1ZBA3

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
GIFPVACADGYGGLVTTDPKTADPVYGKVYNPPKTNYPGRFTNLLDVAEACPTFLRFDDGKPYVVTRADDTRLLAKFDVSLAAKHMSNTYLSGIAQYYTQYSGTINLHFMFTGSTDSKARYMVAYIPPGVETPPDTPEEAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDTAETTNVQGWVCVYQITHGKAENDTLLVSASAGKDFELRLPIDPRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 36
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba300
4N53A 2RS12 4JGZA 1AR93 1BMV1 1ASJ1 1X36A 5JZGB 1RUG1 2RMU3 4RFT0 1ND2B 1NCRB 1HRI3 2X5IC 5C8CC 2XBO2 1NCQB 1QJX3 4GMP1 1AUYA 1PIV3 1QJY1 3JBG3 1E57A 1X33A 2BBVA 5K0UA 4LLFA 4Q4X3 1HRV1 2XBO1 1AYM2 2WFF1 1AR81 4CDWA 1VBC1 5ACA3 1R1A2 1BBT2 1RUC3 4N43B 1RUH1 1RUI2 1TME2 5D8AC 1RMU2 1NG0A 1MEC2 2R062 1VAKA 1HQNA 4GH4A 1CJDA 1VBB3 2RM21 4Q4W1 2RS32 2RS11 3VDDB 1ZBE1 5A33B 2HWC1 4N53C 3J8F3 4CDUA 1QJU3 1POV1 1RHI2 1K5MA 1VRH3 2BPA2 3VBHA 3DPRB 2MEV2 3ZXAC 1VBE3 4WM8C 5L7OB 1TME1 2FZ1A 1A6CA 2WFF3 5ACA1 1R081 1IHMA 1FOD2 3VBHB 2HWD3 5LK7B 1COV1 4GB32 1HX6A 1F8VA 4YVSA 1AYN2 1C8M3 5C8CA 1RUG3 4YVWC 4N43C 2R072 4CDXC 1HRV2 4Q4V3 4GB31 1EAH2 2RS51 3VBSB 1VBA1 2MEV1 1PVC2 4Z92B 2RR12 4JGZC 1RUE2 1F2NA 1FMD3 3VBOB 1Z7S3 1NOVA 3VBOA 5ABJB 3VDDA 1AR82 3ZFFA 1ZBA1 1R093 1RUC2 3CJIB 4RQPA 1EV11 2IZWA 1QQP2 4CDUB 1AYM3 1MEC1 2R061 5C8CB 4Q4Y2 5JZGC 3ZFGA 3NAPB 1D4M1 2QQPA 1PVC3 4RQPB 1RUF1 2HWD1 1BEV1 1ASJ3 1B35C 1PO13 2RR11 5BNNC 1AR63 2HWB3 4CDQA 3J8F1 1PO23 5J96B 2R071 4N43A 1RMU1 4JGYC 4CEWB 4YVWA 1AYN3 5L7OA 1PIV1 4QPIA 1MQTC 1ND2A 4Q4Y1 1RUE1 5BNNB 2XPJA 5CFDA 3DPRA 4RS5B 1FOD3 2GH8A 2HWC2 3VBFC 2PLV1 1VRH1 2HWE1 2VQ0A 4IV3A 5AC92 3J8F2 1H8TA 1QQP1 3HAGA 2R041 2WWSA 1NY72 4FTEA 5D8AB 1VB4A 5CFCC 5FMOS 1RHI3 4WM7B 1RVF3 1MEC3 2R063 5DDJ1 1TMF1 5C4WA 1RUF3 4QPGA 4CDXA 1H8TC 4CEYA 1PO12 4PDWA 1ND3B 1RUJ1 1AR61 2HWB1 2RS53 4YVSC 4Q4V1 1RMU3 4NWWA 2ZAHA 4Q4Y3 1BBT1 1OPOA 3ZFFB 1PGL2 4QPIC 1FPN3 2FZ2A 2RS52 1R083 5ACA2 1HRI1 4CDWB 1FPN2 1R092 5C4WB 3JB4C 1W39A 2X5IB 4JGZB 1C8M2 3ZFEC 2RR13 4Y4YA 4CDUC 1EAH3 3VBRA 1COV2 2R073 4CDXB 1NA1A 1AL21 1RUF2 2GSYA 1GFF2 1RUG2 2BFUS 1BEV3 1PO11 2Y26A 1PO21 5BNPA 2TBVA 1VBE2 2HWD2 2WS91 3DPRC 3IDEA 4FTBA 5D8AA 4Q4W3 2WZR3 1VBD2 5L7OC 4FSJA 1PGL1 1OOPB 1QJU2 1AYM1 2WFF2 3NAPA 4YVWB 1VB2A 4WM7C 1FPN1 4AEDB 1B35A 2BFUL 5AC91 1EV12 4RS5A 4RR3C 1RHI1 4Y5Z0 5C9AB 4IV1A 1AL22 1ND3A 5FOJB 5ABJC 4CEWA 1RUI3 2X5IA 2HWB2 1AR62 4CDQB 1TMF3 1NCRC 1R082 1VBB2 1AR91 3NAPC 3ZFGB 1POV0 1RUJ3 1Z7S2 1B35B 4QPGB 1PIV2 1BBT3 2PLV2 3JD73 4GMP3 2HWF1 1R1A1 1QQP3 4IV1B 3FBMA 3TN91 1NCRA 1VBC2 1HRV3 4Q4V2 1POV3 1AR83 5CFDB 1AR92 1NA1C 2HWE2 5ABJA 1FMD1 4IV1C 2RS31 3S6PA 1QJZA 1QJX2 1ZBA3 3JB8A 4RS5C 1ND3C 1HRI2 5BNOB 3VBSA 2RMU2 1OHFA 1NA1B 4EJRA 1VBD1 1K5MB 1C8M1 1C8NA 2RS13 4N53B 4CDWC 2WS92 1WCDJ 2HWC3 4GB33 5K0UC 5CFCB 2MEV3 3VBHC 5DDJ2 2ZTNA 1RUJ2 1DDLA 1QJU1 3VBUC 3VBRB 5J98B 4GMP0 1V9U1 2WZR1 5BNPC 4PDWC 4RHV1 1HXS1 1VBA3 5A33A 1TMF2 1PO22 3VBUB 3VBRC 1ASJ2 1VBA2 4QPGC 1VRH2 4GH4C 2RMU1 3TN93 3ZFEA 2BUKA 1OOPC 1MQTB 1R091 2R042 1RUI1 5C9AA 1CD3G 1EV13 5CFCA 1RUD2 1AR72 3VBFB 1AL0G 1ZBE2 4PDWB 3ZFEB 1VBD3 2WZR2 2HWF2 2RM22 5BNOA 5DDJ3 3JBG2 3VBUA 1FMD2 1RUH3 1R1A3 1M06G 1RUE3 1NCQC 3JD71 1ZBA2 5A32B 4CEYC 1BEV2 1AR71 1FOD1 5FMOL 4Q4X2 5C4WC 3CJIC 5BNNA 3VBSC 3M8LA 3ZFGC 4YVSB 1PGW1 2XBO3 3JBG1 1SMVA 1OOPA 2PLV3 1RUH2 2HWE3 1D4M3 1RVF1 1VBC3 1PVC1 4GH4B 4FTSA 4Q4X1 4NWVA 5A32A 4IV3C 4AEDC 1NY71 3VDDC 3JD72 1RUD3 1V9U2 3VBFA 1AYN1 2RM23 2HWF3 3ZFFC 1ND2C 1PGW2 3VBOC 4RHV3 5CFDC 1ZBE3 1AL23 4JGYA 1MQTA 3TN92 1VBB1 3CJIA 1HXS3 4CDQC 1AR73 1HXS2 4RR3B 2RS33 4SBVA 1QJY3 4JGYB 1QJX1 2ZZQA 2R043 1NCQA 4CEWC 1VBE1 1RVF2 1BMV2 4RHV2 1QJY2 5BNOC 4Q4W2 5JZGA 1TME3 1RB8G 4RR3A 5K0UB 1Z7S1 4AEDA 5BNPB 2WLPA 1H8TB 1RUC1 4IV3B 4WM7A 5GKAC 3LOBA 5AC93 4RQPC 1D4M2 4WM8B 2DF7A 4WM8A 4CEYB 1COV3 4BCUA 1V9U3 5C9AC 1RUD1 1EAH1 4QPIB 1K5MC 2WS93
chains in the Genus database with same CATH superfamily
4AYUA 1U12A 5FR3A 2VZRA 5EWSA 2OKXA 4HPKB 2RJKA 4LHKA 4IEUA 4XEZA 5GALA 1ASJ1 1DLLA 2VULA 4IE5A 3UKNA 4BQ5A 5C3QA 3ZN4A 2YFUA 2VMIA 4AFCA 2R32A 2VECA 3WQ0A 4FT8A 3WNLA 3MF9A 1JS9A 1XNTA 3LEIA 3C7HA 1QJX3 4I0AA 2ZHKA 3WEZA 4COWA 5KHJA 4GMP1 4QX1A 2FDGA 1AUYA 2EIDA 2WA3A 1LHVA 2VGDA 4O65A 4EWAA 1WKYA 1XNBA 3LDRA 5FZ7A 3WG3A 3BIEA 4FXGB 4Y1ZA 4LLFA 4AQTA 1HRV1 2IC1A 3ACHA 1AYM2 4JX0A 4XBNA 4MYEA 1OFNA 3EHKA 5FY8A 3CEWA 2ZMKA 3H7YA 4MGZE 4FPOB 1BXHA 4JKMA 4P08A 1BBT2 2WNVC 3FJSA 1KFUL 5GM0A 5FP8A 3Q8BA 5IVYA 2ERFA 2QQUA 3LWCA 1TME2 4H7MA 5FO7B 2C9AA 5L9RA 1RMU2 1QKQA 2R062 1UMZA 3N4MA 3HD8B 1SBFA 2V09A 2YUEA 1WCSA 4GH4A 1TNFA 1VBB3 4ZS3A 1O6UA 2XJSA 3H9AA 2RS11 3VDDB 1V6MA 4LA2A 5LATA 4XIOA 3K48A 1OXCA 4LKDA 4IGQA 2FDHA 2AC1A 1JHJA 4YM1A 4JC1A 3I3QA 3J8F3 1KFXL 1GZTA 2D98A 2J7MA 5SV8A 2HEWF 3VGIA 4A42A 3NO8A 2YROA 4QB6A 3VHOA 4A6OA 3FLPA 1RHI2 1UKRA 3THTA 2UYAA 3MI8A 2D6NA 5C71A 1LU1A 3DPRB 4TZDA 1DIWA 2UWAA 3NRUA 4YYOA 3ZXAC 2VOTA 4XF4A 4YM3A 1OSGA 4WM8C 5JMOA 4JDMA 5FYIA 4FPFA 5KC5A 1TME1 4KWKA 2JG8C 4L92A 2R6QA 5CEHA 4BA6A 3FLRA 2XJTA 1IHMA 3RZMA 5LA1A 1GUIA 1WWYA 4Z1VA 1SACA 4FI9A 4D7SA 4NHKA 3J9SA 3CNAA 2VBDA 4OI2A 2B46X 4TN7A 3VBHB 2J1AA 4AHWA 3WG4A 1OD5A 3ZYGA 1HX6A 2Y6KA 1F8VA 1XBFA 4PQQA 2ZX3A 5F9TA 4GWMA 4PIZA 4P9IA 5AFEA 3HVDA 3WG1A 3A7QA 2UURA 1J3RA 2DUQA 3FHIB 2R072 4Q4V3 2A71A 3F95A 2LALA 2XKOA 1O59A 4LBQB 3VBSB 2RS51 5FMBA 4I0WB 5IFPA 4WV8A 5FZ4A 1JOPA 4ASLA 1SG3A 4E4HA 1Y9GA 1O4TA 4H3WA 5C7GA 1NE6A 1F2NA 1FMD3 4EQVA 3NL1A 3VBOB 2A6XA 4LITA 1NQDA 5ABJB 1VAVA 3WF1A 1R093 3RJ2X 2PHUA 1JHNA 4LKFA 5IAVA 2Y60A 1W2AX 1J1TA 4UFKA 3BPSA 5ANNA 1DQ1A 2JG9A 1SBDA 2WC2A 3MW2A 2ZX0A 4BQ4A 3T30A 1W6MA 4XTPA 2IXHA 4GJZA 1KDKA 5LY2A 3OPTA 5C8WA 4LT5A 4I0BA 2QQPA 1ZZ7A 3KLSA 1GOGA 4XF1A 2X10A 3U0ZA 1ASJ3 3O12A 3FFZA 2OQ7A 3HT1A 4OHZA 2KR2A 5ERLA 3ZSEA 4CDQA 1DGLA 2WO7A 1XYNA 1PO23 1GWLA 2QQKA 1HB3A 1GYKA 1SLAA 4YVWA 4QKNA 5L7OA 4K6BA 3K77A 4UWDA 4W4ZA 4Q4Y1 4PQ9A 2IFWA 4LKSA 2VOKA 1UF2C 3R4DB 3N36A 1ZNPA 5FKBA 3UGHA 2P3IA 4RS5B 1WCKA 4I3GA 2RDNA 3L2YA 4FBFA 2PQQA 3PLQA 4HL0A 2HWC2 4L99A 5T54A 3TBDA 4BDVB 4BQ3A 1RITA 1H1AA 1W8TA 3VV1A 2VQ0A 3HAGA 3PUAA 2XH6A 5FZAA 4NJ4A 3DUIA 2BOJA 1X82A 3UV9A 3ME2A 1OUXA 5J1XA 1A8MA 5D8AB 3VLBB 2K46A 4QQPA 1VB4A 2H6BA 2DTYA 3CO2A 2X05A 2XJPA 3POFA 4K1YA 3D3AA 3SC7X 4CPBA 5FMOS 1H2LA 4M3CF 1QY4A 1RVF3 1DG6A 1MEC3 1POQA 5CYYA 5DDJ1 4LHNA 2BWAA 1T2XA 1MZFA 2J1SA 2W0XA 3W9AA 4D8MA 2BGPA 5GZCA 1W0OA 1WD4A 2ZGMA 4PDWA 4O7XA 1F4AA 4KMQA 1AR61 3EB7A 4QGMA 4OQ9A 2VZQA 3SNMA 5FZ9A 3I59A 1DYOA 5FLJA 4LR4A 4BIOA 2Q8CA 4Q4Y3 1BBT1 1RXGA 4NPMA 3WD5A 1W28A 3MIEA 3X29B 3CJXA 2WNUC 5CKQA 3VD7A 2FMYA 3FBYA 4Y24A 2WNVA 2FZ2A 5JIUA 2WRAA 3T4HB 3B5LB 4K8RB 5ACA2 4H7LA 3BTZA 4FFFA 5T5PA 3KSCA 1FPN2 4QPYA 3KZ4C 3M70A 3NKTA 3IIIA 3EXUA 2WNUB 4MGQA 1U5YA 3ZVXA 1W39A 2P5BA 4W65A 3K46A 4A3ZA 1YEWA 4Q2FA 3N9NA 2QUOA 1QJFA 3FZ3A 4FP3A 3ZFEC 1ULCA 5KXDA 4QM9A 3WINE 2W1WA 3T08A 3VBRA 5LWBA 2AEYA 1PNGA 1COV2 1D0GA 1O7FA 2Z42A 1SCRA 4NAMA 5I93A 4GA9A 3V0AB 4LHSA 4CDXB 1W6QB 1H8VA 2GSYA 1GFF2 2BFUS 2XB6C 2ZKNA 3SXWA 1UY0A 1LNSA 5K9YA 4IE7A 2V5DA 4JVAA 5DAQA 3DL3A 5FK7A 4LHLA 4COVA 2TBVA 4K20A 1N1SA 3J7LA 2ZHNA 2HWD2 4P00B 2WS91 2VH9A 3EO6A 2BQPA 3T0DA 1WMFA 1AX0A 2Q0AA 1UZWA 1UY1A 4FSJA 3RYKA 2D7FA 3MV11 2WSVA 1QJU2 2WFF2 4GWNA 3NAPA 3OSDA 3GNEA 4AGVA 1MZ5A 3CF6E 3ATGA 1YHFA 2AYHA 1JUHA 1VB2A 3TEXA 5GLVA 4E27A 1J84A 4AEMA 1B35A 1NUKA 2JECA 3I59B 1EV12 2OZJA 4UT5A 1YJKA 1Y43B 4Y5Z0 2ENRA 2VNRA 5T55A 2BNOA 3AMMA 4IV1A 3MFCA 2XJQA 3H7JA 4XJ9A 1W8ZA 5DAVA 3WZ1A 1GU3A 4UYBA 3AXEA 2OVUA 4AF9A 3H42B 3OEAA 3OY8A 5F5AA 2WN2A 3ES4A 3T2TA 2OUJA 2JIJA 2XQRA 1VMHA 3H3UA 1YQCA 2JE8A 5LEKA 3OG2A 1R082 1MS1A 2BDRA 1VBB2 5FPUA 4NN0A 4Y5SA 3FFQA 1YI9A 1QHDA 3VUOA 2AR6A 3C2UA 2ZGTA 3O1MA 4Q8LA 1RUJ3 4ZY9A 4OI0A 4QPGB 3LKJA 3JD73 2HWF1 2VNOA 4RFRB 4LE3A 3MFAA 1IG0A 4AZZA 4ZHNA 1UW8A 1W9FA 3W58A 1AF9A 1CAUA 4MGTA 1LHUA 5KXEA 1V0AA 1AR83 1UXZA 3T4VA 4MXVA 1LAJA 3LCPA 3ZYFA 3WCRA 2VW0A 3LB9A 1GWKA 1LOAA 2E7AA 3S6PA 3BTXA 3O14A 1QJX2 1ZBA3 4Y20A 2Q1MA 5FAXA 1DZTA 2W2IA 4UF0B 1DGWX 5KC6A 1TVGA 2N7GA 4EN7B 2WO3A 1UPIA 4IUGA 1H30A 1N3OA 4UFLA 4EN6B 1OHFA 5FBJA 5FZKA 4NPLA 1ACCA 2JXAA 5FP9A 1K5MB 2RE9A 3ENRA 3HPNA 2P37A 3WT3A 1YQ8A 4MSVA 4DPNA 2F4PA 2YFZA 5IVCA 5FP3A 5IFTA 1X8MA 4URAA 3WV6A 1DDLA 1UWWA 1UAIA 3VBUC 5J98B 1CX4A 4D69A 3VD3A 4GMP0 4YM0A 4CCEA 2WZR1 2XXZA 3A4UA 4PDWC 3D82A 1NLQA 5IUQA 3OGSA 5FXXA 1QDCA 1HXS1 4PLMA 1K5JA 3RZZA 3SH4A 3THDA 4EN9B 3JQWA 5JOXA 4Q26A 2PHTA 2QQWA 3VBUB 2V5YA 1GR3A 1ZRRA 3MGUA 1ASJ2 5CG8A 4OYUA 1Q43A 3AZWA 1OLMA 2ZGRA 3DN7A 3ZX7A 1MQTB 3WDWA 3ZXDA 1R091 4NRQA 1RUI1 5C9AA 4QKDA 2BGCA 4NRPA 4R4ZA 2F6BA 5CISA 2EIBA 2VNVA 5JXJA 5E89A 1JYXA 1RUD2 5EHDA 3KHBA 1BZWA 5EPAA 4D6RA 1OKOA 4WBBA 4C90A 3E5XA 5FOBB 4JTNA 3U11A 4XUTA 4BWOA 1XPWA 3V64A 3R0RA 5HCFA 2UU8A 3RZHA 1H4GA 1W90A 1DQ0A 3ZFEB 3K75B 2WZR2 4P9GA 1BCXA 1XOYA 1JODA 1GSLA 2XWBB 5BNOA 5CBLA 5F6LB 1RUH3 2LRPA 4MXWA 3WLUA 3L9JT 4A3XA 1LESA 3IDAA 2CU5A 2PHXA 1Q56A 2FHRA 1ZBA2 5A32B 5LBEA 1MACA 1Z0HA 4BZ4A 4NIIA 4CEYC 1E5IA 1Q8QA 4N7UA 1FOD1 4B7KA 4EN0A 1N1YA 4O61A 1ENRA 1FAYA 3GHNA 1QMJA 4GJYA 3FMGA 5C3PA 1ENQA 5FPZA 4CU7A 1XQNA 1GZCA 1LGBA 2ZMLA 1QH6A 2ZPXA 2DVAA 2QQJA 2CL2A 2WAOA 3IAPA 4I09A 4LUMA 3OB8A 4XJZA 3VZKA 3I7DA 3OOXA 1H0BA 3B9IA 5FZIA 2SLIA 1YO8A 2PAMA 2A6ZA 3CKHA 3MUY1 1LOGA 3POEA 1VLNA 1L3JA 3NV3A 3AP9A 4LBMA 4MOAA 1US2A 5E6HA 3B9CA 5G04L 4GH4B 4X8NA 1UNBA 4Q4X1 3MLKA 1Y9MA 4NWVA 4IV3C 4XBLA 1G9FA 4DEQA 1X9PA 1QH7A 1NY71 1UD1A 4OUMA 3IM0A 5DZGA 1W9YA 3VBFA 2NM1A 3VN4A 5FZLA 5HPOA 1CAWB 2RM23 1EUTA 2W39A 2HWF3 1XB9A 3P6BA 2F17A 4UAPA 1PGW2 4Y3OA 3VL9A 2ZGQA 5FYVA 3ZFFC 4BMBA 4RHV3 2OPKA 3B94A 3M3EA 1TE1B 5C3OA 1K3IA 1AL23 3WP6A 3U1XA 5B2GB 1GANA 3M4FA 5IT6A 1XXNA 1TEIA 2VCBA 4P02B 4CDQC 4IERA 3U75A 4P9JA 1PVXA 4XFBA 2BJSA 3AP4A 1FI2A 1CIYA 1LHOA 4JGYB 2ZZQA 2YHJA 4D7YA 4FVVA 1VBE1 3PL0A 1BVP1 1OLQA 2VG9A 3WOGA 1W6OB 1BMV2 3I2KA 5FZOB 3KGZA 4XFHA 1H6YA 5BNOC 2VZVA 4Q4W2 2RJ2A 1W3VA 2XDVA 5F3GA 1RB8G 4ISRA 1S0JA 1CN1A 1ST8A 4H14A 4CUBA 4QD2A 5K0UB 2JICA 1XE8A 3H3ZA 5BNPB 1JZ4A 2JG8A 2EXHA 4RYDA 1RJ7A 3N9LA 1QNYA 3PU8A 1PK6B 3GBGA 4OHWA 1WCQA 1OF4A 3RSJA 2C1FA 5EJZB 5DUWA 4HMZA 3AM2A 1OVSA 4BB3A 2Y6LA 4WM8B 1JW6A 2HBTA 4WM8A 5BYNA 3IMMA 5SV5A 4FOVA 2VOWA 4BCUA 5C9AC 5LY1A 1DF0A 1R64A 4P9WA 2FMDA 3CL1A 4JDNA 1OQEA 1S0FA 1UMIA 1K5MC 4LORA 1JN2P 3AYCA 4OUEA 5HXVA 4JGZA 2Q8EA 5E88A 3POBA 4CZSA 2WR9A 1BMV1 4LBJA 1JYCA 1ENSA 3DCQA 4C8DA 4CP1A 1NCRB 1HRI3 1XU1A 2ZX4A 1CZSA 2XBO2 2CGOA 5A7WA 5FWEA 5HI0A 3ELNA 1VMJA 5LA2A 1PIV3 4XJUA 1OLME 3JBG3 3QH7A 4QXHA 3NQHA 2CDPA 2OW4A 1BYHA 2DUOA 2XBO1 5JPMB 3RYPA 1C3HA 3SCFA 4MVTA 2CAVA 1VBC1 3VD5A 5ACA3 5AFBA 2B9VA 3I8TA 2AACA 4N43B 1RUH1 1Q8OA 1SFNA 2BNNA 4W6WA 5BXXA 4CUGA 2F4LA 1OLRA 3WQBA 3ACFA 5FPAA 1YIPA 1VAKA 2G9ZA 3WUDA 1DYKA 2C9KA 3GCXA 3WW4A 2JX9A 5F3EA 2BV4A 2EXJA 2C4XA 3WQ7A 4HG6B 2WNOA 5JPNB 3TYJA 1UY3A 2HWC1 5FY0A 3PHMA 2A6WA 3V0BA 1ZRCA 2ZOEB 5JI7A 1UOGA 2P1BA 4N9HA 1QJU3 1POV1 3VDAA 4KL1A 1UIJA 4Y1XA 2XG3A 3H0OA 4Y1YA 1MS5A 1VRH3 3VBHA 5EYXA 2KA3A 3OJBA 1ZZBA 2ORXA 2D6LX 2WQ8A 3HNMA 3ZMOA 4IGPA 5CIRA 1YI7A 3O0VA 2LS6A 5HV0A 1H6XA 3EYPA 2R1BA 1UPSA 4HZFA 1WLWA 1A6CA 4XXPA 1W8HA 4UFJA 5ACA1 3MLLA 1FOD2 5IW0A 1REDA 1UO9A 1KGYA 4AQ2A 1PNFA 4XFIA 4I3PA 5KWRA 3I3MA 4QKFA 2DURA 3TAYA 3PVOA 2DCYA 2WZPP 2DTWA 5I0SA 1JZ3A 4WVMB 4AI3A 4AFDA 4YVSA 4KH9A 1AYN2 4MH0E 3OBTA 1LU2A 4FAGA 3N9QA 1DQ2A 4AR2A 3RS6A 4XQDA 4YVWC 3NJXA 3HEIA 1D2QA 4XAEA 2EVXA 3ROUA 2DDUA 1HRV2 1VE0A 2YC0A 5FZ1A 4QU2A 2AENA 5GZGA 2J22A 1G8WA 1WW4A 3RJRA 3DF0A 1W8UA 2RR12 1DHKB 4QDSA 2ZKLA 1ZM1A 1RUE2 5FMCA 4P9XA 4BIFA 2BTVC 1D2SA 2VUAA 1NOVA 3ABZA 4QX8A 3RYRA 1AR82 1W6NA 1O3SA 3CJIB 2HEVF 4CCMA 1QGLA 4LK6A 4ATFA 1QQP2 3IPVA 4CDUB 1X9TA 1AYM3 2LW8A 3HWJA 4HN1A 4BQXA 5BNQA 1LOFC 3SKJE 1SLLA 4XHXA 3ACLA 4RGGA 4UOJA 1MEC1 1ODNA 2GDFA 3WNMA 5C8CB 2EIGA 1YFXA 3I2FA 3JUUA 1NLSA 4XQWA 1UYZA 2PQSA 3OUJA 4LBKA 4LO4B 4M4PA 1TQ5A 4D6SA 5JZGC 5IK8A 1I3HA 2Q4SA 2JDNA 1F5JA 5C5UA 2KM2A 4FO9A 4CUCA 1ULEA 2EICA 1KQRA 1RUF1 1LENA 2HWD1 1PO13 4LJHA 2RR11 5FLHA 3THCA 1AR63 4X8PA 1JOBA 2GC0A 3ALQA 3J8F1 4PF5A 3WQ1A 2QQLA 3ZSKA 2JB8A 2R071 2CAUA 2PYTA 3WNOA 5EFUA 3POSA 1AYN3 1DQ4A 2BU9A 1Y4WA 3RWNA 1PIV1 3LSEA 4XJAA 1MQTC 2YY1A 3T1LA 3KVAA 5FV3A 4EWEA 3ZSLA 4JQTA 5FY9A 5FXVA 2V4AA 4DY3A 1YWKA 2QQNA 1J3QA 1FOD3 3LFIA 5EJ3A 2GH8A 5FYCA 1GNYA 4CXXA 1BLZA 2HWE1 2OX0A 3PURA 1HN1A 2D5FA 2XL9A 3KF5A 5AC92 1H8TA 2R041 3WW3A 1RUOA 1IS6A 2W1SA 3Q9OA 2W95A 5C5TA 3T0AA 3VKFC 3ACIA 1OA3A 3AKQA 3HMYA 1ULDA 3OTFA 5DABA 1UQXA 3ZN5A 4DXSA 4M00A 3NKGA 5CFCC 5FZOA 4A2UA 1GQHA 5IJRA 3VZOA 1QJEA 1LRHA 1RHI3 5IAXA 3BTYA 1UU5A 3POWA 1KDMA 1ULFA 3KHCA 3LQCA 4IEQA 3I3EA 1SDDB 5KR7A 4G4FA 4B1MA 3OGJA 4DUWA 2VVEA 1RUF3 4NHYA 2QQVA 5FY5A 3ZXEA 4GQ7A 4ITCA 4CDXA 5D1IA 1QXPA 2CWSA 3I2DA 5KXCA 2VUCA 2Y6HA 2FD8A 2ARAA 3LDBA 4W8JA 5JR2A 3ZN6B 3PIJA 4KWLA 1WCUA 3HT2A 1CESA 1FV2A 1W2UA 3LE0A 4QHOA 2ZCWA 4NWWA 5CA6A 1HQLA 1OPOA 2JEMA 2YG0A 3ECQA 4KGQA 1NXMA 2ZGUA 4YG3A 5FYZA 1PGL2 2BBAA 2VQTA 4NIAA 5G05L 4QDQA 1UU4A 1SZBA 3M2MA 4CCDA 4DY5A 5JXHA 2VE1A 3PTYA 5FZ6A 2GP3A 1RINA 4LXLA 4IE4A 2XLFA 4O9GA 3IBMA 2E7TA 1OBNA 4DZGA 4ARXA 4ZZ5A 1Q8VA 2ARXA 5C4WB 3JB4C 4QKBA 1G9DA 1DFQA 3C7GA 1WD3A 4JGZB 4V2VA 2V4VA 1X8EA 4TWTA 4XDOA 2VR4A 2VU9A 4MADA 4CUAA 1LHNA 3D4KA 4LIVA 1R1ZA 5FOJB 4MG2A 4MHUA 4CDUC 2XR4A 3LZZA 2G9GA 2FCUA 1D4VB 1HB1A 2R0FA 3E1F1 3GZEA 3U37A 5IHRA 5J36A 3MLJA 2PAKA 5LK7B 2WYSA 2FBEA 2D3RA 1I5PA 4ORFA 3USUA 2Z5WA 3UJOA 3OYWB 3VD9A 1BEV3 1W6PB 4YW4A 2JJ6A 2B8MA 3B93A 5FZEA 2R7EB 5HXMA 1MZEA 2ZA9A 4JKLA 3ACGA 3DPRC 4BPZA 3TB0A 3VHNA 5CB7A 4FTBA 2OUHA 2HBUA 2WO1A 2WZR3 3ZKYA 5J7MA 3KCCA 4Y1VA 3T3YA 2VC9A 5LASA 4OI4A 4AGRA 1UOBA 1AYM1 3OD4A 1PHMA 4R52A 4BQYA 4I2OA 1LOEA 4YRDA 3SHRA 5CG9A 3U4XA 3PVBB 4PI0A 1GMMA 2H0VA 4WM7C 4QXBA 1FPN1 1OI6A 2E32A 2VZUA 2YU1A 1DLCA 4RA0A 1VAMA 4RS5A 3WW2A 3B00A 1DU3D 2VZ1A 3LEKA 3URFA 5C9AB 2Y6GA 4AAXA 4A41A 2VMEA 1G6NA 1SQ4A 1ND3A 1DCSA 1W8WA 1S2EA 1YJLA 4LNVA 2UYBA 1I9RA 4MX3A 4XFAA 3EBRA 2DVGA 4HK8A 4AW7A 2RDRA 4AHYA 4N7IA 1OT5A 2A1XA 1RL3A 2CV6A 2X5IA 1CAVA 3LDKA 3ZDVA 2HWB2 4NAOA 3NMBA 4MUVA 1UU6A 1TMF3 5LW9A 2ZZJA 2V73A 4B8EA 1NCRC 3FX3A 1AR91 2AREA 4QT6A 1SHWB 5LRRA 1PM4A 4KBZA 1POV0 4AHXA 3I3DA 3ES1A 1JOJA 3SCGA 3RDIA 1PX4A 2JE9A 3POIA 3BYWA 2FDFA 3OEBA 2E9QA 1LJ7A 3NNGA 1A78A 1DGRN 1R1A1 2HEYF 3VKOA 2X29A 3GHMA 5F1RA 5LB6A 4NIGA 2VCCA 4IGOA 1NCRA 3QLQA 4Q4V2 1G9CA 1POV3 1KRIA 3MHZA 5CFDB 3N9MA 3IWZA 2JD4A 3AMNA 4R8HA 5ABJA 5IATA 1FMD1 2X8KA 1TZOA 4AQSA 1IKPA 4OMDA 2HH9A 1SPPA 4INDA 1MVQA 5T3NA 2HYXA 4RL7A 1MR5A 2JDZA 1ND3C 1HRI2 4WVWA 1GNHA 3HBKA 5I8TA 3A0KA 2IXIA 4UBGA 1WLDA 4MGYE 5DUUA 3NVCA 3I2JA 2K9ZA 1LEDA 2ATFA 3HQXA 3M1HA 1J58A 3E5UA 4Q0UA 4P14A 1QNWA 4BISA 3O1RA 5A6XA 3GZTB 4XILA 4HKWA 1CVNA 1WCDJ 2ZMNA 4P5YA 5EJ1B 3UGGA 1W3XA 4GB33 1DGWA 2DCTA 4OZOA 3E6BA 4Z07A 4CCLA 1RIRA 1NXD1 4EROA 2MEV3 2Z4FA 4AHZA 2ZTNA 4F83A 3KD4A 4CPBD 3SH5A 2AEZA 1QDOA 2NP0A 1DZQA 1GBGA 3FHQA 1PK6A 3BCWA 5BNPC 3OBRA 1GP4A 4Z2WA 4DNYA 2O1QA 3V0BB 3AKPA 5A3WA 3E6CC 1PO22 3H8OA 1EYBA 1A8DA 1VBA2 4QPGC 1YRZA 1G9BA 3RPQA 3TN93 2YBPA 1SCSA 1U5XA 1WLTA 2BUKA 3GJBA 1NX9A 3B3QE 2VZOA 2R042 3VDBA 2CGPA 4GXLA 3UL2A 1CD3G 1UOJA 1UKGA 4XPVA 3VBFB 2EAKA 3TEYA 4H2AA 2GNDA 3C7EA 1ULPA 4YM2A 3NJZA 5DUXA 2WBKA 3BN6A 1N3PA 2WO2A 3OGGA 3PMSA 4IL7A 4OFGA 3RWKX 5LZ6A 1TG7A 4A4AA 2MPFA 3T1MA 3T2PA 1MZ6A 2OQ6A 2RM22 2ZEZA 4LUKA 1XNAA 5DDJ3 1RUE3 1S0DA 4XFFA 1UZ0A 1H2NA 4CCKA 5IK4A 4AVAA 3AX4A 4YGBA 1V70A 1BEV2 2Y34A 3A0NA 4E8CA 1AR71 3I54A 5IVBA 2ZGPA 2E26A 1YC61 5A3TA 3S57A 2W68A 3CMGA 3CJIC 3MIHA 1VJ2A 2FCTA 3ON7A 4J1XA 5KBFA 4HSLA 3A21A 2YMZA 3J7NA 3F2ZA 3W20A 4DOUA 3N7MA 5BNNA 1ZYBA 3AZYA 4Y22B 3S5AA 3GCWA 3OPWA 1AJKA 1PZ9A 3JBG1 3QACA 4W6YA 2XHKA 3IT8A 1RUH2 3KMHA 3WR0A 1CJPA 2HWE3 4M3CB 4FPEA 4IEPA 1IS3A 1D4M3 4LEJA 4YARA 1U5ZA 4XC9A 3FL7A 3PVNA 5LBCA 1VBC3 1PVC1 1AXKA 1IKQA 3CDZB 2C24A 1UX6A 5A32A 3ZR5A 3D0JA 1GWMA 2YPDA 4ET7A 5JWPA 1O3QA 2OT7A 1SLTA 1KITA 1YUDA 2QVSB 4NMIA 4YW3A 2XLAA 3S30A 4AEDC 4CCOA 1XYOA 2LROA 3RZLA 3KV4A 1HQWA 1I5ZA 1V9U2 2VXJA 1EP0A 4HVRA 4GZ9A 2PA7A 1ND2C 1WW6A 4X6QB 3VBOC 3MW4A 3PUIA 1W6OA 3ZR6A 3DXUA 3OD0A 1DP0A 4QGLA 2EAAA 4M3CE 3U4SA 4CSWA 1RGSA 3PIGA 3Q8AA 3OUIA 1C5HA 1WLCA 4IE6A 2P2KA 5A7SA 3TN92 2C0ZA 2D43A 3GZUC 4F3JA 2W47A 1ZVFA 3LFMA 3WDYA 5F7UA 1AR73 3O7OA 5L19A 1HXS2 2BEOA 1CAXA 5FYUA 2EXIA 4TLFA 1NZIA 1IQDC 4LOSA 5GLZA 4YG6A 4CEWC 1NCQA 1FYUA 4DUXA 4WVVA 4C91A 1G7YA 2BERA 2Q8DA 3ZSMA 3WX5A 2ZGOA 5DG2A 1QJY2 1HIXA 5JZGA 1TME3 4KQ7A 4M01A 4OCTA 4RR3A 3WDTA 4ZU7A 4G3YC 3NNMA 1L7RA 3R05A 2WLPA 1S55A 1CZVA 3FE5A 4HSJA 1QOSA 4BXFA 5A3NA 4BM8A 2WINB 2W1UA 1BQPA 4RQPC 3LAGA 2K2SA 1LODA 3C3VA 4XDPA 1D4M2 3HQRA 3R4SA 1W04A 3FWEA 3ZYPA 1CAWA 1AJOA 3KWVA 4A45A 1JU3A 1C28A 2E63A 1PGSA 3H1WA 5A80A 5LCWL 5A3OA 1AXYA 4AL9A 4MGSA 2JKBA 4Y22A 1RUNA 1YCIA 4GAZA 3BKZA 2D6KA 2R30A 4KG8A 5F2SA 2W9XA 5H9SA 1HB4A 4YZ2A 2XWJB 4NHXA 3DGTA 5FY7A 1REEA 1UMHA 4G9SB 4RD7A 1X36A 1RUG1 2YC4A 3HJRA 3NNLA 4XZUG 4RFT0 2XUEA 3E5QA 5C8CC 5FZCA 5JOWA 4JRLA 1H9PA 1ZRFA 5FBZA 4LO5B 1ZRDA 2Q1FA 1H4HA 3Q8CA 2JDKA 4CP9A 3DKQA 1E57A 5FYSA 1X33A 3N7KA 5K0UA 2BBVA 3O1OA 2NLRA 3VZJA 4Q4X3 2YU2A 2CTVA 1FNYA 1AR81 4CDWA 5JXGA 2GMPA 4Q0SA 4CXYA 2WYFA 4OLLA 2O8OA 3KQRA 2WKKA 3LEGA 1R1A2 4S2HA 1WW7A 3BU7A 5D8AC 1NG0A 2OYZA 2DBNA 2PELA 1MEC2 1W8FA 3AMQA 1GICA 4KWJA 2A3WA 2QZ2A 5FZFA 3G7DA 1HQNA 2B7YA 2C5DA 4LTAA 4AFAA 4XTMA 3NV2A 5BV6A 3AP7A 5IVEA 4Q4W1 2O8QA 3FHAA 1HJGA 2WAAA 3MF6A 1OC1A 1O5UA 1ZBE1 3POJA 1PM7A 4B3NA 3P5BA 5IYYA 4N53C 4YG0A 2WT0A 1GNZA 4FOQA 3VZLA 1J59A 1O8SA 3INAA 3RZKA 3IDCB 4GWIA 4YLZA 1AHSA 1OKQA 3GALA 2E6VA 2MEV2 3D5OA 5DAPA 4Z2AA 3WP5A 5HCBA 3I49A 2WLQA 1XNDA 4FFHA 5L7OB 4IESA 4YGEA 3N35A 4XUQA 2FZ1A 4D94A 3OBZA 4Q29A 3DXTA 5FIXA 1W05A 2GU9A 4AOCA 1R081 3ASIA 3W21A 2EIEA 1JUIA 1H2KA 2CDOA 2H6CA 2HWD3 1WMXA 1RJ8A 3K4ZA 3K4AA 2Y38A 3P1IA 5FPBA 4GB32 2BNMA 3OF1A 4SLIA 3EJKA 3DV8A 4Q27A 1W06A 2ILMA 3U10A 2WUHA 3ILFA 1W6QA 5C8CA 2BZDA 2GN7A 4N43C 2P34A 3MICA 4CDXC 4EE2A 4K3UA 4GB31 2PFWA 2E31A 1UL9A 2MEV1 1PVC2 1L7QA 2YBSA 3L2HA 4JGZC 4CVUA 4HANA 4DS0A 4S2DA 2QKDA 5CVRA 1JYNA 2Z79A 4FPGA 2G4IA 4K9SA 1NKGA 1XSQA 4PHZA 5F2WA 1I1EA 3UKTA 3VBOA 2LUWA 3VDDA 3WW1A 1YFUA 1V6IA 4PLOA 4QB2A 2ZAAA 4GALA 3RMXA 4A44A 3R6SA 4DRRA 2ZEWA 2CSGA 1S0EA 2L9LA 2PXJA 3VHPA 4XCBA 4WVZA 5FRAA 3H8RA 4XF9A 1OH4A 2YBKA 2VTFA 2ZGKA 1CONA 1GZWA 1GOHA 2Q8OA 2VUDA 1AXZA 1GZWB 5C70A 4Q4Y2 2E7QA 2VMDA 1JZ7A 2IXKA 3TRSB 4NHLA 2I74A 5M0TA 2QJVA 3GGLA 4QPWA 4WVMA 2MNGA 1I6XA 3PTRB 3R4UA 5EP9A 5EZWA 4CP2A 1DQ6A 4RQPB 3SH3A 2DFBA 5BNNC 1MS0A 3OGRA 5A7NA 1YQ2A 5J96B 1W8NA 2ZGNA 1UX7A 3D8CA 1QIQA 4N43A 4JGYC 4R9AA 5FZ3A 2ZABA 4XFCA 1JZ5A 5K7PA 3O0XA 4QPIA 5FWJA 1NQJA 1SDWA 1RUE1 5GJ6A 5BNNB 2XPJA 1BJQA 5FY1A 3DPRA 1J1LA 4QX5A 5DZEA 1S0CA 2VO5A 4QX0A 3TEZA 2GH2A 2WFPA 3DYOA 4PIYA 1PMJX 3VBFC 3WDVA 1C1LA 4L9BA 3KGLA 5LEJA 4UF0A 3N3HA 3UKVA 1QOTA 2WABA 1JMUB 1O5LA 4IV3A 5J37A 1QQP1 3BOWA 1LECA 1CQ9A 1KS5A 3MIFA 1NY72 2DCZA 2XGXA 3HOBA 2XQXA 2JD9A 3KT1A 5HV4A 3VZNA 2EALA 3AK0A 1PMHX 1OMIA 3J4UH 3WHTA 1CAUB 2GNMA 2DVDA 2VAUA 4UFHA 2ET1A 3C7FA 4FQ4A 1BK0A 4WM7B 4LBLA 2R063 2B4KA 2WT1A 2A3YA 1MS4A 3W59A 3AXDA 4TSVA 4B4PA 4XJ8A 2DCKA 1W8OA 1KEXA 5APAA 3TEWA 5C4WA 3ZXKA 2PAEA 3M3CA 2IUWA 1Y7BA 4JRAA 3I3BA 4LPLA 5FPLA 3AZVA 1PO12 5FXZA 1RUJ1 3W5NA 4YNIA 2HWB1 2WNVB 1JZ8A 4QX7A 2ZGSA 4Q4V1 5CU1A 3WNXA 1RMU3 5CAZA 3BUCA 2VQAA 1WMEA 2VY0A 4S2FA 4ES9A 3AVSA 2OZ6A 1DYPA 2W94A 3H8UA 1FPN3 4ISQA 4B7EA 5A3MA 4ASKA 1WA6X 5HBAA 4AVVA 1R083 5AVAA 3ZYHA 4TLGA 1HRI1 2P3KA 1UCXA 2PHWA 3GXUA 4AWDA 2ZBJA 3IMNA 3I97A 2WZEA 1IPSA 3AMHA 4V2WA 4CCCA 4CCNA 1VP6A 2RHPA 5DPNA 2X5IB 1MPXA 1W2TA 3ZYIB 4Q1PA 1E5HA 2FDKA 1LEMA 3M3IA 4FFGA 1H9WA 5JVVA 2RR13 2WZ8A 4L0PA 1EUUA 4ZU4A 2QZ3A 4M0NA 2RDQA 3VB9A 5A7QA 2R073 5B4XA 3MPBA 1NA1A 1RUF2 3EMRA 2W08A 3K4DA 2Q1ZB 2VPVA 4Y5TA 4DXTA 5EYYA 2BW8A 1F4HA 2QNKA 2R0HA 3MBWA 4HN0A 1UIKA 4DRVA 3QH6A 1PO21 3GBFA 5BNPA 4XURA 1VBE2 2VJXA 1PX3A 3GBWA 3IDEA 4P9YA 2G19A 1W9SA 5D8AA 4XHBA 3IKWA 4PT6A 5CNAA 4A7YA 4XQ4A 1VBD2 4XCAA 4BLJA 1PGL1 1T6GC 4JCKA 2GMMA 2JDPA 1OQDA 4X6RB 4IEWA 4XACA 4AFMA 1SPPB 1XC6A 1ZRIA 4HVOA 2LTNA 4CYDA 5EQUA 2GNTA 4EN8B 1NYWA 4OHVA 2D93A 2BFUL 5AC91 4LO8A 3H1YA 2DVBA 2EXKA 4QB1A 3DYMA 1C57A 1RHI1 4RR3C 3T2QA 1JZ6A 1ENXA 3AZZA 3KT7A 3U07A 1OPMA 3PMEA 5ABJC 1DQ5A 2Q30A 2XKPA 3QD6A 5FMDA 2A6YA 3HN3A 5DMYA 3LPFA 5A1FA 4YGDA 4YW1A 4CDQB 4QQLA 5JR7B 1OVPA 2VOXA 1LTEA 2OXBA 1B09A 3SCHA 1D7PM 1UY4A 4K40A 1S0BA 1DGRA 1SLIA 2PHRA 1TNRA 2VBBA 5F3IA 3KV6A 1ODMA 1Z7S2 2XVKA 1LOCA 5I8SA 4COUA 1PIV2 2ZJCA 2PLV2 4GMP3 4RSUA 4D6QA 5JSPA 3ZDSA 2CNAA 3AL6A 1QQP3 5FZMA 3S5QA 3FBMA 5A3UA 2BGOA 4RGAA 4MO3M 2AH2A 1VMFA 3TN91 2IVIB 1VBC2 1HRV3 1QOOA 5DAWA 4ATEA 5H9QA 2A73B 4DXRA 4AI0A 4UW6A 1NA1C 2HWE2 2V72A 4YW6A 5FUNA 4HKOA 3GDBA 1BHGA 4HPKA 2ZX2A 1X7NA 4J1WA 3AJYA 5I0RA 2I45A 2RS31 2GC2A 2WNEA 5LBBA 3JB8A 2R49A 3QOPA 4K1ZA 1ZZ6A 3MIDA 4RS5C 5FZBA 2QE3A 2UWCA 4NIDA 3MO4A 3AZXA 5DXDA 3VBSA 5BNOB 5H9PA 5F3CA 5A6ZA 2RMU2 2YZ4A 3CBNA 1NA1B 2J1EA 1JZ2A 1H1MA 1IOAA 4EJRA 3RI8A 1N3QA 2A6VA 1C8M1 1LULA 2GZWA 2RS13 4N53B 4CDWC 4K7JA 3KCYA 2PHLA 4AVCA 5F37A 1W99A 2WQ4A 2ZS6B 3IDBB 4OHXA 3USUB 2NQYA 1V6LA 2PMWB 3N9OA 4KI5M 4QHZA 4XXAA 5K0UC 4AVTA 5CKNA 1EPZA 4HT1T 2IXLA 3FUOA 1OFSA 5DDJ2 3VBHC 4MGIE 3WY6A 4BE3A 2A3XA 4PIXA 4BQWA 1ZA7A 4E2GA 5IVJA 4MV2A 3SISA 2C6SA 4PCRA 1SBEA 5H9RA 4ES8A 1V9U1 4OHYA 3ZMNA 1T6BX 4MZUA 2D6OX 2IWGB 5JMCA 1C4RA 5EXOA 4JAAA 2DV9A 4ZZ8A 1KXGA 1W6MB 2XJVA 3MV01 4DUVA 5LA9A 1QU0A 2YYOA 2TUNA 1WA4A 1V6KA 1MVEA 2ZHMA 5DN2A 5L9VA 5A70A 1UZZA 2D40A 5FZDA 4BYYA 5FFOC 4DQAA 4O9EA 5JUVA 4B1LA 2RMU1 3U78A 1F15A 2VCMA 1WZXA 2VM9A 2WJSA 3E6DA 3O5SA 5JSOA 1MS9A 2WWJA 4W6XA 3IIAA 1MS3A 2BOIA 4Q0PA 4RN5A 3WF2A 3HQUA 3B02A 5CFCA 1C1FA 5I91A 4IEOA 2EF6A 4QMAA 3WF4A 1HKDA 2Y0IA 4PJYA 5JI9A 5I8YA 2VVFA 4M4RA 3OGVA 4MHRA 3M3OA 2Y6FA 2JDYA 2Y64A 1VBD3 1GZ9A 4E2QA 4CU6A 4NROA 4Q5OA 4Y1UA 4BLIA 3J7HA 1ULOA 3ZO0B 1FMD2 2GMEA 5C3SA 1ZX5A 5JLVA 1R1A3 3BI3A 3H1MA 1V6NA 1NCQC 2VUJA 1XYPA 5ANQA 1L7LA 2DFCA 2WL1A 2VQUA 2YPJA 3CIHA 3ZYBA 2Z2SB 1Q5OA 4F8AA 5FMOL 4LBQA 4Q4X2 5F5CA 3T2OA 2NPIA 5C4WC 1CX1A 5C6CA 5FTTC 1LCLA 5FJHA 1HJFA 3O1TA 1VR3A 2P6HA 5FY4A 3VBSC 3M8LA 1UYYA 2B39A 3ZFGC 3AB0A 1OA2A 2BP6A 4YVSB 1PGW1 1OUSA 4HVQA 3KV9A 1YYNA 2XBO3 3CU7A 3HN1A 4AI1A 5JSRA 1XRUA 1CWPA 1URXA 3I2OA 3FUQA 4AXOA 1VALA 5FPXA 1OH3A 1HB2A 4QQOA 4ZKTB 4PBOA 3U14A 1YQ6A 4CP0A 2WWUA 4NE9A 4DXZA 5GLTA 1QF3A 4JV4A 1W6PA 5FREA 4AAPA 2TEPA 3OYWA 1STMA 1SLCA 4HONA 4IXLA 4OUSA 4CRQA 4Z8BA 1AZDA 2KD7A 4BK5A 3RZGA 2HKXA 3OY8B 3CZJA 5ISLA 2OA2A 5FDBA 5FPVA 3DEMA 3SLIA 4FQZA 1SFYA 1CIWA 1REFA 2W5FA 4JGYA 1MQTA 4LE4A 5J09A 4HLTA 4OVEA 2CYFA 1VBB1 2ADDA 3CJIA 5T52A 5IWFA 2E33A 2HJIA 2JB4A 2RS33 2AUYA 3BIWE 4URTA 3WNKA 3ZLIA 1F35A 3RVHA 3IPVB 3ZXLA 4C0HA 2BRTA 4E4ZA 3K3NA 3LF7A 4PF1A 3AFKA 4ASMB 3SEPA 1QEXA 5LRSA 3QBQA 4RHV2 3RRDA 3THPA 1EY2A 4GKXA 4QM8A 1W6NB 2CGNA 1AVBA 1GP5A 2YGMA 3POYA 1Z7S1 4AEDA 1K45A 3K2OA 5EIYB 2RJLA 2P3JA 2ADEA 4IV3B 4WM7A 5GLWA 1A34A 3LOBA 5T5LA 2RVAA 4UI9L 3IN9A 3LA7A 3PUSA 1CPNA 2CHHA 5L9BA 4XZPA 2IFRA 4XVHA 4CE8A 2VZTA 4UW4A 4AI9A 1V9U3 2ZEXA 3ILRA 4XOGA 3FN9A 4ZS2A 2VNGA 5DQ0A 4BH9A 4J6GA 4NPRA 4LO7A 4JTOA 4KNCA 2WN3A 2WQZC 3WNNA 4N53A 5L36A 3MZHA 1NZCA 4LLOA 2RS12 1ZA4A 3PUQA 2ARBA 3DYPA 2ET7A 4E4SA 1WMDA 2PN5A 1AR93 2YC2A 1ULGA 2B9UA 5JZGB 2XVLA 4FPYA 2RMU3 1JYTA 4N9IA 2VZPA 1ND2B 2VCAA 1GP6A 1O91A 2X5IC 1YLLA 3RQ0A 3TNQA 4Q1RA 1NCQB 4BOWA 3G6JB 4B4QA 1NT0A 4DFSA 1J3PA 2GC3A 4YZ1A 3JQXA 2YV8A 2PHFA 1YFYA 2CWMA 4LBOA 1QJY1 3IZOA 2PTMA 2W52A 4CTEA 4OQ8A 1V6OA 3O1UA 1XSRA 2Y8KA 3PU3A 2CY6A 5FYMA 5IK5A 4C1WA 2WFF1 3GF6A 3KCXA 4L97A 5DG1A 3VKNA 4D3WA 4RGKA 1WBFA 1OQ1A 3N7LA 4NHMA 4CCJA 1ALYA 4KU7A 1PMIA 1Q8PA 3TNPB 5F32A 1RUC3 2J1VA 2IVJA 4IDZA 4ONUA 1RUI2 2ZHLA 4FCAA 2QDRA 3AJZA 3WCSA 4J25A 4AQ6A 1GKBA 1F5FA 1WW5A 3UT0A 4R9DA 4BQ2A 4FOWA 2D3SA 1CJDA 2RM21 4NUBA 2RS32 2XUMA 4E2SA 4YFWA 4LIUA 4CXWA 2C26A 4ZU5A 1W2OA 4M3CA 2GALA 2QQMA 5A33B 1K12A 1IZ3A 3ZKUA 3LD8A 3P3PA 2W3JA 5F5IA 1YIFA 4HOOA 5FYHA 2UWBA 4DINB 4YSFA 4CDUA 3I2HA 2JDUA 3KVBA 1JYVA 1S4CA 2OS2A 4KG0A 5BPXA 1K5MA 4JZRA 2WDBA 2BPA2 1LGNA 5F39A 1ZZ9A 3D6EA 2P6CA 1VBE3 5A7OA 3UYJA 4HFSA 1FXZA 4ZXKA 5T5JA 4BMEA 1XJAA 5IVFA 2J1TA 3K3OA 3PUHA 1S0IA 5DUVA 1HV0A 1OD3A 4EZ4A 2D3PA 2VTXA 3NSTA 2Q5TA 2WFF3 4TXWA 2Y33A 3WP4A 1CPMA 3APBA 2A7AA 4IEZA 2Y6JA 4W50A 4TTGA 4AVSA 2FCVA 3MIBA 3MDPA 4D0QA 5FKCA 2NMOA 2JIGA 1S2BA 5IK7A 5A1AA 2D6PA 4U36A 3MPPG 1GLHA 5AVPA 1G86A 1S1AA 3MEPA 1COV1 1HV1A 4V1PA 1DZRA 4YW2A 4HXCA 2KXLA 3DECA 5FYTA 2LM3A 3C8XA 3UNPA 2XVGA 4Q0QA 3KM5A 1C8M3 3ZXGA 4Z82A 1RUG3 2DU1A 5DZFA 4E9KA 3HBZA 4QDRA 4L2NA 2YXSA 3BODA 3UK9A 1EAH2 4I30A 1AX1A 1VBA1 4UW3A 3S7IA 4A6SA 3BPZA 2DUPA 3RMYA 4C1XA 2ZX1A 4K21A 4Z92B 3A23A 3HNYM 5LA0A 4Y4RA 2HLEA 1NE4A 3AKSA 1IPKA 1Z7S3 1CAVB 2Z69A 3ZFFA 4DEVA 1ZBA1 2B5HA 1RUC2 1LHWA 4IE0A 4Y26A 4UBHA 2E51A 2VMHA 4JDOA 2VVDA 2VXRA 1HN0A 2A75A 2O14A 3MUZ1 4IEVA 2W87A 4RQPA 1EV11 1ZZ8A 4UXAA 2IZWA 4XAAA 4XUPA 3NW4A 1JU4A 3SEEA 4DMIA 1G9AA 1VRBA 5FXWA 2YDEA 3AYDA 3KS7A 3LOIA 3UESA 4R9BA 2R16A 2R061 2VZ3A 1K42A 4CP9B 5A1LA 4NVPA 3LA2A 2WIIB 3TOJA 1O3RA 2NN8A 5JAXA 3ZFGA 3NAPB 1D4M1 1KD7A 4JQRA 1GQGA 3C7OA 4K8FA 3O1SA 1PVC3 5FO8B 1FX5A 1BEV1 1B35C 4UW5A 1U0AA 2HWB3 5D2AA 1LR5A 3M3QA 5FZHA 2Y0OA 1LOBA 4UFMA 1RMU1 3GJAA 4CEWB 1E5SA 1N1VA 4XETA 4HETA 3KV5A 4N8MA 5FZ0A 3TWIA 4AFBA 5KHIA 3ZYJB 1P8JA 1ND2A 4KGGA 4A7KA 1HLCA 1YFWA 2DCJA 5CFDA 3USSA 4DO0A 4FOYA 2JG9C 1LGCA 3NJYA 5LK5A 2PLV1 3H8XA 1VRH1 3BTAA 1YXWA 5FQ0A 3AFGA 3RZJA 2X09A 5JOZA 3O1VA 5FP4A 3J8F2 1JTZX 2WWSA 3MW3A 4MGKE 2P4EA 3ZPOA 4FTEA 5F8PA 3IB3A 1KJLA 4LK7A 1O8PA 5FP7A 2PHDA 1JXNA 5CADA 4EWDA 1APNA 1WBLA 2XL7A 1UYPA 4ARYA 2XOMA 1TMF1 4ZXEA 5J3UA 1JYIA 1ZREA 4QPGA 2A70A 1PZ7A 3NV4A 1H8TC 4QXCA 4IW3A 4CEYA 3NNJA 3WP3A 1WUVA 1ND3B 2JKXA 2RS53 1YNAA 2JWPA 3CZUA 4AEKA 4MLOA 4YVSC 5K8SA 3LSDA 4QX3A 4AE2A 5B4NA 2BVVA 2J1RA 1Z78A 2ZAHA 2RDSA 3CQOA 4GD4A 3ZFFB 3OPZA 1UZYA 2WSUA 1ONAA 4QPIC 4LOTA 4YZ5A 4NIHA 5I0DA 2RS52 1IQAA 4ZONA 4AVBA 4KWUA 1QWRA 4XF3A 2ID4A 3S7EA 2RG4A 3N7JA 4AG4A 4CDWB 2VMFA 5GLUA 1SFPA 5HCHA 1R092 4P5HA 1ZZCA 3LIHA 2VD7A 1C8M2 2K0GA 3OUHA 4KU8A 5FJKA 3SITA 2XMLA 4AGGA 5KHGA 2UY9A 5FUIA 1RXFA 2HYKA 3KB5A 3B01A 5IVVA 4Y4YA 3ZXFA 1EAH3 1JI6A 4AI2A 2QFEA 2ZGLA 3A22A 1F9KA 4FFIA 5GZEA 2QQOA 1AL21 2AGSA 3J7MA 1RUG2 2J1UA 2FDIA 4LQRA 2MHFA 4NRMA 5FK8A 1W0PA 1PK6C 1PO11 2G9FA 2GC1A 3AL5A 2VBPA 3S0MA 3WHUA 1S0GA 2Y26A 5DAXA 5JCTA 2VW1A 5JDBA 1SEFA 3MYXA 3RFRA 4BJ0A 3ZXJA 5A6YA 3GZAA 2NYYA 4XUOA 4LBQD 4Q4W3 3ST7A 3LGRA 3AC0A 3UETA 5L7OC 4COYA 3LEMA 1SLBA 1OOPB 1XNCA 3AYEA 3ZPYA 4YWAA 4EV0A 3WDXA 2P17A 4YVWB 4HKLA 3ZIWA 3QCWA 4AI8A 4PI2A 3T0BA 2H0BA 3WF3A 3AVRA 4N90A 4LKEA 2ETEA 3P3NA 4AEDB 4I02A 1N1TA 4XBQA 1JBCA 4XE9A 2E53A 2ZXQA 5FLIA 5JIAA 3V0AA 3MIGA 5E16A 3AKRA 1XNKA 4XJWA 1AL22 1FATA 2D6MA 4NR1A 1UZVA 5I0UA 4KBBA 1RYYA 4NOTA 2JG8B 2NZ9A 3DKWA 4AK3A 4CEWA 1RUI3 5F5QA 5GZDA 3AKTA 4MXWB 1LOFA 3OCPA 1CAXB 1AR62 3V65A 5CKMA 3K51A 5BY5A 4BXSV 5F6KA 4QGNA 4GIQA 1U5IA 4FPLA 4DB5A 5BUVA 2ORZA 3AMPA 3NAPC 4HBNA 3ZIXA 3ZFGB 2TNFA 1JYWA 1Y3TA 4FXKB 4LBNA 3BALA 4YPJA 3E97A 4PBPA 2JE7A 1Y9QA 2QTWB 2W92A 1B35B 4YFZA 1BBT3 2GP5A 1W9TA 1FV3A 2VOVA 5K4LA 3O1PA 2NMNA 4EYUA 4NO4A 2BYVE 4OI1A 4IV1B 5FUPA 4GULA 4ZPIA 1CGPA 5A3LA 1CZTA 4XABA 5FYYA 3BU0A 2BWCA 2VTXJ 1UN1A 3IAQA 3RG0A 1AR92 4B4RA 4PLNA 4CA9A 1OURA 5E1RA 4XYXA 4F7ZA 4IV1C 4FPCA 4C0BA 1QJZA 2DBIA 3VD4A 4B29A 3PNAA 3VDCA 4E4DX 3I2IA 5FQ0B 2XJRA 1BK1A 2GAUA 2XJUA 4QAWA 1BKZA 2IXCA 3ETQA 1MS8A 1LKNA 1VBD1 4LULA 4E8DA 1GQPA 2FQPA 1S2KA 1C8NA 3JU9A 2W46A 2WS92 4WZCA 4QWNA 4TYSA 5C33A 4QXKA 2HWC3 4BU2A 5CZKA 1N47A 1O4YA 4QX2A 5L73A 5CFCB 3NJVA 2VW2A 4P9LA 3J26N 2ARCA 4XUNA 1RUJ2 2WNUA 5FZGA 1QJU1 3KT4A 1EPWA 3VBRB 5A3PA 3AYAA 4JHTA 4JHZA 3N9PA 4XMAA 2UY8A 3GM8A 3H3LA 1IS4A 3KQ4B 1UOFA 3PJYA 4HK9A 4YGCA 4EZHA 4RHV1 1E5RA 4XF0A 3PVEA 4LMFA 4GKYA 4Y20B 1H2MA 2P3YA 3KF3A 1VBA3 5A33A 1TMF2 1H1IA 5C3RA 1AX2A 3BOPA 3VBRC 1F31A 2VMCA 3JCIA 1FT9A 5FZ8A 3NNFA 3RI9A 1VRH2 5A6QA 4GH4C 1O3TA 5J48A 4CU9A 3ZFEA 3V56A 4A7ZA 2D44A 1W9WA 1OOPC 2ES3A 3RNSA 3ZN6A 3BB6A 2DYCA 1XE7A 2DVFA 3VL8A 4BQ1A 1VIWB 2AZ5A 3CHXA 1A3KA 1IS5A 1EV13 3BVCA 1W2NA 3WG2A 4QQHA 3WDUA 1AR72 3VKMA 1HW5A 2SBAA 5I0TA 1RTVA 2XLGA 2EA7A 3PJQA 4M0HA 4S2GA 1AL0G 4I01A 4IEYA 4QU1A 2DU0A 2BVBA 1ZBE2 3H50A 4PDWB 4AEJA 2ZACA 2WT2A 3NV1A 2GNBA 1J83A 2W1QA 5FCCA 3HIFA 4YZ4A 2HWF2 5JOYA 4FAHA 1D0HA 3JBG2 3VBUA 1UYXA 5HCAA 5A7PA 3WVJA 1CR7A 4JKKA 2B42B 4QQ2A 1M06G 2DWRA 4FP2A 3WNPA 3JD71 1GOFA 2VMGA 5TSWA 4YZ3A 2GN3A 4YW5A 3Q8FA 3WF0A 4D7TA 3D0SA 3EQEA 2ZEYA 4XFGA 3B7MA 4COZA 1OA4A 1DBNA 4BK4A 3SMHA 4XMIA 1KS4A 2XHNA 4BHPA 4IEXA 2JENA 5FO9B 1NLRA 1UY2A 4WZFA 1QXJA 3WUCA 5FYBA 2D97A 1SMVA 1OOPA 2PLV3 4LO6B 2G1MA 3UGFA 1NAEA 3ETPA 4H55A 1FNZA 4OMCA 1XU2A 3VHRA 3FC0A 1IGOA 4XW3A 2QBXA 1RVF1 2A5ZA 5T5OA 3VZMA 4OULA 2R1DA 2X53S 4IETA 3HNBM 4FTSA 1KJRA 4FPJA 3T09A 1RC6A 2I2SA 4Q8KA 2JDAA 4Y33A 3I2GA 4FPKA 2YB7A 1Q3EA 2JDMA 3M7AA 3VDDC 3JD72 1OF3A 3ITQA 1RUD3 1AYN1 3AP6A 2XONA 3I4IA 3AP5A 3W5MA 1V00A 2B45X 2W91A 1M4WA 1Q8SA 2QCSB 5CFDC 3NWKA 1O4ZA 1ZBE3 3ZSJA 5EV7A 1IPJA 3GYDA 5KHHA 4QHBA 4U2AA 3JXSA 2VZSA 1V6JA 2FDJA 1HDKA 2RV9A 3LPGA 3PDQA 4LA3A 2OIIA 5GZFA 5E8AA 1HXS3 3UJQA 2JG9B 3ILNA 4GWJA 4META 4Q0VA 3ZM8A 5KHKA 5JXIA 3POGA 3WSOA 3HR9A 4RR3B 2OPWA 4R4XA 4UFIA 1W0NA 3ORJA 5D21A 2J42A 1QJY3 1QXRA 4SBVA 4XDQA 1QJX1 2IXJA 2R043 2QDNA 4XIKA 5LBFA 5A7WB 2I07B 1RVF2 3O0WA 1WGPA 3JZVA 3RGBA 2O0OA 2WA4A 1BVVA 3FLTA 4L11A 1LB2A 1US3A 1GV9A 1PZ8A 1VPHA 1H8TB 1RUC1 3SKVA 2D5HA 5GKAC 5T50A 3SQOA 3ZOIA 3Q8EA 1C5IA 5AC93 2YGLA 3CLPA 1JH5A 4R9CA 1UXXX 1X50A 4YW7A 1IG3A 2JDHA 3VKLA 2DF7A 3LA3A 4FPHA 4CEYB 4DIQA 3B69A 4CU8A 1COV3 4L8QA 3ZYRA 1RUD1 1EAH1 3LIGA 4OZXA 3OBAA 3BGAA 1W03A 5KXBA 2QQIA 4IQPA 1XE0A 4QPIB 1YQ5A 2VL4A 2WS93 3WXPA
chains in the Genus database with same CATH topology
4AYUA 1U12A 5EWSA 4HPKB 2RJKA 4LHKA 4IEUA 4XEZA 5GALA 1ASJ1 1DLLA 2VULA 3UKNA 3ZN4A 2VMIA 4AFCA 2R32A 2VECA 3WQ0A 4FT8A 3MF9A 4I0AA 1QJX3 2ZHKA 4COWA 5KHJA 4GMP1 1AUYA 2WA3A 1LHVA 2VGDA 4EWAA 1XNBA 3WG3A 4FXGB 4Y1ZA 4LLFA 4AQTA 1HRV1 2IC1A 1AYM2 4XBNA 4MYEA 1OFNA 3EHKA 3CEWA 2ZMKA 3H7YA 4MGZE 4FPOB 1BXHA 1BBT2 2WNVC 3FJSA 1KFUL 5GM0A 2ERFA 3LWCA 1TME2 4H7MA 5FO7B 2C9AA 1RMU2 1QKQA 2R062 1UMZA 3N4MA 3HD8B 1SBFA 2YUEA 2V09A 1WCSA 4GH4A 1TNFA 1VBB3 2XJSA 3H9AA 2RS11 3VDDB 1V6MA 4LA2A 4XIOA 3K48A 4YM1A 4JC1A 3J8F3 1KFXL 2D98A 5SV8A 2HEWF 3VGIA 3NO8A 2YROA 3VHOA 3FLPA 1RHI2 1UKRA 3THTA 2UYAA 3MI8A 2D6NA 1LU1A 3DPRB 4TZDA 1DIWA 2UWAA 4YYOA 3ZXAC 4XF4A 4YM3A 1OSGA 4WM8C 4JDMA 4FPFA 5KC5A 1TME1 4KWKA 2JG8C 4L92A 2R6QA 4BA6A 3FLRA 2XJTA 1IHMA 4Z1VA 1SACA 4D7SA 4NHKA 3J9SA 3CNAA 4OI2A 3VBHB 2B46X 4AHWA 3WG4A 1OD5A 3ZYGA 1HX6A 1F8VA 2ZX3A 5F9TA 4GWMA 4PIZA 4P9IA 5AFEA 3WG1A 2UURA 1J3RA 2DUQA 3FHIB 2R072 4Q4V3 2A71A 2LALA 2XKOA 4LBQB 3VBSB 2RS51 4I0WB 4WV8A 4ASLA 1O4TA 4H3WA 1NE6A 1F2NA 1FMD3 3NL1A 3VBOB 2A6XA 5ABJB 1NQDA 1VAVA 1R093 3RJ2X 2PHUA 1JHNA 1J1TA 1DQ1A 2JG9A 1SBDA 2WC2A 3MW2A 2ZX0A 1W6MA 4XTPA 2IXHA 1KDKA 5C8WA 4LT5A 4I0BA 2QQPA 1ZZ7A 3KLSA 4XF1A 3U0ZA 1ASJ3 3O12A 3FFZA 3HT1A 4OHZA 3ZSEA 4CDQA 1DGLA 1XYNA 1PO23 1GYKA 1SLAA 4YVWA 5L7OA 4K6BA 4Q4Y1 4PQ9A 2IFWA 2VOKA 1UF2C 3R4DB 3N36A 1ZNPA 2P3IA 4RS5B 1WCKA 4I3GA 4FBFA 3L2YA 2PQQA 3PLQA 4HL0A 2HWC2 4L99A 5T54A 3TBDA 1RITA 1H1AA 3VV1A 2VQ0A 3HAGA 2XH6A 3DUIA 1X82A 3UV9A 3ME2A 1A8MA 5D8AB 3VLBB 4QQPA 1VB4A 2H6BA 2DTYA 3CO2A 2XJPA 4K1YA 5FMOS 1H2LA 4M3CF 1QY4A 1RVF3 1DG6A 1MEC3 5DDJ1 4LHNA 2BWAA 1MZFA 3W9AA 2W0XA 5GZCA 1W0OA 1WD4A 2ZGMA 4PDWA 1AR61 4QGMA 3SNMA 3I59A 4BIOA 5FLJA 4LR4A 4Q4Y3 1BBT1 3WD5A 3MIEA 3X29B 3CJXA 2WNUC 2FMYA 3FBYA 4Y24A 2WNVA 2FZ2A 5JIUA 3B5LB 5ACA2 4H7LA 5T5PA 3KSCA 1FPN2 4QPYA 3KZ4C 3M70A 3NKTA 3EXUA 2WNUB 1U5YA 3ZVXA 1W39A 4W65A 4Q2FA 2QUOA 3FZ3A 4FP3A 3ZFEC 1ULCA 5KXDA 4QM9A 3WINE 3VBRA 5I93A 1PNGA 1COV2 1D0GA 1O7FA 2Z42A 1SCRA 3V0AB 4GA9A 4CDXB 1W6QB 1H8VA 2GSYA 1GFF2 2BFUS 2XB6C 2ZKNA 3SXWA 5K9YA 4JVAA 3DL3A 4LHLA 4COVA 2TBVA 4K20A 1N1SA 2ZHNA 2HWD2 2WS91 2VH9A 3EO6A 2BQPA 1WMFA 1AX0A 2Q0AA 4FSJA 3RYKA 2D7FA 2WSVA 1QJU2 2WFF2 4GWNA 3NAPA 3GNEA 4AGVA 1MZ5A 3CF6E 3ATGA 1YHFA 2AYHA 1JUHA 1VB2A 5GLVA 4E27A 4AEMA 1B35A 2JECA 3I59B 1EV12 2OZJA 1YJKA 1Y43B 4Y5Z0 2ENRA 2VNRA 5T55A 2BNOA 3AMMA 4IV1A 3MFCA 2XJQA 3H7JA 4XJ9A 3WZ1A 3AXEA 2OVUA 4AF9A 3OY8A 3ES4A 3T2TA 2OUJA 3H3UA 5LEKA 1R082 1MS1A 1VBB2 4NN0A 3FFQA 1YI9A 1QHDA 3VUOA 2AR6A 3C2UA 2ZGTA 4Q8LA 1RUJ3 4OI0A 4QPGB 3LKJA 3JD73 2HWF1 2VNOA 4LE3A 3MFAA 1UW8A 3W58A 1AF9A 1CAUA 1LHUA 5KXEA 1AR83 4MXVA 3LCPA 3WCRA 2VW0A 3LB9A 1LOAA 2E7AA 3S6PA 3O14A 1QJX2 1ZBA3 4Y20A 2Q1MA 5FAXA 1DZTA 1DGWX 5KC6A 2N7GA 4EN7B 1UPIA 1H30A 1N3OA 4EN6B 1OHFA 2JXAA 1K5MB 2RE9A 3ENRA 2P37A 3WT3A 4MSVA 4DPNA 2F4PA 1X8MA 3WV6A 1DDLA 1UAIA 3VBUC 5J98B 1CX4A 4D69A 4GMP0 4YM0A 2WZR1 4PDWC 3A4UA 3D82A 5IUQA 4EN9B 1QDCA 1HXS1 4PLMA 3SH4A 3RZZA 5JOXA 3JQWA 4Q26A 2PHTA 3VBUB 2V5YA 1GR3A 1ZRRA 3MGUA 1ASJ2 5CG8A 1Q43A 3AZWA 2ZGRA 3DN7A 3ZX7A 1MQTB 3WDWA 3ZXDA 1R091 1RUI1 5C9AA 2BGCA 4R4ZA 2F6BA 5E89A 1RUD2 1BZWA 4WBBA 4C90A 3E5XA 5FOBB 4JTNA 3U11A 4BWOA 3V64A 3R0RA 5HCFA 2UU8A 1H4GA 1DQ0A 3ZFEB 2WZR2 4P9GA 1BCXA 5CBLA 1GSLA 2XWBB 5BNOA 5F6LB 1RUH3 4MXWA 3WLUA 3L9JT 4A3XA 1LESA 2PHXA 1Q56A 2FHRA 1ZBA2 5A32B 1MACA 1Z0HA 4BZ4A 4CEYC 1Q8QA 4N7UA 1FOD1 4B7KA 4EN0A 1N1YA 1ENRA 1FAYA 3GHNA 1QMJA 3FMGA 1ENQA 5FPZA 1XQNA 1GZCA 1LGBA 2ZMLA 1QH6A 2ZPXA 2DVAA 4I09A 2CL2A 4LUMA 4XJZA 3VZKA 3I7DA 1H0BA 3B9IA 2SLIA 1YO8A 2PAMA 2A6ZA 1LOGA 1VLNA 1L3JA 3NV3A 3AP9A 4LBMA 3B9CA 4GH4B 4X8NA 4Q4X1 3MLKA 4NWVA 4IV3C 4XBLA 1G9FA 1QH7A 1NY71 1UD1A 4OUMA 3IM0A 5DZGA 3VBFA 2NM1A 3VN4A 1CAWB 2RM23 2W39A 2HWF3 3ZFFC 1PGW2 3VL9A 2ZGQA 4BMBA 4RHV3 3B94A 2OPKA 3M3EA 1TE1B 1AL23 3WP6A 5B2GB 1GANA 3M4FA 5IT6A 1XXNA 1TEIA 4CDQC 4IERA 4P9JA 1PVXA 4XFBA 3AP4A 1LHOA 1FI2A 4JGYB 2ZZQA 2YHJA 4D7YA 4FVVA 1VBE1 3WOGA 1BVP1 1OLQA 2VG9A 1W6OB 1BMV2 3KGZA 4XFHA 5BNOC 4Q4W2 1RB8G 4ISRA 1S0JA 1CN1A 4H14A 4QD2A 5K0UB 2JICA 1XE8A 3H3ZA 5BNPB 2JG8A 2EXHA 1RJ7A 1QNYA 1PK6B 3GBGA 4OHWA 3RSJA 2C1FA 5DUWA 4HMZA 3AM2A 4WM8B 1JW6A 4WM8A 5BYNA 5SV5A 4FOVA 2VOWA 4BCUA 5C9AC 1DF0A 4P9WA 2FMDA 3CL1A 4JDNA 1OQEA 1S0FA 1K5MC 3AYCA 1JN2P 5HXVA 4JGZA 5E88A 4CZSA 1BMV1 4LBJA 1JYCA 1ENSA 4CP1A 1NCRB 1HRI3 1XU1A 2ZX4A 2XBO2 2CGOA 5HI0A 3ELNA 1PIV3 4XJUA 3JBG3 3QH7A 2OW4A 1BYHA 2DUOA 2XBO1 5JPMB 3RYPA 1C3HA 3SCFA 4MVTA 2CAVA 1VBC1 5AFBA 5ACA3 3I8TA 4N43B 1RUH1 1Q8OA 1SFNA 2BNNA 4W6WA 5BXXA 1OLRA 1YIPA 1VAKA 3WUDA 1DYKA 3WW4A 2JX9A 2EXJA 3WQ7A 5JPNB 3TYJA 3V0BA 2HWC1 3PHMA 2A6WA 1ZRCA 2ZOEB 5JI7A 4N9HA 1QJU3 1POV1 4KL1A 1UIJA 4Y1XA 2XG3A 3H0OA 4Y1YA 1MS5A 1VRH3 3VBHA 5EYXA 2KA3A 3OJBA 1ZZBA 3ZMOA 2D6LX 5CIRA 1YI7A 3O0VA 2R1BA 1UPSA 4HZFA 1WLWA 1A6CA 4XXPA 5ACA1 3MLLA 1FOD2 1REDA 4AQ2A 1PNFA 4XFIA 4I3PA 5KWRA 2DURA 3TAYA 3PVOA 2DCYA 2WZPP 2DTWA 5I0SA 4WVMB 4AI3A 4AFDA 4YVSA 4KH9A 1AYN2 4MH0E 3OBTA 1LU2A 4FAGA 1DQ2A 3RS6A 4XQDA 4YVWC 1D2QA 2EVXA 3ROUA 1HRV2 2YC0A 4QU2A 2AENA 5GZGA 1G8WA 1WW4A 3RJRA 3DF0A 2RR12 1DHKB 2ZKLA 1ZM1A 1RUE2 4P9XA 4BIFA 2BTVC 1D2SA 2VUAA 1NOVA 3RYRA 1AR82 1W6NA 3CJIB 2HEVF 1QGLA 4ATFA 1QQP2 3IPVA 4CDUB 1AYM3 3HWJA 4HN1A 5BNQA 1LOFC 1SLLA 4XHXA 3ACLA 4RGGA 1MEC1 2GDFA 5C8CB 2EIGA 1YFXA 3JUUA 4XQWA 1NLSA 4LBKA 4LO4B 1TQ5A 5JZGC 5IK8A 1I3HA 2Q4SA 1F5JA 2KM2A 4FO9A 1ULEA 1KQRA 1RUF1 5FLHA 1LENA 2HWD1 1PO13 2RR11 1AR63 4X8PA 2GC0A 3ALQA 3J8F1 4PF5A 3WQ1A 3ZSKA 2R071 2CAUA 2PYTA 5EFUA 3POSA 1AYN3 1DQ4A 3RWNA 1PIV1 3LSEA 4XJAA 1MQTC 2YY1A 3T1LA 4EWEA 3ZSLA 4DY3A 1YWKA 1J3QA 1FOD3 5EJ3A 2GH8A 2HWE1 2D5FA 2XL9A 5AC92 1H8TA 2R041 3WW3A 1RUOA 1IS6A 3Q9OA 3VKFC 1OA3A 3AKQA 3HMYA 1ULDA 3OTFA 3ZN5A 5CFCC 1O3SA 4M00A 3NKGA 4A2UA 1GQHA 3VZOA 1LRHA 1RHI3 1UU5A 3POWA 1KDMA 1ULFA 4IEQA 4G4FA 3OGJA 2VVEA 1RUF3 3ZXEA 4GQ7A 4ITCA 4CDXA 5D1IA 1QXPA 2CWSA 3I2DA 5KXCA 3ZN6B 4KWLA 3HT2A 1CESA 1FV2A 1W2UA 2ZCWA 4NWWA 5CA6A 1HQLA 1OPOA 2JEMA 3ECQA 4KGQA 1NXMA 2ZGUA 4YG3A 1PGL2 1UU4A 3M2MA 4DY5A 3PTYA 4BLJA 1RINA 4DZGA 4O9GA 2XLFA 3IBMA 2E7TA 5C4WB 1G9DA 1Q8VA 2ARXA 3JB4C 1DFQA 4JGZB 1WD3A 1X8EA 4TWTA 2VU9A 1LHNA 3D4KA 1R1ZA 4CDUC 3LZZA 2G9GA 1D4VB 2R0FA 5J36A 3MLJA 2PAKA 4ORFA 2FBEA 2D3RA 3USUA 2Z5WA 3UJOA 3OYWB 1BEV3 1W6PB 4YW4A 2JJ6A 2B8MA 3B93A 1MZEA 2ZA9A 3DPRC 4BPZA 3TB0A 3VHNA 5CB7A 4FTBA 2OUHA 2WZR3 5J7MA 3KCCA 4Y1VA 4AGRA 4OI4A 1AYM1 3OD4A 1PHMA 4R52A 4I2OA 1LOEA 4YRDA 3SHRA 5CG9A 3U4XA 3PVBB 2H0VA 4WM7C 1FPN1 1OI6A 4RA0A 1VAMA 4RS5A 3WW2A 3B00A 1DU3D 3URFA 5C9AB 1G6NA 1SQ4A 1ND3A 1YJLA 5FOJB 4XFAA 4LNVA 2UYBA 1I9RA 4MX3A 3EBRA 2DVGA 4HK8A 4AW7A 4AHYA 4N7IA 1RL3A 2CV6A 2X5IA 1CAVA 2HWB2 4MUVA 1UU6A 1TMF3 2ZZJA 2V73A 4B8EA 1NCRC 3FX3A 1AR91 2AREA 4QT6A 5LRRA 1POV0 4AHXA 3ES1A 1JOJA 3SCGA 3RDIA 2JE9A 2E9QA 1LJ7A 1A78A 1DGRN 1R1A1 2HEYF 3VKOA 2X29A 3GHMA 5F1RA 1NCRA 3QLQA 4Q4V2 1G9CA 1POV3 1KRIA 5CFDB 3IWZA 2JD4A 3AMNA 4R8HA 5ABJA 1FMD1 2X8KA 4AQSA 1IKPA 4INDA 1MVQA 5T3NA 4RL7A 1MR5A 2JDZA 1ND3C 1HRI2 4WVWA 1GNHA 5I8TA 3A0KA 2IXIA 4UBGA 1WLDA 4MGYE 5DUUA 3NVCA 2K9ZA 1LEDA 2ATFA 3HQXA 3M1HA 1J58A 3E5UA 4Q0UA 4P14A 1QNWA 3GZTB 4XILA 4HKWA 1CVNA 1WCDJ 2ZMNA 4GB33 1DGWA 2DCTA 3E6BA 4Z07A 1RIRA 1NXD1 4EROA 2MEV3 4AHZA 2ZTNA 4F83A 3KD4A 3SH5A 2NP0A 1QDOA 1DZQA 1GBGA 1PK6A 3BCWA 5BNPC 3OBRA 4Z2WA 4DNYA 2O1QA 3V0BB 3AKPA 3E6CC 1PO22 1EYBA 1A8DA 1VBA2 4QPGC 1YRZA 1G9BA 3RPQA 3TN93 1SCSA 1U5XA 1WLTA 2BUKA 3B3QE 2R042 2CGPA 4GXLA 3UL2A 1CD3G 1UKGA 4XPVA 3VBFB 2EAKA 2GNDA 4YM2A 3NJZA 5DUXA 3OGGA 1N3PA 3PMSA 4IL7A 4OFGA 2MPFA 3T1MA 1MZ6A 2RM22 4LUKA 5DDJ3 1RUE3 1S0DA 4XFFA 1H2NA 5IK4A 4AVAA 3AX4A 4YGBA 1V70A 1BEV2 3A0NA 1AR71 3I54A 2ZGPA 2W68A 3CJIC 3MIHA 1VJ2A 4J1XA 5KBFA 4HSLA 2YMZA 4DOUA 3N7MA 5BNNA 1ZYBA 3AZYA 4Y22B 1AJKA 1PZ9A 3JBG1 3QACA 4W6YA 2XHKA 3IT8A 1RUH2 3KMHA 3WR0A 1CJPA 2HWE3 4M3CB 4FPEA 4IEPA 1IS3A 1D4M3 4LEJA 4YARA 1U5ZA 3PVNA 1VBC3 1PVC1 1AXKA 1IKQA 1UX6A 5A32A 3D0JA 5JWPA 1O3QA 3S30A 1SLTA 1KITA 1YUDA 2QVSB 4YW3A 4AEDC 2XLAA 1XYOA 1HQWA 1I5ZA 1V9U2 1EP0A 4HVRA 2PA7A 1ND2C 1WW6A 4X6QB 3VBOC 3MW4A 1W6OA 3OD0A 4QGLA 2EAAA 4M3CE 1RGSA 3TN92 1C5HA 1WLCA 2P2KA 2C0ZA 2D43A 3GZUC 4F3JA 1ZVFA 3WDYA 1AR73 3O7OA 5L19A 1HXS2 2BEOA 1CAXA 2EXIA 4TLFA 5GLZA 4CEWC 4YG6A 1NCQA 1FYUA 4WVVA 4C91A 1G7YA 3ZSMA 3WX5A 2ZGOA 5DG2A 1QJY2 1HIXA 5JZGA 1TME3 4KQ7A 4M01A 4RR3A 3WDTA 4ZU7A 4G3YC 3R05A 2WLPA 1S55A 3FE5A 4HSJA 1QOSA 4BM8A 2WINB 1BQPA 4RQPC 3LAGA 2K2SA 1LODA 3C3VA 1D4M2 3R4SA 3FWEA 3ZYPA 1CAWA 1AJOA 1C28A 2E63A 1PGSA 3H1WA 1AXYA 2JKBA 4Y22A 1RUNA 1YCIA 2D6KA 2R30A 4KG8A 5H9SA 4YZ2A 2XWJB 3DGTA 1REEA 4G9SB 4RD7A 1X36A 1RUG1 4RFT0 3E5QA 5C8CC 5JOWA 4JRLA 1H9PA 1ZRFA 5FBZA 4LO5B 1ZRDA 1H4HA 1E57A 1X33A 3N7KA 5K0UA 2BBVA 2NLRA 3VZJA 4Q4X3 2CTVA 1FNYA 1AR81 4CDWA 2GMPA 4Q0SA 4OLLA 2O8OA 3KQRA 2WKKA 1R1A2 4S2HA 1WW7A 3BU7A 5D8AC 1NG0A 2OYZA 2PELA 1MEC2 3AMQA 4KWJA 1GICA 2A3WA 2QZ2A 3G7DA 1HQNA 2B7YA 2C5DA 4LTAA 4AFAA 4XTMA 3NV2A 5BV6A 3AP7A 4Q4W1 2O8QA 3MF6A 1O5UA 1ZBE1 1PM7A 4B3NA 4N53C 4YG0A 2WT0A 1GNZA 4FOQA 3VZLA 1J59A 3INAA 3IDCB 4YLZA 1AHSA 1OKQA 3GALA 2E6VA 2MEV2 3D5OA 3WP5A 5HCBA 2WLQA 1XNDA 5L7OB 4IESA 4YGEA 3N35A 2FZ1A 4D94A 4Q29A 2GU9A 1R081 3ASIA 1JUIA 1H2KA 2H6CA 2HWD3 1RJ8A 2Y38A 4GB32 2BNMA 3OF1A 4SLIA 3EJKA 3DV8A 4Q27A 2ILMA 3U10A 3ILFA 1W6QA 5C8CA 2GN7A 4N43C 2P34A 3MICA 4CDXC 4K3UA 4GB31 2PFWA 1UL9A 2MEV1 1PVC2 3L2HA 4JGZC 4HANA 4DS0A 4S2DA 2QKDA 5CVRA 2Z79A 4FPGA 2G4IA 4K9SA 1I1EA 3UKTA 3VBOA 2LUWA 3VDDA 3WW1A 1YFUA 1V6IA 4PLOA 2ZAAA 4GALA 3RMXA 3R6SA 4DRRA 1S0EA 3VHPA 4WVZA 5FRAA 4XF9A 2ZGKA 1CONA 1GZWA 2Q8OA 1AXZA 1GZWB 4Q4Y2 2E7QA 2IXKA 3TRSB 4NHLA 2I74A 2QJVA 4WVMA 2MNGA 1I6XA 3R4UA 5EZWA 4CP2A 1DQ6A 4RQPB 3SH3A 2DFBA 5BNNC 1MS0A 5J96B 3D8CA 2ZGNA 4N43A 4JGYC 4R9AA 2ZABA 4XFCA 5K7PA 3O0XA 4QPIA 1NQJA 1SDWA 1RUE1 5GJ6A 5BNNB 2XPJA 1BJQA 3DPRA 1J1LA 4QX5A 5DZEA 1S0CA 2GH2A 2WFPA 4PIYA 3VBFC 3WDVA 1C1LA 4L9BA 3KGLA 5LEJA 3UKVA 3N3HA 1QOTA 1O5LA 4IV3A 5J37A 1QQP1 3BOWA 1LECA 1CQ9A 1KS5A 3MIFA 1NY72 2DCZA 2XGXA 3KT1A 3VZNA 2EALA 3AK0A 1OMIA 3J4UH 3WHTA 1CAUB 2GNMA 2DVDA 2ET1A 4FQ4A 4WM7B 4LBLA 2R063 2WT1A 2A3YA 1MS4A 3W59A 3AXDA 4TSVA 4B4PA 4XJ8A 2DCKA 5C4WA 3ZXKA 2PAEA 3M3CA 1Y7BA 4JRAA 3AZVA 1PO12 1RUJ1 4YNIA 2HWB1 2WNVB 2ZGSA 4Q4V1 5CU1A 3WNXA 1RMU3