1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
molecule keywords signal processing protein
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
1J0YA 2G3NA 1R85A 1CGTA 3I3EA 3DECA 3OGRA 2C0HA 4TVCA 1P6WA 4W93A 4F9JA 5A8MA 1UH2A 1BVNP 2WVVA 4PTWA 1UWQA 3WDJA 4AZ6A 4OBSA 2VT0A 2J7DA 1KXVA 3CHFA 4TUFA 2YLAA 3WMSA 2GDVA 1PZ3A 1XH2A 3LPGA 5D9OA 4M24A 3OLEA 3FAXA 3DYMA 2PC8A 3GZAA 3D3AA 1KQYA 1UR1A 1LL7A 4WKAA 3AICA 5A69A 4EK7A 8A3HA 1I1XA 3AHXA 2VVSA 4AD5A 1NWTA 2YDQA 3WDHA 4GI9A 5A8PA 3CPUA 4HZ7A 2YL9A 5BCAA 4ZFMA 2BV9A 1KR0A 2YJQA 4PUEA 2XM2A 1H0IA 3VIGA 3VIKA 5IHSA 3W82A 1V0LA 3DYPA 3GH7A 3MUY1 2CETA 2WCSA 1SR0A 4LGXA 2ZUSA 1DWIM 5DFAA 4D6CA 1Q6EA 1CIUA 2WANA 3NDZA 4UCFA 4N0RA 5CZKA 2EBNA 3TOPA 2YA0A 4M56A 3RM9A 2X0YA 4CCCA 1YQ2A 2PBGA 3W25A 2FH8A 1OINA 2WPGA 1G9HA 1IZJA 2Y8VA 4AW7A 1SMAA 3ZJ6A 2Y24A 1TVNA 3ARYA 3ZT5A 3PN8A 2WNWA 1JNEA 2XFFA 1VEOA 3WL1A 2Y2WA 2W62A 5AY7A 1OIMA 1ZJAA 3WQ8A 3N15A 1DWFM 5E09A 4LYQA 3F5JA 4PRWA 1ZL1A 1G1YA 1KWGA 1NOWA 1V08A 3AS2A 4MNLA 3MUZ1 4QCEA 4AD3A 1GORA 2DIJA 3UG3A 1UUQA 1SFSA 3VGBA 1W3JA 1QI0A 3N17A 4OBRA 3CBWA 2VTFA 3AFBA 1AQHA 1VFMA 1V3LA 2W5FA 4D6GA 3WNOA 1K6AA 1NWSA 1KFWA 2PI6A 3AHYA 2QPUA 4AWEA 3CUJA 1HF6A 1HT6A 1CPUA 1VRXA 3F5KA 1WKYA 4XV0A 3ALGA 1H11A 5I2UA 2V3DA 4EANA 1V6WA 2Y5EA 4A4AA 1KBBA 2XVPA 3N13A 3AIQA 5ABFB 2WHKA 4OOUA 1CLVA 2VURA 1GCYA 3ALFA 1WDSA 2ZUUA 1QI4A 3WUEA 2XGBA 1BAGA 1X6LA 1W2PA 2XVNA 1GVIA 5IDIA 2E3ZA 1CGWA 4B3KA 3BGAA 4BQ5A 1K9FA 5JBDA 4RE2A 2BHZA 4R5EA 1CYGA 1Q6DA 1UR0A 3CGTA 1XV8A 1CLXA 4QLJA 4XZWA 3GTNA 3ARXA 1F4AA 1E0VA 4UOQA 1B1YA 2WC7A 2DSKA 2GDUA 2WVTA 4PBGA 3UR7A 5I77A 1UQZA 1KGWA 1UG6A 4CN4A 4P7QA 2VQTA 1GQJA 1CGYA 2ZUVA 4M8UA 1J01A 3AISA 1O7AA 2PBOA 4W5UA 4AZCA 1JI2A 3ECQA 4EKJA 2DQXA 1VFOA 1CECA 1JF5A 3VD5A 3W4RA 1QOXA 4UFJA 2XVLA 4UQDA 5A2AA 1B30A 2QMJA 3VGGA 3NIYA 1FH8A 2OWCA 1FFRA 3L2MA 1UZ4A 2GSJA 4U2ZA 4JZ5A 1JDAA 3L4UA 3G6LA 1QNQA 3N1AA 3FNDA 2OWWA 2VQUA 4YHGA 3W29A 3AS0A 5FL0A 4W84A 2XIIA 2WMGA 4TTGA 2IXUA 5I3DA 2ZE0A 1FA2A 2QMKA 3W28A 3W24A 3WDRA 5LA1A 4CVUA 4NRSA 5E70A 3BAXA 2XSAA 1WDQA 2DIEA 3M46A 2XPKA 1MXGA 4UOJA 4Z2HA 1QBBA 3WDIA 1E56A 2D0HA 4PN2A 2A3EA 3GXIA 1KWKA 4UZSA 2YDRA 4JL2A 2DT3A 4UFLA 2HISA 4MDOA 1DTUA 3RPMA 3ARSA 3FHQA 2DDXA 4Q22A 4QP0A 2WB5A 4AIEA 1BGGA 1CTNA 1EO7A 4M1RA 1VBUA 6TAAA 1UKSA 3AIUA 4PMNA 4EE9A 1JNDA 5JH8A 4TOQA 3CH9A 3G6MA 2ZXQA 1E70M 1K9DA 1XH0A 3WENA 3CO4A 3K4DA 2WVVB 2WMKA 1GHSA 4AIOA 5D8WA 1HVXA 4WJXA 2WCGA 4DUXA 4HMCA 3OZPA 1XSKA 5C70A 2WMIA 3QOMA 3B9EA 1ODUA 5CG0A 3VX1A 1BVZA 2BVDA 2VL4A 3WKZA 1CXLA 5ABHA 3FN9A 1JXJA 1W1TA 3CIVA 1XCXA 2XSBA 4GXPA 3UR8A 3EDEA 3IJ8A 1M7XA 3PBGA 1JDDA 3M07A 3NSXA 1G01A 2EPMX 4HTYA 3B9DA 5A6KA 5IXEA 2D0GA 1QNRA 1CNVA 4ZXOA 2CPUA 4AYSA 1C8YA 4GO8A 1LQ0A 5DEZA 5CGMA 2FHFA 1X1NA 4W88A 3K8LA 1EOKA 3OZOA 4PSRA 2J74A 3AHVA 1O6IA 1ISYA 1D3CA 4W86A 2GUYA 2DH3A 1KCLA 4H7VA 1DWJM 1CWYA 3WF2A 3WQ5A 1CXFA 1WPCA 3RM8A 2YKKA 2GFTA 4DM2A 2WMJA 4XUYA 1OB0A 5JBEA 4UFIA 1E6SM 1UA3A 3WBAA 4AD1A 1QHZA 1E4MM 1E73M 2G4FA 2W63A 1TMQA 2PWDA 5DT5A 1JF6A 3NJ3A 4CD6A 1OD8A 3WQVA 2XHYA 2G8ZA 3W81A 1GQLA 1PEZA 2OYMA 3SCSA 4U2YA 3SUTA 3CZ8A 3VDHA 4HPGA 4D71A 4BZYA 3A4WA 2YL6A 3TTSA 3TP4A 2ESCA 3UESA 1VFFA 2EXOA 3ARTA 4GI6A 2XWEA 4ML4A 4TVUA 2V5CA 1US2A 3PTMA 1ISWA 2NT0A 3SCPA 1DP0A 1KBKA 2CNCA 3T08A 3ZM8A 1PJ9A 1XRVA 1XSJA 3T0DA 7TAAA 1FH7A 1JFXA 3IAPA 4JIEA 1CGVA 1M03A 3CHDA 2VJXA 4TX8A 2UY3A 3OGSA 4W8BA 4D72A 1JZ8A 2EO7A 3IJ9A 5CGTA 3TTOA 2ZX8A 1HKIA 1ITXA 1WE5A 2XUCA 3PZVA 1JZ4A 1EXPA 1V02A 4CCDA 5GNZA 3VVGA 1JZ2A 3FY1A 3W26A 4X0VA 1UZ1A 2AMGA 1GVYA 3AMLA 1EA9C 1QW9A 4JCMA 1KR1A 2XIBA 2CCRA 1BG4A 3VUPA 3RCNA 1FP8A 2WWDA 2WW5A 2VZOA 3S6TA 4FLSA 1J0JA 3WFZA 3KE0A 1C91A 3VOCA 4CU7A 2WSKA 3TTQA 5A95A 3WNNA 1PAMA 5EMYA 4AZCB 2WC3A 4J3SA 2GJRA 4K68A 2EJ1A 4M82A 1E6NA 1H09A 1IV8A 1EHNA 2PWGA 4RE4A 2XG9A 3PZOA 1I75A 4DUWA 4H41A 4X9YA 2WKGA 1V6UA 1ZJBA 2YBTA 2GVYA 3ZJ8A 4AZGA 4U3AA 4C7FA 2VX5A 5AC5A 3ZSSA 1SYTA 4WF7A 3ZSTA 1NWUA 3EMQA 1XSIA 4HZ8A 3VGFA 1B31A 1PIGA 4GO9A 2X09A 3EMZA 1LJYA 1OBAA 2VMFA 3WELA 1RP9A 4UOZA 4DWSA 3BAKA 2JF6A 5C71A 1BTCA 4D6JA 2VI0A 3VIJA 2DPEA 1V02E 2WCAA 4QCFA 3T09A 4URIA 3WSUA 2VZTA 1VIWA 5ABEA 3AYRA 1H1NA 3K8MA 1UD5A 4D1IA 2GJXA 4UFKA 1QNSA 1J9YA 4JFTA 4GKLA 1MW0A 3WUBA 2FDMA 5FKYA 4IPNB 1BG9A 4MB3A 2BY0A 3CMJA 1W3KA 2CHNA 1JZ3A 1HNYA 3BLKA 4PMOA 3ZO9A 4PMQA 2CKRA 2YDSA 2J8GA 1IT0A 2G41A 3EDDA 1GQIA 7A3HA 3WFLA 3GH5A 1OGSA 3OLIA 1UD4A 3IAQA 3KL3A 4NF7A 4P8XA 2B31A 3U7BA 1UWIA 1MVYA 2J47A 3FW6A 1UOKA 4KGLA 2OWXA 6A3HA 5GQBA 1TUXA 1JD9A 1M53A 4B16A 3LPPA 2XVKA 3DHUA 4HOWA 2WMIB 3WN6A 2JALA 2XWDA 1HP4A 2VO5A 2D24A 2DSWA 4E4PA 3ARUA 3AHTA 2BHUA 3GNRA 5CPTA 5KZ6A 4CKQA 4PEEA 4PMXA 4D1JA 2BY2A 5E6ZA 2FGLA 8CGTA 1C90A 2WC4A 4U5IA 2RGMA 1XYZA 3L4XA 5A94A 1EQPA 1NM9A 5ECUA 4F8XA 4QLKA 1VF8A 3AYSA 4F79A 2WZIA 4U3CA 4J3VA 4PCSA 4CUCA 1U30A 3JUGA 3PTKA 2A3AA 1L0PA 1E55A 3RILA 4LYPA 4BF7A 2V3EA 4D6IA 4ACZA 3WNMA 1E4NA 3OB8A 1WNOA 1WAWA 2VNCA 4JFUA 5AYBA 2BXZA 3RM4A 5DMYA 2Y4SA 2CYGA 1BYCA 2J8FA 2JIWA 3EYPA 5I0DA 1C7TA 1E72M 1VEMA 3EDKA 4CU6A 2F61A 2ZUTA 4ATLA 1OCQA 2YL8A 5BWFA 3HN3A 2BNJA 2WXDM 1B3VA 3BH4A 2WSPA 2XTKA 4W8LA 2UY2A 2VR4A 4W8AA 2G3IA 4MB5A 3RJYA 4Z2JA 4CN1A 2BVTA 3CZEA 3MANA 3IJ7A 4HA1A 1R86A 3CUIA 1BSIA 2V3FA 1E6QM 3VMNA 1W9VA 4PTMA 1CXEA 1W9PA 4M80A 1V3HA 3CTTA 5KEZA 2J78A 4W89A 1LL6A 3BMVA 1E6ZA 1UQYA 3TTYA 3VD4A 1JYXA 3U7VA 5I79A 4N42A 4OZOA 3AIWA 4CU8A 3SURA 2PF0A 2VZUA 3VMPA 5A1AA 4FLOA 1B0IA 4NI3A 2AAAA 5HDRA 3HU7A 1OGGA 2X8RA 4B9YA 1MW1A 4JHZA 2F8QA 1RPKA 4H04A 1J11A 1BGAA 2DT2A 3MMDA 4JFWA 3QHMA 4C7DA 1E0WA 3GXFA 5ABGA 4BS0A 1E3ZA 5A6BD 2CERA 1V3MA 5CXPA 2E40A 3BAWA 3A6OA 4AIUA 1EIBA 1QVBA 4UNIA 1BF2A 1JL8A 3SEPA 2E8YA 4L4PA 1HKMA 4CD7A 1EO5A 1HJUA 3AXHA 2E0PA 1ZBWA 1UD3A 3AIVA 2G3JA 2X0HA 4P8VA 3WD4A 1CGUA 4GQRA 3WQ6A 1TA3A 3VIHA 4UQAA 1LG2A 1VENA 4DWSC 1AMYA 1PBGA 1U2YA 1UR2A 1HP5A 1NP2A 1C93A 1QI2A 1B3YA 3AHZA 3MSDA 4JL1A 4Q7NA 5LYRA 5EFDA 1B3XA 1UD2A 1J0IA 1E0XA 4LQ1A 1WO2A 4WLCA 1CZ1A 2PWEA 4MB1A 3EDFA 1JYVA 1VFUA 4IM4A 2OSYA 4PTXA 3VX0A 2ZWYA 2VRQA 3CUGA 1W3HA 1B2YA 1A47A 4DWSB 4MB4A 4AXNA 1OD0A 1J10A 1JYNA 5EBAA 1TE1A 1Z32X 3MKKA 3CHEA 4P8WA 3KL5A 1JXKA 3O9NA 1US3A 1J0KA 4KRTA 2GJXB 3PZUA 2D20A 1PX8A 1V0MA 2XJ7A 3FHAA 1K9TA 4Z2GA 1FFQA 1PZ2A 1WCGA 3KEHA 1MW2A 1GPFA 1OWQA 3ZJ7A 3MO4A 2PB1A 1R7OA 2O9RA 1EDQA 4A3YA 2OYKA 5D9MA 1HKJA 1R87A 1TFVA 2BHYA 1NQ6A 1C8QA 4GQQA 1MQRA 2ZWZA 3GYCA 3U5YA 3CZKA 1CBGA 4P7OA 3E1F1 1WP6A 1V3JA 3L4YA 2ZX6A 3ARVA 3EMCA 1H2JA 4TTUA 1E15A 4TVDA 2BY1A 2JFEX 3WD2A 2IUZA 4UFHA 2WHMA 2ZUMA 2ZUNA 5LA2A 2WHLA 3POCA 1J12A 1V6XA 1XD1A 2D1ZA 3VM5A 1OT2A 5I78A 4HOZA 2ZXAA 5A6BA 1WZAA 1N82A 1W1VA 1QW8A 2MANA 4IPLA 1C7SA 3THDA 2J7GA 3N18A 1E4LA 1ESWA 1H41A 1GQKA 5CSUA 2X2YA 1E4IA 2J7BA 1UKQA 4FF5A 1E9LA 2G3MA 1D2KA 2V5DA 4PMYA 5E0CA 1QBAA 1BYBA 1JZ7A 1GOMA 1GONA 3T0BA 4MJ2A 2GJPA 3AIEA 1ISVA 2CBJA 4PMUA 5A6MA 4ACZB 3SCQA 2V38A 3POHA 1WB0A 3SCWA 3I3DA 4HU8A 5FL1A 1XD0A 1R8LA 4HA4A 1LL4A 1R7AA 3WH7A 4BA0A 4DUVA 3AZTA 3OLGA 1EH9A 3ZMRA 1OIFA 1C8XA 4MNMA 1DWHM 4PYSA 1W9BM 2C8NA 5A8QA 2O9TA 3GXDA 4P8UA 1ZB5A 3PZIA 1AQ0A 4MNKA 3SUWA 4E8DA 4H8HA 2VZVA 5BRQA 1QI3A 2V3GA 4UZUA 3SCTA 1ISZA 2WHJA 1FOBA 5DO8A 2DSZA 3WD3A 3HJEA 3THCA 1U33A 2WAGA 4BQ4A 2CIPA 2UY5A 2Z1KA 4AZ7A 4B15A 2VX4A 1TCMA 4HPHA 1HXJA 1OT1A 1GZJA 5BXSA 3N9KA 1QI5A 3DC0A 4WK9A 2W91A 3SUVA 4AEFA 4H8VA 2Z1SA 4KH2A 1EQCA 2E8ZA 1E6PA 2BS9A 4V2XA 3CZLA 4LXFA 1RD6A 1HN1A 1QHPA 2D3NA 1J0HA 4CN6A 1XHGA 3WQ4A 1E40A 3CUFA 5IFPA 3UERA 5E9AA 3ZIZA 1ZU8A 2F2HA 3SCRA 2E9MA 4PTVA 1F4HA 1W9XA 2D0FA 1CXHA 4ATDA 1QNPA 3OG2A 1Q6GA 4J7RA 3VO0A 1V03A 3WF0A 4MADA 1UWSA 2YA1A 3AMGA 3PTQA 1X6NA 3WUFA 4KGJA 3RMEA 2OYLA 3GNPA 3WNKA 3SIMA 4GZEA 4YPJA 2NSXA 3AI0A 3AMDA 1J0ZA 2CBUA 1TA3B 2VC9A 4S3KA 1S46A 1W9DM 2D3LA 3WNLA 1ECEA 1GHRA 2NT1A 3U57A 3AROA 5E0FA 5M17A 2C7FA 5LA0A 4HU0A 3VD9A 2VCBA 1E6XM 5BRPA 1UR4A 3WQWA 4CCEA 3T0AA 3L4TA 4J3UA 2DSUA 2J7HA 5HXMA 3AS3A 2J7EA 4Z2LA 4AD0A 1VAHA 4ZE4A 5BXPA 4FK9A 4HA3A 3SCVA 3VMOA 4UQCA 3NCOA 1XGZA 2OLHA 2J25A 5HPOA 4UQBA 3AIBA 3NSNA 1GOKA 1BYDA 1CEOA 3PZMA 3UEQA 2VCAA 2EPLX 3J7HA 1ZBVA 1Q6FA 3VGEA 3IANA 3WY1A 1BQCA 2W61A 2WVSA 3UETA 2J7FA 4ZEPA 4MAZA 2J4GA 4KRUA 3T2QA 4J3TA 1K9EA 3L4ZA 4AD2A 3CZGA 4JFVA 4JHOA 4P7RA 4R27A 1UH4A 1B9ZA 1AVAA 4AEEA 2CHOA 3W6MA 4X0NA 1KXTA 1BFNA 1NP0A 2QF8A 1W32A 2PWFA 3VDAA 2AOSA 2YBUA 4PMRA 3NYDA 1E71M 4W7UA 1J18A 4MNJA 1ZBKA 2CITA 4GINA 4F9DA 5I24A 1LWHA 3BAJA 3AMKA 1H4PA 2A3HA 1G0CA 1V0NA 4YN5A 2ZX7A 3QHNA 3VD7A 1UKOA 1B90A 2WLYA 3M6DA 4AZHA 4JAWA 1VJSA 4Z2IA 3WL0A 4WSJA 4HMDA 3AQUA 4RE3A 3VDCA 4J3XA 4CD5A 1V3KA 2YA2A 1Y7VA 1UR9A 3ARWA 3K46A 4D6EA 4JFSA 4J28A 4MDPA 1NWRA 5FCZA 3UG5A 1UD6A 2Y8KA 4FLRA 3LPFA 1MXDA 1EHAA 4IUGA 1UH3A 4E8CA 3F4VA 1UWUA 3BAYA 1UD8A 1VBRA 3OIHA 2EPNA 2DGAA 3WF3A 3ZT7A 1D7FA 1FP9A 2BVYA 3RO8A 1OM0A 3W0KA 3VIOA 1Q6CA 1KXHA 1MQPA 1HJSA 3BCFA 3VGDA 1AQMA 1PX4A 4BQ3A 5AYIA 1MQQA 3VNYA 6CGTA 4JKMA 5BROA 2JE8A 2ZUWA 4XZBA 4HOXA 3AIRA 3BLPX 4MPKA 1JAKA 1DEDA 2GK1A 1H49A 3WDPP 4LX4A 3AS1A 4S3JA 1LWJA 1MFVA 3AXIA 2D2OA 1UWTA 1Q4NX 4LYRA 1H3GA 4JKLA 2EPKX 1XC6A 1QHOA 5FIPA 1E1FA 4QLLA 2E9LA 5DT7A 3LPOA 3MS8A 3K1DA 3B9AA 5CSYA 2O9PA 2YIHA 5D9PA 1JGIA 5CQ1A 2WM0A 2J79A 3GXMA 1JD7A 1WDRA 4BCEA 1G94A 2Q8XA 3VPLA 2DSVA 1E6RA 4CVWA 5EB8A 1EDGA 3MU7A 2WK2A 4YHEA 3LMYA 3TA9A 4H2CA 1BHGA 1ITCA 2CBIA 1TG7A 2WMHA 3WH6A 4A3HA 4D6DA 4TX6A 1HJXA 2E9BA 4HMEA 5TD4A 5M5DA 3SCNA 5DF0A 3AXXA 1FHDA 3N12A 1MWOA 1UHVA 5A8OA 3QHOA 2VX7A 2YL5A 3EDJA 2A3CA 3MUAA 4AISA 1E1EA 4GPNA 1EDTA 3QR3A 2JEQA 2VZSA 1CXKA 3WUGA 4B3LA 4WIWA 4CGTA 5A6AA 3I3BA 1C92A 4ZXLA 2J77A 4P7NA 3BMWA 4F66A 2DT0A 1M01A 3VTRA 3ZR6A 3AJ7A 3ARZA 1G5AA 1PPIA 2WKLA 3AZRA 3TONA 1CENA 4WKFA 2W67A 4HZ6A 4ZE5A 2EPOA 2O9OA 5GNXA 2JEPA 5A3HA 2WLZA 2YOCA 1LLOA 2W4XA 4WSKA 3O2LA 1XCWA 1EGZA 3FAWA 2TAAA 1KCKA 5CLTA 1W3LA 1VB9A 3MV01 4PMVA 4J3WA 2X05A 1HIZA 4JCLA 3VILA 3WH8A 5CJ5A 1C3FA 4QDMA 3RIKA 3ARPA 3WMBA 4ATWA 5JIPA 2EEXA 2O92A 1GJWA 4AZ5A 1V6VA 3CMGA 4J27A 3OGVA 5F7UA 3L4WA 2DH2A 2VX6A 5JBFA 1B3ZA 1ZBCA 3WD1A 1DWAM 4MJ4A 1GW1A 3W6LA 1W1YA 4H8UA 3BAIA 4U31A 1KB3A 4PMZA 1FHLA 5M3WA 5A6LA 5IHRA 3GBDA 4GIAA 3BC9A 3K8KA 1KGXA 2OSWA 3A3HA 1W91A 1KGUA 3W37A 4M29A 3NUKA 3KZSA 2BFGA 3SCUA 2FGZA 3KL0A 4FMVA 2XVGA 1DWGM 1NARA 3M7SA 1JDCA 4U5KA 2WYSA 5BYWA 3PHAA 3L2LA 1DHKA 3DYOA 3VIIA 5EFFA 4RL3A 3WF1A 1HKKA 3VNZA 3WNPA 3WEMA 3W38A 1RH9A 1W2VA 4BQ2A 4IISA 2VOTA 1FH9A 4LPCA 7CGTA 4QFUA 1CXIA 3VKKA 5E6YA 4NSBA 2WVUA 1WZMA 2FH6A 1JAEA 4V28A 1GOQA 5CPSA 2VVNA 3II1A 2WWCA 2XGIA 3BSHA 2VCCA 2HVMA 1PX3A 1V0KA 2UY4A 3VIPA 5GNYA 5FOOA 3ZOAA 3WH9A 1IZKA 3WD0A 3CZJA 4UQEA 1JFHA 4L4OA 3MV11 5IFTA 4XB3A 3SCOA 3UCQA 1QNOA 4CD8A 2DT1A 1W1PA 4ZENA 4M81A 1OGBA 3SUUA 4EAMA 5BXRA 3K4AA 3N04A 4OUEA 3WEOA 4DM1A 5AC4A 4Y7EA 3UG4A 4V27A 5I6SA 4UQ9A 3PZTA 5JIWA 1LG1A 4C7GA 2XM1A 1TZ7A 1UKPA 2CBVA 5M03A 2ZXDA 3ZR5A 2QLYA 3AMCA 2ZXBA 3EBVA 2JF7A 5HBFA 3S2CA 1MW3A 3D5HA 1BLIA 3MUIA 2GK1B 4DWSD 3MSGA 1E5NA 3VGHA 1GOWA 1JYWA 1VJZA 3ARRA 4CD4A 5JUVA 1TR1A 1V6YA 4D6FA 4W5ZA 3GH4A 4P7LA 3FXYA 5A2BA 4KWUA 3QOKA 2XYLA 3QGVA 4U33A 1M04A 1OSEA 3AOFA 4D6HA 4UTFA 3BSGA 4W85A 4GZJA 4AY1A 1I1WA 4AC1X 3NDYA 1JZ5A 5A8NA 1V3IA 3IK2A 1L8NA 2CESA 2ZX5A 3PZQA 3WMCA 1WZKA 4Z2KA 3OBAA 5A6SA 2A3BA 2PWHA 3CLWA 4OJYA 4QAWA 1E3XA 3ZQ9A 4AZIA 2RGLA 2WZHA 4GZIA 3AZSA 5D9NA 3VU2A 2YLLA 5CPQA 1GOOA 3HMCA 3L4VA 2IXVA 5BXTA 5HPCA 3PZGA 2BY3A 2CEQA 4MAVA 2QPSA 3GDBA 1XH1A 1KQZA 1HVQA 4PUDA 3RDKA 3T2PA 4XX6A 4AMCA 1HJWA 4UR9A 3WBEA 2E4TA 3NSMA 3VIMA 1HJQA 1JZ6A 1W9UA 4UFMA 1QPKA 1JI1A 1B3WA 2J62A 1H0GA 5ABFA 2CXGA 3N11A 2WBKA 1GUVA 2DEPA 1LF1A 2ZIDA 3W53A 4JKKA 4ACYA 5I5RA 1UYQA 1MFUA 3APGA 1UR8A 4W87A 3ARQA 5FD0A 2WBGA 5I23A 5GPRA 2ZX9A 3VIFA 3VINA 2ZOXA 5D4YA 1TVPA 2WZEA 4NRRA 3CUHA 3GBEA 1KXQA 2BXYA 1E5JA 1UKTA 4TXEA 1CDGA 3BXWA 3GM8A 1BYAA 3A47A 2FHCA 3VD3A 1A3HA 1ISXA 3O6AA 1VEPA 2VRKA 1NOUA 1HL8A 3WF4A 1MYRA 3PZNA 1YHTA 1WDPA 4FLQA 3ZJKA 4OOZA 1EOMA 1JIBA 5HOSA 5CLWA 1HJVA 4MTVA 4OKDA 2VUYA 4PMDA 3B8SA 5D8ZA 1GNXA 1BPLB 2W66A 1E43A 2CKSA 4GI8A 1HX0A 9CGTA 1XYFA 1H5VA 3WH5A 3VDBA 1SMDA 3MMUA 4E2OA 3A4AA 2D22A 2X1IA 4W7VA 2VR5A 3WDQA 4WKHA 1ODZA 2QHAA 3GNOA 4AD4A 1NH6A 2XFYA 1UWRA 5C8BB 2VRJA 4B9ZA 3CHCA 4HP5A 3OLDA 3T2OA 2W92A 1HL9A 1GOIA 1PIFA 3PZ9A 1CGXA 1ZS2A 3WIJA 2XFRA 3VM7A 2QV4A 5A2CA 2WMFA 1WZLA 2J7CA 3ZT6A 2OSXA 2JIEA 2ZICA 3W27A 3A4XA 4W7WA 3BCDA 2NW0A 2UWFA 1UA7A 3RJXA 5A6JA 4PCTA 4KMQA 3OA5A 3U5UA 3KWXA 1JG9A 3SUSA 3F5LA 2J75A 2EQDA 4PSPA 2FHBA 1RP8A 3WEZA 1GJUA 4NZCA 3DHPA 3MMWA 1NOFA 5HNNA 2D23A 4AZBA 4OIFA
chains in the Genus database with same CATH superfamily
4BWLC 1J0YA 1KV5A 1XM3A 1CGTA 1BKFA 3CM4A 1R3RA 4YLWA 4JQ3A 5B7ZA 1PTAA 4W93A 5ECVA 4GIRA 5C54A 4H6RA 3NGJA 1JUBA 1KXVA 4GBUA 2HBVA 4C6MA 1XH2A 3LPGA 3T55A 2AL1A 3Q37A 2D9FA 2QULA 2QCLA 1H5YA 1X1OA 3DYMA 1TCDA 3FK4A 2C19A 3ZZ1A 4EK7A 4RW5A 1H1YA 2YDQA 2WNZA 4LB3A 4O53A 4HZ7A 3TCEA 1NIUA 4ZFMA 1MZHA 2BV9A 2ODOA 3TDFA 3V3WA 1UASA 3BOLA 1AH4A 2ZZ7A 4PUEA 3LBOA 1VFSA 1BTMA 3VIGA 4JTRA 1V0LA 3PULA 4IIBA 4GUIA 2R14A 3CL7A 2CETA 1EZWA 2WCSA 4LVFA 1QW7A 4WCJA 4D6CA 1Q6EA 3DI0A 4RPQA 2V82A 2WANA 3NDZA 3QY8A 3N34A 3P60A 2YA0A 4ROPA 4CCCA 5GVJA 3W25A 1OINA 1X96A 2Y24A 4Q8VA 3GNNA 1NAL1 2VC5A 1Z8AA 3PN8A 2WNWA 3P0WA 3QTPA 1W54A 3CC1A 5C9RA 2W62A 3P67A 5AY7A 1ZJAA 2DZPA 1DWFM 3KAOA 3F5JA 1TR9A 1KT0A 4QJ5B 1V08A 4AD3A 3RG6A 3UG3A 4JTUA 2DZWA 3CBWA 2NXHA 1JPHA 3AFBA 3ITYA 2NVCA 1FY6A 3SAZA 1S5MA 2QPUA 3CUJA 3NWRA 1HT6A 2MNTA 3ALGA 1H11A 4L7ZA 2TPSA 5I2UA 3FAPA 2V3DA 4PUKA 4EANA 4Q4RA 3E3HA 2XVPA 3IACA 4NG3A 4Q33A 3EX3A 2VURA 1GCYA 1NDWA 1QI4A 3C5QA 4GYJA 2XVNA 1GVIA 2EPHA 2X30A 4LFYA 1K9FA 3H4GA 3L21A 1QU4A 2OZ0A 4L4MA 3IIZA 1UR0A 3TTEA 4ZOBA 5LGZA 1R3YA 3B06A 2PS2A 1UROA 4D2JA 5I77A 4GC4A 1KGWA 4M5PA 3PG9A 3MJYA 3EPNA 1GQJA 1CGYA 3O5LA 3FA4A 1J01A 1GG0A 3CGMA 3AISA 1F8MA 4W5UA 3H2NA 1F6KA 4ZB2A 2W9MA 2D2HA 4DF1A 1DJIA 1NFGA 2UBPC 1PE1A 5A2AA 3VGGA 4DNHA 1YNYA 1FWFC 5D30A 1EJVC 1IXOA 2CLLA 3GHUA 1UZ4A 1X6UA 4IQ2A 2GSJA 2VYOA 3IV3A 3KOXA 4E2BA 3NQAA 3H22A 4JZ5A 3VAWA 1QNQA 3N1AA 2YW3A 4K3ZA 5FL0A 2R1KA 1P5QA 5D2TA 4Y9AA 2R1NA 3MTWA 3H55A 4ZO8A 3SY8A 3NURA 4QE5A 2Z2UA 2NVDA 1WKDA 1FTXA 4O15A 1REQA 4G1NA 1QBBA 3WDIA 4PN2A 2D0HA 4KS0A 4ZTYA 3GXIA 5CC7A 1DIDA 1FWWA 2TRSA 1NVMA 3GXTA 1SW3A 1DTUA 4JFKA 2AL2A 4GVIA 1XL9A 2QAPA 3OVRA 2V2DA 2ZXQA 3WENA 3CO4A 1XDLA 3K4DA 5H2ZA 4I9MA 4YCOA 4IQEA 3TYBA 3STPA 1TYGA 5KMYA 4AIOA 2PODA 5D8WA 8XIMA 3C52A 5F4WA 1TELA 2ZVIA 1XLMA 2WCGA 4DUXA 4L1GA 5AC6A 1UW9A 3LSCA 2D69A 4LY4A 1RBOB 1ZQ5A 4AVOA 1KM3A 4NHVA 2HNHA 5M1TA 3PTDA 1PINA 3LM7A 4K1WA 1KT1A 1EUNA 5CG0A 1E0UA 1BVZA 2OLSA 4WVXA 1EJRC 1MZRA 5ABHA 1N2VA 2YCKX 3M0XA 1JUEA 3MDWA 1XCXA 2X41A 3CL6A 3CNYA 3EDEA 4ZSTA 5HWCA 3PBGA 1JDDA 3M07A 2RKXA 2PV2A 1G01A 4DO5A 2DFAA 5IXEA 2D0GA 4ZXOA 5K4XA 2CPUA 3RPDA 3IVSA 4DRQA 5CJMA 4AYSA 1LQ0A 2VDIA 2RDTA 4PFMA 3UWEA 1QPOA 2QUNA 5CGMA 2IPGA 2FHFA 4R7OA 1TJ0A 2DQWA 4W88A 1F9CA 5KZDA 4DQWA 1TPEA 4I9JA 4LBSA 5I3GA 1D3CA 2Q5AA 4H7VA 1O94A 4QQUA 1CWYA 1OYAA 3CJPA 4O11A 3WQ5A 2AGTA 6TIMA 2QV5A 3GVQA 3KTCA 2PDWA 2PE4A 2PDKA 3UWWA 5B8IC 5AN7A 1FWHC 1ENUA 3GG1A 3K1GA 1NF0A 4B92A 4AD1A 1QHZA 5C6MA 1NSGA 4PL2A 1SO3A 5DT5A 3BVJA 3CV1A 1EBGA 3W81A 1PEZA 2OYMA 4U2YA 1V77A 3VDHA 1D7HA 3WLTA 2INEA 4BZYA 2YL6A 2OPJA 2OFNA 1T96A 2BX7A 3UESA 3GDMA 4PCFA 1W3NA 3ARTA 3Q4DA 3F4WA 1TPDA 3V0UA 3VZZA 1OCJA 5D09A 4FR1A 1TPB1 1FWBC 3TK7A 2EG8A 3ZM8A 3MO7A 3I7RA 2GUUA 3GFYA 1PJ9A 4J40A 4L1WA 4FSAA 4BEUA 1XSJA 2NSOA 1M03A 3CQKA 3CHDA 5FA5A 2UY3A 4D72A 3O5KA 2EO7A 4DJEC 1HKIA 1ITXA 1FCUA 1MEWA 1XXXA 4CCDA 1DORA 2QVHA 2H3BA 5HR6A 5GJPA 1O5RA 2IMRA 4O1AA 2AMGA 1KO0A 4C1KA 4QXIA 3M0LA 2WW5A 2VZOA 3S6TA 3A64A 3VOCA 4CU7A 3WNNA 3S5NA 3N14A 3GKFA 5EMYA 4RPPA 1DJGA 2NQLA 3W7KA 4J3SA 3AWOA 5E5CA 3H12A 3U2CA 4KQZA 1M7OA 1IV8A 2PGEA 2XG9A 3N2XA 3PZOA 5BOFA 1FWEC 5FEXA 5D03A 4XAPA 2G50A 3CS2A 2ONEA 4U3AA 3ZSSA 3ZSTA 1BWKA 4HZ8A 2MUCA 3GTYX 1KCXA 4ECLA 1LJYA 2V30A 4UOZA 3BAKA 2JF6A 3KZ7A 4Z1YA 5C71A 1BTCA 3F7JA 3T09A 3BGJA 3WSUA 1VFHA 5DRCA 1UD5A 3SR7A 4LVGA 4NVTA 1REQB 3CYVA 2XZ9A 1QNSA 1J9YA 4Q8WA 1O60A 4IPNB 3N6JA 4ADUA 3MI2A 4CQAA 3LNPA 3SSZA 2QEZA 1XS2A 4LEQA 2NLIA 1D3GA 4XISA 2AL2B 1ELSA 3ZO9A 2CKRA 2YDSA 4QX4A 2PRMA 2J8GA 3D3FA 5BMXA 1RLCL 7A3HA 3WFLA 3GH5A 3IAQA 1XLIA 3LV5A 4LSBA 4Y9NA 3W7LA 1H60A 1MVYA 4Q8NA 1UOKA 1DKWA 5DMLA 5GQBA 3T1GA 4B16A 3LPPA 4IMCA 3FSUA 3W7QA 3NVDA 3DHUA 4QE4A 3SRKA 1H7PA 2XWDA 1RV8A 4XD6A 2VO5A 2R9RA 4E4PA 3BMXA 5DMMA 5KZ6A 3E9AA 4CKQA 3U6WA 3U4FA 4D1JA 3N4AA 3FGCA 5E6ZA 2HV5A 4IPPA 3TEVA 2RGMA 3L4XA 4F8XA 4GCXA 3UFYA 1LQAA 1QCWA 1Q6HA 4NIRA 1IT8A 1QOQA 4KPLA 4KFPA 3DFSA 4Y90A 1MNSA 1U30A 3BE7A 3M64A 2HNEA 4BF7A 2V3EA 4D6IA 1OFPA 5JQ9A 1WAWA 3D46A 4B5UA 2QXWA 3SQSA 3CTLA 2BXZA 3VXGA 4MKVA 1PSCA 2I5GA 3M0VA 3M7WA 1WX0A 1S5TA 3LCLA 5AZ1A 2MLZA 3EYPA 1C7TA 1E72M 5BRBA 4PUNA 4UTWA 4CU6A 1Q63A 1GT8A 4ATLA 4RCXA 5BWFA 2WXDM 5CH9A 4F4RA 3CH0A 2UY2A 2VR4A 4MB5A 2ITKA 3RJYA 3CZEA 3CQJA 3MANA 2G0WA 3BV4A 4KF1A 3CUIA 4S3BA 3R8HA 3HM7A 5FF7A 1XINA 1E6QM 1R5YA 2HJPA 4JTAA 1FKJA 3N25A 4G56A 4W89A 4TU1A 3BMVA 4KRZA 4BY3A 2Y7GA 1E6ZA 4EPKA 3VD4A 2ZFAA 3TN6A 1FHVA 3P2VA 4MPQA 3EWZA 2ZVRA 3PJXA 4OZOA 2EULA 2C1IA 3AIWA 3B05A 2VZUA 1Q4WA 5A1AA 2W0UA 4NI3A 5BU6A 3HU7A 4A8IA 1MW1A 3LHVA 4JTJA 4H04A 4H9YA 4GCAA 3MMDA 4WOQA 2OG9A 4DJFC 3G1XA 2PUZA 3GR8A 3V5OA 4AWSA 5LHEA 4IPIA 3WJWA 4MFDA 3PWGA 4L4PA 1ZNNA 1R3WA 3R8RA 4CD7A 3N9SA 1A5AA 1HJUA 4JFLA 3AXHA 2A79A 4DJDD 3AIVA 2EKCA 1F61A 2Y5SA 4Z0SA 4KFNA 3USBA 2GVGA 1UIPA 1CGUA 4GQRA 1YDOA 3P82A 3LCGA 3O0KA 4UQAA 4GZ7A 4DWSC 1GTHA 1F07A 4XK2A 1HP5A 5CCZA 4K2SA 1E9IA 2VXNA 2YGYA 4Q7NA 2B81A 4HJFA 2NUXA 1WO2A 4WLCA 4O13A 4IMFA 4MB1A 2PWEA 3GXPA 3P3BA 4PTXA 4KT2A 2ZWYA 1W3HA 3FEQA 1UMYA 1B2YA 2Q8ZA 1P1XA 4MB4A 3T05A 1J10A 4XBJA 5EBAA 3HGOA 3UXKA 5KINA 4J2MA 1JXKA 4R7JA 4UTTA 2HTMA 3GX9A 1L2QA 4Z2GA 1EC9A 3K5XA 1WCGA 1GPFA 1OWQA 3VNLA 4TQTA 3P8JA 2PB1A 3EOUA 3GW3A 1JCNA 3HO8A 1HKJA 5JU6A 2P50A 1YRRA 5KTLA 1V7YA 2GGGA 1I2PA 1BL4A 4WQ6A 1XRTA 1P7TA 1P6BA 5XINA 4FNQA 4Z1AA 5CPLA 3L4YA 3S9ZA 2ON3A 1N8WA 4J5NA 1E15A 2AKZA 3EOEA 2WHMA 2ZUMA 3OA3A 3POCA 5I78A 4HOZA 1U83A 1ZZMA 3VC5A 5PTDA 5D75A 1WZAA 3ES8A 1W1VA 3CV2A 1QW8A 1XLHA 3FGCB 4NZ3A 1I45A 1C7SA 1FKRA 3BWWA 3QH2A 2HWGA 5CAKA 1ESWA 1P0BA 5I3KA 1GQKA 3SECA 2X2YA 3WK3A 1FQ0A 3WLSA 1KNWA 3OHIA 4FF5A 3LGEA 3WQGA 1QBAA 1BYBA 3B9OA 2XH7A 2MF9A 3NQMA 2CBJA 4FZIA 1T5AA 1XIEA 3POHA 5FL1A 5CZ0A 4PTDA 2OU4A 4JFJA 1A5SA 3BO9A 4HA4A 2VP8A 4BA0A 4LAOA 4DUVA 1TIMA 3OLGA 1EH9A 2DVXA 1H7RA 4US6A 2OGJA 5C55A 4O18A 2VHLA 5A8QA 3RX2A 1ZB5A 4DO6A 5I3FA 3P80A 3SUWA 4BEQA 4E8DA 3E96A 4AWUA 1QK0A 5BRQA 1R30A 3SCTA 3BTNA 2PV1A 3M0YA 1R9YA 1ISZA 2WHJA 3VKDA 4H19A 1FOBA 4LOCA 3H6OA 4MWAE 2BP1A 3TXVA 1VC4A 3PBVA 3THCA 3EWBX 2PA6A 2TMDA 2XIQA 3WJZA 3GAKA 1NQKA 1TCMA 4IIGA 1XLEA 1XKJA 1W17A 2PDCA 3M44A 3TWBA 1GK8A 4O4WA 4WK9A 4K6AA 3QLLA 4LBUA 4AEFA 3STCA 3W83A 2Z1SA 1E9ZB 3FS2A 4KH2A 4MLRA 2Q8LA 4DO4A 5FJTA 1KRAC 2QCGA 3CZLA 1HN1A 3S8HA 3V7PA 3R0UA 1J0HA 2VKZG 4ZQRA 1XHGA 5CPNA 1TSIA 5IFPA 4L56A 3CK5A 4HPJA 3ZIZA 1ZU8A 3RRAA 4BI5A 2E9MA 2B5UB 1QNPA 3S1WA 3VCCA 2XPAA 4LEFA 3RYSA 4HU3A 1RY0A 1V03A 4MADA 1A5BA 1ZLPA 3AMGA 1X6NA 3WUFA 3QW4B 3LGGA 4KGJA 4CNTA 1C9WA 1V51A 2HBXA 1X8FA 3N2CA 3SIMA 3M6YA 1Y0OA 1J2BA 1J0ZA 3UCDA 3W84A 2GWGA 3S1XA 4LVBA 1HKVA 4OFCA 1ZAJA 4P61A 1O1ZA 2OX1A 5D32A 4PODA 3AROA 4OE7A 2OR2A 1AW2A 1W1ZA 5M17A 2PLKA 3IJIA 1RVKA 5G4EA 3ABSA 1UR4A 3WQWA 5JXQA 3T0AA 2WJEA 3L12A 4GXWA 2IKGA 3L4TA 4J3UA 5G1YA 2DSUA 2J7HA 3BQ6A 4ES4A 3B0YA 4NASA 4LWWA 3DAQA 4N6FA 4FK9A 4HYWA 3SCVA 3NCOA 4NILA 1XGZA 4G8TA 3W74A 2RUDA 2FB3A 1GOKA 4ZS6A 2Q6ZA 1KM2A 4D9PA 1HTIA 2GSEA 3J7HA 1EJTC 5C9WA 5J6EA 1Q6FA 3UI4A 3R12A 4GXMA 4KEMA 2PWUA 2BWGA 2WVSA 2C91A 4EAYA 3UETA 2J7FA 5JH1A 1E0TA 4A3QA 4NI8A 1CB2A 1M7JA 3SO7A 4J3TA 3L4ZA 4AD2A 3NPXA 1XLLA 4NUWA 1SUXA 5D38A 4P7RA 1UH4A 1GYNA 3DC8A 1P7TB 4X0NA 3O06A 1RY8A 2QF8A 1W32A 2PWFA 3BW4A 3O7UA 2QPXA 1EF3A 4PMRA 3NYDA 1E71M 2W27A 3VUSA 2DUXA 4H2HA 5JVLA 5HWBA 1D3HA 1HZYA 2CITA 2P76A 3GE7A 3W76A 4EXQA 4CLMA 3M0ZA 1LWHA 4UTJA 2PGRA 2ATSA 2ZX7A 3MVIA 4I7VA 3QHNA 3S3GA 1B90A 2NX1A 4DAIA 4W9TA 1EGMA 1N8IA 4GACA 4AZHA 4BJHA 5DX7A 4JAWA 3G2GA 3IUIA 2YYUA 4PL1A 1JCMP 4EACA 1PKMA 3LCHA 3GU0A 4UXDA 4WSJA 4H6EA 1U22A 3LTSA 4HU4A 4J3XA 4QE1A 4NL1A 4J2PA 4J4KA 1XUZA 1QPLA 3E02A 4M6PA 4J28A 4DRIA 1IXQA 1CT5A 2QVNA 3W75A 3LHZA 4Q4KA 2Y8KA 2VWSA 2M2AA 2XINA 1EHAA 3A3WA 3F4VA 1UD8A 1X7IA 2WO5A 2DGAA 3OW1A 3W70A 2GDQA 2WOQA 4GHRA 2TSYA 2OZ8A 4AAJA 1F2JA 1DJWA 4FHAA 1TJ2A 1HJSA 5LNSA 3VGDA 3SSJA 6CGTA 1RXOB 5BROA 4L64A 2GSHA 2ZUWA 3AIRA 2CXEA 2Z28A 1X7FA 1DEDA 5DELA 2GK1A 4RDZA 1H49A 3U0HA 4S3JA 3O5GA 3C2YA 3M5VA 1YXYA 1MFVA 1Q6OA 4R0XA 1Q4NX 1H3GA 2EPKX 4DBDA 4DHGA 2PPPA 2PDPA 4JFIA 3W2UA 2NXIA 5DT7A 3LPOA 3LDVA 3MS8A 3K1DA 3B9AA 3PPHA 4TMCA 4GY0A 2WM0A 2GUBA 4BCEA 4C6EA 4EWND 2DSVA 1E6RA 3MU7A 2WK2A 4YHEA 3TA9A 2FMOA 3GU9A 1BHGA 1SFJA 4AQLA 5TD4A 3IS4A 5HUPA 4XKYA 2PU0A 3AXXA 3P61A 2G3FA 3PNUA 2YL5A 1ZCNA 2C3ZA 5F4XA 4N19A 1S39A 4LAWA 2WSQA 4C6QA 4S1FA 4IJCA 1FCBA 4GPNA 1OY0A 3OODA 3QR3A 2JEQA 1CXKA 5FJJA 3PPCA 1XLJA 1ZRQA 1HG3A 2F6KA 2BMBA 2DT0A 3UY8A 1OF8A 1M01A 3KOZA 3VTRA 4LY8A 3AJ7A 2BGNE 3H21A 1EJUC 4QROA 3TONA 1MUMA 1D8WA 4IWWA 5MF5A 1W5PA 2EPOA 3HGJA 3IIOA 2X16A 4LS1A 4QNEA 1S3HA 1LLOA 4ZQNA 1I9CB 2G96A 5D02A 3O2LA 3NO3A 3UNTA 3UI6A 1EGZA 1KFBA 2FFCA 2YDAA 4AG0A 3MV01 1QAPA 5DITA 4O19A 1FWDC 5EBUA 2Z2BA 4JCLA 3QFWA 3UPMA 3SGUA 1C3FA 1FWJC 5K2ZA 2O92A 3KS5A 3UWZA 1TPVA 3R6IA 3AXMA 2QW5A 2IKJA 5F7UA 2DH2A 3HPFA 5JBFA 1UWAA 4MJ4A 4GK8A 2OELA 3BAIA 2YFOA 5G4WA 3OBEA 1LLZA 5A6LA 4QRNA 2CU0A 1DIEA 1LTDA 4QG9A 2OSWA 2IPFA 3LCFA 4JBRA 1D6OA 2Y89A 4A8LA 3C8NA 3PVFA 4GX9A 3RR1A 3SCUA 2FFIA 2PF8A 3KL0A 3LI0A 3G1SA 4XD4A 1W6TA 3M7SA 1JDCA 3VFLA 5BYWA 4DZ5A 4IZGA 3THAA 4CCZA 1VHNA 2HXTA 3O0FA 4IFKA 1E51A 3C6CA 4RL3A 3WF1A 3SQLA 3WNPA 2M08A 1Y65A 4Q4OA 2NX3A 4KCTA 1FH9A 3HG4A 4TW7A 3WLRA 4LPCA 1T99A 1ZP3A 2OZ3A 3GUWA 4M6VA 3ELFA 5LXEA 2F6XA 5CSRA 1K03A 2DJLA 1BEUA 3BSHA 4DRNA 3UWQA 2ABBA 3ENLA 3RXZA 2HVMA 1OYCA 3F03K 3M16A 4H6KA 4GH3A 2VD8A 1N8FA 3WH9A 2WPBA 2CW6A 5FF2A 2PD9A 4L4OA 4BWLA 3SCOA 3G3MA 3URBA 3HZ3A 3KFTA 1ROUA 1JCYA 3WEOA 4DXVA 5I3IA 4HNCA 2C79A 2BGSA 3ITXA 4IT1A 3UG4A 1KFKA 5DQPA 2NV2A 4UQ9A 4LAXA 2QCCA 4C7GA 1TUFA 1XC4A 3TLLA 3W01A 1M5YA 3CAQA 4LCRA 1R47A 2JF7A 4M7SA 3S2CA 1UC5A 4Q7IA 4ZGYA 1J5TA 3QF0A 2GK1B 1E5NA 4GQ0A 3VGHA 1GOWA 4MJMA 4IH3A 4CD4A 3FCPA 1MMFA 3W88A 4W5ZA 3CB8A 1IWPA 3HQPA 4U33A 1M04A 1OSEA 2CLEA 3BSGA 4GZJA 4HN8A 3NDYA 3PZQA 3WMCA 1Q8AA 1YDVA 1J4HA 3NQVA 3BL3A 4OJYA 3EEZA 1E3XA 4ODMA 1P0KA 5G1MA 1DBTA 1KM6A 4GZIA 5K9XA 5CPQA 1GOOA 2F84A 2IXVA 4PUWA 4MAVA 4ZOEA 1GPWA 4MY8A 5HKGA 3GU2A 4XG1A 1RVGA 5DCEA 3RDKA 4IX2A 4O1EA 4XKYB 5DIUA 1TV4A 2EG6A 1YPFA 3TV8A 2TYSA 4ZPTR 2C1GA 4D8LA 1PV8A 4JTHA 1KBJA 1H0GA 4O0QA 2G95A 2Y1HA 3QSRA 3N11A 2C14A 4JY9A 3LXBA 1ZAIA 1GUVA 4PULA 2ZIDA 4W87A 5H91A 2WBGA 3HV8A 2ZX9A 3HURA 4F0SA 3VINA 5BNKA 1JGMA 4FXSA 9XIMA 5D4YA 1TVPA 3CUHA 3GBEA 2WZTA 4HMNA 1QPNA 1UKTA 2UZ5A 1ZK6A 3QGKC 1S5NA 3GM8A 4C6LA 2FHCA 1YLVA 1X1ZA 3IKDA 1KRBC 1VEPA 3UGRA 1NOUA 2EJAA 3W1AA 1HL8A 2VEGA 2RUCA 3ZJKA 4OOZA 1XQKA 1R6WA 2FTWA 1HJVA 4OKDA 3B8SA 2W66A 4GQBA 2VGFA 4K36A 1H5VA 1PDYA 2Y5JA 3GKAA 4XQ6A 3LCWA 1EEPA 4N02A 1G7VA 1I2OA 1XBYA 3M0JA 1BXNA 3B0XA 3W72A 4NX5A 2QHAA 1ECQA 2NQJA 1AD1A 3WQCA 3ZVHA 3CHCA 4H3DA 1CGXA 3ORWA 4IMAA 2XFRA 2QV4A 2WMFA 2J7CA 3ZT6A 2JIEA 5D33A 3C61A 3A4XA 4W7WA 4AC7C 4Q8QA 1SW7A 5BZAA 8RUCA 2CZFA 1EJSC 1XPYA 2VENA 3M43A 1G6CA 1OG6A 2J75A 4IFKB 2YXOA 1E44A 3DHPA 3M9YA 3QV7A 3MP3A 3VE9A 4QJ1A 4CQ9A 4GISA 5FJOA 1QRQA 2PD5A 1L6WA 3DECA 1H62A 1F3TA 2C0HA 4TVCA 1RQBA 1BD0A 2DJXA 5A8MA 1UH2A 4PTWA 3S5ZA 4XZNX 4OBSA 2Z00A 2J7DA 3T44A 4IICA 1F5ZA 5D9OA 4M24A 2PC8A 4IGNA 4WKAA 5A69A 1WKEA 4KIEA 1I1XA 4AD5A 2Z1VA 4GI9A 4LTSA 3CPUA 2EG7A 1PIIA 1JDFA 2YL9A 3O5JA 3STFA 1KR0A 5LIWX 3NO1A 1UCWA 4NQ1A 5FEWA 2A7PA 3VIKA 2FPYA 3FYOA 1TMHA 2H9AA 1S3TC 3DYPA 5G4HC 1OFAA 3MUY1 1KLYA 1N55A 1LRQA 4R53A 4GGBA 1SR0A 4LGXA 5HA7A 1U1UA 1FKTA 2PN0A 3CPRA 2PV3A 4V1YA 4N0RA 5CZKA 5LGXA 2OO0A 2DORA 4M56A 2NX9A 2X0YA 3BG3A 2PBGA 4HKPA 3INPA 2WPGA 2Y8VA 3IK8A 4HHLA 1KV8A 5D2WA 3HG5A 3EPOA 1XQLA 1TVNA 3ARYA 3VC6A 2Z25A 4E38A 2XFFA 4YVPA 1ZAHA 4B5NA 3NL6A 5C7VA 4KIRA 3QQWA 1O68A 3QLDA 5E09A 4LYQA 1ZL1A 1G1YA 1KWGA 1UP3A 2PRHA 4IP5A 1O5KA 3AS2A 2DIJA 2ZTKA 3CQ0A 3VGBA 2H8ZA 2J13A 2VTFA 1Z89A 1GG1A 1V3LA 1VFMA 1XIBA 2W5FA 1FWRA 1K6AA 1NWSA 4AWEA 1TKKA 4MSPA 3F5KA 4XV0A 3L7RA 3O63A 3SN4A 3SJNA 3MYOA 1KFLA 4A4AA 4O8AA 4JTGA 2VDHA 4OOUA 4MWAD 4NYYA 1DPMA 1BAGA 4HCLA 1W2PA 1GVFA 1YTEA 5IDIA 4EPDC 2IQ0A 4B3KA 3GG7A 1XRFA 3MP4A 4EVZA 5JBDA 2XFWA 2BHZA 3HTWA 4G2DA 3ZFHA 2F38A 4XZMX 1CYGA 4PBFA 3RF9A 4C6DA 4S39A 3C56A 3GIQA 4QLJA 1XV8A 1QPQA 3UR5A 3GTNA 1F4AA 4UOQA 4QJ3B 4Q32A 4HA0A 2WC7A 2LGOA 2WVTA 4RXGA 1C8VA 3BZGA 2QCMA 4JTCA 2X42A 2VQTA 4DBEA 3A9IA 2R24A 4IFOA 4LCQA 4JHMA 1J4EA 1UP2A 2PBOA 3VNIA 2R6OA 3GTHA 4Q4SA 3LSBA 1JI2A 3BLFA 4S3AA 3KAFA 3ITTA 4EKJA 2DZBA 1RUSA 2DQXA 3VD5A 1ADOA 1QOXA 2Y61A 4EP8C 4MG4A 4UFJA 1A7XA 4ODKA 2XVLA 2PDJA 3MP5A 3NIYA 1FH8A 4R33A 3GC4A 1CCWB 3UXAA 3L2MA 4GD0A 2R91A 3DKJA 3L0NA 3ZVHB 2VQUA 3CEUA 3BV7A 5EKYA 2CLPA 4YHGA 3AS0A 3CV7A 1MEHA 1F3WA 3HJZA 2AQVA 1CX9A 3P84A 4W84A 2ACSA 2WMGA 3GVRA 2ZE0A 1FA2A 4UR8A 4OBTA 4S2BA 4L6OA 4JTSA 4CVUA 4H4IA 5E70A 1O5XA 3GPKA 3M46A 2XPKA 2HZGA 1MXGA 3TN3A 2ZE3A 3UJRA 3QYSA 1KWKA 4ALDA 1L1PA 3O5PA 1PDZA 1OQFA 3P6LA 4PA8A 2HISA 2VFDA 3O3RA 3MZ2A 3ARSA 3FHQA 1O4UA 4J1OA 3TYZA 3RN6A 1S5VA 4M1RA 1XGEA 4PMNA 3WCZA 3BLEA 4HT3A 4QDPA 4YU1A 1KTNA 2BG5A 1E70M 1J5SA 4WDTA 1S2AA 1LQ2A 1UB3A 2WMKA 4LUYA 2BOFX 3ZYZA 5F4SA 3T9PA 2OT1A 4DF2A 1HVXA 3L0GA 1FVPA 4HMCA 4L6HA 5C70A 1PL9A 1CW2A 2CLMA 2WMIA 4DZ3A 1A5CA 2CWXA 1IEVA 3VX1A 3FJNA 2VL4A 3WKZA 1JVNA 1CXLA 1POJA 4AY8A 1JXJA 3H9RB 2F21A 5FEZA 2BODX 2CZEA 5CC3A 3BZJA 3EB3A 3OEXA 1M7XA 4ORMA 3TIMA 1JPIA 2EPMX 3BURA 2H9AB 3RK8A 1FKKA 5FSEC 1C8YA 2ZCGA 5DEZA 5DCBA 3LNMA 4E2VA 4QHRA 4A2RA 4ODRA 1X1NA 2ZRYA 1QO2A 1O6IA 5U7SA 1ISYA 4W86A 2DH3A 1POKA 1XDJA 1AL8A 3JR2A 2ZYFA 1CXFA 5E93A 4QIUA 1PHQA 4AVFA 4DM2A 1P6CA 2V5BA 1OB0A 2INFA 4GVGA 1L2UA 4HK7A 1E6SM 1EZ2A 1UA3A 5BMWA 5AHLA 3M47A 2G4FA 3BSMA 2W63A 4B5WA 4YVXA 3ONBA 4DNMA 2RH9A 1VBHA 3QPEA 4UB9A 3W02A 3SCSA 3SUTA 4HPGA 4AHPA 3LLDA 4Z17A 4C60A 3V1HA 2TODA 4O1DA 3C86A 1DYSA 4LUJA 4UBPC 4NX0A 4ML4A 2V5CA 3PTMA 3A24A 3E2QA 3GIYA 3GW0A 2GVLA 1B57A 1DP0A 3VE7A 3LS9A 3NQFA 2DUZA 3T0DA 5D37A 1FH7A 3IARA 2UZ9A 1Y5WA 3IAPA 4O10A 3WX7A 2YW4A 1CGVA 2IQDA 3EZ4A 4TX8A 3OGSA 1S2CA 3IJ9A 5CGTA 3I68A 5TAOA 4IOTA 4PH6A 3PBUA 1V02A 3T0CA 1TREA 1F7BA 3OP2A 2E77A 4C6IA 1A5KC 3DI1A 2GVJA 1GVQA 1IX5A 1GVYA 1QW9A 1KR1A 4LAUA 1BG4A 4GRSA 3E12A 2CLHA 3GR4A 4UTIA 3G0XA 1VKFA 4R9OA 3FIGA 2WNNA 1MRQA 1J0JA 4ADSA 3FA3A 3KE0A 1C91A 3JYMA 3TTQA 3IVTA 3PRBA 5EYWA 4K68A 2N87A 4M82A 2ZC8A 3PM6A 4LUTA 3W7PA 1EHNA 4C65A 1RLDA 4JQ4A 3S4TA 3FEMA 3QXBA 4NZ5A 4DUWA 4NJGA 2WKGA 3C2FA 4GYFA 2GVYA 4KWOA 4N9DA 3BANA 4AZGA 3R94A 4C7FA 5AC5A 1HL2A 4US5D 2LPVA 8XIAA 2O7SA 1XSIA 3VGFA 3QV9A 1AJ0A 3OZMA 1PIGA 4GO9A 3EMZA 3PWIA 1C29A 3WELA 4RZ5A 1FUYA 1RP9A 4DWSA 4YVVA 3GFZA 2WCAA 3S2MA 4QCFA 4NZJA 1VIWA 3PJTA 4GX8A 1H1NA 1OC7A 4D1IA 3UWYA 5H8UA 2GJXA 2PDLA 1MW0A 3FYYA 4GIYA 1BG9A 1SJCA 4ZQOA 1W3KA 2CHNA 3NZRA 2A3LA 1L6YA 3PPFA 3BLKA 2E5BA 2VEMA 1IE7C 4PMQA 4DXKA 2CHRA 2RDXA 3IJLA 4K7YA 2C16A 4ZZ9A 1TCOC 1RPXA 5C9ZA 1OGSA 3OLIA 1UD4A 3KL3A 5H8MA 4NF7A 1IGSA 4IGMA 4P8XA 3G8EA 2D73A 3FV9A 2PTZA 2J47A 4A22A 3FW6A 1TUXA 4RNJA 1M53A 4KW2A 2ZQUA 2BTMA 1YX1A 4F2BA 4PCNA 5H6HA 2WMIB 4YMZA 4PUMA 3UY7A 4E6MA 2I16A 3HGRA 4LAMA 2DSWA 3ARUA 3WLMA 4LC8A 2V2CA 2BHUA 3WBYA 4MF4A 4WRHA 3FJLA 2BY2A 4FAPA 2FGLA 8CGTA 2WC4A 1K77A 2ASHA 2J24A 4C5YA 5A94A 3TSBA 1O5QA 1P5BA 5K7JA 1EQPA 1NM9A 1N1AA 3CYJA 5ECUA 1VF8A 4IQLA 4MKNA 3QV8A 4U3CA 4ICNA 3NI6A 1FJDA 2PMQA 1BRLA 3QYQA 1DQWA 4LYPA 3RU8X 4XAKA 1IR1A 1K4GA 2E5DA 4N9EA 1BKSA 4H7ZA 1WNOA 4HJWA 4L65A 1JR1A 3Q45A 4JDYA 3GHRA 1XFBA 5DMYA 1FAPA 1UJQA 4X2RA 5EU9A 2Y4SA 3IGUA 3FYPA 1DXIA 2JIWA 3KRSA 4DH0A 3T6CA 4JIIX 5I0DA 5AHEA 3EDKA 4LV4A 1U1JA 4WDXA 4EXBA 1OCQA 4N7QA 4ZBCA 3V36A 1NFBA 2BNJA 3TN5A 3TFCA 4S2CA 3LZ3A 4NNRA 2ALDA 4GG9A 4US5A 2G3IA 3E0WA 5LKYA 5H8PA 2ETNA 3DKLA 1XGDA 4HA1A 3H23A 3G5EA 5A6TC 1BWLA 4PTMA 1CXEA 2DG3A 1I2RA 2QDEA 2X7VA 4M80A 2OT0A 4Q8PA 1V3HA 5HW6A 5T8GA 3CTTA 2J78A 2P8CA 1TPH1 4AU0A 1UQYA 3TTYA 1BQGA 3WK2A 4HK6A 3RHGA 3E0LA 5I79A 3BG9A 3UZXA 3ITOA 5EY5A 3SY5A 1FRBA 2E09A 3TC6A 4L9ZA 3EB4A 3UG8A 3VMPA 2P88A 2QIIA 5E9XA 3W1MA 4B9YA 3M5ZA 3NOYA 1NJJA 2F8QA 4EWJA 1RPKA 1J11A 5FF3A 2DT2A 4UR7A 4C7DA 1E0WA 1OABA 3GXFA 5CZTA 1GVOA 1AQFA 1E3ZA 2E68A 2CERA 2C1HA 2LKNA 3DENA 1W31A 2E40A 5HW8A 2C13A 3H26A 1EIBA 6ENLA 4UNIA 1BF2A 4MLJA 3PJUA 2E8YA 3SEPA 1QT1A 3DFYA 1JNTA 2P1FA 1PS9A 1PYMA 1UD3A 2NQHA 1YTKA 3W6YA 3W7RA 3IJQA 2X0HA 4P8VA 3WD4A 3WQ6A 2A7RA 2AMXA 4RKAA 4ZFCA 1M3UA 5KETA 1VENA 3W73A 1XR2A 1PBGA 3PG8A 1UR2A 1NP2A 3U2EA 2PDYA 4LUTB 4LW7A 4YTUA 1QI2A 1B3YA 3QZEA 3K2GA 3IKGA 4ZSUA 4LS0A 1EYEA 1IEWA 3JU2A 5EGRA 1Z7AA 4GMEA 3AUJA 2G4JA 1UD2A 3LK6A 3TNOA 1JYVA 1AW5A 2OSYA 3G8RA 3PP7A 3RLVA 4M6UA 1WOBA 5REQA 3W2LA 3QPYA 4N6EA 1FWAC 2L5HA 4DWSB 3EKLA 4DROA 3WLNA 4AF0B 3MKKA 4D8AA 3QBUA 2PWVA 4P8WA 3KL5A 4ZO9A 5CGQA 5CPMA 1Y5XA 3EOOA 2GJXB 3PZUA 9RUBA 3R79A 1PX8A 4M6QA 4NY2A 2XJ7A 3FHAA 1K9TA 1PZ2A 4UNLA 1MW2A 3G3DA 2NQ9A 3ZJ7A 2ZC1A 3N4EA 1R7OA 4QITA 4E2DA 3EA3A 3VK5A 1NQ6A 4H00A 3U5YA 1VCFA 1TV2A 2KR7A 3MQTA 1BF6A 3SRDA 3LQLA 1KTBA 4LRSA 1AW1A 3V5CA 3WLPA 2JK2A 3E1F1 3RITA 3S42A 1KBLA 1DV7A 2ZX6A 1H2JA 4TTUA 4Z1BA 3LZ5A 4R88A 5LA2A 5J04A 4TV5A 3KBVA 1TO3A 2WHLA 1XD1A 2D1ZA 3VM5A 3RFWA 1OT2A 3ZLFA 2ZXAA 2ZZ1A 3WLIA 3FKRA 1A0CA 4QQ3A 5L9FA 3PUGA 3THDA 2J7GA 4PFHA 3GYEA 1E4LA 7ENLA 4HSNA 3TZFA 1P1MA 1UKQA 4OTKA 3LI1A 2V5DA 3BW2A 4PMYA 4TX0A 1BRLB 1GZ1A 1GOMA 4TNSA 1SFTA 3DCPA 4REQA 1ISVA 1EJ7L 4PMUA 4F48A 3FXGA 2QCHA 2SFPA 4QS5A 4PMJA 1WB0A 5HW7A 1P0NA 3GR7A 3W7OA 1R8LA 1LL4A 1R7AA 3WH7A 1SSDA 3O1NA 3ZMRA 1OIFA 4PYSA 1UPPA 1W9BM 2CLIA 1TV8A 2X7WA 1XLFA 3PZIA 4ZOAA 3NQDA 2VZVA 4H8HA 1WQ5A 5JH2A 3WMLA 4MZ8A 3E38A 1IGWA 1OEPA 3OIXA 5BW6A 2PDGA 1TB3A 2ZA3A 3WD3A 3HJEA 4ZOCA 4FXJA 4BQ4A 4ZL1A 2GPTA 2CIPA 2Z1KA 4AZ7A 3G1AA 3LGDA 2Y6ZA 3LUTA 3S9YA 2ZR6A 4MM1A 3UXLA 1GZJA 5BXSA 1QI5A 4H9TA 3M1ZA 4HHPA 5I3HA 3GIPA 3IHZA 4H8VA 5C2GA 2E8ZA 1E6PA 4IUOA 3V1PA 3UZJA 1RD6A 4Y9PA 3RGTA 4CN6A 3JW7A 3TC5A 3WQ4A 1ZUAX 1PO9A 2E1WA 2ATMA 3IRSA 4A6GA 3S2JA 4P5UA 4RUBA 1DQUA 1ZGDA 3NGFA 2Z7GA 3I65A 4MOZA 2F2HA 2PRLA 2PPNA 1FWCC 2WKJA 1F4HA 4UMCA 2D0FA 3W1RA 4ATDA 3V75A 1HW6A 4J7RA 2DZUA 4O0ZA 1K8ZA 3QQ1A 1XG4A 1EP2A 1UWSA 2YA1A 2JQXA 2O0TA 4GNJA 5C5YA 1LRTA 5I98A 2FIQA 2WSYA 2EAWA 4K38A 2ACRA 4GY7A 1UJPA 3DX5A 4ODLA 4GZEA 4PB5A 4WDWA 2NSXA 1LROA 2PCQA 4GLEA 4FI4A 3E0FA 1QJWA 2VGIA 3F4DA 3WNLA 1GHRA 1DXEA 2NT1A 3U57A 1R0MA 5DIVA 1KM1A 1XYAA 2C7FA 3VD9A 1E6XM 5BRPA 3EPMA 4UCGA 4CCEA 2QKFA 3NDOA 1OC6A 2FYMA 3LN3A 5HXMA 3HB9A 3AS3A 3RMJA 4F0RA 3DG7A 3GNXA 8TIMA 2Y0FA 3AYVA 4Z1CA 1W5NA 3KHDA 5LXXA 4LT9A 3M0HA 5HPOA 3AIBA 3GO2A 1S2WA 3Q94A 3H24A 1RJQA 1CEOA 2AQOA 3KBJA 3DGRA 2LJ4A 1ZBVA 1Z44A 3G1HA 3IIXA 2CLOA 4JEJA 3VGEA 4RZ4A 3CT2A 2J66A 1GVRA 3KVKA 1VLIA 4ZEPA 4JGDA 5KITA 2J4GA 3W00A 3T2QA 1B5TA 5B80A 2UV8G 2WQDA 5EPDA 3W2JA 3M41A 4JFVA 4BHYA 3EIPA 2OKOA 1K1DA 4JTIA 3O07A 2P10A 1GYMA 1GTEA 1KXTA 1BFNA 1NP0A 1TPUA 2EF9A 2INZA 2I7GA 3PSWA 4TIMA 4GYPC 1DIKA 1ZBKA 2YR1A 4JN6A 3KP0A 4A29A 4BI7A 5I24A 3PK7A 3AMKA 5HQEA 4GVHA 3V4BA 3VD7A 2Z24A 3QQ0A 2WLYA 4O17A 1AH0A 3EWCA 1VJSA 5K3VA 1JPKA 3UZ5A 2E6DA 4DRHA 1ICPA 1AL7A 3WL0A 4WXZA 4Q8MA 1NELA 1R2TA 1R9HA 3LLFA 4REQB 2E1DA 1GWJA 4ERIA 2G37A 5DXXA 4D6EA 3QC3A 4HARA 3CT7A 2I9UA 4JDBA 4JEQA 4MDPA 4EF9A 1NWRA 3R10A 1AA1B 1I60A 1KC7A 1YDNA 4W9QA 1MXDA 3T40A 1UH3A 4ASTA 3GG0A 1UWUA 3OIHA 3PANA 2EPNA 1XW8A 4DRKA 3D6NA 4N9BA 3TR9A 4I6KA 3RX3A 1B6CA 3UQIA 4XVEA 2ZA1A 3W0KA 4A3UA 1Q6CA 3R4IA 1KXHA 4NXKA 1PX4A 1X97A 2JE8A 1ITQA 2BVWA 4HBOA 4U10A 1JEZA 2OJPA 3TAOA 4XWUA 2NVAA 4JNYA 4ITZA 1Q3NA 1NY1A 4I5RA 3S1UA 1JQXA 1XIMA 1IXPA 2O4QA 4RZBA 5FJRA 4ZODA 1UWTA 3H4WA 3LHTA 2FPTA 1PKNA 1E1FA 4QLLA 2E9LA 1VYRA 3TQKA 2CLKA 2O9PA 3TR2A 3W7EA 2J79A 5C9UA 1C9HA 4B5XA 3VPLA 4CVWA 3XINA 3SRFA 3LMYA 4H2CA 3BLLA 1ITCA 1TG7A 2E9BA 5I7GA 4DRMA 3PUDA 1XIIA 1MWOA 4CQCA 4WOZA 5AYZA 3QHOA 4LU0A 4F0KA 2ICSA 2OX4A 4N4QA 3UGVA 4I9AA 3KDOA 4B3LA 4WIWA 1A0DA 4CQ8A 1I8JA 1EKOA 1SJBA 4HSHA 5A6AA 1RA0A 3P5ZA 4ZXLA 4QEHA 3BMWA 3ZS4A 4F66A 5AOUA 2BBFA 3BARA 5HWJA 2PTWA 4DELA 4RNIA 3G77A 3AZRA 4QEEA 3LRKA 3UW6A 1ICSA 3WQEA 2O9OA 3VAVA 2JEPA 3SZ8A 3RRXA 2WLZA 3SFKA 5AYYA 1YPXA 2YOCA 3B0UX 3DN5A 2YPIA 3ONCA 3P81A 1DE5A 1GKQA 2VWTA 3W1XA 1A3XA 3RLGA 2W3ZA 3N29A 5MHBA 4GVFA 3FAWA 2PPGA 2V5KA 1D7IA 1LUCA 2TAAA 1W3LA 4NNCA 4PMVA 5CPOA 4J3WA 3SGZA 2X05A 3T07A 3VILA 3R0DA 3B0VC 1OVDA 4K8EA 4EPEC 3RIKA 3KACA 3LCIA 2EEXA 1R2SA 2X1RA 2WJDA 1V6VA 4QT2A 3EX1A 3W6LA 1GW1A 1W1YA 4H8UA 1IWAA 3AXKA 2BXVA 1KB3A 2E5CA 5M3WA 3R25A 1IHIA 1JCJA 4RLIA 4GIAA 3K8KA 1KGUA 1ADSA 1YKWA 3JZEA 1FWTA 4M29A 1KD0A 5CZJA 5I03A 3KZSA 3N73A 5EA9A 4KESA 2BFGA 1FKIA 5DO2A 1OX5A 1Q65A 3UR2A 3DGBA 3VKAA 4G9PA 1TE6A 2XVGA 4RK8A 2QJNA 1JCHB 1OFOA 2WYSA 3VOIA 1IZCA 2PEVA 3PHAA 3DYOA 1U1HA 1UR3M 1RH9A 1WKFA 3QY6A 2VOTA 4FB7A 5LNWA 1CXIA 2XH2A 3IGSA 3VKKA 5E6YA 4HHMA 1SW0A 2FH6A 4Y96A 4V28A 3DZ1A 1GOQA 5CPSA 2ISWA 2PP1A 3II1A 1O12A 3UI5A 3T7VA 2XGIA 4FALA 4J35A 2JGYA 1WAUA 2VCCA 3DDMA 3RUBL 1PX3A 3IIPA 3TKFA 2FVLA 2UY4A 4M7TA 1EGVA 3LX9A 5D2YA 5GNYA 2Y63A 1TWZA 3NNTA 3KHJA 3ZOAA 5HR7A 1IZKA 3VYLA 1EL3A 3UP8A 3CZJA 3SRHA 3MV11 4HZMA 2WM1A 1A0EA 1PVNA 2NQ5A 4XB3A 5IFTA 4C6OA 3QV6A 4IL0A 1W1PA 4ZENA 4FNUA 3SUUA 1SFLA 5BXRA 3IRDA 5DRIA 4NAEA 1RCOB 2DG9A 3HQOA 5AC4A 2OZTA 2RHGA 2PTDA 4EIVA 3NM3A 4ODQA 3FJ6A 4V27A 1EP1A 1AFSA 2XU2A 1GQNA 5I6SA 5JIWA 3DESA 1WUFA 4FIQA 1XJBA 1TWIA 1UKPA 3DFQA 1ONEA 2QLYA 1R9XA 3L5MA 5IBXA 1XI3A 1MW3A 2Y88A 4NNBA 1JYWA 5JUVA 1V6YA 4C91A 3FXYA 3NEHA 5CC6A 1V7AA 4Q4QA 3O15A 5K9DA 1ZJHA 3AOFA 4QJ4B 4GBDA 4W85A 3IK4A 2D2JA 4AC1X 1JZ5A 5A8NA 1V3IA 3IK2A 1WZKA 2A3BA 4KEVA 4KBXA 3V0TA 3UNDA 3HQNA 3ZQ9A 3TROA 4AZIA 2WZHA 3AZSA 3E5PA 2IW0A 2YLLA 4JTTA 5D9NA 1SPQA 3HMCA 3L4VA 3PZGA 4WXYA 3C0LA 4W9OA 3QSTA 3MMTA 3APYA 4PUUA 4DYEA 2ZQSA 3LXCA 3T2PA 4ICCX 4MZYA 4ODNA 4XX6A 2XH4A 2WV8A 3LERA 2R8WA 4AMCA 2J9YA 5FAJA 4LANA 1LOSA 3SGGA 3NSMA 4UMBA 3LU2A 4LUSA 2KAUC 3B0PA 4O1FA 4HNOA 1QPKA 2DP3A 1S1PA 2DEPA 3TU9A 2ABAA 4G1KA 4WR3A 4ACYA 5I5RA 3ABQA 3S9IA 3B9NA 3APGA 4ZTXA 3W2MA 3ARQA 5I23A 1QTWA 5GPRA 3ZVIA 4HCDA 1YE4A 4YS1A 2XIJA 1KXQA 5DBUA 4TXEA 4UTTC 3QMSA 1ONWA 3EWYA 3VD3A 4GUHA 1A3HA 1ISXA 3O6AA 4K7VA 5BU9A 3GNDA 1DJQA 3I4KA 2JBMA 3KOFA 2G5WA 4WX2A 1LUCB 1JIBA 1G4PA 4FX7A 5HOSA 2DW7A 4U4MA 4PRRA 1LDCA 3L67A 5FJPA 4NJJA 1JCLA 1E43A 4GI8A 1HX0A 3O6YX 3UVAA 1TMLA 3OQ8A 1AJZA 4FNRA 3MZNA 3AC0A 2FAPA 1EJWC 1XWYA 2X1IA 3GLCA 4LVDA 1HKWA 1OHLA 2XFYA 5C8BB 3G18A 4HP5A 3T2OA 3OLDA 4YTSA 4J4NA 3CWOX 5B7YA 4YIWA 1GOIA 3PZ9A 3CHVA 2V63A 1TV5A 4XBSA 4AB4A 5A2CA 3KP1A 1J93A 1HXVA 3EXTA 1YPIA 3W27A 2ISDA 3ATZA 3RJXA 4PCTA 5LZLA 2PLMA 2F9RA 3OA5A 3U5UA 4IPJA 5IRPA 3KWXA 4YYFA 4O8RA 3SUSA 4DJDC 4ML9A 1SR9A 1QFEA 2EQDA 4GJ1A 3SM0A 2FHBA 3WEZA 3UJ2A 4ADTA 3AO0A 3GU1A 2VUNA 4WHBA 4FNPA 5HNNA 2HS6A 3LHUA 3LCXA 4LB4A 2D23A 4JX4A 4AHOA 4RJEA 3ZWSA 2G3NA 1YATA 4GGQA 3I3EA 4O57A 1EYWA 4L1XA 1QXLA 3TVAA 1TJPA 4CEXC 3EX2A 1UWQA 3BGGA 4AZ6A 3PS7A 1LCOA 2ZZ5A 4L5ZA 4R9XA 3CHFA 1OYBA 4TUFA 4PRTA 3UT0A 3WMSA 2GDVA 3NL2A 1PZ3A 2OEJA 1EBHA 3OLEA 3VOGA 3FAXA 2PPOA 3RGCA 3D3AA 1TV7A 1UR1A 3AICA 2E7FA 2I57A 2VVSA 1OFBA 4ZVJA 5BCAA 4NAEB 3B8TA 3SW6A 1EWEA 2O4MA 1QMLA 3CQHA 2NV9A 5BOEA 4I9TA 4DIPA 5HNUA 2FDSA 1XBZA 3W82A 3DU0A 4Y2WA 5E0KA 4Z0JA 2PGFA 2ZUSA 1DWIM 1XLKA 5DFAA 1DJHA 1CIUA 1JCTA 4UCFA 1L6SA 1U5VA 2EBNA 3DBPA 2BZNA 3S0CA 1IZJA 4M19A 2OQYA 1SMAA 3ZJ6A 1SZGA 1TWWA 1FKSA 4QDWA 3WL1A 2XPBA 1OIMA 5G2IA 3WQ8A 2QUUA 2QT3A 1KBIA 3UJSA 2PDNA 3QPZA 3MUZ1 4QCEA 1GORA 4ZB0A 2AAMA 1UUQA 1SFSA 1QI0A 4OBRA 4JFMA 1AQHA 1YXCA 1XKYA 5EMKA 1KFWA 2WNQA 1HF6A 5CBBA 1M5WA 5EMLA 1HO4A 1VRXA 4ZPVR 3GDKA 2GJLA 4H8NA 1GYLA 4LUSB 4QZVB 1EB3A 1V6WA 2Y5EA 1NFPA 1KBBA 3N13A 4BI6A 2ZZ6A 1IEQA 1M65A 5CSSA 1TTIA 3XIMA 3UA4A 4IXHA 2QAFA 3ALFA 5HINA 4HN4A 2XGBA 2E3ZA 2VC7A 1CGWA 1FWNA 1R3SA 3BGAA 1EP3A 4BQ5A 2NV1A 4RE2A 2HMCA 5DN1A 4F3HA 3U2ZA 1RBLA 3MKCA 1NMVA 1G4TA 2GDUA 4PBGA 3REQA 1JDEA 1UG6A 1K7EA 4F2UA 4CN4A 4P7QA 3NXFA 2ZUVA 2Q71A 4MY1A 3Q58A 4M8UA 4I90A 3B40A 2VDGA 5D05A 1O7AA 4AZCA 3ECQA 2VR2A 3PPGA 3BPWA 4JNZA 4UIOA 2E6AA 4JXCA 4IPXA 3NQ6A 1VFOA 4OU1A 2ZDRA 1F40A 3RO6A 1NDYA 3W4RA 1K7FA 4RDYA 4UQDA 1U5JA 1B30A 1FFRA 1LZOA 1R38A 2V69A 5AB3A 3RNDA 2C0AA 3L4UA 3G6LA 2OWWA 3CEPA 1Q8JA 4I6VA 1EJXC 2XIIA 3NQBA 5HNTA 2PFHA 3W28A 3GD6A 4X22A 3FOKA 3SB0A 4NRSA 3BAXA 2XSAA 4X63A 1M41A 4EOUA 3GUGA 1WDQA 4LBRA 5E1QA 4O0KA 7TIMA 4UOJA 4Z2HA 4FXRA 1F3XA 3BLIA 3IEBA 3PFRA 4UZSA 5HANA 4JL2A 4U86A 4MZ1A 3RPMA 1S2VA 4EPBC 2DDXA 2DW6A 4QP0A 2A6LA 2WB5A 4AIEA 1BGGA 3EY6A 1EO7A 1VBUA 1FDJA 1UKSA 6TAAA 2IKIA 3AIUA 3DEQA 1JNDA 5JH8A 2GGIA 1M6JA 4NU7A 3G6MA 4DVOA 4JQ2A 1YBQA 1RSCA 3LMZA 3IVUA 1XIDA 4JX6A 1VBGA 1GHSA 2FB2A 1LBLA 1XBVA 5K9CA 3KLLA 2V81A 1XSKA 2ZZ2A 2R1LA 1VIZA 2W6RA 4NJHA 3SJ3A 1ODUA 4OT7A 4JQ1A 2J9XA 1Q7QA 3AWNA 5KZEA 2E28A 2PDUA 1QPRA 2BVDA 3C0QA 2V0TA 1KKOA 4XBKA 3FN9A 3VABA 1YADA 1W1TA 2XSBA 2PDQA 4L4LA 3IJ8A 4IHCA 4LAZA 4B5VA 1GZGA 1XLCA 1MSSA 1A50A 2F7FA 4HTYA 3B9DA 2YCLA 5A6KA 1CNVA 1RCXB 4N2YA 4H9MA 3TZNA 2XP8A 4GO8A 3TN4A 1A5LC 3W9ZA 1MI3A 4FO4A 1KA9F 1Q85A 3SDOA 3THQA 4IIDA 2REQA 3K8LA 1EOKA 3BDKA 2YXXA 1LOQA 3OZOA 2J74A 4PSRA 4GA8A 4ODOA 1PZ1A 2VEKA 2D2GA 2XIMA 1KCLA 4DRPA 1PB0A 4DRSA 3C0SA 3R58A 3G1FA 3RCMA 3W7MA 1DJZA 1WPCA 3RM8A 2E6YA 1VD6A 4LF2A 5LSMA 4GABA 2GFTA 2WMJA 4E3VA 3H2AA 5JBEA 2KI3A 2C15A 1R3TA 4UFIA 3CWNA 3NM1A 3NTPA 1E4MM 4NZ1A 3W22A 4IGSA 1UBSA 4CD6A 5AVHA 2XHYA 3M0IA 1GQLA 4AUBA 3B03A 1PCKA 1ZSXA 5EL1A 3CZ8A 4D71A 2CFFA 4C90A 3A4WA 1UIOA 3MA8A 1GKRA 2QGYA 3DIPA 2ESCA 3C0JA 1FHUA 1JUKA 4M1BA 1J6PA 1VFFA 4W4QA 2XWEA 4TVUA 1UUOA 1US2A 1ISWA 1H7XA 1DL3A 1R3VA 3A9BA 1KBKA 2CNCA 3PUOA 2V67A 2R1MA 1Q13A 2BSLA 1XRVA 4FOKA 7TAAA 4G6CA 4A21A 1PCWA 1TX0A 2VEFA 4JIEA 5T9CE 4IJRA 2VJXA 3MKVA 1JRBA 3I6TA 4W8BA 2Q09A 4GKTA 2ZX8A 1JRCA 1JZ4A 2H90A 2GQ8A 3OYZA 2DZTA 3VVGA 3W26A 4N4PA 3NPUA 3KBNA 3AMLA 1EA9C 3P8IA 3NQ8A 2POZA 3VNMA 1UOZA 3VOFA 2CCRA 4L80A 3REQB 3RCNA 1FP8A 3VUPA 4B2DA 5H1WA 3MSYA 5D04C 1M9HA 1OF6A 2NWSA 3BJSA 5A95A 3G1YA 4TW6A 1YXDA 4AZCB 1AMKA 3K4WA 2GJRA 2EJ1A 2PLJA 1NF7A 4Z08A 2GGEA 4RE4A 2AKMA 1L8PA 4E5TA 1AH3A 3KUMA 4H41A 1X38A 1K6WA 4X9YA 1V6UA 1ZJBA 3ZJ8A 1Q7MA 3ES7A 4UTUA 4MYAA 1NWUA 4HNLA 2JKAA 3H2OA 3KVLA 1ML1A 1B31A 4HPXA 3NTYA 3QZAA 4FNTA 1OBAA 1US0A 2VMFA 4E8GA 4IJBA 3KM8A 1SZEA 4D6JA 2BLEA 4OECA 2DPEA 1V02E 3NVTA 4URIA 2VZTA 1TPC1 4L61A 5ABEA 4BFAA 2DZAA 2OMAA 4UFKA 2HK0A 1XX1A 3UZWA 3ID7A 1BVWA 4JFTA 3WUBA 4CQBA 2FDMA 2E25A 3CU2A 3L2IA 3ZLHA 3LV6A 4C6CA 1JZ3A 1XLGA 1I0BA 5DY2A 4QG8A 1F8IA 4PMOA 4YWIA 1DOSA 4WD0A 5LHFA 4FEZA 4C6PA 1IT0A 3EDDA 2OXNA 1YBQB 2GGJA 3SBFA 1LP6A 1YYAA 1YNQA 3U2OA 1UWIA 4GOAA 5TIMA 6A3HA 1JD9A 1T6MA 2NUWA 5XIAA 2HQAA 3EXRA 4HOWA 4O1CA 3PBWA 3W7GA 2PDBA 3LB0A 2VEIA 1SJAA 3NZGA 4KWVA 3AHTA 3GNRA 2ZZ4A 5CPTA 3JS3A 4PEEA 4LH8A 1K02A 1RZMA 3UF8A 3FVDA 4PMXA 3VZXA 1TZZA 5HMSA 5HJLA 3DG3A 3DOPA 1XYZA 2VOMA 3KTXA 3WQDA 5C0QA 3KABA 3EGJA 5HT1A 4FPSA 3PBYA 2Z1BA 4QLKA 4XD5A 3KDNA 2YCLB 4J3VA 2PDHA 3PTKA 2A3AA 1L0PA 4BR1A 3RILA 3KBWA 4ACZA 4AWTA 3OB8A 4H1ZA 4C1LA 2VNCA 4JFUA 2REQB 5AYBA 3MHFA 1JQVA 3W85A 1SZRA 3NA8A 4AVNA 5KSWA 5BOOA 3RM4A 4OGZA 4HNUA 1F74A 5SWUA 3M5YA 2CYGA 3KW3A 2J8FA 4JQAA 2ZRUA 1VHCA 1VEMA 3SQMA 2DUAA 2F61A 4JTFA 3L65A 2V6AA 3WLOA 3BH4A 4BKNA 2WSPA 2XTKA 4W8LA 3GTIA 1FD9A 3MDUA 4Z2JA 4CN1A 2FZ9A 3I6CA 3IJ7A 2QJIA 3S2NA 1V93A 1R86A 1BSIA 1LBFA 4JPGA 1UC4A 1W9VA 2FKEA 1VJIA 3O5FA 1W9PA 4XAZA 1Z42A 5KEZA 1ZP4A 2MLY