1ZBA3

Foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
GIFPVACADGYGGLVTTDPKTADPVYGKVYNPPKTNYPGRFTNLLDVAEACPTFLRFDDGKPYVVTRADDTRLLAKFDVSLAAKHMSNTYLSGIAQYYTQYSGTINLHFMFTGSTDSKARYMVAYIPPGVETPPDTPEEAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDTAETTNVQGWVCVYQITHGKAENDTLLVSASAGKDFELRLPIDPRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
total genus 36
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zba300
4CEWA 4CEWB 1VB2A 2RS51 4RR3A 4IV3A 4RR3B 2HWF3 2HWF2 1RUI3 1RUI2 5AC93 1EV11 5AC92 1VRH1 3ZFGC 1HX6A 1POV3 4Q4Y1 1MQTC 2WS91 4CDUC 1RVF1 4Z92B 1TME1 3JB8A 4N43B 5ACA1 2R043 2R042 4NWVA 3JD73 2HWC1 4RQPC 5ABJA 1NA1A 5ABJB 4IV1C 1NA1B 4BCUA 3IDEA 1X33A 1ND3C 4CDXA 5DDJ1 2ZTNA 3J8F3 3VBSA 3J8F2 4CDXB 1D4M2 1WCDJ 4JGYC 1AR93 3ZFEA 2RR13 3ZFEB 2RR12 5D8AB 3VBRA 5C9AB 2VQ0A 3VBUC 1RUH3 1POV0 4PDWC 4QPIA 1AR83 1AR82 4QPIB 2BUKA 1VBC1 4GMP1 1ZBA3 5FMOS 1QJU3 2RS33 1QJU2 2RS32 5BNOC 4AEDC 1VBD1 4JGZA 4JGZB 1QJY1 1W39A 1PVC3 1PVC2 1NCQB 4FSJA 1QJZA 1QQP3 1QQP2 2RM23 1OHFA 2RM22 1PGL1 2ZAHA 4GH4C 4Q4W2 1VBB3 1VBB2 1D4M1 3JB4C 1TMF3 5C4WA 1TMF2 2X5IA 2RS11 1RUE3 1RUE2 2XBO1 1VAKA 1BBT3 1BBT2 1OOPA 4Q4V3 1OOPB 3FBMA 4Q4V2 5L7OA 5L7OB 1AL0G 1ASJ3 5K0UA 1ASJ2 1R081 3CJIC 5K0UB 2RMU3 2WFF1 2RMU2 3VBOA 1AYN3 1AYN2 3VBOB 1M06G 1EAH1 3VBUA 1FPN3 1RHI3 1FPN2 1RHI2 3VBFA 1RUC3 1RUC2 4FTSA 1R1A3 1R1A2 2PLV1 2FZ1A 4QPGA 1COV3 2R061 1COV2 3DPRC 4QPGB 5J98B 2MEV1 3VBHC 1RB8G 4YVWC 4Q4X1 3ZFFA 4FTBA 1RMU1 3ZFFB 2HWD3 2HWD2 4NWWA 4CDWA 4Q4W1 1AR63 1AR62 4CDWB 5J96B 1PO11 5A32A 1RUF1 4RS5B 5A32B 1PO22 1HXS3 1HXS2 4N43C 1ND2C 1RUD3 4N53A 2R073 4N53B 2R072 2WWSA 1HRI2 1MEC3 4LLFA 2IZWA 1ZBE1 1AYM3 4CDQA 1AYM2 2HWB3 2HWB2 1B35C 1PIV3 3NAPA 5BNPA 4IV3B 3NAPB 1V9U3 1V9U2 5BNPB 3JBG3 1BEV1 3JBG2 1FOD3 1FOD2 5C8CA 2HWE1 5C8CB 1NCRA 4WM7C 1NCRB 1NG0A 4WM8C 5D8AC 5JZGC 5C9AC 1RUG3 1RUG2 1GFF2 2BPA2 3DPRA 1C8M3 1C8M2 3JD72 3TN93 4GB33 3TN92 1IHMA 4GB32 2WZR1 1PO21 5CFDA 1HRI1 3VBSB 5BNNC 1AR92 1FMD3 1A6CA 1FMD2 1NCQC 2HWF1 1RUI1 2GH8A 5AC91 5FOJB 1POV1 1F8VA 3VBRB 1RUH2 5GKAC 2WLPA 4RFT0 3ZFGA 3ZFGB 1ZBA2 1HRV3 1MQTA 1HRV2 2R041 1MQTB 2Y26A 1NY72 1K5MC 1QJX3 4CDUA 1QJX2 3JD71 4RHV3 4RHV2 1H8TC 1AL23 2BFUS 4RQPA 4RQPB 4IV1A 3J8F1 5C4WB 2X5IB 1AR91 1ND3A 3VDDC 1BMV2 4CEYC 2RR11 1AUYA 4YVSC 1VBE3 1VBE2 4JGYA 1Z7S3 1Z7S2 4JGYB 1RUH1 1CJDA 1AR81 1RUJ3 1RUJ2 5CFCC 4RS5C 1ZBA1 1QJU1 2RS31 4PDWA 3VBUB 3VBFB 4PDWB 5FMOL 1R093 3S6PA 1VBA3 1VBA2 4CEWC 4RR3C 1HQNA 1PVC1 4IV3C 1QQP1 1AR73 4AEDA 1AR72 2RM21 5BNOA 5BNOB 4AEDB 1VBB1 1TMF1 2GSYA 2RS53 1RUE1 1F2NA 1EV13 1BBT1 1EV12 1VRH3 1VRH2 4GH4A 1X36A 4Q4Y3 1RUD2 4Q4V1 2WS93 2WS92 1OPOA 1MEC2 1ASJ1 4CEYA 1RVF3 1RVF2 5ABJC 5LK7B 2RMU1 1NA1C 1AYN1 4CDQB 1TME3 1TME2 5ACA3 5ACA2 1PIV2 2ZZQA 4EJRA 1FPN1 1RHI1 2HWC3 2HWC2 1RUC1 3CJIA 4CDXC 3VBSC 1R1A1 1SMVA 1COV1 1PGW2 3ZFEC 5DDJ3 5DDJ2 2DF7A 2HWD1 3VBRC 1AR61 3VBHA 4QPIC 3DPRB 3VBHB 4YVWA 4YVWB 5A33A 1HXS1 5A33B 1RUD1 1VB4A 2R071 2BBVA 5CFDB 1MEC1 1VBC3 4JGZC 1VBC2 4GMP3 1AYM1 4N43A 1ND2A 2HWB1 1ND2B 1PIV1 3ZXAC 1VBD3 1VBD2 1V9U1 1E57A 3JBG1 1FOD1 1QJY3 1QJY2 1B35A 5C4WC 1B35B 2X5IC 1PGL2 1PGW1 1OOPC 1D4M3 1RUG1 2RS13 4WM7A 2RS12 5L7OC 2XBO3 2XBO2 4WM7B 1C8M1 5K0UC 3TN91 4GB31 4WM8A 4CDUB 5D8AA 3VBOC 4WM8B 5JZGA 5C9AA 5JZGB 1AL22 3VBFC 1R083 1R082 2WFF3 2WFF2 4IV1B 1EAH3 1EAH2 2FZ2A 4QPGC 4GMP0 1FMD1 3M8LA 1ND3B 3ZFFC 2PLV3 2PLV2 5BNNA 4CDWC 2TBVA 5BNNB 2R063 2R062 1NCQA 2MEV3 2MEV2 4Q4X3 4Q4X2 1RMU3 1RMU2 4Q4W3 4N53C 1HRV1 1PO13 1R092 1PO12 1RUF3 1NY71 1RUF2 4FTEA 1QJX1 4CDQC 2XPJA 4RHV1 1AL21 4Y4YA 1C8NA 3NAPC 1K5MA 5BNPC 2BFUL 1K5MB 1NOVA 1ZBE3 1ZBE2 3HAGA 5C8CC 1H8TA 1NCRC 2RS52 1H8TB 1BMV1 1BEV3 1BEV2 2HWE3 4GH4B 2HWE2 4Q4Y2 4Y5Z0 1VBE1 1Z7S1 3VDDA 3VDDB 4CEYB 1RUJ1 4YVSA 4YVSB 3LOBA 1CD3G 1DDLA 1R091 3CJIB 5CFCA 5CFDC 4RS5A 2WZR3 2WZR2 5CFCB 1PO23 2QQPA 1VBA1 4SBVA 1HRI3 1AR71
chains in the Genus database with same CATH superfamily
3D0SA 2YDEA 3IN9A 3LFIA 4CEWA 1PZ7A 3OBRA 2QZ3A 4OYUA 3HNMA 5BYNA 4KWJA 2DUPA 4MADA 3OEBA 3AKRA 1RUI2 1AJOA 3MW2A 4ZU5A 3BGAA 3VKOA 1W9TA 2NMNA 5JPNB 4YYOA 1W90A 5DG2A 5BY5A 4XUTA 2W1SA 4ZS3A 3U07A 3ZSJA 3KGLA 1LOFA 2BP6A 3MIGA 4WVMA 4DEQA 3OOXA 1IKPA 1UQXA 3JB8A 2VOXA 3QH6A 4UF0B 5ACA1 2R043 3Q8BA 3IDBB 5F5IA 2WINB 2RHPA 4NWVA 3WDXA 2C0ZA 2HWC1 4RQPC 5E89A 1DQ1A 3WQBA 4UW6A 2FMDA 3NVCA 1U5YA 2DU1A 3PVNA 5T5PA 4D7TA 5J7MA 3V0AA 2A6ZA 4BCUA 3IDEA 3OPWA 4Z1VA 4AFMA 1XYPA 3PHMA 1JUHA 4YW7A 4XXAA 4LIVA 3J8F2 4CDXB 3URFA 1GOGA 2OZJA 5LBCA 3OY8B 1WA6X 3AMNA 3OYWA 3I2DA 4FPHA 4FP3A 5CA6A 3HWJA 3GBGA 2RR12 2WQ8A 1S4CA 3ZYBA 3QLQA 2HEVF 3OBTA 5H9SA 4P9JA 4W6YA 3VBRA 1EUTA 4ZKTB 3BTAA 2EXKA 2L9LA 4PDWC 1O4YA 5C5UA 2PELA 4QPIB 4LK6A 3BN6A 4KGGA 4ZHNA 4XIOA 2VMDA 3AZYA 4GMP1 1Y43B 1WUVA 1CPMA 3C7FA 1WWYA 4UW3A 3NSTA 3JU9A 2YV8A 1W8UA 4AQ2A 1B09A 3BIEA 3WW3A 2XXZA 2X05A 4D6RA 3NW4A 4YFWA 5FZ7A 3H3UA 2VBPA 1JHJA 2YPDA 4HPKB 4QQHA 2Z5WA 5DUVA 1KS5A 1F5FA 5SV8A 5A7PA 4NR1A 1PVC2 1MS0A 3ZSMA 1CAVB 4P14A 3M3IA 1QQP2 4JZRA 2RM23 2A1XA 4PLOA 2UURA 2VUDA 2ZAHA 4HBNA 3CIHA 1QWRA 1S0EA 5A7WA 4CP2A 1VBB3 1X50A 2WNUA 4Y26A 2D6MA 3JB4C 1TMF3 1LJ7A 3HMYA 2X5IA 2RS11 4XJZA 5FUPA 3SQOA 1WMXA 2CY6A 2XBO1 1K12A 1BBT3 3K4AA 4XF9A 3SMHA 2WIIB 1OQ1A 3RZHA 2QVSB 3JQXA 4GA9A 4BYYA 4I3GA 2W68A 1VMFA 2AUYA 3FE5A 1AL0G 2BZDA 3MI8A 5K0UA 4AVTA 1ASJ2 2WT1A 2FDKA 4E8DA 1L7RA 5A70A 1F31A 1Q56A 2WFF1 4FFGA 3VBOA 1AYN3 5JPMB 3KV6A 5G04L 2ARXA 1DYPA 2W47A 3AKPA 3MZHA 4XF3A 1NZIA 4E9KA 3O1RA 2E7AA 3I2HA 1ZVFA 3VBUA 3U78A 1H2NA 1G7YA 1QDOA 1RUC2 4CUBA 4GXLA 3O5SA 5JOYA 3B94A 4JDMA 1DG6A 1O59A 1R1A2 2B7YA 4R52A 1WMEA 4LO4B 2GN7A 1RTVA 5M0TA 2P5BA 1W06A 1W6QB 5FPAA 2VZPA 4R8HA 3VBHC 4AHXA 1J84A 1YQCA 2MEV1 4Q4X1 3OEAA 1SQ4A 1LECA 3LCPA 1RMU1 5ANQA 3ZFFB 3D6EA 2PHDA 5T55A 3B02A 3HEIA 4CDWA 4S2HA 4D0QA 5EPAA 5CU1A 4RFRB 5J96B 1PO11 2VNOA 1QGLA 4OI0A 2XUMA 3CMGA 4UBGA 2VPVA 4LOSA 4N43C 2WT2A 1L3JA 5F9TA 1ZZ8A 2R072 3AL5A 3FN9A 4N53B 5CISA 1LRHA 2P3JA 1HRI2 2GH2A 1X8MA 3R4UA 3W5NA 1ZBE1 1GNZA 1D7PM 1EPWA 4MGSA 1WCKA 2H6CA 4I01A 4DINB 1B35C 4FPYA 1U0AA 3I2GA 1QMJA 2WABA 3GCXA 4QB6A 2SBAA 3NAPA 4D7SA 1L7LA 5L19A 1WW6A 5F3EA 5T5JA 5BNPB 3LGRA 1BEV1 3WF1A 2ZKLA 1NCRA 3GZEA 3Q8AA 2WO3A 4QHZA 4DRVA 2VMHA 1VIWB 4B1LA 3NMBA 3OD0A 4WM8C 5K7PA 3MPPG 5EXOA 1UMHA 4LHNA 2I2SA 2KA3A 4ATEA 5C9AC 1RUG3 2VG9A 5FREA 4O65A 5J1XA 4XTPA 4N90A 3M3CA 5EV7A 5FJHA 1C8M2 3TN93 4M3CE 1IHMA 3M1HA 3M3OA 4GB32 1NX9A 2LRPA 1F35A 2WZR1 3FC0A 1PM7A 1Y7BA 1AF9A 1Y3TA 1H1IA 1PO21 3N9NA 3O14A 3VDAA 1JODA 5IK4A 1O3SA 3AP9A 1WD4A 4JAAA 2W0XA 1A34A 2B46X 2YMZA 2R30A 4FAHA 2HYXA 3POGA 3GZAA 3USSA 4HK8A 4EN8B 3T1MA 1IZ3A 2R7EB 4EE2A 3KV5A 5D2AA 4KMQA 5J37A 1A6CA 4LBQD 1NCQC 2A5ZA 1OH4A 4FFHA 4LBLA 5CADA 1ONAA 5EFUA 2BV4A 1J58A 1RUI1 4AVVA 4Z2AA 1JYCA 2BGCA 4XMIA 1SDWA 1UY2A 2E51A 2W52A 4UW4A 4MGKE 4ES9A 1F8VA 1H9WA 2VW2A 1XU2A 4PBPA 3BTXA 5FLHA 4NAOA 3ZM8A 2OQ6A 1YI7A 1CR7A 1MZFA 3ETQA 1C4RA 3MIBA 4ASKA 1OT5A 2HH9A 3ZFGA 4OCTA 5C33A 1DGRN 2UWCA 3WOGA 3I3EA 4AVCA 2LS6A 2HEYF 2VMEA 2Y0OA 4URAA 4DY3A 4CDUA 2J7MA 1CIWA 2D40A 3H50A 5A3WA 3ENRA 2GZWA 4RHV3 4HG6B 4P5YA 3TEZA 4LHLA 4LKFA 2K9ZA 4LKSA 1UIKA 4AQSA 3LQCA 4ITCA 3J8F1 1ST8A 4XBLA 5LCWL 1QXJA 2E6VA 3A0NA 4I0AA 1G9FA 1JXNA 3LD8A 1CZTA 1ULOA 4W8JA 1DLCA 4QM9A 4FOVA 5A3LA 4J6GA 2P34A 1W05A 2RR11 1SPPB 4U2AA 5CEHA 4YNIA 1HB3A 2F6BA 2CAUA 2EAAA 5JOXA 3VD7A 4JGYB 3K3OA 3ZPYA 1CJDA 1RUJ3 2PHFA 5JSPA 5CFCC 3WW4A 2O8OA 2D6NA 2O8QA 4L92A 3WG4A 1ZBA1 3P3PA 3BPSA 1QOTA 3NV1A 5CKMA 3VBFB 4CP1A 1HKDA 5FMOL 3VD4A 5FP9A 3OGVA 4IEYA 4MOAA 3ZKYA 4Y1ZA 3E6DA 1VBA2 1SFPA 1XOYA 3HNYM 1HW5A 4UT5A 2EAKA 2IFRA 2QKDA 3PVOA 1LTEA 4LXLA 4AW7A 1OLQA 1PVC1 3ES4A 4IV3C 1QQP1 4AEDA 2ZX1A 1RXFA 2OUJA 1KFXL 1J3QA 1V6MA 3OJBA 1W0PA 3WNOA 4BOWA 1ULCA 2JB8A 3RZKA 3ETPA 1EV12 2K2SA 3RNSA 1OQEA 1ODMA 4CXWA 1ULFA 3W59A 3VKLA 3H42B 3POEA 3D5OA 3BODA 4CXXA 1AX2A 1ASJ1 2UYBA 3GZTB 3KCXA 1RVF2 3LSEA 4Y4RA 4CEYA 4IGPA 5LK7B 3DGTA 1V6KA 1OURA 3DXUA 5HXVA 4AWDA 4XF0A 1TME2 3MF9A 4K9SA 3AYEA 5ACA3 2J1TA 3FLTA 4EJRA 2VQAA 2Y64A 2HWC3 1RUC1 4PLMA 4CDXC 1R64A 1N3PA 2JE9A 3RVHA 1R1A1 5FZ3A 2JG8C 1LGBA 4BQ2A 4CPBA 3K3NA 1H30A 1GNYA 2FBEA 2J1UA 3NV2A 3MLKA 1C28A 5B4NA 1NKGA 3AVSA 4YM2A 3AXEA 3UK9A 1FYUA 5IK5A 5T5LA 2DF7A 2E7TA 1Q3EA 1W6NB 1YC61 1HV1A 1GQHA 2WNEA 2Y60A 1FXZA 4X6RB 1QNWA 4M01A 5IHRA 3ZXDA 4QPIC 3DPRB 4YVWA 3IIIA 1XE8A 1D0GA 1SCRA 4OI4A 4XFCA 1GKBA 5A33A 1W2OA 2AR6A 3RWKX 4LO5B 1T6GC 2ILMA 4NIAA 3S5AA 2R071 5HCHA 1NE6A 1YQ5A 1MS3A 1VBC2 1H2KA 4H14A 4BJ0A 4GMP3 2VMCA 4IE7A 4KWLA 1N3QA 5I8SA 2KXLA 3P6BA 1I5ZA 1K45A 2PAEA 3ZXAC 2G1MA 3KT4A 1DQ4A 3N35A 2BVVA 4YW5A 5FY8A 5FY0A 2GAUA 4EQVA 2ZXQA 4JRLA 1QH7A 4XDPA 1O3QA 4YG3A 3LPFA 2J1VA 3IAPA 3H8XA 3N7MA 4XFBA 2ZGNA 4FPKA 4ZU7A 4D6QA 2WSVA 1UYYA 3NKGA 3NV3A 4P9XA 3JZVA 4DXTA 2ZKNA 3AL6A 3SKJE 2FDGA 4QPWA 2RS13 4K7JA 4OMCA 2XBO3 5A3UA 4WM7B 4H7LA 1ZRFA 1C8M1 4GB31 1ZZBA 4D6SA 4Q29A 1UZ0A 1W99A 1WW7A 3KWVA 5D8AA 4BIOA 4DMIA 4EN0A 3SCGA 5J3UA 3I4IA 3PL0A 5JZGA 1KITA 1KQRA 2ZGSA 5IAVA 4LUKA 4OVEA 5LZ6A 2BTVC 1TG7A 3P1IA 5FLIA 2WFF3 3AMQA 3K4ZA 4M4RA 1T6BX 2QQOA 3TEYA 3QCWA 2EIEA 1EAH2 2FZ2A 3MEPA 2J1SA 3NL1A 4HK9A 2RJ2A 4YGDA 4TWTA 2ZPXA 4YG0A 3ZFFC 3ZLIA 4J1XA 2VL4A 4LTAA 1XU1A 3N7KA 4JDOA 2PLV2 3U37A 3ZR6A 1LHOA 4AEJA 3ON7A 1YXWA 2YUEA 1S0CA 4I09A 2ZS6B 2MEV3 3AFGA 4JKKA 4Q4X3 4ES8A 1RMU3 4XMAA 4YZ2A 1SFYA 1R1ZA 3U1XA 5KC5A 2TUNA 1S0JA 2X09A 2ZEXA 1W0NA 5FZDA 4N53C 1S0FA 5AFBA 2AH2A 4A44A 4GJZA 1PO13 2QZ2A 3M4FA 1F4AA 4CRQA 2WN2A 4DUWA 4CCEA 4CDQC 5FO8B 2XPJA 5CZKA 2PHRA 3HQUA 2HLEA 4LBKA 4Y4YA 1TE1B 1WBFA 3FFZA 2O14A 1S0IA 5BNPC 4Y1UA 2ZBJA 1NOVA 3KQ4B 1ZBE3 2ZX2A 4Z82A 3KD4A 3WDWA 1H8TA 1H0BA 3O12A 1HV0A 3CF6E 4GJYA 4MGIE 4HOOA 1C1FA 1DZTA 2X29A 1PK6A 2YC2A 4GWIA 4BLIA 3WF3A 1BEV3 1Q43A 1XE0A 4BQ5A 4HKLA 4EN6B 1PX4A 5DXDA 5FCCA 1KEXA 2XKOA 5JUVA 3CL1A 1IPJA 3ZDVA 3VDDA 2XDVA 4F7ZA 3IKWA 5FY5A 1W03A 1LESA 3RI8A 4XVHA 4YVSA 5GLUA 5FMBA 5IUQA 4E2SA 2B45X 3VV1A 3R0RA 4XUQA 4KI5M 3ZYPA 3NNMA 5FQ0B 4CP9B 3I59A 3ROUA 5CFDC 4RS5A 2WZR3 2ARCA 3BALA 1YFUA 1PO23 1WA4A 2VZVA 4B4PA 4CXYA 2QQPA 1VBA1 4XQ4A 4AL9A 4JKLA 5FY1A 2Y0IA 3QH7A 5FK7A 4AVBA 1W8FA 3VKNA 5GM0A 1SLIA 1AXYA 1JTZX 1C5IA 1JOBA 4OI1A 1ULEA 4INDA 1BJQA 3PLQA 4TXWA 5EJ3A 1X82A 4MGQA 3ASIA 4CEWB 3T3YA 5FKBA 1BHGA 4A3XA 2QFEA 4AE2A 4N7UA 5GLZA 3RMYA 2WYSA 4AEMA 4C90A 1KRIA 2HWF2 1RUI3 4Q2FA 4XF4A 4YZ1A 1EV11 1O91A 5F5QA 5AC92 5CNAA 1HX6A 1O4ZA 4K8RB 2JDKA 2Y6GA 1YQ6A 1AJKA 3MIHA 4IE6A 3ZN4A 4E27A 2WBKA 4M4PA 4QX0A 3TNQA 3NJZA 2BOJA 1RVF1 1VMHA 4E2QA 2KR2A 3I3DA 3LDBA 2ID4A 4AF9A 3VZLA 4WVMB 1UOFA 1TME1 4N43B 4AAXA 2JB4A 4Q1PA 4Q5OA 1VP6A 3VZOA 5FY9A 3B01A 4Y33A 4E4DX 5ABJA 3IT8A 1NA1A 4IV1C 4LOTA 1BVVA 4XAEA 3QOPA 4MXVA 2ZMLA 3V0AB 5FMDA 3LE0A 1ND3C 2VO5A 4IQPA 1DGWA 5E8AA 3KS7A 3J8F3 4KU8A 4TYSA 5DAXA 1VRBA 2XL7A 4PF1A 1PMHX 4NOTA 3VBSA 1WCDJ 5FWJA 3GHMA 4JGYC 4BXSV 1GU3A 1NT0A 2VMFA 1DZQA 4MZUA 4XFGA 3AP5A 1NQDA 3UETA 2Y38A 2Y34A 3ZYRA 1PMIA 2Z79A 2VQUA 2RR13 1DCSA 1V6IA 4OZXA 4PIYA 4B4QA 5F1RA 3MIFA 5C9AB 2WO7A 3NV4A 3BCWA 5DAPA 3E1F1 3TNPB 1POV0 2AEZA 2OX0A 3PNAA 1UKRA 2OA2A 1AR82 4CCMA 3CU7A 4HN0A 2BUKA 4K3UA 5IWFA 1VBC1 2EA7A 3VHRA 3HBZA 5HI0A 1NAEA 3RZLA 1UU5A 3UJQA 1ZBA3 2WKKA 5F3IA 1ENXA 1PZ8A 4XCAA 3ACIA 1LHUA 5LEKA 4IEVA 2WLQA 3AKTA 3WP6A 1PNGA 1RC6A 5LRSA 2A75A 4JGZA 2R6QA 5EIYB 2EIGA 1GWKA 2ARBA 2FD8A 1MS4A 2O0OA 3VN4A 1PVC3 2JENA 2YC0A 1NCQB 2R0FA 2WFPA 1JU3A 2YPJA 1QQP3 3GNEA 4MUVA 3ZXLA 1UAIA 1OHFA 2E53A 3JCIA 4GH4C 2OPKA 1OLRA 1UOJA 5FPBA 1C1LA 1NXD1 3F2ZA 4AHZA 4O9EA 2WNUB 1I5PA 3APBA 4YGBA 5C4WA 3WNLA 3OCPA 4PBOA 1SLTA 1UPIA 3FLRA 1AXZA 3NRUA 1OA3A 1UX7A 3OGSA 1UNBA 1XPWA 4Q0SA 4Q4V2 2IVIB 3B5LB 2R1BA 4KNCA 3M3EA 2VUAA 2G4IA 1G9BA 1ASJ3 1Y9MA 2ETEA 2IVJA 3DKWA 5FZ6A 4YSFA 5K0UB 2RMU2 4EZ4A 3VBOB 3DF0A 1M06G 2Z69A 2EXJA 3DL3A 1EAH1 5E6HA 4MV2A 4AI3A 4AZZA 1RHI2 4M0HA 1RUC3 1V0AA 4AFCA 1RUNA 4PIXA 2ORXA 3R05A 4D69A 4IESA 4LQRA 1R1A3 2A7AA 5HXMA 2PLV1 2EIDA 1KJRA 5I0UA 2DCJA 3WVJA 2BU9A 1W9FA 4K21A 3HN3A 4ZXKA 3BB6A 4KG0A 3WG1A 4BM8A 3DPRC 1COV2 4JTNA 4NHKA 3ACGA 5FO9B 2IFWA 2KD7A 2MHFA 4FTBA 1H1MA 3NNJA 2HWD2 2WL1A 4H55A 1IPKA 5GZDA 5HCBA 1NYWA 4Q4W1 4P00B 2DCYA 4Y3OA 4CDWB 4TTGA 4URTA 2E63A 3HT2A 2D97A 3NQHA 5J48A 2OT7A 1PO22 1HXS2 5FZFA 4FPFA 4JHTA 2R073 5FY7A 5IVYA 1WCQA 4DY5A 1G9CA 2W91A 2I45A 4QXCA 1H4HA 1FT9A 2IZWA 2OW4A 1E5HA 4P02B 4ZS2A 4AI0A 1UYPA 1AYM2 3BU7A 4E4HA 3BTZA 2HWB2 3WUCA 3E5XA 1UX6A 1CZSA 4AFDA 3A21A 5JXIA 3POFA 4B8EA 4IV3B 3NAPB 1UMZA 1V9U2 1G9DA 3JBG2 2X10A 1DYKA 1FOD2 4YW4A 2EICA 2VMGA 3KVBA 2GN3A 2XLGA 4L99A 4WM7C 1NCRB 1NG0A 1S1AA 2GNBA 1HJFA 4Q0QA 1RJ8A 3DV8A 3RYKA 5FZEA 1H1AA 4OHZA 1LULA 2W1QA 5HBAA 2VW0A 1S2KA 3U4SA 3C7OA 4CCLA 5HPOA 1MS8A 3KF5A 5BNQA 2ZMNA 3KCYA 1C8M3 3CJXA 5FXVA 5L9BA 3VKFC 4GB33 4DFSA 4HSLA 1ZM1A 4AGVA 1X9TA 1YIPA 2VMIA 4GULA 4BZ4A 2WNVC 2CSGA 3V0BA 1P8JA 2ARAA 1KD7A 3ZVXA 5J36A 4XBQA 3U4XA 4A2UA 4OUEA 2J1RA 3SH3A 5A1FA 2JG8B 5DUWA 3UGFA 4YZ4A 5FXZA 4KG8A 4CCJA 1FMD2 3J9SA 2GMPA 3NJXA 5A7QA 4KH9A 2HWF1 5LBFA 4Y20B 3RS6A 5AC91 4MX3A 2Q8CA 3SITA 2VJXA 4FOWA 4JX0A 2BGOA 4LORA 4EN9B 3UNPA 2YB7A 1LHWA 1OMIA 3HPNA 4XILA 5GKAC 1BXHA 1WLWA 5JXHA 1PNFA 1SBFA 4LBJA 5LA1A 3X29B 3W58A 2WLPA 3CO2A 4KQ7A 3T1LA 3ZFGB 1ZBA2 1SLLA 4W6WA 4YFZA 2R1DA 4GQ7A 1TZOA 1J3RA 1MQTA 5F6LB 5C71A 3N4MA 3T0DA 2Y26A 5F2SA 2OPWA 2HYKA 3DXTA 1AX0A 3KV4A 1LR5A 4GALA 5GLWA 3WHUA 1IKQA 2Q1FA 5BPXA 4BB3A 1YO8A 2ZZJA 1FNYA 3MW3A 1GQPA 1YCIA 2VW1A 3E6BA 3FHQA 2IXIA 2PN5A 3AB0A 1N47A 3N36A 3RMXA 1OA4A 2FCUA 5EYYA 5KHJA 3SKVA 1AVBA 1E5RA 2VQTA 1OUSA 4P9GA 5JI7A 3ZMNA 2VE1A 1ULPA 1UY0A 1A78A 3AJYA 4N9HA 1ENRA 2PHTA 2DVGA 5T54A 2V09A 1JZ8A 2GP5A 2FHRA 4CTEA 5C3OA 1VBE2 4XETA 3RZZA 4DRRA 1Z0HA 1Z7S2 2A70A 2NLRA 4BISA 4YW6A 4AAPA 5I8YA 1F15A 4WV8A 1ZREA 2VZOA 1AR81 2GU9A 3LDRA 1US2A 5G05L 3I2OA 5FZHA 4QKDA 2PAKA 3U10A 1DP0A 2CU5A 3GBWA 4NAMA 3H1MA 5LATA 1WZXA 2VTXA 3KSCA 1CWPA 3AK0A 5DAQA 4WVWA 1Q8SA 1U12A 3S6PA 4LA3A 2Y6FA 1PM4A 1WKYA 1VBA3 4BPZA 4CEWC 1JZ4A 4YZ3A 3PIJA 1NLRA 3K48A 1WLDA 4KL1A 1ZA4A 4ISRA 2GP3A 3ZYJB 1GMMA 4UYBA 4C8DA 5BNOA 5FZBA 2XJQA 4AEDB 2PTMA 4OHYA 3PJYA 4XYXA 4ATFA 3HJRA 3LWCA 4L11A 5FJKA 5A6QA 2PMWB 3ELNA 5DMYA 2FDHA 1EV13 4MLOA 1LOFC 1VRH2 1QHDA 1GZTA 1FV2A 1X36A 4OHVA 3OUJA 4Q4V1 3WP5A 1SG3A 4XFFA 2DWRA 4YW3A 5A6ZA 1YHFA 2WS92 4QXBA 4NRQA 4C0BA 3I7DA 1CAUB 1RVF3 4ISQA 3ST7A 2D5FA 3A23A 2RMU1 1V6LA 2VCAA 3WY6A 4CDQB 1TME3 4HVQA 3W5MA 5JOWA 3B69A 3TWIA 4JC1A 2ZZQA 3LKJA 1RHI1 3LZZA 4IW3A 1JZ2A 3CJIA 4CCCA 4HN1A 4OULA 4AQ6A 5GZCA 2JG9A 3BTYA 1W2UA 4XFAA 3UKVA 2XL9A 2A71A 4JKMA 4MO3M 3M2MA 3ZXGA 4IDZA 1COV1 2ZA9A 5A3PA 2WDBA 5DDJ2 4COYA 5HV4A 2IXCA 4COUA 3ES1A 3SHRA 4AXOA 4FFIA 2HWD1 3KLSA 1SLCA 1IPSA 2QQUA 1ULDA 3VBRC 2D6PA 3MF6A 2IXLA 4CUCA 3D0JA 5FZKA 1YI9A 3WNXA 4P9IA 4Q8LA 3RZGA 4YVWB 2D7FA 4HKOA 1PX3A 3OBAA 1J1LA 1HXS1 5A33B 1RUD1 2B8MA 2JDYA 3ZN6B 4A45A 4KBZA 5JCTA 2Z4FA 5CFDB 1MEC1 1Q8VA 1VBC3 4BQ4A 1AYM1 1MZEA 3B7MA 1ND2A 4UF0A 2HWB1 4IEPA 2JD4A 5FDBA 1TQ5A 4IL7A 1PIV1 3ORJA 1QKQA 5L9RA 1V9U1 4GAZA 1E57A 3TEXA 3LB9A 3JBG1 1W9YA 4COZA 1FOD1 3ZX7A 2DBIA 2WNUC 5FPXA 2OVUA 3EB7A 3NJVA 1OFSA 2DUQA 3FL7A 3PU3A 2X5IC 4FQ4A 1PZ9A 1PGL2 5EJZB 1PGW1 2P3IA 4IE4A 5GZEA 5KXCA 1W6OB 1ZA7A 2ERFA 2AZ5A 3MFCA 4ONUA 4E4SA 2UY9A 1W6MB 3QACA 4J1WA 3B9IA 4RA0A 4CYDA 5A3TA 3CKHA 3D4KA 3B3QE 3L9JT 5FR3A 5K0UC 2PYTA 2WR9A 3VBOC 2ZAAA 4AEKA 1GV9A 4HLTA 5GZFA 3WD5A 5JZGB 3H3LA 1JI6A 3FZ3A 3MO4A 3LA2A 4JDNA 2VOKA 4MH0E 5E88A 5JIUA 4NHYA 4BE3A 5FUIA 2ZGLA 1LOCA 3LIGA 1S2BA 4FPGA 4IV1B 5FPLA 2Q1MA 5KR7A 2PQQA 1EAH3 2QBXA 3MBWA 4DO0A 3O1TA 2VUCA 4DZGA 4MYEA 1FMD1 3M8LA 1ND3B 3EYPA 3CEWA 5FRAA 2VAUA 1IG0A 3NJYA 4I0WB 2PLV3 3N9QA 5FWEA 2B9VA 5BNNA 1HDKA 2ET7A 5GLVA 4CDWC 2XKPA 1OKQA 2R062 2BJSA 4ZXEA 2E26A 3USUA 4QKBA 1SBDA 1IQDC 3LOIA 3IAQA 4FT8A 3ZSLA 2VTFA 2Z2SB 5LASA 3MDPA 3VDCA 2VZQA 4Q4W3 4EYUA 2VH9A 1UF2C 2VM9A 2EIBA 3I3MA 4RN5A 1EPZA 1RITA 1K42A 5KHHA 1RUF2 4MGZE 1PMJX 2WO1A 2BNNA 4FTEA 5H9QA 2OZ6A 5D21A 5JOZA 3NKTA 2NPIA 2W1WA 3THCA 2CAVA 4YGCA 1AL21 3Q8EA 1O3TA 3GHNA 1C8NA 2AC1A 3NAPC 1K5MA 3LA7A 5IVJA 2PHUA 3HAGA 2BNOA 4P9YA 3S5QA 4YM1A 5E1RA 1NCRC 1NE4A 3GYDA 4XUOA 1H8TB 3KM5A 3Q8CA 1NZCA 3FX3A 4XJ8A 3RQ0A 3EO6A 3RZMA 2VXJA 1O3RA 3FWEA 4OZOA 4Y1YA 4GH4B 2HWE2 2F17A 5EJ1B 1VBE1 3H8UA 1O6UA 2VZTA 4U36A 1Z7S1 3WNKA 2N7GA 2B39A 4JQRA 2J1EA 3UYJA 2QE3A 3VDDB 3WF4A 1MS1A 3V56A 4CCNA 2GC3A 2HKXA 4CCDA 3DN7A 2VECA 3BOWA 4YVSB 2GC0A 4HKWA 1IS4A 2CHHA 1CD3G 1DU3D 3IWZA 4IERA 3V65A 1DDLA 3BI3A 3TRSB 3AKSA 4HANA 4XF1A 1LU1A 4QU2A 1OF4A 2CNAA 4JV4A 3HQRA 3UGHA 1GZWA 2J42A 4P5HA 5C3SA 5F37A 3OGRA 1CAWA 5A80A 1PHMA 1RINA 3DYPA 3PIGA 4M0NA 1XNAA 4M3CA 4FVVA 4GWNA 5FZ1A 2JDZA 3PUAA 2VCCA 5FYMA 3U11A 3WXPA 2VCBA 4AVSA 4Q8KA 2RDNA 3I8TA 4K1ZA 3KGZA 4FO9A 4C91A 1K3IA 1GZCA 4RR3A 4R4XA 3K4DA 5FZ4A 1OUXA 1UYXA 2HWF3 1HQWA 5AC93 1I6XA 1VRH1 4IGOA 3ZFGC 3RSJA 3T0AA 3SH4A 2ENRA 1HB2A 1POQA 2ZMKA 2QQMA 3VZMA 4DUVA 2KM2A 3FJSA 3SISA 2W92A 1W8ZA 3AM2A 4L8QA 4UFMA 3LAGA 4YW2A 2WS91 2BRTA 5FPVA 3WF2A 2Q30A 1BYHA 4CDUC 5KWRA 4AYUA 3O1PA 2JDPA 4Z92B 1YFWA 2PA7A 1LOBA 3IDCB 4W65A 1Q8QA 3EBRA 4HSJA 1HJGA 2Y6LA 5CAZA 1UZYA 4IE5A 5ISLA 2WWJA 3UJOA 1UZVA 2VC9A 4Q1RA 1W2NA 3SCHA 5ABJB 1NA1B 3AZXA 3IIAA 4B1MA 2YROA 1QXPA 5I0RA 3MV11 3I49A 4GD4A 3WSOA 1CPNA 3AMHA 4PCRA 5T3NA 4BIFA 1MVEA 3KQRA 4QM8A 1JYWA 2Y6KA 3D8CA 5DDJ1 2XQXA 2ZTNA 3INAA 1NXMA 5IW0A 4EZHA 1J59A 2W87A 2ZHKA 3C7EA 3GXUA 3THPA 4BQ3A 2YGLA 5BV6A 2P6CA 3VD5A 2LTNA 2P37A 5C8WA 5FO7B 3F95A 3ZFEA 5IVFA 1QY4A 4BQWA 3PJQA 3M70A 4ASMB 1AXKA 3HVDA 5FZOB 2VQ0A 3KVAA 3AP7A 3LEKA 5D1IA 1TVGA 1IS5A 2ZABA 2XJSA 1AR83 1SCSA 2TEPA 2VVFA 1YQ2A 2E9QA 2JXAA 2V4AA 1SDDB 3UV9A 5DABA 5FXXA 2WNVB 1QJU2 2RS32 3H7JA 4UFKA 4NPLA 5L73A 2XVGA 1ENQA 3CZJA 2FDJA 3ZOIA 4AEDC 2YU2A 2Q8OA 2VZSA 2CGNA 4JGZB 2ZGOA 5IVCA 2P3KA 3E5QA 1W39A 3DYOA 1XXNA 4NIDA 4FSJA 4UWDA 4PJYA 1QJZA 2JX9A 1Q8PA 3HBKA 4CE8A 1PGL1 5JSOA 1J83A 1VE0A 3DEMA 4Q4W2 1D4M1 2ZGPA 2ATFA 3H3ZA 4RGGA 3EHKA 3WDYA 5FZCA 3AYCA 3O0WA 4QMAA 4C1WA 4DXZA 1RUE2 1UW8A 1OD3A 1JZ6A 2PXJA 1FATA 4DXRA 5JMOA 1OOPA 4NHLA 5FV3A 3LIHA 4Q4V3 3THTA 5L7OA 1GICA 2WYFA 4MXWB 1YFYA 4BDVB 1OFNA 4YM3A 4CUGA 2HBTA 3HR9A 5A7SA 3BU0A 3WQ7A 5EWSA 2PQSA 2RMU3 3NNFA 1UYZA 2WO2A 4LBQA 4BWOA 3B93A 4K8FA 4PHZA 2D44A 1D0HA 4SLIA 5GALA 4BXFA 1BLZA 1ZZ6A 2BWAA 4HMZA 3ILRA 4R9AA 1UOGA 3PTRB 1RHI3 3VBFA 1FPN2 5JWPA 5CVRA 3OSDA 1CX1A 4FPEA 4UOJA 2JIGA 4QGNA 2BWCA 2O1QA 2XJPA 4QQLA 2Y33A 4XJWA 2GDFA 3OBZA 2FZ1A 3H9AA 4PIZA 2HBUA 2FCVA 4QPGA 4XQWA 1SFNA 2R16A 1COV3 1LHVA 2JD9A 2R061 5J98B 4AK3A 5IATA 1RB8G 4YVWC 5IK7A 4LO8A 2C6SA 2HWD3 1D2SA 5FFOC 3T08A 4CUAA 4E2GA 1E5SA 2VZ3A 1AR62 1W28A 4UAPA 2EVXA 3S30A 3T30A 5FYYA 4AQTA 4NUBA 2YHJA 4Q26A 2W2IA 1QXRA 1RUF1 3E97A 2G9GA 5A32A 1DBNA 2XLFA 1HXS3 4QX2A 3WUDA 3ZIWA 4PQ9A 3W20A 1RUD3 2JKXA 2DYCA 3AJZA 3N3HA 3OPZA 4D3WA 2D6OX 1OLME 2QQNA 2WWSA 3ZSEA 3RJRA 3SH5A 1MEC3 2XONA 5IYYA 1AYM3 2ES3A 2VOVA 4OUSA 5FPUA 2HWB3 4BK5A 3LF7A 1PIV3 5DN2A 4COWA 5F2WA 3KZ4C 1RJ7A 5KXBA 1V9U3 4BK4A 3DECA 4FPCA 3JBG3 3ZXKA 4PLNA 2VNVA 4DOUA 1FOD3 2WAOA 3AFKA 1VJ2A 2LW8A 1LKNA 1KS4A 2HWE1 4TSVA 5C8CA 2OYZA 1J3PA 4KU7A 4NHMA 4XUPA 5CYYA 4YWAA 3MLJA 2VOWA 3POWA 4CA9A 1W6PA 1AX1A 1UD1A 4LIUA 4OI2A 4LLOA 4BU2A 4E8CA 2ZGUA 3GF6A 5D8AC 1QEXA 3O1UA 5JZGC 5IVEA 4HL0A 1JOPA 2PHXA 4WVVA 2RJLA 3E5UA 1O5LA 5LA9A 1GFF2 4FXGB 4I2OA 2Q5TA 3DPRA 4META 4QB1A 3T2QA 4NN0A 4LR4A 3H7YA 1FAYA 2R49A 1H2LA 2IWGB 4UFLA 4JCKA 2P2KA 1S0BA 2FCTA 3IM0A 5I0SA 2I07B 2QDNA 5FPZA 2EF6A 1J1TA 3MUZ1 3V0BB 2B9UA 5FP8A 1QJFA 4XCBA 5BUVA 2XQRA 1OD5A 2GNDA 4NIHA 2ZGRA 1X7NA 3R4DB 2JE8A 2QJVA 1WCSA 3QD6A 1IS6A 3RWNA 4YLZA 3OYWB 1FMD3 1YRZA 3VZJA 2CWSA 3TAYA 4LKDA 4QGLA 3TOJA 5DZGA 4QU1A 1IGOA 2C9AA 3OUHA 1UY3A 1POV1 4Q27A 4NIGA 3UESA 3VBRB 2VR4A 2VVDA 2A3XA 5AVPA 4PQQA 4FFFA 2BBAA 2AACA 3NO8A 5APAA 3RGBA 2DURA 4EWEA 3RFRA 2ZCWA 4GIQA 5JSRA 1ACCA 2LM3A 4ZZ5A 1HRV2 4XOGA 3O1OA 1V6JA 1K5JA 1MQTB 4AI8A 1QJX2 4I0BA 3JD71 2QQLA 1KDKA 4MHUA 4XHBA 3N9LA 4FPJA 3UL2A 1OQDA 1N1VA 1H8TC 1AL23 3CZUA 2BFUS 2RG4A 4LE3A 3RYRA 4G4FA 4ZONA 1PK6C 4RQPA 1JHNA 5FP7A 5LBEA 4QKNA 3VL8A 5IAXA 4Z8BA 1XYOA 2BW8A 1REEA 1NQJA 5A7WB 4W4ZA 4H3WA 4EWAA 3K46A 4JVAA 1O8SA 2X5IB 3P3NA 5FZGA 1AR91 3VDDC 4B3NA 1SLBA 4Q0VA 2DTWA 1NLSA 5F5CA 2P3YA 3UT0A 4LBMA 1VALA 4YVSC 1VBE3 2D93A 4M3CF 2A6WA 5EP9A 5JR2A 1Z7S3 3AP6A 3K77A 1MS5A 5KHIA 4ZY9A 1RUH1 4IEXA 4DUXA 3U75A 2BQPA 4Q0UA 4KBBA 4RS5C 3CNAA 2C4XA 2YFZA 3BPZA 3O7OA 4OLLA 3AXDA 3NWKA 5IJRA 5L36A 2C5DA 1QJU1 2RS31 4PDWA 1ALYA 4RGKA 3VBUB 3RZJA 1DGRA 1MZ6A 4BLJA 4BQYA 3Q9OA 5FAXA 3EXUA 5F8PA 5FKCA 4MVTA 3WW1A 3WP4A 4X8PA 1DQ6A 4QX3A 2ZEYA 3I2IA 3POYA 5IVVA 5LY1A 3MHZA 1C57A 4D94A 1AR72 4PT6A 1V6NA 2ORZA 5I8TA 5BNOB 4NROA 4GWJA 4K1YA 3WNPA 3ZDSA 2ZGTA 4MG2A 1GP5A 4KWKA 4Y1XA 4CCOA 1Z78A 2GSYA 3OD4A 1F5JA 1RUE1 1F2NA 2IXJA 3FUQA 4Y24A 4XZUG 1UPSA 1EUUA 1VRH3 2YZ4A 3KF3A 1CVNA 1FX5A 1OXCA 1XBFA 3LA3A 3O0XA 4WZCA 4Y22A 3H8OA 1RUD2 4Z2WA 1V6OA 4UI9L 1WLCA 4G9SB 2WS93 3W9AA 1OPOA 1QOSA 1MEC2 4ORFA 3A7QA 1YFXA 5ABJC 2WRAA 1NA1C 2PHLA 4CU9A 4LITA 1XRUA 1BK1A 2OXBA 1JYNA 3ZYHA 1PIV2 2NN8A 4QXKA 5A7NA 1FPN1 3MIDA 4CP9A 2Y6JA 3NNLA 4V2VA 1VR3A 4XW3A 3TYJA 1CONA 3VBSC 2XG3A 2ZOEB 1MACA 4HT1T 2BGPA 5C3QA 3VL9A 1YWKA 1SMVA 1Y4WA 2W08A 3B00A 3MIEA 1EP0A 2C9KA 2D3RA 5JXGA 2R32A 2EXHA 1CIYA 2BOIA 2XJRA 4IXLA 1O5UA 1PGW2 1G8WA 3AC0A 5DDJ3 4OQ9A 3ZYGA 5KXEA 5EHDA 5I0DA 1W3XA 4JRAA 3H1WA 2XR4A 1YJLA 2IC1A 3OG2A 1FV3A 4DXSA 2J1AA 4JHZA 3WCRA 4I02A 1AR61 2ZGQA 3VBHA 4F8AA 3AX4A 1UIJA 4JTOA 2QQKA 2WWUA 2R0HA 1WBLA 1YLLA 1JS9A 1LOEA 4H7MA 1JYXA 3FHIB 4MGTA 2NZ9A 1A8MA 2OIIA 4GKXA 4Q0PA 4CU6A 4IEZA 2JDNA 2BBVA 2SLIA 4JGZC 2A73B 1GOHA 3MGUA 4M00A 2QTWB 4LMFA 4N43A 2P4EA 4PI0A 4RSUA 1S0DA 2YC4A 1ZX5A 1ND2B 3IDAA 5ANNA 5HCFA 2WZPP 4G3YC 4XPVA 2RJKA 5LBBA 2DFCA 4FP2A 3PVEA 1XSRA 3OB8A 1VBD2 2VZRA 4LHKA 3ZXEA 2WAAA 5C5TA 4QT6A 1QJY2 1B35A 3MW4A 4NMIA 5C4WC 1LB2A 5LRRA 5DZFA 4A42A 2VUJA 5FP4A 1WD3A 3A0KA 3J7LA 4LEJA 1T2XA 1V70A 3J26N 3GJBA 1D4M3 4I3PA 1WCUA 3J7NA 1BCXA 1UY1A 1DHKB 1W8HA 3ILNA 3BUCA 1XB9A 1HQLA 1LODA 4WZFA 5KC6A 3R6SA 5T5OA 2AREA 3I3QA 2YBKA 2V73A 2YGMA 4WM8A 4CDUB 1OPMA 1RGSA 3FUOA 3UGGA 4AHWA 5C9AA 2G9FA 1AL22 5FYBA 1WMDA 3VKMA 3AZWA 2RDQA 1MVQA 3A22A 3CQOA 1LOAA 2OS2A 3POBA 5A3OA 1R082 4C1XA 4QDRA 5IT6A 4LKEA 4NJ4A 5F6KA 3LPGA 3WQ1A 4XE9A 4AI1A 4QQPA 4GMP0 5JMCA 3IPVA 4TN7A 4YZ5A 4X6QB 4N7IA 4NHXA 4UW5A 2DFBA 5A3MA 2CTVA 2PFWA 3AZZA 3ZYFA 1RUOA 4C0HA 5KHKA 1MS9A 3VD3A 1XNDA 2TBVA 3WX5A 5BNNB 2R063 3GM8A 1NCQA 2X8KA 2QQJA 4CPBD 3USUB 5CBLA 1Q8OA 2F4PA 4HONA 2Q8DA 4EWDA 4AHYA 2XHKA 4LJHA 4A7KA 1Q5OA 2JE7A 2RDSA 1CAXA 1HRV1 3A4UA 2W3JA 2WQ4A 1GWLA 5A6XA 1RUF3 1JZ7A 3J7MA 1QJX1 3I3BA 3VHOA 3LFMA 4X8NA 3ZMOA 4CCKA 3MV01 4EN7B 2QQIA 1IG3A 2JICA 2YXSA 3ZPOA 2ADDA 1JN2P 1CZVA 1SEFA 1K5MB 5FYSA 2MNGA 1SZBA 4D7YA 3WLUA 1JZ5A 2D6KA 2CDPA 3KB5A 4LUMA 2DVDA 2RDRA 2WJSA 3FBYA 2NYYA 5LWBA 1ZZ7A 2W46A 3V64A 2VBDA 4GWMA 4V1PA 1IS3A 3BIWE 2WQZC 2HWE3 4PF5A 4XIKA 3WCSA 2JDAA 3RJ2X 3P5BA 1I3HA 2UU8A 1UMIA 4LK7A 2MPFA 5DQ0A 1OBNA 1HLCA 4OUMA 3RDIA 2VU9A 4CEYB 3H0OA 5C3RA 4XJUA 2JDMA 2QCSB 3G7DA 3U0ZA 1Y9QA 4ARXA 1EY2A 4W6XA 1H2MA 2BDRA 4MSVA 3ACHA 1SHWB 2V5DA 1UU4A 2ZHMA 1XNKA 3ABZA 3PTYA 2RV9A 2D3PA 1UZZA 1WGPA 4NRMA 3KHCA 1UL9A 2DCZA 1GR3A 1R091 4A4AA 2RVAA 5CFCA 1XC6A 2W9XA 2JECA 4NPMA 3TEWA 3N9PA 1GZWB 2TNFA 4MHRA 4N9IA 4I30A 1TNRA 2CV6A 1CAWB 1JMUB 3FLPA 4AR2A 1GWMA 1UCXA 3DYMA 5FZOA 3RYPA 1AR71 2V72A 4D8MA 2JEMA 4M3CB 3GCWA 1RL3A 3AMPA 3EQEA 4QB2A 1RIRA 3HIFA 4RL7A 1VB2A 2RS51 1N1TA 1SBEA 1GLHA 4IV3A 4RR3B 3I2JA 5C7GA 2DDUA 1XNBA 2AGSA 4FPLA 4LPLA 3POSA 3ITQA 1POV3 4CZSA 4Q4Y1 1KGYA 1XYNA 1PVXA 1MQTC 1WW4A 1YIFA 3N7JA 4LO7A 3VGIA 4L2NA 1XE7A 3IB3A 2Q4SA 1ZRRA 2C26A 4HFSA 5T52A 4AVAA 5FZ8A 1VPHA 4Y1VA 2V4VA 4YM0A 4QPYA 5JR7B 2OQ7A 2D43A 2R042 1AZDA 1BKZA 2UY8A 1QH6A 2VZUA 3JD73 2Z42A 4DIQA 1WMFA 1CN1A 3KT7A 2B42B 3OF1A 4KWUA 4P08A 5KBFA 2WA4A 3HQXA 1CJPA 5F3CA 1X33A 2GC1A 4PI2A 3N9MA 1I9RA 4CDXA 5JVVA 4FBFA 1QDCA 1W8TA 5GJ6A 1D4M2 2JG8A 2H6BA 3OY8A 2HJIA 3TBDA 1ZZ9A 4BQXA 3K75B 5BXXA 1AR93 2WUHA 4QQOA 4Z07A 2XJTA 5I93A 5JXJA 5FBJA 5K4LA 1VAMA 4Y20A 3ZFEB 2VTXJ 4QDQA 2BYVE 4XJAA 5D8AB 2XOMA 2YBSA 1CESA 2W94A 4ARYA 4IEQA 4XTMA 1DQ2A 3RRDA 1RUH3 3VBUC 4AOCA 1O8PA 3WNMA 4DNYA 1M4WA 4QPIA 4ZPIA 5LB6A 4DPNA 2A3YA 2GNTA 2XGXA 5JDBA 1NUKA 1MZ5A 1MR5A 2VNRA 1DFQA 1FI2A 5FMOS 1QJU3 1U5XA 2RS33 4HXCA 3BYWA 1CGPA 5B2GB 3JUUA 2JIJA 1KJLA 2VNGA 2YYOA 5BNOC 1VBD1 4HPKA 3AYAA 5KXDA 3ZKUA 3ECQA 1W2TA 5FYUA 1QJY1 3DKQA 2P6HA 3UKTA 1CAVA 5JAXA 4FCAA 2B5HA 4RYDA 3VB9A 3VD9A 5CIRA 2RM22 3PUSA 1G86A 2UYAA 2A3WA 3M7AA 3KV9A 1VBB2 3SLIA 1D4VB 1UZWA 1TMF2 4NRPA 1RUE3 3SEPA 3N7LA 3PU8A 1VAKA 2ZEZA 1BBT2 3AKQA 1APNA 4QKFA 2PAMA 4AGGA 1DF0A 2WC2A 1US3A 1OH3A 3OGJA 2DCTA 1OOPB 3FBMA 1F9KA 4RGAA 5FXWA 2OKXA 4EROA 1BVP1 2HEWF 4NE9A 4UFJA 5L7OB 2W5FA 4AFAA 1H8VA 1QJEA 2P1BA 3FHAA 1R081 3CJIC 4QX7A 3I2FA 4OMDA 3WDTA 5H9RA 1AYN2 4YPJA 4LBQB 2JG9C 2YFUA 2I74A 3WF0A 2XVKA 1LEDA 1FPN3 1JYVA 4XXPA 1GYKA 2K0GA 5DUUA 4FOQA 2YU1A 1PK6B 4FXKB 3WEZA 1U5ZA 4QXHA 3PDQA 5LA0A 4FTSA 2FQPA 4LNVA 3RPQA 2Q1ZB 2D6LX 1ZRCA 2EXIA 1W6QA 2WSUA 2NQYA 2WZEA 3T2PA 5AFEA 1ODNA 1KXGA 5LW9A 4QPGB 4R4ZA 1I1EA 3JQWA 4QGMA 4AG4A 3ZFFA 1G9AA 4JQTA 5F3GA 3RG0A 2GNMA 4NWWA 5CKQA 2QDRA 2CGPA 1AR63 4V2WA 3CHXA 4IEUA 5FBZA 1H9PA 1DGLA 2X53S 2W1UA 2WT0A 4BMEA 3IMMA 3LOBA 4A6OA 3I59B 1W3VA 4RS5B 5A32B 5FLJA 2DVBA 3I97A 5F5AA 1ND2C 3J7HA 5L9VA 4N53A 2B4KA 4WVZA 2A6YA 2V5YA 1N1YA 5A1LA 4YG6A 1IOAA 2JWPA 1CAUA 3OGGA 1OVSA 5A7OA 4LLFA 1JU4A 3C8XA 1VLNA 4CDQA 3ZYIB 5TSWA 2ZEWA 4XABA 3GDBA 1STMA 1O7FA 1H6XA 4OHWA 4AFBA 5BNPA 1E5IA 2WNOA 2G9ZA 2GMEA 4NIIA 3PUIA 4MGYE 2VZ1A 3ACLA 4OHXA 4YRDA 3S0MA 2GALA 3PVBB 2D3SA 5C8CB 3C3VA 1YNAA 5F32A 1D2QA 2WN3A 2XH6A 3Q8FA 5CG9A 2XHNA 2XWBB 2CGOA 1AHSA 2LALA 3WP3A 1W6PB 5K8SA 1W0OA 5F7UA 3ZXFA 4S2DA 1DQ0A 2VVEA 4XUNA 1RUG2 4EV0A 3GJAA 5DUXA 4TZDA 2UWAA 4B4RA 5IK8A 3ALQA 5FZMA 5FZLA 3KHBA 3JD72 1OKOA 2DV9A 3TN92 4ASLA 5FYVA 4B29A 4XBNA 4BQ1A 1LCLA 1W8WA 3BVCA 5CG8A 2QNKA 1W04A 3WW2A 3WHTA 1SACA 4XJ9A 4XFHA 3ZN6A 4AGRA 3GALA 3O1SA 2LUWA 4OFGA 3D3AA 2EALA 2ZX3A 2D98A 4HZFA 1UN1A 5CFDA 3T0BA 2XMLA 3PURA 1S55A 1HRI1 2BERA 4XDQA 1UWWA 3T09A 3VBSB 4FI9A 1GNHA 5BNNC 2WA3A 5FK8A 3VZKA 4QQ2A 2ET1A 3RI9A 4FOYA 1AR92 4A7YA 4CU7A 1MPXA 4KGQA 3ZO0B 4QHBA 1WLTA 2GH8A 5FOJB 4XACA 1LGCA 1YQ8A 3K2OA 3IBMA 1RUH2 5IVBA 1JYIA 1TEIA 3WV6A 3WNNA 4XQDA 3NNGA 2P17A 2ZGKA 2VULA 1W9WA 4AI2A 4BH9A 2CDOA 1W6OA 1G6NA 4RFT0 1H6YA 2XJVA 1X9PA 1W6MA 1OC1A 3KMHA 3WDVA 4E4ZA 1YJKA 1HRV3 4CU8A 3C7HA 2R041 2NP0A 2ZX0A 1GSLA 1V00A 4J25A 1NY72 1K5MC 1QJX3 5FMCA 3VLBB 5C3PA 4P9LA 2H0VA 4P9WA 1LENA 1QF3A 1HB1A 1Y9GA 3IZOA 4RHV2 1CQ9A 1WW5A 4BHPA 4UXAA 1GZ9A 1ULGA 2NM1A 2IXKA 4ZZ8A 2VOTA 1UY4A 2CWMA 3PUQA 4IE0A 4RQPB 3S7IA 5C6CA 4IEOA 1UOBA 1GP6A 4IV1A 4N8MA 2DUOA 4W50A 4XFIA 1KDMA 3LSDA 5I91A 2LROA 3E6CC 5EQUA 5CKNA 2H0BA 3OTFA 5C4WB 4LE4A 4IUGA 5J09A 5K9YA 3AYDA 1DYOA 1ND3A 3EJKA 1JZ3A 1BMV2 3HNBM 3MYXA 1SPPA 4CEYC 2VCMA 1EYBA 1AUYA 3VZNA 3WR0A 4DEVA 1XSQA 3KT1A 1JOJA 4K40A 4JGYA 4LO6B 1GP4A 4RD7A 4QHOA 5HV0A 3MLLA 4XAAA 1YYNA 3O0VA 5FZ0A 1C3HA 1GBGA 1RUJ2 4QDSA 5AVAA 3ATGA 4QAWA 3AMMA 4O7XA 1LAJA 3D82A 4XC9A 2BNMA 3O1MA 1HIXA 2C24A 3T4VA 1REDA 2JJ6A 2ZHNA 3LDKA 4PDWB 1R093 4O9GA 1F4HA 5GLTA 5JLVA 1NLQA 3BOPA 3GGLA 4LA2A 5FZIA 1ZYBA 3HN1A 3THDA 5IFPA 1REFA 4LHSA 3B9CA 2DTYA 3SEEA 2G19A 2XLAA 3S7EA 5A1AA 4RR3C 1HQNA 3DUIA 3LEIA 4IGQA 4L0PA 1AR73 4A41A 2RM21 2C1FA 4HETA 4DS0A 1L7QA 5HCAA 1VBB1 1W8NA 4WBBA 3WINE 4XURA 4TLFA 1TMF1 1LHNA 2RS53 5FZ9A 2ZGMA 5FY4A 2BEOA 2ZHLA 5F39A 5LK5A 2J22A 3VHNA 3TB0A 3S57A 2VY0A 3IMNA 1BBT1 4NPRA 1GOFA 4ZU4A 4YARA 2GMMA 4GH4A 4IETA 4Q4Y3 4Y22B 1RXGA 1BZWA 2Y8KA 3M3QA 5JI9A 4Y5SA 4XZPA 5EYXA 3I2KA 2DCKA 3EMRA 3ZXJA 2E32A 1AYN1 5ACA2 3K51A 3HT1A 4S2GA 5FYHA 5DAVA 2HWC2 3WQ0A 2XWJB 2IUWA 4GZ9A 3ZIXA 4BMBA 3MFAA 5B4XA 1U5IA 2FMYA 2K46A 3C7GA 1TNFA 2ZACA 2QQWA 3OUIA 1HN1A 5E16A 3WDUA 3SXWA 3ZFEC 1JW6A 3MICA 5KHGA 1W6NA 3J4UH 1OA2A 1RYYA 2VBBA 2ADEA 4QX5A 4LBNA 2ZX4A 1PGSA 2BVBA 3SNMA 2A6VA 3VBHB 4Y5TA 4CSWA 5DG1A 4H2AA 2FDFA 1XNCA 3WZ1A 3PMEA 5DZEA 4FPOB 3UKNA 3KCCA 3H8RA 1YUDA 2VXRA 1VB4A 1LEMA 3GZUC 1W9SA 3GBFA 5CB7A 1C5HA 3MPBA 5DAWA 5FOBB 2PHWA 4R9DA 3C2UA 1UKGA 4QD2A 2A6XA 3T2OA 4BA6A 2JDUA 3WG2A 1VBD3 5EZWA 2D5HA 4R9CA 1DLLA 3AP4A 2Q8EA 5FZAA 1QJY3 2FDIA 2OUHA 3CLPA 3G6JB 2W95A 2GC2A 3HOBA 4L97A 1B35B 4HVRA 4XDOA 5FYIA 1CX4A 1SLAA 4O61A 3POJA 1YEWA 5LY2A 3W21A 4YW1A 4R9BA 1UXZA 3LEMA 5A6YA 1OOPC 4YGEA 1RUG1 5L7OC 4WM7A 2RS12 2E33A 4FAGA 1FNZA 2CYFA 2XBO2 4XEZA 5FYCA 3ME2A 2DBNA 3TN91 3T4HB 4GKYA 1JH5A 2RE9A 4WM8B 4K6BA 1KFUL 2XUEA 1UO9A 4B7KA 5LEJA 1DZRA 1QIQA 3VBFC 3FMGA 1QOOA 1R083 3HD8B 2WFF2 3VUOA 1VAVA 4QX8A 2XJUA 1GUIA 4LBOA 5FYZA 2DVFA 1JYTA 1BQPA 5C70A 3WT3A 2JDHA 2WNVA 4QPGC 2IXHA 1OI6A 3CBNA 1ZRIA 4A6SA 1LGNA 2CL2A 3O1VA 1S2EA 3IPVB 1DIWA 1UU6A 4A3ZA 1LOGA 4OQ8A 5GZGA 2AYHA 1BK0A 4CP0A 3R4SA 2MEV2 4TLGA 1VMJA 4Q4X2 2AENA 4F3JA 4LT5A 4IEWA 1RMU2 2BPA2 5JIAA 5T50A 1UXXX 1OSGA 5FUNA 2VD7A 1OF3A 2XVLA 3ZSKA 5I0TA 2JKBA 3FFQA 2ZJCA 4FQZA 3VHPA 1CAXB 1XQNA 1PO12 1R092 4K20A 1NY71 1GANA 4DB5A 2NMOA 2W39A 3I54A 4RHV1 4CVUA 3N9OA 1ZZCA 3POIA 1URXA 1ZNPA 4MXWA 1H4GA 1LNSA 4LULA 5DPNA 3ILFA 3SC7X 1QU0A 1A3KA 1N1SA 3L2YA 4F83A 1HB4A 4UFIA 3ACFA 2BFUL 5H9PA 1ZRDA 5ERLA 1ZBE2 2AEYA 3JXSA 1DQ5A 1O4TA 5C8CC 2Y6HA 1W2AX 2QQVA 3QBQA 5SV5A 2RS52 2F4LA 4UBHA 1X8EA 4QX1A 4NVPA 4DQAA 5FYTA 1JBCA 3PMSA 1BMV1 1XNTA 1OLMA 2Q0AA 1BEV2 3DCQA 1ENSA 4AI9A 4Q4Y2 4Y5Z0 5A3NA 2WZ8A 3ZR5A 3AVRA 2YBPA 4S2FA 1LU2A 2DVAA 2QUOA 3LEGA 3MUY1 3VDBA 1RUJ1 4HVOA 1JUIA 5LA2A 1HN0A 4NO4A 4XHXA 4ET7A 3BKZA 3AZVA 4QWNA 1S0GA 5FQ0A 2XB6C 4L9BA 1OVPA 1W8OA 3H1YA 1N3OA 3CJIB 1DGWX 4A7ZA 2WZR2 2YG0A 2E31A 3WG3A 2DU0A 5CFCB 3L2HA 2JG9B 2UWBA 3CDZB 5FTTC 3U14A 3PUHA 3OPTA 1GQGA 4SBVA 1A8DA 4COVA 5IFTA 4B7EA 3ZN5A 4UFHA 5FP3A 3SCFA 3T2TA 1XJAA 2E7QA 2VGDA 5FIXA 1HRI3 1IQAA 1QNYA 2YY1A
chains in the Genus database with same CATH topology
3D0SA 2YDEA 3IN9A 4CEWA 1PZ7A 3OBRA 2QZ3A 5BYNA 4KWJA 2DUPA 3AKRA 1RUI2 1AJOA 3MW2A 4ZU5A 3VKOA 2NMNA 5JPNB 4YYOA 5DG2A 5BY5A 3ZSJA 3U07A 3KGLA 1LOFA 3MIGA 4WVMA 1IKPA 3JB8A 2VOXA 3QH6A 5ACA1 2R043 3IDBB 2WINB 2RHPA 4NWVA 3WDXA 2C0ZA 2HWC1 4RQPC 5E89A 1DQ1A 4UW6A 2FMDA 3NVCA 1U5YA 2DU1A 3PVNA 5T5PA 4D7TA 5J7MA 3V0AA 2A6ZA 4BCUA 3IDEA 4Z1VA 4AFMA 1XYPA 3PHMA 1JUHA 4XXAA 4CDXB 3J8F2 3URFA 2OZJA 3OY8B 3OYWA 3AMNA 3I2DA 4FPHA 4FP3A 5CA6A 3HWJA 3GBGA 2RR12 3QLQA 2HEVF 3OBTA 5H9SA 4P9JA 4W6YA 3VBRA 4ZKTB 3BTAA 2EXKA 4PDWC 1O4YA 2PELA 4QPIB 4KGGA 4XIOA 3AZYA 4GMP1 1Y43B 1WUVA 1CPMA 4UW3A 3NSTA 3JU9A 2YV8A 4AQ2A 1B09A 3WW3A 3NW4A 4YFWA 3H3UA 4HPKB 4QQHA 2Z5WA 5DUVA 1KS5A 1F5FA 5SV8A 4NR1A 1PVC2 1MS0A 3ZSMA 1CAVB 4P14A 3M3IA 1QQP2 2RM23 4PLOA 2UURA 2ZAHA 4HBNA 1QWRA 1S0EA 4CP2A 1VBB3 1X50A 2WNUA 4Y26A 2D6MA 3JB4C 1TMF3 1LJ7A 3HMYA 2X5IA 2RS11 4XJZA 2CY6A 2XBO1 1BBT3 4XF9A 3SMHA 2WIIB 1OQ1A 2QVSB 3JQXA 4GA9A 4BYYA 4I3GA 2W68A 2AUYA 3FE5A 1AL0G 4AVTA 3MI8A 5K0UA 1ASJ2 2WT1A 1F31A 1Q56A 2WFF1 3VBOA 5JPMB 1AYN3 2ARXA 1DYPA 3AKPA 3MZHA 4XF3A 4E9KA 2E7AA 1ZVFA 3VBUA 1H2NA 1G7YA 1QDOA 1RUC2 5JOYA 4GXLA 3O5SA 3B94A 4JDMA 1DG6A 1R1A2 4R52A 2B7YA 1WMEA 4LO4B 2GN7A 1RTVA 1W6QB 4R8HA 3VBHC 4AHXA 2MEV1 4Q4X1 1SQ4A 1LECA 3LCPA 1RMU1 3ZFFB 3D6EA 2PHDA 5T55A 3B02A 4CDWA 4S2HA 5CU1A 5J96B 1PO11 2VNOA 1QGLA 4OI0A 2XUMA 4UBGA 2VPVA 4N43C 2WT2A 1L3JA 5F9TA 1ZZ8A 2R072 4N53B 1LRHA 2P3JA 1HRI2 2GH2A 1X8MA 3R4UA 1ZBE1 1GNZA 1EPWA 1WCKA 2H6CA 4I01A 4DINB 1B35C 4FPYA 1U0AA 1QMJA 2SBAA 3NAPA 4D7SA 5L19A 1WW6A 5T5JA 5BNPB 3LGRA 1BEV1 2ZKLA 1NCRA 4DRVA 2VMHA 1VIWB 3OD0A 4WM8C 5K7PA 3MPPG 5EXOA 4LHNA 2I2SA 2KA3A 4ATEA 5C9AC 1RUG3 2VG9A 5FREA 4XTPA 4N90A 3M3CA 5EV7A 1C8M2 3TN93 4M3CE 1IHMA 3M1HA 3M3OA 4GB32 2WZR1 3FC0A 1PM7A 1Y7BA 1AF9A 1Y3TA 1H1IA 1PO21 3O14A 5IK4A 1O3SA 3AP9A 1WD4A 4JAAA 2W0XA 2B46X 2YMZA 2R30A 4FAHA 3GZAA 3USSA 4HK8A 4EN8B 3T1MA 1IZ3A 5J37A 1A6CA 4LBQD 1NCQC 2A5ZA 4LBLA 5CADA 1ONAA 5EFUA 1J58A 1RUI1 4AVVA 1JYCA 2BGCA 4XMIA 1SDWA 2E51A 4UW4A 2W52A 4ES9A 4MGKE 1F8VA 1H9WA 2VW2A 1XU2A 4PBPA 5FLHA 1YI7A 1CR7A 1MZFA 3ETQA 1C4RA 3MIBA 3ZFGA 5C33A 1DGRN 2UWCA 3WOGA 4AVCA 2HEYF 2Y0OA 4DY3A 4CDUA 3H50A 1CIWA 2D40A 3ENRA 2GZWA 4RHV3 4LHLA 2K9ZA 1UIKA 4AQSA 4ITCA 3J8F1 4XBLA 1QXJA 2E6VA 3A0NA 4I0AA 1G9FA 1JXNA 4QM9A 4FOVA 5A3LA 4J6GA 2P34A 2RR11 4U2AA 4YNIA 2F6BA 2CAUA 2EAAA 5JOXA 4JGYB 3ZPYA 1CJDA 1RUJ3 2PHFA 5JSPA 5CFCC 3WW4A 2O8OA 2D6NA 2O8QA 4L92A 3WG4A 1ZBA1 3P3PA 3NV1A 1QOTA 4CP1A 3VBFB 1HKDA 5FMOL 4IEYA 4Y1ZA 3E6DA 1VBA2 1HW5A 2EAKA 2IFRA 2QKDA 3PVOA 1LTEA 4AW7A 1OLQA 1PVC1 3ES4A 4IV3C 1QQP1 4AEDA 2ZX1A 2OUJA 1KFXL 1J3QA 1V6MA 3OJBA 1W0PA 4BOWA 1ULCA 1EV12 2K2SA 3RNSA 1OQEA 1ULFA 3W59A 3VKLA 3D5OA 3BODA 1AX2A 1ASJ1 2UYBA 3GZTB 3KCXA 1RVF2 3LSEA 4CEYA 5LK7B 3DGTA 1V6KA 5HXVA 4AWDA 4XF0A 1TME2 3MF9A 4K9SA 3AYEA 5ACA3 3FLTA 4EJRA 2VQAA 2HWC3 1RUC1 4PLMA 4CDXC 2JE9A 1N3PA 1R1A1 2JG8C 1LGBA 1H30A 3NV2A 2FBEA 3MLKA 1C28A 4YM2A 3AXEA 3UK9A 1FYUA 5IK5A 5T5LA 2DF7A 2E7TA 1Q3EA 1W6NB 1HV1A 1GQHA 2WNEA 1FXZA 4X6RB 1QNWA 4M01A 3ZXDA 4QPIC 3DPRB 4YVWA 1XE8A 1D0GA 1SCRA 4OI4A 4XFCA 1GKBA 5A33A 2AR6A 4LO5B 1T6GC 2ILMA 2R071 1NE6A 1MS3A 1VBC2 1H2KA 4H14A 4GMP3 4KWLA 1N3QA 5I8SA 2KXLA 1I5ZA 2PAEA 3ZXAC 3KT4A 1DQ4A 3N35A 2BVVA 4YW5A 2GAUA 4JRLA 1QH7A 1O3QA 4YG3A 3N7MA 4XFBA 2ZGNA 4FPKA 4ZU7A 2WSVA 3NKGA 4P9XA 3NV3A 3JZVA 2ZKNA 2RS13 2XBO3 4WM7B 4H7LA 1ZRFA 1C8M1 4GB31 1ZZBA 4Q29A 5D8AA 4EN0A 1WW7A 4BIOA 4DMIA 5J3UA 5JZGA 3SCGA 3I4IA 1KITA 1KQRA 2ZGSA 4LUKA 4OVEA 2BTVC 5FLIA 2WFF3 3AMQA 3QCWA 1EAH2 2FZ2A 3MEPA 3NL1A 4HK9A 4YGDA 4TWTA 2ZPXA 4YG0A 3ZFFC 4J1XA 4LTAA 1XU1A 3N7KA 4JDOA 2PLV2 1LHOA 4AEJA 1YXWA 2YUEA 1S0CA 4I09A 2ZS6B 2MEV3 3AFGA 4Q4X3 4ES8A 1RMU3 4XMAA 4YZ2A 1SFYA 1R1ZA 5KC5A 2TUNA 1S0JA 4N53C 1S0FA 5AFBA 2AH2A 4CRQA 2QZ2A 1PO13 3M4FA 4CDQC 5FO8B 2XPJA 2PHRA 4LBKA 4Y4YA 1TE1B 1WBFA 3FFZA 1S0IA 5BNPC 4Y1UA 2ZBJA 1NOVA 1ZBE3 2ZX2A 4Z82A 3KD4A 3WDWA 1H8TA 1H0BA 3O12A 1HV0A 3CF6E 4MGIE 1C1FA 1DZTA 2X29A 1PK6A 4BLIA 1BEV3 1Q43A 4HKLA 4EN6B 5DXDA 5FCCA 2XKOA 3CL1A 1IPJA 3VDDA 4F7ZA 3IKWA 1LESA 3RI8A 4YVSA 5GLUA 5IUQA 4E2SA 2B45X 3VV1A 3R0RA 3ZYPA 5FQ0B 3I59A 3ROUA 5CFDC 4RS5A 2WZR3 3BALA 1YFUA 1PO23 1WA4A 4B4PA 2QQPA 1VBA1 4XQ4A 2Y0IA 3QH7A 4AVBA 3VKNA 5GM0A 1SLIA 1AXYA 1C5IA 1JTZX 4OI1A 1ULEA 4INDA 1BJQA 3PLQA 5EJ3A 1X82A 3ASIA 4CEWB 4A3XA 2QFEA 4AE2A 4N7UA 5GLZA 3RMYA 4AEMA 4C90A 1KRIA 2HWF2 1RUI3 4Q2FA 4XF4A 4YZ1A 1EV11 1O91A 5F5QA 5AC92 5CNAA 1HX6A 1O4ZA 3MIHA 1AJKA 3ZN4A 3TNQA 3NJZA 1RVF1 4E2QA 4AF9A 3VZLA 4WVMB 1TME1 4N43B 4Q1PA 1VP6A 3VZOA 3B01A 4E4DX 5ABJA 3IT8A 1NA1A 4IV1C 1BVVA 3QOPA 4MXVA 2ZMLA 3V0AB 1ND3C 4IQPA 1DGWA 5E8AA 3KS7A 3J8F3 4KU8A 4TYSA 3VBSA 2XL7A 4NOTA 1WCDJ 3GHMA 4JGYC 1DZQA 4MZUA 4XFGA 3AP5A 1NQDA 2Y38A 3ZYRA 1PMIA 2Z79A 4OZXA 2RR13 4PIYA 1V6IA 4B4QA 5F1RA 3MIFA 5C9AB 3NV4A 3BCWA 3TNPB 1POV0 3PNAA 1UKRA 2OA2A 1AR82 3CU7A 4HN0A 2BUKA 4K3UA 3VHRA 1VBC1 2EA7A 5HI0A 3HBZA 1UU5A 3UJQA 1ZBA3 2WKKA 1ENXA 1PZ8A 1LHUA 5LEKA 4IEVA 2WLQA 3AKTA 3WP6A 1PNGA 1RC6A 5LRSA 2A75A 4JGZA 2R6QA 2EIGA 2ARBA 1MS4A 2O0OA 3VN4A 1PVC3 2JENA 2YPJA 1NCQB 2R0FA 2WFPA 2YC0A 3GNEA 1QQP3 4MUVA 3ZXLA 1UAIA 1OHFA 2E53A 3JCIA 4GH4C 2OPKA 1OLRA 1C1LA 1NXD1 4AHZA 4O9EA 2WNUB 3APBA 5C4WA 4YGBA 3OCPA 4PBOA 1SLTA 1UPIA 3FLRA 1AXZA 1OA3A 4Q0SA 4Q4V2 3B5LB 2R1BA 4KNCA 3M3EA 2VUAA 2G4IA 1G9BA 1ASJ3 2ETEA 3DKWA 4YSFA 5K0UB 2RMU2 3VBOB 3DF0A 1M06G 2Z69A 2EXJA 3DL3A 1EAH1 4MV2A 4AI3A 1RHI2 4M0HA 1RUC3 4AFCA 1RUNA 4PIXA 3R05A 4D69A 4IESA 1R1A3 2A7AA 2PLV1 5I0UA 1KJRA 2DCJA 3WVJA 4ZXKA 4K21A 3WG1A 3BB6A 4KG0A 4BM8A 3DPRC 1COV2 4JTNA 4NHKA 4FTBA 5FO9B 2IFWA 2MHFA 1H1MA 2HWD2 2WL1A 4H55A 1IPKA 5GZDA 5HCBA 1NYWA 4Q4W1 2DCYA 4CDWB 4URTA 2E63A 3HT2A 2D97A 5J48A 1PO22 1HXS2 4FPFA 2R073 4DY5A 1G9CA 4ZU4A 2I45A 1H4HA 1FT9A 2IZWA 2OW4A 4AI0A 3BU7A 1AYM2 2HWB2 3WUCA 3E5XA 1UX6A 4AFDA 4B8EA 4IV3B 3NAPB 1UMZA 1V9U2 1G9DA 3JBG2 1DYKA 1FOD2 4YW4A 2VMGA 2GN3A 2XLGA 4L99A 4WM7C 1NCRB 1NG0A 1S1AA 2GNBA 4Q0QA 1RJ8A 3DV8A 3RYKA 1H1AA 4OHZA 1LULA 5HBAA 2VW0A 1S2KA 1MS8A 5BNQA 2ZMNA 3KCYA 1C8M3 3CJXA 3VKFC 4DFSA 4GB33 4HSLA 1ZM1A 4AGVA 4GULA 1YIPA 2VMIA 4BZ4A 2WNVC 3V0BA 1KD7A 3ZVXA 5J36A 4XBQA 3U4XA 4A2UA 3SH3A 2JG8B 5DUWA 4YZ4A 4KG8A 1FMD2 3J9SA 2GMPA 4KH9A 2HWF1 4Y20B 3RS6A 5AC91 4MX3A 3SITA 4FOWA 4EN9B 1LHWA 1OMIA 4XILA 5GKAC 1BXHA 1WLWA 1PNFA 1SBFA 4LBJA 3X29B 3W58A 2WLPA 3CO2A 4KQ7A 3T1LA 3ZFGB 1ZBA2 1SLLA 4W6WA 4YFZA 2R1DA 4GQ7A 1J3RA 1MQTA 5F6LB 3N4MA 2Y26A 2HYKA 1AX0A 1LR5A 4GALA 5GLWA 3WHUA 1IKQA 5BPXA 1YO8A 2ZZJA 1FNYA 3MW3A 1YCIA 2VW1A 3E6BA 2IXIA 2PN5A 3AB0A 1N47A 3N36A 3RMXA 1OA4A 5KHJA 5EYYA 1AVBA 4P9GA 5JI7A 3ZMNA 1A78A 3AJYA 4N9HA 1ENRA 2PHTA 2DVGA 5T54A 2V09A 2FHRA 4CTEA 1VBE2 4XETA 3RZZA 4DRRA 1Z0HA 1Z7S2 2A70A 2NLRA 5I8YA 4WV8A 1ZREA 1AR81 2GU9A 2PAKA 3U10A 3GBWA 3H1MA 3KSCA 3AK0A 4WVWA 1Q8SA 1U12A 3S6PA 4LA3A 1VBA3 4BPZA 4CEWC 4YZ3A 1NLRA 3K48A 1WLDA 4KL1A 1ZA4A 4ISRA 3ZYJB 5BNOA 2XJQA 4AEDB 2PTMA 4OHYA 3PJYA 4XYXA 4ATFA 3LWCA 4L11A 3ELNA 1EV13 4MLOA 1LOFC 1VRH2 1QHDA 1FV2A 1X36A 4OHVA 4Q4V1 3WP5A 4XFFA 2DWRA 4YW3A 1YHFA 2WS92 4C0BA 3I7DA 1CAUB 1RVF3 4ISQA 3ST7A 2D5FA 2RMU1 1V6LA 3WY6A 4CDQB 1TME3 4HVQA 5JOWA 3B69A 3TWIA 4JC1A 2ZZQA 3LKJA 1RHI1 3LZZA 3CJIA 4OULA 4AQ6A 5GZCA 2JG9A 1W2UA 4XFAA 3UKVA 2XL9A 2A71A 3M2MA 3ZXGA 1COV1 2ZA9A 5DDJ2 4COYA 2IXCA 4COUA 3ES1A 3SHRA 4AXOA 2HWD1 3KLSA 1SLCA 1ULDA 3VBRC 2D6PA 3MF6A 2IXLA 3D0JA 1YI9A 3WNXA 4P9IA 4Q8LA 4YVWB 2D7FA 4HKOA 1J1LA 1HXS1 5A33B 1RUD1 2B8MA 3ZN6B 5JCTA 5CFDB 1MEC1 1Q8VA 1VBC3 1AYM1 1MZEA 3B7MA 1ND2A 2HWB1 4IEPA 2JD4A 5FDBA 1TQ5A 4IL7A 1PIV1 1QKQA 1V9U1 1E57A 3LB9A 3JBG1 4COZA 1FOD1 3ZX7A 2WNUC 5FPXA 2OVUA 1OFSA 2DUQA 4FQ4A 2X5IC 1PZ9A 1PGL2 1PGW1 2P3IA 5KXCA 5GZEA 1W6OB 2ERFA 4ONUA 2AZ5A 3MFCA 4E4SA 2UY9A 1W6MB 3QACA 4J1WA 3B9IA 4RA0A 4CYDA 3D4KA 3B3QE 3L9JT 5K0UC 2PYTA 4AEKA 3VBOC 2ZAAA 1GV9A 4HLTA 5GZFA 3WD5A 5JZGB 4JDNA 3FZ3A 3LA2A 2VOKA 4MH0E 5E88A 5JIUA 4BE3A 2ZGLA 1LOCA 4FPGA 1S2BA 4IV1B 2Q1MA 2PQQA 1EAH3 4DZGA 4MYEA 1FMD1 3M8LA 1ND3B 3CEWA 5FRAA 4I0WB 2PLV3 5BNNA 1HDKA 2ET7A 5GLVA 4CDWC 2XKPA 1OKQA 2R062 3USUA 1SBDA 3LOIA 4FT8A 3ZSLA 2Z2SB 3MDPA 4Q4W3 2VH9A 1UF2C 1EPZA 1RITA 5KHHA 1RUF2 4MGZE 4FTEA 2BNNA 5H9QA 2OZ6A 5JOZA 3NKTA 2NPIA 2CAVA 4YGCA 1AL21 1O3TA 3GHNA 1C8NA 3NAPC 1K5MA 3LA7A 2PHUA 3HAGA 2BNOA 4P9YA 4YM1A 5E1RA 1NCRC 1NE4A 3GYDA 1H8TB 3KM5A 4XJ8A 1NZCA 3FX3A 3RQ0A 3EO6A 1O3RA 3FWEA 4Y1YA 4GH4B 2HWE2 1VBE1 3H8UA 4U36A 1Z7S1 2N7GA 2B39A 4JQRA 2QE3A 3VDDB 1MS1A 3V56A 2GC3A 2HKXA 3DN7A 2VECA 3BOWA 4YVSB 2GC0A 4HKWA 1IS4A 1CD3G 1DU3D 3IWZA 4IERA 3V65A 1DDLA 3TRSB 3AKSA 4HANA 4XF1A 1LU1A 4QU2A 2CNAA 4JV4A 1GZWA 4P5HA 1CAWA 1PHMA 1RINA 4M0NA 4M3CA 4FVVA 4GWNA 3WXPA 2JDZA 3U11A 4AVSA 4Q8KA 3I8TA 4K1ZA 3KGZA 4FO9A 4C91A 1GZCA 4RR3A 4R4XA 2HWF3 1HQWA 5AC93 1I6XA 1VRH1 3ZFGC 3RSJA 3SH4A 2ENRA 2ZMKA 3VZMA 2KM2A 3FJSA 3SISA 4L8QA 3AM2A 4YW2A 3LAGA 2WS91 2Q30A 1BYHA 4CDUC 5KWRA 4AYUA 4Z92B 1YFWA 2PA7A 1LOBA 3IDCB 4W65A 1Q8QA 3EBRA 4HSJA 5CAZA 1UZYA 3UJOA 5ABJB 3SCHA 4Q1RA 1NA1B 3AZXA 3IIAA 2YROA 1QXPA 5I0RA 1CPNA 3AMHA 4PCRA 5T3NA 4BIFA 1MVEA 3KQRA 4QM8A 3D8CA 5DDJ1 2ZTNA 3INAA 1J59A 1NXMA 2ZHKA 3THPA 2YGLA 5BV6A 2LTNA 2P37A 5C8WA 5FO7B 3ZFEA 1QY4A 3PJQA 3M70A 4ASMB 1AXKA 2VQ0A 3AP7A 5D1IA 1IS5A 2ZABA 2XJSA 1AR83 1SCSA 2TEPA 2VVFA 2JXAA 2E9QA 3UV9A 2WNVB 1QJU2 2RS32 3H7JA 5L73A 2XVGA 1ENQA 4AEDC 2Q8OA 2CGNA 4JGZB 2ZGOA 2P3KA 3E5QA 1W39A 1XXNA 4FSJA 4PJYA 1QJZA 2JX9A 1Q8PA 1PGL1 5JSOA 4Q4W2 1D4M1 2ZGPA 2ATFA 3H3ZA 4RGGA 3EHKA 3WDYA 4DXZA 3AYCA 3O0WA 4QMAA 4C1WA 1RUE2 1UW8A 1FATA 1OOPA 4NHLA 4Q4V3 3THTA 5L7OA 1GICA 4MXWB 1YFYA 1OFNA 4YM3A 3HR9A 3WQ7A 5EWSA 2RMU3 4LBQA 4BWOA 3B93A 4K8FA 4SLIA 2D44A 1D0HA 5GALA 1ZZ6A 2BWAA 4HMZA 3ILRA 4R9AA 1RHI3 3VBFA 1FPN2 5JWPA 5CVRA 4FPEA 4QGNA 2BWCA 2O1QA 2XJPA 4QQLA 4XJWA 2GDFA 2FZ1A 3H9AA 4PIZA 4QPGA 4XQWA 1SFNA 2R16A 1COV3 1LHVA 2R061 5J98B 4AK3A 1RB8G 4YVWC 5IK7A 4LO8A 2HWD3 1D2SA 5FFOC 4E2GA 1AR62 2EVXA 3S30A 4AQTA 2YHJA 4Q26A 5A32A 1QXRA 1RUF1 3E97A 2G9GA 1DBNA 2XLFA 1HXS3 3WUDA 3ZIWA 4PQ9A 1RUD3 2DYCA 3AJZA 3N3HA 3OPZA 4D3WA 2D6OX 2WWSA 3ZSEA 3RJRA 3SH5A 1MEC3 1AYM3 2ES3A 2VOVA 4OUSA 2HWB3 4COWA 1PIV3 3KZ4C 1RJ7A 5KXBA 1V9U3 4FPCA 3JBG3 3ZXKA 4PLNA 4DOUA 1FOD3 3AFKA 5C8CA 1VJ2A 4TSVA 1LKNA 1KS4A 2HWE1 2OYZA 1J3PA 4KU7A 4NHMA