1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
molecule tags Signaling protein
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
2XTKA 5ECUA 3WF1A 3OLDA 2Y5EA 1WP6A 2BVDA 3SCRA 3WL0A 1EDQA 4W7WA 3PN8A 1H4PA 4D6GA 3AS0A 1QVBA 3RMEA 3WEZA 1GHSA 3EDEA 3VDBA 1G0CA 1KFWA 3IJ7A 1PJ9A 4Y7EA 2J7HA 5JBEA 1FFQA 2CBIA 1UR2A 4KGJA 1VFMA 2ZUNA 1CXLA 3M46A 1V3JA 3MUAA 1DHKA 4CD5A 1I75A 4HP5A 4V27A 4P7RA 2PF0A 1J10A 1RD6A 4B3KA 3OZOA 4J3VA 1E3ZA 4QLLA 3EBVA 4CD8A 1PAMA 3ZM8A 1NM9A 3MUY1 1IZJA 4AY1A 4JCLA 1CLVA 3WUEA 3TA9A 5AC5A 4QLJA 4Z2LA 3WEMA 4CUCA 4E4PA 2D1ZA 2C8NA 4PSPA 3WF3A 3MS8A 1L0PA 4JAWA 4HOWA 1K9FA 4DUWA 4AEFA 3AIVA 5IXEA 4CKQA 1VEPA 4MNKA 2JEQA 2WPGA 2UY4A 3VO0A 1QW8A 2GFTA 2BVTA 4MB4A 3PZIA 1W9VA 1ISZA 2QMKA 4J3TA 2J4GA 1LG2A 1AVAA 3WQ6A 1E6NA 1BSIA 1KBBA 1DWFM 2D2OA 4FLOA 4HOZA 1E6PA 4W8AA 1VEMA 3EMCA 1UHVA 4HMEA 1VAHA 5M17A 3AMGA 3MUZ1 3ARPA 1UR4A 2PWGA 2WWDA 2FGLA 2BY3A 2CKSA 3SCQA 1HJQA 3CIVA 4F8XA 4WKAA 4TTUA 3TTOA 4TVCA 3N13A 3FHAA 3T2PA 1VF8A 1ESWA 1ECEA 1SMDA 4GIAA 1OWQA 4FLRA 1J9YA 3VMOA 1LL7A 1IT0A 4NSBA 5BXSA 3T09A 1AMYA 2WVTA 1JAEA 1JI1A 1OT2A 3ZR5A 1JZ2A 2VURA 3GBEA 1PZ3A 3AMLA 4KH2A 4E8DA 4NRRA 5DT5A 3NCOA 7TAAA 2EPOA 1QI2A 3AHXA 3VD3A 3PZQA 2X2YA 2A3AA 5BCAA 5JIPA 4PCTA 3CMGA 5IDIA 1OD8A 3D3AA 3WH7A 2ZXBA 4AIEA 1IZKA 3J7HA 2WBGA 3CZLA 1B1YA 1HN1A 1Q6FA 3VD5A 1UH3A 1BQCA 4JHZA 2ZXDA 4MNLA 3O6AA 5A94A 1C91A 4TUFA 3K4AA 4U3CA 2O9RA 2RGMA 4N42A 5ABGA 4CCEA 1EQCA 2A3BA 1W3JA 3NSNA 4XB3A 3GM8A 3WQ4A 4JZ5A 3B9AA 4UQDA 3WUGA 4J28A 5D9OA 1JZ8A 1WO2A 1NH6A 3CUGA 1A3HA 5D8ZA 4X0NA 2FHFA 2VZTA 4UFHA 2DDXA 1DTUA 4P7NA 2XFFA 2WZIA 3AXHA 4JKKA 5CSYA 4M8UA 5BRQA 4CD4A 3DYOA 3SCPA 3K8MA 1WNOA 2X8RA 1M53A 6TAAA 1FH8A 4ZE4A 5IFPA 4WKFA 4AIOA 1LG1A 1GCYA 1B0IA 5CGMA 2YDQA 1M7XA 3DHUA 3BMVA 3W4RA 4LYQA 4NI3A 3RILA 3NYDA 3RDKA 1LWJA 3IJ9A 3GXFA 2VCCA 1CXKA 3WKZA 3B8SA 3ARYA 2VI0A 3ARUA 3NDYA 3N15A 4QAWA 3VMNA 1JD7A 1LWHA 3NIYA 3WQVA 5KZ6A 4IPNB 1JG9A 3TP4A 2J47A 2YL9A 3TONA 4PRWA 5EFFA 1ISYA 3POHA 3GH4A 1E56A 3ARRA 1V02A 3AZSA 2G41A 3MANA 2W91A 4ML4A 5JBFA 1E1FA 1F4HA 3CUFA 2OWCA 2NW0A 5M3WA 2PBOA 3AS1A 1KGUA 3MV01 3W6LA 1UKSA 3AICA 2J7CA 1IV8A 1TR1A 2J25A 3RPMA 1E4NA 1E6RA 3WD4A 1HKIA 2V3DA 1TFVA 1UKOA 1UD2A 4QDMA 2EPNA 2EPMX 4M81A 5C70A 1D3CA 2WHLA 3ZSSA 2BY1A 2D3NA 3WUBA 5E6YA 4UOZA 2WANA 1Q6EA 1LF1A 5CSUA 1PZ2A 3UG4A 2ZOXA 2ZUSA 2BV9A 4AC1X 2W61A 5GNXA 1GVIA 1XH1A 4KRTA 1E4LA 1KWKA 4X0VA 4ACYA 1V6XA 3OIHA 1CYGA 1QHOA 5FOOA 1H5VA 1OBAA 2OYMA 4MB1A 1G94A 3DYPA 4UFJA 3L4TA 5JIWA 4GZEA 1HXJA 1K9EA 1KQYA 2G3IA 4AWEA 1E43A 1CPUA 2VZUA 1WE5A 3OGVA 4B15A 5D8WA 1XGZA 2WZHA 3NSMA 1BG9A 1VFFA 1O6IA 4W8LA 1HF6A 2YL6A 2FDMA 1DWGM 2O9OA 1W1TA 4U5KA 1C90A 4MJ4A 1MQRA 3CZEA 1UD3A 2ZX7A 1Y7VA 1XCXA 3W6MA 4ATLA 1B3VA 1YQ2A 4AZIA 3SUTA 1V3IA 1V6UA 3RM9A 2G3NA 4W88A 4V28A 1HP5A 4HZ6A 2ZXAA 1XSJA 2WYSA 4RE2A 1WB0A 4GZJA 3VGEA 3PTKA 3ZJ8A 2BHUA 2MANA 5BXPA 2V5DA 4F9JA 3ECQA 4WK9A 3U5YA 3ARXA 3UG3A 1VFOA 1Q6CA 3VMPA 3A4XA 1UD6A 3WBEA 2J78A 1Z32X 4PYSA 1XYZA 5CQ1A 3OA5A 5JBDA 4A4AA 1O7AA 1CGYA 2VL4A 3CBWA 1WCGA 1Q6GA 2E8YA 3SCWA 2JEPA 2W62A 4D72A 4GO8A 2PB1A 3I3DA 3II1A 1XH0A 2FGZA 2WMGA 2WLYA 4D6DA 2V3EA 2WLZA 2YKKA 4AEEA 1EQPA 2DPEA 1UR8A 3DHPA 4QCFA 4WSKA 1B30A 4UCFA 3OZPA 3POCA 5A95A 3GYCA 8A3HA 4DUXA 5EB8A 5DEZA 4JFSA 3VD9A 1TA3A 4WF7A 3PZ9A 3VTRA 3VD7A 3BSHA 4JKLA 2WC4A 4JFWA 5EMYA 2X09A 4J3WA 3W28A 5ABFA 4W7UA 5I2UA 2WB5A 2YLLA 1MQPA 1W3KA 2WMIB 1JXKA 3F5LA 4WSJA 5DFAA 2ZWYA 3L4WA 4MDPA 5CG0A 4CN1A 3VDAA 3L4XA 3VIFA 3T0DA 3AROA 5GPRA 2XM2A 2VX7A 4Z2JA 4RE3A 1UKPA 1L8NA 2V3GA 1WDPA 1FP9A 2XG9A 2QPSA 3A4WA 4H7VA 8CGTA 3WBAA 5E0CA 4FLQA 4FF5A 1TCMA 4LX4A 3WF4A 2EXOA 2W63A 1HT6A 4AYSA 2UY3A 2YJQA 2YA0A 1SFSA 2WVSA 1JZ4A 2D3LA 2VCAA 1HJVA 1MFUA 1MFVA 2ZUTA 3CTTA 5A1AA 1JIBA 1W1YA 1EDGA 1MXDA 3AXXA 1Q4NX 3BLKA 5BROA 1HJSA 3O2LA 1CLXA 3WNKA 3ZJKA 2EEXA 1ODZA 1E0VA 2WVVB 1CXEA 1AQHA 2CNCA 3WUFA 4R5EA 3VU2A 2PWHA 5HBFA 3TTQA 3EMQA 2OYLA 4J3SA 2VX6A 2WMFA 1UG6A 4DWSC 2CHNA 1U33A 5C71A 3N11A 5DO8A 2QLYA 1GOKA 1BLIA 4UOQA 4GQRA 3B9DA 1NWTA 5A2CA 1J0IA 1VBRA 1KXTA 2V38A 5E0FA 4AD5A 2EJ1A 3OB8A 5CPSA 5A8QA 3FAWA 3UESA 3ZIZA 1VJZA 1QW9A 4J7RA 4HTYA 1W9XA 1BYBA 2D23A 3LPFA 4J3UA 3LMYA 4HOXA 3PZMA 4P7LA 4V2XA 4HA1A 1J0ZA 1ZBCA 2PC8A 3UR7A 2B31A 3CZKA 2XSAA 2F2HA 5FL0A 3TOPA 4PTVA 5GNYA 1HJUA 5AY7A 1H0GA 5I0DA 9CGTA 1LJYA 3WL1A 1F4AA 1VBUA 1YHTA 4Z2HA 2HISA 1FFRA 1B3YA 4GI8A 3SCNA 4QP0A 3FY1A 1AQMA 2J7GA 3WD2A 4D6FA 1XRVA 1MQQA 5F7UA 4B3LA 1UUQA 4PMQA 1E6XM 1VJSA 2JF6A 2GVYA 1TUXA 4OUEA 5A6KA 3VILA 3PTQA 3VUPA 4D6IA 1J0JA 2FH8A 3WD3A 4L4OA 2DSUA 4W5ZA 1H3GA 4AD2A 2XFYA 4K68A 5A6LA 1R85A 4U31A 2YL5A 1GOMA 1V02E 5JUVA 1R87A 3THCA 1K9TA 1GONA 4GO9A 3WSUA 4HMDA 2XJ7A 1GQIA 2DT3A 1QBAA 3CMJA 2OSXA 1UZ4A 3DC0A 1NOFA 2D24A 3IANA 4NRSA 5HPOA 1B31A 2XFRA 1ZBWA 1GOOA 3L4YA 1WZKA 5ABEA 3SIMA 2GK1B 5FD0A 3ALFA 2J7DA 5I79A 4IPLA 3ARTA 3KL3A 3MMUA 5D9NA 4DWSB 3A47A 1HX0A 4TTGA 1JF6A 5KEZA 1RP8A 2WCGA 3ZJ7A 4E2OA 4CVWA 1E55A 1C7SA 4R27A 2WKGA 2XPKA 3KE0A 1OIMA 1JF5A 3BAXA 2OLHA 1U30A 3UCQA 1TZ7A 4UNIA 3W81A 3MU7A 2ZX6A 2WC7A 2XVLA 1J0KA 2VZSA 2DIEA 3U7BA 4CU6A 1V0MA 1RPKA 2DSWA 1TMQA 1HVXA 3VD4A 5LYRA 3HU7A 1VEOA 3WELA 5AC4A 1OB0A 4IISA 4ACZA 3PZGA 1GOIA 4GZIA 3OG2A 1CBGA 1QHZA 1CZ1A 1EIBA 2A3CA 4PTWA 1VFUA 3SCUA 4EANA 1VB9A 1ZJAA 4D6HA 1KQZA 2DQXA 2VJXA 3WENA 2VTFA 1US3A 3MKKA 3CUIA 2VVSA 1MWOA 1V0NA 1JL8A 3FN9A 4CGTA 2DH3A 1EH9A 2O92A 1CECA 1FP8A 2WK2A 3WQWA 3L2MA 6CGTA 3MO4A 4UFIA 3FHQA 2YDSA 3ARZA 1C92A 2VT0A 3W29A 3EDJA 5BRPA 2CCRA 5D9MA 4MJ2A 3M07A 3JUGA 2Y8KA 3CLWA 2VC9A 1XD0A 1WZMA 2J7BA 5IFTA 4A3YA 5E9AA 1PPIA 5M03A 3AHYA 1M04A 2ZUWA 4UQAA 2VNCA 4AMCA 3AIQA 3GXIA 3QR3A 3SCSA 3VIMA 1OT1A 3GH5A 1XSKA 1KXQA 4ATWA 4DWSD 4P8VA 1QI4A 4A3HA 1J11A 3SCOA 1EHAA 2O9PA 2WVVA 1ISXA 7A3HA 1CXFA 1HJXA 1BHGA 1GOWA 5ABHA 1JZ7A 1EA9C 3NSXA 2PWEA 3QHNA 3BAIA 3RM4A 2J79A 3E1F1 1OGBA 1ITCA 1H0IA 1FA2A 2J7FA 2X1IA 3WH8A 1B3ZA 3AIRA 2XSBA 1HP4A 3T08A 2VUYA 3W0KA 3SUUA 4AZCA 3OBAA 3VIJA 2WMIA 2QF8A 4XUYA 5HXMA 2WZEA 1GOQA 3CUHA 3VM5A 3GNPA 2CXGA 1HKMA 3RM8A 1WZAA 3L4ZA 1R7OA 3SEPA 3RIKA 4D6CA 3AHVA 3EMZA 4W85A 1ZB5A 4MDOA 1JYWA 4AD0A 1UOKA 3M7SA 3GZAA 1CNVA 5LA2A 1OIFA 4PMOA 1ZL1A 2YA1A 2JALA 1GQLA 4PMRA 1LL6A 4PSRA 2Z1SA 4W5UA 5A6JA 1HIZA 1QNOA 3WD0A 2V5CA 1FOBA 1ZS2A 5TD4A 4W7VA 3PZVA 1H1NA 1CGVA 3VKKA 3QHMA 4LPCA 3WMBA 1HKKA 3KL5A 4TVDA 4JIEA 2QHAA 3ALGA 3K46A 5FCZA 5D4YA 2AMGA 3SCVA 6A3HA 1UH4A 2ZICA 2CHOA 2XUCA 4DM1A 1G5AA 3BAJA 1K6AA 4AZHA 1UR0A 4WKHA 4J27A 3N04A 1B90A 3HMCA 1V08A 4HZ7A 1BG4A 1D2KA 3PZOA 2XGIA 1MW0A 1CTNA 1QNRA 2J7EA 2CERA 4TXEA 4YHGA 1JAKA 3HJEA 5E70A 3W26A 4BQ4A 4TOQA 5IHSA 4PTMA 1UD4A 1QNSA 1UKQA 1PIGA 4OOUA 1CDGA 1G01A 1C7TA 4CCCA 2VRQA 4CVUA 4S3JA 3FW6A 1ODUA 4MB5A 1PX3A 3WDPP 4PMYA 3B9EA 3UERA 4H8UA 4HPHA 2ZX9A 4MB3A 1E0XA 2E4TA 5HPCA 3N18A 4YPJA 3VIPA 2O9TA 3CH9A 4D6JA 4MPKA 2WAGA 2BY2A 2YDRA 4H41A 1E6QM 2XIIA 1DWAM 4AW7A 4GQQA 3BAYA 2VR5A 5I5RA 3BH4A 3GXDA 4CCDA 5A6SA 2WVUA 1BGAA 3W25A 3K4DA 3GDBA 5GQBA 2WWCA 3GH7A 1VENA 3BGAA 4AD1A 1GNXA 5A6BA 1LQ0A 4MNJA 4AZ5A 1QPKA 3AMKA 4B9ZA 3VGGA 2VRKA 1US2A 3WH6A 1KBKA 3QOMA 2XVGA 4C7FA 1WKYA 1X1NA 4E8CA 2GJXB 2XWDA 4IUGA 1JYNA 3N17A 1UQZA 1BVZA 1U2YA 2QV4A 4QFUA 1GJWA 2RGLA 2YBUA 2QMJA 1E71M 3N9KA 1V3LA 1PBGA 1JD9A 3ZMRA 4UFMA 4DM2A 3IAQA 1E9LA 4TX6A 4EAMA 1BYAA 3WF2A 1KCKA 4JKMA 3AZRA 1GJUA 1HL8A 1V3KA 3A4AA 2PI6A 2EQDA 2A3EA 2YOCA 1UH2A 1J01A 3PHAA 2YBTA 4HU0A 1EO7A 4BQ3A 3F5KA 2Z1KA 3CZGA 2DSVA 1BTCA 2GDVA 2VX5A 4F9DA 3ZO9A 3L4VA 3ZR6A 1AQ0A 3U5UA 2X05A 3BCDA 3VIIA 4P7OA 4MAVA 1WZLA 2WHMA 5C8BB 5DT7A 4AZGA 1TVPA 3I3BA 3WDHA 1JDDA 3MSGA 2ESCA 4J3XA 3VDHA 3AFBA 1SMAA 1WDRA 2A3HA 3GBDA 4AISA 3OLIA 3OGSA 4M56A 1MW1A 1UWQA 3N12A 3RJXA 1B3XA 3BMWA 4M80A 1ISVA 1QNPA 1CGUA 2W66A 1V6VA 3WMCA 2DEPA 4CD7A 1CXIA 2XVKA 4P7QA 4EE9A 2J74A 5A2AA 4EKJA 1DWJM 3FXYA 3AIUA 1EXPA 3THDA 3AOFA 2DGAA 3WNNA 3AS3A 1RP9A 2D0HA 3VGFA 1JZ6A 1HJWA 3AZTA 4PUDA 4U2YA 4NZCA 3VM7A 2Y2WA 2EBNA 4JL1A 4PMXA 3CO4A 2DIJA 2XYLA 3AHZA 4CN6A 2IXUA 3AS2A 3DECA 4HPGA 1MXGA 4IM4A 3VIGA 2G8ZA 2E3ZA 1RH9A 2HVMA 2Y24A 2DSZA 1KB3A 1W3LA 4UFLA 3CHCA 1NWSA 3VIHA 2JIWA 3WNLA 2NT1A 1I1XA 4PMVA 2UWFA 3KL0A 2VZOA 3WH9A 2GJRA 4XV0A 4AD4A 1BYDA 3CHEA 1XD1A 1X6LA 1EOMA 3PZNA 1W9BM 3BXWA 2JF7A 1J0YA 3GTNA 1BPLB 3F5JA 2CPUA 1E40A 1V3HA 1BYCA 3T2OA 2PWDA 3VOCA 1S46A 1JNDA 4AXNA 1E5JA 1WPCA 2CIPA 4NF7A 5BXRA 2DT0A 1CGXA 1CWYA 2W92A 3WNPA 1W9DM 3VGHA 2WCSA 2CBUA 2WCAA 4HU8A 4PCSA 4KGLA 4B16A 1B9ZA 3EDFA 3APGA 2WXDM 3W27A 1ITXA 1TG7A 1GPFA 4UTFA 2YA2A 1HKJA 4FMVA 4TVUA 3K8KA 4F66A 5DF0A 1V0KA 5I23A 3ARWA 2E8ZA 3AMCA 4YHEA 4KWUA 3AIEA 3RJYA 1W1VA 1OSEA 3AYRA 4QLKA 5HOSA 5A6AA 1G9HA 2ZX5A 1LLOA 2D22A 1EGZA 1E1EA 4M29A 2BHZA 2WSKA 3WEOA 5CLWA 4N0RA 4PMUA 5D9PA 1FH9A 1J0HA 1W2PA 1W91A 2VO5A 3CPUA 4JFUA 4MNMA 4HMCA 5CJ5A 3VDCA 1UR1A 2VVNA 1R86A 4Q7NA 2DSKA 1BF2A 2ZWZA 4GKLA 2GUYA 5A8NA 3BCFA 4JHOA 5A6MA 4BQ2A 5I3DA 1GZJA 3NDZA 1SYTA 1V6WA 4W89A 3O9NA 4ZXLA 1M03A 2CBJA 2PBGA 1QHPA 4H8HA 1LL4A 2D20A 5AYBA 4CU7A 4PUEA 1E6SM 5FKYA 3NJ3A 1MW3A 2Y4SA 1B3WA 2X0YA 1GUVA 4TX8A 4BF7A 3AIBA 1E5NA 2AAAA 1W9UA 2CITA 4D1JA 1FHDA 4CN4A 3WIJA 3KZSA 4W93A 4AZCB 4UFKA 4RL3A 1W3HA 3WQ8A 5ABFB 1UYQA 1OINA 2VQTA 4BQ5A 4ACZB 3M6DA 1TA3B 2W5FA 2GSJA 4H04A 3WDQA 4AZBA 3KWXA 1C8XA 1UWUA 1H41A 3W38A 3S2CA 5EBAA 3BAWA 1QI5A 3TTSA 3WMSA 1QI3A 1CGTA 1NP0A 3BSGA 2ZUVA 3VINA 4BCEA 4LYRA 3IAPA 1PEZA 1E3XA 3MMDA 1JYVA 3D5HA 4HA3A 2FHBA 2BHYA 2ZUUA 4LQ1A 3VNYA 5A8MA 4P8XA 4AZ7A 3AI0A 4YN5A 1HL9A 3DYMA 1PIFA 5CGTA 3GNRA 3CZ8A 2GK1A 4W86A 2E0PA 5I24A 4JFTA 2DT2A 4U2ZA 1ZBVA 3WH5A 3SUVA 2ZUMA 2OSYA 4CD6A 3GXMA 2BS9A 1XH2A 2WC3A 4LXFA 2E40A 2W67A 1E72M 5A2BA 1JYXA 1JFHA 3AISA 3EYPA 2WM0A 3AYSA 3VIOA 5LA1A 3NUKA 4ZXOA 3K1DA 3AMDA 3WNMA 4W84A 1M01A 1VIWA 1OCQA 1XCWA 2WBKA 1KXVA 3G6LA 3LPPA 5CXPA 4OBRA 1ZU8A 1QOXA 4JCMA 3ZT5A 4PMZA 2CBVA 5BYWA 2J8GA 2BFGA 3OLEA 4Z2IA 1EHNA 1JDCA 1ZJBA 3PBGA 1I1WA 3WNOA 4X9YA 2VX4A 3MUIA 4M24A 1UWIA 7CGTA 3LPOA 2X0HA 1H49A 2F61A 1TVNA 4H8VA 4FK9A 1XC6A 4PMDA 1BGGA 3CUJA 3ARSA 4BA0A 4C7DA 3AQUA 1J12A 2W4XA 5CPTA 3VNZA 3W24A 2JE8A 1J18A 2FHCA 4UZSA 1W2VA 1UD8A 2VRJA 3WFLA 3SCTA 2C7FA 1E4IA 1V6YA 5AYIA 3F4VA 1DP0A 1PX4A 2CYGA 5I77A 1XYFA 2DH2A 4UQCA 3I3EA 3WD1A 4C7GA 2XGBA 1GVYA 1UR9A 4PN2A 2D0FA 1NOWA 1GORA 1TE1A 5M5DA 1BAGA 5BXTA 4AD3A 3WFZA 4UQBA 2G4FA 4XZBA 1OD0A 3K8LA 2J77A 1XSIA 4GINA 2WNWA 1MW2A 4GXPA 2XHYA 4UR9A 2E9MA 3QHOA 5CPQA 4URIA 3U57A 1KGWA 1D7FA 4QCEA 3T2QA 2IUZA 2OYKA 3S6TA 3SUSA 1V3MA 1QNQA 1KWGA 3CZJA 2J75A 3WY1A 3KEHA 4DWSA 1DEDA 2EPLX 1GW1A 2VZVA 3BAKA 2QPUA 3FAXA 3U7VA 1QI0A 1GQKA 4KMQA 4ATDA 3WF0A 4HA4A 4WJXA 4GI9A 4OBSA 3UR8A 2F8QA 1WDQA 3IJ8A 4PTXA 5A8OA 4JFVA 3RO8A 4ZEPA 4XZWA 2E9LA 1V0LA 5I6SA 3BC9A 3VGBA 2Y8VA 2NSXA 3WDRA 4MAZA 4OZOA 4WIWA 4LGXA 1MVYA 2XM1A 4OIFA 1JDAA 1NWRA 2UY5A 2OWXA 1NP2A 1JFXA 3W53A 1B2YA 3MSDA 1V03A 4BS0A 1P6WA 3A3HA 3CHFA 1NARA 3AJ7A 4P8UA 1BFNA 1UWRA 3QGVA 1W9PA 4D71A 2EPKX 2CESA 1XV8A 4L4PA 5A8PA 3VGDA 3PTMA 2WHJA 5DMYA 1FH7A 4U3AA 4S3KA 2GJPA 1GQJA 2C0HA 4UQEA 1CGWA 5CLTA 3UETA 2BXYA 1MYRA 4GPNA 2JFEX 5JH8A 2PWFA 3TTYA 2V3FA 1WAWA 1ISWA 5FIPA 2WSPA 4UOJA 3IK2A 5EFDA 3L2LA 1H2JA 3A6OA 4AZ6A 3GNOA 1PX8A 1C8YA 3LPGA 1E0WA 4EK7A 4WLCA 3WQ5A 4RE4A 1OM0A 1UQYA 3HN3A 1ZBKA 3ARVA 3UEQA 3UG5A 4M82A 3G6MA 2NT0A 2OSWA 4MADA 1R7AA 1G1YA 4HZ8A 1EO5A 4PEEA 2VR4A 2XWEA 1JZ3A 2WHKA 1KXHA 1E4MM 1E70M 2J8FA 3FNDA 1CXHA 4H2CA 1A47A 2YIHA 1QBBA 1DWHM 4Z2KA 4KRUA 5HDRA 1GHRA 1X6NA 1EDTA 1KR0A 3ZQ9A 1KR1A 2FH6A 2GJXA 5HNNA 4Z2GA 1H11A 2ZIDA 4OKDA 4ZENA 1JNEA 1UZ1A 2GDUA 2VQUA 4D1IA 3ZSTA 3SURA 1WDSA 4ZFMA 5A69A 1R8LA 5E6ZA 3VX1A 3VX0A 1JGIA 2VMFA 3PZUA 1VRXA 1NWUA 5IHRA 2VCBA 1H09A 3N1AA 2IXVA 5I78A 1UWTA 5E09A 1JZ5A 3AIWA 4U33A 3WDIA 1UKTA 3ARQA 4DUVA 1E15A 5GNZA 2E9BA 1NQ6A 2BY0A 3CHDA 3CGTA 1DWIM 5A6BD 2YL8A 3OGRA 1UA3A 4M1RA 3ZT6A 2DT1A 5BWFA 1Q6DA 4LYPA 1W1PA 2ZXQA 3T0BA 2TAAA 4OOZA 1NOUA 2WMKA 3BLPX 1HNYA 3VVGA 4W87A 2Q8XA 1C3FA 2D0GA 4FLSA 4OJYA 4JL2A 2UY2A 3PZTA 4UQ9A 5A3HA 3AXIA 1FHLA 4Q22A 1CIUA 3RCNA 1SR0A 2ZE0A 3VPLA 2XVPA 2VOTA 1BVNP 4W8BA 4D6EA 5LA0A 2WMHA 3EDKA 1EOKA 3WDJA 4U5IA 1KCLA 4BZYA 2CEQA 1K9DA 3MV11 1C8QA 3W82A 5FL1A 1JI2A 1E6ZA 3QOKA 2YLAA 2CETA 5CZKA 2XVNA 4XX6A 3VIKA 1E73M 4F79A 3WN6A 3L4UA 4GI6A 3ZT7A 1UA7A 3SUWA 2JIEA 2WW5A 1HVQA 1CEOA 1W32A 2G3JA 3OLGA 2WMJA 2G3MA 2OWWA 1JXJA 3MMWA 4AIUA 4MTVA 2BVYA 4CU8A 1KGXA 3T0AA 3EDDA 2XIBA 4PMNA 1C93A 4ZE5A 4UZUA 4B9YA 4P8WA 2WKLA 2BNJA 1OGGA 2EO7A 1N82A 2BXZA 1CENA 3AHTA 3ZJ6A 1UWSA 3W37A 1OGSA 2AOSA 2CKRA 3ZOAA 2J62A 1UD5A 4PBGA 2ZX8A 1XHGA
chains in the Genus database with same CATH superfamily
2VEPA 1S2TA 3OLDA 3WL0A 4W7WA 4EVZA 3PN8A 2ZQTA 1QVBA 1LRQA 3RMEA 2DVUA 3FGCA 3VDBA 3NZQA 4JN7A 1DBTA 2PE4A 3IJ7A 4L1GA 4HSNA 5K4XA 4C6JA 2V5JA 2VDIA 3QKEA 5A8GA 1S2VA 1UR2A 2ZUNA 2DU2A 4CD5A 4ZB5A 4HP5A 4V27A 1YADA 2PF0A 1RD6A 4B3KA 3OZOA 4J3VA 1E3ZA 3T4CA 4RNHA 3QTPA 3EBVA 4LUSA 1PAMA 1OYCA 3C2VA 1TCDA 4AY1A 1CLVA 4S3GA 2A5HA 3UU0A 5AC5A 2W9MA 1VBJA 3M7WA 2WPBA 3WF3A 1L0PA 4JAWA 1RXOB 4HOWA 3I7QA 3W7IA 3VKJA 5IXEA 3LCIA 4MNKA 1PKMA 3DAQA 3QY8A 1SSGA 2XH0A 1W9VA 1ISZA 4J3TA 3OTRA 1WAUA 3AU2A 3EOEA 1JGMA 3M1ZA 1DWFM 3AXMA 2OKOA 4HOZA 1B9BA 4I7WA 3VC5A 1QMLA 3AMGA 1O12A 4OVXA 2YXOA 3DIPA 1VFHA 3V0TA 2WWDA 3P80A 4RNJA 4F8XA 4J5NA 3U2OA 4BWLC 3N13A 2MPHA 4RZ6A 4JQ1A 1ESWA 1ECEA 3E6EA 3FDGA 3NQ7A 1SMDA 2ZVIA 1LL7A 3T09A 3CT7A 2O55A 2WJEA 1SZRA 1TWIA 1EJUC 4YJ5A 4E8DA 5DT5A 3HGOA 3NCOA 7TAAA 5HNUA 4JFJA 3VD3A 3QKZA 2QXWA 2X2YA 3Q2DA 2A3AA 3KBVA 3O8AA 5D38A 3ANYA 1AW1A 3CMGA 1XIMA 3UI5A 5IDIA 1YDOA 3D3AA 3WH7A 3HV8A 1PSCA 4QE4A 4C6NA 2WBGA 1YATA 1V5XA 1W5QA 1UH3A 3NZ1A 3QC3A 3O6AA 1C91A 4TUFA 5E9XA 1A0EA 3SI9A 1AL7A 1ZFJA 4XZLX 4DJDA 4N42A 4PCFA 3RNDA 4GISA 1W3JA 1KCXA 1XISA 4XB3A 3E5PA 4GQGA 3S1VA 3WLTA 4FXJA 5FSEC 3I10A 3UA3A 3BICA 1F5ZA 1AJZA 5H91A 4M51A 1UR3M 3CUGA 1I9CB 4MY9A 2EPHA 4A29A 5CJMA 1JPDX 2FHFA 2VZTA 4UFHA 4P7NA 2I16A 3LS9A 1H7XA 3TW9A 3V0SA 4M8UA 3H2EA 1Q3NA 3LGEA 1H7RA 2KR7A 2X1TA 3F4DA 1X8CA 3UZJA 5G2WA 4WKFA 4R9XA 1GCYA 1B0IA 2C0AA 2YDQA 1F3EA 2QW5A 4OE7A 3QF0A 4NI3A 3NYDA 3RRAA 2VCCA 1CXKA 3WKZA 3W1AA 3B8SA 3NDYA 3N15A 4JDBA 4K37A 1DJQA 3NIYA 2Z00A 5A5WA 5CPMA 3TP4A 3QM3A 2YL9A 1XIBA 3MKCA 3POHA 3AZSA 5I3JA 5F4SA 4FIRA 1E1FA 1F4HA 2FZNA 2OWCA 3KBJA 2NW0A 2PBOA 2XZ7A 3MV01 3BJFA 3AICA 3THUA 3BW4A 3N2XA 3VZZA 3ITLA 4GVHA 5AYYA 3GTHA 4H6KA 2E28A 1HKIA 2V3DA 1KKRA 1TFVA 3CMFA 1UD2A 3K4WA 2NXHA 4M81A 2QUVA 1DIEA 1XPGA 4XO7A 1HW6A 4IQLA 5AECA 3ZSSA 4Q4OA 1G7VA 4PBFA 4UOZA 3PK7A 1Q6EA 5FA5A 1PZ2A 3IIPA 1J4RA 1K8XA 2ZUSA 3Q4DA 2BV9A 2Y89A 1E4LA 3BGJA 3S0CA 2WSYA 1KWKA 4ACYA 4GGHA 1J4IA 1V6XA 1Q6OA 1ZUAX 3FYOA 3OIHA 4IG2B 1D7IA 1KM0A 1OBAA 3URNA 5J6EA 5K3VA 2OYMA 2K8IA 1EIXA 4PH6A 1W5PA 5EMKA 1HXJA 1OCJA 4QZVB 5HTGA 3WX7A 4AWEA 1EYEA 3VI2A 4EAYA 1VFFA 4HKPA 2YL6A 2IF4A 2O9OA 4U5KA 3UWVA 3S6DA 2CLHA 4JS3A 4L5ZA 1NDVA 1B3VA 2Z27A 3IRSA 4CNNA 3E96A 1RJQA 5I09A 4AIBA 3BV7A 1OZMA 4NZ5A 1WOAA 3V1PA 3SY1A 3O7UA 2POTA 3EEGA 3RCMA 4C91A 1XSJA 3VGEA 3P5ZA 3ZJ8A 2FPYA 2I9UA 5HWBA 4YLWA 2V5DA 1XS2A 2PPNA 4C6EA 4WK9A 4UBPC 5I3IA 3NL5A 1NFPA 3VMPA 3FKKA 4XZMX 1WXYA 1Z32X 4PYSA 4LALA 5LHEA 5I03A 2TSYA 1O7AA 3NTYA 1H60A 3VNJA 4A35A 3CBWA 1Q6GA 3QV8A 3PWGA 3MHGA 4GO8A 4ZO6A 3IWPA 5GJPA 3OP2A 2C1GA 1XH0A 2FGZA 2GL5A 5BXJA 1FKWA 2V3EA 4RX0A 4CCZA 4J4KA 4QCFA 1DQWA 3OZPA 4RXFA 5A95A 1ZZMA 2E6DA 4GUGA 4V33A 5DEZA 1XQKA 3GHRA 2PGEA 4JFSA 4YWSA 3VTRA 1KRMA 3NAVA 1TPVA 4J3WA 1GVOA 1JXKA 2GUUA 3O05A 5XINA 2PDPA 4H9YA 2ZWYA 1YW5A 3CWNA 1QO5A 3VIFA 3T0DA 1K3UA 3TROA 4WY0F 3MB9A 3LRKA 1VHCA 4Z2JA 4PL2A 1QR7A 2ZRYA 2J9XA 1TV3A 2XG9A 2QPSA 4H7VA 3ZLGA 3B0UX 1TCMA 4LX4A 2EXOA 2INZA 4JHMA 2UY3A 5K9XA 1MDLA 2YJQA 1SFSA 2WVSA 4QITA 3GNNA 1MFUA 4TYOA 4IOTA 4O11A 1W1YA 3C2FA 1Q4NX 1R3SA 1KM4A 1MUCA 3ZYZA 1HJSA 3T05A 1UUOA 3WNKA 2VDGA 1ONXA 2XIMA 5MF5A 3WUFA 3SQLA 2RJHA 1Q7ZA 3Q67A 2PWHA 1RBOB 4LAVA 5HBFA 2RUDA 3EMQA 4DRKA 1KW1A 2PGWA 4AUBA 2CHNA 2RUCA 2RH9A 3N2MA 4LNYA 2QLYA 3G1YA 1IEWA 4UOQA 3K5XA 1GVRA 1NWTA 5KITA 4I6VA 2HE5A 1NDWA 2FLIA 4NG3A 2V38A 4I9JA 3EKGA 3HBLA 1TUFA 2G37A 1PWMA 4HYWA 3ZIZA 5EPDA 5L9FA 5AZ1A 3LPFA 3DGRA 3NEVA 1PDZA 3CK5A 4LUTB 3EWDA 1J0ZA 4HQVA 4XAKA 3LERA 1GOXA 2PDHA 2NQJA 2PC8A 3CZKA 1TQJA 1VHNA 4PTVA 4MUPA 1H0GA 1VZWA 1Q2SA 2FPTA 3MCMA 3H54A 2J9YA 3G3DA 1F4AA 1AUSL 1E1CA 3NXFA 1GKRA 3SCNA 3RFWA 3M4HA 2R6OA 3LCLA 5IBXC 5HATA 1QOPA 1RR2A 4AQLA 4D6FA 3G0UA 2QF7A 1D8WA 2Y5SA 4OUEA 2Y8UA 3PTQA 3S9ZA 1JUKA 4XTDA 3FDKA 1EUNA 2CZDA 4W5ZA 2L5HA 3TIMA 3ZZ1A 2HVOA 4DX3A 1PZ0A 4K68A 5A6LA 1Z41A 3OVGA 2YL5A 4L6DA 2ZR5A 3HQPA 3W1QA 3PUGA 1RY8A 2PDQA 4HMDA 1GQIA 3CMJA 3USZA 4KIEA 1WBHA 2XFRA 3IV3A 1GOOA 2A6LA 3TJXA 2DV0A 4DRJA 3VCRA 4DZ3A 3L4YA 1LQ2A 3SIMA 3WMLA 5FD0A 3ALFA 2UBPC 4CQAA 3KL3A 4DWSB 3A47A 3EX6A 2QCEA 3DC8A 2RFGA 4H83A 1FKJA 5DIUA 3UFYA 3TW6A 3LXCA 2FQIA 3MSYA 1U30A 1PO9A 1TZ7A 2AQVA 3W81A 2UV8G 2VFEA 3EWUA 2ZX6A 4F0MA 5BMWA 2VZSA 3U7BA 3WLQA 4IIBA 1V0MA 1HGYA 3D46A 3TQPA 4GBDA 2DSWA 4QEEA 3AXKA 1M41A 2FVLA 1HKWA 1R2SA 1TRIA 3UI4A 1I6NA 3R0DA 4WOQA 5AC4A 3PZGA 2WJDA 2QGHA 3LI0A 4CNOA 2F6KA 2OR2A 4LY4A 3KHDA 3L0KA 1GRJA 3MDUA 1VFUA 4GX9A 4IQEA 1R3WA 4PGLA 2PWVA 3EOLA 3W7DA 1I2PA 3IKDA 4GD0A 1BKHA 3V16A 1KRBC 5I3FA 3P62A 2DH3A 3RRXA 3NO3A 2O92A 1JNTA 1CECA 2WK2A 4Y8FA 3G77A 3N4EA 3W73A 4DZAA 2VC7A 1VS1A 3EDJA 4WOZA 3HJZA 4NASA 4MJ2A 3UD6A 2Y8KA 3M0LA 3R4IA 1EYMA 3IIZA 2J7BA 3N9RA 5E9AA 4PL1A 6REQB 3CEUA 3AIQA 3S1UA 3GPKA 5HUOA 1F61A 2VGIA 4MVAA 1ZCCA 3QR3A 4B5UA 3P2VA 3NZGA 3DENA 4IPJA 3SCOA 1FWJC 4CQ9A 2QQ6A 1DVJA 2ZZ6A 1PVNA 3GS6A 1CXFA 1YPXA 4DRNA 3MWCA 1JZ7A 3NSXA 4G7EB 4LF2A 2J79A 3E1F1 1ITCA 3FA4A 3URAA 1FA2A 3WH8A 3AIRA 2XSBA 4FO4A 2XH2A 2VUYA 3ITYA 1OFDA 3SUUA 3OBAA 1RQBA 2QF8A 2V81A 3OQEA 4PB4A 3GNPA 5EY5A 5H8UA 3RM8A 3L4ZA 4NU7A 1J79A 2Y6ZA 3FJNA 3W75A 4D6CA 4UTWC 1W31A 1ZB5A 1EWDA 1JYWA 4LU0A 4AD0A 6TIMA 3S4TA 1UOKA 2RKXA 3M7SA 2EG8A 3DFTA 3S5YA 2G0WA 4FI4A 2NVDA 2JALA 4PMRA 1LL6A 1FKIA 3KAGA 2Z1SA 3NEHA 4QE5A 1HO4A 4V1XA 1QNOA 1K4GA 2NUWA 1L6SA 2EKCA 1ZS2A 4J1OA 1QATA 3W2JA 2GUBA 2PTWA 3N9SA 5DXXA 1LM1A 1CGVA 3EOOA 3KL5A 2PDBA 3FYPA 3TR9A 3QPZA 1TQXA 2QHAA 3FYYA 1RCQA 2WM1A 4OFCA 2P88A 2ZADA 1SSDA 5D4YA 5TIMA 1UH4A 3TSMA 2CHOA 2XUCA 4DM1A 4GGQA 1G5AA 1GK8A 1Y5XA 1UR0A 3HF3A 2XISA 1B90A 4BF5A 5AKQA 1P7TA 4C6MA 3G1HA 1LZOA 1AH0A 2PPGA 3NNTA 2YCLA 4FX8A 1QNRA 1V79A 5I7GA 3FIGA 5E70A 4BQ4A 5T91A 5IHSA 3DG6A 4PTMA 3W71A 1W56A 4G1KA 2YB1A 2X1RA 2ACSA 3KCLA 3UF8A 1C7TA 5C2XA 2VRQA 1R9ZA 4BK9A 2XGZA 4ZOAA 2PAJA 3PBYA 1HZYA 4JX4A 4HSOA 4W9OA 3VIPA 3CH9A 4J2PA 2Z6JA 4HPJA 1LOSA 2WAGA 1EX5A 4LVAA 4AW7A 4GQQA 2C79A 2PD9A 3GXDA 3AO0A 4CCDA 2OELA 1KBIA 2MUCA 1LUCA 3S83A 2DY3A 6XIAA 3GR7A 5LIYX 5GQBA 3GH7A 3ZLHA 5A6BA 4L1WA 1MDRA 4C6QA 2OEMA 1QPKA 4B9ZA 1KNWA 3SB0A 3MO7A 5AYZA 5B80A 2Z26A 4DRHA 1M7JA 4Z1BA 3WH6A 1P7TB 2XN0A 5IM51 2O7QA 3PRAA 1X1NA 4E8CA 4IUGA 3QGKC 4CNPA 2OPJA 1BVZA 1TWWA 2QV4A 4QJ3B 1R3RA 1E71M 1V3LA 1IXPA 1JD9A 3ZMRA 2YCLB 5D2WA 4EAMA 2QAFA 1GJUA 4LCRA 4X2PA 1NMWA 2I5IA 3TZFA 5GJNA 3KVMA 4KWSA 3EPMA 4CNSA 2OVLA 5F1UA 2YBTA 1EZWA 1ZJHA 3PG9A 2DSVA 4EXBA 3BZGA 1VFTA 2B7NA 3U5UA 1PCKA 2WQDA 4ZQMA 3BCDA 4MAVA 4ODNA 4FALA 1AD4A 1B5TA 4QX4A 4AZGA 1MO0A 5CBJA 3CQJA 1TVPA 2QJNA 3W2UA 3EY6A 3I3BA 3WDHA 3IGXA 2Z29A 1LBLA 4M1BA 3MSGA 4WVXA 2ESCA 4ZSUA 4ODLA 3AFBA 4UMBA 3B0YA 4Q8NA 3KLLA 4M56A 2PLCA 3U48A 4XZHA 1UWQA 4B2DD 1K8ZA 3PR2A 4KPLA 3V1HA 5K9CA 3TQVA 1QNPA 2ICSA 1FX6A 4KQZA 2JGQA 3WMCA 4KKXA 4CD7A 1K1DA 1PZ1A 5A2AA 2G3FA 2QPXA 1DWJM 2VFIA 4F40A 3QV9A 3WNNA 3AS3A 4ZQPA 5E93A 3C0SA 3WK1A 4U2YA 4JYEA 2DIJA 3GU0A 4GIRA 3WJXA 2PDWA 1YEYA 1MXGA 1GEHA 4IM4A 3VOIA 3DX5A 1W3LA 1NWSA 4L6HA 1K7XA 4KEMA 2FJKA 4PMVA 2VZOA 4XV0A 1A4MA 1BYDA 3NVDA 1F6PA 1QK0A 2ACUA 4L4MA 3GY1A 1V3HA 1BYCA 1VLIA 1XWYA 1DIOA 4LB4A 1S46A 3WG6A 3G1AA 1WPCA 4L80A 3V18A 1WUEA 1CGXA 2W92A 4O8RA 2P1FA 1AMKA 1Z8AA 4HU8A 4PCSA 3APGA 1ITXA 1P6BA 2ZVRA 5TQLA 1M5WA 1TG7A 4C6CA 2PV1A 1GPFA 2YA2A 4I3GA 1F3TA 4IGSA 2E8ZA 4UTHA 4YHEA 1PWLA 1JDEA 2DJXA 1Q65A 4Q32A 1LLOA 1VRDA 1E1EA 2QCDA 2WSKA 4LUIA 5CLWA 4N0RA 4PMUA 4BF9A 3RCYA 5D05A 5CGQA 4IICA 4DJED 2VO5A 3NVTA 4DAFA 4DN1A 1Q8JA 5CJ5A 4Q8TA 2VVNA 1OJXA 3BK0A 2DSKA 2ZWZA 3FX4A 2C16A 4C5YA 4JHOA 4R9OA 1AQFA 3M43A 3NDZA 3IK4A 1XYBA 3DUGA 1SYTA 4XVDA 4ZXLA 3GVVA 1TMHA 4MG4A 4F0LA 3VOHA 3WBWA 1WUFA 5JH2A 3WQCA 2ZYFA 1AD1A 2YYTA 1E6SM 3D47A 4Y9NA 1M7OA 1SZNA 1BWVA 3A9BA 1EC9A 1O1ZA 1GUVA 4YIWA 3AIBA 4QJ4B 2CITA 2CFFA 3WIJA 3KZSA 1H51A 3S5NA 4RL3A 4IQJA 2FVKA 1UYQA 3P67A 4QT3A 3DXIA 2VQTA 1GYNA 3M6DA 2J13A 2B81A 2ZE3A 4H04A 4AZBA 1KA9F 4EF9A 3BLDA 3U9IA 3PVFA 4KCWA 3B06A 3BAWA 1QI5A 1EKOA 3TTSA 4UR8A 1QI3A 1V7AA 1L2QA 1FHUA 1Y0EA 5BOOA 2X7WA 3BANA 1E3XA 3NO1A 1JYVA 3D5HA 2BHYA 1J8VA 4DBWA 3P5YA 5U7SA 4P8XA 4PEKA 1SJAA 2VELA 3MT1A 1HL9A 3B4UA 5CGTA 4ZZ9A 3QTGA 1X6UA 3FAPA 1ITUA 4W86A 3M44A 4LOCA 4FZIA 1OCNA 4JFTA 4JX6A 2NX1A 3LZ5A 3TOYA 3WH5A 1H61A 5LGXA 1YPIA 2OSYA 4GCXA 3GXMA 2BS9A 1O5XA 3LTYA 2WC3A 2P5NA 4FIQA 3CHVA 1RQEA 2E40A 4UWMA 3UJRA 1XFCA 1MNSA 2OGYA 3AYSA 4PB3A 3NUKA 2HSAA 5CC3A 3K30A 4NXSA 1VIWA 3B8VA 3CL6A 3REQA 3UT0A 1KXVA 3HGRA 4I5XA 4JCMA 3TNBA 5C5YA 4BY3A 5E0KA 1I2QA 3QZEA 4RNFA 1P1XA 2J24A 1EHNA 1ZJBA 3PBGA 5ABTA 1I1WA 3D0CA 2V5BA 4JOMA 1TPWA 1LUCB 4M24A 1TVNA 4ECLA 2QV5A 2JKAA 4TW8A 4HBKA 1J12A 2OQLA 4S3CA 3S5OA 2JE8A 1J18A 1RV8A 1EF2A 2FHCA 4JNZA 1Q4WA 2ISFA 2VRJA 2BGQA 4JTSA 1DIDA 1E4IA 3F4VA 3O5FA 2CYGA 5I77A 1P5BA 4EF8A 1NQKA 2A2IA 3NQEA 1FKDA 2FKPA 4JQAA 4FB7A 2D0FA 5FESA 5I3HA 5BXTA 3OVPA 4XZBA 2NLIA 4UTWA 1OD0A 1HKVA 4PFHA 3K8LA 2J77A 5F2LA 5FEWA 3F2DA 1TIWA 3LTPA 2I14A 2WNWA 1G4PA 4GJJA 1VPYA 3JYMA 1P43A 2PMQA 1P5QA 2PD5A 1IXOA 1NAL1 1KGWA 3GU2A 5HWCA 2QIIA 1YE6A 2IUZA 3JZEA 3S6TA 4ICNA 1M68A 2P8BA 4IP4A 1ELSA 3ITCA 3CZJA 3HQOA 2POZA 3L9CA 3R0UA 2BVWA 1EGMA 4S23A 1JCYA 3CAKA 4JTGA 3LA4A 2OGJA 1VD6A 1WKDA 1GW1A 3G8RA 1TWSA 4GA8A 4MIMA 5D75A 3WF0A 3U4AA 3DKJA 3H4GA 1AK5A 1BKSA 3UR8A 3OG3A 2F8QA 1WDQA 3IJ8A 2E9LA 3TC3A 3DFSA 1QWKA 5I6SA 2Y8VA 4O4VA 2NSXA 2XM1A 4OIFA 4ERGA 2OT0A 2CLLA 3LLDA 1JFXA 3WLIA 3W53A 2NZLA 4BS0A 4KBXA 1QZ2A 3IPWA 3ITVA 4L4PA 5DO2A 1FH7A 5HJLA 4CNTA 1R47A 2RDWA 4UTIA 4LRSA 3OYZA 4JD4A 4MKSA 5CLTA 3UETA 1VYRA 3UY7A 1MYRA 2XIOA 3ID7A 1WAWA 4R3UA 1H2JA 4AZ6A 1DE5A 1J96A 3P14A 1AW5A 2R1PA 4WLCA 3TKFA 5DQPA 4RE4A 1UQYA 1E0TA 4A2SA 2ZA3A 3GHUA 1W54A 3ARVA 3UEQA 2NT0A 1MSSA 5G5IA 1G1YA 1BXNA 1EJ7L 4QSHA 3KAFA 1KXHA 1ENUA 1KM6A 1XIHA 3HZ3A 4H2CA 1A47A 2XU2A 1VCFA 1ICSA 3E0VA 1K8YA 5HDRA 2VD8A 1X6NA 3M6YA 1EDTA 1VIZA 3JXVA 1KD0A 1IT8A 2XPBA 1DYSA 4DRMA 3IIOA 4L9YA 5HUAA 3G3MA 2VQUA 4D1IA 5TNVA 1MNZA 4ZFMA 4N9BA 3SURA 3GVQA 5E6ZA 1SJCA 5AC6A 5HA7A 3KTCA 1JGIA 3QJAA 2PU1A 1JCMP 1NWUA 1D9EA 3B9OA 2F38A 1NY1A 1EP3A 1JCXA 1H09A 2IXVA 2NSOA 3VYLA 4KCVA 4IXXA 5E09A 4XD6A 4AAJA 1UKTA 1NQ6A 3MZNA 1VP5A 5A6BD 3B0VC 5JMUA 4EXAA 1ADOA 2DT1A 1SO5A 4GYPA 4DO6A 3PSWA 4S38A 4LYPA 1W1PA 2ZXQA 3T0BA 2TAAA 1NOUA 3BLPX 1BWKA 3KCEA 1HNYA 3CYJA 2FZ9A 2D0GA 5DCEA 4OJYA 2R14A 3Q65A 2M1IA 1FHLA 2ZE0A 3R8RA 3W7KA 5LA0A 3EDKA 2PCEA 1DXEA 3TUUA 5HWJA 1NEYA 3O5KA 3MUXA 3LCGA 2E5DA 5IBXA 3VFLA 1C8QA 1FWAC 3KW3A 1E6ZA 3TCZA 3EWZA 1IWBA 2XVNA 4LCSA 3S3GA 4K1WA 4GI6A 2A79A 1OZQA 1KLYA 5TAOA 4YCPA 5KSWA 1DQXA 3C0JA 3B03A 3PS7A 1W32A 3LNPA 2XH7A 1DOSA 3OLGA 2BLEA 3UJ2A 3H2CA 2G3MA 2OWWA 1JXJA 4AIUA 1Q7MA 2NWSA 2BVYA 4AYGA 3T0AA 1YNPA 1C93A 5F2MA 4ZE5A 4UZUA 1OFBA 2WKLA 1N82A 3AHTA 3ZJ6A 3W37A 4ODRA 3ZOAA 1UD5A 1W1A1 1GTEA 4REQA 3DFYA 5ECUA 4ODQA 1A80A 3QVQA 1H4PA 4D6GA 4US5D 1A5BA 1A3XA 1Y5WA 3WEZA 1FJDA 3YPIA 4Z08A 4JXCA 2R1LA 4DBEA 3UZ5A 9RUBA 1PJ9A 1O68A 3W9ZA 4AY7A 3ITGA 4DPPA 3PB2A 2X1SA 2PPPA 4K7VA 4GE8A 1V3JA 3MUAA 1I75A 3PAJA 3A12A 1J10A 3GTXA 3CXOA 1J4EA 1A5KC 3R1ZA 1DJWA 3ZM8A 2C19A 3MMTA 3W02A 3KOZA 3WUEA 5SWUA 2Y85A 4IMDA 4QLJA 4CUCA 3RX4A 4E4PA 2XP8A 2C8NA 2GGIA 2BG5A 1KT0A 1GVEA 2P76A 3UPWA 1NTHA 3VNKA 4Q4MA 5HT1A 2WPGA 2UY4A 4R88A 4I9MA 3VO0A 3RUBL 4PUUA 3PRBA 1CX9A 2BVTA 4MB4A 1QO2A 1ME9A 1V8EA 1TREA 4DF2A 1QAPA 2NQLA 1AG1O 3QMSA 2D2OA 2HBVA 3JW7A 5FEXA 4S2BA 3EMCA 1UHVA 2Y61A 4HMEA 2HXTA 1S2WA 3MUZ1 3WBXA 3ITOA 3EPNA 2C1HA 3EXRA 3UCDA 1DJNA 4AHPA 2CKSA 5JU6A 4NT0A 1OYAA 4LY8A 1FXPA 4NY2A 4DXXA 3BTNA 1VF8A 4C1NA 3UZWA 2RSEA 2VGBA 4GIAA 1UWAA 1TTQA 3HMJG 3R5EA 1XX1A 1BXCA 3ZFHA 1XPYA 5BXSA 2EG7A 1YNYA 2Z7GA 1PZ3A 4UTLA 4KH2A 4NRRA 3U8GA 2OFNA 4HZMA 3PRDA 5BCAA 5JIPA 5D09A 2ZR4A 5LKYA 1YYAA 2CLKA 1LDCA 2DW6A 3KVKA 4MOZA 2OX4A 1HN1A 3VD5A 4WXYA 4ZPWR 4GYFA 4JHZA 4UNLA 4MNLA 5A94A 5LHFA 3K4AA 4U3CA 4P2VA 3JU2A 4L56A 3FA5A 4DZ5A 4WRHA 3O5PA 2VEFA 3M41A 3TCEA 1TV2A 3W3OA 4CCEA 1FWFC 4Q6JA 1RLDA 2Z1BA 3R58A 5FJUA 1WBJA 3RX2A 1M5YA 3LD5A 1A3HA 1YBQB 4MYAA 3N2BA 3NPXA 3C6CA 4NXKA 5D30A 2QULA 4XKYA 4CD4A 4N4PA 1FWWA 1VC4A 3KWSA 1GJPA 3FFSA 4GXMA 3W2LA 3LHUA 1WNOA 4DZ2A 2X8RA 4PUNA 1M53A 1KBJA 1ZENA 2DFAA 3O5RA 4AIOA 2OFJA 3S2JA 3IJQA 3UGVA 4LC8A 3QQ1A 3ENLA 3BMVA 3RILA 1PCWA 3P7YA 3LGDA 1YW1A 4AB4A 4P5UA 4DI9A 4LVFA 3TDFA 3GC2A 1XIEA 5KMYA 1XINA 3WQVA 4AWSA 3WZ0E 4IPNB 1JG9A 4LBSA 2HPIA 3TONA 3APYA 3FSTA 3HFTA 3F4WA 1E56A 1V02A 2RAGA 4ML4A 2DUZA 2H9AA 3GVWA 4O16A 4DZIA 1V6TA 2NXGA 2VC6A 3NO5A 3CUFA 4TW6A 3LSCA 4HVXA 1LLZA 1KGUA 3AWOA 3W6LA 1I8JA 1EJSC 1E4NA 1P48A 5EU9A 3F2BA 1UKOA 2Q6ZA 1ICQA 4LVDA 3DH7A 1O66A 1YDVA 2EPMX 1X38A 3HOJA 3DHFA 5C70A 3WUBA 3RHGA 4HIBA 5E6YA 3TYDA 2HVNA 1A5NC 4IG2A 3EXTA 1ALDA 8RUCA 5DIVA 4PZVA 1IR2A 4LANA 5K9DA 1AJ2A 1W1B1 3KABA 2W61A 3JZUA 3W88A 2VXNA 4GKTA 3ABQA 2P3EA 4LW7A 1CYGA 1R9XA 4FEZA 2QAPA 3GR4A 1IWPA 2QCMA 3RPTA 1A5CA 1I2OA 4ODKA 1YLVA 1XM3A 1AFSA 3BLIA 2NWRA 1FTXA 4ZB2A 1MEHA 4GZEA 3KP0A 1K9EA 1X8FA 3WQPA 2VZUA 3QLDA 1OG0A 3T9PA 4QT2A 3EX3A 4FNSA 4W9QA 3KXQA 3QZAA 5C9UA 1PTAA 2ITKA 1O6IA 2FDMA 2VEGA 3V5CA 4MJ4A 3CZEA 1TV8A 2ZX7A 3KRBA 3W6MA 3P81A 5AHNA 1YQ2A 4AZIA 3I65A 4DNMA 1V3IA 1SJBA 3EA2A 4W88A 1HP5A 5AHFA 5C7VA 2B0MA 2JGYA 2G96A 3QW3A 4UTJA 1TTPA 4ZODA 4IT6A 4HMNA 4PODA 2BHUA 4DYEA 1WYIA 1P6CA 5M2FX 1FBAA 1EFZA 4QTGA 3CQKA 3U5YA 2P10A 5E5CA 3ARXA 1P4CA 1SUXA 1GQNA 3BCJA 1Q6CA 2Y62A 4MLJA 4O1EA 1NMVA 3RF9A 5CQ1A 5JBDA 3TMLA 1XDJA 2PLMA 5K4ZA 3N19B 3W86A 2MF9A 4AC7C 3TE9A 1WCGA 4DJDD 3OO2A 2TPSA 1F8MA 2E8YA 3I6CA 4JIRA 4AFYA 2PB1A 3ONCA 5IDZA 3II1A 3E0IA 4MM1A 4OV9A 1PS9A 2ZDSA 1TJPA 1R30A 2WLYA 2PDGA 1QXLA 3LCWA 1WKEA 5AC7A 4IQ2A 1J6YA 3VA8A 1B30A 4UCFA 4K3ZA 5BMXA 2F23A 3POCA 3PBMA 3W01A 4FXFA 3DHDA 3VD7A 2WC4A 2QDGA 2X09A 3M16A 3V0UA 4W7UA 2WB5A 2YLLA 4PR4A 1Y65A 3O06A 2ZBTA 1JUEA 4MJMA 1TX0A 3L4WA 2PTZA 3VDAA 3OU8A 3RU6A 3AROA 4A22A 3MZ2A 3BZJA 1FDYA 4L1XA 4RE3A 5G2HA 3RLGA 4AWUA 4QSFA 1FP9A 1ZTVA 8CGTA 1E9YB 4NUWA 3WF4A 4AYSA 3ELFA 6PTDA 4ZO7A 5B8IC 4AMAA 2FYMA 1JIBA 1MXDA 5BROA 1TYGA 2PCQA 2HCVA 3ZJKA 1EA0A 2EEXA 1ODZA 1E0VA 4H9UA 4OV4A 2NQ5A 4R5EA 4Y8EA 2JKEA 2VKZG 3VU2A 1TPDA 1REQB 4KW2A 3B97A 3H7RA 4WD0A 1XIGA 1N1AA 1UG6A 3E38A 4E2VA 4UCGA 1U33A 4M3PA 3N11A 4R7OA 2CXEA 3PG8A 1GOKA 4NJJA 3H9RB 4JTFA 1R5YA 3B9DA 3FJLA 1S2AA 1PTDA 3L2IA 3MVTA 2XP6A 1IGSA 3UESA 3QLLA 1UMLA 3ABXA 1VJZA 1QW9A 3LQGA 3KADA 3EX2A 1W9XA 3FK4A 2BMBA 2X7VA 5T9BG 3AYTA 4RCXA 4J3UA 3LMYA 5HNTA 2XIQA 3H2NA 3WLNA 4V2XA 3IS4A 1FWIC 1DJYA 4C6FA 1LT8A 2E1DA 3LCFA 3UQNA 3SQMA 3LLFA 2HNHA 1HJUA 5AY7A 1K7EA 1K7FA 3BARA 3WL1A 1OFAA 2GGGA 2HISA 1LT7A 3IK8A 4GI8A 1S5VA 3OBKA 3IJ6A 4ROPA 1CT5A 4WDXA 3PJXA 1AQMA 2J7GA 3WD2A 1XRVA 2X41A 1OX4B 4JICA 3SSJA 4NNAA 1NF7A 1FKXA 2GVYA 1TUXA 1RY0A 3FCPA 4OU1A 3VILA 3VUPA 1EUAA 4D6IA 1J0JA 2GQAA 2FH8A 1Q6UA 5AYXA 2DSUA 3RAOA 4PCPA 2QCLA 4UTMA 1H3GA 1EQ3A 3DZ1A 4IMGA 4IPXA 1TV5A 4GY0A 1R85A 4ES4A 4U31A 1XKJA 1S2CA 1GOMA 3NG3A 1R87A 2ZC1A 4O1CA 1Q6IA 5LGZA 4GO9A 1QBAA 2WQPA 2X30A 1UZ4A 5GPGA 2OEJA 4DNHA 3E0FA 2HE8A 1H7OA 3IANA 3EA3A 1B31A 4KRZA 3FA3A 4JR5A 2ABAA 4OUIA 1T8XA 1UROA 4F3HA 4ZB0A 3VZYA 2GK1B 3PY2A 2Q02A 4HD5A 4C60A 3ARTA 5D9NA 2VC5A 2Y0FA 4DRQA 1JF6A 1FWDC 3OIXA 5AFDA 1RA5A 1F74A 4RR4A 1OIMA 4QDWA 1IEVA 1XYLA 4O0ZA 3UCQA 4NI8A 3BPWA 2QJGA 3L7RA 3CU2A 4GUJA 3KRUA 4GGBA 3NQAA 3L21A 4HB7A 4AU0A 1DE6A 1WXJA 5DANA 4B90A 3UQIA 3G0XA 1TMQA 1Y5VA 1HVXA 4M6UA 3ZVHB 5LYRA 2CZ5A 3GSMA 4TQTA 3WK3A 4ADTA 2KFWA 3MI2A 3DBPA 4IISA 1A50A 3BSMA 3W2MA 4JBRA 2HS6A 1CBGA 3W7QA 1S5NA 4DQWA 4F2UA 1EIBA 2A3CA 3SCUA 4EANA 5H6HA 4O14A 1RQHA 3S9YA 7XIMA 3KAHA 3MW7A 2VJXA 2JQXA 3TWBA 1US3A 3S46A 4H8NA 3FN9A 3BURA 1EH9A 3R7MA 3GG0A 6CGTA 5KTLA 4FX7A 3MO4A 2BSLA 4KWVA 4UFIA 1POKA 3TQ0A 4I8YA 5DELA 2FGBA 4TW7A 3KVLA 3UZXA 3CLWA 2VC9A 1XD0A 1PKNA 1PPIA 3BJSA 3VNLA 5M03A 1XLFA 1EJTC 4UQAA 2VNCA 2FZBA 1DORA 4UTUA 1OT1A 3GH5A 4YTTA 1XSKA 1KXQA 1PYFA 3AJXA 2CLIA 4PFMA 3MP5A 3LRLA 3V3WA 5H2ZA 2OG9A 3Q94A 3RMJA 2WVVA 3GXPA 1UZHA 7A3HA 1HJXA 1BHGA 5ABHA 1EA9C 4F0SA 1FKLA 3RM4A 1H0IA 3VKBA 4G50A 3W7NA 1HP4A 1XQLA 1RK6A 3W0KA 3VIJA 1KTNA 1AH3A 4GH1A 4R7WA 3DG7A 4Q8UA 5HXMA 3W22A 1IXNA 3LHVA 4CQ8A 1R7OA 3SEPA 2RUSA 2REQB 4MDOA 1L8PA 3GZAA 5LA2A 3O6YX 5BU9A 3SZ8A 4PMOA 2VEMA 4UIOA 5AHIA 1ICPA 4CQCA 3HPSA 3WH0A 4HCHA 5A6JA 4FSAA 1FKTA 3CASA 1FOBA 2EF9A 3C3UA 2Z2AA 4RXGA 1G67A 3GDKA 1EPVA 3S47A 2HEJA 3PZVA 1H1NA 2A7RA 3VKKA 3QHMA 4LPCA 4TVDA 1OX4A 4XWUA 4FS9A 3QPEA 1R2RA 5FCZA 2G5WA 4GNVA 2AMGA 3SCVA 3HV9A 2E67A 4IHCA 5AC8A 1ZQ5A 2ZICA 2YGYA 3T0TA 1TPC1 3I6TA 3GU9A 5XIAA 1N7KA 3BAJA 3E5BA 4GOAA 4OQVA 5PTDA 4H9TA 5HW8A 1V08A 1BG4A 2FFCA 1D2KA 1TE6A 3TQKA 2DG3A 2QCNA 4IJBA 3W83A 3PZOA 4IZGA 3GW0A 2F2DA 3THQA 4O28A 4K2SA 4YHGA 4FPSA 3P74A 4OT7A 4TOQA 3RFAA 1QNSA 1UKQA 4GCAA 4OOUA 1JUBA 4C1NB 3IV8A 1R9HA 1W5OA 4S3JA 5FF2A 2YFNA 3S2LA 4NL1A 3UR2A 2ZX9A 2J88A 2YX0A 1E0XA 2E4TA 3LV6A 4D6JA 4MPKA 2E7FA 3MP4A 3TYCA 2BY2A 2YDRA 2XIIA 3DFHA 3GUWA 1ROTA 2XN2A 1KFLA 5KZDA 2PDLA 4DLFA 1BGAA 1XP3A 3N29A 1W17A 3K4DA 3GDBA 2WWCA 1VENA 1LQ0A 4MNJA 5HULA 1R3YA 2GYIA 3TNOA 3WLHA 2PN0A 2H8XA 2O0TA 4QQ3A 1US2A 1KBKA 4L9XA 3WQDA 4R0XA 1WKYA 2G50A 2GJXB 2XWDA 1JYNA 1UQZA 4YTQA 5FF4A 1RAKA 2GOKA 4QFUA 1GJWA 2RGLA 2YBUA 3N9KA 3BUVA 1PBGA 4WJ8A 3GVGA 2PDIA 2V68A 4TX6A 5HMSA 5CAHA 4JKMA 3CTLA 2J27A 1V3KA 2AAMA 2JK2A 3A4AA 1E0UA 3TTEA 3COTA 1UH2A 1J01A 3R11A 4W9PA 4PA8A 1BTCA 4LAZA 2VX5A 5CSSA 1AQ0A 3H2MA 5G1MA 2X0SA 3H2FA 4D2JA 4ENLA 4P7OA 1WZLA 2YW3A 4ZQRA 5DT7A 2OO0A 1B3OA 3TN4A 4J3XA 1PUDA 3UZZA 2HMCA 2YCJA 4MSSA 1WDRA 3GBDA 1W0MA 1OC5A 4HK7A 5G4HC 1MW1A 5DRCA 1ROUA 2GWNA 1MMFA 2QUUA 1WV2A 2HPMA 2OZ3A 1L6FA 1V6VA 5J8LA 3KX6A 5CZ0A 3GNXA 2XVKA 2E25A 2J74A 5AZ0A 1E44A 1X98A 4KEUA 3FXYA 4H7CA 5CCZA 3AOFA 5DY2A 4CEUC 5C2CA 3VGFA 2ZRUA 2PDFA 4PUDA 1AZ2A 1QNVA 2EBNA 4PMXA 4IQDA 1PKLA 2E09A 4N2YA 3MA8A 1PV8A 3AHZA 3BOFA 3JVAA 1XL9A 2C3ZA 1FDJA 4HPGA 3TV8A 2HVMA 2I1OA 2Y24A 3UF9A 1JPIA 1U1HA 3IRDA 1QPOA 1NSGA 5BNKA 2NVAA 5FAJA 4ORIA 1QPLA 1W9BM 2E77A 2I57A 1BPLB 3F5JA 4MYXA 3LCXA 1CLKA 4R34A 2O4QA 1EC8A 3B0XA 3T2OA 3LHZA 3FV9A 5EMLA 4QJ1A 2PDXA 2REQA 4NF7A 5BXRA 3NFUA 2AL1A 4DELA 3WNPA 2PDMA 1ONWA 4DBSA 1IYXA 1XBVA 2Z0IA 4LUSB 3H7VA 3E2SA 3KCJA 4EACA 4UTTA 3IKGA 5D2YA 4UTFA 3FJ4A 1HKJA 4TVUA 3I6EA 2WKJA 3W74A 3ARWA 4LBRA 4RNIA 1L1PA 4MHBA 3RJYA 3GDLA 1FXQA 3VUSA 3AYRA 4ILSA 1FKHA 2ZX5A 2BGSA 1DKWA 3RK8A 1MI3A 1EGZA 4WY0B 2BHZA 3LQLA 5D9PA 2VN1A 2PP1A 4KCTA 4NJIA 1PBKA 1XLKA 3BLLA 3CPUA 4M6VA 2A3LA 3T8LA 2V0TA 2WOQA 5G4EA 2X16A 1IEIA 5LSMA 1R86A 4LYKA 1MZRA 3FVDA 3AALA 1EC7A 3BCFA 3PM6A 2VFHA 1YMYA 2QJMA 3MKVA 1C9HA 1SPQA 4LJ3A 1M03A 2CBJA 4KF1A 2KO7A 5MKGA 1DL3A 1LL4A 2D20A 5AYBA 3R2GA 4CU7A 2XSXA 4PUEA 5DRIA 4PRTA 3HG2A 1MW3A 1RCXB 2Y4SA 3HGSA 4IGHA 3PULA 3UCCA 1E5NA 1W9UA 5DMNA 2Q8ZA 4IP7A 3R25A 4GNKB 2XP4A 5F1VA 2QS8A 4AZCB 5CBBA 1TMLA 4QBXA 4BQ5A 3CQIA 1K6WA 1U1JA 3LHTA 2ISVA 1JVWA 3I7SA 1LOLA 2EHHA 2INFA 5L6UA 1UWUA 4NVTA 1UBSA 3CWOX 5CZJA 3S2CA 2QUTA 3C8NA 4LUYA 3LU2A 3DERA 3SGUA 1RVKA 3WMSA 1CGTA 2DZVA 4FA3A 3ABSA 3BSGA 3VINA 4N6FA 3MTWA 5C7HA 4FAMA 1L6YA 1PEZA 4PTDA 4MJZA 3WK2A 1U22A 2E68A 2ZUUA 3VNYA 5HWMA 1EJXC 3HPAA 3AI0A 3TN3A 1PIFA 3A24A 2IPWA 1BQGA 3GNRA 3CZ8A 1TPFA 3OZMA 3R0KA 4MGGA 4B2DA 2GK1A 3TYEA 4JTDA 2DT2A 1T6MA 4HBOA 3DESA 3C2EA 3NQBA 1O4UA 1JQVA 1W5NA 2P0OA 1IHIA 1XH2A 5E1QA 2DORA 2PTXA 4Z1AA 3PP7A 2W67A 1E72M 5A2BA 1JYXA 2DW7A 1V77A 2ZR6A 4IMAA 2WNQA 2WM0A 5D33A 4FOKA 1M3UA 3PPCA 3VIOA 4DT4A 2FB2A 1NF0A 3PSVA 1ZAHA 3AMDA 4S3EA 1EXBA 1XCWA 2WBKA 4MKNA 3K13A 4M7TA 3PBVA 5C2GA 3UW6A 1QOXA 4PMZA 2B7OA 2SFPA 4G7EA 1JDCA 3N6QA 3WNOA 4X9YA 2VX4A 4WJEA 4EWND 4AG0A 3LPOA 2X0HA 2F61A 1OADA 3LLXA 1XC6A 1ZY9A 1Q6RA 3TVAA 4LRTA 3C5QA 3UXLA 3AQUA 3UNDA 4HNNA 1GG1A 1A0CA 4UMCA 3IVUA 2R9RA 2CZEA 1BL4A 1OK4A 4WGXA 4ALDA 2ZCGA 4C6IA 4JTCA 1UD8A 4KFOA 3HB9A 4S3FA 3WFLA 1WKFA 4E6MA 4MGVA 1XIJA 2C7FA 1V6YA 5AYIA 1CCWB 2QJJA 1P0KA 3NPVA 3KAIA 1XYFA 2DH2A 5BOEA 3H23A 3WD1A 4O18A 2XGBA 1UR9A 2GSHA 2CZFA 4PN2A 1NOWA 4F2BA 1BAGA 4QROA 4UQBA 2FTWA 1KM3A 1BSLA 3A23A 4GINA 1E51A 1XLDA 2E6FA 4LV4A 5HAOA 2XHYA 1FWGC 3UXAA 3FKRA 4ERIA 5CPQA 3U57A 3W7JA 1OFOA 4QCEA 2DUXA 3NQGA 3NXLA 1VLWA 4NZJA 4RKAA 4B5TA 2BASA 1KWGA 1Z3NA 1XRFA 4IJCA 3WY1A 5KINA 4N6EA 3GQYA 3KEHA 4DWSA 1DJIA 1FKGA 2EPLX 2VZVA 2QPUA 3FAXA 3U7VA 1GQKA 4ATDA 1TPB1 2AMXA 1JPMA 4HA4A 3G8EA 4GI9A 3N4AA 2GGHA 3TSDA 4X2RA 1NVMA 5A8OA 5CEWA 2Z2UA 2DZXA 3VGBA 4DH0A 3HIJA 3O0FA 1NWRA 2UY5A 4YCOA 5U4NA 1UJQA 3MSDA 1V03A 4LAUA 4QE1A 1LBFA 4EWJA 1PXGA 3CHFA 3AJ7A 1UWRA 1PIIA 1W9PA 3UJSA 1XC4A 3LMZA 3VGDA 2RDUA 4N19A 5DMYA 2MLZA 4U3AA 3O5QA 1I0DA 5G4WA 3UJEA 3EA1A 2C0HA 3LEPA 1CGWA 1VQTA 3TFXA 5CPLA 2BXYA 1QASA 2JFEX 2VD9A 3TTYA 2V3FA 1B4EA 5FIPA 5BZAA 5EFDA 3L2LA 1PL9A 3OHMB 4XAFA 4EK7A 4KWOA 1OM0A 2KGJA 2KI3A 4M82A 1YDYA 2OSWA 4Q7IA 7PTDA 4YU1A 1EO5A 2BOEX 1VR6A 4JIIX 2XWEA 3URQA 3IGUA 2WHKA 3H4XA 5HK4A 3M0JA 3EOSA 3FNDA 3MQTA 3WLRA 2W0UA 4AVOA 4DY1A 1GHRA 2TMDA 1KR0A 4JYFA 1KR1A 1E1CB 5CG7A 1FRBA 4PUKA 4JTKA 4UNKA 4B91A 1FDZA 2ZIDA 3PWAA 5K2ZA 5MHBA 4OKDA 1D7KA 4ZENA 2Z28A 4Q8VA 1WDSA 3CUZA 5A69A 1IQ8A 1TB3A 3PZUA 2VMFA 2KX9A 2Z6IA 4A8RA 2VCBA 1UC4A 1WXZA 1FWHC 3MWAA 4JIQA 3N1AA 4I7UA 3B40A 5I78A 3N2TA 3WDIA 1H63A 4DUVA 4Y6GA 4GXWA 3CGTA 1DWIM 3NQFA 5BW6A 4GHRA 3S8HA 3ATZA 5BWFA 1Q6DA 2DG4A 1A53A 3SJNA 1W6TA 4OOZA 4A3QA 1XFBA 5XIMA 3N6HA 1C3FA 2ZTKA 1CB2A 5BWAA 5F2GA 4UQ9A 2EGZA 4AX6A 1CIUA 1GVSA 3RCNA 3W1LA 3RLHA 1SR0A 3GIPA 3VPLA 2NX3A 2QDEA 2F7FA 2H3DA 3QQ0A 1EOKA 1RSCA 3GFXA 4U5IA 4YYCA 2GVGA 1EBHA 1K9DA 3RGTA 3MV11 5FL1A 1JI2A 2DVXA 2YLAA 5CZKA 4ZMGA 4NIRA 5HJYA 3L4UA 4XIAA 1T11A 5BOFA 4E2BA 4MWAD 1NU5A 2JIEA 1HVQA 1YE4A 5HMFA 3XIMA 1CEOA 3M9YA 3E3HA 3SFWA 2WMJA 4LAMA 5FJJA 2OCZA 3W7GA 4HNLA 3EDDA 2XIBA 1K70A 4B9YA 5FEPA 4P8WA 2H9AB 3UWUA 2EO7A 2QUMA 2BXZA 1CENA 5EMJA 4E3VA 2PC4A 2AOSA 2CKRA 4ADUA 2ZX8A 1XHGA 3MYOA 1F3WA 2Y5EA 1WP6A 2BVDA 4XD5A 3AS0A 3STEA 7TIMA 3IGSA 1G0CA 1KFWA 4LF1A 2PBCA 2KE0A 4A2RA 1RPXA 4Y7EA 3DDMA 1FFQA 3T55A 1V7YA 3ES7A 4O57A 3LX9A 5CBIA 2A7PA 1FHVA 3M46A 3WFAA 4IQCA 1QPQA 5BRBA 3GAYA 2D2JA 2QVNA 3LHWA 3H7UA 4CD8A 2YPIA 2Y7FA 1ME8A 3NL3A 3MUY1 1IZJA 3TN5A 4JCLA 3TA9A 2HDJA 4JNMA 4Z2LA 4IIFA 4S1FA 2D1ZA 3MI6A 2ZA2A 3MS8A 2PGRA 4TIMA 5J04A 1K9FA 4DUWA 3AIVA 4CKQA 1VEPA 2DP3A 2ZZ5A 3VOGA 1QW8A 1ZRQA 2GFTA 2PODA 1I45A 3PZIA 3R43A 2QMKA 4UDMA 1QOQA 2ASHA 2PGFA 4M19A 3V4BA 2C91A 3R10A 1AVAA 3C2RA 1GTHA 4FLOA 2PZNA 1J5SA 2AQWA 1VAHA 5M17A 3T8QA 3RG6A 2Z1VA 3UA4A 3SY8A 3ARPA 1UR4A 4HCDA 3I4KA 4Q7BA 5AB3A 3OVQA 1YKWA 2BY3A 1XLMA 1HJQA 4DJFD 4AVFA 1YXYA 3TTOA 3BGGA 1AW2A 3S1XA 3QXBA 3T2PA 1F7BA 4FLRA 1TWDA 3WO8A 3P0WA 1JAEA 2WVTA 1OT2A 2HK1A 3ZR5A 1YPFA 2VURA 2ZQVA 3H22A 3GBEA 5EKYA 3LXAA 1QI2A 3G1DA 4HK6A 5CJNA 3GVRA 3A5FA 3DU0A 1OHLA 2ZXBA 1P0DA 3CZLA 1B1YA 2YCEA 4HNVA 3G24A 4Y9MA 1BQCA 3ZVIA 1TJRA 2ZXDA 2QCFA 1XW8A 5C55A 4MZ1A 3CV6A 4ZTYA 4UXDA 4JQ3A 2RGMA 3N3TA 4IMFA 5ABGA 3QFEA 1EQCA 2A3BA 3N4FA 3WQ4A 2PV2A 4QG6A 4J28A 1FCBA 3QPYA 3DG3A 1BEUA 4LB3A 3VKCA 1P0BA 3E74A 3H21A 1S5MA 2V67A 2Z25A 4X0NA 4IP5A 4BEUA 4ZS6A 3VDGA 2DDXA 1MZHA 2GLKA 3BQ6A 1NIUA 4XAPA 3U4FA 3AXHA 3E0WA 5H1WA 2EG6A 4U28A 6ENLA 4JKKA 5CSYA 5BRQA 3DYOA 3MBDA 1S1PA 3VE7A 3TDBA 5CSRA 4HNTA 4K8EA 4LS1A 3W1TA 3O5JA 2OU4A 3TCSA 1FH8A 1EX1A 4ZE4A 2RURA 4LVBA 4K39A 4MWAA 5FF0A 1LG1A 3TWAA 5CGMA 4IL0A 3DCPA 4U4MA 2BTMA 1D7JA 3W4RA 2QCCA 5I3KA 3RDKA 1LWJA 1O1HA 3GXFA 1EWEA 3ARYA 4D8AA 2CLPA 4QAWA 1HGWA 3RITA 4D8ZA 1LWHA 1IIGA 2J9ZA 1IR1A 2J47A 4H01A 5J5DA 5EFFA 1ISYA 4BFAA 3TYUA 3GH4A 4HNUA 3ARRA 2G41A 5JBFA 2W91A 3VXGA 2FPVA 2VHLA 3BLEA 4YL2A 3IJLA 3MJMA 5HUPA 3AS1A 1UKSA 2J7CA 1IV8A 1TR1A 5FJIA 3UWEA 3WD4A 1W8GA 2C71A 3MC5A 2QDHA 3B8WA 3O1NA 3TXZA 1G4SA 2GJLA 4QDMA 1XF0A 1D3CA 4M6PA 3NQMA 4C65A 2BY1A 4QISA 2EAWA 1RJPA 4F0KA 2WANA 1LF1A 5HKGA 1J6PA 4RPPA 2ZOXA 1XIIA 4AC1X 1S2UA 1IEXA 4YTSA 1GVIA 1XH1A 4KRTA 4NNCA 4X0VA 3G1VA 3P3BA 1H5VA 1UUMA 3NGFA 1QTWA 4MB1A 3PWIA 3DYPA 4UFJA 3SRDA 2CLMA 3CC1A 5JIWA 3DI1A 2NV2A 4L65A 4JYDA 1KQYA 3C8FA 1CPUA 1WE5A 2YSWA 5D8WA 1XGZA 4C1KA 2WZHA 1BG9A 2VEIA 1M7PA 3DEQA 4HN4A 2VWTA 4W8LA 3GK0A 1HF6A 1AZ1A 1W1TA 3G1XA 4FF7A 3QY6A 4RDYA 3GW3A 4KEVA 1DPMA 1MQRA 1Y7VA 2XINA 1XCXA 3PANA 3S42A 4FNRA 3JS3A 8XIMA 3BDKA 3RM9A 2G3NA 3QGAC 3O5IA 2PU0A 4RJEA 4V28A 4HZ6A 3F1QA 4ODOA 1TV7A 3SIZA 3NR0A 1X39A 4GZJA 1ZALA 3PTKA 3VKAA 1AJ0A 2MANA 2O56A 2FZDA 3G18A 4O52A 4BHYA 3ECQA 3CO8A 1IWAA 2LGOA 1GZGA 1SFTA 2HTMA 4MKVA 5B7YA 3B0PA 3A4XA 2J78A 1JRCA 5FF3A 4J4OA 1XYZA 2YCIX 3OA5A 1NDZA 4A4AA 3INPA 1RBLA 4XQ6A 1CGYA 2VL4A 5HMEA 3O5GA 2ZRXA 1FKFA 2JEPA 4D72A 3MJYA 3VNMA 2ISSA 3I3DA 5JXQA 4JNYA 2WMGA 3LI1A 4HGXA 4D6DA 1Z42A 3HURA 2WLZA 3KOYA 2YKKA 3EX4A 4A8LA 4R7JA 4AEEA 3UJFA 2DPEA 3DHPA 2Z1XA 3CAVA 3GTYX 4DRIA 4DUXA 5EB8A 4WF7A 3A21A 4JKLA 4JFWA 2BZNA 5EMYA 1W3TA 5DBUA 3B05A 4JTAA 3GD6A 1J2WA 1MQPA 4QS6A 4PMJA 2WMIB 4JTHA 3F5LA 4L3NA 3EZ4A 2A85A 5C54A 7ENLA 5DFAA 4IUOA 4IIHA 2ZRVA 3G22A 3QY7A 3QR1A 4H4IA 3VOFA 4DJEC 5DMMA 5CZSA 4O12A 2XM2A 3W1MA 2WZMA 2VX7A 1G6CA 4X61A 4GYKA 4QR6A 2V3GA 1WDPA 4U85A 1T5AA 3A4WA 3WBAA 5E0CA 1HT6A 4V1YA 2V63A 4C6LA 4F4RA 4JEQA 2YA0A 5J5RA 2D3LA 1FKBA 2GPTA 5CZTA 2VCAA 1MFVA 2ZUTA 3CTTA 1MEWA 2PURA 3BLKA 3Q45A 2V30A 3BE7A 3O2LA 5LNRA 2J6XA 3F7JA 3P84A 2WVVB 4O4WA 1CXEA 1J4HA 4HA0A 1D8CA 3TJIA 3HTWA 4JY9A 3PR9A 4LFYA 1NJJA 4AXKA 4J3SA 1KM2A 2VX6A 4RV8A 1LWIA 2QUNA 5C71A 3GR8A 3R79A 3TYZA 1KTBA 1QT1A 1BLIA 4GQRA 4ZOEA 4LTSA 3W7MA 2TYSA 5A2CA 3BW2A 4DEFA 2Z1WA 4JGDA 1J0IA 4H9MA 5E0FA 4AD5A 2EJ1A 3OB8A 3JR2A 2R1NA 2PRLA 2Q5AA 3W2KA 1J93A 4J7RA 4Q4PA 3H6OA 4I90A 3GG1A 2ANUA 1BYBA 5DXYA 4F48A 1ML1A 4C02B 4FR6A 4TR9A 1TSIA 4HOXA 3PZMA 1JULA 1T99A 3W84A 4JN8A 4H19A 1XLLA 1FUYA 3UR7A 1QDSA 1U5JA 2F2HA 3TOPA 1VPXA 3GTFA 5GNYA 3EWYA 1W3IA 4DJDC 2C13A 5I0DA 1LJYA 3WJWA 1S3HA 3VZXA 5T8GA 1VBUA 1YHTA 4Z2HA 4ICMA 1FFRA 4IT4A 2VWSA 2UZ9A 1H62A 3WLKX 1B3YA 4MPQA 1F07A 4CLMA 3FY1A 3KBWA 3QFWA 1ZNNA 7REQA 3PJTA 3VAWA 4GBUA 2CHRA 4LBUA 4B3LA 5F7UA 3E2QA 1BKFA 4PMQA 4TO8A 1OQFA 2JF6A 3FJ6A 2AWGA 2Z2BA 3RR1A 1GZ1A 3WD3A 2LLEA 4O1BA 3GIQA 4AD2A 1TPUA 3O5EA 2ZZ7A 4E4UA 3WQOA 3W6YA 4M6QA 1V02E 1UOZA 3CAQA 5JUVA 3W1RA 2OO6A 1K9TA 1GONA 3WSUA 2AGKA 2XJ7A 4ITZA 2R1KA 1FQ0A 2XP9A 2YZ5A 4NRSA 5HPOA 1THFD 3GLCA 4KQNA 1A5UA 4JFMA 4PULA 3U6WA 1YXDA 2YFOA 1KT1A 2BGNE 5ABEA 2XP7A 4HHMA 2PDUA 4Y96A 2ATSA 2J7DA 3K1GA 4IPLA 2OZ0A 3MMUA 4IPPA 1HX0A 4TTGA 3SJ3A 5KEZA 4IMEA 1OC7A 1RP8A 4LWWA 3TJLA 3ZJ7A 1OC6A 3WCZA 1KO0A 4CVWA 1E55A 4R27A 2WKGA 5JQ9A 1NDYA 1JF5A 3BAXA 3KVJA 4FXRA 3SRHA 4KT2A 4UNIA 3MU7A 2F84A 2CLFA 4N9CA 3TJ4A 2WC7A 2XVLA 1MUWA 3LOTA 2DIEA 1JJKA 3JYJA 3EB2A 3M0HA 3L5LA 1RPKA 3BOLA 4HPXA 1OX5A 1KRCC 2F2KA 4FXSA 3LXBA 1Q5MA 3WELA 5F2IA 1OB0A 4NJGA 3LUTA 4NZFA 3HPZA 3KDNA 4WUIA 4PTWA 3G5EA 1ZJAA 4D6HA 3LG3A 4E3TA 4KFPA 2ZQSA 1H1ZA 2VTFA 1JCNA 4WDUA 1SFJA 3MKKA 5GVJA 3CUIA 4KS0A 4QIBA 1H7PA 4CQDA 1MWOA 1V0NA 1SO6A 2DIKA 3GE7A 1JL8A 4CGTA 4JFIA 4XKMA 1ZGDA 2Y5JA 3WQWA 4RZ5A 2HQAA 2YDSA 2DG9A 1C92A 3NM3A 3KP1A 5AOUA 3VNIA 5H8MA 5BRPA 4ODMA 2OEKA 2I56A 3M07A 2GWGA 4K36A 5HR7A 1WZMA 5IFTA 1UASA 4A3YA 2L2SA 1Z44A 3AHYA 2VFDA 4AMCA 2OODA 2IW0A 3GXIA 3TXVA 3SFKA 3C0QA 3VIMA 3ITTA 4ATWA 3T7VA 4YXGA 2W6RA 4GACA 4DWSD 4E2DA 1V51A 2AGTA 4XISA 2YZRA 2O9PA 2F21A 3DOPA 1BRLA 1ISXA 5FSDC 1GOWA 1YRRA 3O0KA 4OTKA 4XK2A 1JVNA 5I3GA 2PWEA 3SAZA 4W9TA 3WK0A 4TNS