1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
molecule tags Signaling protein
molecule keywords signal processing protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
3GXDA 5BXPA 3F4VA 1PZ2A 4ZEPA 2E9MA 4W7WA 5BRQA 3MKKA 4NSBA 2X05A 2GDUA 4LGXA 1JFXA 1HIZA 1UA7A 2J25A 3W0KA 2XUCA 4UTFA 1BVNP 4DM2A 3OB8A 3F5JA 1XHGA 2WM0A 3NSNA 2EO7A 2QLYA 4JFUA 4YHEA 3W29A 4PBGA 3BMVA 5A95A 4ZXOA 4M24A 2G3JA 1BYCA 2XGIA 5CGMA 4LXFA 1IT0A 1AMYA 1WO2A 4Z2IA 2G3IA 3NJ3A 3BAJA 1GHSA 1JYXA 3CUGA 1JDAA 1NQ6A 4AWEA 1V3MA 2JEQA 3WH9A 1SFSA 2XG9A 2A3AA 3EDEA 3VMPA 3RDKA 1PEZA 1TG7A 1XRVA 1PPIA 2VVNA 4AY1A 5FKYA 3WF0A 1ITXA 1QW8A 1UD8A 2WC4A 2XWEA 4D6IA 5DT7A 3T09A 4KH2A 1CPUA 4XX6A 3VGEA 3OA5A 2D20A 1BG4A 3ARVA 2PWFA 3ZT7A 1W3KA 1TVNA 5EFFA 4DUWA 1VFFA 4CCDA 2WWCA 2CCRA 2YDQA 3L4UA 4HOXA 1SMAA 3T2PA 2Y2WA 4UCFA 5JBDA 4RE2A 1J0KA 1MW2A 2YL5A 4TVDA 3DC0A 1GOMA 3VTRA 3AI0A 4AD3A 3RM4A 4J3XA 1KXVA 4E4PA 1RH9A 4RL3A 3AS3A 5A8QA 3VIGA 2YDRA 1OB0A 1NWTA 1KCKA 7TAAA 3SCQA 2FH6A 3FNDA 3MUAA 4N0RA 1UQYA 2E4TA 4AC1X 2X0HA 4HP5A 2RGMA 1VAHA 1KXHA 1O7AA 1E0WA 1JZ2A 3SIMA 4EANA 2E0PA 4AZCA 4FLQA 3CZLA 2CETA 5EFDA 2WVUA 3E1F1 1SR0A 5E70A 2OYMA 4F8XA 5DEZA 4PTMA 4CN6A 2J7EA 2C8NA 5A6MA 3ZOAA 4Z2HA 1N82A 5C8BB 2PWEA 3B9DA 1J0YA 8A3HA 1QHZA 2UY4A 4JCMA 2OYLA 2J79A 2D3LA 1Q4NX 4F79A 2J78A 5CLWA 3WIJA 3F5LA 3VDCA 3BSHA 3VGHA 4D6EA 1V03A 5DFAA 4NRSA 3AZSA 4GZJA 3VUPA 1JDCA 2WMHA 1UR4A 4UNIA 1UWIA 2VCAA 5BWFA 3BAKA 2VX6A 3ZM8A 2IXVA 1KWGA 4HMCA 4MPKA 4OOUA 4CGTA 3M6DA 2X0YA 1XYFA 2QPUA 3AIWA 3CBWA 4QP0A 1EXPA 3NCOA 5D9NA 3SCRA 1B2YA 1HF6A 1V6XA 5HXMA 2CIPA 5IFTA 4W88A 4FF5A 1HKJA 2FHFA 4BQ5A 3TTOA 4WIWA 4UQBA 3N12A 5A6SA 3WKZA 2X8RA 2DGAA 2ZX6A 1GOIA 3WQVA 2G3NA 3EDFA 3WQWA 1CXIA 2J7FA 4MAZA 1C93A 2D1ZA 1LF1A 3PZGA 1E40A 4PTXA 1QHOA 1E0XA 3RCNA 2DT0A 4LYQA 1QI0A 1PX8A 3NIYA 1DEDA 2WCSA 3BAWA 5A8PA 3SCOA 3CZGA 4B16A 3N13A 3WBEA 2XSBA 4A4AA 1B3ZA 3EDKA 4PMOA 4AW7A 5ABHA 2WKGA 4CU8A 1J18A 1Q6CA 1H3GA 2ZX8A 2UY3A 4GI8A 5A6AA 5HOSA 4H8VA 3VIJA 2O9RA 5A2CA 2PF0A 1KXTA 1O6IA 3AIQA 3MANA 3NSXA 3W4RA 3VGFA 5FOOA 1RPKA 5HBFA 1KXQA 1QW9A 4W85A 5A8OA 1WP6A 4PCSA 1UH2A 1B31A 1H41A 3ZQ9A 4H7VA 1G01A 1QOXA 1UA3A 4HZ6A 1JL8A 3TA9A 3U5UA 2ZUNA 3ZSSA 4D6CA 4NI3A 1XC6A 1ZBWA 3SCPA 1VB9A 4WSJA 1WZMA 4OIFA 3AHTA 1BFNA 4JCLA 3ZO9A 4V27A 3N1AA 4QLJA 3TONA 1JZ4A 1M7XA 1R8LA 4GIAA 2F61A 4W89A 3OG2A 3W37A 2GUYA 2BNJA 4XZBA 3BAYA 1VFMA 4ACYA 3NSMA 5AC4A 1J11A 2BHZA 4AIOA 4GINA 1JI2A 4YN5A 1ZJAA 1NARA 4M56A 3EBVA 5FD0A 3GTNA 2CBJA 3VDHA 4D6HA 3GNOA 3LMYA 1K9FA 1VIWA 2W66A 3BH4A 1EDGA 1KCLA 4HTYA 1F4HA 1E6QM 2EPMX 3WF4A 2ZE0A 3SCUA 2PB1A 4QLKA 3OIHA 2ZX5A 2XFRA 3LPOA 1C7TA 3PZTA 2ZUMA 5KEZA 3FXYA 4ZE5A 1JDDA 1XSIA 1TA3B 1KGUA 1JIBA 2YL8A 5ABGA 1GQLA 1OT2A 4CD4A 4PUEA 4ATDA 2GJRA 4RE4A 4KRTA 4C7DA 1VEPA 3KL5A 1V6UA 1B90A 1ECEA 1MW1A 2WZIA 1Q6GA 1J0ZA 1ZS2A 1OIFA 1UG6A 2WB5A 1CNVA 1E73M 4PCTA 3W26A 1EH9A 3A47A 1W1PA 3I3EA 2BY2A 3PHAA 2VR5A 5I0DA 5E09A 3M07A 4IUGA 1QNQA 4CD5A 2WCAA 2NT0A 3CZJA 3RO8A 3ARTA 4M81A 4W8AA 3LPFA 3U57A 2J75A 3WNKA 1UUQA 3SCNA 1CZ1A 2WPGA 2CHNA 4RE3A 3HN3A 3BAIA 1UQZA 4D6GA 3RJXA 3APGA 4U31A 5GNZA 3VPLA 1AQ0A 4WJXA 4H41A 1E6SM 1UZ1A 3L4YA 4OZOA 2WBKA 4FLSA 2CPUA 2OSYA 4UFIA 3ZT5A 1B0IA 2YA1A 1VFUA 1E6NA 3VM7A 2VT0A 2X1IA 3NDYA 1MYRA 3UG4A 1V02E 1C90A 3WDJA 5A6JA 3PBGA 2BY3A 3VD7A 1EA9C 4C7GA 2DIJA 2ZXQA 1B9ZA 1J10A 2XVLA 3OLEA 1K6AA 1SYTA 1MQQA 4JL1A 2RGLA 3WDQA 1E1FA 5CQ1A 1E4LA 1J0HA 2VCCA 2DIEA 3VOCA 2AOSA 4QDMA 4OUEA 4JHOA 1H49A 1UZ4A 5A8MA 3BLKA 3DYMA 3VIFA 5FL0A 4AIEA 3B9AA 1TUXA 3PZMA 1WDSA 5AYBA 2D2OA 2QHAA 4ZENA 2QF8A 3K46A 3D5HA 1A47A 1HVXA 1FHLA 4FLRA 3VILA 4AZBA 4MJ2A 2UWFA 1LG2A 2DQXA 1KBBA 4BQ2A 3PZQA 2J7GA 1M01A 4NF7A 1V6YA 1B3VA 5CPTA 3W81A 2CBVA 2JF6A 1PX3A 3WUFA 3ZJKA 2A3CA 1MWOA 4AEEA 4MTVA 1ISWA 3WBAA 1EOMA 3UCQA 4OOZA 5JUVA 2TAAA 1CGYA 1GNXA 2D0FA 1PAMA 2J74A 2VX5A 4HPHA 1MXDA 2WW5A 4HOWA 5BXTA 4PYSA 4HA3A 2YBUA 1V0LA 4TVCA 4UFKA 1QNPA 3KWXA 4JFTA 2VNCA 4P7OA 2Y8VA 4AZCB 3WFZA 1W9BM 2OWXA 1MW0A 1NWSA 1R86A 4L4PA 4UFMA 2UY2A 2Z1KA 3WN6A 2V5DA 2VMFA 3K1DA 1U2YA 3WMSA 1LG1A 4HMEA 5E6YA 4B15A 1ISZA 1KGWA 1NP2A 2PWHA 1G1YA 1BF2A 1RP8A 4MB4A 1B3YA 1B30A 3EDDA 4PSPA 1W1TA 1D7FA 4W7VA 3VKKA 1BYAA 3MMDA 3N17A 1OBAA 1K9DA 2O9TA 3MUZ1 3AS0A 1HJUA 2D22A 4BCEA 4W93A 2G8ZA 1MFUA 2BY1A 4ZE4A 3LPGA 4W84A 3VINA 1UKSA 1U33A 1NOUA 3PZOA 4U33A 4UQ9A 4LX4A 2J77A 3GYCA 1CGXA 1H5VA 5HNNA 2WCGA 1C92A 1D3CA 4GZEA 1DWAM 2BVTA 2E9BA 2D3NA 1JF5A 3WUBA 3RM8A 5EBAA 3ARYA 2WHKA 2VQUA 3GH5A 1WNOA 4UOJA 4U2YA 1Q6FA 3ZT6A 5A6LA 3VMOA 1FFRA 1DWGM 3WD4A 4B9ZA 3CZKA 4AXNA 2W92A 3VM5A 4MADA 4IISA 1V6WA 1CXEA 4P8XA 1UWUA 5KZ6A 2VZOA 1EO5A 3WF2A 1Y7VA 4QCFA 1R7AA 1EHAA 2ZXBA 5IHSA 1XH1A 3QR3A 2WMJA 4MDOA 3RPMA 4C7FA 4P7QA 4UR9A 4M82A 3RM9A 4D71A 1HJQA 1US2A 3AOFA 4J3SA 4P7RA 1QNRA 1PZ3A 1QI3A 4EKJA 1QI5A 4PMUA 3VIMA 3AHVA 1HJXA 2E40A 1UWRA 1EDQA 1OINA 3PTQA 1QI2A 3MV11 1CGVA 2VCBA 4TTUA 4AYSA 1W9UA 3WQ4A 2C7FA 1V3JA 4PEEA 2YDSA 4P8UA 4D6DA 3GZAA 1QVBA 2XYLA 1HP5A 3PZNA 4MB5A 1EDTA 1FP9A 4PSRA 4HPGA 5GNXA 1H09A 4PTWA 4MJ4A 4WSKA 1GQJA 3CUJA 1XH2A 4CU7A 1E9LA 3RMEA 4WKHA 4HU0A 3WFLA 3WH5A 2VZTA 3A3HA 5CSYA 4W8LA 1M03A 2WYSA 1GOKA 5EB8A 3L4WA 3S2CA 1VBUA 1CENA 1LQ0A 2GJPA 3ZR5A 3VDAA 2WLYA 2A3BA 3UR8A 3WD3A 1UWQA 4CKQA 3GXIA 2WHMA 3QOKA 2WMIB 4ZXLA 1D2KA 3VX1A 3VDBA 3RILA 1WCGA 4J27A 3PZVA 3WD1A 2FHCA 3SEPA 3CIVA 3IAPA 2VRKA 3L2LA 3WNNA 3KZSA 3MUIA 2EPOA 3VX0A 2EPKX 2PWDA 3VIIA 5A1AA 3T2OA 3AICA 1E71M 2CKSA 2XM1A 3FHQA 3AROA 1JZ6A 3IAQA 4PRWA 1C3FA 1MXGA 2V5CA 4ZFMA 4F9JA 3ARPA 3KL3A 1JF6A 5TD4A 4D1JA 2A3EA 4WLCA 4OBRA 2NSXA 2CXGA 1E3ZA 2ZICA 3GDBA 4Z2LA 4YPJA 3M7SA 2V3DA 4URIA 3PZUA 1LWJA 1JXKA 2G3MA 5F7UA 1ISXA 3A6OA 3NYDA 4UZSA 4YHGA 2W91A 2VTFA 2BXYA 4KRUA 1UKTA 3N9KA 2YA0A 3UETA 3AMGA 1W2PA 3WENA 2C0HA 7A3HA 6A3HA 3ALFA 3POCA 1HNYA 4FMVA 3FW6A 4PMYA 4PTVA 1V02A 2EXOA 3ARQA 3WDHA 3MV01 2ZUUA 1DWFM 3WNMA 4TX6A 1E56A 4AEFA 4TVUA 2VZSA 2DDXA 3AHXA 1WPCA 1UHVA 4J3TA 2W62A 3W27A 1DP0A 1C8QA 2YBTA 1BVZA 3GBDA 2XHYA 3EMQA 4EK7A 4E8DA 2O9OA 3ZR6A 2AAAA 1M04A 2X2YA 2YOCA 2D23A 3OZOA 2CHOA 2V3EA 1TCMA 4CVWA 1W2VA 2WBGA 1MW3A 3I3DA 1U30A 4KGJA 3AMCA 4M29A 1L8NA 2ZXDA 2DSVA 2QV4A 5FIPA 1CWYA 1HT6A 2Q8XA 3BSGA 3N11A 5DF0A 1EHNA 3VU2A 5A3HA 3WQ6A 4U2ZA 1DWIM 1VENA 4JKMA 2CEQA 2CITA 1NWRA 2BVDA 1C8YA 5ABFB 2PI6A 1HXJA 3AMDA 3EDJA 2DSKA 1UWTA 1FFQA 1W9PA 1EQCA 1QI4A 2IXUA 2MANA 1MQPA 5CGTA 2JFEX 1XSJA 3W6LA 1US3A 5A69A 2CKRA 3BAXA 4CU6A 3U7BA 3WNPA 1KFWA 9CGTA 3CTTA 3CHFA 5D9MA 2X09A 3BCDA 4QLLA 1B3XA 2E9LA 4UOQA 4GZIA 4B9YA 2YLAA 3MSDA 1VRXA 5FL1A 3AZRA 3UEQA 1UD4A 1BHGA 4GXPA 1J12A 2NW0A 5I23A 1JYVA 5IXEA 1EQPA 2V3FA 2DSWA 5A6KA 1HVQA 1Z32X 1I1XA 1IZJA 4FK9A 1HKKA 4IPLA 4MDPA 1GHRA 3RJYA 3VMNA 2VO5A 5D8WA 3FY1A 1TFVA 1X6LA 1E1EA 2OLHA 5D8ZA 2ZWYA 1BGGA 5GNYA 5LYRA 4N42A 1EOKA 4WKAA 1B3WA 1XD0A 3ZJ7A 2HVMA 4Y7EA 5AY7A 1VFOA 3WMBA 3LPPA 1JAKA 3O2LA 1LLOA 1V0KA 4UQAA 3VIHA 2J8FA 2WC7A 2DT1A 2D0HA 3T0AA 2ZUWA 3HU7A 3S6TA 1GVIA 1E4MM 1CXHA 5JH8A 5A6BA 2F2HA 2YA2A 1FP8A 3AXXA 1JZ5A 1EO7A 2Z1SA 1OT1A 1J01A 1UD6A 3DHPA 3VO0A 3UESA 4S3KA 1GQIA 2O9PA 3AIRA 3W38A 3T08A 4PMDA 1AVAA 1V0MA 3NDZA 2PWGA 1UH3A 4AD1A 1ZU8A 5ABEA 4BS0A 2ZOXA 3W53A 3AQUA 3CHEA 2CBIA 1QBAA 1VEMA 1ZJBA 2GJXA 2VX4A 5CG0A 2JALA 3QHOA 2XIBA 1GORA 3SUWA 3WQ8A 2WSKA 3O9NA 3CMGA 3BC9A 5LA0A 1JFHA 1IZKA 3WF3A 1K9EA 1OGGA 2FHBA 1JXJA 2WANA 5IFPA 2ZWZA 3K4AA 2VRJA 4IM4A 3IJ9A 5BXSA 1PX4A 1E6RA 1W9XA 1JZ3A 3WEOA 2BFGA 1H2JA 2J7BA 4JKLA 1CXKA 1QNOA 2XVPA 3PTKA 4CD6A 4F9DA 1VJZA 2XVKA 1W3HA 1UR0A 3UG5A 3B8SA 1V3IA 5BXRA 1KWKA 3WNOA 3L2MA 2HISA 1JD9A 2JF7A 1QNSA 2QPSA 1J0IA 3K8MA 4U5KA 3RIKA 3W25A 1ESWA 3AISA 5CXPA 2YL9A 1XCXA 1E6XM 1XV8A 4F66A 1G94A 1KQZA 4CN4A 1YQ2A 1J9YA 3GXMA 4CCCA 2F8QA 3CH9A 1FH8A 3K4DA 1E3XA 3CGTA 4HU8A 1XH0A 1LWHA 5I5RA 1BPLB 3OLDA 4UQCA 4TUFA 2WVSA 2GJXB 2XIIA 1BLIA 3OZPA 3WMCA 3W24A 5I6SA 1A3HA 2GDVA 1ZL1A 4GKLA 3CLWA 1WKYA 1W1YA 2OWCA 4HA4A 3A4XA 2XGBA 4KGLA 3G6LA 2Y5EA 3BGAA 3VVGA 3KEHA 2EBNA 4M8UA 4PMQA 3TTSA 1JNDA 1NH6A 2VUYA 1JG9A 3WDPP 4PN2A 4J28A 4PUDA 1KR0A 1ODUA 4HZ8A 2J7CA 4J7RA 2VL4A 2WNWA 3N04A 4X9YA 1WZLA 2EJ1A 5I79A 4HOZA 1V3HA 4CVUA 5JIPA 1JD7A 4OJYA 1CECA 3W82A 1WAWA 3ZIZA 2VZUA 1UH4A 2ZXAA 5A2AA 3PN8A 4UFHA 1GOOA 1Q6EA 3OGSA 1TZ7A 1HP4A 3WEZA 3OBAA 3L4TA 2G41A 2WWDA 3G6MA 2WHJA 1DWJM 3N15A 1ITCA 5GQBA 1PBGA 2FGZA 1E55A 2PBOA 3GXFA 2DT2A 3WNLA 3A4AA 1WDQA 4MB3A 2VC9A 1WZKA 3MUY1 1HKMA 4AISA 4A3HA 3GH7A 2XTKA 1W9DM 3WH8A 2DPEA 1I1WA 1W91A 1JYNA 3EMZA 2NT1A 4X0NA 1ZBCA 3AIBA 4AZ5A 4W5ZA 2WXDM 4JFVA 1DTUA 3WDIA 2JEPA 2WMGA 3ARRA 1R85A 4MNLA 5I3DA 1E72M 3IK2A 3TOPA 4K68A 4UFLA 3ZJ8A 2E3ZA 2EEXA 3MMUA 2XFYA 1TA3A 4H8HA 4BA0A 4AD2A 3SUUA 1I75A 3J7HA 2VR4A 2BHYA 4IPNB 2D0GA 2WVVB 1UYQA 1E70M 2V38A 4ACZA 1GOQA 4PMXA 3L4XA 1MFVA 4H8UA 3F5KA 2V3GA 3FAXA 3WF1A 4AZHA 1AQHA 1E4IA 4A3YA 4LPCA 3AXIA 1WB0A 4MNJA 3HJEA 3WUGA 6TAAA 3GH4A 4P7NA 4ACZB 2E8ZA 3WQ5A 4JIEA 1ISYA 1JGIA 1BG9A 3WY1A 1L0PA 5ECUA 1MVYA 4JKKA 1GZJA 3MO4A 2JE8A 3MS8A 2E8YA 4AD4A 1IV8A 1WDPA 2EQDA 1KGXA 3D3AA 3AXHA 3OGVA 1UD5A 3SCTA 2WC3A 5E0FA 4P8VA 4Z2GA 4KMQA 5AC5A 2YIHA 3VIOA 1DWHM 1M53A 1W3LA 3AIVA 2DH3A 5HPOA 1VJSA 3AS2A 4HA1A 1GPFA 1V3LA 2WVTA 5GPRA 4W5UA 4B3LA 4U3AA 4P8WA 4DWSD 4D6FA 1LJYA 2VURA 1E5JA 4GO8A 4XUYA 3VNYA 2DSUA 3CZ8A 2OSXA 3VD5A 1WDRA 2WVVA 1TE1A 5E9AA 1BGAA 2OWWA 1PJ9A 1OD0A 1JZ7A 3U7VA 2QMJA 2CYGA 1VBRA 4H04A 4GPNA 1XD1A 2EPNA 2B31A 2Y8KA 3K8LA 2YL6A 3FN9A 2CERA 1HL8A 1HJSA 3BCFA 4AIUA 1ZBVA 4U3CA 2ESCA 2OSWA 1EIBA 5M5DA 3WH6A 2ZIDA 1E15A 4TX8A 5JBFA 3VD9A 3AYSA 3NUKA 1JYWA 1GUVA 2J8GA 2XFFA 1X1NA 3ALGA 2BHUA 1W3JA 4J3UA 2Y4SA 2J4GA 4TTGA 3SUVA 1UD2A 5DO8A 4HMDA 1GVYA 2WLZA 3AHYA 4PMZA 5BYWA 1WZAA 3CHCA 3TTQA 4X0VA 2BS9A 3JUGA 1G5AA 1GONA 3ARZA 1W32A 5D4YA 3GNRA 2CNCA 3ARXA 6CGTA 4CCEA 3O6AA 4AMCA 3AYRA 1HJWA 3GM8A 4GQRA 2WMFA 5CSUA 1XSKA 4DM1A 2J7DA 2GSJA 4JFSA 2WHLA 2BXZA 3QOMA 4OBSA 1JAEA 2YJQA 3U5YA 2CBUA 2XM2A 4UFJA 3FHAA 3VGGA 1XGZA 1CGTA 5C71A 4EAMA 2Y24A 4MNKA 4QFUA 4UZUA 4LYPA 1H11A 3WD2A 2JIWA 3SCWA 1W9VA 1LL6A 3ZSTA 1H1NA 4CD8A 2XVGA 1CGUA 1KB3A 4W8BA 2BVYA 2XPKA 3UERA 5E0CA 1GJUA 4R27A 1R7OA 2ZX7A 3WELA 3M46A 1FH9A 2ZX9A 2WK2A 4M80A 4TXEA 2YLLA 4GI6A 1UD3A 5A8NA 3N18A 1W1VA 2PBGA 2VQTA 4H2CA 1PIGA 1E0VA 3PTMA 5DT5A 4AD5A 2PC8A 1HL9A 5BRPA 1UR9A 1G9HA 1JNEA 3ARSA 2OYKA 1UKQA 1HX0A 3T2QA 4CN1A 5DMYA 3VD4A 2ZUSA 1E6ZA 1FH7A 4J3WA 1HKIA 3QHMA 3A4WA 2BV9A 2VI0A 1NOFA 1XYZA 1QBBA 1DHKA 5M03A 1BYDA 1OWQA 4W87A 3ARUA 1CIUA 1V0NA 4DWSC 1Q6DA 2DSZA 4D1IA 4GI9A 3WDRA 1JI1A 5A94A 2UY5A 1R87A 4PMRA 4CUCA 1UR8A 3CUFA 1BSIA 3MSGA 5JBEA 1LL4A 4DUXA 2CESA 3GBEA 1C7SA 1TVPA 5CLTA 1HN1A 2XWDA 7CGTA 3WD0A 3TP4A 1BQCA 2W63A 2XJ7A 2DH2A 5A2BA 2J47A 5IHRA 3DECA 2VZVA 4UQEA 4Q7NA 1FA2A 4OKDA 5I2UA 1CGWA 1ZB5A 4GO9A 5AYIA 5CZKA 3MU7A 3L4ZA 2O92A 3THDA 1KR1A 3PZ9A 1RD6A 1GJWA 1H0IA 3W6MA 3VGDA 1CLVA 2EPLX 3K8KA 5I77A 1OGSA 4S3JA 1HJVA 1TMQA 3AIUA 4JAWA 3WH7A 3SURA 1GOWA 4DWSB 1V08A 1X6NA 2VVSA 5JIWA 2BY0A 3AFBA 4NZCA 1QHPA 5D9OA 2ZUVA 3II1A 1OSEA 3AJ7A 1V3KA 1CLXA 2ZUTA 4TOQA 4J3VA 3SUSA 2VX7A 4UQDA 1E5NA 1BTCA 3DYOA 4MB1A 3THCA 4HZ7A 4E8CA 3OLGA 4CD7A 4LYRA 1QPKA 3SCVA 1BAGA 1GQKA 4L4OA 1S46A 3W28A 3ZMRA 1ZBKA 2AMGA 2WZHA 5CPSA 3CPUA 1G0CA 2W4XA 3OLIA 2WMKA 4BQ4A 1UKPA 3T0DA 1MQRA 2WMIA 4QCEA 2FH8A 2XSAA 3IANA 4AZGA 4UOZA 1F4AA 3TTYA 1UR2A 4W7UA 5C70A 1NM9A 4AZ6A 1CXLA 4ATLA 3VGBA 2XVNA 3T0BA 5FCZA 4Q22A 1WE5A 1GW1A 3PZIA 4JZ5A 5ABFA 1E4NA 5LA1A 1RP9A 1XCWA 3VNZA 3DYPA 3BLPX 4B3KA 4XZWA 4BF7A 1NWUA 1FHDA 1KQYA 5I78A 3KE0A 3IJ7A 1E6PA 3EYPA 4LQ1A 4JFWA 3AIEA 5HPCA 1SMDA 2JIEA 3BMWA 3VD3A 1OGBA 2DT3A 1UOKA 5I24A 5CPQA 4ML4A 4QAWA 2VRQA 4GQQA 4NRRA 2IUZA 2W67A 2GK1A 1B1YA 4Z2KA 3CZEA 4EE9A 3B9EA 1P6WA 3L4VA 1BYBA 1KBKA 1J0JA 1PIFA 4W86A 1VEOA 1LL7A 2QMKA 8CGTA 4V2XA 1TR1A 1UWSA 5D9PA 3CUIA 5LA2A 1H0GA 1CTNA 4ATWA 3IJ8A 1CYGA 1VF8A 2GK1B 2FGLA 3AS1A 3AZTA 4M1RA 4KWUA 4D72A 4R5EA 4JHZA 5HDRA 3WUEA 3CHDA 3WL1A 2W5FA 1C8XA 1OM0A 5M17A 5A6BD 3AHZA 1C91A 1EGZA 2VJXA 3AMLA 4WF7A 1YHTA 1AQMA 4AZIA 3WL0A 1OIMA 3UR7A 2D24A 5EMYA 4XV0A 1CXFA 4FLOA 2W61A 5M3WA 3QHNA 3KL0A 4WK9A 4BZYA 2YKKA 1JZ8A 3GNPA 3ZJ6A 4D6JA 1NP0A 3EMCA 3FAWA 1UR1A 2G4FA 4P7LA 2J7HA 1CDGA 2FDMA 2WAGA 3ARWA 4WKFA 4U5IA 2A3HA 3DHUA 5BCAA 3MMWA 3ECQA 2WSPA 3QGVA 3HMCA 1E43A 4DWSA 2J62A 5E6ZA 1UKOA 2GVYA 4PMVA 1CBGA 3VIPA 4Z2JA 3OGRA 2VOTA 3SUTA 1OD8A 3UG3A 3CUHA 1H4PA 5BROA 2WZEA 1FOBA 2WKLA 1ISVA 3CMJA 3I3BA 4E2OA 3WEMA 2GFTA 4AD0A 2DEPA 3AMKA 3WSUA 4JL2A 4PMNA 1K9TA 1OCQA 4DUVA 4V28A 3BXWA 1CEOA 3POHA 1ODZA 4XB3A 1NOWA 3CO4A 5IDIA 3SCSA 4MAVA 1GCYA 4MNMA 4BQ3A 3VIKA 4AZ7A 1V6VA 5CJ5A
chains in the Genus database with same CATH superfamily
2TSYA 4ZEPA 4NYYA 2E9MA 2ODOA 4W7WA 5BRQA 4ODOA 2WSYA 4NSBA 4FS9A 4W4QA 2R82A 1HIZA 3W0KA 3UJEA 2DZXA 3LNMA 4LAVA 4PH6A 4XTDA 4A6GA 2EO7A 3P80A 3UVIA 4DZ3A 5A95A 1TQJA 2J8TA 3FLUA 3VOFA 5CGMA 3LBOA 4LXFA 4AFYA 3O63A 1Q6RA 3NJ3A 5A6TC 3BAJA 1JYXA 2F6UA 3CUGA 3TXZA 3B3DA 2ADAA 4LUSB 4KERA 3S2NA 4WDTA 2Y5SA 3A64A 3BV4A 3UGVA 3LXCA 2XG9A 3OOQA 1TJ0A 3E2RA 3VMPA 4NJKA 3MQTA 3RDKA 2AQVA 2TPSA 3GTFA 5C2XA 1Q85A 1ITXA 2PDGA 1QW8A 4ODQA 4D6IA 1CPUA 3VGEA 1BG4A 3ARVA 3BG3A 1W3KA 2CZEA 4PTDA 4OECA 3O5LA 5EFFA 3L4UA 4Z0SA 1SMAA 2Y2WA 1OHLA 2DJXA 2Y61A 1MO0A 3N9RA 3QKEA 2QJHA 3LXBA 4BWLA 3N2BA 2NZLA 4LUTB 2PDPA 4IFKB 3ID7A 4JQ3A 3SADA 4A22A 3SSZA 2R1PA 1OX4B 4R9OA 4UNLA 1RH9A 1X7FA 3AS3A 5G5IA 4ZL1A 1OB0A 4EXQA 3KRZA 4H6QA 1NWTA 1KCKA 3HQPA 3QQWA 5AZ0A 4WSHA 4Z1AA 4RZBA 3M5XA 2K8IA 1KFCA 3R5EA 4EANA 3P62A 5T9CE 5I07A 1JGMA 5E70A 1KT0A 2OYMA 4F8XA 4GYFA 5DEZA 2J7EA 3LERA 5DBTA 3ZOAA 5C8BB 3PPGA 1FKDA 3BMBA 3S5SA 5U7SA 2A4AA 3B9DA 1QHZA 4JCMA 1Q4NX 1AK5A 4AHPA 4YWSA 5AOUA 4XBSA 3QQ0A 1ZAIA 2ZDRA 2ZA2A 4K8HA 2EKCA 5HINA 3VFCA 3VUPA 4O1AA 3STCA 1UR4A 1MRQA 5TF0A 3UXKA 1JPKA 3HTWA 3VA8A 1RLCL 4JTUA 1IEWA 1KWGA 4GXWA 4HMCA 4N2YA 4R53A 1DJXA 2X1RA 3DG7A 4CGTA 1XYFA 3GK0A 2QPUA 3WLIA 3R8RA 3GFXA 1Q6UA 3EIPA 4MKSA 1A5NC 1EXPA 3WLOA 3FSUA 3SCRA 2GVLA 3QH2A 1OC6A 1OQFA 1AG1O 3NTPA 5IFTA 4HGXA 4IGNA 4QJ1A 3TTOA 1R38A 3N12A 4LVBA 5A6SA 4K1WA 2RQSA 2MUCA 4ROPA 1GOIA 1DOSA 3WQVA 3GVQA 4ZS6A 1GTHA 3E0WA 4H6RA 1FWAC 3CB8A 2NWSA 1E0XA 3RCNA 4LYQA 4UCGA 1ADOA 1B5TA 1DEDA 1GG1A 4KETA 2QDHA 3SCOA 3ME3A 2FPVA 3OVQA 3EX6A 1N8WA 5FJIA 4M6PA 4DEFA 1Q6CA 2XZ7A 5DQPA 1S3HA 5CZ0A 5A6AA 5HOSA 2B0MA 1LQAA 1Z7AA 2O9RA 1O6IA 3LLXA 1XLLA 4FNQA 1RPKA 2AKMA 4O19A 3MSYA 4W85A 4GRSA 4KKXA 4Y9AA 1SM9A 4QEEA 1SSGA 2PMQA 3QXBA 3UU0A 4HZ6A 4H8NA 1JL8A 3TA9A 4D6CA 2CLKA 3ZWSA 3PS7A 3WLKX 4WSJA 3R58A 1DQWA 3LN3A 3W22A 4QLJA 2YCLB 2V5BA 3GFZA 4GIAA 3M16A 4HHPA 1WA3A 1XIDA 1VFMA 1I2PA 4LVDA 4ACYA 1VYPX 3NSMA 2JKEA 4D2JA 4DRMA 5FD0A 3GTNA 4ZVJA 2FVMA 1UB3A 5F2IA 3GNOA 3LMYA 1K9FA 4LF2A 3KTSA 4HTYA 2EPMX 4C6NA 5HR7A 4JTRA 1HW6A 5AYXA 4Q4OA 3CUXA 3IIVA 3GAYA 4AU0A 1KBJA 1T41A 3KACA 3FGCA 1RJRA 4B5TA 3OU8A 4NAEB 1AL7A 4ZE5A 1QPQA 1XSIA 2E77A 1SJCA 3E0VA 2Y7DA 5ABGA 1RALA 3CAKA 4TV5A 4RE4A 2GUUA 3VCRA 2Y62A 4H7CA 2FFCA 1MW1A 1JEZA 4Y8EA 1J0ZA 2CLOA 2WB5A 3WQCA 1CNVA 1VYSX 1KM2A 3W26A 4IJBA 3IKGA 2A0NA 3BZJA 1W1PA 1AFSA 2PTDA 1S3TC 1P5BA 4REQA 3M07A 4YWIA 1NAL1 1QNQA 4CD5A 2NT0A 4RZ5A 5FJJA 3RO8A 2CZVA 3K13A 1CZ1A 4I8DA 2E67A 2NVCA 4QQUA 4HPJA 4Q3MA 5GNZA 1SQ7A 5JH2A 5LXXA 1AQ0A 2BB0A 2P1FA 4WJXA 4Y9PA 2CPUA 2FQIA 3RYSA 4UFIA 4ZQNA 2POZA 1XPYA 1B6CA 4KFPA 3LD5A 4J4KA 4JX5A 1WKFA 3NDYA 4X9SA 1DIOA 3UG4A 1V02E 2QULA 5A6JA 3USZA 1EA9C 4C7GA 2XVLA 4HTBA 1E1FA 2MLYA 4KFNA 2J88A 3NA8A 1E4LA 2AOSA 1I2NA 1RLDA 4DXVA 2P50A 4B5WA 1XUUA 3DEQA 2HE8A 3M5YA 1DBTA 3QN3A 2OOGA 3CASA 5G1YA 3KAGA 4UR8A 1WDSA 5AYBA 1K4GA 4Z1DA 3DXIA 3VK5A 3KAHA 4FLRA 1S2WA 3KHDA 3DG6A 1BVWA 3TQVA 3MBDA 3UWEA 4Z08A 3B40A 4A05A 3W81A 2CBVA 4F2BA 2PN0A 3WUFA 3MVTA 4H1ZA 3TN3A 5DCEA 2DZSA 3MHFA 4MTVA 4KCUA 1EOMA 5EA9A 7XIMA 4OOZA 2TAAA 1RAKA 8RUCA 4CNSA 4BFAA 3PUDA 3APTA 3ITOA 2J74A 2Y0FA 1MXDA 4US5D 4PYSA 4WOZA 4TVCA 4JFTA 2QGYA 3E0FA 3BVJA 4NZJA 4K7VA 4OBTA 2Z1KA 3RLUA 4IQEA 2VMFA 3WMSA 4DNHA 2B7QA 1UASA 4Q8OA 1PZ1A 3G24A 4Q8UA 1LG1A 4HMEA 4WOQA 5E6YA 2PWHA 3BOXA 1RP8A 1B3YA 1B30A 3KXQA 1ZJHA 3EDDA 4X2RA 1W1TA 3N17A 2V30A 3CS2A 3IPWA 4ERGA 2D22A 3LRKA 1MFUA 1JR1A 1GG0A 2P3ZA 4ZE4A 2V2DA 4J3ZA 1U33A 5IDZA 4C6MA 1NOUA 3PZOA 4UQ9A 2J77A 3HV8A 5JVLA 3TQ0A 1D3CA 4GZEA 1HGWA 2E9BA 2Z2UA 2GL5A 5D2XA 2D3NA 5EBAA 1BXNA 4ENLA 4DJDC 1Q6FA 1FFRA 4IP7A 2Q8ZA 5G4EA 4GH1A 4ASTA 4AXNA 3VM5A 1HUVA 3WF2A 4IF2A 2DZAA 1R7AA 4PRRA 4MDOA 3RPMA 3B0XA 3OTRA 4UR9A 4RDVA 4FHAA 3T55A 4J3SA 4A3UA 3TYAA 3EWBX 5LIKX 1YKWA 2FZMA 2HROA 4PMUA 4RCXA 5HQLA 4GIVA 3AHVA 3V7PA 2QCFA 2TMDA 1UWRA 1F6PA 4RDYA 3HGSA 3MMTA 4YMZA 1FCUA 4PEEA 1EF2A 3B8VA 2R9RA 5JH1A 1Y0EA 1FWDC 3GZAA 1OFOA 2YZ5A 3NQAA 5D2WA 4MB5A 4PSRA 5HWNA 1RCXB 4HPGA 5GNXA 5U4NA 4MJ4A 4BI7A 4EWJA 1GQJA 4NZ5A 3BZGA 1XH2A 5HUOA 1H7WA 1R2SA 3ODKA 4WKHA 1TKKA 4HU0A 3WFLA 4W8LA 4NASA 4H9YA 4H9UA 4ZB0A 1TV3A 1CENA 4IX2A 2GJPA 2WLYA 4JIHA 2WMIB 3VX1A 5I03A 1EQ3A 4GNJA 2X1SA 4YJ5A 4X3ZA 3TR9A 3PZVA 4WVXA 1EJTC 3L2LA 3OW1A 4O52A 4LBRA 2IS7A 4H9ZA 2ONEA 3EKZA 3MUIA 4BEQA 3LK6A 3S1GA 1E71M 2C3ZA 4QEHA 2XM1A 4C1NA 2XH0A 3IAQA 2O4QA 3T40A 2VEGA 4UTTA 4F9JA 5TD4A 1ITQA 1EB3A 2NSXA 2CXGA 3THAA 3ES7A 3BMXA 3H7RA 3T05A 4XO7A 3P84A 1R3TA 2V3DA 3H24A 2XH7A 1G7VA 3LCGA 1BWKA 1BWVA 5H8UA 1UP3A 3T7VA 2ATSA 5FF3A 2OB3A 4UZSA 4EVZA 3NL2A 4HHHA 1LRTA 2BGNE 3RF9A 1UKTA 3EWYA 3PA7A 3TAKA 4WJEA 4GWEA 4L72B 3AMGA 3W1UA 4XZMX 3I7SA 4IMDA 2PFHA 3WENA 5KZEA 5HA7A 1ONWA 3ALFA 3POCA 3G1RA 5SWUA 3FW6A 2FFIA 4PMYA 4J4OA 2EXOA 3ARQA 1D3GA 1LZOA 4H3DA 4S1FA 3IHZA 2VFEA 1DWFM 5T9BG 3KZ7A 5AC7A 4AEFA 1EJWC 3LLDA 4LAOA 2ZRVA 2VZSA 2DDXA 4IT4A 3TJ4A 5T26A 3WJYA 1DP0A 5HNRA 1C8QA 2PUZA 2HJPA 2PDBA 1M9HA 3GU1A 5CJMA 4DRNA 4E8DA 3UQBA 3PJXA 2X2YA 3UZXA 1NTHA 3LNPA 4ODPA 1EC9A 1QPFA 2CHOA 5I3GA 3PRAA 5HQMA 3BDKA 1FKBA 1IWBA 2V82A 2BX7A 4M29A 1L8NA 4L80A 1PIIA 1DXFA 4FNTA 2PPNA 3P8IA 4O16A 1XLDA 3N11A 4IG2B 4LH8A 3VU2A 5DRIA 5A3HA 1QK2A 3WQ6A 3IJIA 5FEWA 3BQ5A 4JTHA 4L65A 3YPIA 4JKMA 1YXDA 2CITA 1MI3A 4OU1A 1C8YA 1GJPA 1HXJA 1EEXA 1KM0A 2PCEA 3O5JA 2PRHA 1FFQA 2DUZA 2ABAA 1I9CB 1QPNA 2IXUA 1NIUA 2E6YA 2JFEX 1XSJA 4DUOA 5A69A 2CKRA 3F7JA 4JNYA 3IK4A 5KTLA 3WNPA 2BG5A 1SW7A 9CGTA 3CTTA 3CHFA 1TV5A 5D9MA 2X09A 3H22A 3BCDA 1LBLA 3RFWA 1I2QA 2WJFA 2YLAA 2E7FA 4R34A 2E25A 1LLWA 3AZRA 1UD4A 5FEXA 1XG3A 4M1BA 5M2FX 4RV8A 1TWWA 1FXPA 2Q8LA 1PHWA 5A6KA 4DBSA 1K02A 4UMCA 2A1YA 3LI1A 1HKKA 1FWIC 3GDTA 4DXKA 1YNYA 1JRBA 2OLHA 2D73A 1D9EA 2RDXA 4B2DA 4I5XA 3C52A 2HVMA 3LBCA 2FYMA 2OO6A 3LPPA 2PD9A 2CXEA 2Z24A 5A5WA 1NFGA 2WC7A 2D0HA 3IGXA 5HT1A 1G4TA 3S6TA 4G2PA 4WEVX 5JH8A 4GLEA 5J04A 2F2HA 1EJVC 1FP8A 3KTCA 2VGGA 2Z1SA 3TKFA 3DHPA 3VO0A 3UESA 1GQIA 2O9PA 2GVJA 3T08A 5REQA 3H12A 1AVAA 3KUMA 2PEVA 1FDZA 2OLSA 4GJ1A 1E51A 3AQUA 5HKGA 1VEMA 5HTGA 1TELA 2P8CA 5CG0A 2JALA 4I9JA 4OV9A 3O9NA 4BEUA 1OFBA 5LA0A 2WPBA 3H8AA 1OGGA 2FHBA 2WANA 1XIEA 4ONVA 2ZWZA 3K4AA 4IJCA 2V63A 5CC7A 5CG7A 1PX4A 4O14A 1W9XA 3ORWA 3Q37A 4HBEA 3ITLA 3EWDA 3GW0A 1KCXA 1WX0A 1SFJA 2G4JA 3QQ1A 3M0VA 4GBDA 3MC5A 1TTPA 3B8SA 3HJZA 3WNOA 3U2CA 4O11A 3REQB 2HISA 3DBNA 1O1ZA 3ITTA 4MSSA 4GY0A 3U3HA 1ESWA 3AISA 1UCWA 3RR1A 2YL9A 3WJSA 5TNVA 1VBHA 3GPKA 1JPIA 1G94A 4YCPA 1YQ2A 3W7RA 4LB4A 1E3XA 4NX5A 3TW6A 3DC8A 1TVLA 5I5RA 1BPLB 4OVXA 4MYAA 3WMCA 4ZPTR 2Z1BA 3W24A 5I6SA 4LSBA 5C9WA 1QO2A 1ZL1A 3F2CA 1W1YA 5I7GA 2AQOA 4HA4A 4V1YA 4UTWC 3W7LA 8XIMA 3VVGA 2EBNA 4M8UA 3A9IA 3WDPP 4DF2A 4JOMA 4J28A 2QVHA 2IQTA 3AUJA 1VRDA 6XIAA 3FJNA 3AJXA 2VGFA 1PXGA 4WGHA 4HOZA 3GSMA 4GOAA 6XIMA 3CTLA 3BW2A 3IUDA 1AH4A 4OJYA 4S3AA 1UP0A 1WAWA 3THUA 5A2AA 3P67A 3DFYA 4Q7BA 3FK4A 3PBVA 4HN8A 5H1WA 3L4TA 5DXYA 4MHBA 5CEWA 2G41A 3R2GA 4XD6A 3KBVA 2PGRA 4PBFA 1A0CA 4O1FA 3A5VA 3LBMA 2FGZA 3CGMA 2PBOA 3W83A 2Q6ZA 3B06A 5C9XA 3KCEA 1A5KC 1OCNA 2DT2A 1KTCA 4I8YA 1L9WA 3R0KA 3MBFA 4LRTA 1Q5MA 4LBSA 2XP8A 1WZKA 5B7ZA 2C0AA 2FB2A 2H8XA 3H2CA 1RQBA 1R47A 1HKMA 3CQHA 4AISA 2EG8A 3KBSA 3EMZA 3I4KA 4X0NA 1XX1A 2O7QA 3AIBA 1MDRA 2L2SA 3I68A 4JFVA 1TRIA 3SY5A 2X42A 1OVDA 3ARRA 5CPLA 3IK2A 4K68A 3TK7A 3DAQA 2OFJA 2WSRA 1MEWA 2ZA3A 4ALDA 1G4SA 1I75A 3GKAA 3VE9A 2E6DA 2BHYA 2PDYA 3ICJA 3KAOA 2HZGA 3QZEA 2PV2A 3QEZA 3FAPA 2PLKA 4PMXA 1EA0A 1TR9A 3OHMB 1KBIA 1HO1A 1PV8A 3F4CA 4G7EA 4YTSA 4MNJA 1QPLA 3GH4A 3TA6A 4IMFA 4A8RA 2R14A 1X38A 3W72A 1Q1CA 5ECUA 1GZJA 1XKJA 3NXLA 2JE8A 4DRHA 3CL8A 4DF0A 3CT7A 2Z0IA 4E0CA 3OGVA 1KRBC 1OCBA 2NVAA 1WXZA 1IWPA 1GZ1A 4LY8A 5AC5A 3VIOA 3W02A 3AIVA 4YTUA 4AG0A 2AAMA 1K1DA 2ON3A 1VJSA 2VGIA 3I7RA 5GPRA 4DYEA 4AVOA 4B3LA 2LPVA 3U8GA 3P82A 1E5JA 3TFCA 3CZ8A 5LXEA 3O15A 3JZUA 5D2YA 4A21A 1DKWA 1O95A 5I00A 3KOZA 2WJDA 3RGCA 2IPGA 4YVVA 3GNXA 3HPXA 2V68A 4BWLC 1HZYA 1ZAHA 3U7VA 3TV8A 3LRLA 3GXNA 1FKSA 3VXGA 2KE0A 1UJPA 4C91A 4GPNA 3HBLA 2V67A 3F2DA 3SRKA 4XAPA 2Y8KA 4LAKA 4DZIA 2YL6A 3FN9A 4U28A 4QJ5B 2XP5A 1HL8A 4HCHA 3BLOA 1X8FA 3N3TA 1UZHA 1RCQA 4E8GA 1R3SA 4FO4A 1MNSA 1AH0A 2V2HA 3MY9A 3SN4A 3DFOA 5JBFA 1S2TA 2D2HA 3QY7A 1G4PA 2WNQA 1CI1A 1JQXA 3W71A 3RN6A 3IRDA 2XFFA 2GWNA 3ALGA 1VBGA 2BHUA 4YNGA 3RMJA 3ZR4A 4ILSA 4D8ZA 1E9IA 3GXTA 3UY8A 3U0HA 3FOKA 2WJZA 4TTGA 2FJKA 3PM6A 4XAZA 4KS0A 3IIOA 3BCJA 3AHYA 3VNJA 1RQEA 1IHIA 4Q8WA 1PB0A 3DH7A 1EJRC 1UMYA 2DZVA 3TJXA 3TTQA 1DXEA 1NQKA 1T5AA 2ZFAA 4X0VA 3NM3A 4I3GA 1G5AA 1I2RA 1JUKA 3GNRA 3SBFA 4JDYA 6CGTA 5AFDA 4K1GA 1J4IA 1M65A 4GQRA 3L0KA 2WMFA 1XSKA 4ZQCA 4J40A 3W7HA 1O4UA 4JTIA 1PKYA 2A7NA 5H8MA 4JFSA 2BXZA 1JAEA 1R3RA 3TN4A 4EAYA 4UFJA 5D04C 1S2AA 3EB4A 4G1NA 4W9OA 5C71A 2PDNA 4EAMA 4RV3A 3FA4A 1BKFA 4XKMA 4LYPA 3GKFA 1XDJA 4XZIA 1M5WA 4DRKA 1CGUA 3UXAA 3PP7A 4V1XA 4CNNA 4WY0F 3UERA 3M7WA 5E0CA 4R27A 4MY1A 4YL2A 2PP1A 4E5TA 1PVNA 1AZ1A 1WOAA 3UWUA 5D2VA 4GI6A 2I5GA 2VQTA 4H2CA 3NQVA 3LQLA 5DT5A 2PC8A 1HL9A 1UR9A 4PB5A 1JNEA 4DYKA 2ACRA 1UKQA 3T2QA 3UA3A 1Q65A 4WGXA 5EMKA 1YLVA 2BOEX 1PHQA 4RK8A 5M03A 1OWQA 1OF6A 1P6CA 1QATA 2DSZA 1RUSA 3BTNA 3CJPA 1DJHA 3OBKA 3P60A 1ZCNA 1TPC1 1TWSA 3T0CA 4DUXA 2XP7A 3EY6A 3G1FA 3H2EA 1W1ZA 1TVPA 4GKTA 1HN1A 1TPH1 7CGTA 3WD0A 1ZALA 3BK0A 3ZVHB 2IF4A 2W63A 3O0KA 5HMFA 3BE7A 4R0XA 1IEVA 2A85A 1XLMA 4OKDA 4ZODA 1OF8A 4GO9A 5CZKA 1ZTVA 4NXKA 1A5SA 3THDA 1KR1A 2HNEA 3IGHX 4FA3A 4GNKB 3TZNA 1J6PA 2W27A 5D32A 2EPLX 3K8KA 3KM8A 4U86A 3TVAA 1HJVA 1EP3A 5I98A 1OFAA 4ZPWR 3O1NA 1VQTA 3PTDA 4JAWA 1C8VA 1C29A 1V08A 3G0XA 1EBGA 1VC4A 4LF1A 4LU0A 3II1A 2FZ9A 2PV3A 3G5EA 3W6YA 3NPWA 3F1QA 3H70A 4NX0A 2VX7A 5LHEA 3MCOA 1BTCA 4AX6A 4UBPC 3THCA 3BOLA 1VHCA 4E8CA 4AHQA 4B5VA 3G1DA 4LV4A 2FLIA 3UI5A 3SCVA 3OP2A 4Q8QA 3HPAA 3HV9A 1JVNA 5CPSA 1JJKA 3NVTA 3OLIA 2WMKA 2WNZA 1DJYA 1MQRA 3CPGA 1XLJA 4BK9A 4C6JA 4YCOA 3QFEA 1OX4A 2G96A 2D2JA 2OT0A 5F2GA 2VOMA 1XLFA 2IKIA 1WE5A 1GW1A 4NHVA 1FTXA 5LA1A 2BXVA 2ISDA 2QUUA 4XWUA 3IV8A 3A23A 3AU6A 1J5TA 3KAIA 3DYPA 3DI0A 5BZAA 4Q8NA 2PGEA 1KQYA 1PSCA 5I78A 3KE0A 2AL2A 4GC3A 1E6PA 4LNCA 1EC8A 3ITGA 5HPCA 2JIEA 3VD3A 1OGBA 4KWWA 1Q3NA 4XO6A 5CPQA 2KX9A 5LNUA 3H54A 5KSWA 2G5WA 5HJYA 4W9PA 2X7VA 3EXRA 3E02A 4GJIA 1I2OA 1XR2A 2AKZA 1GZGA 3B9OA 3RLGA 3B9EA 4A3RA 3CWOX 2OODA 2H3BA 4IICA 4XD4A 1H7XA 2HBVA 4G6CA 8CGTA 4J35A 1GVSA 3CUIA 2Z2AA 4ATWA 1FXQA 5K7JA 1A50A 2GK1B 3AS1A 4D72A 5B80A 4R5EA 1BXCA 3CHDA 1GVFA 2P5NA 1TSIA 3IIPA 4IHCA 4MF4A 1N2VA 3SW6A 3H6OA 2QUTA 1G69A 1EGZA 2IPJA 4HK7A 2D24A 2Q5AA 1HKVA 4XV0A 1D3HA 4KFOA 4LC6A 1K8ZA 1ROTA 1LP6A 3LHTA 3WJXA 5M3WA 3KL0A 4BZYA 4N4PA 2DG3A 3FAWA 2RAGA 3P6LA 3HG3A 4XZHA 2G4FA 3NZ1A 3HQNA 1BQGA 4GX9A 2J7HA 1XFBA 4H6EA 3R1ZA 2A3HA 3DHUA 4G5DA 1B3OA 3B8DA 3LM7A 2V81A 3N4EA 3E3HA 4NUWA 1E43A 2GJNA 3TROA 3EAUA 3AO0A 1F3TA 3LTPA 4LAWA 3O5EA 4JR5A 3UG3A 1H4PA 3L9CA 4HT3A 1H63A 5LNRA 5D02A 3W00A 4PUWA 1CW2A 4DHGA 1A4LA 1BF6A 1OJXA 2V0TA 3MO7A 4E2OA 3WEMA 4AD0A 4LY4A 1W31A 3AMKA 3GE7A 4YIWA 2PS2A 1AH3A 1DJIA 2BTMA 3KDNA 4H9XA 3W7CA 9XIAA 2RUCA 3N14A 4RLIA 4V28A 4FX6M 5IDIA 3CO4A 3SCSA 4MAVA 1RV8A 4Q6XA 4K39A 4WCJA 1GCYA 3L5LA 3S1UA 2IKHA 4AZ7A 3DESA 1V6VA 5CJ5A 4OT7A 3CWHA 3GXDA 1PZ2A 3IV3A 4N6EA 2QDDA 3NI6A 1UA7A 3CC1A 2IPWA 1Z41A 3PAOA 2RFGA 3T8LA 5FJUA 5XIMA 3F5JA 2F2DA 1O94A 1S2VA 3G1AA 4AAJA 4E2VA 4GQ0A 4C5ZA 2QLYA 4H9TA 3NL6A 3BMVA 3KFTA 4ZXOA 5A8GA 4NG3A 2ATMA 5L9FA 4M24A 2G3JA 4XIAA 3ONCA 2XGIA 1C9DA 3KS6A 2NX1A 1IT0A 1AMYA 1LTDA 2DY3A 5FA5A 4LWWA 1KT1A 2YYUA 4W9TA 1JDAA 1NQ6A 1C9WA 1V3MA 2JEQA 3BJSA 3WG6A 4IQ2A 3L21A 1SFSA 1ZSXA 2A3AA 3EDEA 1T0OA 2OO0A 4KRZA 1WV2A 4WDUA 1PEZA 1KA9F 1XRVA 3WF0A 4ICMA 1L6SA 3OA5A 3B0UX 3V1HA 2PWFA 1TIMA 4N9DA 4MGGA 5I3KA 4H6KA 2NLYA 4CCDA 3LU2A 4PUNA 1FKIA 3GG0A 4NP7A 2JGYA 3O3RA 4DJFA 4DY1A 4C1KA 3WLRA 1J0KA 3KHJA 3DC0A 1GOMA 4EX4A 4M3PA 3VTRA 2VCDA 4L4MA 4AD3A 1TWIA 4G7FA 3CHVA 2XP6A 2FIQA 2VR2A 4RL3A 3O06A 4KCVA 2F21A 4MUZA 1A5OC 4DRPA 3PFMA 3UW6A 3FNDA 3MUAA 3REQA 1FKFA 4N0RA 3OIXA 3NQFA 2ALRA 2RGMA 3GU9A 2I14A 3RO6A 1IXOA 3SIMA 3N6QA 2QW5A 2E0PA 4AZCA 5C55A 4MG4A 2WVUA 2X2GA 1RBLA 4PTMA 4HJWA 4CN6A 3CXOA 2C8NA 2CLHA 3H2OA 5A6MA 2VUNA 1M68A 4BKNA 1N82A 1OZMA 3FIGA 4FX8A 1X1ZA 8A3HA 2UY4A 4JFLA 3CV1A 4F79A 5CLWA 1XWYA 3W1QA 4F0RA 1EJ7L 2ZZ3A 3VDCA 3AYTA 1VIZA 3DFNA 1V03A 5DFAA 3HPZA 3PB2A 4AMAA 5JXQA 3AZSA 3GX9A 4K38A 1YNQA 3O5IA 1VPXA 3GTIA 1WUFA 2IPFA 1FQ0A 1UWIA 2VCAA 1YDVA 1M41A 5BWFA 4NNBA 1SO5A 2CFFA 2IXVA 4MPKA 3OVPA 1QTWA 4GI4A 2OJPA 3IUHA 4ZSUA 1KRCC 3AIWA 4F0KA 3ZXWA 3VNIA 3CBWA 3UZWA 2GVEA 5D9NA 2OQYA 2X7WA 3DDMA 1B2YA 3IUIA 4IH3A 4FF5A 4CEXC 1TTQA 1D7IA 1ZNNA 5FSEC 4WIWA 4UQBA 2R8WA 1TZ9A 2DGAA 4YLWA 1ZP4A 3R43A 3WQWA 4DBUA 4MAZA 5LIXX 1C93A 2D1ZA 2HMCA 4FOKA 4XD5A 1W8SA 4XIMA 4PTXA 1PX8A 2VP8A 4XQ6A 4Z1BA 2ISWA 3EX1A 3CZGA 3QFWA 2C71A 3WBEA 4A4AA 1B3ZA 1M1BA 4ZMGA 4MOZA 1JCHB 5K3VA 2WKGA 3T44A 1J18A 1H3GA 3C3NA 1DE6A 3WQEA 3UJ2A 2ZX8A 4JIRA 4GI8A 1FCBA 5HJXA 2DW6A 3HG2A 3UNDA 4C6EA 4HARA 2VHLA 5A2CA 3AIQA 3MANA 3NSXA 1F9CA 1Z9AA 3W4RA 1ICSA 1AJ2A 2GYIA 4ZB5A 3VGFA 3R94A 3WMLA 2Y63A 4ADTA 4GH3A 1WP6A 3KDOA 3HG5A 3ZQ9A 4H7VA 5DITA 1SJBA 1QOXA 1VS1A 3F4NA 3BL3A 3W7DA 4RPQA 3TOYA 4FN2A 2ZUNA 1XC6A 5IM51 1QDSA 4I7WA 1SFTA 4BY3A 1DJZA 1BFNA 3ZO9A 4MFDA 4O50A 1M7XA 3W2NA 1R8LA 2F61A 2PDCA 1RK6A 2PDXA 1ZRQA 3BAYA 5DO2A 5CAHA 1Q7MA 3BW3A 1J11A 3URNA 2XPAA 1JI2A 4JFMA 4FXJA 4HNLA 1NARA 3NQBA 4GUFA 5FJPA 4FALA 3VDHA 2B81A 3EZ4A 1UJQA 4YYCA 3DENA 3ZFHA 3ITCA 2CLIA 2R1KA 3SCUA 2YPIA 2Z1WA 1TWDA 2ZX5A 4S39A 2XFRA 2FVLA 3LPOA 4GVIA 1LWIA 3BWWA 3KCOA 1JDDA 3HA1A 1D8CA 1KGUA 4FXRA 1JIBA 2NWRA 1OT2A 1ZPTA 3EKLA 2GJRA 3FGCB 4QG6A 3SRHA 3DFTA 3WX7A 4C7DA 3GLCA 4HVXA 1PBKA 1V6UA 1B90A 2KGJA 1ECEA 1F8IA 2WZIA 1OIFA 2VDIA 2C1IA 4QE4A 4PCTA 2FKPA 1EH9A 3HZ3A 4ICNA 3NFUA 1KD0A 5CPMA 3TDFA 5B8IC 1W56A 2VR5A 1UROA 5E09A 4IUOA 2WCAA 1O1HA 2J75A 3WNKA 3RGTA 3A4JA 3P0XA 2RKXA 1XBYA 1GVRA 2JBMA 3HN3A 4U31A 4JTQA 6ALDA 1W3TA 2NXHA 5C6MA 2MPHA 4H41A 2Q01A 1UZ1A 2Z28A 3VDGA 5TAOA 2LJ4A 3LV5A 1B0IA 3KVKA 5DX7A 2WM1A 2Q02A 3BLFA 1KM4A 1R2RA 2ZC1A 3PANA 3VM7A 2VT0A 3M0MA 2X1IA 1XLGA 1IT8A 2ZXQA 1B9ZA 4ADSA 2F6KA 1YTDA 4FX7A 4L1XA 3N4FA 1KM1A 4AH7A 1K6AA 4JL1A 3R13A 1ZAJA 1G7UA 3D3FA 4NT0A 4H2HA 4R7OA 2ZVRA 4KEZA 3VOCA 2VCCA 2DIEA 1A4MA 3R0UA 4L6OA 1H49A 2ZRXA 1KC7A 5CKSA 4O18A 5FL0A 4AIEA 3V18A 1ALDA 1TUXA 2P0IA 3PZMA 4ZQOA 2D2OA 4NJJA 4KEMA 2QHAA 2QF8A 5CGQA 1NMWA 1NMVA 2OEJA 3GIQA 2UWFA 3MB9A 1W0MA 2DQXA 3O5PA 4UTLA 1KBBA 4B91A 1EPVA 2J7GA 4QJ3B 3DU0A 1A0EA 4NF7A 1UBPC 5CZSA 2OKOA 1K70A 3S2JA 1GKPA 1YDOA 2YW4A 2OX4A 4ADUA 4B92A 1JPHA 3MPGA 1ONEA 2QZRA 2P10A 3UCQA 2FAPA 4Y9MA 3WFAA 4M6UA 1TV7A 3DHDA 2WW5A 3RNDA 5BXTA 3RFAA 4UFKA 4PFMA 3BANA 4AZCB 2VYOA 3WFZA 3QR0A 1MW0A 1NWSA 1IXPA 3S9YA 4HNOA 3C4UA 3K1DA 1U2YA 4QITA 3V5OA 4NAFA 1ISZA 2ZQSA 5AC6A 1Y8BA 1PUDA 4OFCA 4PSPA 4W7VA 3PUEA 1R9HA 1H50A 1K03A 3RPTA 1OBAA 1IZCA 2OXNA 1Q7ZA 3AS0A 1JCNA 1HJUA 1QNVA 3TEVA 3M0YA 3TJLA 1T99A 4N19A 4W93A 2WQPA 1FWEC 3NQ7A 3VINA 1UKSA 4ZB2A 1ME8A 4B5NA 4QSFA 2DZTA 2E6FA 4HN4A 2F84A 4GGHA 1H5VA 1V7AA 5DIUA 1H1ZA 4DJFD 1JRCA 3AC0A 3CNYA 2CC0A 1JF5A 3WUBA 3RM8A 5AHFA 2WHKA 4Q32A 5AHIA 3KOXA 1A49A 3CZKA 2W92A 1V6WA 1CXEA 4CLMA 5KZ6A 5H6HA 1JCLA 1EO5A 1VPQA 4RZ4A 1Y7VA 1TTJA 1XH1A 4I9AA 4HYVA 1LLZA 4C7FA 4P7QA 4F0HA 1JULA 3W1XA 4P7RA 1QNRA 4DH0A 5HATA 2RJHA 1PZ3A 3UZJA 1WBJA 1KM3A 1AQFA 2E68A 1XF0A 3E96A 3CLMA 4E4UA 1EDQA 3IVTA 1DIKA 1U5HA 3MV11 1CGVA 3G0UA 2C15A 2VCBA 3IVSA 3WQ4A 4D8LA 1OABA 4P8UA 4D6DA 4WQ6A 4DJED 1QVBA 2XYLA 1HP5A 2BLEA 3PZNA 3HB9A 4X63A 4PTWA 2POTA 3XINA 3FDGA 4WSKA 1LOLA 4B5UA 3CUJA 4E38A 1YDYA 4R3UA 4UMBA 2VZTA 1B54A 5FF4A 2EF9A 1GOKA 4IPIA 3L4WA 3G77A 1VBUA 1LQ0A 4QE5A 3ZR5A 4Z42C 1VP5A 1P6BA 3N2TA 4D8AA 3T81A 5HNTA 4ZXLA 3NGJA 1D2KA 2GLKA 3RILA 3N9SA 4J27A 3MKCA 1QAPA 3G18A 4Q8TA 3IAPA 4UDMA 2OELA 2RURA 3KZSA 4EF8A 1OX5A 5B7YA 4O4VA 3QSTA 2EPOA 3NPXA 5DBUA 2EPKX 1L6GA 1NF7A 3U2OA 3T2OA 1VCGA 1TV2A 4N9BA 3H53A 1FRBA 4XAYA 3EOLA 1YYAA 2AGKA 2YXXA 4PRWA 1C3FA 1EJSC 1Y5XA 1F8MA 3ONBA 1XUZA 5DCDA 1EWDA 3ARPA 2PCQA 3KL3A 1JF6A 4D1JA 2A3EA 4OBRA 2YXGA 2ZICA 2VDGA 3STEA 4Z2LA 3N3MA 1H62A 2D69A 4DIPA 4S3GA 2XZ9A 4F0SA 4MY9A 1Z8AA 1JXKA 3MKVA 5F7UA 4YHGA 2VTFA 2BXYA 3OOBA 4DB7A 3I4EA 5D30A 4KRUA 3N9KA 1TPVA 3UPWA 3UETA 2LKNA 4UTUA 1ZY9A 2OZ0A 3PPCA 1TJPA 3E2QA 3DG3A 2E28A 2HV5A 2PWUA 6A3HA 4F48A 3TW7A 3UCCA 2YYTA 3URQA 2J9YA 3UXLA 1V02A 5K9CA 3UY7A 3RHGA 3W7GA 3EWZA 3NO1A 3W1LA 1RJQA 2ZUUA 3WNMA 4AHOA 3BICA 4TX6A 2PLCA 1E56A 3SIZA 3AHXA 3BGJA 2RUQA 4J3TA 2DZWA 4XVEA 3W27A 3VNKA 4DZHA 2XHYA 1W5QA 3FFSA 3EMQA 5G2IA 4IQJA 3UA4A 3ZR6A 2PC4A 5ECVA 3TMLA 1VLIA 5F2MA 2V3EA 4CVWA 4S23A 3FV9A 3AMCA 4G9PA 3O5MA 4OHQA 3OO2A 1HT6A 5DF0A 1EHNA 4U2ZA 5E5CA 2CEQA 4L6HA 4MWAA 4XVDA 4IXXA 4Q4PA 2INZA 3ZVHA 1THFD 2PAJA 2ZZ1A 1SJDA 1UWTA 3U4FA 1GWJA 1QI4A 3VOGA 3MP4A 3W6LA 1US3A 4PUMA 3U7BA 4UMAA 2GQ8A 3GTHA 4GUGA 5CPOA 4QLLA 4UOQA 4QTGA 3MSDA 1VRXA 1K4HA 4ODLA 1BHGA 2NW0A 1REQA 5IXEA 4E4FA 1WUEA 3O16A 2E5CA 2KO7A 1V8EA 3V0SA 4H01A 3TIMA 4US6A 3ZLGA 3IS4A 1FUYA 1IZJA 1R3QA 1S5MA 4MJZA 2VO5A 5D8WA 1PCWA 1R6WA 1E1EA 1I8JA 4C65A 3VCCA 2QAPA 4XG1A 5D8ZA 3LENA 4IFKA 4HSOA 2O56A 2ZWYA 5GNYA 1A53A 5LYRA 1EOKA 4WKAA 1B3WA 3K1GA 3N73A 1YPFA 3M0JA 2EJAA 1MUCA 3SO7A 3WMBA 4ZO8A 3O2LA 1V0KA 4UQAA 2DT1A 4TW7A 2OLAA 2OZ8A 1LBMA 3PC0A 1E4MM 1CXHA 4RUBA 4I7UA 1NDZA 1RPXA 2YA2A 3AXXA 4M6VA 5HW6A 4HK6A 1PWMA 1FKXA 2ETNA 4JTDA 5G4WA 1M7OA 3NDZA 2PWGA 1UH3A 2RJGA 1DPMA 1U5VA 2A21A 4NAEA 5EMLA 3JR2A 3H21A 4IQDA 1U22A 3W7JA 5CZTA 1H7PA 5FEZA 4YU1A 1S1PA 4IFRA 1SVDA 4HBOA 1GORA 1Q6OA 3V36A 1L6FA 2VGBA 4FPSA 1GYLA 1W3NA 1FD9A 1IZKA 2G3FA 2G95A 1K9EA 1Q6LA 2NSOA 5IFPA 2VRJA 3TSBA 2FZNA 4HBKA 3WEOA 2HK0A 2BFGA 4JKLA 4MKNA 1Z42A 4R7JA 1QNOA 1O66A 4F9DA 1EXBA 2HQAA 4Q8PA 4CQ8A 3EB2A 5BXRA 4DBEA 3L2MA 2I57A 3NNTA 2QPSA 5E1QA 3R12A 3RIKA 3FA5A 4PCNA 1XV8A 3H2MA 1Q63A 4CN4A 4AY8A 2YCJA 3GXMA 1VH7A 2DVTA 2F8QA 3EXSA 3TSMA 3K4DA 2VDHA 3MHUA 5EMUA 2ZE3A 4ZR8A 3OLDA 4XD3A 1YNPA 4H9MA 3A9BA 2GJXB 1BLIA 1YPXA 4PB3A 5M1TA 3WK2A 2GDVA 4EWND 2PLJA 4IPPA 8XIAA 3MDWA 1WBHA 1T96A 3A4XA 2HDJA 4K8GA 4J1OA 3EWWA 3G6LA 3A12A 4AY7A 1TRDA 2VUYA 3PBWA 4FZIA 2QCNA 1FWRA 2IW0A 2J7CA 4J7RA 1V77A 3N04A 3DFHA 1QWGA 1QFEA 3PRBA 2BZNA 1CECA 3URBA 1I0BA 3RUBL 3ZIZA 4C6FA 1UH4A 4IT6A 2ZXAA 1UPMB 4UFHA 1GOOA 3RRAA 4Q4QA 3WEZA 3L0NA 1P0EA 1XW8A 4JIIX 4EXAA 2WHJA 1ITCA 1QOPA 3U2EA 2FZDA 5GQBA 1PBGA 4DN1A 4ZSTA 4HD5A 2PODA 2PGFA 1UR3M 3LI0A 2PE4A 1FWFC 4HZMA 3B8IA 5JMUA 2NT1A 1ZBCA 2VEMA 3T8QA 2JKAA 3CQ0A 1GQNA 3M43A 2JEPA 3FKKA 1R85A 4KQZA 5I3DA 3MMUA 4Y96A 1TA3A 3RU8X 1L6YA 4AD2A 4QIBA 3QMTA 5IRPA 3LV6A 3DBPA 4IPNB 2FTYA 3T4CA 3BOFA 2WVVB 4GUHA 2NQHA 3PBYA 2HVNA 3L4XA 4GX8A 4RDWA 5CSSA 3WF1A 1O5XA 1TPEA 4JYSA 4A3YA 2FPYA 2M08A 5EMJA 2V6AA 3AXIA 1R5YA 4LUSA 1WB0A 2F7FA 6TAAA 5BMWA 5D38A 3GNDA 5HWCA 5HMSA 2QCLA 3Q65A 1ISYA 2FKEA 4FIQA 1JGIA 4PUJA 3MO4A 4KT2A 3G1VA 4I9TA 3QYQA 2E8YA 3DKLA 3D3AA 1XPGA 3GUWA 4Z2GA 2YIHA 1DWHM 3EGJA 2FGBA 3UXIA 1RJPA 1SU5A 1OFEA 2CZFA 4P8WA 4DWSD 1LJYA 2VURA 4AB4A 1Q45A 1L2UA 3VD5A 4C02B 2HRWA 5E9AA 2I16A 4RPPA 2VFFA 1PJ9A 1OD0A 1ZK6A 7REQB 4JD4A 2GSEA 4EIVA 2CYGA 1VBRA 2KFWA 2VELA 4ZCWA 2QIWA 4OGZA 5RUBA 2C16A 3R7MA 4XKYA 1HJSA 1GT8A 4S38A 3NO5A 3GY1A 2OSWA 2C79A 3MUXA 3WH6A 4TX8A 1E15A 4PCFA 4RR4A 3VD9A 2WZTA 3V5CA 3B7XA 3LTSA 2A7RA 1F8AB 4JY9A 3P3BA 4L56A 4J3UA 1EZWA 3K2GA 2DORA 3MDYB 3W74A 1KBLA 3SUVA 1PDZA 1B4EA 1UD2A 1EX1A 2BBFA 1GVYA 1WZAA 2O7SA 3MHGA 3IJQA 3N29A 3NEVA 1J93A 2D9FA 2OQLA 4IGHA 3JUGA 5K4ZA 3ARZA 5D4YA 2CNCA 3R8HA 3ARXA 3AYRA 2FDSA 1UMLA 4QS6A 2HXTA 4B3ZA 2KR7A 2Y8UA 4PODA 4HNUA 2GGHA 3GZ3A 4LAXA 3VYLA 3F4WA 4GZ7A 4C6DA 2P3EA 2WHLA 3S47A 4KBXA 4MIMA 3HM7A 3PG8A 3TC5A 3KOFA 1EYEA 2CBUA 2Z27A 2XM2A 5EKYA 2SFPA 3FHAA 3GB6A 1FDJA 3LS9A 1H11A 4WDWA 3CB3A 3WD2A 3SCWA 1W9VA 4IIEA 4EPEC 3NXFA 1KB3A 2XPKA 3D6NA 4E3TA 3CEPA 4NAFB 2ZX7A 3FXGA 4IFOA 4GISA 4HU4A 1MDLA 2WK2A 4M80A 4QDPA 4TXEA 2HCVA 4PTNA 3C6CA 1UD3A 3NQEA 3V16A 1PIGA 1F61A 4AD5A 3TE9A 1QUMA 3C61A 5BRPA 5AN7A 3BARA 2XH4A 3ARSA 1LQ2A 3VE7A 5DMYA 1FH7A 4J3WA 1DJWA 4JX4A 7TIMA 3A4WA 3S9IA 2VI0A 1XYZA 2WZMA 1DHKA 4EACA 1FCQA 1CIUA 2C13A 3M0HA 1V0NA 4FNRA 4NU7A 4L64A 1JI1A 2BVWA 3PY2A 3B05A 3SFWA 4M51A 4CUCA 1UR8A 1BSIA 5C54A 1B57A 4L61A 3W87A 5J6EA 2XN1A 5D33A 3NL5A 2TODA 2VEFA 3LLFA 3E2SA 5CBIA 3TP4A 3MI3A 2VFHA 1BQCA 4DRQA 4F2UA 2XJ7A 3K4WA 4DI8A 5IHRA 3OPSA 4XZLX 4R7WA 5I2UA 4NZFA 4PULA 5FJRA 3UYCA 1ELSA 1TUFA 4F4RA 3PZ9A 5AB3A 3O05A 1RD6A 1H0IA 3FEMA 2H3DA 3EWXA 4JTAA 3W6MA 4S3DA 1OK6A 1OGSA 5I02A 2PPGA 3O6DA 4ORIA 2IKJA 3H2AA 1R30A 3N6HA 3IJDA 2ZQVA 1QPOA 4XAGA 1A80A 4DWSB 3PR9A 5DCBA 2VVSA 2BY0A 1DJQA 1PYMA 1QHPA 5LZLA 5J8LA 1EPXA 3ABRA 1R0MA 1CLXA 4IIBA 2PSNA 3CT2A 3BPWA 3O5GA 2QEZA 1TIWA 2R94A 4UQDA 3PULA 1O5RA 4ITZA 4HZ7A 2NXGA 2RHGA 3OLGA 4LYRA 1GQKA 2ASHA 2INFA 5FAGA 3KW3A 3VFLA 4JTLA 2AMGA 2ZZ6A 2WZHA 2QKFA 1G0CA 4BQ4A 3GDKA 3HGJA 2FH8A 3R79A 2X30A 4KEUA 1XFCA 3VZZA 3TTYA 2OU4A 3ZLHA 2XIOA 5G1MA 5C70A 1PDYA 1NM9A 1CXLA 3VGBA 2XVNA 5FCZA 3LQGA 3C0LA 5ABFA 2XDFA 3UJFA 3WQOA 4LCRA 1XLEA 3H26A 1XBXA 4IZGA 3DGBA 3V35A 3VNZA 3AIEA 1SMDA 1ONRA 1WKEA 1G6CA 3TMQA 2PU0A 3NQDA 1S2UA 3PSWA 5EMMA 8TIMA 2VRQA 1XYLA 4NI8A 4E6MA 2J13A 5AECA 4Z2KA 3INPA 4Q6JA 4EE9A 4E3VA 5C9UA 1JCTA 1J6OA 3JRKA 1YW5A 1BYBA 2REQB 1J0JA 1LRQA 2OPJA 1PIFA 4W86A 4PZVA 3JU2A 1VEOA 3U48A 4JHMA 2QMKA 4V2XA 3GO2A 1K3UA 3OBEA 1UWSA 3QPZA 3KBWA 4QNEA 1H0GA 4RJEA 5CJNA 1CYGA 3RXZA 4DYJA 7PTDA 2FGLA 3WBWA 2GZXA 1GKQA 2EG6A 2C1HA 3VAVA 1UOZA 4JHZA 5HDRA 2MLZA 3WL1A 1C8XA 4LVGA 4N9EA 3EX3A 3DGRA 3NYZA 3UWZA 4GIRA 1YXYA 3AHZA 4Z1YA 4UB9A 3AMLA 3L12A 3WL0A 5I3FA 4Z0JA 2W61A 1NSJA 4Y8FA 4WK9A 2G0WA 2YKKA 1JZ8A 3ZJ6A 4D6JA 3LHUA 2QCCA 3GVVA 2PP0A 5AVHA 1EEPA 4X60A 4IMAA 5KINA 2BWGA 4P7LA 2HPMA 5I3HA 1K7EA 3IJ6A 4IT1A 3EB3A 5BCAA 3MMWA 4LOCA 3ECQA 3QGVA 1LM1A 4DELA 3C3UA 1PINA 1V51A 2Q3RA 3B8UA 4QZVB 4BF8A 1QT1A 5E6ZA 2OQHA 1R9ZA 5CSRA 1R3WA 4Z2JA 4HSHA 1OD8A 1N8IA 2OT1A 5BROA 1FOBA 3FA3A 1ISVA 4QG9A 2M2AA 1W5OA 3PAJA 3WQDA 4DZ2A 2RDUA 3SSJA 1ZQ5A 2GFTA 2DEPA 4PMNA 1NFPA 2FPTA 2V9DA 4ZTXA 2H9AB 3UNTA 3A5FA 4DPPA 3RG6A 3DN5A 4MY8A 1ODZA 4XB3A 1NOWA 1WQ5A 5HAOA 4MNMA 3LCFA 1U1UA 3T07A 4BQ3A 1W5NA 2W3ZA 3PPHA 2NV1A 2VEIA 1FKWA 3F4VA 2VFIA 3GR8A 1F07A 3MKKA 5LNVA 1W54A 4L3NA 5F1VA 3TC7A 2X05A 2GDUA 1F40A 1JFXA 3CAWA 5HK4A 3OA3A 2J25A 2XUCA 1BVNP 3TWBA 4DM2A 3OB8A 2NUXA 3TNBA 2V8ZA 4NZ3A 1QCWA 4H4IA 1R46A 1SZNA 1OYAA 1BWLA 4JFUA 1FKGA 3W29A 2XN0A 3KLKA 3NURA 2OKTA 4DQWA 2OOFA 2NUYA 3S42A 3NOYA 1AW2A 1LT8A 3AWNA 3H55A 4GY7A 5BXJA 4JEJA 1GHSA 1TTIA 2PDWA 2I56A 1XS2A 4AWEA 3DZ1A 2DVXA 5CC3A 1BL4A 2BSLA 3LCLA 4FXSA 2J66A 2RDTA 2VEPA 1FWNA 1TG7A 4CCZA 1TCOC 4IIFA 3W3OA 2QJMA 1UD8A 5DT7A 3T09A 4A8NA 3LCHA 4HMNA 3V0TA 3ZT7A 1FKRA 1VFFA 1WYIA 2WWCA 1F6YA 3G22A 2XINA 1PTGA 3H4WA 3MJMA 4UCFA 1Z6KA 4EPKA 1UW9A 4F0LA 3M5VA 5DY3A 4M7SA 3R89A 1RXOB 4TVDA 3QR1A 3T42A 4JNMA 4UTMA 2P4VA 3Q67A 4C6PA 2CLMA 3O8AA 4PL2A 5F4XA 3AI0A 3C56A 4J3XA 1FKLA 2C18A 4JIQA 4RW5A 3VIGA 2YDRA 1JNSA 1P1XA 1L2QA 3PWGA 7TAAA 2FH6A 5FF2A 2EGZA 4AC1X 2X0HA 4HP5A 1KXHA 4DO4A 1IR1A 3Q2DA 3STPA 1JZ2A 4V15A 1TV4A 5HJLA 4FLQA 3PK7A 3CEUA 2CETA 5EFDA 3MWCA 4J2MA 4XK2A 2ITKA 4Q8VA 3NM1A 4C5YA 3IIXA 1J0YA 1V4YA 2OYLA 2J79A 2D3LA 2PDLA 3MVIA 4HK5A 3BSHA 3UZ5A 5HW7A 3N6JA 3O5KA 4NJIA 4GZJA 4MZ8A 3L7RA 1JDCA 2WMHA 2RSEA 1XISA 2ZVIA 3GS6A 1HXVA 3E0LA 4LEFA 2QAFA 2VX6A 1Q2SA 3TH6A 4UNKA 2MNRA 2X0YA 1W26A 4HNVA 4XSMA 1A5UA 5E9XA 4QP0A 2H8ZA 5AHLA 5FESA 4PB4A 3G1SA 1V6XA 2CIPA 2P8BA 3L23A 2FHFA 3E9AA 1MNZA 1FHVA 4LJ3A 4EOUA 3TX9A 2A6NA 3KCLA 3WK0A 3OVGA 3WKZA 2X8RA 4P5UA 4IP4A 3EDFA 2J7FA 1XQLA 1IQ8A 1UC4A 1LF1A 3PZGA 2DFAA 4LYKA 3EWCA 4GFSA 4QIUA 5AVNA 1E40A 1A7XA 3W7IA 1QHOA 4GGBA 2DT0A 1QI0A 2WCSA 2XP3A 2F2KA 4IQCA 4PEKA 3EDKA 4XTIA 2XP4A 4PMOA 1YIXA 1EUNA 3TAOA 5ABHA 3EX4A 3N25A 4CQ9A 2KZHA 2UY3A 4H8VA 3VIJA 4AWSA 4NZ1A 3SN1A 3WLPA 4HQVA 3MCNA 1KXTA 5EGRA 2ZC8A 1K8XA 5ABTA 1V5XA 3LHWA 5FOOA 1KV5A 5HBFA 4GXMA 3UJRA 2NV9A 1QW9A 3MZNA 5A8OA 3ELFA 1PE1A 1UH2A 4PCSA 4DBWA 2Y89A 2VFDA 4IL2A 5K4XA 3S5NA 1LUCB 2VWSA 1G01A 3SM0A 3NQ6A 2NQJA 1UA3A 1JCYA 4FSAA 3ZSSA 1Q13A 3IEBA 1T8XA 1ZBWA 2PP3A 5KZDA 1VB9A 1WZMA 5I06A 3KADA 3AHTA 1TV8A 3UVAA 3C86A 3N1AA 1KFKA 3TONA 1JZ4A 2WNNA 4DJDD 4LVFA 4W89A 3OG2A 4M5PA 5BOEA 3W37A 2BNJA 3MW7A 1Q8AA 3ABXA 5HWMA 3TCSA 3LY0A 2GQ9A 2BHZA 3HQ1A 4MJMA 4AIOA 3QTGA 3M4HA 4GINA 1X39A 4YN5A 4ZZ9A 3WQFA 3EBVA 2CBJA 3EOUA 3FJ4A 2W66A 3N4AA 4FNPA 1EUAA 1KCLA 1KO0A 1F4HA 1E6QM 4EF9A 2ZE0A 4DVOA 3VNMA 2PB1A 3OIHA 2AL1A 4NQ1A 1Y5WA 3G0SA 3PBMA 1M5YA 4O12A 3TSDA 1C7TA 4NXSA 3W86A 4RNIA 3EA3A 4ZPVR 1JPMA 5FACA 3RX3A 3JVAA 2Y6ZA 1TA3B 4ZTYA 4CD4A 4PUEA 1AMKA 4ATDA 1ZCCA 4MVAA 5BMXA 2QPXA 3PRDA 4KRTA 1QRQA 3ATZA 2H90A 1VEPA 1JUBA 3OEXA 3KL5A 3RU6A 4QBXA 4IIDA 3NVDA 1UG6A 3M0XA 2ZRYA 3A47A 3WJWA 2H6RA 2BY2A 4L1GA 1Q7QA 2VENA 5I0DA 2A2IA 2GUBA 3CZJA 5CCZA 5HQEA 3ARTA 3M47A 3U57A 3HGOA 1H1YA 3SCNA 3PF3A 3UQNA 3HIJA 3BAIA 1UQZA 1XQKA 1WXJA 1VD6A 5AC8A 4I6VA 3VPLA 2R91A 1E6SM 4KR0B 3UBPC 3NR0A 3QKZA 3L4YA 4OZOA 4HCDA 3HURA 3ZT5A 1XLHA 2GPTA 1VFUA 1E6NA 2Y70A 1MYRA 3GG7A 3CYVA 3KVJA 5D03A 3WDJA 3PBGA 2BY3A 2X40A 3VD7A 3T78A 3PPFA 1FBAA 4M0XA 4C6KA 3OLEA 4IGMA 2RGLA 3C2RA 5C7HA 2FMOA 1GPWA 3TLLA 1OC5A 4QDMA 4OUEA 4JHOA 4BF5A 2DUXA 4TR9A 3OYXA 1SFLA 1XBZA 4DRIA 3BLKA 3DYMA 3VIFA 2WKJA 1FKJA 3O7UA 5JU6A 5G2HA 4O8RA 4GIEA 1VGAA 3D5HA 1A47A 3ZVIA 4MJ2A 4ZO7A 1D7HA 1KKRA 3PZQA 1V6YA 1B3VA 2VXNA 3QMRA 4R9XA 2JF6A 2QUMA 4GBUA 1KCZA 2ANUA 3TN5A 3M0IA 3T4WA 3LX9A 2ZQTA 2JGQA 3WBAA 3VKCA 1JCMP 1CGYA 2D0FA 1PAMA 2ABBA 3GR4A 3KS5A 4HPHA 4HOWA 3VKDA 4HA3A 1QNPA 3KWXA 4GVGA 4ICCX 2VWTA 6ENLA 3OQ8A 1T6MA 2VNCA 2Y8VA 4HYWA 4IXHA 1W9BM 2OWXA 3P61A 5HMEA 1OYBA 1R86A 2UY2A 3TW9A 3WN6A 3LZ5A 1ICQA 4LUYA 4WHBA 4XISA 1KGWA 3QSRA 4Y6GA 1ENUA 2Z7KA 4B4FA 3WJZA 4QAIA 1G1YA 2A3LA 4UR7A 3VKKA 1BYAA 3PJUA 4KESA 4G50A 4J5NA 4NNRA 1FKKA 2O9TA 1RSCA 3MUZ1 2GQAA 2TRSA 4BCEA 2CZ5A 4B4HA 2G8ZA 3QV7A 1RQHA 3EPMA 2AQWA 4S2CA 2NX9A 1FAPA 3KX6A 4LX4A 3HF3A 1P0BA 1TO3A 4JBRA 2BVTA 3WQGA 2EAWA 1CT5A 1WNOA 2R1MA 3WBXA 5GPGA 3E5BA 1VCVA 3R8GA 4L5ZA 3VMOA 1J6YA 4JICA 1EYMA 4KPLA 2ZZ7A 1HKWA 3QW3A 4MADA 2E6AA 4IISA 2ZDSA 1UWUA 3LUTA 2VZOA 3T1GA 1FWTA 1TPUA 3UXDA 5J5RA 3U9IA 1EHAA 2ZXBA 5IHSA 3TUUA 4KWVA 1A5LC 3UGRA 2WMJA 2DZPA 4DRSA 3MJYA 3PJTA 3T0TA 3RM9A 3K5XA 5DY2A 3UCDA 1US2A 3AOFA 3VUSA 3RCMA 3UG8A 3ITVA 1QI5A 3G3DA 4YVXA 1O5KA 1QI2A 3M9YA 4YTRA 4F2TA 3QGKC 1JCXA 3E49A 4TTUA 2QNEA 1X97A 2C7FA 3HFYA 2YDSA 3FSTA 3CU2A 4I90A 1I60A 1OY0A 1EDTA 1FP9A 4CNPA 1HO4A 4L9ZA 5GVJA 4CU7A 1E9LA 3NZPA 3KBMA 3NQCA 2YCIX 3WH5A 2XISA 5CSYA 5HWJA 4W9QA 1M03A 2WYSA 3S2CA 4C6LA 2YFOA 1IEIA 3VDAA 3IJLA 3CGNA 3UR8A 1FHUA 2C1GA 3WD3A 3I65A 1UWQA 5MF5A 4O2TA 3ABSA 3VDBA 3FJLA 4KCTA 1WCGA 3SZ8A 3PG9A 3COTA 4DROA 3BLEA 2VRKA 3B9NA 1EC7A 3E38A 4ZOBA 3SB0A 3VX0A 3KVLA 5A1AA 2CLEA 3FHQA 4OTKA 4Z17A 3H7UA 1MXGA 4F3HA 2GJLA 4ZFMA 2PDQA 4DX3A 4KW2A 1T8QA 4WLCA 2OG9A 1E3ZA 3UT0A 1UUOA 3GDBA 4YPJA 3M7SA 2PV1A 1AA1B 3SR7A 3HQOA 3PZUA 1LWJA 5KITA 1XLKA 4WJ8A 2G3MA 4UTWA 3MYOA 2DIKA 2DG9A 1OFRA 2W91A 1CLKA 1AL8A 4YYFA 3W07A 4QSHA 4NILA 3W01A 3IGUA 1XLBA 3L5MA 7A3HA 2HK1A 1O12A 4XZNX 2ZBTA 1HNYA 1TWZA 1RVKA 3RRXA 6REQA 4LS1A 4GNVA 4PTVA 4CNUA 2YXOA 1SZEA 2BP1A 3SECA 1XXXA 1WPCA