1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
molecule tags Signaling protein
molecule keywords signal processing protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
4PTVA 5A1AA 3B8SA 1G94A 5BXRA 1GUVA 1O6IA 1GHSA 5FOOA 1ISYA 4OBRA 4N0RA 7TAAA 2X09A 1E43A 1CWYA 2C7FA 5JH8A 3SCWA 4W8LA 3KE0A 2VR5A 2VRKA 2QLYA 2O92A 4M8UA 1PPIA 2C8NA 3VU2A 5M5DA 5A6SA 3QHMA 2W92A 3WF0A 2XIBA 3D3AA 4HU8A 1V6VA 1ISVA 2G4FA 1UUQA 1XRVA 4JFWA 2RGLA 2PWEA 2CHNA 2YKKA 1BLIA 1DWGM 2F61A 4KRTA 3M7SA 4AEFA 4ATWA 1VRXA 3M6DA 1W1YA 2ZXQA 3T2PA 5A8PA 2W62A 3K46A 3OLIA 3PZVA 3VOCA 3W53A 2DGAA 3GYCA 3CZEA 4P7NA 2J79A 3EMZA 5BXTA 1HKJA 1KXHA 1UA3A 1JYWA 2WK2A 3EYPA 1A3HA 3ZOAA 1BHGA 4TVCA 1TCMA 5CGMA 1GQLA 1VIWA 4PMZA 4AZCA 1FFRA 3ZIZA 1EO5A 1UKQA 3FHAA 1UWRA 3BMWA 4U33A 2YLLA 3UCQA 4HMEA 5ABFB 2WVSA 4JL2A 4ML4A 2J47A 1E3ZA 4LGXA 2W67A 3AICA 4PSRA 5CLWA 3ALGA 2J25A 2EPMX 1R85A 2EO7A 2WCGA 4AZBA 3WD4A 3OBAA 1CXLA 4S3KA 3GH5A 2WWCA 4BA0A 3CZ8A 1CGYA 5CG0A 3NSNA 1JZ2A 1EDTA 4PSPA 4UFIA 3WBAA 4YPJA 1V0KA 4ACZA 4PCSA 1NOFA 1E5JA 3DHUA 4PTWA 2YBTA 1UKPA 2DH2A 1CTNA 5CXPA 1KGXA 1XH1A 3OGVA 2Y4SA 3PZIA 3WFZA 1UYQA 1FFQA 5A6MA 1BG4A 3I3DA 4NRSA 4X9YA 1W9XA 5FL0A 1FP9A 1UR9A 4HZ8A 3THDA 1QI3A 3CBWA 3UR8A 3W29A 4AD0A 4ZE4A 4CD8A 3BLPX 1UKSA 3HJEA 3OZOA 2RGMA 5A6AA 1ZU8A 5EFFA 4TXEA 1KR0A 3FN9A 2ZUUA 4J3XA 6A3HA 4GIAA 4GQQA 4PMUA 4UQEA 4GO8A 3WQ8A 3RO8A 3L2MA 4A3HA 3ZO9A 5ECUA 2E9LA 2E0PA 3W82A 2OSXA 2YOCA 3B9DA 4YHEA 3MUZ1 4CCEA 1DWIM 1EA9C 3OG2A 1W9DM 3BAXA 3NJ3A 3ARTA 3FAWA 1HN1A 5ABFA 1UD2A 1QBAA 1RD6A 4PMRA 4HMDA 3EDEA 1QPKA 3ALFA 3L4TA 1MFVA 1PJ9A 4YHGA 2ZXAA 2UY4A 3VGBA 1V02A 4AZIA 3T2QA 4DWSC 3J7HA 2OWXA 1GQJA 1QBBA 2E8YA 2BHZA 3WUEA 3T09A 3N11A 2BXZA 1M04A 3EDDA 5HDRA 3VDAA 3WMCA 9CGTA 2A3HA 4BZYA 3GXIA 2PWDA 1JYXA 3GDBA 1UWQA 2CXGA 2WWDA 4J3UA 1H4PA 2YLAA 2JEPA 5E09A 4KGJA 1UR1A 4P7RA 3CUIA 1WO2A 3POCA 2BY1A 5CPTA 3WY1A 3MS8A 5EBAA 4PUDA 1Q6GA 3ARXA 1V08A 2QPUA 3MMDA 3SCNA 1HL9A 1YHTA 1HJUA 1E4MM 3WNNA 3SEPA 1ESWA 1B3YA 2TAAA 2DT2A 4OOUA 1QW9A 1ZBVA 4MNKA 1C91A 2DIEA 1WE5A 3ZQ9A 3T0BA 3WN6A 1NH6A 2J7DA 2VX4A 3AIVA 1B3XA 2J7FA 1MVYA 4UQDA 1B1YA 4AZ6A 4CD5A 3AMLA 1CXIA 2V3FA 3NSMA 2IUZA 4P8UA 1RP9A 3QOMA 1GOMA 3TTOA 3CHEA 5DFAA 1JZ7A 1KXVA 1WZKA 4FLSA 2DSZA 3M07A 3VGGA 2Y8VA 3CGTA 2Y5EA 4F9JA 1I1XA 1CGUA 5LYRA 3VINA 2G41A 3WL1A 1ZJBA 4V28A 4RL3A 2WSKA 1H0GA 3EDKA 3ARZA 3ZM8A 1X6LA 1E0XA 4Z2LA 2CEQA 3WF4A 4WK9A 3EDFA 1A47A 3AZRA 3WMBA 3W4RA 3AISA 3WDQA 4Y7EA 1UQYA 2IXUA 2J7HA 2ZWZA 1KWGA 3ZR5A 4M56A 4ATDA 1E73M 5CPSA 1ITXA 1OB0A 2NT0A 3RJXA 4IPNB 2J8FA 2DSWA 3MMWA 5JIWA 5KEZA 1BYAA 3VIFA 1HT6A 3WH7A 4AISA 1UD4A 5LA1A 4LYRA 2OYMA 1QOXA 3AYRA 3SUSA 2WBGA 4JHZA 1JZ4A 2DIJA 4AEEA 2ZE0A 1CLVA 3TONA 3GNOA 3WSUA 3RM4A 1JXKA 5FIPA 5BRPA 3KL3A 2D24A 3OGSA 4TUFA 5IFTA 2O9OA 2VZOA 2J77A 3L4ZA 1DHKA 1WDRA 4JL1A 1E55A 3AMDA 3WMSA 1HP4A 1EOKA 1EQCA 4EANA 4ZENA 3AZSA 1OCQA 5BROA 1QNOA 1BTCA 1W91A 4JFSA 5A6BA 2E9MA 3WEZA 5ABEA 1V6WA 3AHXA 5A2CA 1EGZA 1E4NA 3SCUA 1J10A 1GVYA 3W38A 1KR1A 1C8QA 1V02E 1LL4A 4DM1A 1UOKA 2FH6A 1MFUA 4LX4A 3FY1A 3AS3A 3VDHA 3ARWA 1LG2A 2E40A 2J7EA 1V03A 3K4DA 4PMDA 1PZ2A 2WSPA 1J12A 4OOZA 4PCTA 4F8XA 5IHSA 1OM0A 4TVUA 2XVPA 2ZIDA 2D3NA 2YDQA 5FL1A 3O2LA 3VNYA 2GJXA 2CBUA 3ZJ8A 3BAKA 1UQZA 3AIRA 4UFMA 5A94A 1KGUA 4NF7A 5HBFA 1FH8A 4GZJA 4WKAA 2ZWYA 1ECEA 4MTVA 1R7OA 3ZJ6A 2JF7A 3VD7A 4L4PA 4KRUA 3VD3A 1QHPA 3ZJKA 1ZB5A 3KZSA 3VIKA 2CPUA 1B31A 3VMNA 1EOMA 1V6YA 4U31A 4M29A 2PBOA 5BXSA 3KEHA 2CBJA 1MWOA 1GJWA 3GH4A 2OWWA 1XCXA 1EDGA 4E2OA 1B3WA 3MUAA 1BGGA 1P6WA 4WLCA 3AI0A 2DSVA 1FHDA 5JIPA 1UH4A 2BFGA 1U2YA 2O9RA 2O9TA 2JEQA 2BHUA 4AD3A 1M03A 1H5VA 2XWDA 3WIJA 2CHOA 2V3DA 3FW6A 3BAJA 1TMQA 4AD2A 3VIHA 4P7QA 4U3CA 3WDPP 3APGA 1M01A 3OLGA 4MJ4A 2WKLA 4JFVA 1V0LA 4GPNA 1VEMA 5A3HA 1CNVA 2ZUMA 5EFDA 4B16A 2VQTA 4HOZA 1MW3A 1WB0A 1N82A 1OGBA 3WUGA 4JZ5A 2ZXDA 4MPKA 4QP0A 3TOPA 2J62A 2FGLA 4D1JA 1E1FA 1G1YA 1EHAA 2XM2A 2VI0A 4XB3A 1MW0A 3CIVA 3EMCA 4ZE5A 5GNYA 1E15A 3LPFA 1J0HA 2HISA 2FHCA 2VQUA 5JUVA 4Z2HA 3TTYA 4HP5A 1TE1A 4LYQA 2JFEX 5A8OA 5BCAA 2DT3A 4CN6A 3BAWA 1JI2A 3A4WA 3OLEA 4NRRA 3VD4A 1JZ5A 1HNYA 1UZ1A 4W88A 3AIEA 2XUCA 4A4AA 2XWEA 2DT0A 1NP0A 2WLYA 1L0PA 1HJQA 4F9DA 1B3VA 4B15A 4UFHA 3MV11 2QMJA 3T2OA 4MB3A 2D2OA 1H1NA 1OT1A 4JAWA 2ESCA 1W9BM 5FKYA 3VM7A 3NSXA 1WNOA 4E8DA 4AC1X 1F4AA 3L4WA 3MSDA 1JG9A 4WKFA 4MNMA 1YQ2A 2WZHA 5FD0A 2WCSA 3AMKA 4PMVA 3VIPA 4WSKA 4AW7A 2PWHA 3W28A 3AIWA 3CHFA 2YL9A 4AZGA 5D9NA 3VIMA 3A3HA 3PTMA 1VFOA 3GTNA 3M46A 4H7VA 1GHRA 4P7LA 3W26A 4MB1A 2CETA 3AFBA 2XFFA 3CUGA 3MANA 5I24A 1UR8A 2MANA 3VTRA 1UKOA 5DF0A 1JAEA 1OSEA 2YL5A 3W27A 2VTFA 3QHOA 2J74A 3SCPA 1H0IA 4J3SA 1XHGA 1UWSA 4QCFA 2WVVB 1ZBCA 5JBEA 3S6TA 1KQYA 4MAZA 3AS0A 3PTKA 1C7SA 1UWIA 4CD6A 1C7TA 1J9YA 3SUWA 2GSJA 2VR4A 4R5EA 2FHBA 3WDHA 2ZX6A 1EQPA 5AY7A 2D20A 2FHFA 4EKJA 1SR0A 1DTUA 3AMGA 3CTTA 2G8ZA 2VJXA 4HOWA 1JGIA 5E70A 3CHDA 4WIWA 1E40A 5AYBA 2VX5A 1HVXA 1JIBA 3TTSA 4QFUA 2E8ZA 2GJPA 2GVYA 4XV0A 3LPOA 1PX8A 3SCVA 4BCEA 3WD1A 3IANA 1DWFM 4M80A 4W89A 4Z2GA 4PMXA 4ZXLA 2D0FA 2BXYA 5DO8A 1BFNA 4M82A 1J0YA 3IJ8A 1IZKA 3DYMA 5I78A 3A47A 2XSAA 4LQ1A 5A8NA 4CCDA 1G5AA 1CDGA 3DYPA 1GVIA 1SMAA 3WDRA 2VCCA 4D6JA 2EPKX 3A4AA 1BQCA 1Q4NX 2QPSA 3U5UA 5I6SA 4UFLA 1TR1A 1J0KA 4QCEA 3W81A 4ATLA 2WW5A 3CZLA 3SCQA 4N42A 1X6NA 4W85A 2Y24A 1F4HA 2WHKA 3K1DA 1KBBA 1J0JA 1E9LA 1BYCA 3AXIA 1I75A 5F7UA 5DT7A 4MNJA 1J18A 5IXEA 1UH3A 2B31A 1E4LA 2X1IA 1B30A 2VRQA 4D71A 1QI5A 1LWJA 1UR4A 2PC8A 1B2YA 4B3KA 2O9PA 1R7AA 2V3GA 2OWCA 3GZAA 1CXHA 2EJ1A 1EDQA 3WUBA 2ZUSA 1GJUA 2VZUA 4MNLA 1E0WA 2XVNA 1L8NA 2W66A 4FLQA 1TZ7A 1PEZA 1NWTA 1JYVA 4WSJA 4FF5A 2D22A 3TTQA 1V3KA 2XPKA 2QV4A 4LPCA 1E6RA 4IPLA 1GOWA 4BF7A 1HKMA 2V3EA 1MW1A 4F66A 1W3KA 3FAXA 1CIUA 2ZX8A 5GNZA 3ZT6A 2WVUA 4AZHA 3WF2A 4H8HA 1V3IA 3WF3A 1LL6A 4P8VA 4CD4A 3F5KA 2GDVA 3OZPA 4QLKA 1TVNA 5A8MA 3GBDA 2PF0A 1E6ZA 1QVBA 3ZR6A 5D4YA 4CU6A 2VURA 1JNDA 3DC0A 2QF8A 1NQ6A 1XYZA 1C92A 1J0IA 4AXNA 2EPNA 5C71A 5I77A 2AOSA 1E0VA 3UG4A 3ARSA 4MAVA 2IXVA 2WMKA 3AYSA 1X1NA 2JIWA 4HZ6A 1TG7A 4TTGA 4WKHA 1E5NA 1WKYA 1CGXA 1K9FA 1R86A 2BVDA 3KL5A 4CU8A 5BWFA 4UZUA 4EK7A 4CN4A 1XGZA 3DYOA 3EMQA 4IUGA 4J7RA 3PBGA 4M1RA 2XM1A 4U3AA 1NWUA 5D8ZA 2W5FA 1LLOA 4V27A 5KZ6A 2Z1SA 2WMIA 4GKLA 3B9EA 3QR3A 3GM8A 5I23A 1V6UA 1JNEA 1BGAA 2ZUWA 1D3CA 3AS1A 3IK2A 3VDBA 5D8WA 3DHPA 1VFFA 2GUYA 4NSBA 5ABGA 4JFTA 3NIYA 3N13A 5CGTA 3WH5A 3MO4A 4HMCA 4J3VA 3IAQA 4OZOA 4WJXA 1J0ZA 2VX6A 4D6HA 3W6MA 1KCLA 3WDIA 2WMFA 1UHVA 1NWRA 1JXJA 2C0HA 1W3JA 3B9AA 2Z1KA 5D9OA 3MUY1 1GNXA 4C7DA 3CZKA 2CKSA 1JDAA 2WXDM 3PHAA 1DP0A 2WHJA 4RE2A 4UFKA 3EDJA 4PN2A 1NOWA 2Y8KA 3VKKA 4QLLA 3WNKA 3SUTA 1E6PA 5AC5A 1DEDA 2OSWA 3U57A 4S3JA 2QMKA 2G3IA 4FLOA 2CIPA 3RM9A 3MUIA 3T0AA 1S46A 4GXPA 1CPUA 5CSUA 1BAGA 2J7GA 2ZUTA 1LG1A 3GNPA 4M24A 4W8AA 2A3EA 3D5HA 1TA3A 2VRJA 2GDUA 1UD8A 3WELA 4UTFA 1K9TA 4MJ2A 4IM4A 1JF6A 3VIJA 8CGTA 3WH6A 3WKZA 4Z2IA 1V0NA 5C70A 4Q7NA 2DT1A 4TX8A 2WM0A 4F79A 4HPGA 6CGTA 3BSGA 1R87A 4W87A 3U7BA 4NI3A 4Z2JA 1NP2A 1KXQA 3ZJ7A 1JF5A 3W0KA 3K4AA 3POHA 3JUGA 2ZX5A 1RP8A 1EO7A 1KBKA 2BHYA 1W2PA 1OGGA 1FH7A 4D6EA 3OB8A 3NDYA 2UWFA 4KWUA 4PYSA 3RPMA 4P8WA 4W8BA 3N15A 3F5JA 1OT2A 3AIQA 2ZX7A 1ZJAA 3MKKA 3NCOA 1HJSA 2WB5A 4AD1A 1W3HA 4W7UA 4CU7A 1VFMA 2VUYA 3WUFA 4D6FA 5IHRA 3K8LA 1XSJA 3N1AA 4QAWA 2CERA 1NWSA 3A6OA 2AAAA 1E6XM 1PBGA 3VGEA 1CGVA 4UOZA 2OLHA 2QHAA 3UERA 2X8RA 5HOSA 1EXPA 4UNIA 1ISWA 3U7VA 1VB9A 4HU0A 4DWSD 4Z2KA 3BCDA 4HA1A 3WQ6A 5CLTA 2ZICA 4KGLA 3PZNA 4GI8A 4DUXA 1PIGA 1E70M 4ZFMA 1ODUA 1BPLB 1U30A 2VZSA 4LYPA 3KL0A 2EBNA 4E4PA 1WDQA 1J11A 3GBEA 2VL4A 1US2A 2X05A 2XJ7A 3ZT7A 1H2JA 1QI4A 4RE3A 4AY1A 2VOTA 4CUCA 3WD3A 1CEOA 1JZ8A 2A3AA 3SCTA 1OD0A 4U2YA 5A8QA 3WQ5A 5HNNA 3ZT5A 3WQWA 4UQAA 1E56A 1CXEA 4JKLA 3L4XA 1DWAM 4UQ9A 2A3CA 1WCGA 4YN5A 3VD5A 5EMYA 4JKKA 3CHCA 2BY0A 3BAYA 3I3BA 3CH9A 2WVTA 1H11A 4BS0A 5LA0A 4H8UA 5E0CA 4D6CA 1VJSA 5A2AA 2J78A 3VX0A 3ZSTA 2UY3A 2X2YA 4MB4A 4J27A 1B3ZA 2VC9A 3WH9A 2X0YA 3FXYA 4MB5A 4W5UA 1VEOA 1GZJA 3QGVA 4J3WA 4W84A 4NZCA 5ABHA 4HOXA 4OIFA 5A6BD 4JIEA 1JDDA 5E6YA 1JL8A 2XVGA 2YBUA 2DDXA 2WHMA 4BQ4A 3VGHA 2XIIA 4DWSB 1PAMA 2ZX9A 2E3ZA 1BVNP 1G9HA 1GONA 1BYBA 4TX6A 1FOBA 4LXFA 1WAWA 3AROA 3ARPA 3FNDA 1FH9A 1BF2A 4W86A 3THCA 2WYSA 3WH8A 3CZJA 1HIZA 2PWFA 1W9PA 2WNWA 2PI6A 1JYNA 3IJ9A 3PTQA 4FLRA 3AQUA 2YDRA 2D0HA 3F4VA 2WZIA 3WEOA 4W7VA 2E9BA 1CBGA 2EXOA 2J7BA 5E9AA 2WLZA 1CYGA 4HA3A 2V38A 5I0DA 2GJXB 2YA2A 1G0CA 5CPQA 3PN8A 2JF6A 1PX3A 1SFSA 4GI9A 3WNOA 4U5IA 2VVNA 3VIOA 1KXTA 1QNQA 1M7XA 4PUEA 1KCKA 3RMEA 4AIOA 1UD3A 1W2VA 1JZ6A 4J28A 1E71M 3K8KA 4X0VA 3G6MA 3PZ9A 1KFWA 3WD2A 2BNJA 3U5YA 4BQ2A 4OUEA 4XX6A 5D9MA 1LL7A 4CVUA 1E6SM 3CMJA 2ZUVA 1ISXA 3UEQA 3BMVA 3BAIA 3GXDA 3VIGA 2Q8XA 3AIUA 2WC3A 1ZL1A 1V3JA 4QLJA 3CLWA 3HN3A 2BVTA 4OKDA 4PMNA 3VNZA 3N18A 1W3LA 1SMDA 3BLKA 1XD1A 1QW8A 3PZMA 1E72M 4ZEPA 2CCRA 1KWKA 3RM8A 1GOKA 4AYSA 1E4IA 4KMQA 4B9YA 2WHLA 3VO0A 3ARRA 4MDPA 1J01A 4CVWA 3UG5A 1E3XA 1TVPA 1XSKA 1V3LA 1CENA 2DPEA 1UH2A 3WQ4A 1QI2A 2WMIB 1VJZA 4L4OA 2FGZA 1GOIA 4AZCB 3O6AA 3T08A 3BC9A 3UETA 2JIEA 2YA0A 3VX1A 1C8XA 1JZ3A 2CITA 2W61A 3E1F1 1KQZA 3NUKA 2XFYA 4W7WA 2XGIA 2D0GA 2WCAA 2WANA 2CKRA 3DECA 3BCFA 3UG3A 4UFJA 2NSXA 1Q6FA 5A6LA 1MQPA 5E6ZA 3CUFA 2XVKA 4UOJA 3GXFA 3MU7A 1JI1A 3UESA 2XFRA 1B9ZA 2CNCA 4UCFA 1K9DA 3RILA 1D7FA 1MQRA 4HPHA 2XTKA 3WQVA 1XCWA 4AD5A 4H04A 1W1TA 2UY2A 1VFUA 1AQMA 2BVYA 1CLXA 1K9EA 1BG9A 1XC6A 5D9PA 1C8YA 1H41A 3AHZA 1O7AA 3BH4A 2W91A 5IFPA 2J7CA 3AHVA 4D72A 1ITCA 3EBVA 1UZ4A 2DEPA 2ZUNA 1NARA 3SCRA 2J4GA 3VGDA 1GQKA 4GZEA 1E1EA 3TP4A 2F2HA 3WBEA 1IZJA 3SIMA 5HPOA 4OJYA 1OGSA 2D3LA 2HVMA 3VMPA 3VD9A 4M81A 1XH2A 1OIFA 1HXJA 2G3JA 2XYLA 1HF6A 3W24A 3CO4A 1LQ0A 4BQ5A 1GPFA 2EEXA 2UY5A 4J3TA 1C90A 3PZUA 4R27A 4PTMA 1UA7A 2DSKA 3WENA 1VEPA 2YA1A 4HZ7A 1CGTA 5A6KA 3RDKA 1V6XA 4B9ZA 4K68A 1Q6CA 4PMYA 1HKIA 5A95A 4AZ7A 2J8GA 4DUVA 4C7FA 4CN1A 4AWEA 4P7OA 4H2CA 3AHYA 3W37A 1KGWA 3FHQA 1XSIA 4PMQA 1ZBWA 1W1VA 1C93A 2ZXBA 1EH9A 5BRQA 1WZLA 1OWQA 2DSUA 5LA2A 2WVVA 3VDCA 4AZ5A 3SURA 1MW2A 1TA3B 3O9NA 3LMYA 4DWSA 3NDZA 2BV9A 2GK1A 1XH0A 4MADA 4V2XA 3ZSSA 4BQ3A 1R8LA 1CXFA 1GQIA 2WAGA 4QDMA 4RE4A 2FDMA 1QNPA 3VMOA 1NOUA 2JE8A 3IJ7A 2GFTA 2WBKA 2YL6A 5GPRA 1D2KA 3S2CA 3ZMRA 2VZVA 5E0FA 4E8CA 5CZKA 4GI6A 3N9KA 5HPCA 2CESA 1QI0A 3WD0A 1GORA 1HJWA 2OYLA 4UQCA 4JHOA 2AMGA 2VT0A 3GXMA 3ARQA 4UOQA 5IDIA 1K6AA 3AZTA 3CUHA 4JFUA 1WDSA 1JAKA 3WL0A 4U5KA 1AQHA 4CD7A 3GH7A 4AIUA 5CSYA 3MV01 2BY3A 2OYKA 1VF8A 3VILA 3ARVA 1U33A 2X0HA 3GNRA 5AYIA 1LJYA 2OSYA 3L4UA 3N12A 1MYRA 2XHYA 1V3HA 4D6IA 3WNPA 1UWTA 3N17A 4A3YA 3PZQA 2J75A 3UR7A 4FK9A 1B90A 2XGBA 5BYWA 4JKMA 4U2ZA 3AOFA 3L4VA 4AIEA 1CXKA 3OGRA 1OIMA 1VAHA 2VX7A 2VCAA 4KH2A 1VBUA 2FH8A 1BSIA 3CPUA 5JBDA 2CBIA 2NT1A 1WZMA 4OBSA 1EHNA 3RCNA 3OLDA 2EQDA 1UD5A 2D1ZA 8A3HA 1LF1A 4JCLA 1W1PA 1GCYA 2E4TA 4CCCA 1LWHA 5M03A 1G01A 2PB1A 2VVSA 1UKTA 3L4YA 1JFXA 3MMUA 4CGTA 2WPGA 2GK1B 3II1A 4GZIA 1E6NA 1BVZA 2WC4A 3BGAA 2YDSA 4W5ZA 2W63A 3N04A 2PBGA 5A2BA 1H49A 1HKKA 3ECQA 1C3FA 3PZGA 2BS9A 4MDOA 1MXDA 1TFVA 1VENA 4H8VA 2V5CA 3VM5A 3WDJA 1OBAA 3WEMA 3CZGA 6TAAA 3HMCA 1US3A 2WZEA 2WKGA 4TTUA 1AVAA 3AMCA 4IISA 4PBGA 2WMJA 2D23A 1Q6DA 1GW1A 3VPLA 1WZAA 3ARUA 2PWGA 1HJXA 1WP6A 2ZOXA 1QNSA 3KWXA 4UQBA 1MQQA 3BXWA 1XYFA 3BSHA 3WF1A 2NW0A 1CZ1A 1FA2A 3PZOA 1CGWA 1XV8A 3SUUA 2WC7A 2G3MA 3CUJA 5A69A 5CJ5A 3K8MA 2XG9A 5EB8A 1QHZA 3HU7A 4DUWA 3RIKA 2YL8A 4PRWA 5M17A 1WPCA 2VZTA 1IT0A 1UD6A 4PEEA 1I1WA 5HXMA 5I5RA 3VUPA 4ZXOA 4ACZB 1HX0A 3W25A 4AMCA 5DEZA 1M53A 5DMYA 4EE9A 2JALA 1XD0A 4UZSA 3CMGA 1H09A 1OD8A 4HTYA 2XSBA 1HVQA 1UWUA 1WDPA 3VGFA 3AXHA 3SCOA 3WFLA 3AJ7A 3WNLA 1W32A 1HJVA 2VNCA 1AMYA 4DM2A 5BXPA 4D6GA 1Y7VA 1V3MA 1AQ0A 3AS2A 1JD9A 1PX4A 3I3EA 4WF7A 2WMGA 1FP8A 5A6JA 4UR9A 5M3WA 4X0NA 1Z32X 4D6DA 2A3BA 1H3GA 2EPOA 1V0MA 3WNMA 2WMHA 1KB3A 1TUXA 1JFHA 1RPKA 5GQBA 1VBRA 1NM9A 2BY2A 1W9VA 2XVLA 2YIHA 1B0IA 3A4XA 1CECA 1GOQA 1JD7A 3RJYA 3QOKA 2W4XA 4GO9A 3T0DA 1HL8A 5GNXA 5JBFA 2CBVA 5AC4A 1QNRA 4EAMA 2DQXA 2VMFA 3AXXA 5DT5A 3NYDA 4P8XA 4CKQA 3OA5A 2EPLX 4URIA 2Y2WA 1UR2A 5C8BB 4GQRA 1ISZA 3MSGA 3SUVA 3VIIA 2GJRA 4W93A 3SCSA 1IV8A 4PMOA 2VO5A 4XZWA 1DWHM 3AIBA 1ZBKA 1E6QM 1GOOA 3LPGA 4PTXA 3PZTA 2VCBA 4AD4A 3F5LA 3G6LA 4TOQA 2CYGA 4HA4A 4ACYA 4XUYA 5I3DA 2G3NA 1FHLA 1PZ3A 2V5DA 1UR0A 4Q22A 3W6LA 1RH9A 3OIHA 3IAPA 1JDCA 5CQ1A 3LPPA 5I79A 5FCZA 2F8QA 4JCMA 1SYTA 5TD4A 1UG6A 1MXGA 1ZS2A 4H41A 1ODZA 1Q6EA 3QHNA 1DWJM 1BYDA 1HP5A 4GINA 4TVDA 1OINA 3VVGA 7CGTA 2YJQA 1PIFA 7A3HA 4C7GA 3ARYA 5I2UA 3TA9A 1EIBA 4XZBA 1W9UA 2DH3A 3AHTA 1QHOA 4B3LA 4FMVA 4D1IA 3L2LA
chains in the Genus database with same CATH superfamily
4LAOA 4ERGA 2E1DA 1A49A 3TJLA 1XICA 5BXRA 4MKNA 3ITCA 4V1YA 1U5VA 1PYMA 2YZRA 4NG3A 5FOOA 2OX4A 1ISYA 4NYUA 4DNHA 7TAAA 1D8CA 3TIMA 1CWYA 1FWSA 3SCWA 4A8IA 3KE0A 3TYBA 3LZ5A 3THAA 2RJGA 3I4EA 3WF0A 1Q66A 2GUUA 4NYYA 3FKRA 4ZR8A 4L1WA 4FXJA 3W2LA 4KRTA 3SN0A 1VRXA 2ZXQA 2W62A 3K46A 3OLIA 3PZVA 5T26A 4IP4A 2DGAA 1RV8A 4P7NA 3PWIA 3QPYA 4XAYA 4S2BA 3URAA 3EYPA 3TC7A 1R47A 2QKFA 1GQLA 3A4JA 4M19A 3G24A 1VIWA 4AZCA 4DEFA 3GUGA 1TWSA 1VFSA 1YXDA 3BLOA 1H62A 1EO5A 3HJZA 1Z8AA 3H2EA 1OFDA 4QE1A 2WVSA 2F4EA 4JL2A 4PH6A 4ML4A 4LS1A 3M0XA 2XDFA 4LAUA 2INEA 4PSRA 3ALGA 3L0KA 1R85A 2WCGA 2Q8LA 1K8YA 3OBAA 3TSDA 1CT5A 3BURA 3GH5A 2PAJA 1Q6IA 1BL4A 4MG4A 1WV2A 4PSPA 3WBAA 4YPJA 4DJDA 4PCSA 3HGRA 4EAYA 5LXXA 2YBTA 1UKPA 5I3HA 3V3WA 5CXPA 1KGXA 1XH1A 1SJBA 2Q5AA 2OQLA 2Y4SA 4ONVA 1Z7AA 5A6MA 1BG4A 3SDOA 3GB6A 4ROQA 4MM1A 5FL0A 5CBBA 4WDUA 4AVFA 1QI3A 3CBWA 3UR8A 3W29A 4AF0A 4UBPC 3A5FA 2VYOA 3HJEA 3OVGA 3P5YA 1TR9A 4ODRA 1E1CB 3G77A 4PB5A 1BEUA 6A3HA 2GZXA 4GQQA 4ZCWA 4WJ8A 5ABTA 2H8ZA 3WQ8A 3RO8A 3ZO9A 3KBWA 1TV7A 1K70A 2H90A 4YHEA 2TMDA 3MUZ1 1DOSA 2ICSA 2BGNE 4CCEA 2DZSA 1Q45A 1EA9C 1F3TA 3RN6A 1Z69A 3GU1A 3FAWA 1HN1A 4QJ5B 3EX3A 4DN1A 3EDEA 4I7VA 2V67A 1SZFA 1MFVA 3KBJA 1PJ9A 3VDGA 2PUZA 3W1MA 3B8IA 4FO4A 4QG8A 2OWXA 2E8YA 1JCHB 2P0OA 2BXZA 2JBMA 2AAMA 3EDDA 9CGTA 2C19A 3MC5A 3KOFA 2PWDA 2WPBA 2WWDA 4J3UA 1H4PA 4KS0A 3A64A 4ODPA 3CUIA 1WO2A 5CPTA 2DG4A 1NDZA 4PUDA 1O60A 3PBWA 4J4NA 3SCNA 5BZAA 3L0GA 3FYPA 5FJIA 1FKBA 1FKKA 1AMKA 1HJUA 2HJPA 5BOEA 3N2OA 3LLXA 3UZXA 3N4AA 2R1KA 3W7HA 1UP0A 1B3YA 2TAAA 4OOUA 3AUJA 2DIEA 4NXKA 3ZQ9A 2FZBA 1XIEA 3TU9A 4RZ4A 2XH4A 4ORIA 3SN4A 4I5RA 4IQDA 1D7IA 4AZ6A 4B5XA 4D8ZA 3HQOA 3NSMA 1OVDA 4LAKA 4XO7A 1RP9A 2HVNA 4QJ1A 3TTOA 3CHEA 4IMDA 5DFAA 4FLSA 3LLDA 3M07A 3HFTA 5F4XA 2OR2A 5LYRA 1OADA 3VINA 1ZPTA 1ZJBA 3UGRA 3MI3A 2YCJA 3EDKA 3WLMA 3ARZA 2F6UA 4Q4QA 4Z2LA 2CEQA 1ZAIA 5HMFA 3RRXA 4QX4A 4XVEA 2BDQA 2QNEA 1UQYA 2A7RA 2J7HA 3DFYA 4A29A 2NT0A 2X7VA 4X9SA 3PG9A 1EWDA 3MMWA 2OTDA 1HT6A 1DQUA 2HE5A 3WH7A 4AISA 1GG0A 1XIMA 1F8IA 3CQIA 4AFYA 3JZEA 3DGRA 1I60A 1AA1B 4JHZA 4OGZA 2V63A 1QO2A 5G1TA 3GNOA 4PCNA 3A12A 1BKFA 3OGSA 4WY0A 4K8EA 3S1VA 4O15A 3L4ZA 4RDZA 2GGGA 3AMDA 3M5ZA 2VELA 2NUWA 4EANA 4LTSA 1XDMA 1ZLPA 2Z25A 2GSEA 4C6JA 4ODLA 1QNOA 5SWUA 1V8EA 1W91A 2ITKA 4JFSA 3H4WA 3AHXA 5DANA 1T6MA 1RCQA 1E4NA 4GZ7A 2G97A 2NWSA 5HWJA 3ICJA 4MFEA 1XIBA 2BODX 1LL4A 1DJXA 2H9AB 4QT3A 3ARWA 2YR1A 2X2GA 3UF9A 1XW8A 2HTMA 1I2RA 4OOZA 4C02B 4JDBA 4F8XA 4R7WA 5H8UA 5G2WA 4DZIA 2ZIDA 3BV4A 3O2LA 5AC7A 3FYOA 2QUUA 1KFLA 4DZ5A 2ALRA 1T99A 1XGDA 4UTJA 3AIRA 4C6FA 4NNAA 1O5RA 4RDVA 3QZ6A 1Q2SA 5HBFA 4IFKB 4Q8MA 2ZWYA 3SRFA 2KO7A 2PCEA 4G2DA 4MTVA 1R7OA 2JF7A 2ATSA 3M0KA 4DJFA 2XP3A 2YXOA 2O0TA 3BLEA 1LWIA 4FB7A 3HMJG 3LHUA 2FJKA 2CZFA 1TPB1 4ZQPA 1TPVA 5HJXA 1Z6KA 3KZSA 4O11A 3KRSA 5C7VA 1PKNA 4B4FA 3H2AA 1D7KA 1V6YA 4IMCA 4M29A 4C1KA 2PBOA 3LCXA 4LB4A 1J5SA 1Q1CA 2EKGA 2OWWA 4E2DA 2ZYFA 1H51A 1LOSA 5JIPA 2YW4A 3SJNA 1RJQA 2JEQA 3WZ0E 3W7GA 2GGIA 3HF3A 1XXXA 1FKGA 3MSYA 3W2NA 3BAJA 4P7QA 2R9RA 1K8CA 4U3CA 2P8CA 1M01A 2CLKA 4GPNA 1CNVA 3Q2DA 2VQTA 3FJ6A 4B16A 4AU0A 4KQZA 4GYPC 3F1QA 1AFSA 1XYCA 4IGNA 4MPKA 4B5WA 2GQAA 3CTLA 2O56A 4IIEA 5AN7A 3TOPA 3WBXA 4HNCA 3MHUA 1G67A 2ZRZA 3CNYA 4Q3MA 1QPFA 4QXIA 4ZE5A 3NFUA 5CZTA 5GNYA 3M64A 1E15A 1PXGA 1QPNA 5JUVA 1QPOA 3VXGA 1G6CA 3ITYA 5J04A 4HP5A 1KC7A 3REQA 2DT3A 2WJZA 1JI2A 2QCHA 1LRNA 1KM4A 3KW3A 1UZ1A 4W88A 2XUCA 4A4AA 2DT0A 1EF3A 4HSNA 3ABQA 4MSPA 1L0PA 1DIEA 1HJQA 1TV8A 4ZO6A 2Z2AA 2HPIA 3AWNA 1J4IA 4UFHA 2QMJA 3MI6A 1V6TA 1UP2A 4QQ3A 4WY0B 1FCBA 1W9BM 1XIGA 3PFMA 5FKYA 4E5TA 1U1JA 5E9XA 1TTPA 4JTCA 3I6EA 2ALDA 2KE0A 4WKFA 4GJIA 2WZHA 4TQTA 4N4PA 3EA3A 2WCSA 3GNXA 2ACQA 3VIPA 4AW7A 4QRNA 2OT0A 3DI0A 4JY8A 1UZHA 3RFWA 1BWKA 2WZTA 4GA8A 4GC3A 1VFOA 2DIKA 4H7VA 5LNWA 2WNQA 2XFFA 5I24A 2AL2A 4RR4A 2MANA 2A85A 2YL5A 4MYXA 4DF0A 5EU9A 3T40A 3QHOA 4WRHA 3UPWA 3RGCA 3INPA 3ENLA 2ZZ4A 2G3FA 2WNNA 5JBEA 1YADA 3AS0A 1C7SA 4O8AA 4MWAE 2FZMA 3T8QA 4R5EA 2FHBA 3LUTA 1EQPA 5AY7A 1JPKA 2OEJA 2ZQVA 1SR0A 2FGBA 1JGIA 5E70A 3CHDA 4AH7A 3B03A 3VNLA 5IOBA 4IT4A 4DPQA 1FCQA 3TTSA 1TJRA 7ODCA 1KM2A 1S2UA 3BG3A 4PFMA 2GVYA 4X63A 2GJLA 3JRKA 1PX8A 4BCEA 1ME9A 5F2GA 3R1ZA 1DWFM 5G1YA 1FKDA 2VEGA 4M51A 9XIMA 4PMXA 4ZXLA 1K3UA 2PDUA 4JICA 1BFNA 3IJ8A 1IZKA 1EEXA 2J6XA 2A6LA 1GEQA 5I78A 3PA7A 3S0CA 2ZR5A 3R6IA 4CCDA 4PMJA 3SIZA 3HFYA 4G8TA 4D6JA 3A4AA 1Q4NX 1Z3NA 2HNHA 3BOFA 1M7JA 1F3WA 3CL6A 3NPUA 3R5EA 1TR1A 5DX7A 1ZALA 4QCEA 4ATLA 3CZLA 4KT2A 3A5VA 3SRKA 4IF2A 3W7IA 2Y24A 2PTWA 2HXTA 3K1DA 2AQOA 3H22A 4RE0A 4ZQCA 2FTYA 5DT7A 2C79A 1ALDA 2OLSA 2B31A 1P0NA 1GVEA 1E4LA 3EEZA 2V82A 3G1FA 2E28A 2V8ZA 1L6WA 3C8FA 3FJLA 4QDPA 4Z1CA 3W1RA 4Q4KA 3T4WA 2V3GA 2OWCA 4JYSA 3BLIA 3LA4A 4FR6A 4QS5A 2IKHA 3IK4A 5BXJA 3HQPA 2MNRA 3QLLA 5EYWA 4OQVA 1AJ2A 5BU6A 4QE4A 3OIXA 4F40A 2QDGA 5BWAA 3U48A 2D22A 4ZOBA 3FKKA 1VYPX 3TTQA 1RQEA 5CKSA 4QNEA 1E6RA 2GL5A 4IPLA 1IR1A 5HAOA 1GK8A 4HBEA 2R1LA 4LVBA 3M0ZA 4UMCA 3LCWA 1A0EA 1R3RA 1GZGA 3WF2A 4AZHA 1V3IA 2QDHA 3WF3A 5AVNA 4QT2A 3GVGA 4DZ2A 1LUCB 3L2IA 4QLKA 1Q65A 1KA9F 2GGJA 3GBDA 2PF0A 1E6ZA 1QVBA 4M6UA 5E0KA 4DLFA 4I9JA 4UTWC 3L23A 4PUMA 4LB3A 3DC0A 1CCWB 2XINA 2D2JA 3UNDA 4O14A 1C92A 2NVAA 2OKOA 5CZ0A 3DBNA 2PGFA 2MNTA 1OK6A 2OKTA 5FJPA 3CAWA 4UNKA 3O0KA 1SVDA 4HYVA 3W74A 3AYSA 2WMKA 4F2UA 4GIVA 1TRIA 2JIWA 3IGXA 4NQ1A 5GPGA 1E5NA 1K9FA 3W7CA 4PRTA 3O3RA 5BWFA 1A5MC 1XGZA 1MNZA 1YPIA 4Y90A 3PBGA 1TUFA 4KPLA 5LGZA 4N4QA 1XR2A 3O0FA 3UPBA 1A5UA 4ZQNA 1P4CA 3VYLA 4HU4A 3TC6A 1B5TA 3UI6A 4A05A 3GM8A 1Q6OA 3SECA 4PA8A 1DQWA 1YTDA 4NSBA 5I3KA 5ABGA 3S1UA 4HMCA 5HQLA 3QPEA 3O5FA 5AC6A 3IAQA 3O5QA 4MPQA 3WDIA 1JXJA 2PV1A 4R85A 2I1OA 2Z1KA 3P93A 1ZUAX 3SJ3A 5CC5A 4ENLA 3CZKA 1X8FA 2YXXA 2WXDM 3PHAA 2MLXA 5IM51 1REQA 4NNCA 1XFCA 1G4PA 3C5QA 1QWGA 4MOZA 2P8BA 4D2JA 1XBXA 4PN2A 2NUXA 2NZLA 3TN5A 3VKKA 3WLLA 4LWWA 5FI8A 4MHBA 5KTLA 3C6CA 3LRMA 3KS5A 1AZ1A 1VZWA 3CL7A 1JCMP 4O17A 1H60A 2R1NA 4LU0A 4GYFA 4DO5A 3EX1A 1TVLA 2FZDA 2C1HA 1RBAA 5H6HA 2FDSA 3PPGA 1VBHA 1M5YA 1JF6A 3M0VA 4H7CA 1MDLA 5DELA 2H3BA 2XU2A 3IJ6A 8CGTA 5IBXC 1V0NA 3BJFA 4TX8A 3TWAA 1R87A 3U7BA 1XPYA 1S5VA 4C6IA 1NP2A 5DRIA 1R3QA 1DYSA 4UXDA 3W0KA 2TRSA 3WYZA 4GXWA 3F03K 2H3DA 3W2UA 4G7EB 3OVPA 2ACUA 1EO7A 3WLQA 2BHYA 3GD6A 1W2PA 2ZZ7A 3E0WA 1X1ZA 1FH7A 2FIQA 5T9BG 3VAWA 2PFHA 3B7XA 2HCVA 2VFIA 1XKYA 3L67A 1LOQA 4W8BA 3OBEA 1AD1A 2ZTKA 1JR1A 5I3IA 5REQA 3O6YX 1DJWA 1ZJAA 3MKKA 3NCOA 1D6OA 5AZ0A 2J9XA 2VUYA 3K8LA 5EMKA 1Q6QA 2VCDA 1RVGA 4UDMA 5K9CA 3PSVA 3CIWA 3V35A 4L5ZA 1E6XM 3VGEA 4LBSA 3NL5A 1AD4A 1ITUA 4ORMA 1RVKA 4XZIA 4HU0A 4DWSD 3WQ6A 1GVFA 4HA1A 5CLTA 1L6SA 4KGLA 3FXGA 2KI3A 4GI8A 1PIGA 2YB4A 4HSHA 1GKQA 3TE9A 5FAJA 1RJPA 4LYPA 2ODOA 3KVJA 3NL2A 3CGNA 2IPGA 2IKIA 3ZVHA 1WDQA 3TVAA 3PY2A 1SU5A 4K6AA 4HB7A 2DZXA 2JZVA 2XJ7A 1H2JA 5J8LA 2GDQA 5EMJA 1R2TA 4AY1A 3H7RA 1A7XA 1K8XA 4CUCA 3WD3A 4QQUA 4TW7A 3SCTA 5A8QA 2NV2A 2E09A 3Q94A 3WQWA 3WX7A 5AB3A 4H19A 1E56A 4TR9A 3NZ1A 1YTEA 3MO7A 2A0NA 4N9BA 1RLDA 1JUBA 3UJRA 3QYQA 5LNRA 2BY0A 4FNRA 1X97A 3BZJA 3GLCA 4KQNA 4D6CA 1T41A 3GHSA 3ZSTA 3USZA 2PDKA 4J27A 3GKFA 2PPNA 1B3ZA 2GSHA 3D3FA 1P5QA 1GTEA 4PTDA 1GZJA 3TWBA 4NZCA 4L4LA 1P0KA 2VD8A 1G4TA 3T4CA 5LKYA 2A6NA 4JIEA 2HMCA 5E6YA 5I06A 3FSUA 1A53A 1MUMA 2DDXA 2NUYA 2XN0A 2ISWA 4DWSB 3DESA 1PAMA 3P2VA 3GDKA 1GONA 4LUJA 3R8HA 3VOHA 4MGGA 4KFNA 4TX6A 4LXFA 3FNDA 1JQXA 2UZ9A 4ZL1A 3UY7A 3KS6A 2WYSA 2PLJA 3EXSA 1EEPA 2PI6A 1JYNA 3UA4A 3PTQA 5EGRA 4ZSTA 2YDRA 1P7TB 3U9IA 1AUSL 3W2JA 3WEOA 5CH9A 4XQ6A 1CBGA 2EXOA 3MBDA 4H00A 3RPTA 1R30A 1CYGA 3UWYA 5HW7A 1YMYA 2IPWA 2V38A 2PS2A 2TPSA 4JD4A 2YA2A 3EOOA 5HT1A 4DI9A 1BXNA 3PN8A 2JF6A 3NQMA 8XIMA 3W71A 3I7SA 4DRMA 3K13A 4JEQA 1XQKA 3IGUA 1DIOA 3M1ZA 4LVFA 3CC1A 1OABA 1FWCC 3FGCA 1JZ6A 4GVIA 1VYRA 4F0KA 3PZ9A 1R46A 3HZ3A 1KFWA 1XLAA 3U5YA 4BQ2A 1AW2A 3W23A 1QZ2A 1ISXA 3BMVA 1BXBA 3RR1A 4UWMA 4D8LA 4QLJA 1TJ0A 3CLWA 5FF2A 3HN3A 3R8RA 4YTRA 3PFRA 3FAPA 3VNZA 1G69A 2VN1A 3EGJA 2ZQTA 1MI3A 4W9OA 1PL9A 3NDOA 3M5VA 2F23A 3RG6A 1S5WA 3ONBA 3AWOA 5RUBA 2QVNA 1GOKA 1IEXA 1E4IA 2RFGA 1B4KA 3DEQA 3RF9A 3ARRA 3ZXWA 3EWBX 4REQA 3N2MA 1TVPA 2QDEA 1FHUA 1N55A 3H2FA 3WQ4A 2IW0A 3QMSA 4Q33A 5D75A 4C91A 1IT7A 3STCA 5KZMA 1MNSA 2VC6A 1EPVA 3PF3A 3VX1A 5LIXX 3T42A 4JTKA 1JZ3A 5DCDA 4HK6A 1VRDA 2FVMA 3NQ8A 3A22A 3E2SA 2XGIA 4UFJA 1SGJA 2NSXA 3WLKX 3TW7A 5E6ZA 3RITA 4OUIA 3CJPA 3CUFA 4UOJA 3GXFA 3UESA 1B9ZA 3DG3A 3G18A 3L66A 2QQ6A 1MQRA 3B06A 3IGSA 5I7GA 1POJA 1FXQA 4H04A 4LRSA 4DBSA 4KIEA 1OG6A 2I57A 1CLXA 2C6QA 1C8YA 3LRLA 3G1HA 4IIHA 3BH4A 2W91A 2J9ZA 2QUMA 1F73A 3EBVA 2DEPA 2P76A 2WNZA 4ZSUA 3LN3A 3TP4A 4BJHA 3BLDA 1VS1A 5BOOA 1JNTA 2ZDSA 4G1NA 4XBSA 4LUTA 1OGSA 5DXXA 3A9BA 2GWNA 5EBUA 3VD9A 1F76A 1O1ZA 4IL2A 1U1HA 1OIFA 4BY3A 2XYLA 1GYMA 1OYAA 1LQ0A 4BQ5A 1VLWA 3TYUA 4DF2A 4JFJA 2QT3A 4K3ZA 3H53A 4UC5A 8XIAA 4HZ7A 5A6KA 1J2WA 4MUZA 4DHGA 4K68A 1XPGA 4X22A 3GZ3A 4C7FA 4CN1A 1JDEA 4AWEA 4P7OA 2MLYA 5CGQA 9RUBA 4JTTA 2NQLA 2I9EA 1ZBWA 2ZXBA 1EH9A 3BL3A 1YYAA 3OZYA 1WZLA 4YTUA 2DSUA 4DELA 1XQLA 4HNVA 3STGA 2GVEA 3VKCA 4HK7A 3O9NA 3LMYA 3NDZA 4MADA 5M1TA 2HXUA 3C3NA 1R8LA 1GQIA 1B3OA 4Q6XA 1FWTA 4HIBA 3MCNA 2OB3A 2CHRA 2YL6A 2WBKA 3GC2A 1QPRA 3RRAA 1N7KA 3O5IA 5E0FA 1T5AA 4Q8PA 4U84A 1HKWA 3VOFA 5KMYA 3RAOA 5CPMA 4AMAA 1ZHAA 2CESA 1QI0A 4BHYA 2PDMA 3L5MA 4Y9AA 3L9CA 3IK8A 2AMGA 2VT0A 3GXMA 1QOQA 2R82A 3CUHA 1T40A 3FDGA 4U5KA 3C8NA 4PBFA 3NI6A 3CV7A 3GWQA 1D3GA 2BY3A 2FZ8A 1R2SA 4XD6A 1XINA 2X0HA 1LDCA 4I6KA 1Q7ZA 3L4UA 1MYRA 2XHYA 2PU0A 1GOXA 1VCFA 1AW1A 3FCPA 1P48A 2DZAA 1TSIA 5BYWA 3H70A 4QG9A 4U2ZA 4FOUA 3GXTA 1CXKA 1AH3A 4N6FA 1VAHA 4K8HA 5DXYA 4EPKA 4X2PA 3CQKA 2X16A 4Q8VA 2ZZ6A 3IVUA 3RCNA 3OLDA 1UD5A 3WLTA 1CX9A 4JCLA 3LDVA 3BANA 3HURA 3E74A 2RUSA 1LWHA 1G01A 2PB1A 1PE1A 3O5GA 1E9ZB 1BVZA 3KFTA 4W5ZA 2C18A 3G1VA 1H49A 5E1QA 2OGJA 1KFBA 2BS9A 1QFEA 1TRDA 4NHVA 1XYMA 3ITGA 1BQGA 2EG6A 4E3VA 3KBVA 1WX0A 3GG1A 3QR1A 1OBAA 2XSXA 4DY1A 5FA5A 3W88A 2WZEA 5AHLA 4F0SA 3RPDA 3EXTA 4IISA 3MHGA 4PBGA 3CH0A 4RZ6A 1MSSA 2V2CA 1Q6DA 4EXQA 2TODA 2PWGA 3KAGA 1FD9A 1A0DA 4UQBA 1S2TA 4HPXA 2ZZ2A 4DPPA 3BOXA 1KTNA 1S3HA 3EKGA 3H4GA 1VPQA 4K39A 1QHZA 3HU7A 1PCWA 2Y85A 1XIFA 5C2XA 5M17A 3GNNA 5B7YA 1CI1A 3R94A 1B9BA 4LW7A 3UVIA 3I6TA 3PK7A 4QISA 4EE9A 3KCJA 1XD0A 2XP6A 4UZSA 1V5XA 6REQA 2Z00A 3IUDA 4ODKA 4TV5A 2XSBA 3VGFA 3WLIA 3DUGA 3SGUA 2X1TA 3T81A 4P5UA 1W32A 3GVRA 3KOZA 1UUOA 5D33A 2DZTA 4XSLA 5EY5A 4D6DA 1H3GA 5EPDA 2ZKMX 1W8SA 2BOGX 2QPXA 5LGXA 2GWGA 1NM9A 4MUPA 2EG8A 5JXQA 3DIPA 4GX9A 1N8WA 4FNQA 4FAMA 1XLBA 1WAUA 4KWVA 1GOQA 3BW3A 1JD7A 3RJYA 5AOUA 4WDXA 4NASA 2DZVA 2KAUC 1KO0A 4N7QA 1QATA 4L3NA 2RH9A 5LHFA 4LC6A 3O5MA 2DQXA 2VMFA 3RX2A 3NYDA 4P8XA 2FVKA 4CKQA 4ZOAA 1UR2A 5C8BB 3GU2A 1QCWA 4GQRA 1W5NA 2R94A 4ZO8A 3H12A 3LZ3A 2WV8A 2VO5A 3CAKA 4XZWA 1DWHM 1TZ9A 4IGMA 2QCDB 1E6QM 1GOOA 3V18A 2W3ZA 3G1DA 4TOQA 3VOJA 1WKDA 3A24A 4E3TA 2G3NA 1FHLA 1S39A 3RLHA 1RH9A 4HGXA 3BJSA 3OIHA 4AHPA 3C2VA 3IAPA 1JDCA 5CQ1A 3LBOA 3KCEA 3P5ZA 3QEZA 4YTQA 4BI7A 2X40A 1SYTA 3QZAA 3JR2A 1SW3A 1S5MA 4KFPA 1DWJM 4GINA 1OQFA 3F2DA 1OINA 3BQ6A 3PUDA 1S1PA 4HA0A 2YYTA 3K5XA 3ARYA 4GUHA 3TA9A 2XP4A 4O28A 3G0XA 2DH3A 2PRMA 4B3LA 4D1IA 1Q7MA 5T8GA 5LIWX 3B8SA 4QTGA 4L7ZA 1PB0A 3WQDA 4A8LA 1X98A 5I3JA 4UTTC 2ZQ0A 4OBRA 4N0RA 3VC5A 5G4WA 2X1SA 3FV9A 2VUNA 2X09A 2IMRA 2C7FA 2B0MA 1PV8A 4ZB2A 4IPXA 4HHHA 2PSNA 4H1ZA 2VHLA 1XUUA 4H83A 4GUJA 2C8NA 1KD0A 4KCWA 4MJZA 5A6SA 1OCNA 1VP5A 1FWNA 4UR7A 2VGIA 3WLRA 1O95A 2QZRA 1ISVA 1JCXA 2G4FA 1AODA 4JFWA 1DQXA 2CHNA 4FX6M 1W5MA 1DWGM 3GRIA 3M7SA 4HYWA 2X0SA 3WG6A 1SO6A 2Y5SA 3M6DA 2OZ8A 4PUNA 2QCEA 1AL8A 2AKZA 1R3TA 4RXGA 1W1IE 3GYCA 3EMZA 3XIMA 1KXHA 4C60A 4JN7A 1UA3A 4GY7A 1JYWA 2WK2A 3DFSA 3P82A 1A3HA 3ZOAA 2OELA 6ALDA 5CGMA 5TQLA 3AXMA 2ISSA 3F2BA 1ME8A 3QW3A 3PSWA 4KRZA 3TH6A 3FHAA 3E5BA 3BUVA 3ONCA 4Z0SA 2YLLA 4HMEA 1ZCOA 3C4UA 4A22A 1TPEA 3R2GA 5HULA 5HWNA 1Z48A 3IV3A 5JH1A 1OCJA 4B5UA 3IEBA 3SQMA 2EPMX 4AZBA 2A21A 3B9OA 3CYVA 3NQVA 1VFLA 1CXLA 4PZVA 4S3KA 3GX9A 4TMCA 1OFEA 4GNVA 1OX5A 2WWCA 4BA0A 1ITQA 3KAFA 3NSNA 1EDTA 4UFIA 5HW8A 1V0KA 4ACZA 1E5JA 1NF7A 1DTNA 4PTWA 2DH2A 3WQEA 4RNJA 5FF7A 1CTNA 5HW6A 4I90A 3W22A 3WFZA 1A3XA 4L6DA 1LROA 3TC5A 3ODKA 2HS8A 1AJ0A 1EGMA 3UD6A 2Y78A 5PTDA 4HNTA 4NRSA 4X9YA 4LUTB 1W9XA 1IGSA 3DFQA 1X7IA 3UI5A 4IP7A 3HGOA 4HZ8A 4J2PA 1TPC1 3THDA 1AK5A 3HPSA 1S2AA 1F6PA 3TN6A 1U5JA 1OK4A 1XLDA 4AD0A 4ZE4A 4CD8A 3BLPX 3S5OA 1OX4A 1XS2A 3O5RA 3OZOA 2RGMA 4F0LA 3ABSA 5EFFA 3UA3A 3KDNA 4DJFC 2ZUUA 4ROPA 2PDFA 3TTEA 3C61A 4JTUA 4PMUA 3NRKA 4OV4A 3PR9A 4BEUA 1YBQB 1EJSC 4MFDA 2OSXA 1LZOA 3MUXA 1VPYA 3UF8A 2MLZA 1KKRA 1J8VA 4ZGYA 3OG2A 1DXEA 3SSZA 2MF9A 3TDFA 5ABFA 3LBMA 1QBAA 4HMDA 1PKYA 2NVDA 4NZFA 2V5JA 3IRDA 1SSGA 3ALFA 3L4TA 3TK7A 1JCYA 4V15A 1V02A 1P0BA 1YXCA 3T2QA 3J7HA 4Q8WA 1GZ1A 3FSTA 1GQJA 3WUEA 3T09A 3UU0A 4C1LA 3VDAA 4CQ9A 2A3HA 4GBUA 1LT7A 4DJEA 3WQOA 4GQGA 3GDBA 1UWQA 4DBUA 5LHEA 2JEPA 4JTHA 1T8XA 3VKAA 2FTPA 1FWFC 3POCA 3CT2A 4YXGA 3VCCA 3MS8A 1Q6GA 1V08A 2QPUA 3MMDA 3UCCA 3SQSA 4FP1A 3ORWA 1JQVA 3GC4A 1PDZA 2VXNA 3CYJA 3WNNA 3SEPA 3DFHA 1ZZMA 3VNJA 2P1FA 2YBVA 1ZBVA 4MNKA 1C91A 4R3UA 1I8JA 2ASHA 1VCGA 4JX4A 3T0BA 4NAEA 5F1VA 3RR4A 3C0SA 4CQ8A 4MMWA 5CBJA 3S9IA 2PP0A 5DN1A 5FEXA 4UQDA 1ZSXA 4CD5A 3W7MA 1FWEC 2V3FA 4LOCA 3VFLA 1HGYA 3QOMA 1G7VA 3UXLA 1NJJA 2V0TA 1KXVA 4BF9A 2XZ9A 2BZNA 3VGGA 2Y8VA 1IZCA 1NMVA 2PE4A 2Y5EA 4F9JA 1I1XA 1TIMA 1XFBA 3QFEA 2WSKA 3SFKA 1H0GA 1VD6A 3N6JA 3ZM8A 1E0XA 4C6PA 3U2ZA 4XVDA 2BTMA 4BWLC 3CO8A 4XSMA 2VFEA 3TOYA 2IXUA 4NVTA 5BU9A 3W83A 3ZR5A 1E73M 5CPSA 1ITXA 4Y8EA 3GXNA 3V1HA 3BG9A 4ZQOA 1RHCA 3VIFA 1SO3A 4EF9A 4F0MA 5I98A 2OYMA 4RX0A 4FHAA 3BMBA 4IX0A 4I9AA 3ZS4A 1ZP3A 2WBGA 1FWGC 4GUGA 1SZNA 2VEMA 3WSUA 4LY4A 1FWWA 1RZMA 1V77A 2BBFA 5F4SA 1VLIA 5IFTA 4Z1AA 2J77A 4JL1A 3EPMA 5F2MA 5CC3A 1EOKA 2ATMA 2PDXA 3TQPA 4NZ4A 4AY7A 3B8VA 3NQAA 4GNKB 3P61A 7XIMA 2JKAA 1BTCA 4FALA 3ITVA 2E9MA 2Y0FA 3WEZA 5ABEA 1GVSA 1V6WA 1W3NA 4I5XA 2ZA2A 5A2CA 3NPVA 5I03A 2Y88A 1J10A 3CK5A 1GVYA 1KR1A 3KBSA 1C8QA 1TMHA 1KBLA 3V36A 2NX9A 5EMLA 4L1XA 1UOKA 3KCLA 2FH6A 2QF7A 4XAKA 4RCXA 3VDHA 3MBFA 2E40A 2I5IA 1KRBC 1V03A 1W31A 1PZ2A 2WSPA 4MKVA 3UZWA 2B7QA 3W85A 4PCTA 2DP3A 4QAIA 2E6FA 2XVPA 2VM8A 1B57A 1F05A 2YDQA 3M47A 5BMWA 3G3MA 2CBUA 2CLHA 3IJIA 4GZJA 5FSDC 3TCEA 1WKEA 1OC7A 4KRUA 3VD3A 3L5LA 3ZJKA 1GTHA 3UT0A 2CPUA 3LCIA 1B31A 2VDIA 4JTJA 2P5NA 3EWDA 1EOMA 3U2EA 4EXAA 3TFXA 3JYMA 2PDQA 4ICMA 2C91A 1C9DA 5BXSA 1PTDA 1W37A 2RUCA 1GJWA 3EOEA 4D8AA 1XCXA 1EDGA 4E2OA 3VOGA 3MUAA 3P62A 1P6WA 3AI0A 3IIXA 2DSVA 2NWRA 1W5OA 3F4NA 1E44A 3BGJA 2BFGA 1UJQA 1U2YA 5D2TA 1EP1A 2F6KA 2C15A 1EP3A 2DW7A 3RHGA 2XWDA 3WIJA 2PURA 4AD2A 1P7TA 3OLGA 4MJ4A 1W56A 2WKLA 1V0LA 1VEMA 2PDHA 4GYJA 1N82A 1OGBA 3TKFA 3WUGA 4JZ5A 2QJHA 3LENA 4YVVA 5HUAA 3EEGA 1IXOA 1H7RA 4HCHA 1WYIA 2FGLA 1X96A 4LY8A 2EJAA 1AL7A 3WK3A 1BTMA 2VI0A 1MW0A 3B0UX 4JTIA 1FWDC 3S5SA 3N73A 1SFTA 3CIVA 1UPMB 2NXIA 2XN2A 2PCQA 4WGHA 1J0HA 2HISA 3MJMA 2VQUA 1F5ZA 4NX0A 4R9XA 4WGXA 1TE1A 3CASA 1F6YA 4LYQA 4ZO7A 4A8NA 1EKOA 1TPFA 2B4GA 3A4WA 4NRRA 1JZ5A 2B5UB 2Y63A 3UWQA 3AIEA 5GVJA 2WLYA 1BKSA 4F9DA 1N8FA 4LT9A 4FS9A 4LAVA 2PF8A 3MV11 5C9WA 2WZMA 4XZ9A 1RLCL 3MVIA 2VC7A 5XIAA 3MI2A 3GYEA 3NSXA 1ML1A 1F4AA 4NIRA 4DRPA 3GU0A 4UTWA 4LV4A 4JTQA 3ZZ1A 2VEFA 1M7PA 3HTWA 3DHDA 1J4HA 2PWHA 3W28A 3CHFA 1ADDA 2YL9A 4AZGA 5D9NA 5LIKX 3H9RB 3GTNA 5C2GA 4IT6A 2OXNA 1GHRA 2QJMA 4DLMA 3AFBA 3DDMA 3CUGA 3MANA 4UNLA 4Z08A 4CLMA 1V7AA 4PUJA 5G5IA 2YYUA 4Q4OA 3W27A 2J74A 3RLVA 1H0IA 1XHGA 3LRKA 4IMGA 1VCVA 1RPXA 1TELA 1DBTA 2JGYA 1KQYA 3R58A 4MAZA 4JY9A 4OT7A 4KWOA 3DBPA 5FEZA 2ZX6A 2D20A 2FHFA 3UJEA 2Q8ZA 3LTPA 3GR7A 3UNTA 1A4MA 3AMGA 4D9PA 2VJXA 4S3BA 4M3PA 4WIWA 4LAZA 1E40A 2DUAA 5AYBA 1HO1A 4ZA0A 2PTZA 5HNRA 1JIBA 4ZB5A 2E8ZA 2CLLA 2GJPA 2BGSA 4XV0A 4GVHA 3WD1A 4Q8QA 3IANA 4DBDA 1ELSA 3DH7A 3R0DA 4W89A 4Z2GA 3F4WA 3ITXA 3OTRA 4LRTA 2D0FA 2BXYA 3FA3A 4Q8NA 3TXVA 1J0YA 3VI2A 5J6EA 4RV3A 4UMBA 1LBMA 2OO6A 4ODNA 4UB9A 3SZ8A 1CDGA 3IJQA 1XYLA 3DYPA 1GVIA 4GY1A 3WDRA 2EPKX 4JTRA 5TAOA 1L1PA 3V0UA 3PPFA 4IIBA 1EBHA 3V4BA 2AQWA 1OY0A 3ZLHA 2IF4A 1SUXA 3PG8A 4XAGA 5I6SA 3F4CA 2Z27A 4QGCA 1J0KA 2WW5A 4LNYA 4DRKA 2ABBA 4MZYA 4N42A 2FB3A 1X6NA 4V33A 4GACA 4W85A 4C1NB 1F4HA 3TV8A 2FYMA 3TQ0A 1KBBA 4HCLA 1J0JA 1NTHA 1TIWA 1NFGA 1A4LA 5F7UA 3LB0A 2FB2A 4W9QA 3GKAA 1QW7A 4K36A 3O6DA 1K03A 1XRFA 2P88A 2X1IA 5FF0A 2VRQA 2N87A 1H50A 2V30A 4NP7A 2GYIA 3EOUA 4C6DA 3NG3A 5B7ZA 4B3KA 4Q6JA 2UV8G 2O9PA 4JYFA 4LEFA 4BI5A 3L0NA 2GVGA 4GQ0A 2EJ1A 3WUBA 1MO0A 4HK5A 3KM8A 2L2SA 4IL0A 1NFPA 2NXGA 3OODA 1TYGA 4O1AA 4MNLA 3LY0A 1TZ7A 4B91A 1NWTA 4EF8A 3IIPA 4QDWA 1FCUA 1RD5A 2XPKA 2Z7GA 2QV4A 3M0IA 4JTFA 4BF7A 1DJQA 1I4NA 4XG1A 4F66A 4O1FA 5H91A 1W3KA 3GIQA 3N9SA 3BTNA 4IIFA 1SJAA 1QK2A 3SY1A 1YW1A 4CD4A 3F5KA 1CLKA 1XIDA 2GDVA 1HQTA 3OP2A 1TMLA 1YDVA 3URQA 4O13A 3IV8A 3TYZA 1IF2A 4JDYA 3LHWA 1P5BA 4CU6A 2NVCA 1JNDA 2VURA 1ZY9A 5FSEC 3BDKA 2QF8A 1F6KA 1NQ6A 4OBTA 3QBUA 4WVXA 5C71A 2AOSA 5G2IA 2PDLA 2EF9A 2OZ0A 1M1BA 3LV5A 1TG7A 4TTGA 4WSHA 4WKHA 1WKYA 3H7VA 1CGXA 2CLOA 1EA0A 1O94A 2VOMA 2WSQA 1X39A 1QWKA 3EMQA 4GCXA 5TF0A 2HK0A 1NELA 4U3AA 4GFSA 5AC8A 1VC4A 5D8ZA 4B2DA 1ICSA 3G1RA 4V27A 5KZ6A 2WMIA 3QR3A 3QSRA 5I23A 2PTDA 2VFFA 2P10A 3VE9A 1JNEA 1BGAA 2ZUWA 3AS1A 2BP1A 3IJLA 4IFRA 3QV8A 1F8AB 3UZJA 3AU6A 3N13A 2I9UA 5CGTA 5DIUA 4WJXA 2XFWA 2VX6A 4D6HA 3M0YA 2YW3A 1KCLA 3TX9A 4IJBA 2WMFA 1W3JA 3S2JA 3IKGA 3A21A 4TX0A 3FYYA 1Q8AA 1TE6A 1SFLA 2CKSA 2CXEA 1DJNA 2NSOA 4I5UA 5KZDA 1AW5A 4L6OA 1BD0A 1YLVA 4QLLA 3WNKA 4MY1A 2E5BA 2OSWA 4HQVA 4DJDD 4O1EA 4Z17A 1M6JA 4I8YA 2PWUA 2G3IA 4FLOA 3T0AA 4GXPA 1CPUA 5CSUA 1BAGA 1JUEA 2J7GA 4K8GA 3G1XA 4GABA 3GNPA 4M24A 2WOQA 1TA3A 4AUBA 4E38A 2GDUA 1QPLA 1NQKA 3TEVA 4GQBA 3DG7A 3WELA 4CQBA 4OTKA 4MJ2A 4IM4A 1M9HA 3VIJA 1UIOA 1QXLA 2QCMA 3KBNA 4Z2IA 4Q7NA 4IJRA 2DT1A 2PP1A 1X38A 6CGTA 3BSGA 2SFPA 4XIAA 3VNIA 1FBAA 3MDWA 4NI3A 5LSMA 3M0LA 2NQZA 3CU2A 3MCMA 1KXQA 4L64A 1XX1A 3R79A 5HINA 3K4AA 4PTNA 3POHA 1P0DA 2ZX5A 3B9NA 2O55A 3NXFA 1Q7QA 2NLYA 3OA3A 4GIEA 1R2RA 4CNUA 2X30A 3I6CA 3NDYA 3ZWTA 2Q02A 4KWUA 2YX0A 4P8WA 1OC5A 3OZMA 2DZUA 2ZX7A 4IPIA 1HJSA 4PB4A 1DIDA 4HHMA 4ZFCA 5IHRA 2P4VA 3WUFA 2ZADA 3UJFA 4D6FA 4QAWA 1VFHA 3GSMA 4YCOA 1FWAC 2GVLA 1PINA 2AAAA 2Q3OA 2XH7A 2WSRA 4L1GA 4YVPA 1CGVA 4UOZA 4TU1A 1M3UA 1XLIA 5I00A 5AHFA 1ISWA 1KBIA 3PC0A 3BCDA 2ZICA 3IIOA 1XLCA 1E70M 1RBLA 4IQEA 4ZFMA 4YIWA 1ODUA 1GGOA 2QW5A 1BPLB 2VZSA 2POTA 4LYKA 3KL0A 3MSRA 2C13A 4MZ8A 1UB3A 1LRTA 3ES7A 3GBEA 2X05A 4JIRA 2QAPA 1Y5XA 4GG9A 4ZODA 1AQFA 3LHVA 3N6QA 4JX6A 2HWGA 3W01A 2RUDA 1UMLA 2DG9A 4QNWA 3ZT5A 2OX1A 4ZS6A 3NTPA 3R89A 4JKLA 2ZRWA 4LF1A 3PTDA 6REQB 3ITLA 1DWAM 4E6MA 1WOAA 4JTLA 3E0FA 3N25A 4JKKA 3CHCA 3VABA 1MUWA 1JUKA 2WVTA 4H8UA 4AB4A 2PTYA 2J78A 3BVJA 6XIMA 4Z1BA 2RDWA 3WH9A 3MJYA 4W5UA 2NX3A 4W84A 1XLFA 1R3WA 4OIFA 5A6BD 1JDDA 3VZYA 2BLEA 4AHOA 5HUOA 2XVGA 4H2HA 3CB8A 1LTDA 2WHMA 4BQ4A 2DZWA 2ZX9A 3BK0A 2E3ZA 1WA3A 1G9HA 1ZTVA 1Y5VA 2VGBA 4L61A 1PWMA 1BYBA 1IEWA 1EBGA 1FOBA 3EPOA 3ARPA 4N6EA 4XKYA 1FH9A 1BF2A 4X2RA 3BICA 3THCA 7REQA 3NVDA 4H9XA 1TV2A 3HQNA 1W9PA 2AGKA 2WNWA 2QS8A 1A5SA 1Z9AA 4DYKA 3M4HA 2Z1WA 3GQYA 1SZGA 1VKFA 2D0HA 2Q3RA 1XWYA 1Q13A 3B0PA 4KESA 4R53A 2Z0IA 3VC6A 5E9AA 3USBA 5I0DA 2QUNA 2YDAA 1G0CA 1SFSA 3LXAA 1GG1A 4WDTA 3UCDA 4C6EA 3ANUA 1KLYA 4GI9A 4U5IA 2DVXA 1IE7C 3G0SA 4X61A 3S9ZA 1KCKA 3RMEA 4FOKA 4QG6A 4J28A 1RK5A 1E71M 3K8KA 4MWAB 4X0VA 3G6MA 2JGQA 4JPGA 2BNJA 4OUEA 4XX6A 5D9MA 1T7LA 1XL9A 3IVTA 2A5HA 2A79A 3LMZA 3BAIA 4HJFA 2Q8XA 5L9FA 1P1XA 1RSCA 1ZL1A 1DJIA 3UQIA 3VKJA 2Y70A 4OKDA 4PMNA 3N18A 4PUKA 3B8DA 1W3LA 3H2OA 2I5QA 1SMDA 3E0VA 3KBMA 3HG2A 4K38A 1PHWA 1DJZA 4ZEPA 4BWLA 3UY8A 1KWKA 1EJUC 3QKZA 3TN3A 2ZRUA 5CSSA 2ZA1A 1DL3A 4AYSA 4RZ5A 5EKYA 2WQPA 3VO0A 4EVZA 1H7NA 3P8JA 3UG5A 2FTWA 1EC7A 5DY2A 1VJZA 1GOIA 3APYA 2VGGA 3GR4A 3FJNA 2JIEA 3A3WA 4QITA 2XIOA 3GC5A 5EMMA 3GVQA 2CITA 2W61A 2QDDA 3OOBA 4ITZA 2XFYA 3DXIA 2D0GA 1E0TA 3UG3A 1Q6FA 6PTDA 2XFRA 2CNCA 4UCFA 1K9DA 3P3BA 3P84A 3IJDA 3UW6A 3U8GA 3WQVA 2L5HA 1FDYA 4AD5A 1TCOC 3QC0A 1VFUA 1AQMA 1XBYA 4GBDA 1K9EA 2ZVRA 1O7AA 2J7CA 3TYEA 2ONEA 1ITCA 3WK0A 4N9CA 4O8RA 1UZ4A 4GWEA 3A9IA 4S2CA 3TAKA 3V5FA 3NXLA 1YXYA 1IZJA 2CLMA 4OJYA 2RDUA 4EP8C 4LCQA 2PRLA 1OJXA 1HXJA 2Z28A 1YPFA 4NJIA 2ISFA 4PB3A 5D04C 1RCOB 2IS7A 1GPFA 2F38A 1A80A 2EEXA 2UY5A 4QHRA 3DHFA 4PTMA 4R7OA 5HANA 1GVRA 2QJIA 2NV9A 3RDKA 4B9ZA 1Q6CA 4IHCA 2J8GA 1DXFA 3I6RA 1UOZA 1KGWA 3FHQA 4ZZ9A 2FMNA 1W1VA 1OWQA 3SR7A 3G2GA 4AEOA 3U4AA 3SURA 5KZEA 1GW9A 1XISA 2QIWA 3RCYA 4M7SA 2GK1A 3MTWA 2FDMA 3VMOA 3XISA 2JE8A 3IJ7A 4NAFA 3O5EA 4GD0A 1UWAA 4H8NA 1JVNA 3S2CA 2VZVA 1I2QA 2Y8UA 4GI6A 3N9KA 5HPCA 3QMRA 3LSBA 1KM5A 1HJWA 4L9XA 1JPMA 4UQCA 5IDIA 4UOQA 4A3RA 3GPKA 2OOFA 3WFAA 3C0QA 1WDSA 1JAKA 1R9YA 1SO5A 1JCJA 3MV01 5CPNA 1WBHA 1KFEA 2K8IA 2M1IA 3PAJA 3ARVA 3NGFA 1KFJA 3S4TA 4YTSA 4MIMA 1V3HA 1DXIA 1RBOB 3WNPA 1VBGA 4A3YA 2J75A 1VFTA 4JKMA 4H4IA 3AOFA 3KOYA 2EHHA 2PDBA 4C6KA 4ZBCA 4BF8A 4KH2A 3QY6A 1ICQA 1IIHA 1VBUA 4RW3A 3CPUA 4MKSA 1D7JA 4QEHA 1F2JA 4OBSA 1EHNA 3NZGA 4H6EA 5ECVA 3LS9A 4REQB 5M03A 2VVSA 3L4YA 1S3TC 4ADUA 4HZMA 3MMUA 2B7PA 2WPGA 1LOLA 5FF4A 3HV8A 2WC4A 1L2UA 2PBGA 4S3GA 4UTTA 2DG3A 1TX2A 3KTCA 1C3FA 3PZGA 4OWGA 4MDOA 2FZ9A 4IQLA 2PLKA 3VM5A 3P6LA 3SRHA 3RUBL 1PO9A 4J5NA 3UXKA 3HMCA 1US3A 3RFAA 4TTUA 3HQ1A 1XG3A 3KCOA 2RUQA 3IVSA 2KFWA 2IKJA 2D23A 3E5PA 3VPLA 3NWRA 3FGCB 1WZAA 3ARUA 2H6RA 2Y1HA 1WP6A 4ODMA 2I17A 2QCDA 1MQQA 3BXWA 1XYFA 3BSHA 3WF1A 1CZ1A 4FPSA 1CGWA 3GG0A 3PBVA 1JCTA 3KP1A 4OU1A 5A69A 2ZC8A 2XG9A 1T11A 4QS6A 5EB8A 2PV3A 5HQMA 3KACA 3RIKA 2LJ4A 1G7UA 3ZWSA 1AG1O 3W1AA 4ACZB 4AMCA 1A5OC 1JULA 3BLLA 5DMYA 2HE8A 3ANVA 3EWUA 3B0VC 5CEWA 3VCRA 2BXVA 4RV8A 1H09A 1OD8A 3VNKA 5DMMA 3AXHA 3C2FA 3HA1A 3EX2A 1XLEA 3S42A 3DC8A 1AMYA 5BXPA 4HNNA 3I3EA 1MXSA 4TYOA 3EWCA 5A6JA 2BOFX 3TZNA 1EFZA 4F48A 4O52A 1Z32X 1TPWA 4CNPA 2Q01A 3EPNA 1TUXA 1JFHA 1TPUA 4DNMA 4LAYA 4A2RA 3H2NA 3OJGA 4L4MA 1J79A 4QIUA 1W9VA 4NZ3A 2EGZA 4S38A 2WJFA 4JQ1A 4IOTA 5D09A 3CPGA 1U83A 3QOKA 1TQJA 1THFD 2DFAA 1OF6A 3T0DA 4OVXA 3HOJA 1UUMA 2CBVA 5AC4A 3RGTA 3LU2A 4GIYA 5DT5A 2V6AA 4INFA 4S3FA 2Y2WA 1N2VA 1QU4A 3WBWA 4EWND 3TQKA 1R6WA 1G4EA 3MSGA 3SUVA 2GJRA 3LTSA 4NL1A 3NQEA 4W93A 2YXGA 3CUXA 1UC5A 1GVQA 2VKZG 2VCBA 3KOWA 2Z1XA 4AD4A 3NVTA 4DRJA 4HA4A 4I3GA 2V5DA 4IICA 3VNDA 4LH8A 3QR0A 1MEIA 2Y7EA 2QIIA 3LPPA 2VEPA 5I79A 2F8QA 4LAXA 4H41A 4AX6A 4IFKA 1HP5A 3WLSA 2VWTA 4U85A 3TW6A 4EX4A 7CGTA 3R7MA 2ZCGA 1OX4B 4LS2A 1K1DA 2BVWA 4IIGA 5LIYX 4PCFA 2NV1A 3AHTA 3NZQA 2VEIA 2O7QA 4FMVA 4N19A 5AHMA 5A1AA 2OEMA 3OOQA 3MZNA 1GUVA 4IT1A 3MW7A 1JCLA 1GHSA 3W72A 5HWBA 4Q4SA 4X60A 5XINA 1E43A 5JH8A 4HNUA 4W8LA 2HV5A 2VR5A 3T0TA 3GTYX 4R33A 3UJ2A 1W54A 2VRKA 4DYJA 2QLYA 4HCDA 4NAEB 3E49A 4NX5A 2O92A 3GAYA 1PPIA 3VU2A 5M5DA 2A7NA 2ETNA 2XIBA 3D3AA 4DF1A 1TWZA 3COTA 3WLPA 1UUQA 1XRVA 3KZ7A 4HVXA 2XIMA 3PJXA 3O8AA 1BLIA 2X1UA 2FPTA 2F61A 4IPJA 4AEFA 4ATWA 1W1YA 2M2AA 2OODA 3VOCA 3W53A 3M0JA 2CWXA 2Y62A 2J79A 5BXTA 1HKJA 4YWSA 3O63A 4HARA 4N02A 4TVCA 1TCMA 5G1MA 2IPFA 4XD5A 2XN1A 1FFRA 1QNVA 4RK8A 1UKQA 4DRQA 5CAHA 3BMWA 1RJRA 4U33A 1L6GA 3LNMA 3NL3A 3DAQA 4DZ3A 2J47A 3VUSA 2W67A 3AICA 4H9MA 1TJ1A 3WO8A 2V9DA 5CLWA 4JTDA 4WQ6A 1WBJA 1A3WA 3W7NA 4DXKA 3DOPA 4KWSA 3D47A 3WD4A 1F9CA 3MWAA 3I7QA 1IWAA 2JKPA 3W2MA 4F0RA 3UXAA 1X7FA 5CG0A 1JZ2A 2CLPA 4UTMA 1G4SA 3CQ0A 1NOFA 3EZ4A 4K2SA 1A0CA 4X3ZA 1FFQA 1Y0OA 3CV6A 5AHIA 1EX1A 3B8WA 5GJMA 3PBMA 4HPJA 1LORA 4IFOA 1OX6A 3AALA 1MMFA 1UR9A 4O0KA 3UR5A 5HNTA 4KEVA 4KEUA 4GGQA 3P14A 1ZU8A 4O53A 1HL2A 4XZMX 1KR0A 3FN9A 2RKXA 1IEQA 4QJ3B 4J3XA 4GIAA 3S2MA 3A13A 1Q8JA 3QXBA 1O66A 3L2MA 3W84A 4A3HA 3PRDA 2V5KA 2E9LA 2PBCA 3B9DA 2ZR4A 5D2XA 1OFOA 1YATA 1YE6A 3N3MA 1DWIM 4F2BA 2OZ3A 3CWNA 4CEUC 1W9DM 3GVVA 3NJ3A 3ARTA 1UD2A 3NEVA 3LQLA 3W7JA 1RD6A 1VH7A 3CUZA 4E2VA 2OGYA 3HGJA 1QPKA 1B4EA 2YB1A 4W4QA 4YHGA 2ZXAA 4W9TA 4DWSC 4FIRA 1NDYA 2DJLA 4NY2A 4NJGA 1J6OA 4GE8A 1YNYA 3WMCA 3JW7A 3S8HA 5D05A 4BZYA 3GXIA 1JYXA 3FS2A 2CXGA 2BASA 3KDOA 4YTTA 3FEQA 1XLGA 3B04A 1MEHA 4MJMA 4KGJA 4HU3A 4P7RA 3H23A 2E67A 1PKLA 2V81A 5EBAA 3NGJA 2J88A 3EB4A 1GT8A 1E4MM 3QRHA 2RDTA 5FJRA 3WN6A 3T0CA 3LCGA 2J7DA 2VX4A 3O1NA 5HMSA 1WOBA 1J96A 1MVYA 3LHYA 3QN3A 5C5YA 1BRLB 4DJDC 1ZFJA 3BJTA 1O4UA 1JPHA 4HKPA 1ROTA 5I3GA 3LSCA 2OG9A 2DSZA 3N2BA 5JQ9A 3CGTA 1CGUA 5JU6A 2G41A 5D03A 3WL1A 3E0LA 4RL3A 2P53A 5FEWA 1MZHA 3B8TA 3U2CA 3DG6A 1KRAC 1OC6A 4WK9A 3EDFA 4ZB0A 1A47A 3M43A 3NAVA 4GMEA 3BG5A 3WMBA 1EZWA 3CWHA 3QJAA 3LCHA 3AISA 4KKXA 3Q58A 2MUCA 2ZWZA 1QOPA 4QE5A 3GHUA 4M56A 4LANA 3V7PA 4NJHA 2PPOA 3MT1A 4N2YA 4C6OA 4IPNB 2DSWA 4H7ZA 5JIWA 1P6CA 2ADAA 2PDNA 1UD4A 5LA1A 1LT8A 1IEVA 1PSCA 3DI1A 3SUSA 4RPPA 7PTDA 1E9YB 1GJPA 3V0SA 4A21A 4AEEA 1H7PA 3LLFA 3RM4A 1JXKA 2HEJA 4M5PA 4FX8A 1UROA 1RQHA 4GYPA 5FIPA 5BRPA 2DZBA 2D24A 4TUFA 2REQA 2VZOA 1DHKA 1WDRA 3NTYA 1O5KA 5AYZA 1E55A 3WMSA 1HP4A 4Y96A 1FQ0A 4ZENA 5EMUA 2X42A 3AZSA 3W75A 5BROA 2A1YA 5A6BA 1OEPA 3EWXA 1LP6A 3QQWA 1EGZA 3W38A 2WJEA 1V02E 4QROA 4O50A 1FAPA 3CB3A 1LLWA 2ZE3A 1A5BA 2FAPA 1RY8A 2EPHA 1YTKA 3AS3A 1KV8A 2J7EA 2XP7A 1KFCA 4FNUA 4PMDA 1J12A 3KVMA 3KWSA 2W79A 4GISA 5IHSA 1OM0A 4O54A 4TVUA 2J66A 4WEVX 5AKQA 5FL1A 4KW2A 1SR9A 2HROA 1FJDA 3IHZA 1SZEA 3G3DA 3BAKA 1UQZA 4UFMA 5A94A 3E9AA 4NF7A 1FH8A 4JYDA 1H61A 1I6NA 3V16A 1ECEA 1TTIA 2FFCA 3GDRA 4OECA 4LC8A 3GDMA 4DO6A 2XP8A 1W1ZA 3WLJA 3QV6A 1ZB5A 1M41A 4O2TA 2YZ5A 3VMNA 1AH0A 2YCEA 4U31A 3L21A 3R10A 2VENA 5AECA 3RU6A 2KR7A 1MWOA 4Q4PA 2VFGA 5AHNA 2CFFA 5E93A 3NO5A 1Y5WA 4YYCA 1B3WA 2DQWA 2PMQA 3TYAA 1BGGA 4WLCA 3S6DA 2Z7KA 1DJGA 2ABAA 4IZGA 1QMLA 2O9RA 2O9TA 3S1XA 4AD3A 1M03A 2JQXA 2OZTA 1QAPA 1XLMA 2CHOA 1TMQA 2PD9A 3WDPP 3OW1A 3SM0A 3SI9A 4JIQA 5DCEA 5A3HA 1UR3M 2ZUMA 5EFDA 4HOZA 1MW3A 5DBTA 3SQLA 1R9XA 4QP0A 3TA6A 1SW0A 4RPQA 2C71A 1XM3A 3LOTA 4WCJA 1FKHA 2NX1A 3TAOA 4NT0A 1W8GA 2QR6A 3V5OA 4O19A 3P74A 4GVGA 7TIMA 3LPFA 3T07A 4HJWA 5FJTA 5FESA 2V5LA 4XZNX 5BCAA 1UC4A 4R88A 2Z29A 2EULA 3OLEA 3BZGA 3VD4A 1HNYA 4PRRA 3ATYA 5HMDA 1VQTA 1NP0A 3PUEA 2RJHA 4BFAA 2A3LA 1FKJA 1B3VA 4B15A 1FWBC 1PDYA 2G37A 4MB3A 2QYGA 3B4UA 1WXJA 1OT1A 4JAWA 2ESCA 3GU9A 1ZAHA 4E8DA 4AC1X 3L4WA 4ZQMA 4IUOA 4BF5A 1JG9A 5FD0A 4IXXA 4Y9MA 3MPGA 1C8VA 1FKXA 1EB3A 1NFBA 2BSLA 3LI0A 3MP3A 4WSKA 4AAJA 3AIWA 1RCXB 5MHBA 3VIMA 2Z4GA 4AVOA 4AF0B 3L12A 3PTMA 3M46A 4DAIA 2GJNA 5C6MA 1EL3A 1TJPA 3VZZA 3W86A 4CQAA 2XP9A 2CETA 1IWBA 1GYLA 1UR8A 3PUOA 4C1NA 2PDYA 3VTRA 1BVWA 2VGFA 5DF0A 4LVGA 1OSEA 2VTFA 2O4MA 4N9DA 3SCPA 4J3SA 4GYKA 3LX9A 4GHRA 1TPDA 1ZBCA 3S6TA 4M6PA 4CD6A 1J9YA 3SUWA 2F6XA 4KWWA 2VR4A 1U1UA 4I7UA 3WDHA 3O07A 1YDOA 3OHIA 4C6MA 4JBRA 1BF6A 4CNSA 3E02A 5K9XA 1POKA 4V1XA 1HVXA 5C2CA 4QFUA 1EUAA 1YDNA 2DVTA 3LPOA 3SCVA 5CC7A 4L6HA 3CEUA 4M80A 2VDGA 3NEHA 1W6TA 3UBPC 1R5YA 3SGZA 5DO8A 4DI8A 3DFTA 3GTXA 2XSAA 3DERA 4LQ1A 5A8NA 2XPBA 2R14A 1SMAA 1A5KC 4MYAA 2VCCA 2B7NA 2C1GA 4IGSA 2OU4A 1BQCA 3GTFA 3IRSA 2QPSA 3U5UA 1TJ2A 2X7WA 2YCKX 3RMJA 1S2CA 4FXRA 3W81A 3IIZA 1VHCA 2PDJA 4TIMA 1RALA 2QAFA 1EX5A 4A3QA 4AWUA 2AL2B 1EJRC 2WHKA 1YPXA 1W1A1 1YW5A 1H1ZA 1BYCA 1KCZA 3AXIA 4MNJA 1J18A 2GVJA 1FRBA 1EUNA 1Q85A 1Y0EA 1IWPA 4O1BA 4US5D 1UR4A 1YDYA 4EIVA 1B2YA 3C0JA 3DENA 2CLEA 3WJZA 4WHBA 1FKTA 1S2WA 1CXHA