A 3AZWA 1CAXB 3USUB 1UMHA 1W6QB 1PVC1 4LMFA 4BM8A 2IXKA 2GDFA 3FN9A 4XDPA 1IKPA 1GSLA 5DDJ1 1PO21 2LW8A 1NQJA 2DVAA 3HNMA 5C70A 1ND2A 5KBFA 4A44A 2DUPA 4XF1A 1TNRA 2LRPA 2GNDA 4Q4W3 3RGBA 5FXWA 1WCUA 4WVMB 2Y6FA 3ZDSA 1HB4A 3NNFA 2Q8DA 4M01A 1XB9A 1L7LA 4PLMA 5L19A 1H2MA 3WDUA 2FZ2A 4QX1A 3K51A 3QLQA 3ZSLA 1GOGA 4F83A 5DUVA 1PGW2 1CAVB 5CFCA 1D4M1 3A0NA 3KV5A 1GWLA 3RRDA 4MGSA 4P9IA 2PLV2 4AQTA 3T0DA 2ARXA 5JIUA 1DIWA 1Q8SA 1GR3A 1PO22 1FMD1 5HCBA 5F37A 4IGOA 3OBZA 2ORXA 4QPIC 3N7JA 4TLGA 5FLIA 5GZDA 4DFSA 2XWJB 4UFMA 5IVCA 4XMIA 2K9ZA 4Q0QA 3M3IA 4YVWA 1FAYA 4NIDA 4UW5A 5C3SA 5DZGA 5IVFA 1GYKA 1LGCA 1YCIA 1LULA 1KFXL 1GP4A 2FQPA 2VW0A 3D8CA 3DV8A 5J36A 5EIYB 3ORJA 5KXEA 3R4UA 1CR7A 1H9WA 2UYBA 1AX0A 1SBEA 3SQOA 1NA1C 3ZN4A 3VD9A 1COV1 4W6YA 3RQ0A 4UAPA 4IDZA 3R05A 1RUI3 4COZA 4P5HA 5A32B 1HV0A 3I8TA 5FMBA 1TME3 2WA4A 1ND3C 1MQTA 3MV11 5FO8B 3OTFA 4HXCA 4N53A 1D0HA 1QY4A 1HX6A 1WD3A 4TLFA 4Y1UA 4OMDA 2ZHNA 3B00A 2HWE2 2ZGLA 1PK6A 3AKTA 4RFT0 4UFHA 5IK7A 3WQ7A 4O9GA 4FTEA 2Q8OA 5IVEA 3SEEA 5ACA3 3S5AA 4QX7A 1ULGA 3FL7A 3I3QA 2NYYA 2ZHLA 4A4AA 3OPWA 1COV2 3GDBA 1IG3A 1ZNPA 1FYUA 1PIV2 2D97A 5FV3A 2R061 2WO3A 4CEWA 2OYZA 3VL9A 1YHFA 2VMHA 1SACA 2R0HA 2YG0A 2ZKLA 3ZR6A 1HQWA 1G9AA 5I0DA 1LJ7A 2W52A 3FZ3A 5T50A 4A7ZA 5ACA1 3RZKA 1OH4A 2DUOA 2DYCA 4IEXA 1VBB2 3AKRA 3OG2A 3ILRA 3M3CA 3LDRA 1B35B 5JSPA 4OUEA 3ZN6A 5FWJA 4JKMA 1NLQA 1UZYA 5F9TA 2BBVA 1NG0A 3MICA 4WM7B 3O5SA 5F3EA 2ZXQA 4DZGA 3ROUA 4K1ZA 3TN92 1NCQA 1ENSA 3JBG2 2L9LA 3WNOA 1JUHA 1S0BA 1WW4A 3PDQA 4C90A 3BB6A 1OI6A 1I5PA 5LA0A 2XVKA 2F4LA 3ON7A 4YW4A 3GZTB 3IAPA 1O3QA 4XJ9A 3JD73 1QHDA 1YO8A 2FDJA 3R0RA 5K8SA 1WLDA 1HV1A 2GC2A 2E7AA 2Y0OA 4HPKA 3DYOA 1BEV1 4LBMA 1IZ3A 3CJIB 4A2UA 4G9SB 2RR13 2VJXA 1R081 3RG0A 3K48A 2OW4A 3C8XA 4LXLA 3SCGA 4Y24A 4I09A 3WQ1A 1UYYA 1LB2A 1DYPA 2XGXA 4RR3B 2VTXJ 5FREA 1PGL1 1F35A 3ZM8A 2QQPA 2FBEA 1VE0A 4RQPA 4X8PA 4P9XA 1O7FA 5LEJA 4XUNA 1MPXA 4KGQA 5A3UA 3K75B 2R1BA 3VZMA 2YFUA 4GZ9A 3TEZA 3IKWA 1FMD3 4GIQA 1CIWA 3ZYJB 1K5MC 3AKPA 5AC93 2BP6A 2ARCA 4XBQA 5LY2A 2A6YA 5T5OA 3UGHA 4ONUA 2IFRA 4YW7A 3TBDA 4CDXC 5IFTA 1K5MB 4FFHA 3ZXDA 1QQP3 5KHHA 1QIQA 1VBB3 3HT1A 5E88A 3FLTA 1VLNA 4AXOA 2XKOA 2FDFA 1MEC3 3E97A 5CKQA 3RJ2X 2ET7A 1JZ2A 5T3NA 2QKDA 3HQUA 2Q30A 1UW8A 3PL0A 4CTEA 1VBA1 1C4RA 1DGWX 3VBOB 3MBWA 2EAAA 4FT8A 4M0HA 4ASKA 1XPWA 4AYUA 3VV1A 4IETA 2DTWA 5CVRA 5L73A 3IIAA 4OMCA 4XDQA 3ZXLA 3NAPC 4FAGA 1BVVA 5GZCA 3DYPA 2G9FA 1Q56A 3J7LA 1EUTA 1QJY3 2AGSA 1DQ0A 4B29A 2P3IA 3PUQA 5DUUA 1CD3G 1KGYA 5FJKA 1GZCA 1GQHA 4MOAA 4R8HA 5F5QA 1RMU3 1C8M3 2WINB 2JE7A 2FMYA 4YZ4A 2DCKA 1EYBA 1AR83 2I74A 2R042 4XZPA 1N47A 5JR7B 1AYN3 5FOJB 1BMV2 4YW3A 3H1YA 5FZ3A 3SH5A 1SLIA 1RHI1 1P8JA 1UKRA 2D3SA 5GLUA 4HVRA 3TRSB 4FCAA 4CDXA 5A3LA 1W8NA 2YC4A 4M00A 2WS92 3BIEA 5CNAA 1IGOA 2WT1A 3B3QE 5A7QA 1VMHA 2EICA 2UY9A 4N43A 3RVHA 3ZSKA 1JZ4A 3SEPA 3FLRA 3UETA 3I2OA 1DZTA 1QOSA 3ZIXA 2XJSA 3ZVXA 4PLNA 2EIBA 3TNQA 2WFF3 5CKMA 2RM23 2CGNA 4MGIE 5FYCA 1X36A 5K9YA 3VBRB 3GZAA 5E16A 1AVBA 3ACHA 5CADA 4P00B 4Q4W2 1J3PA 2RHPA 3POGA 1RHI2 4Q4X3 5AFEA 4H3WA 2VCCA 4LBNA 3PU3A 4IV3A 1CJPA 2IC1A 3ALQA 5DZFA 4WVWA 1F2NA 4CCNA 1J84A 4CCCA 5BNNA 1I3HA 4JTNA 1GICA 3D0SA 3AJYA 3VUOA 5BNNB 4FPHA 5FZ8A 5F2WA 5A3TA 3JXSA 2QQUA 3WNLA 2JECA 4ZZ5A 2PHDA 4UW4A 4GH4C 3VBFC 2VXJA 1LKNA 3EB7A 1WCDJ 4L99A 4N53C 4ZU4A 5T5PA 2PHWA 3BTXA 4CEYB 1SBFA 3GXUA 5IWFA 1FOD2 3VBRA 5JMOA 1ENQA 1VBD1 2ES3A 4NN0A 2XG3A 3D82A 1PGL2 1NE4A 4OUSA 4BQ4A 2WAOA 2YDEA 1UN1A 2RMU3 4WM8A 2GC1A 5EV7A 5FKBA 4D3WA 4PQQA 3PNAA 4AEDC 1GNZA 2W39A 2ENRA 5FYHA 3RZGA 2DCYA 4COVA 3LEGA 1E5RA 4C0HA 5H9RA 4CU6A 1QMJA 2FCTA 2W1WA 2RS33 1ZBA1 1EV13 4N7UA 4DMIA 1BK1A 3AVSA 3UKVA 1UY3A 2FDKA 1SZBA 3VL8A 3BYWA 2VPVA 4GULA 3WF4A 4YLZA 5EYXA 5F5AA 4V1PA 4XILA 2YBSA 3JD72 1IQDC 5JSRA 1OFSA 1W6PB 2J1UA 3FHAA 3PMSA 2VM9A 1MZ5A 1PVXA 1ZZ8A 1APNA 4AEJA 1UZZA 2OPWA 1LHWA 4FQZA 2XVLA 2UU8A 3LE0A 3NRUA 4NRMA 4RHV2 5FZ0A 3ZYFA 2OZ6A 2FCVA 2PAMA 3I59B 2Z79A 4XUQA 1WW7A 4YG3A 3PVOA 1OPOA 5A7WB 4N43C 3HWJA 3NNMA 1ASJ3 2BTVC 3OBTA 1HIXA 4QGMA 4XJUA 1HKDA 3OJBA 3ZMOA 4AW7A 2ZEWA 5LRRA 1ZZ7A 1PNFA 1GWMA 4Q0PA 2JDZA 4EZ4A 4NWWA 4Q1RA 5K0UB 1NYWA 1UOJA 4Y5Z0 4DEQA 4HFSA 3AYDA 5A7WA 4XHXA 3IDCB 4CUAA 1X7NA 4Q0VA 5BNOB 1NCRC 1REDA 5GZGA 5E89A 3GYDA 4HKOA 4XJWA 2BOIA 5JZGB 4LHKA 3ZXGA 1CVNA 2RS52 4BJ0A 3KV9A 3J7MA 1NCRB 3C3VA 4QGLA 2RE9A 2VQUA 5F6KA 3EQEA 1W8FA 4M3CF 2W94A 4IW3A 4ZXKA 1L7RA 1XNDA 3V0BA 1H6XA 3PUSA 2AH2A 1UU6A 1YUDA 2A1XA 2JE8A 3LSEA 2VECA 4RR3A 3O0WA 5FKCA 3VZLA 1H2NA 4D8MA 1LOBA 1V6KA 1RUE2 1RVF2 2GAUA 5C9AB 1BBT2 3WNMA 4HPKB 1RUF1 5BY5A 2EXKA 4YVSB 3C7OA 1KDMA 1DQ2A 3MO4A 4OHXA 4L92A 3CLPA 2R6QA 2QQMA 3PJQA 1AXKA 3VDDA 4KWKA 3ZYHA 5DMYA 3AP9A 4Z8BA 2QNKA 3KMHA 3PLQA 3MUY1 5FWEA 3BGAA 3OBRA 4IE5A 2ARAA 3VD5A 1GP5A 1POV1 4CP2A 4EN9B 4UOJA 1LAJA 1H30A 1RUC2 3ME2A 1FMD2 2E31A 3QACA 4A41A 5CFCC 2XH6A 1WMFA 3RJRA 1I6XA 5B2GB 5LA1A 2IVIB 4I0AA 5JXIA 4Q27A 2WZR2 2RS31 3UT0A 2XJUA 2ARBA 1AUYA 2CAVA 4OI1A 2VW2A 5FXZA 1GUIA 2QDRA 5I0RA 1VRH2 3KM5A 1ZM1A 4PHZA 3OD4A 1J1TA 4X8NA 3IT8A 1D7PM 2CY6A 5F39A 1DYKA 1U5XA 2RJ2A 3A4UA 5DN2A 5JOXA 5F3IA 2F6BA 2YXSA 2C5DA 3K77A 5FZKA 4HVQA 4EN0A 1TG7A 3UJQA 3WP5A 4ET7A 2VVFA 2HBUA 1S0FA 1TMF1 3DN7A 4LEJA 3LEIA 1IKQA 5LBCA 1DP0A 3FBYA 4GD4A 3K46A 1JZ8A 4CXYA 2CU5A 3A23A 1OURA 2XJPA 3ETPA 1BXHA 4HL0A 1QJU1 4ZU5A 1SHWB 2EALA 3OD0A 4IL7A 3NMBA 4L97A 4HMZA 4LE4A 4N53B 4QT6A 3VHRA 4ZU7A 4LOSA 4Z07A 1YFUA 4B8EA 1GZTA 4NIGA 1S2BA 1AYM2 1ULCA 3ZYGA 3PURA 3HQXA 5C3QA 2RS32 5IAVA 4AI0A 1SFNA 2GP3A 4NRQA 5K0UC 4JZRA 5HV0A 5LA9A 1W8HA 3DKQA 3K4ZA 3EXUA 5KC6A 1FPN3 2X09A 4LBQB 1R092 1RUG3 5FY7A 1RGSA 4AI1A 4UXAA 2VZUA 4ITCA 4QB2A 1DQ6A 2V73A 4YW5A 5FYBA 2CDPA 4YG6A 3DYMA 2X5IA 1OA3A 3CL1A 5JMCA 3VBRC 4D0QA 4Z2WA 2G9GA 3IZOA 4LKFA 3AZVA 3WG1A 1GQPA 1RUC3 1RUOA 1O3SA 1MVQA 4XUTA 4ASLA 4LK7A 3TWIA 4YM2A 2UWCA 2GH2A 5A7PA 4Q0UA 3CEWA 3LPFA 1XNCA 3CHXA 4KG8A 3RFRA 3IMNA 1M4WA 3KT1A 4MADA 2K0GA 1JOJA 1R091 4YZ3A 2WDBA 5FZOB 4CP1A 1RUI2 3R4DB 1IPSA 3MIDA 3AP6A 5KWRA 2B4KA 4R4XA 5K0UA 2AC1A 5D8AC 1YI7A 4RL7A 1PGSA 2LM3A 5FP9A 5J3UA 2G19A 3VZOA 4XF0A 5BYNA 5DDJ3 3VHNA 2QZ3A 2WT2A 4I3GA 5DQ0A 4AFCA 3ZSEA 1R1A1 5KHJA 5T55A 4UW3A 3FX3A 3HBZA 1OF4A 1XXNA 3POSA 4S2DA 1QDCA 1PK6C 5T5JA 1BVP1 5JOYA 1CN1A 4XFBA 1XYOA 4XE9A 1GLHA 4HETA 4E9KA 1ND3A 1N3QA 3S7IA 3IB3A 5J98B 3W9AA 2QUOA 2WC2A 2Y64A 3NAPB 4IXLA 1Z0HA 4BXSV 4LJHA 4CEYC 4ORFA 3LEMA 2HWD1 1NAEA 2R32A 1RIRA 3LB9A 1VRH3 1U0AA 4QPWA 1OKQA 5IVBA 4QQHA 5ERLA 5I8YA 5KR7A 1VBE1 4AFDA 3HVDA 1FT9A 3GF6A 4PI0A 1EAH1 4HK9A 4GAZA 5FXVA 4A6OA 5AVPA 1A6CA 4AG4A 2V4AA 2JE9A 1COV3 1O5LA 1VRBA 4TTGA 4YFWA 4JDOA 4E8DA 4KMQA 1VBE3 2W68A 4R9AA 2VE1A 4BQXA 1WCKA 4URTA 2VOKA 4CCMA 1TVGA 1TME1 4LA3A 2YU2A 3EYPA 3H3LA 4ARYA 4IE6A 1NZIA 1NX9A 2ZPXA 5EPAA 5SV8A 2B7YA 4GMP3 4NHKA 4EN7B 1QJY2 2YHJA 4K6BA 5FPZA 3JB4C 4CCOA 3RYPA 5BNQA 2VMDA 4LO8A 3UGGA 4K9SA 4MXWA 3VD3A 1HW5A 3FJSA 3EO6A 4XFFA 3WXPA 4AL9A 1FX5A 1UXZA 1Z7S3 2XQXA 3GNEA 5FZBA 1ZZBA 2A3WA 5I0TA 5F8PA 4GB32 1QJU2 1RUD1 3I7DA 4JGYB 2OKXA 1ZA4A 4B7EA 2YYOA 1TEIA 2Y6KA 3AMQA 1N1YA 3AKSA 2IXLA 3H7YA 4W4ZA 3WNKA 5FBZA 4URAA 1QQP2 1UXXX 2JG9B 1QNYA 2FZ1A 1IPKA 4A3ZA 1ULOA 2D40A 1YFXA 4YGDA 1EUUA 2TBVA 1AR71 2EA7A 3ELNA 1DQ4A 1H2LA 2E7TA 4LULA 3VKFC 3E5XA 1CZSA 1ZBA3 5B4XA 3U0ZA 3ZFFA 2AACA 3VDDB 3WNXA 1Y4WA 3O0XA 1S2EA 4XFIA 2WKKA 1RJ7A 3MF9A 5FK7A 2C0ZA 1F15A 1UX7A 1A78A 4RN5A 2W92A 1MQTB 3ZSJA 3LWCA 3TNPB 2DURA 4HLTA 2Y8KA 3IDEA 4QQ2A 5LEKA 1B35C 1PMJX 1CQ9A 1OUXA 4E27A 2ZHMA 2HWC2 2ZEXA 3BI3A 4AFAA 4MLOA 4DEVA 1CONA 4LO4B 4ZONA 1QJEA 2WQ8A 4QAWA 2A7AA 2IUWA 4TN7A 3VZNA 4XF3A 1VAVA 2BQPA 1C3HA 2Y26A 3ETQA 3KCYA 4XMAA 2HJIA 4YG0A 4RS5B 3WG3A 1OPMA 4YVWB 2X10A 3JBG1 3ZPYA 5A1LA 3UKTA 1X9PA 4YFZA 1LOFA 2VZQA 4KGGA 2FDGA 3DECA 1AHSA 1V6IA 3TN91 5A3PA 1FATA 1HRV2 1MVEA 2MEV2 3LPGA 2XONA 4L11A 1SBDA 2RJKA 3C7FA 2VTFA 1OXCA 1V6NA 1YQ8A 5C8WA 3JBG3 4PDWC 5BNOA 1YQCA 2CL2A 1AXZA 1W2TA 1A8DA 5FZOA 1DBNA 4K20A 1AJKA 3U07A 1UIJA 3ZYIB 2Q1ZB 4QHOA 1EV12 4Y1VA 1TNFA 3V56A 1MS5A 1ENRA 1UOBA 2RG4A 2ZJCA 2RJLA 4IERA 1HJGA 5GKAC 3M3OA 4HK8A 1CAUA 5A3OA 4AQ2A 1OQ1A 2NM1A 1EAH2 2ZBJA 2YV8A 3CJIC 3I2DA 3TEWA 3RYRA 2VNRA 3D4KA 4IQPA 2Q0AA 5CISA 4JAAA 3KF5A 3WG4A 3AFGA 4OLLA 4Q4V1 2ZMNA 5JSOA 1XU2A 3E6DA 4IGPA 2RVAA 2RS13 3SKVA 4NIAA 4OHWA 3I3EA 1W6PA 2EXJA 3LIGA 2WZPP 1LU1A 2JG9C 1W0PA 3E6BA 1QJY1 4OI4A 1LEDA 2Y38A 2BYVE 1QJX2 5FZAA 5FPXA 3VGIA 4CCDA 2VOWA 5L9RA 3KSCA 3NW4A 1WZXA 1XYNA 3OYWA 4IE4A 1M06G 4OZOA 2BV4A 4XF4A 5J1XA 1XBFA 2D6KA 4OUMA 4O7XA 4QXBA 4IEYA 5C71A 2W47A 4V2VA 3WDTA 2GN3A 4H7MA 2BVVA 1UYZA 2VZ3A 1E57A 3CQOA 1TZOA 3P5BA 4GWNA 3VDAA 1GV9A 4DUVA 4OCTA 5EJ3A 2QQNA 4D7YA 5J96B 1O6UA 1AYM3 3GJBA 2W95A 5L7OB 3ASIA 4JKLA 4QB1A 5HCAA 3SITA 2OIIA 4FP2A 4ATEA 5T54A 1RHI3 5FYTA 5A70A 1UAIA 4B1MA 5IVVA 5EXOA 4QQLA 4UF0B 1OFNA 5IVYA 3VKOA 1NE6A 2A6WA 3ABZA 3T2PA 3W5NA 2FHRA 2VMEA 3I54A 1RITA 3J8F3 3FLPA 2KA3A 5F32A 1AR93 3GGLA 2YROA 4OHZA 2NZ9A 1KITA 1D0GA
chains in the Genus database with same CATH topology
2ZGRA 3JUUA 3MIHA 4WM7A 1EPWA 2VUAA 5IK5A 3ZN6B 2D6OX 2D3PA 2ZGPA 4YM3A 2BFUS 3KGLA 3WG2A 3CO2A 3POWA 3RZZA 1WGPA 2ZACA 1J3RA 3VBHC 2R041 1C8M2 4I01A 4LHLA 1YNAA 3D5OA 1SLLA 1G9CA 1DGWA 3GBWA 1U5YA 4AVCA 1OOPB 1S0EA 2A75A 2IXCA 1LOAA 1OLRA 4QPIB 4NOTA 4QMAA 1FPN1 2MNGA 1NXMA 5T52A 1PK6B 1MEC1 4YYOA 2BPA2 4COWA 1VBD3 3IWZA 2BFUL 4L2NA 4S2HA 4Q0SA 4D69A 1HRI3 2N7GA 3UL2A 1JW6A 1V6OA 2TUNA 3S30A 4A3XA 1AX2A 1RINA 3RYKA 4AGVA 2ZGSA 1WLTA 2ZA9A 2ZGOA 3VN4A 1FPN2 2ZOEB 1Q8OA 4QPGA 1MEC2 3MW4A 3OGGA 3J26N 2NMOA 4MGKE 4OZXA 3SHRA 3IM0A 1QXRA 3NKTA 4EWDA 1S2KA 5AFBA 4X6RB 2VMGA 2LALA 4GALA 5FOBB 4BLJA 2YPJA 1RC6A 1VBD2 4FOYA 4R9DA 1W6OA 3VBUA 3VKNA 2DTYA 1JH5A 3ACLA 1DQ1A 4LBKA 1FV3A 1W0OA 2XBO2 1H1IA 1VIWB 1OOPA 5FCCA 4N9IA 4KNCA 3U4XA 1S0IA 4H7LA 2WQ4A 4FXKB 4Y20B 1X8MA 5CAZA 4GXLA 2VULA 2DVFA 2PHXA 1W6QA 1GQGA 1NA1A 4Q4X2 1KFUL 5H9PA 3KT4A 2VXRA 4HN0A 4XFAA 3INAA 5FQ0B 3DPRA 4OULA 3ZFEC 2HYKA 3THTA 4W6XA 1PNGA 3SH3A 5HI0A 1AF9A 4IEPA 1VJ2A 4BQ1A 2WT0A 3ZFGB 2XHKA 3H8UA 4RQPB 3WP3A 1U12A 3GALA 4LT5A 1R083 5CU1A 2HWC3 4KWJA 5L7OA 4JV4A 2R043 4X6QB 3E5UA 2VUJA 2E51A 3CJIA 1UX6A 4XW3A 1Z7S1 3KS7A 5GALA 2WJSA 1Z78A 3JQXA 1QXJA 4Q4Y2 4A7KA 1YIFA 1V6MA 1LESA 2BNMA 1Q8PA 3B02A 3DKWA 5FMOL 1IHMA 2ZGTA 3DPRB 2JEMA 4XXAA 2VNOA 4J6GA 2RS51 1WBFA 1KS4A 3ZXKA 4LBQD 1SLTA 2A6VA 1FXZA 4E2GA 4GB33 3N4MA 2R30A 2GC0A 1BEV3 1LGBA 3G6JB 2E7QA 1Z7S2 1RL3A 5FDBA 1I1EA 1XE8A 1PVC3 5AVAA 1HQLA 2D7FA 2GMPA 1R082 1UIKA 1ZBE1 3M1HA 3QCWA 5JZGC 1WW5A 1H8TA 2H6BA 1OD5A 1ZBA2 3LA7A 3VBHB 3VHOA 5AC92 2PAEA 1ULDA 1O4YA 3JQWA 3VBUC 5JAXA 2GNBA 4AI2A 2GNTA 3N7KA 1ZBE3 1DFQA 2IXIA 1Y43B 4E4DX 4R4ZA 1RUH2 4WV8A 5FRAA 4ES8A 3MZHA 1AYN1 4FPJA 1NY71 3URFA 4BCUA 2O8OA 3MIBA 2NP0A 3E5QA 1YI9A 3OPZA 4IEQA 2ZAAA 4CEWC 2I45A 3LA2A 1CGPA 1S0DA 3WP4A 4PIZA 4MGYE 2LUWA 1RUG1 4AGRA 2X53S 3IN9A 3FUOA 3P3PA 1D4M2 1H9PA 3FFZA 1FNZA 3ES4A 4FOWA 5L7OC 3JB8A 4DRVA 2YZ4A 3H3UA 3WLUA 2RS12 1CAVA 4Q4X1 4RGGA 2VGDA 1H8TB 4YARA 1LGNA 3M8LA 1H4GA 3LOIA 3P3NA 3KGZA 1KJRA 4BOWA 1VR3A 2VG9A 1C1FA 5GLZA 4G3YC 4WM8C 4WZCA 3ATGA 5DXDA 2Q1MA 4AEDB 1NOVA 1RUNA 2GALA 3NJZA 1EP0A 5C4WA 2YY1A 5L36A 2QJVA 4CDWB 1HRI2 3E6CC 3V65A 1I5ZA 1UU4A 1HLCA 2D3RA 2GC3A 5J7MA 2D6PA 4MXWB 4DS0A 3KCCA 3L9JT 1AXYA 3L2HA 2Z69A 3MDPA 3A0KA 1YXWA 2HEVF 4KH9A 1KRIA 4P14A 4L9BA 1H2KA 3PMEA 2XKPA 2R072 1GFF2 5BNNC 3EBRA 4QPYA 1W6NA 1UCXA 2A5ZA 5EFUA 3DL3A 2OA2A 4BHPA 3LOBA 4IV3C 3WDWA 1C57A 5C6CA 4PDWB 2PHRA 1F5JA 4IV1A 5FFOC 5EZWA 1KD7A 5C4WC 1PMIA 3ZFEA 4E4SA 1YYNA 4UBGA 3AXEA 4TWTA 1UF2C 4Q26A 3AYEA 4XF9A 1ZBE2 1JYCA 1VBC3 2ZGUA 2BW8A 3J8F2 4K8FA 2JJ6A 1LOGA 1AR92 2LTNA 4LO6B 2BUKA 4Q2FA 5GLVA 5FQ0A 3G7DA 4E2QA 4LO7A 2A6XA 4I0WB 5CG8A 3SCFA 1VBC1 1MQTC 2B8MA 3DPRC 2ILMA 4FTSA 4JGZC 3H9AA 3W58A 1CAUB 4TZDA 2CYFA 3ZXJA 5LK7B 5F1RA 4XYXA 1DDLA 2HEYF 4MVTA 4OHVA 4FVVA 1NLRA 1LODA 2XUMA 1NZCA 1PZ7A 4C91A 2X8KA 2H0BA 4WBBA 4META 1C1LA 4C1WA 2CWMA 1W6OB 1S1AA 2X5IC 2X29A 4LLOA 3FUQA 2GMMA 2GZWA 5HXVA 4JDMA 3WDXA 1AX1A 3I4IA 1VBA2 3WINE 1RUE3 3MIEA 3AM2A 4PQ9A 3TYJA 4LBQA 1RUD2 1ZRRA 4DPNA 2D6NA 2QE3A 1DGRN 2PHLA 4OVEA 3QBQA 3TOJA 1CAWA 1ASJ1 2ZHKA 2V09A 3NVCA 2PLV1 2W0XA 1IS3A 3LAGA 1RMU1 2WIIB 3R4SA 3AFKA 4FOVA 4XJ8A 2DUQA 3AMNA 1C8M1 1OQEA 2GH8A 2I2SA 2GNMA 3BU7A 2P17A 2R073 2TNFA 1SMVA 1Q43A 3R6SA 3BPZA 3D6EA 3VBHA 3RMXA 3S7EA 2D5FA 5E1RA 5C8CC 2DFCA 2SLIA 3M7AA 3HD8B 4FTBA 2JG9A 2R071 3HAGA 5I0RA 3H50A 3WX5A 3ZO0B 3H0OA 4IEOA 2BWAA 2KXLA 3RMYA 4XBNA 1BEV2 2PTMA 4ISQA 3JZVA 4H55A 1NXD1 4RA0A 1BMV1 1ASJ2 2DU0A 1GNHA 4AI8A 2AYHA 2YMZA 5H9SA 4AVVA 5CFDC 3TAYA 4GMP1 4AHZA 1KJLA 5EYYA 5KHKA 2P2KA 1MZ6A 4K40A 3SMHA 2AUYA 2MEV1 1PIV3 4TYSA 3KZ4C 1BBT1 1F9KA 3FC0A 4K21A 4WM7C 4M3CA 2PHTA 1H1MA 4YGEA 1NLSA 4C0BA 3MW2A 4I0BA 4YVSA 5FMOS 1XYPA 5I91A 4XPVA 4EN6B 2WNUB 4IEZA 4YGCA 2CV6A 2PHUA 3D0JA 1N3PA 3GZUC 4QHBA 1WUVA 4Q4V2 3UV9A 4RD7A 4EWAA 4FPCA 3OYWB 1JHNA 2EXHA 2WNVA 1ULFA 3LA3A 4XFGA 4PLOA 4B4PA 5KC5A 1ND3B 2PFWA 1POV0 2DVDA 1PO23 4MZUA 1CX4A 2EXIA 2CGOA 4XBLA 1NA1B 3ZN5A 2HWF3 3ENRA 4MYEA 4BPZA 1Q8QA 1VBE2 2NQYA 1DZRA 1O4ZA 2H6CA 4Q29A 1FNYA 1AR82 3LGRA 4Y20A 1MS9A 4R9CA 1PO11 1HXS3 3AZZA 3B9IA 4FQ4A 3X29B 3HR9A 1RMU2 1VP6A 2C9AA 2WNVC 4AEMA 1H0BA 1ZZ6A 1YFYA 2O0OA 2C1FA 1WMDA 1LTEA 2UURA 3HMYA 1LOFC 1QDOA 3WP6A 2HWD3 2WS91 5C8CA 1JTZX 2X5IB 1ZZCA 1JXNA 1X82A 2SBAA 1V9U2 2R0FA 2H0VA 2R062 3WW2A 1LENA 4L8QA 4Q4V3 3OCPA 3NV1A 5FAXA 4FPYA 1YJLA 2BEOA 1J59A 1DF0A 5DUXA 3O14A 1N1SA 3O7OA 3MFCA 4U36A 3KCXA 1URXA 2UWBA 1LR5A 1S55A 2JD4A 3C2UA 5TSWA 2OPKA 1JYIA 3T1LA 5J48A 3T1MA 1RB8G 4DQAA 3PTYA 4AF9A 2DCTA 3WHTA 1V9U1 5IUQA 1O91A 1Q5OA 1D4VB 3MFAA 4N7IA 3AX4A 4BMEA 2A3XA 1KDKA 3AB0A 1SEFA 4YGBA 2NPIA 3NV2A 2VU9A 4DRRA 4LE3A 4CEYA 5I8SA 3CJXA 1FOD3 2XLAA 1X33A 2JG8A 2E9QA 5BNPA 1VAMA 3IPVA 5T5LA 1HXS2 3U11A 1PZ8A 3ES1A 3OGJA 4BH9A 3LKJA 2B45X 3WDYA 4QD2A 2NLRA 3MIGA 4Y4YA 4XQDA 3ZX7A 3J8F1 4TSVA 3NWKA 2JG8B 5BNPB 1AR91 3B7MA 2NMNA 1AL22 2V5YA 1H4HA 3H1WA 1MS1A 1Y9QA 4P9GA 1IQAA 2ET1A 3WW4A 2WLQA 1OA4A 1LECA 1VBC2 4EV0A 3RI8A 2YC0A 2XJQA 1FI2A 2WFF2 3FMGA 2VOVA 2ZZJA 4LA2A 5H9QA 3L2YA 3KT7A 4KWLA 4YM0A 2GU9A 1CJDA 4N43B 1YRZA 1KS5A 2XB6C 4P9JA 4H14A 1D2SA 2AREA 4OHYA 1OQDA 1AL23 2ETEA 3PVNA 2BVBA 4P9LA 3VDDC 5FO7B 1O5UA 2B42B 2QFEA 3MW3A 2QCSB 3AMMA 1XE7A 3ST7A 1T6GC 1ULEA 5CFDA 1BJQA 4CZSA 4LNVA 4YNIA 4KQ7A 2ZGKA 4F3JA 5AC91 4JTOA 1RUD3 4AHWA 4XHBA 1AL21 4XIKA 3U10A 2G4IA 2RMU2 2VNGA 5J09A 3VBSA 4Y1ZA 1HRI1 1NCRA 1TMF2 2ERFA 1YLLA 4KU7A 1F31A 1QJX1 2D43A 4Y1XA 3VHPA 4LBJA 1C8NA 2OUHA 1BQPA 1H8VA 1ONAA 4XJZA 1YIPA 2BNOA 2VQAA 3ECQA 3VBOA 3PJYA 3GHMA 3POYA 2E6VA 4E4ZA 3HIFA 1ZZ9A 4FBFA 5BXXA 1C5IA 3NL1A 1GZWB 1RUE1 2IFWA 4QM8A 1ZRDA 1WCSA 1QNWA 2RS11 3I59A 4XFHA 4UBHA 1S0CA 1V9U3 4FAHA 1G9FA 4YZ1A 3NV3A 1XRUA 3THPA 2WNEA 2R16A 1HRV3 1MR5A 1XNKA 5I0UA 1REFA 4K3UA 1DQ5A 5JDBA 1G9BA 1D4M3 4RHV1 4GMP0 3TN93 4OI2A 1RUF2 2HEWF 4HSLA 4Q1PA 4QQOA 1U5IA 1HRV1 4DY3A 4HVOA 5JPMB 4KL1A 1QOOA 4W65A 4WVZA 2XLFA 4LTAA 4HSJA 4CDWC 2XBO1 4XQWA 4GQ7A 3FWEA 2ZX1A 1AR61 5CBLA 1VRH1 4LO5B 1EPZA 2D44A 2ZX2A 1WBLA 3BALA 2RM21 4PJYA 4Y26A 4HKLA 2ZGQA 4WM8B 4FP3A 1J3QA 2P3JA 4BZ4A 4HKWA 4FO9A 4M3CB 4Y22A 3ZFFB 3BOPA 1PGW1 3FFQA 5JI9A 3B9CA 4MH0E 1UPSA 2B39A 5IK4A 1QH6A 2B9UA 2WSUA 5SV5A 2TEPA 4CDUA 1AR62 4YW1A 4Q4Y3 4QXKA 4M3CE 3N7MA 1BBT3 1UPIA 3RS6A 4JGYA 1QJZA 4U2AA 1QGLA 3SISA 3CNAA 1LU2A 3DGTA 3H1MA 4FPGA 3B94A 3QH6A 4JC1A 4XTPA 3W59A 1DZQA 3WV6A 1BCXA 3QH7A 4FOQA 3WOGA 3MEPA 5JOWA 1AYM1 4CEWB 3WUCA 4HN1A 2RS53 2RMU1 3LZZA 5D1IA 1QJX3 3SLIA 5I0SA 2ZX0A 3VBOC 3SCHA 2Q5TA 4BIOA 1KQRA 3RDIA 4GWMA 2VY0A 3MI8A 4Y22B 4GB31 1RUJ2 4ISRA 1DHKB 3VZJA 2DCZA 3N7LA 4FPFA 2VVEA 4XEZA 5JIAA 1UKGA 3VKMA 4CDXB 5A32A 1LRHA 4WZFA 4B4QA 1Q8VA 3PHMA 1UD1A 4YW2A 4P9WA 3AZYA 4R9BA 3ZXAC 1TQ5A 2RR11 5IK8A 5HBAA 2HWF1 3V0BB 3WVJA 3B93A 1XNBA 1RUH3 1VB4A 3RNSA 2OVUA 3NAPA 4AQSA 3M4FA 4RR3C 4RHV3 4NHMA 4JQRA 4S2FA 3Q9OA 3AP4A 5BUVA 5CFCB 2D98A 2EIGA 4BE3A 4DY5A 1DGRA 2VVDA 4KG0A 5E8AA 4WVMA 5GLTA 1GZWA 3ZXEA 4XFCA 1KXGA 1WMEA 2DCJA 1NQDA 1GBGA 1ZRCA 1ND2B 3HN1A 4B3NA 2PYTA 4OI0A 4K7JA 2WL1A 4KBBA 1WD4A 4BYYA 3M2MA 3KLSA 3WW1A 4R52A 1VBA3 1K5MA 1X8EA 5DG2A 4XJAA 5C9AC 3ZIWA 2D5HA 3WHUA 2DFBA 1RUJ3 2PELA 1PHMA 2IZWA 1ZRFA 1WLCA 1RUI1 4QQPA 4RQPC 1ZREA 1V70A 2CAUA 4XETA 3OF1A 4NWVA 4AVTA 1SCRA 1RTVA 2B5HA 2WNVB 2A73B 1TME2 1A3KA 3B5LB 3ZFEB 5JOZA 1RVF3 1OOPC 3SH4A 3N36A 1W2UA 3DUIA 4IV1B 5DDJ2 4GH4A 1LOEA 2WNUA 3VBFA 1FOD1 4PDWA 5BNOC 1IS4A 2D6MA 4QX5A 1AR81 2R063 3AK0A 2VH9A 4IEVA 3AZXA 1DLLA 1GZ9A 5BV6A 3MLJA 1W6NB 4AFBA 2WZR1 2QDNA 3APBA 4PIYA 3MIFA 2HWD2 4Z92B 1RJ8A 4DNYA 4YSFA 2A71A 3RSJA 3NKGA 1MZFA 4C1XA 1W39A 2XWBB 4QM9A 1WW6A 2VMIA 2OUJA 2OZJA 1NY72 2KM2A 2Z5WA 1SLAA 3AKQA 1B35A 4AQ6A 1ENXA 1XQNA 4JVAA 2D93A 2HWC1 2WNUC 2BGCA 3J4UH 3N3HA 2IWGB 3AJZA 4I2OA 2RR12 4J1XA 1J58A 2HWF2 1Q3EA 4CDUB 1MS8A 3VKLA 1OMIA 3B01A 1U5ZA 1X50A 4MGZE 1O3RA 3MPBA 2XJRA 4B4RA 2MEV3 4CDUC 5KHGA 2D6LX 2HWE1 2ZGMA 2F4PA 1DU3D 4DXZA 4HANA 2XJVA 5FO9B 1A8MA 1LHUA 2EVXA 3MLKA 1G86A 4XQ4A 1G8WA 5C9AA 5JLVA 4LLFA 1IS5A 2E53A 3ILNA 3ZYPA 5JCTA 4BMBA 1V6LA 1OLQA 1SFYA 4SBVA 1QQP1 1LOCA 2A3YA 5I0TA 1VBB1 2ZKNA 1BYHA 1R1A2 1OA2A 1EV11 4NVPA 5A3MA 4MUVA 4KU8A 1LHVA 5C8CB 3MLLA 2VW1A 4LUMA 5JZGA 1PZ9A 1G7YA 5KHIA 2VOXA 2E63A 2JKBA 4IV1C 1VB2A 1RVF1 1R1A3 3CF6E 4OFGA 3M3EA 5GZEA 2FMDA 4YVWC 3ZYRA 4RGAA 4ASMB 5I93A 2CTVA 2P3KA 4PBOA 4MX3A 2GSYA 3AP7A 4AHYA 1MZEA 2WZR3 1CAXA 3USUA 4IEUA 2BWCA 4S2GA 4BLIA 4CDQC 1F8VA 1ZVFA 3WR0A 5CB7A 2PAKA 1Y3TA 1POV3 1MS4A 3JD71 3MYXA 4XTMA 4UW6A 1OSGA 3VBSB 1QU0A 3EHKA 1S0JA 1G9DA 5LK5A 3S6PA 1ND2C 4XIOA 2WS93 1AL0G 4YM1A 5JWPA 4LBLA 2DWRA 2ZZQA 5CFDB 2WQZC 3BOWA 4J1WA 4F7ZA 4GKXA 1SDWA 1LHOA 3V0AA 2ZAHA 2WLPA 4LHNA 5IT6A 1PIV1 4YZ2A 4BA6A 4JGYC 3BCWA 1I9RA 4I30A 2ZTNA 5ACA2 1JUIA 4MXVA 2HWB3 4AI3A 1LHNA 4PCRA 3WQ0A 4AE2A 1RUF3 4Y1YA 1O3TA 2HWE3 4HT1T 1SQ4A 3LSDA 1IOAA 3O0VA 1C5HA 3GHNA 3UKNA 1S0GA 4CDWA 2UWAA 1W6MB 5JVVA 5C4WB 2ZABA 2ZCWA 2MPFA 4FPLA 2ZS6B 4F8AA 1AR73 3VLBB 2Y0IA 4AEDA 4RS5C 3VZKA 2WA3A 2PQQA 3IPVB 4LUKA 1V6JA 1V00A 1QWRA 4IV3B 4RSUA 2QZ2A 3NSTA 4FPOB 3B69A 2RM22 3S0MA 1PM7A 4CP0A 2P34A 5ABJC 2PA7A 1YJKA 4JCKA 1TMF3 4PF5A 5DZEA 3BIWE 1HXS1 1WLWA 4Q4W1 3T2TA 1NCQC 4QPGB 3WCRA 4FPEA 4PIXA 3TB0A 3AYCA 4JGZB 4QGNA 1BZWA 4NO4A 2DVBA 3QOPA 4E2SA 1H1AA 4FPKA 4FXGB 3WD5A 2AENA 2WFF1 1GANA 2XL7A 3NO8A 3JCIA 1IPJA 4IEWA 4QPIA 2JXAA 3M3QA 1RUJ1 2CNAA 2ZX4A 2IXJA 1JBCA 3JU9A 3O12A 1G6NA 5J37A 3MGUA 1R093 1RUG2 1EAH3 4CRQA 5JPNB 3WDVA 2Z42A 3ILFA 3UJOA 4FSJA 1REEA 1QXPA 1Y7BA 2ZGNA 4JRLA 2A6ZA 2HWB1 1B09A 1J1LA 1DG6A 2CWSA 2YUEA 4O9EA 3CU7A 4EJRA 4NR1A 2ATFA 2I07B 2XJTA 2R49A 1SCSA 3WCSA 4G4FA 5EWSA 4DINB 4D7SA 5GJ6A 2EAKA 5I8TA 1VAKA 3LCPA 3USSA 3WT3A 4N9HA 5A33B 3MPPG 4A7YA 2UYAA 3DF0A 5D8AA 4EN8B 4P9YA 2HWB2 4LR4A 2AZ5A 4PBPA 4COUA 1C28A 4JDNA 3IBMA 1FV2A 1L3JA 3GBFA 2Z2SB 1PO12 5DG1A 4ATFA 4Q8KA 5JI7A 3SXWA 5FTTC 1IS6A 1MACA 2XBO3 1WA4A 1AR63 4ES9A 1VALA 5D8AB 5DUWA 1QH7A 3ZFFC 3ZFGA 2HKXA 1H8TC 1UMZA 4AGGA 4HBNA 5A33A 3HT2A 1AJOA 1R1ZA 1ZYBA 1ZX5A 1QOTA 3V64A 3AP5A 2QVSB 3IDBB 4QPGC 2O8QA 4CDQA 1NCQB 4AVBA 4GA9A 4AEKA 2Q4SA 5GLWA 3SNMA 4Q4Y1 4Z1VA 1AYN2 1YFWA 1N1VA 1CPNA 1O4TA 1PO13 1QJU3 2YGMA 2GMEA 5ABJB 3KD4A 4AFMA 2WSVA 4YZ5A 5F6LB 5BPXA 3BTAA 4HZFA 4GKYA 1YWKA 3ZFGC 1HDKA 4N90A 3VBUB 1LEMA 1QF3A 1CESA 4INDA 2JG8C 5FLJA 5BNPC 2JICA 2BNNA