1ZBA2

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
DRLLTTRNGHTTSTTQSSVGVTYGYSTEEDHVAGPNTSGLETRVVQAERFFKKFLFDWTTDKPFGYLTKLELPTDHHGVFGHLVDSYAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKAFDTREKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVLSPLTVSNTAAPQIKVYANIAPTYVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 207
sequence length 207
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba200
1ND3C 4N53B 1BMV1 5ABJA 3VBSA 2RS12 2R061 4PDWA 5C9AC 1CD3G 1K5MA 4CDUC 4WM7B 1TME1 4RR3C 1VBC2 3J8F1 2HWD2 5BNOB 1PIV1 2XBO2 3VBSC 1H8TB 1HXS3 2WZR3 1Z7S3 1VBD2 2HWB1 1GFF2 3VBFB 1PVC3 3VBRB 5BNPB 2R073 1VRH2 3CJIA 4WM7C 1X33A 4RQPB 5CFDB 5C8CB 1RUJ1 4JGZA 1OOPA 3VBHA 5JZGA 1RB8G 1AL0G 5DDJ3 5J98B 1RUI1 1MEC1 1R092 2RM21 1RUH2 3VBFC 3VBRC 5BNPC 1RMU1 1AYM1 3JBG1 1BMV2 1C8M1 4FTEA 2R062 1QJU2 3NAPA 1COV3 1TME2 1NCQA 1M06G 3ZFEA 3J8F2 3JD71 5J96B 4GMP3 4NWVA 5A33A 1FOD2 1AL23 2RS53 3VBOB 1NOVA 1PIV2 2HWF1 4FSJA 1B35C 1VBB3 5AC92 4CDQA 2HWE1 2HWB2 1V9U3 1RUE1 2BPA2 1QQP1 1QJY3 1MQTB 3VDDA 1FPN3 4Q4V3 1RUJ2 4IV1B 3JB8A 4YVWB 1EAH1 4JGYC 4RS5A 1R083 4CEWB 3ZFFA 5K0UC 1QJZA 1ND2A 1MEC2 1RUI2 2RM22 1NA1C 5L7OC 2R043 1RMU2 5BNNC 1QJX3 1AYM2 1NCRA 2WFF3 3JBG2 1C8M2 2PLV1 1POV1 4N43B 4GH4A 1SMVA 1AR91 5A32A 2HWC3 1PO23 1BEV3 3TN93 1AR61 4CEWC 4Z92B 1ZBA3 4WM8B 3JD72 1WCDJ 1RUG3 1HRI3 2RS33 3ZFGB 1ND3A 2HWF2 1AYN3 2HWE2 5C9AA 3DPRB 1RUE2 4CDUA 1RHI1 1R1A1 3IDEA 1QQP2 2TBVA 4RHV3 1VB4A 4WM8C 5C4WB 5LK7B 1AR71 2RS13 1EAH2 1PO13 3LOBA 1C8NA 4SBVA 4FTBA 2XPJA 1E57A 1FMD3 4QPGB 2R071 3DPRC 5ACA3 1VBC3 4WM7A 4QPIB 2GSYA 1AR92 4N53C 2BFUL 2MEV1 2FZ1A 1AR62 5ABJB 4Q4W1 1RUC3 4PDWB 1CJDA 3VBUB 3VBFA 5BNPA 3VBRA 4CEYB 1K5MB 4IV3B 1RUF3 1POV0 4GB32 1TMF3 3ZXAC 4BCUA 1COV1 1NG0A 5BNOC 1RHI2 1R1A2 2RR11 1H8TC 4AEDB 2WS91 1RUH3 1BBT1 1D4M3 1ZBE1 3VBUC 1AR72 1VBE1 1IHMA 2R063 2WWSA 1VBB1 4NWWA 1QJU3 4RQPC 2X5IB 4IV3C 1B35A 1V9U1 5CFDC 5C8CC 1ASJ3 2BUKA 5D8AB 1QJY1 1OOPB 3J8F3 4CDWB 1FPN1 1RVF1 4AEDC 1DDLA 1FOD3 1PIV3 5AC93 1R081 4JGYA 2HWB3 2MEV2 4FTSA 2X5IC 5K0UA 4Q4W2 1HRV1 4LLFA 1HQNA 2R041 5D8AC 1A6CA 1QJX1 2GH8A 1NA1A 4YVSB 1AUYA 5L7OA 5BNNA 1RUJ3 4Q4X1 1MQTA 4CDWC 1NCQB 1COV2 3VBOC 1AR81 1BEV1 5A33B 2RR12 1MEC3 2WS92 1RUG1 2RM23 4CEWA 1BBT2 1RMU3 1HRI1 1ZBE2 4CDQB 1C8M3 3S6PA 1VBE2 4YVSC 3M8LA 1AYN1 1MQTC 1V9U2 3VDDB 4IV1C 4YVWC 1QJY2 4RHV1 1RUD3 1FPN2 1RVF2 1OPOA 2RMU1 4CDXB 2WLPA 4GMP0 1VBA1 4RS5B 2HWF3 4WM8A 1PO11 3FBMA 2HWE3 1R082 1RUE3 1FMD1 4N43C 1NCRB 1EV13 1W39A 1HRV2 1HX6A 1QQP3 5ACA1 2R042 4GH4B 4Q4Y3 1QJX2 3DPRA 4Q4X2 4CDXC 1EAH3 1F8VA 1AR82 1HXS1 1Z7S1 2WZR1 3ZFGC 4N53A 5CFCB 1RUC1 1NY71 1PVC1 1HRI2 4Y5Z0 1RUF1 2HWD3 1AYN2 1TMF1 1AR93 2PLV2 2ZZQA 4RR3B 2XBO3 5C4WC 5BNOA 1VBD3 1RUH1 4RHV2 5DDJ1 1H8TA 1D4M1 3VBSB 2RMU2 4RFT0 1VRH3 1VBA2 4QPGC 1PO12 3VBUA 4CEYA 1QJU1 4GB33 4RQPA 1ASJ1 4QPIC 4IV3A 1FMD2 5CFDA 5C8CA 1RHI3 1R1A3 5ACA2 2BFUS 1FOD1 1PGW1 1R093 4AEDA 1AR73 5ABJC 4GMP1 2ZTNA 1AL21 2RS51 4PDWC 5AC91 4CEYC 2WZR2 1HXS2 1Z7S2 1K5MC 3CJIB 1RUC2 2X5IA 1NY72 1PVC2 1TME3 5D8AA 2R072 4JGZB 1OHFA 1RUF2 2QQPA 4Q4V1 4CDWA 2ZAHA 1TMF2 3VBHB 5JZGB 1PGL1 2DF7A 2MEV3 3VBOA 4Q4W3 5DDJ2 3CJIC 1D4M2 5GKAC 1B35B 2VQ0A 2WFF1 4JGZC 4YVSA 1OOPC 3NAPB 1ASJ2 3VBHC 5JZGC 3ZFEB 2HWC1 2RR13 1F2NA 4IV1A 2WS93 4YVWA 1PO21 1RUD1 3TN91 1BBT3 1ZBE3 1ZBA1 1PGW2 1RUI3 1VAKA 4JGYB 1VBE3 4EJRA 1AL22 2RS52 5K0UB 1AYM3 2RS31 3JBG3 1NA1B 1VBB2 5L7OB 1EV11 5BNNB 3NAPC 1NCQC 4N43A 4Q4Y1 3ZFEC 1RVF3 2BBVA 2IZWA 3JD73 4Q4V2 2Y26A 4CDXA 2RS11 3ZFFB 1PGL2 4CDQC 1ND2B 3ZFGA 1HRV3 3JB4C 4Q4X3 1VBC1 3VDDC 2HWD1 2WFF2 5A32B 3HAGA 5FOJB 2XBO1 1AR83 4RS5C 3ZFFC 5C4WA 1VBD1 2HWC2 5FMOL 1X36A 1PO22 1RUD2 1BEV2 3TN92 1ND2C 5CFCA 2FZ2A 1ND3B 1VRH1 1ZBA2 4Y4YA 1RUG2 1NCRC 4GH4C 2RS32 4GB31 1VB2A 4QPGA 5C9AB 2PLV3 1POV3 1EV12 4CDUB 4QPIA 5FMOS 4Q4Y2 4RR3A 1AR63 2RMU3 1R091 5CFCC 1VBA3
chains in the Genus database with same CATH superfamily
3NV1A 5C6CA 2VBBA 1IPJA 2BDRA 3T2PA 1BMV1 3ZPYA 2B4KA 3BOWA 1I1EA 1YXWA 3HQXA 4ES9A 1W0NA 3TEWA 3GF6A 3WINE 3H8RA 3RJ2X 2R30A 1MACA 2WT0A 3U1XA 3ZSLA 4FFIA 1LNSA 3T0DA 2HEVF 4CDUC 1H9PA 3KB5A 4IEPA 3ZDSA 3UYJA 4HK9A 3VGIA 2DTYA 1C5HA 5FPBA 1ZM1A 3FMGA 2HWD2 4W4ZA 1DGLA 3P5BA 5A3WA 3VD3A 4OHZA 4BQ4A 3AVSA 4OCTA 2WNVA 4FQ4A 4BIFA 5E8AA 1L3JA 1YC61 3EJKA 4LBOA 3VBSC 1DQ5A 1H8TB 2IXCA 1HXS3 2JB4A 3U11A 4Q1RA 4FOQA 3A22A 4LBQB 3QH7A 3CNAA 3POIA 4HG6B 3V0AA 3BTYA 2HWB1 4C1WA 4H55A 2P17A 3GGLA 2D6KA 4HPKA 1UIKA 2QQKA 3HBKA 1TG7A 2ZHLA 3HN1A 5FZGA 4NIDA 1UD1A 5GALA 3WQ7A 5C8CB 1RUJ1 5J37A 1CR7A 1KJLA 3ZDVA 4BQ1A 1SACA 5F32A 4BM8A 5HCAA 3MHZA 3MPPG 2VCAA 3J7MA 3IM0A 3VBHA 3H42B 2E26A 4XHXA 1RUI1 1STMA 4GJZA 5DABA 4UF0A 3VBRC 3S30A 5BNPC 4BH9A 1C3HA 3AP9A 1AYM1 2JDAA 3KCYA 4MGKE 3T1MA 1BMV2 1W2AX 1YFYA 2QUOA 3AB0A 1Y7BA 2DURA 3CDZB 1KITA 3IDAA 2CSGA 1JHJA 4QHOA 3R05A 1WLWA 3I59A 1COV3 1UY0A 1LOFC 1YQ5A 4QB6A 1CPNA 3RYRA 1W6PA 1M06G 2XJUA 1QOOA 4O61A 2Z4FA 4GMP3 2JG8C 1AL23 3VBOB 2EXJA 2WO3A 4E4HA 4P9LA 5K7PA 3MW3A 2XVKA 2LALA 4QXCA 5BY5A 3ACGA 1B35C 4XF9A 5AC92 2VW1A 3O14A 4RGKA 1W6OB 2HWB2 4EN7B 1XQNA 1RUNA 2P3IA 2JE8A 2DCZA 1GQPA 4YNIA 2YDEA 3E97A 1QJY3 4QPWA 4JDMA 1MS0A 1PMJX 4K8FA 1R1ZA 4Q4V3 1RUJ2 2XMLA 5FY4A 4I3PA 2VCMA 3N9MA 1X7NA 4IV1B 3JB8A 4IE0A 1FV3A 4M4RA 1LOEA 3AZYA 4JGYC 4KBBA 1LGBA 2JG9A 3MPBA 4BQ3A 2YFUA 1WD3A 1JI6A 3OUIA 3SXWA 3OD0A 4CEWB 5K0UC 4DINB 2FDHA 3RYKA 4XFIA 1ULCA 2OX0A 3T3YA 3ZPOA 5JXJA 1RUI2 2A6ZA 2VZ3A 3AZZA 3ORJA 3SC7X 5E6HA 2ZGNA 4IEWA 3G6JB 3WUCA 1YQ6A 3WDUA 3HMYA 1ULEA 1AYM2 1NCRA 4OMCA 2PLV1 2QTWB 2XKPA 3FFQA 2B8MA 4HSJA 4N43B 5H9PA 3CL1A 1MZ6A 5KXEA 2Y0IA 1SMVA 3KMHA 4EQVA 2ZACA 3AYCA 1UN1A 3FC0A 4PF1A 1DP0A 2WNUA 4S2DA 1WW7A 1Q8SA 2Q1MA 1AR61 5DUXA 5FZCA 5IHRA 4FI9A 4NN0A 4H2AA 4W8JA 5LATA 2OQ7A 2R1DA 5A7QA 2B5HA 2A3YA 5C33A 4XUOA 1S0CA 4BOWA 4ET7A 5HI0A 3DYMA 4NHMA 2G4IA 2HYXA 3NW4A 2RG4A 3VD9A 1DF0A 2CNAA 3B5LB 2QQJA 1JXNA 1QF3A 2DFCA 3F2ZA 2ZGRA 3J4UH 1RHI1 1R1A1 3SITA 4CDUA 1LENA 3WT3A 2TBVA 3EO6A 4BISA 5EV7A 4YM0A 4E9KA 2JDZA 1VB4A 3PHMA 4GQ7A 5FY1A 4QKBA 4E8CA 1AR71 2W94A 2WZEA 3SQOA 1RJ7A 3A0NA 5J48A 1JZ3A 4HOOA 1JS9A 3HIFA 4ASLA 1C8NA 3ZYGA 4LHKA 2ET1A 2E53A 2ZS6B 5LBEA 2XPJA 1W9FA 3O1UA 3VHNA 4E4DX 5ACA3 1IZ3A 1JUHA 1HKDA 1ODMA 1SFPA 3MYXA 4W6XA 2BEOA 3FN9A 5IVFA 2C26A 1ZRCA 2XKOA 5F7UA 5JOXA 1W2NA 5LY2A 3WF4A 1U5XA 5K9YA 4A6OA 2ZAAA 4XMAA 4XQWA 3TEZA 1AR62 4Q4W1 3ZN4A 4ASKA 5C8WA 1RUC3 1WKYA 2VOXA 4XABA 3AKRA 5BNPA 1H4GA 2JXAA 4LE3A 4XEZA 3VBRA 3ZYPA 3ACHA 3PTYA 4ITCA 4X6QB 4AXOA 2YGLA 3BODA 4CU7A 1YYNA 1EUTA 1V6MA 1RUF3 4AAPA 4DUVA 1W3VA 1JZ7A 1W2UA 1AHSA 5FUNA 4N90A 4BCUA 4DIQA 4QXKA 3KS7A 1HQWA 1NG0A 2PHRA 2LROA 3N7JA 1RHI2 1R1A2 3M3CA 4C0HA 1LOFA 1VALA 1HW5A 1H8TC 2F4PA 4CUAA 4UOJA 5F3CA 3K4AA 4EV0A 4QQPA 1K5JA 3RZZA 1M4WA 2A6YA 1MS9A 2EIBA 3B3QE 4XCBA 2WSVA 4DEQA 1AR72 1VBE1 2JG8A 2Y64A 1IHMA 3PIJA 3SH4A 1B35A 3BALA 3CQOA 5C8CC 3ZX7A 1CZVA 2WAOA 4Y5TA 2WUHA 5D8AB 4QDSA 2VY0A 1ODNA 5T5LA 5JWPA 4CP1A 2VZVA 3LDKA 3HPNA 4CPBA 4CE8A 2VUJA 3ZSMA 4ZU5A 5GLVA 3I2IA 5LCWL 1YJKA 2PHDA 1DG6A 2AREA 1SLCA 1H2MA 2VC9A 4NR1A 5AC93 1D2QA 4JGYA 2HWB3 4XUPA 3SHRA 3TAYA 1V6OA 3OUJA 5K0UA 4Q4W2 3JZVA 3TBDA 4LK7A 1YIFA 4LLFA 3HT1A 2VR4A 1A6CA 3LA3A 3SISA 1H6YA 2GH8A 4YVSB 4BDVB 3UKTA 2LW8A 1J58A 5FYMA 3DGTA 1RUJ3 4CDWC 4AI2A 2OIIA 4GWIA 5C3SA 4LO6B 2VQTA 3MW2A 3MZHA 1NCQB 1S1AA 3ZMOA 3PJQA 3WNKA 2ILMA 5LRSA 1RITA 1LU1A 1K45A 3K75B 5IVEA 3MICA 3VBOC 1AR81 3OGVA 5AFEA 2D6OX 4OZOA 1FAYA 2AR6A 4XJWA 5A33B 1H2KA 1WUVA 4GA9A 4MGIE 1HV0A 1EY2A 4WZCA 3OG2A 3OBAA 5A1AA 1HRI1 4LTAA 1DZTA 5FXWA 5M0TA 4CP2A 3S6PA 4CCOA 1VBE2 1YWKA 5CEHA 4C90A 4IUGA 1AYN1 3E5UA 1O4ZA 2GH2A 1CAXB 1L7LA 2W5FA 2W39A 1UU6A 2V5DA 4MZUA 1H8VA 4IV1C 1XSRA 4P9GA 5FYUA 1S0DA 2QJVA 1JU3A 3SKJE 2KM2A 2RDQA 3HNYM 1RUD3 1GBGA 1G8WA 5FOBB 4YGDA 2NP0A 4BK5A 1SPPA 3LSEA 1GLHA 3FHQA 4CDXB 1O5UA 1VBA1 1F15A 4GMP0 5FDBA 2IFRA 1PO11 5T5PA 3MV11 4IL7A 3BKZA 4B4QA 4E2QA 2WWJA 3ILRA 4AR2A 4IE7A 1KRIA 1FMD1 4N43C 1NUKA 2L9LA 4GWNA 4GH4B 2D6PA 1WMDA 4Q4Y3 1POQA 1YRZA 2TNFA 4ORFA 1WCSA 2Y6KA 4QXHA 1SFYA 2WYSA 5FWEA 2YU1A 1GUIA 3RFRA 1F8VA 2EA7A 4Y1YA 5FY8A 4XJ8A 4DXTA 3I8TA 1AR82 2WT1A 3DKWA 1UQXA 2UYBA 1UWWA 4HVQA 2ZGSA 2AEYA 2VZ1A 1DU3D 2BGPA 4PIYA 5BXXA 2A6VA 4PI0A 2YPJA 1HRI2 2Z2SB 4PT6A 3KD4A 5FZBA 4AFDA 1SLAA 2A7AA 4QWNA 4AEMA 4LE4A 1XE8A 4AQ6A 1AYN2 3LEMA 2C24A 2ORZA 4CVUA 1DBNA 1NXD1 2A70A 3ASIA 4P14A 4RR3B 5LA1A 4AVVA 2D40A 3QOPA 3S7IA 1O59A 3DXTA 1SHWB 4PLMA 1VBD3 2RV9A 3THDA 3N7MA 5I93A 1H8TA 2BNOA 1G9CA 1WMFA 4LBQA 2A5ZA 1QWRA 2JB8A 4XC9A 5IVYA 1VBA2 1U5IA 3H7YA 2YC4A 3NNMA 1PO12 5IFTA 1LAJA 5H9RA 4CEYA 3FUOA 3C2UA 3O1PA 4M0NA 5FFOC 1BK0A 3I3DA 2P3KA 4QHBA 2VZRA 1FMD2 4L2NA 5C8CA 1H6XA 1RHI3 1R1A3 1UZ0A 3HD8B 2JDKA 5FZDA 5FBJA 3NNGA 1HB1A 2XHNA 4HVOA 3K51A 1C4RA 5L9RA 3CEWA 1V6NA 3UK9A 3BPZA 2XJQA 4YZ2A 3VZOA 1AR73 3POGA 1RIRA 2Z79A 1O3QA 5FZIA 2JECA 1W9YA 3VD4A 4Y3OA 4FPFA 5FJKA 3V0AB 5DUWA 5E88A 4D69A 1XXNA 4RN5A 4OI1A 3ZKYA 4M0HA 4HPKB 5J7MA 4BQYA 3EB7A 4Z8BA 1EYBA 1AXYA 3TOJA 3Q8FA 4N9HA 2R072 5FYHA 2CWMA 4N8MA 3LF7A 1QHDA 5FWJA 3U4XA 2EXKA 3AKQA 1W99A 4XZUG 5EIYB 1PZ8A 4CDWA 2QQPA 1XB9A 1GNHA 4LOTA 2RE9A 1JU4A 3VBHB 4E2SA 5FTTC 3MUZ1 3ZMNA 1LOBA 1S0IA 2GALA 1VMJA 4NIHA 5EHDA 3H8UA 3K4DA 3VBOA 3K46A 4Q4W3 4MVTA 1AX0A 3RZGA 3WW1A 2PQSA 3AYAA 2ADDA 1O6UA 5DG1A 3ZIXA 3ZVXA 1WMXA 2Y6HA 4AVTA 1Q5OA 1BHGA 1W6QB 2WDBA 1IG0A 4JGZC 2WFF1 3HEIA 4AF9A 2EXHA 3PUIA 4DO0A 4ZKTB 3I59B 1JZ2A 1W0OA 2VZSA 4HMZA 1IOAA 4LLOA 1W6PB 5JZGC 2D93A 2GAUA 4IV1A 5L73A 5LW9A 3E6DA 1ZX5A 4AFCA 2HBTA 1JZ6A 1VBE3 2Q1ZB 3GJBA 1FI2A 2RS31 5DAQA 3JU9A 3DYPA 4HVRA 1W8UA 2F6BA 1NA1B 1VBB2 3PNAA 4AE2A 3NAPC 5HCBA 5A6QA 5IVJA 1LRHA 2XOMA 1NCQC 4N43A 4QQLA 1UMIA 4BB3A 2ARCA 3N9PA 5DUVA 3B02A 5FZMA 2BBVA 4FPKA 2FCVA 1GR3A 5C5TA 1OF3A 4ZY9A 3T0AA 3JD73 1O5LA 1YCIA 4HSLA 3VZNA 3FLRA 4MGZE 2JG9B 4QQ2A 1A8MA 2VE1A 2RS11 3OPTA 2P5BA 4N7UA 3U78A 4P9WA 4FXKB 2B42B 2ZX4A 2W08A 5JIAA 2AC1A 5G05L 1CAWA 1Y4WA 3V64A 3BI3A 2VMGA 4LEJA 2BWAA 1OKOA 1OLME 1U5ZA 2WO1A 3RS6A 1WA6X 1WCKA 3B7MA 3LDBA 2YUEA 2WFF2 4GJYA 2ZCWA 2W95A 5C3PA 2B9UA 2WNUB 3MFAA 1AR83 1X8MA 4QX5A 5CZKA 4CCNA 1FNYA 1G9FA 1NE6A 4FOWA 1W9WA 2R1BA 4S2GA 1BEV2 1FATA 5CFCA 3NV3A 1PZ9A 1H2NA 2RDRA 4QM9A 2QE3A 1XNBA 1VRH1 2FZ2A 1IKPA 1RUG2 4PQ9A 3C7GA 3D8CA 5L9VA 5GZCA 5CU1A 4GH4C 2RS32 3W59A 1VB2A 1TE1B 2DDUA 2ET7A 4XF0A 3EBRA 3RZHA 2WKKA 4HN1A 4CDUB 2VNOA 3N9QA 4NE9A 4PLNA 4WVVA 2VNRA 3ZLIA 3ZXKA 4BIOA 3A7QA 3ECQA 4E4ZA 1S0BA 1ZVFA 2D5HA 1R091 3M7AA 1B09A 3MV01 4L99A 4JV4A 1UO9A 4B4PA 1VBA3 3KV9A 4YW6A 1K42A 2HH9A 2ZGQA 1ND3C 2Q8CA 4DRRA 4DOUA 5BYNA 2ZKLA 4BWOA 2RS12 2R061 5GZEA 5FYIA 2VGDA 3K3OA 4FOYA 4P08A 1CD3G 1SDDB 4RYDA 3SCGA 1SZBA 4XW3A 1ZRIA 4R4ZA 1W90A 3ON7A 5D21A 1TME1 3D0SA 3HQUA 2Q8OA 1TEIA 4RR3C 3WCRA 1OUXA 1T6BX 2KA3A 4URAA 5FYZA 4AFAA 2J22A 1N47A 4FP3A 4AI0A 5F3GA 1FV2A 3M3IA 3CO2A 2D6LX 2Q30A 3NNLA 1PIV1 4PIZA 4XIKA 3MO4A 2OVUA 2PXJA 2ZHNA 2PHLA 3HNBM 2A6WA 1YQCA 5DUUA 1CIYA 2Y6FA 3AP4A 3ILNA 3I3BA 1IQDC 3KT7A 3LPGA 1GFF2 3TWIA 3UKVA 4EWEA 3VBRB 5BNPB 4CCJA 5FO9B 1OT5A 1V6LA 2R073 1VRH2 4WM7C 2D3SA 1X33A 5KR7A 4ZS3A 3IBMA 1DGWA 3IPVA 5F8PA 3U75A 2BWCA 4CXXA 5JSOA 5CFDB 3OY8B 4HXCA 4J25A 2WO7A 3T4HB 1V00A 3AVRA 3LAGA 4JGZA 5IK4A 2VOKA 1TVGA 2BQPA 4DEVA 1YEWA 4OMDA 3TYJA 5I8YA 3WD5A 1GQHA 3RYPA 5JI9A 2GNBA 5JZGA 5JOZA 3FHIB 3ZKUA 4ISRA 1R092 2FDFA 2O1QA 1RUH2 2JG8B 2E7AA 4JDOA 1Y9QA 3M1HA 4LBKA 1OQ1A 3H3ZA 2DV9A 2IXJA 3FE5A 4FPYA 3JBG1 3H1YA 1UXZA 3NVCA 1IQAA 5GM0A 2VNVA 2R062 2OXBA 4F8AA 2C9AA 2W46A 1O3TA 4NIIA 2MNGA 3NAPA 2VQAA 4BHPA 4CCCA 3R4SA 1LHWA 1TME2 5H9SA 1NCQA 2DCJA 1J1TA 1W8HA 3IMMA 3ROUA 5J96B 1YJLA 3ZXLA 4DPNA 4NWVA 4P9XA 5A33A 4ATFA 4QGLA 1PIV2 3KWVA 3ME2A 5I8TA 2Y33A 4JCKA 1VBB3 2W92A 4AQ2A 1MR5A 1RXFA 2JE7A 3WQ1A 1IPKA 1V9U3 4OI2A 1RUE1 3ACIA 1NX9A 2XJTA 5AVPA 3C7FA 5FXZA 2LUWA 1WCUA 2R7EB 1QQP1 3D82A 2FQPA 3POYA 4IEOA 1DGRN 1TQ5A 1UMHA 2CL2A 2IXIA 2YV8A 3K3NA 4JC1A 4LNVA 3O1VA 2W2IA 4IESA 2XUEA 5DAXA 3SH3A 4D6RA 3LFIA 1ENSA 4I3GA 4AGVA 2ZMLA 4CTEA 2C5DA 2YBKA 4IGPA 5EPAA 2E6VA 2GNMA 2Q4SA 3KHBA 1R083 3I54A 4O7XA 4GAZA 3ATGA 4CYDA 4NIAA 2IXLA 1DHKB 3B94A 1PVXA 3DYOA 2VULA 3KZ4C 1DQ0A 1NA1C 4NHLA 1GANA 5A80A 3TB0A 1ENXA 2R32A 3JBG2 2WFF3 3WUDA 3ZXJA 4S2HA 1QKQA 1POV1 2C6SA 2J1UA 4NROA 5LB6A 5IVCA 4GH4A 2WLQA 4GD4A 3QLQA 3VZKA 5I0SA 2XLGA 3GBWA 1GKBA 5FZHA 3SKVA 2Z69A 4XF4A 1BEV3 2OZ6A 3SEEA 4QQOA 4GWJA 3MIHA 5DZFA 5DQ0A 1JODA 1RUG3 1S0FA 2OUHA 4J1WA 4AI3A 3LE0A 5J3UA 4IEQA 1DQ1A 2RS33 1ND3A 1JOPA 5JDBA 3H1MA 4HANA 4D94A 4WVMB 3U37A 1TNRA 4XIOA 1J3PA 1RUE2 3T2OA 3N7KA 5KWRA 5EWSA 4QX7A 2GMEA 1QQP2 5IAVA 3W21A 2VW2A 2PHXA 3VKFC 2PAMA 4RHV3 1GNYA 2WZPP 1A34A 3GZUC 1AX1A 4LUMA 4GXLA 2A6XA 3Q8CA 2OPKA 2RS13 1JBCA 2QZ3A 3MDPA 4OYUA 2FDIA 1S2EA 2X29A 2J1TA 3ES4A 3ZN6B 2Z5WA 4UT5A 4K6BA 1E57A 2HEYF 4Y24A 3DPRC 1WW6A 1NKGA 4OHWA 4QKFA 4WM7A 2ZBJA 4PCRA 1QNWA 2F4LA 3WCSA 4QPIB 4YARA 3VKOA 4A45A 3GDBA 2WN2A 1Q3EA 2VAUA 4IEVA 1CIWA 3LEGA 3LGRA 2QVSB 3ZYBA 1O8SA 3AC0A 4FPGA 1LCLA 2MEV1 2FZ1A 2A3WA 2VUCA 4JZRA 4NRQA 4HFSA 4W6YA 1W8FA 3B9CA 4KWKA 2OZJA 1HB2A 4LBJA 4PDWB 5FQ0B 1D7PM 5CADA 4CEYB 1Q56A 1UOJA 4K1YA 1K5MB 2TUNA 4O65A 3AZXA 3OUHA 4EN9B 3GCWA 5T55A 4GB32 1TMF3 5JI7A 4LO4B 3UT0A 1MS4A 1OKQA 2W9XA 2A73B 2WS91 1RUH3 5T54A 4YZ4A 3ZYRA 2OPWA 1H1MA 3POJA 3QH6A 1D4M3 2UWAA 4BA6A 1V6IA 3CHXA 4RFRB 3ZM8A 1QEXA 4A4AA 1MS5A 4LQRA 3ZOIA 2R063 1JN2P 2WWSA 1W03A 3RWNA 4AI8A 4XJAA 5KHGA 4CU6A 3LIHA 2B9VA 3HJRA 1JYTA 2VG9A 1XNDA 4DUWA 5CFDC 1W6QA 1ASJ3 2BUKA 1UY1A 4LO7A 3O12A 4R9DA 3VHRA 1D0HA 4CDWB 1FPN1 4AEDC 1XNAA 5LEJA 1RYYA 1ONAA 3OEAA 1PIV3 2QQWA 3W58A 5BNQA 1LHNA 2VMIA 4U36A 2VQUA 5BUVA 3FFZA 1RJ8A 2RJKA 3RVHA 2MEV2 4ZZ8A 4FTSA 2D44A 4Z2WA 2YROA 4MUVA 3ZSKA 2JDYA 2R041 5JXHA 4NRMA 1QJX1 4KBZA 1NA1A 3ZXFA 3N36A 5EQUA 4JAAA 1JYCA 4NIGA 4TXWA 3POEA 3NRUA 2ZEXA 2AH2A 4XDOA 3ZXEA 3UV9A 2H0BA 3GBGA 1XNKA 2WS92 4CXYA 5FREA 4JQTA 1Q8OA 5DXDA 4CDQB 4XJUA 1ENRA 4JKLA 5I0TA 3H7JA 3M8LA 4ZHNA 1BJQA 3WHTA 3EYPA 3OPZA 1KFXL 1XNCA 3LSDA 5CVRA 3VDDB 2JWPA 5GLUA 3B00A 3NJZA 5FLIA 3WX5A 3O1OA 4FQZA 3D5OA 1UYXA 2DBNA 4G9SB 4XHBA 1FPN2 3USUA 3IZOA 1LOCA 2P2KA 1S55A 2WLPA 3SH5A 5DZGA 4RS5B 4LKDA 5F3EA 3OBTA 2VZTA 4WVZA 1UCXA 3FBMA 4QQHA 1SLIA 3EXUA 2B7YA 4XQDA 3THPA 4MGTA 1CAWB 2DCYA 3TNQA 1EUUA 4P00B 2ARBA 1GZWB 1TZOA 1RUE3 4LIUA 1RUOA 1EV13 4UFJA 3KV6A 3URFA 2DUPA 4V1PA 4MH0E 4C8DA 1QQP3 4A2UA 2R042 2D98A 4NHYA 4XF1A 5I91A 2ORXA 1QJX2 3DPRA 3O0WA 1H4HA 5EJZB 5FZ9A 3ZIWA 4Q8KA 3PVEA 4XURA 1XYNA 5FMCA 3WDTA 5LEKA 4YYOA 3OBZA 4FAHA 5FY5A 1IS6A 1XC6A 2WZR1 1GSLA 1Z7S1 3OGGA 5CFCB 2D3RA 1G9BA 4PBOA 4FAGA 5FZ8A 4EZ4A 1NY71 2X05A 1GYKA 5CA6A 3I2FA 5FZLA 3AMHA 4D6SA 5IT6A 3VB9A 3GBFA 5FZEA 2QDNA 3WP3A 3LEKA 2HWD3 1OI6A 1OA4A 1LEDA 2PTMA 3PURA 1OMIA 2PLV2 2ZZQA 4TLFA 1QNYA 3UGGA 5FPXA 4KWUA 1S0GA 2OW4A 1UY4A 3AMPA 1Y9MA 5JMOA 2E32A 3NJXA 4MO3M 1UOBA 2WA4A 4AG4A 5FUIA 3WG1A 4JQRA 3VL8A 3FUQA 5DDJ1 1SLTA 5KHKA 3ZR5A 4YFWA 1OA2A 4OI0A 3MGUA 4UW4A 2JD4A 5LWBA 2H0VA 1GNZA 1QIQA 1QJU1 1RINA 1TNFA 1VP6A 4FVVA 4GB33 4OQ9A 3WXPA 2VOTA 5FZFA 1JOJA 4WV8A 3GHNA 4QPIC 1C5IA 5CFDA 2JKBA 3OY8A 4NAOA 5FZKA 2LTNA 3AFGA 3LDRA 2P6HA 3T08A 2SLIA 2BFUS 4ES8A 3PU3A 2E7QA 1JYWA 3H9AA 1OPMA 1FOD1 3OGJA 1PGW1 2XXZA 4AEDA 3DCQA 1O7FA 1W9TA 1D0GA 4PDWC 4ZU4A 5FRAA 3JQWA 4CEYC 5LBCA 1OSGA 2R16A 2WZR2 1Z7S2 4B8EA 2BV4A 4JX0A 1K5MC 2JKXA 3AMMA 1W6MA 1DZRA 3OOXA 2E7TA 1FX5A 5FP3A 1NY72 3D4KA 3IPVB 4DRVA 2V73A 5IFPA 5J1XA 1OURA 3AJZA 1CVNA 2E63A 1QH7A 1T6GC 4JGZB 1WBFA 1VAVA 4YZ5A 1J1LA 5JXGA 1MPXA 3VD5A 3AL6A 1LB2A 5K4LA 3FL7A 5JZGB 2CYFA 3OBRA 2MEV3 3S57A 2IXHA 4N9IA 5GZFA 4NVPA 1PM7A 2IC1A 2Q0AA 4BMBA 1JZ4A 3NV4A 5DDJ2 2NPIA 5GKAC 2ZX3A 1FNZA 2EVXA 2O8OA 4JRLA 3VN4A 1UKGA 4K7JA 5EZWA 1ZA7A 1QXJA 3NAPB 1XPWA 3J26N 1LU2A 2R0FA 3Q9OA 3HQRA 4HBNA 3B01A 1FXZA 1W3XA 2GC2A 2UY9A 1GZCA 2BNNA 2HWC1 3WW4A 4D6QA 2WS93 1AF9A 1PO21 3CIHA 3WG2A 4YLZA 3AKSA 5D2AA 3RJRA 4Q26A 1ZBA1 1PGW2 1RUI3 1SDWA 1SEFA 2J1EA 3SNMA 1JOBA 4QKDA 3NKGA 2WL1A 4YM3A 1AYM3 1XJAA 4KL1A 4ZS2A 2BOJA 1CZTA 5FXVA 5L7OB 2F17A 5BNNB 1N3QA 3BVCA 4HT1T 4COVA 4ZU7A 2WQZC 2PHWA 3AX4A 4IEYA 5FBZA 1OC1A 1SBFA 4U2AA 2X53S 4M01A 1L7QA 4IEZA 1CONA 4BPZA 3CKHA 2A1XA 5FP8A 3IDCB 1OD5A 2ZA9A 3VDCA 3ZYFA 2HEWF 1YI7A 1BQPA 2OKXA 2CGOA 3M4FA 2ZOEB 4CDQC 2NLRA 2W52A 3MLKA 2FDKA 3OGRA 1WBLA 2AENA 3QCWA 2P37A 3WNOA 2CHHA 4AHZA 1UZWA 2GN7A 2G9GA 4YM2A 5LZ6A 4QHZA 4R9CA 5GLWA 5HCHA 1GZTA 4WVMA 4C1XA 3U10A 2DVDA 3LOIA 4QX8A 3RQ0A 3VDDC 5C70A 1A78A 3WG4A 4COYA 2BP6A 3ACLA 1WZXA 4P02B 3CU7A 3HAGA 2BU9A 1C1LA 4HZFA 2XBO1 4EROA 2VZOA 3ELNA 4RGGA 5JSRA 1JZ8A 1E5IA 3R4DB 3WNNA 4ZXEA 4RS5C 4L8QA 4OVEA 5BV6A 3T4VA 4XFBA 4YFZA 2HWC2 1JYNA 1MVEA 5IVVA 1F5FA 1PO22 3KQ4B 3ZO0B 1ND2C 2PAEA 2WIIB 2DBIA 1ZBA2 1ND3B 3BCWA 4Y4YA 1XE0A 2ZEWA 3ZN6A 4RL7A 4XBLA 3VHOA 3KVAA 2PLV3 1MZEA 4CP9B 3QD6A 1H2LA 4B7EA 2G9ZA 4UFIA 1MZFA 2CDOA 4P9JA 2OYZA 4QPIA 2PA7A 5KHIA 5FMOS 1UNBA 4UI9L 2VCCA 5C3QA 1AZDA 4J1XA 2B39A 4I0WB 1GWLA 2WO2A 3OB8A 1AR63 2I74A 5CFCC 1OH4A 1GV9A 4XJZA 4N53B 3PUAA 1CESA 2V72A 4RSUA 4I30A 3DKQA 4KU7A 2DU0A 3D0JA 4PDWA 5FQ0A 1CAVA 3MIEA 5C9AC 2Y8KA 1K5MA 1OLMA 4CCEA 2W0XA 4WM7B 1HN0A 1G6NA 3ZR6A 5FPAA 3EMRA 3J8F1 4W6WA 1CJPA 1YQ8A 1QDCA 3CF6E 3VDBA 2XBO2 1KDMA 2DUQA 1O3SA 2WZR3 1Z7S3 4NAMA 2ERFA 1PX4A 5FYVA 3VL9A 5F2WA 5JPMB 4LORA 1H1AA 3WP5A 4B29A 3AXDA 5C7GA 3MUY1 3VKLA 1HLCA 5A3MA 5KBFA 2IXKA 3IAQA 4O9EA 4Y1UA 1YUDA 1L7RA 4QB1A 3AZWA 5F5AA 3PUHA 2XVGA 2NYYA 2YU2A 3H50A 2CDPA 1RB8G 1AL0G 1SFNA 5DDJ3 1MS1A 2NZ9A 1QXPA 3BTAA 5J98B 1IKQA 3BUCA 3VBFC 3GZAA 5FPZA 1UOFA 1G86A 1Z78A 5LRRA 1W8OA 3IDBB 4FTEA 5HXVA 4KU8A 2Q1FA 3I2HA 4A7ZA 5A7NA 2DYCA 3WZ1A 1OF4A 4RD7A 3H3LA 4META 1VIWB 3RRDA 4IW3A 4XE9A 3MW4A 2B46X 1K3IA 2CY6A 3LZZA 3MBWA 2N7GA 3TRSB 3BU0A 4IE5A 3J8F2 1REEA 2AGSA 1WGPA 1ENQA 3SLIA 4AGRA 3IT8A 3JUUA 2PQQA 1YO8A 3Q8EA 4TYSA 2VXJA 2DU1A 4C91A 3DN7A 1Y3TA 2WT2A 2O14A 4FSJA 4CDQA 2VZPA 4GZ9A 4AWDA 4A7KA 2VUAA 5FPVA 4DUXA 3N9NA 2WNEA 2P34A 3DV8A 2YY1A 4AW7A 3O0VA 2V4AA 5FY9A 3U0ZA 1PNGA 2BYVE 1N3PA 3IB3A 2WQ8A 4B7KA 2AACA 3CZJA 4QX0A 4KQ7A 4CXWA 3TEYA 5KHHA 3VDDA 2J1VA 2BOIA 3ES1A 3MIBA 4X6RB 3SMHA 1BXHA 4FXGB 3T1LA 1G9AA 2ZX1A 5LA0A 2GDFA 4XAEA 5LY1A 4LKSA 1EAH1 3S5AA 1UYZA 3N9OA 5T52A 3B9IA 3CMGA 4NJ4A 3GJAA 3ABZA 4RS5A 2YZ4A 5EXOA 1J84A 1QJZA 2UWCA 4BMEA 4MGSA 2XL9A 5KXBA 1DLLA 2OUJA 3LA7A 3FLTA 1ND2A 5L7OC 5BNNC 2YXSA 2YB7A 3PU8A 1GZWA 2PHUA 1X50A 5A6XA 2BBAA 4EWDA 2EXIA 1MS3A 1S0JA 2VOVA 2VVFA 3NNFA 4LBNA 5C71A 4LULA 3J9SA 2JJ6A 5D1IA 4QPYA 3NNJA 3LQCA 1HJGA 3UJQA 2HWC3 3WDWA 4BQ5A 5JAXA 3LEIA 1PO23 2KXLA 3LIGA 3KV4A 3UGHA 3USUB 4Z92B 1W04A 4IXLA 1ZBA3 1HDKA 3GM8A 3J7NA 1NYWA 4QM8A 4LHSA 1HRI3 5BPXA 2WN3A 1UYYA 3ZFGB 1NAEA 3PTRB 4KWJA 1HB4A 3FJSA 4LXLA 3VKNA 2ZKNA 1AYN3 3O1MA 3WG3A 5C9AA 5FZ3A 3DPRB 4TTGA 4TLGA 4KH9A 4D0QA 5FP7A 3IDEA 4NMIA 1G7YA 5EJ1B 2ETEA 3BPSA 3PIGA 2VECA 4BQWA 2WWUA 4WM8C 4TWTA 4YGEA 5ANQA 1DGWX 3I7DA 4KGGA 3NL1A 4EYUA 5CISA 1EAH2 1PO13 4JTOA 3HOBA 3MF9A 4Q0PA 3Q8AA 5DPNA 4SBVA 2O0OA 5K8SA 2K0GA 1ZNPA 2GNTA 5FUPA 1FMD3 2J1SA 4QPGB 4NHKA 3UJOA 1AXKA 2YBPA 5ERLA 1UPIA 3PMSA 5A3LA 4QKNA 2BTVC 3BIEA 2VNGA 3C8XA 1MVQA 5FZOA 2GSYA 5KC6A 4B1MA 1N1VA 3RMXA 3CZUA 4MX3A 4QGNA 1LGCA 1Z0HA 4AQSA 5FR3A 3IAPA 2JDUA 4YW2A 4N53C 1PMHX 2BFUL 1J59A 3HR9A 4QX3A 3C7OA 5FYBA 3L2HA 4BU2A 3WW2A 3WQBA 5ABJB 1ULGA 3AKTA 5A6YA 1D2SA 2FCTA 4HONA 1BK1A 3VBFA 1BYHA 1YFXA 4UXAA 4BZ4A 2J42A 3RZMA 4A3ZA 2E31A 1BZWA 4CRQA 4Y22A 4XBNA 4DXZA 3PUSA 3VV1A 3O1SA 3KT4A 5FLJA 3NJYA 1COV1 1Q8VA 3BOPA 2QQIA 4PLOA 1I5PA 5F1RA 2RR11 4QX1A 4AEDB 3ALQA 2ZGOA 4BE3A 5DN2A 4GIQA 1BBT1 1IS3A 1OFNA 5DAWA 2DUOA 1UX7A 4ATEA 4EN6B 3VBUC 4KGQA 1KXGA 3HN3A 4PQQA 1IS4A 1DYPA 2ARAA 3JCIA 1JTZX 3IIIA 3MI8A 4NWWA 1W6MB 1JYVA 4XUTA 4AHYA 3U07A 1YNAA 4IV3C 4PI2A 4M3CF 4DNYA 4P5HA 2ZMNA 1YQ2A 1T2XA 4XETA 5CIRA 5GZGA 4KWLA 1QJY1 3I3QA 5A3UA 2I2SA 1OOPB 3J8F3 2V09A 1RVF1 2RDSA 1GP6A 4HETA 4BQXA 5JUVA 3ZYJB 5CYYA 2NMOA 4LBMA 4OHYA 5LA2A 1YFUA 4FBFA 3T09A 2QDRA 3WLUA 1OQDA 3V0BB 4DB5A 1REDA 2EF6A 3VD7A 3E5XA 4P9IA 5H9QA 1RC6A 2X5IC 1S4CA 1HRV1 1FYUA 1HQNA 2V4VA 3KF5A 1SG3A 1O8PA 1QGLA 1CX4A 1W8WA 4QD2A 1AUYA 5L7OA 5BNNA 2XHKA 1GP5A 3PVBB 4Q4X1 1EPWA 1MQTA 2ARXA 3P1IA 4KG8A 1H9WA 1VR3A 5I0DA 1XSQA 4D7TA 4X8NA 4EE2A 4IERA 3KCXA 5SV8A 3RZKA 5FZ6A 1COV2 1W6NA 1CPMA 3THTA 1G9DA 5A6ZA 4FP2A 4ZPIA 5IATA 2XVLA 4LA3A 2RR12 4IE6A 2DVGA 5AFBA 3X29B 1BBT2 1ZRDA 1QY4A 2VMFA 2XWBB 1HN1A 4LT5A 2YBSA 4COZA 1XU2A 2VBPA 4OHVA 3GALA 1XU1A 2XQXA 4NPLA 3KT1A 4QDRA 3MIFA 1LOAA 3AP5A 1PK6C 1CWPA 1KJRA 1QJY2 2GN3A 4UFHA 4B4RA 2BZDA 1BVVA 2JD9A 3OF1A 4UFMA 4CUCA 4QT6A 1RVF2 5F37A 4LBLA 2JE9A 3AYEA 4WM8A 1OVPA 2VZQA 2X8KA 1F5JA 1C1FA 4IQPA 2KR2A 1KDKA 2FD8A 3PVOA 3VDAA 3LFMA 5CNAA 5J09A 4LJHA 2VD7A 4FT8A 5FIXA 1X9PA 1W39A 1HRV2 1HX6A 3CJXA 5ACA1 1O3RA 1O91A 4BLIA 4CP9A 2XLFA 1PMIA 3E6BA 5IYYA 2W3JA 2Y60A 3GNEA 1WA4A 1OBNA 4H7LA 4Q4X2 4Y26A 1WMEA 4YW5A 3N7LA 4XMIA 1GOHA 1UKRA 1UU5A 5F39A 1NXMA 2VU9A 1EAH3 4XAAA 2VW0A 3OSDA 4HN0A 4CU9A 1ULFA 1OLRA 1JYIA 3I2OA 1QH6A 3ZFGC 2XR4A 4N53A 4D8MA 4JTNA 4OUSA 4XTPA 1RUC1 2WYFA 2BNMA 3I2DA 3NJVA 5FO8B 1PVC1 2E9QA 3WR0A 3ACFA 4UFLA 1DLCA 2PN5A 1W8TA 4XQ4A 1JUIA 4CP0A 5C3RA 5JCTA 1WCQA 1RUF1 1S0EA 1KQRA 3AM2A 1J3QA 3OYWA 3DF0A 3GZEA 3OGSA 4Q1PA 1E5RA 4MLOA 4TSVA 2UY8A 2BGCA 3MIGA 1U12A 1GICA 2CWSA 5EJ3A 5FY0A 1KFUL 4MXWB 4DZGA 4YW7A 4QU1A 2JX9A 4Y5SA 4RFT0 4LBQD 1VRH3 3N3HA 1CAVB 2GU9A 3I2KA 4QPGC 3VBUA 4LA2A 5JR7B 5LBFA 3USSA 4LO8A 4XJ9A 5A7PA 5LBBA 4R9AA 4IV3A 5J36A 4Y1ZA 1JHNA 2VZUA 3MIDA 5ACA2 2D6NA 3C7EA 2WFPA 4BYYA 4GULA 4DY5A 4E27A 1CZSA 1R093 1K12A 4Y1XA 5IJRA 3T30A 4FPEA 5ABJC 5FPUA 1MS8A 2Y0OA 2RS51 3N35A 5AC91 5JXIA 1W05A 4MSVA 4G4FA 5IW0A 4UFKA 5L36A 2OQ6A 2B45X 1I6XA 2PFWA 2JIGA 4XFCA 4YM1A 5T5JA 1RUC2 1W8ZA 2JICA 2X5IA 2XL7A 3WY6A 4RA0A 1PVC2 2VJXA 1TME3 4Q27A 1SLLA 1BLZA 4BLJA 3LB9A 1HQLA 4WZFA 3CBNA 3WHUA 2VTXJ 2W1UA 1OHFA 4NUBA 4L92A 1RUF2 1ZRRA 5CKNA 2ZAHA 4LHLA 5CB7A 3WP4A 3V65A 4I02A 2DF7A 2RJLA 1PGL1 2E51A 5FKCA 4AOCA 4XFFA 2G1MA 5LASA 2GC3A 4XXPA 3AKPA 3LPFA 5HV4A 5JOYA 3CJIC 4YWAA 1V6JA 4LK6A 3KF3A 3WF0A 2VQ0A 5FP9A 1OOPC 1VMHA 5B4XA 2HKXA 2I45A 2XUMA 3PJYA 4K9SA 3O1RA 3VZMA 2EAAA 1LODA 2YPDA 2GZWA 3WNXA 5JR2A 2HBUA 4CU8A 2DFBA 4OLLA 1H30A 4I2OA 2GP3A 2RR13 1F2NA 1PK6A 1RUD1 5HXMA 3TN91 1BBT3 2CV6A 3IWZA 2WINB 2QQNA 3BB6A 3MEPA 4EJRA 1OD3A 2WABA 5I0UA 4XBQA 3ZXGA 2RS52 3KLSA 4K3UA 3JBG3 2XONA 5FYTA 3KQRA 1GU3A 1VE0A 4Q2FA 1XYOA 1ZREA 2XDVA 2XQRA 4OUMA 5FK7A 3PLQA 2UURA 4Q4Y1 2W87A 2FMYA 1GZ9A 3ZFEC 1ZZ6A 1J3RA 3RMYA 1RVF3 1WW5A 1SCRA 4GKXA 2ZJCA 2ZGMA 1O4YA 1IS5A 4I01A 3O1TA 2Y26A 4SLIA 1ZZCA 1W0PA 4FPHA 3WDVA 4X8PA 4H7MA 2WJSA 1PGL2 1KS4A 3WVJA 2FDGA 3KVBA 1ZZ9A 1V0AA 1ND2B 3G7DA 2FCUA 3M3EA 3TEXA 1GMMA 3MF6A 1HRV3 3JB4C 2PAKA 4IGOA 5FXXA 3ZFGA 5CG8A 1XRUA 4ONUA 3SCFA 3BTXA 2VTFA 2YGMA 1VBC1 3AP6A 4Q4X3 3MLJA 4FPCA 3L2YA 5LK5A 3I3MA 4L0PA 3POSA 4YZ1A 4BK4A 4HKLA 5FMDA 4MV2A 1EP0A 5F6LB 1LHUA 4KMQA 3WDYA 4XOGA 4TZDA 1QJFA 4B3NA 4Q5OA 3ZFFC 2QKDA 1GQGA 1KEXA 1GOGA 1VBD1 3OEBA 4HL0A 3W9AA 1X36A 1RUD2 4XFHA 3TN92 4QDQA 2P3YA 4E4SA 1PHMA 3M70A 4MGYE 1YI9A 3T0BA 1DQ6A 1JW6A 2ZGTA 3PUQA 3BIWE 4OQ8A 1AJOA 2IVJA 4QPGA 3WF1A 2Y6LA 5C9AB 1POV3 1SBDA 4LO5B 3FLPA 5GZDA 2ZEYA 3IIAA 4Q4Y2 3IMNA 4XPVA 2PHFA 4LMFA 2GC0A 3ST7A 4AFBA 3E5QA 5FO7B 4UW5A 5JLVA 4DY3A 1U0AA 2ATFA 1DQ4A 3FHAA 3VBSA 1RTVA 4L9BA 4S2FA 3RI9A 2XJSA 5ABJA 4DMIA 4YG0A 1WD4A 5FCCA 4INDA 3AMNA 3I97A 3W5MA 1XOYA 5EYYA 1OFSA 2LM3A 2VO5A 1I5ZA 3PL0A 5A70A 4M00A 4Q0VA 5FJHA 1PNFA 5FYCA 2AUYA 4A3XA 4Q8LA 5FZOB 4CCDA 1VBC2 2D6MA 2D7FA 3BTZA 1PZ7A 4M3CA 4E2GA 1QJEA 4A6SA 3BGAA 3P6BA 5BNOB 4UW3A 5B4NA 5FYYA 3H8XA 3EHKA 3H1WA 1AJKA 1CAUA 4IE4A 1VBD2 4CA9A 4CUBA 3L9JT 5CG9A 1JH5A 3FX3A 3SEPA 3VBFB 1PVC3 1UX6A 2LS6A 4BQ2A 1H1IA 1IPSA 1Y9GA 2FMDA 2W68A 3CJIA 3ETPA 1D4VB 3AXEA 4Q0SA 4RQPB 4Y22B 2ZGLA 2AEZA 2BVBA 3GXUA 2ZX2A 3WSOA 2ZZJA 3IKWA 1PGSA 1OOPA 4EN8B 1REFA 4MHUA 2C0ZA 4XXAA 1MZ5A 5GLTA 3I49A 4UWDA 3O7OA 2G9FA 2IFWA 3WQ0A 5I0RA 3NO8A 4PIXA 1N1TA 4JHTA 3V0BA 1MEC1 3AJYA 2RM21 1KD7A 1RMU1 4YG6A 5JOWA 1F35A 2FHRA 3OTFA 4Y33A 2ES3A 2OT7A 5GJ6A 1C8M1 4FFFA 2JIJA 1BKZA 1Y43B 4LIVA 2ZGKA 1NE4A 1WWYA 5FYSA 5KXDA 5L19A 1QJU2 2RVAA 2C9KA 5A7OA 4YW4A 5A7WA 4XYXA 4AGGA 1KS5A 1N3OA 2J1RA 4AVBA 1SBEA 1DZQA 3B69A 2ID4A 4PF5A 3ZFEA 2GNDA 4ARXA 4Y20B 3W5NA 3JD71 4WBBA 4RGAA 2QFEA 5IVBA 1I3HA 1FOD2 2RS53 5HV0A 2WNOA 1NOVA 2HWF1 2RHPA 1Q43A 2ZGUA 4CCMA 3LCPA 2HWE1 2D43A 3ZN5A 1SCSA 4F83A 1AVBA 2LRPA 5G04L 4ZONA 5F6KA 1LJ7A 3OD4A 3U14A 5B2GB 1MQTB 4IEXA 3KSCA 1XE7A 5JIUA 2XGXA 3E1F1 2D97A 1FPN3 1QMJA 1LHOA 2NN8A 2UYAA 3M2MA 3ZXDA 1VRBA 1W6NB 3P3PA 3PDQA 4IDZA 4YVWB 4AVCA 4ZZ5A 4FPLA 4CCLA 4CCKA 5DAPA 3WEZA 5F2SA 4YPJA 3GHMA 5A1LA 2JDNA 2RDNA 4Q0QA 5F3IA 3ZFFA 2DWRA 1J83A 4G3YC 3AFKA 1WW4A 1C28A 1MEC2 2RM22 2VVEA 3M3QA 2R043 1RMU2 2J7MA 1QJX3 2EIGA 3LKJA 4YW3A 3NSTA 1C8M2 5FK8A 5T50A 4IEUA 3P3NA 4OHXA 1HJFA 1AR91 5A32A 1ST8A 2C4XA 2QQMA 2OS2A 2X09A 3R0RA 4K40A 4M3CE 1LR5A 2I07B 3TN93 1OVSA 4CEWC 2YC2A 4YG3A 4WM8B 2QQVA 3JD72 1SQ4A 1WCDJ 3LWCA 5A3OA 1UW8A 3S0MA 4XUQA 3A21A 2W91A 2NM1A 2QQOA 3KCCA 2JDHA 1IG3A 1XNTA 2DVAA 2HWF2 3QBQA 4B1LA 4V2VA 2ZABA 4FFHA 5SV5A 4H3WA 1LHVA 2HWE2 4M4PA 1QDOA 2P3JA 5TSWA 1NQJA 1ULOA 4LKFA 2WC2A 1AX2A 4JKKA 4K1ZA 1V70A 1E5HA 3PVNA 1LGNA 1W8NA 2CTVA 2DVBA 2GC1A 3DEMA 3W20A 2V5YA 3POWA 2ZGPA 2EAKA 1W2OA 3DUIA 3WOGA 1DYOA 2CAUA 5C4WB 5LK7B 3A0KA 2UWBA 1LKNA 4MXWA 4XDQA 1ZA4A 2H6BA 4Y4RA 3J7LA 4EWAA 4F7ZA 3LOBA 2PYTA 4XACA 3ILFA 4FTBA 5IK5A 3HT2A 5FZ4A 2JDMA 5I8SA 2JENA 2R071 3WF2A 4PHZA 1VBC3 1CN1A 3AZVA 3OYWB 2CU5A 2R0HA 2EICA 1OLQA 3RZJA 3FZ3A 3ZSJA 4A44A 3THCA 3IN9A 2SBAA 1AR92 2Q5TA 4OFGA 1F31A 4AFMA 1RL3A 4R9BA 2GMPA 3O0XA 5FP4A 1GP4A 3RI8A 4I09A 1CJDA 3VBUB 3WP6A 3DXUA 1JMUB 4FOVA 3RNSA 1VLNA 5F9TA 4DQAA 5IK8A 3ETQA 1X82A 4IV3B 3KGZA 1POV0 5DAVA 2CGNA 2ENRA 2VBDA 2R49A 2Q8DA 3ZXAC 2VMEA 5E16A 5HPOA 2GMMA 5BNOC 3NV2A 4OZXA 5FAXA 2WNVB 5F5IA 2W1WA 4AK3A 4AQTA 2Y38A 2XWJB 1PX3A 4COUA 3HVDA 1EPZA 4QX2A 4YGCA 2TEPA 2XG3A 1ZBE1 4PBPA 4QGMA 4R8HA 4UBHA 1UZZA 4Z07A 3WF3A 5IAXA 2VM9A 3UESA 1RXGA 2DCKA 4BJ0A 4LOSA 2QBXA 3D6EA 5ANNA 1VBB1 4XFAA 4KG0A 4L97A 1QJU3 4RQPC 2X5IB 4MHRA 1V9U1 2ZHKA 1LECA 3AP7A 5FZ0A 3VZJA 1DCSA 3V56A 2W47A 2CAVA 2O8QA 2WR9A 3UGFA 3K77A 4L11A 2NQYA 2J1AA 1DDLA 2D3PA 1FOD3 3KV5A 3Q8BA 4QB2A 4P5YA 4NOTA 4AI1A 5IK7A 4Z1VA 3KGLA 4UF0B 1R081 3JQXA 1N1YA 4OUEA 3WW3A 4AL9A 1US2A 2NMNA 1UMZA 3T2QA 5HCFA 3ENRA 2VXRA 5FMBA 3AYDA 1W6OA 4HK8A 5D8AC 4AZZA 3C3VA 2CGPA 4FCAA 3VUOA 3RPQA 1Q8QA 1UL9A 3DL3A 2VMDA 4EZHA 3N4MA 1UIJA 2IWGB 4LUKA 2BVVA 1YHFA 4UAPA 1PK6B 4Y1VA 1WLCA 2PMWB 4YSFA 1QOTA 1BEV1 2VOWA 3MFCA 4MADA 5IUQA 4HLTA 3OJBA 4ASMB 5KC5A 1MEC3 4NO4A 1RUG1 2RM23 4NPRA 4AEKA 4CEWA 1RMU3 1ZBE2 1W9SA 2BGOA 4I0BA 1C8M3 3UL2A 4YVSC 5EFUA 1I9RA 1X9TA 4JRAA 1UY2A 1ZYBA 4BXFA 1MQTC 4WVWA 4I0AA 3BU7A 4XF3A 4AI9A 2HLEA 1V9U2 4ARYA 3JXSA 5FLHA 2YFZA 1LULA 3MLLA 1C57A 4MYEA 5FZ1A 5DMYA 4XUNA 2K2SA 4YVWC 5FZ7A 5FZAA 1P8JA 1AXZA 1URXA 4FO9A 4XVHA 5F5CA 4RHV1 4XFGA 3O5SA 1XBFA 3BYWA 5GLZA 4E8DA 3A23A 3K4ZA 1OPOA 2ZX0A 4D7SA 2RMU1 1GOFA 4DXRA 2HWF3 3VLBB 1ACCA 1ULPA 1VAMA 2GP5A 1ALYA 1NZCA 2JEMA 4XCAA 4IETA 2HWE3 1R082 1DQ2A 2Q8EA 1N1SA 4LITA 1NCRB 2KD7A 3NWKA 3KM5A 4QU2A 1HB3A 2E33A 4TN7A 4YZ3A 2DTWA 1UPSA 2BERA 2WRAA 1NLQA 2WAAA 2YYOA 4NHXA 5APAA 4F3JA 4FPJA 3NQHA 2JDPA 4LPLA 5C3OA 5DZEA 4AAXA 2A71A 5FY7A 1NQDA 2ADEA 1E5SA 5L9BA 1NLRA 2ZPXA 3POFA 4CDXC 5A3NA 3FBYA 1BVP1 2DVFA 2G19A 1VPHA 1HXS1 2UU8A 5JPNB 3INAA 5A3PA 3H0OA 3AMQA 4XTMA 1FT9A 1OH3A 2XH6A 2XJVA 1LTEA 2VL4A 2Y34A 4FPOB 4UYBA 5T5OA 4P9YA 2HJIA 4DXSA 3OCPA 4Y5Z0 3UKNA 5EP9A 5AVAA 1PM4A 3U4SA 4DS0A 1QXRA 4CUGA 5FPLA 1TMF1 1AR93 5CBLA 1WLTA 2XBO3 1W2TA 4JHZA 5C4WC 1ULDA 4W65A 3I2JA 1W06A 5BNOA 1JYXA 2X10A 4QMAA 4URTA 2BW8A 1RUH1 2QQUA 4XZPA 4RHV2 5T3NA 1OUSA 4OI4A 1YIPA 1D4M1 4V2WA 3E6CC 3ZSEA 3VBSB 2RMU2 3I2GA 2A75A 3NMBA 3C7HA 4UBGA 4CSWA 2H6CA 2PHTA 2VMHA 3KHCA 4AHWA 4N7IA 2VVDA 4AYUA 4BXSV 3TNPB 2YC0A 4Q29A 4RQPA 2MHFA 1ASJ1 1Q8PA 2D5FA 4Z2AA 4K8RB 3K48A 1GWMA 4AHXA 2WA3A 4NPMA 3B93A 5DG2A 3RWKX 4M3CB 2ZMKA 1ZRFA 4J6GA 3AK0A 3WDXA 1QOSA 4GMP1 2W1QA 2YG0A 2ZTNA 1VMFA 3WNMA 1CAUB 1AL21 1CX1A 4GALA 3WV6A 1NLSA 2XJPA 1UOGA 5E89A 1HXS2 3QACA 1GWKA 4W50A 2P1BA 4FFGA 3CJIB 1LEMA 1UYPA 2IVIB 4ISQA 1O4TA 4LKEA 5C5UA 3SCHA 1VJ2A 5D8AA 2Z42A 3VKMA 2FBEA 3I3EA 2VMCA 3D3AA 2WNVC 2QQLA 4Q0UA 4CPBD 4GWMA 4Q4V1 5F5QA 1TMF2 4DFSA 3HNMA 2AYHA 3RDIA 4Y20A 1UU4A 1OXCA 3T2TA 3F95A 4UW6A 1SLBA 2FDJA 1UXXX 5E1RA 2C1FA 2EALA 3LD8A 2PELA 3BN6A 4COWA 1D4M2 2ZEZA 3OPWA 2BRTA 1APNA 2XB6C 3NKTA 1B35B 1DIWA 2WSUA 3H8OA 4MG2A 1UZYA 4LHNA 4YVSA 4YGBA 4A41A 1NT0A 3GYDA 5A7WB 5CKMA 1A8DA 2RJ2A 1ASJ2 5KXCA 4D7YA 1YLLA 3UNPA 3GCXA 3HBZA 3VBHC 4JDNA 1H0BA 3ZFEB 3POBA 1X8EA 4YVWA 1OQEA 4R52A 3WNLA 2MPFA 2YHJA 3FWEA 4C0BA 1BCXA 1ZBE3 3S7EA 5KHJA 5CAZA 1VAKA 2AZ5A 2BJSA 4JGYB 3ZYIB 4AVAA 3RG0A 1AL22 4PJYA 4GKYA 1S2KA 3ITQA 5K0UB 3M3OA 2VCBA 3R6SA 1F4HA 2ZXQA 4YRDA 2A3XA 1EV11 1UZVA 5A1FA 2K46A 1CAXA 2VH9A 1F4AA 5EYXA 4QXBA 4HKOA 4CZSA 2DCTA 1A3KA 2IZWA 2QCSB 2P6CA 4EN0A 1ZZ8A 2P4EA 1U5YA 1LOGA 4R4XA 3EQEA 4LR4A 4Q4V2 4XILA 3RGBA 2QNKA 3VZLA 4D3WA 1HIXA 4JVAA 3S5QA 2WQ4A 1DYKA 5JVVA 4CDXA 3WNPA 3ZFFB 2K9ZA 1RGSA 2XJRA 3I4IA 4O9GA 2Y6GA 4MXVA 1S2BA 3APBA 2EIEA 5JSPA 2VPVA 4OULA 4MOAA 3UETA 1QU0A 5CKQA 1XYPA 2W1SA 1CGPA 2Y6JA 1CQ9A 1US3A 5FV3A 4K21A 2XLAA 5HBAA 2EIDA 2HWD1 3ZYHA 2HYKA 5IWFA 3GZTB 5A32B 5JMCA 3HWJA 1R64A 5FOJB 4Z82A 1UF2C 4KI5M 1W28A 2OA2A 5LA9A 2WBKA 2JG9C 3DECA 4JKMA 4A7YA 3RZLA 1SPPB 3N9LA 2YMZA 4K20A 3PMEA 5C4WA 2VTXA 3VHPA 5FMOL 1OA3A 4A42A 1IGOA 4HKWA 5A3TA 2BPA2 4ZXKA 4MGQA 4IGQA 2R6QA 1V6KA 1YFWA 4AEJA 1NCRC 4YW1A 1DGRA 1KGYA 1NZIA 4XDPA 1DFQA 1ZZ7A 1UAIA 3LA2A 4GB31 4KNCA 3H3UA 4NRPA 2ZHMA 3R4UA 5FKBA 2WZ8A 4H14A 1EV12 1JZ5A 4QAWA 1HV1A 3CLPA 1F9KA 1ZZBA 2WNUC 1UY3A 4RR3A 2QZ2A 3AL5A 5A7SA 3RSJA 3K2OA 1WLDA 3A4UA 2RMU3 3J7HA 1LESA 5ISLA 4AVSA 2VUDA 2IUWA
chains in the Genus database with same CATH topology
3NV1A 5C6CA 1IPJA 1BMV1 3ZPYA 3BOWA 1I1EA 1YXWA 3HQXA 4ES9A 3GF6A 3WINE 3RJ2X 2R30A 1MACA 2WT0A 3ZSLA 2HEVF 4CDUC 1H9PA 3KB5A 4IEPA 3ZDSA 4HK9A 3VGIA 2DTYA 1C5HA 1ZM1A 3FMGA 2HWD2 1DGLA 4OHZA 2WNVA 4FQ4A 4BIFA 5E8AA 1L3JA 3EJKA 4LBOA 3VBSC 1DQ5A 1H8TB 2IXCA 1HXS3 3U11A 4Q1RA 4FOQA 4LBQB 3QH7A 3CNAA 3V0AA 2HWB1 4C1WA 4H55A 2P17A 4HPKA 2D6KA 1UIKA 3HN1A 2ZHLA 1UD1A 5GALA 3WQ7A 5C8CB 1RUJ1 5J37A 1CR7A 1KJLA 4BQ1A 1SACA 4BM8A 5HCAA 3MPPG 3VBHA 3IM0A 4XHXA 1RUI1 5BNPC 3VBRC 3S30A 4BH9A 1C3HA 3AP9A 1AYM1 4MGKE 3KCYA 3T1MA 1BMV2 1YFYA 2QUOA 3AB0A 1Y7BA 2DURA 1KITA 3R05A 1WLWA 3I59A 1COV3 1LOFC 3RYRA 1CPNA 1M06G 1W6PA 2XJUA 1QOOA 4GMP3 2JG8C 1AL23 3VBOB 2EXJA 4P9LA 5K7PA 3MW3A 2XVKA 2LALA 5BY5A 1B35C 4XF9A 5AC92 2VW1A 3O14A 1W6OB 2HWB2 4EN7B 1XQNA 1RUNA 2P3IA 2DCZA 4YNIA 2YDEA 3E97A 1QJY3 4JDMA 1MS0A 4K8FA 1R1ZA 4Q4V3 1RUJ2 4I3PA 1X7NA 4IV1B 3JB8A 1FV3A 1LOEA 3AZYA 4JGYC 4KBBA 1LGBA 2JG9A 3MPBA 1WD3A 4CEWB 5K0UC 3SXWA 3OD0A 4DINB 3RYKA 4XFIA 1ULCA 1RUI2 2A6ZA 3AZZA 2ZGNA 4IEWA 3G6JB 3WUCA 3WDUA 3HMYA 1ULEA 1AYM2 1NCRA 2PLV1 2XKPA 3FFQA 2B8MA 4HSJA 4N43B 5H9PA 3CL1A 1MZ6A 5KXEA 2Y0IA 1SMVA 3KMHA 2ZACA 3AYCA 1UN1A 3FC0A 2WNUA 4S2DA 1WW7A 1Q8SA 2Q1MA 1AR61 5DUXA 4NN0A 2R1DA 2B5HA 2A3YA 5C33A 1S0CA 4BOWA 5HI0A 4NHMA 2G4IA 3NW4A 1DF0A 2CNAA 3B5LB 1JXNA 1QF3A 2DFCA 3J4UH 2ZGRA 4CDUA 1RHI1 1R1A1 3SITA 1LENA 3WT3A 2TBVA 3EO6A 5EV7A 4YM0A 4E9KA 2JDZA 1VB4A 3PHMA 4GQ7A 1AR71 1RJ7A 3A0NA 5J48A 3HIFA 4ASLA 1C8NA 3ZYGA 4LHKA 2ET1A 2E53A 2ZS6B 2XPJA 3VHNA 4E4DX 5ACA3 1IZ3A 1JUHA 1HKDA 3MYXA 4W6XA 2BEOA 1ZRCA 2XKOA 5JOXA 1U5XA 5K9YA 2ZAAA 4XMAA 4XQWA 1AR62 4Q4W1 3ZN4A 5C8WA 1RUC3 2VOXA 3AKRA 5BNPA 1H4GA 2JXAA 4LE3A 4XEZA 3VBRA 3ZYPA 4X6QB 3PTYA 4ITCA 4AXOA 2YGLA 3BODA 1YYNA 1V6MA 1RUF3 1W2UA 1AHSA 4N90A 4BCUA 4QXKA 3KS7A 1HQWA 1NG0A 2PHRA 3N7JA 1RHI2 1R1A2 3M3CA 4C0HA 1LOFA 1VALA 1HW5A 1H8TC 2F4PA 4EV0A 4QQPA 3RZZA 1M4WA 2A6YA 1MS9A 3B3QE 2WSVA 1AR72 1VBE1 2JG8A 1IHMA 3SH4A 1B35A 3BALA 5C8CC 3ZX7A 5D8AB 2VY0A 5T5LA 5JWPA 4CP1A 2VUJA 3ZSMA 4ZU5A 5GLVA 1YJKA 2PHDA 1DG6A 2AREA 1SLCA 1H2MA 4NR1A 5AC93 1D2QA 4JGYA 2HWB3 3SHRA 3TAYA 1V6OA 5K0UA 4Q4W2 3JZVA 3TBDA 4LLFA 1YIFA 3HT1A 3LA3A 1A6CA 3SISA 2GH8A 4YVSB 3UKTA 1J58A 3DGTA 1RUJ3 4CDWC 4AI2A 2OIIA 4LO6B 3MZHA 3MW2A 1NCQB 1S1AA 3ZMOA 3PJQA 2ILMA 5LRSA 1RITA 1LU1A 3MICA 3VBOC 1AR81 5AFEA 2D6OX 5A33B 1FAYA 2AR6A 4XJWA 1H2KA 1WUVA 4GA9A 4MGIE 1HV0A 1EY2A 4WZCA 1HRI1 4LTAA 1DZTA 4CP2A 3S6PA 1VBE2 1YWKA 4C90A 1AYN1 3E5UA 1O4ZA 2GH2A 1CAXB 2W39A 1UU6A 4MZUA 1H8VA 4IV1C 4P9GA 1S0DA 2QJVA 2KM2A 1RUD3 1GBGA 1G8WA 5FOBB 4YGDA 2NP0A 3LSEA 1GLHA 4CDXB 1O5UA 1VBA1 4GMP0 5FDBA 2IFRA 1PO11 5T5PA 4IL7A 4B4QA 4E2QA 3ILRA 1KRIA 1FMD1 4N43C 4GWNA 4GH4B 2D6PA 1WMDA 4Q4Y3 1YRZA 2TNFA 4ORFA 1WCSA 1SFYA 1F8VA 2EA7A 4Y1YA 4XJ8A 3I8TA 1AR82 2WT1A 3DKWA 2UYBA 4HVQA 2ZGSA 1DU3D 4PIYA 5BXXA 2A6VA 2YPJA 1HRI2 2Z2SB 3KD4A 4AFDA 1SLAA 2A7AA 4AEMA 4LE4A 1XE8A 4AQ6A 1AYN2 1DBNA 1NXD1 2A70A 3ASIA 4P14A 4RR3B 4AVVA 2D40A 3QOPA 3S7IA 4PLMA 1VBD3 3N7MA 5I93A 1H8TA 2BNOA 1G9CA 1WMFA 4LBQA 2A5ZA 1QWRA 1VBA2 1U5IA 3H7YA 1PO12 5H9RA 4CEYA 3FUOA 3C2UA 4M0NA 5FFOC 2P3KA 4QHBA 1FMD2 4L2NA 5C8CA 3HD8B 1RHI3 1R1A3 4HVOA 3UK9A 3K51A 1C4RA 3CEWA 1V6NA 3BPZA 2XJQA 4YZ2A 3VZOA 1AR73 1RIRA 2Z79A 1O3QA 2JECA 4FPFA 3V0AB 5DUWA 5E88A 4D69A 1XXNA 4OI1A 4M0HA 4HPKB 5J7MA 4Z8BA 1EYBA 1AXYA 3TOJA 4N9HA 2R072 2CWMA 1QHDA 3U4XA 2EXKA 3AKQA 2QQPA 1PZ8A 4CDWA 1GNHA 2RE9A 3VBHB 4E2SA 5FTTC 3ZMNA 1LOBA 1S0IA 2GALA 3H8UA 3VBOA 4Q4W3 4MVTA 1AX0A 3WW1A 3AYAA 5DG1A 3ZIXA 3ZVXA 4AVTA 1Q5OA 1W6QB 4JGZC 2WFF1 4AF9A 2EXHA 4ZKTB 3I59B 1W0OA 4HMZA 1IOAA 4LLOA 1W6PB 5JZGC 2D93A 2GAUA 4IV1A 5L73A 3E6DA 1ZX5A 4AFCA 1VBE3 2Q1ZB 1FI2A 2RS31 3JU9A 4HVRA 2F6BA 1NA1B 1VBB2 3PNAA 4AE2A 3NAPC 5HCBA 1LRHA 1NCQC 4N43A 4QQLA 5DUVA 3B02A 2BBVA 4FPKA 1GR3A 3JD73 1O5LA 1YCIA 4HSLA 3VZNA 3FLRA 4MGZE 2JG9B 4QQ2A 1A8MA 2RS11 4N7UA 4P9WA 4FXKB 2B42B 2ZX4A 2W08A 5JIAA 1CAWA 3V64A 2VMGA 4LEJA 2BWAA 1U5ZA 3RS6A 3B7MA 1WCKA 2YUEA 2WFF2 2ZCWA 2B9UA 2WNUB 3MFAA 1AR83 1X8MA 4QX5A 1FNYA 1G9FA 1NE6A 4FOWA 2R1BA 4S2GA 1BEV2 1FATA 5CFCA 3NV3A 1PZ9A 1H2NA 4QM9A 2FZ2A 2QE3A 1XNBA 1VRH1 1IKPA 1RUG2 4PQ9A 3D8CA 5GZCA 5CU1A 4GH4C 2RS32 3W59A 1VB2A 1TE1B 2ET7A 4XF0A 3EBRA 2WKKA 4HN1A 4CDUB 2VNOA 4PLNA 4WVVA 2VNRA 3ZXKA 4BIOA 3ECQA 4E4ZA 1S0BA 1ZVFA 2D5HA 1R091 3M7AA 1B09A 4L99A 4B4PA 1VBA3 2ZGQA 1ND3C 4DRRA 4DOUA 5BYNA 2ZKLA 4BWOA 2RS12 2R061 5GZEA 2VGDA 4FOYA 1CD3G 3SCGA 4XW3A 4R4ZA 1TME1 3D0SA 2Q8OA 1TEIA 4RR3C 3WCRA 2KA3A 4AFAA 1N47A 4FP3A 4AI0A 1FV2A 3M3IA 3CO2A 2D6LX 2Q30A 4XIKA 1PIV1 4PIZA 2OVUA 2ZHNA 2PHLA 2A6WA 5DUUA 3AP4A 3KT7A 3ILNA 3TWIA 3UKVA 4EWEA 1GFF2 5BNPB 5FO9B 3VBRB 1V6LA 2R073 1VRH2 4WM7C 2D3SA 1X33A 3IBMA 1DGWA 3IPVA 5JSOA 2BWCA 5CFDB 3OY8B 1V00A 3LAGA 4JGZA 5IK4A 2VOKA 2BQPA 3TYJA 5I8YA 3WD5A 1GQHA 3RYPA 5JI9A 2GNBA 5JZGA 3FHIB 4ISRA 1R092 2O1QA 1RUH2 2JG8B 2E7AA 4JDOA 1Y9QA 3M1HA 4LBKA 1OQ1A 3H3ZA 2DV9A 2IXJA 3FE5A 4FPYA 3JBG1 3H1YA 3NVCA 1IQAA 5GM0A 2R062 4F8AA 2C9AA 1O3TA 2MNGA 3NAPA 2VQAA 4BHPA 4YARA 3R4SA 1LHWA 1TME2 5H9SA 1NCQA 2DCJA 1J1TA 3ROUA 5J96B 1YJLA 3ZXLA 4DPNA 4NWVA 4P9XA 5A33A 4ATFA 4QGLA 1PIV2 3ME2A 5I8TA 4JCKA 1VBB3 4AQ2A 1MR5A 2JE7A 3WQ1A 1IPKA 1V9U3 4OI2A 1RUE1 2XJTA 5AVPA 2LUWA 2BPA2 3D82A 1QQP1 3POYA 2FQPA 4IEOA 1DGRN 1TQ5A 4JC1A 2CL2A 2IXIA 2YV8A 4LNVA 4IESA 3SH3A 1ENSA 4I3GA 4AGVA 2ZMLA 4CTEA 2C5DA 2E6VA 2GNMA 2Q4SA 1R083 3I54A 4CYDA 3ATGA 2IXLA 1DHKB 3B94A 1PVXA 2VULA 3KZ4C 1DQ0A 1NA1C 4NHLA 1GANA 3TB0A 1ENXA 2R32A 3JBG2 2WFF3 3WUDA 3ZXJA 4S2HA 1QKQA 1POV1 4GH4A 2WLQA 5I0SA 3QLQA 3VZKA 2XLGA 3GBWA 1GKBA 2Z69A 4XF4A 1BEV3 2OZ6A 4QQOA 3MIHA 5DZFA 1RUG3 2OUHA 1S0FA 4AI3A 4J1WA 5J3UA 4IEQA 1DQ1A 2RS33 1ND3A 5JDBA 3H1MA 4HANA 4D94A 4WVMB 1TNRA 4XIOA 1J3PA 1RUE2 3N7KA 5KWRA 5EWSA 2GMEA 1QQP2 2VW2A 2PHXA 3VKFC 2PAMA 4RHV3 2WZPP 3GZUC 1AX1A 4LUMA 4GXLA 2A6XA 2OPKA 2RS13 1JBCA 2QZ3A 3MDPA 2X29A 3ES4A 3ZN6B 2Z5WA 4K6BA 1E57A 2HEYF 4Y24A 3DPRC 1WW6A 4WM7A 4OHWA 3WCSA 2ZBJA 4PCRA 1QNWA 4QPIB 3VKOA 1Q3EA 4IEVA 1CIWA 3LGRA 2QVSB 4FPGA 1LCLA 2MEV1 2FZ1A 2A3WA 4HFSA 4W6YA 3B9CA 4KWKA 2OZJA 4LBJA 4PDWB 5FQ0B 5CADA 4CEYB 1Q56A 4K1YA 1K5MB 2TUNA 3AZXA 4EN9B 5T55A 4GB32 1TMF3 5JI7A 4LO4B 1MS4A 1OKQA 2A73B 2WS91 1RUH3 5T54A 4YZ4A 3ZYRA 1H1MA 3QH6A 1D4M3 2UWAA 4BA6A 1V6IA 1MS5A 2R063 1JN2P 2WWSA 3RWNA 5KHGA 4AI8A 4XJAA 2VG9A 1XNDA 5CFDC 1W6QA 1ASJ3 2BUKA 4LO7A 3O12A 4R9DA 3VHRA 1D0HA 4CDWB 1FPN1 4AEDC 5LEJA 1ONAA 1PIV3 3W58A 5BNQA 1LHNA 2VMIA 4U36A 5BUVA 3FFZA 1RJ8A 2RJKA 2MEV2 4FTSA 2D44A 4Z2WA 2YROA 4MUVA 3ZSKA 2R041 1QJX1 1NA1A 3ZXFA 3N36A 4JAAA 1JYCA 2AH2A 3ZXEA 3UV9A 2H0BA 3GBGA 1XNKA 2WS92 5FREA 1Q8OA 5DXDA 4CDQB 4XJUA 1ENRA 5I0TA 3H7JA 3M8LA 1BJQA 3WHTA 3OPZA 1KFXL 1XNCA 3LSDA 5CVRA 3VDDB 5GLUA 3B00A 3NJZA 5FLIA 3WX5A 4FQZA 3D5OA 4G9SB 4XHBA 1FPN2 3USUA 1LOCA 2P2KA 1S55A 2WLPA 3SH5A 5DZGA 4RS5B 3OBTA 4WVZA 1UCXA 3FBMA 4QQHA 1SLIA 3EXUA 2B7YA 4XQDA 3THPA 1CAWB 2DCYA 3TNQA 2ARBA 1GZWB 1RUE3 1RUOA 1EV13 3URFA 2DUPA 4V1PA 4MH0E 5I91A 1QQP3 4A2UA 2R042 2D98A 4XF1A 3ZIWA 1QJX2 3DPRA 3O0WA 1H4HA 4Q8KA 3PVEA 3WDTA 1XYNA 5LEKA 4YYOA 4FAHA 1IS6A 2WZR1 1GSLA 1Z7S1 3OGGA 5CFCB 2D3RA 1G9BA 4PBOA 4FAGA 1NY71 1GYKA 5CA6A 5IT6A 3AMHA 3GBFA 2QDNA 3WP3A 2HWD3 1OI6A 1OA4A 1LEDA 2PTMA 1OMIA 2PLV2 2ZZQA 4TLFA 1QNYA 5FPXA 1S0GA 2OW4A 3AMPA 2WA4A 4AG4A 3WG1A 4JQRA 3VL8A 3FUQA 5DDJ1 1SLTA 5KHKA 4YFWA 1OA2A 4OI0A 3MGUA 4UW4A 2JD4A 2H0VA 1GNZA 1RINA 1QJU1 1TNFA 1VP6A 4FVVA 3WXPA 4GB33 1JOJA 4WV8A 3GHNA 4QPIC 1C5IA 5CFDA 2JKBA 3OY8A 2LTNA 3AFGA 2SLIA 2BFUS 4ES8A 2E7QA 3H9AA 1OPMA 1FOD1 3OGJA 1PGW1 4AEDA 1O7FA 1D0GA 4PDWC 4ZU4A 5FRAA 3JQWA 4CEYC 1OSGA 2R16A 2WZR2 1Z7S2 4B8EA 1K5MC 3AMMA 1W6MA 1DZRA 4DRVA 2E7TA 1FX5A 1NY72 3D4KA 3IPVB 2V73A 3AJZA 1CVNA 2E63A 1QH7A 1T6GC 4JGZB 1WBFA 1VAVA 4YZ5A 1J1LA 1LB2A 5JZGB 2CYFA 3OBRA 2MEV3 2IXHA 4N9IA 5GZFA 4NVPA 1PM7A 2IC1A 2Q0AA 4BMBA 3NV4A 5DDJ2 2NPIA 5GKAC 2ZX3A 1FNZA 2EVXA 2O8OA 4JRLA 3VN4A 1UKGA 4K7JA 5EZWA 4HBNA 1QXJA 3NAPB 3J26N 3Q9OA 1LU2A 2R0FA 3B01A 1FXZA 2GC2A 2UY9A 1GZCA 2BNNA 2HWC1 3WW4A 2WS93 1AF9A 1PO21 3WG2A 4YLZA 3AKSA 3RJRA 4Q26A 1ZBA1 1PGW2 1RUI3 1SDWA 1SEFA 3SNMA 3NKGA 2WL1A 4YM3A 1AYM3 4KL1A 5L7OB 5BNNB 1N3QA 4HT1T 4COVA 4ZU7A 2WQZC 2PHWA 3AX4A 4IEYA 5FBZA 1SBFA 4U2AA 2X53S 4M01A 4IEZA 1CONA 4BPZA 3IDCB 1OD5A 2ZA9A 2HEWF 1YI7A 1BQPA 2CGOA 3M4FA 2ZOEB 4CDQC 2NLRA 2W52A 3MLKA 1WBLA 2AENA 3QCWA 2P37A 4AHZA 2GN7A 2G9GA 4YM2A 4R9CA 5GLWA 4WVMA 4C1XA 3U10A 2DVDA 3LOIA 3RQ0A 3VDDC 1A78A 3WG4A 4COYA 3ACLA 3CU7A 3HAGA 1C1LA 4HZFA 2XBO1 4EROA 3ELNA 5JSRA 4RGGA 3R4DB 4RS5C 4L8QA 4OVEA 5BV6A 4YFZA 4XFBA 2HWC2 1MVEA 1F5FA 1PO22 3ZO0B 1ND2C 2PAEA 2WIIB 1ND3B 1ZBA2 3BCWA 4Y4YA 3ZN6A 4RL7A 4XBLA 3VHOA 2PLV3 1MZEA 3QD6A 1H2LA 4B7EA 1MZFA 4P9JA 2OYZA 4QPIA 2PA7A 5KHIA 5FMOS 1AZDA 4J1XA 2B39A 4I0WB 1AR63 2I74A 5CFCC 1GV9A 4XJZA 4N53B 1CESA 4RSUA 4I30A 4KU7A 2DU0A 3D0JA 4PDWA 5FQ0A 1CAVA 3MIEA 5C9AC 1K5MA 2W0XA 4WM7B 1G6NA 3J8F1 4W6WA 1CJPA 1QDCA 3CF6E 2XBO2 1KDMA 2DUQA 1O3SA 2WZR3 1Z7S3 2ERFA 3VL9A 5JPMB 1H1AA 3WP5A 4B29A 3AXDA 5A3MA 3VKLA 1HLCA 5KBFA 2IXKA 4O9EA 4Y1UA 1YUDA 3AZWA 2XVGA 2NYYA 3H50A 1RB8G 1AL0G 1SFNA 5DDJ3 1MS1A 2NZ9A 1QXPA 3BTAA 5J98B 1IKQA 3VBFC 3GZAA 5FPZA 1G86A 1Z78A 5LRRA 3IDBB 4FTEA 5HXVA 4KU8A 4A7ZA 2DYCA 3WZ1A 4RD7A 4META 1VIWB 3RRDA 4XE9A 3MW4A 2B46X 2CY6A 3LZZA 3TRSB 2N7GA 3J8F2 1REEA 2AGSA 1WGPA 1ENQA 3SLIA 4AGRA 3IT8A 3JUUA 2PQQA 1YO8A 4TYSA 2DU1A 4C91A 3DN7A 1Y3TA 2WT2A 4FSJA 4CDQA 4AWDA 4A7KA 2VUAA 2WNEA 2P34A 3DV8A 2YY1A 4AW7A 3O0VA 3U0ZA 1PNGA 2BYVE 1N3PA 4B7KA 4KQ7A 5KHHA 3VDDA 3ES1A 3MIBA 4X6RB 3SMHA 1BXHA 4FXGB 3T1LA 1G9AA 2ZX1A 2GDFA 1EAH1 5T52A 3B9IA 5EXOA 4BMEA 4RS5A 2YZ4A 1QJZA 2UWCA 2XL9A 5KXBA 1DLLA 2OUJA 3LA7A 3FLTA 1ND2A 5L7OC 5BNNC 2YXSA 1GZWA 2PHUA 1X50A 4EWDA 2EXIA 1MS3A 1S0JA 2VOVA 2VVFA 4LBNA 4LULA 3J9SA 2JJ6A 5D1IA 4QPYA 3UJQA 2HWC3 3WDWA 5JAXA 1PO23 2KXLA 3USUB 4Z92B 4IXLA 1ZBA3 1HDKA 1NYWA 4QM8A 1HRI3 5BPXA 3ZFGB 4KWJA 3FJSA 3VKNA 2ZKNA 1AYN3 3WG3A 5C9AA 3DPRB 4KH9A 3IDEA 1G7YA 2ETEA 2VECA 4WM8C 4TWTA 4YGEA 1DGWX 3I7DA 4KGGA 3NL1A 1EAH2 1PO13 4JTOA 3MF9A 4Q0PA 4SBVA 2O0OA 5K8SA 2K0GA 1ZNPA 2GNTA 1FMD3 4QPGB 4NHKA 3UJOA 1AXKA 5A3LA 1UPIA 3PMSA 2BTVC 2VNGA 1MVQA 2GSYA 5KC6A 1N1VA 3RMXA 4MX3A 4QGNA 1LGCA 1Z0HA 4AQSA 4YW2A 4N53C 2BFUL 1J59A 3HR9A 3L2HA 5ABJB 3WW2A