1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
2CESA 4D1IA 3A4AA 3MMUA 3WD1A 1S46A 1J0KA 2J62A 2OSWA 4TVUA 1X6LA 1Z32X 4WSKA 3W25A 2O9OA 1CXLA 4L4PA 4MADA 3AZRA 1EO5A 4TX6A 1GOMA 1OD0A 1E6ZA 2PF0A 2AOSA 5DF0A 4CN4A 4WKAA 3ARYA 1I1XA 3GYCA 2J7BA 3VILA 2BXYA 4KH2A 2VVNA 1BQCA 2CBJA 4Z2KA 4D1JA 3AIWA 1J0JA 1QBAA 1E3ZA 3MUIA 3ZMRA 4P8VA 4E2OA 2XVLA 1GQLA 3WENA 1B31A 2OSXA 3EMCA 1J12A 4EE9A 2G41A 1VFMA 4YN5A 1E56A 1QI2A 3WBAA 3OLIA 3K1DA 3CHDA 4H2CA 4ZXLA 3BLPX 4BCEA 1B3XA 4WJXA 1E4MM 1JFHA 2YLAA 3L2MA 3SUTA 1J9YA 5AYBA 4HOZA 5JBDA 1UWRA 2GJPA 3THCA 1VB9A 1PZ3A 2F8QA 3F5KA 4R5EA 2YA2A 1IZJA 4MB4A 4PTXA 3CPUA 3F5JA 3AJ7A 3VNZA 2VL4A 2E3ZA 3B9EA 2F61A 3IK2A 3AMLA 3UERA 1D7FA 1FP8A 3WDPP 2W63A 1SYTA 3NDZA 1BVZA 3CUGA 1IV8A 2AAAA 3SUUA 4P7LA 3AIBA 5HOSA 1OINA 3NJ3A 4CN6A 4NI3A 4CCEA 4DUXA 1PX3A 3EDDA 1RH9A 2WMHA 4S3JA 2JFEX 1L0PA 3WH8A 4MAZA 3AIRA 1EDTA 2EQDA 4NRSA 3N15A 4WSJA 1HJWA 2TAAA 3AQUA 2WK2A 2E8ZA 3CZJA 4ZXOA 2ESCA 3FHAA 2WM0A 3CHEA 1RP9A 2DT0A 1B9ZA 2BY0A 1LG2A 3L4XA 3QOKA 4QLLA 3VD4A 4OOUA 1DWIM 1MXGA 1QVBA 2V3EA 2JEQA 1LL7A 1HJVA 4TTUA 3VOCA 3O2LA 3T08A 2EPOA 5KEZA 1JXKA 2D23A 3AROA 3RJXA 1KXQA 2DPEA 4H41A 3WUEA 1E15A 4JZ5A 1HN1A 3WH5A 4P8WA 4OIFA 1VRXA 4M56A 3L2LA 2JF6A 4IUGA 4AD2A 3NSXA 2YBUA 2UWFA 4ATWA 1NWRA 4F9DA 2EEXA 1H11A 4MNKA 3AHYA 2XIBA 4CU8A 1QPKA 1PBGA 1UWIA 3N11A 1QHPA 1CEOA 1QI4A 3CZKA 5CLTA 1E72M 2CXGA 1UD4A 4F9JA 1C7SA 1GHRA 2DSUA 4H04A 2XGBA 3VD5A 4AD0A 1W32A 4W84A 2YBTA 5BRQA 3CZ8A 5EBAA 4C7GA 4GZJA 2J79A 2VZVA 2WMIB 3WEZA 3WMCA 2DSWA 1G5AA 2XIIA 1SMAA 3GH4A 1UWQA 2GUYA 4MNJA 1UR1A 2WVUA 1LWJA 1C91A 3HU7A 4B16A 5D4YA 1E4IA 2JE8A 4AYSA 4X9YA 1MQRA 2QHAA 3N13A 5EB8A 2DSVA 5A2CA 1E43A 1V3KA 2E9MA 4YHGA 2FH6A 3GZAA 4JCLA 3VIIA 2QLYA 4A3YA 1VBRA 1XH1A 3DYPA 1W2PA 5FL1A 1H1NA 3NYDA 4AZIA 1F4HA 3TP4A 2Z1SA 4X0NA 4C7FA 3VMNA 3KL3A 7TAAA 1WDPA 4DWSB 2XVPA 1E9LA 2DSKA 1UH2A 3CUHA 4M81A 3VD3A 2PWEA 3FW6A 2ZXDA 3KL5A 4YHEA 1GVIA 1B0IA 2XUCA 3ZJKA 4B3LA 1V0MA 2FHBA 5I24A 4W5ZA 5IDIA 2DDXA 2WVSA 1DEDA 3SUVA 1E6QM 1GPFA 3CUJA 2W61A 2ZICA 3N04A 3MUY1 2WHKA 1BSIA 1UZ1A 4W8BA 5GPRA 1GOQA 4BQ5A 2ZUWA 3APGA 4NF7A 1ZBKA 5LA0A 2W5FA 2WYSA 2VT0A 1XCXA 3AMGA 3RDKA 1JZ6A 3FAWA 4QCEA 2VRQA 4U5KA 5A6LA 1NOWA 3GTNA 3EDEA 2WC3A 8CGTA 1K9FA 3D3AA 1EOKA 4U2YA 3ARZA 2J47A 3EBVA 1VBUA 4D6DA 1FA2A 4MNLA 2ZX5A 1E70M 5TD4A 2J7GA 2WVVA 4TUFA 1EOMA 2DGAA 3ZIZA 2BNJA 2X8RA 1H09A 3FNDA 4P7RA 3I3BA 3VKKA 3BXWA 4M82A 1JAEA 2WMIA 2XVGA 1KGWA 3TTSA 2V3FA 5IHSA 1KR0A 1XRVA 1QNPA 1HT6A 2WNWA 3W81A 3AFBA 2G8ZA 2YDRA 1BGAA 4AZBA 1GCYA 2CETA 1MXDA 4PMXA 2HISA 5JBEA 2IXVA 4E8CA 4UFHA 1WP6A 4Z2IA 2BXZA 1EDGA 2JIEA 4RE2A 1V0KA 3WD3A 4F66A 1VEPA 3VGFA 5E0FA 4HTYA 4DWSA 5CZKA 5C71A 1U2YA 2ZUNA 1KR1A 1AQ0A 3KEHA 3ZQ9A 5D9OA 2YDQA 2WKGA 4AEFA 1OD8A 2BVDA 4CD5A 3VIJA 4ZFMA 2CPUA 4N0RA 3ZJ6A 3WL1A 1CGWA 3PBGA 1NARA 3OIHA 2VX6A 1M01A 3VM5A 2ZX7A 5A94A 2VJXA 4AISA 5ABEA 2PBGA 2J77A 1XD0A 2J25A 1CIUA 1LJYA 5CXPA 1H4PA 2VOTA 2J7DA 1XSJA 4CN1A 3VMOA 3OGVA 1E5JA 2O9TA 4ACYA 3VPLA 1QNQA 2VUYA 2J74A 3MANA 1DP0A 1GOOA 3MV11 1NH6A 1KQZA 3POHA 5M17A 4FLQA 1FH9A 1E6SM 3W6LA 2XFYA 4R27A 2J7FA 3CIVA 3ZT7A 5ECUA 4AW7A 1DWJM 1UOKA 4JIEA 3ECQA 3M07A 1TFVA 4W5UA 5KZ6A 4H8VA 1C92A 4W85A 5GNZA 2EO7A 2Y24A 1U30A 4UCFA 4WF7A 2E8YA 1KFWA 3L4YA 4OJYA 1UA3A 1ZB5A 2ZXBA 1TR1A 4KMQA 9CGTA 1QHOA 3W4RA 2PWFA 2UY4A 3CUIA 4JFVA 2V38A 2PB1A 2ZX6A 2D3NA 5BYWA 1HIZA 4AZGA 2JF7A 1ZJAA 1ODZA 1UKSA 2YLLA 3RM8A 2XSBA 3GH7A 3GNPA 4D6GA 1ODUA 4CVWA 4LX4A 3WMSA 1BTCA 5EFFA 5C8BB 1JYNA 3PZIA 2J78A 4PN2A 2VI0A 2XVKA 1UKTA 1WO2A 4HMEA 3W27A 1G94A 4J3TA 4PUDA 1WZMA 1EH9A 4HA4A 1TA3B 1AQMA 1HJSA 1KXTA 2ZUVA 4H7VA 3FHQA 1W9DM 3MMWA 1JZ8A 4DM2A 1TUXA 4CGTA 1WE5A 3W82A 1W9VA 3K4DA 1V3IA 1E40A 5A8MA 5LYRA 3ZJ8A 3AS3A 3BMWA 1MW2A 1XD1A 2FHCA 5AYIA 1J0HA 5FOOA 1VF8A 3RO8A 2X09A 4QLKA 4DWSC 1H41A 3CZLA 1TMQA 1UWTA 4AZ6A 2VR4A 1PZ2A 3WF3A 3WFZA 4BA0A 5F7UA 3QHOA 3WH7A 2EPNA 1C8QA 4P8UA 1GJUA 1Q6DA 4BZYA 1CTNA 5CGTA 4QAWA 3I3DA 3CUFA 3OGSA 1JD7A 4UR9A 1LG1A 5BXPA 4UFLA 4MDOA 4XX6A 3WDHA 5BXRA 1UQZA 2D0GA 1EGZA 3DYMA 3AIEA 2VURA 1HVXA 3L4WA 3WH6A 1KXHA 3ARUA 3AHTA 4PCTA 1G1YA 2BS9A 2X2YA 3MO4A 1V6XA 1UD8A 5I3DA 1HP5A 4D6HA 4CUCA 1UD3A 3PZMA 2VX4A 1ISWA 5I2UA 1OIFA 3NSMA 5DEZA 1ISVA 4CU7A 1VFUA 2BVTA 1JF5A 3AIQA 3WNLA 3WDQA 3AZSA 3N18A 1L8NA 5BXSA 3L4UA 1NQ6A 4V2XA 5FD0A 1TA3A 3A3HA 3W29A 4D6JA 1V3HA 3N1AA 2XGIA 3TONA 1X6NA 2CIPA 4W7UA 2VRKA 4UQ9A 4MTVA 2WWCA 2A3EA 2CKSA 4AXNA 4J3VA 1ISZA 1Y7VA 2WSKA 2X0YA 4PEEA 3OLGA 3WMBA 3QGVA 3A47A 3VD9A 4HPHA 3E1F1 2VRJA 4TVDA 2B31A 2DT2A 4HZ6A 4W7VA 1E1EA 3T0AA 4W89A 5A8NA 1W9UA 2YIHA 4GQQA 4ZEPA 2Z1KA 3WEMA 3O6AA 4GXPA 1D3CA 3CHCA 3VGDA 1BVNP 1QW9A 3PZ9A 3B8SA 2C0HA 1PIGA 3W28A 4KWUA 1JYVA 3EMZA 3GBDA 3AS0A 5E9AA 1VIWA 4D72A 4PBGA 3VTRA 5JIPA 1C8XA 4C7DA 5HBFA 3GNOA 4JCMA 2VTFA 3G6LA 3VGGA 2WMJA 4B9YA 1B90A 1V3LA 2G3MA 3GXFA 1JDDA 2GK1A 5BCAA 2V5DA 1TG7A 1V6WA 1UD2A 2HVMA 3DECA 3EDKA 2VR5A 3HJEA 4PMVA 3AHVA 4HA1A 5HPCA 4PCSA 1ITXA 2EBNA 1OGGA 1EO7A 1K9TA 1V08A 1WCGA 1IZKA 2VX7A 3QOMA 1UWUA 3D5HA 4ML4A 5A6SA 4PRWA 5M5DA 1UR9A 1J0ZA 3AMKA 2XYLA 4AIOA 3AI0A 4V27A 1GHSA 3UG3A 1CECA 2X0HA 5A8PA 5JBFA 2YKKA 4GI6A 1UD6A 2VZTA 3VNYA 4GZEA 7CGTA 8A3HA 1QNSA 5AY7A 2X05A 1E4LA 3NDYA 3AOFA 1XH2A 4QFUA 2XVNA 3HMCA 1KGXA 5HXMA 1JI1A 5CGMA 2W66A 1G0CA 1JDAA 1E6PA 3SCUA 1E6RA 1JDCA 4KGLA 1V3JA 3LPFA 2W67A 3OZPA 5I6SA 2FHFA 3MU7A 2WVTA 3PZTA 2GFTA 2XFFA 1KGUA 1NWTA 1XGZA 1DHKA 1I75A 2WVVB 5A2BA 3VINA 2ZXAA 3PN8A 3ZSSA 3A6OA 1QNOA 3WF2A 5IFPA 2A3BA 1B3YA 1R87A 4FF5A 1OT2A 3ZR6A 1UR8A 4D6FA 4D6IA 3W24A 3WF0A 3W0KA 4W8LA 1UH3A 1SFSA 3A4XA 1DWGM 2IXUA 3SCOA 4J7RA 1QW8A 1XYFA 3BAJA 3VVGA 3GXIA 5EFDA 3K4AA 5DFAA 3ZJ7A 1UR0A 2PWHA 1Q4NX 3IAPA 3FY1A 3DHUA 4H8UA 1GOKA 1XH0A 3BMVA 3N17A 1FOBA 4W87A 2E4TA 2EJ1A 1JZ2A 1JD9A 3N12A 3ARXA 2C8NA 1M03A 3B9AA 4U3AA 2W91A 4D71A 1CXHA 1EA9C 3WIJA 2ZXQA 2MANA 1E55A 2O9PA 5CSYA 1CDGA 3AXXA 3WQ5A 1R86A 3UCQA 4H8HA 4B9ZA 1HJXA 2VC9A 1NWSA 2E9BA 1AVAA 1Q6FA 4JKLA 1EDQA 1UG6A 2BV9A 4J3SA 3SCNA 2CNCA 4HOXA 3T2OA 1GQIA 1KBKA 3M7SA 3VIOA 4OZOA 4CCDA 1JZ3A 5ABGA 2DIEA 3BH4A 6TAAA 1Q6CA 4JFTA 4M80A 2J7HA 2CHNA 4U3CA 3PZVA 2EPLX 4IM4A 4EANA 3NCOA 2WW5A 4XV0A 1VFFA 4HZ7A 3BCFA 4HZ8A 3AZTA 5DT5A 5A6AA 2NT1A 2WHJA 1TZ7A 2YJQA 5DO8A 1WB0A 2NSXA 5CSUA 3TTOA 2CITA 3AYRA 1BG4A 1BYCA 1E3XA 3KL0A 3RCNA 2ZUMA 4DUVA 1HKMA 2XTKA 4JL1A 1E0VA 1RP8A 4UZSA 2Y8KA 2CYGA 2YA1A 4B3KA 4RL3A 5GNYA 5D9MA 1HL8A 1CLVA 3MKKA 4UFMA 2XM1A 1C7TA 1GOIA 4RE4A 3VDBA 1BPLB 2JEPA 3ARWA 1BHGA 1NOUA 5CPTA 2XG9A 3CLWA 1KWKA 1VFOA 1CNVA 4UQAA 6A3HA 2F2HA 1WDRA 1EIBA 1R7OA 3WFLA 1O7AA 1ZU8A 5BXTA 3W37A 1PAMA 2QMJA 2GDVA 4F79A 1IT0A 2ZUUA 4ATDA 3PZNA 3DC0A 4Y7EA 4A3HA 4LXFA 3AIUA 4KGJA 5IXEA 3NUKA 3WD0A 3GBEA 5LA1A 1H0GA 3BSGA 2ZX9A 5CG0A 1CGVA 1PIFA 1C93A 4TXEA 2YL9A 4UQEA 3GH5A 4AY1A 4J3XA 3CHFA 3AXHA 3L4TA 4JL2A 1KXVA 3ALGA 2ZWYA 3BSHA 1GW1A 1JAKA 3M6DA 3W6MA 4M29A 4AIUA 2UY2A 4PTVA 4BQ3A 1CXIA 3VIMA 1EQCA 4CD7A 3GXMA 3WKZA 1PEZA 1ESWA 5A8OA 1W3JA 5M3WA 4TOQA 2PI6A 2V3GA 1CGYA 4BF7A 1J0YA 3QHNA 2QV4A 1NOFA 1X1NA 1C90A 1UHVA 6CGTA 4UNIA 3A4WA 4FK9A 3F5LA 3OA5A 1TE1A 1HNYA 1W3KA 4CD6A 1CGUA 2WLZA 1UWSA 4X0VA 3DYOA 4URIA 1ZBVA 2XHYA 4AZ5A 5I79A 1EXPA 1UA7A 3CTTA 4JAWA 1OB0A 3BAYA 1BAGA 3PZUA 1FFRA 3AHZA 1EHAA 2QPUA 3WDRA 2XFRA 4E4PA 4P8XA 2O9RA 1TCMA 2GDUA 5A6BA 3TA9A 2E40A 5JUVA 3ARPA 3K8KA 3SCTA 2GVYA 3AHXA 4P7OA 4UOJA 2YDSA 3VGEA 4LYPA 3WQVA 4GI8A 4B15A 4CCCA 3F4VA 2C7FA 5I77A 2D2OA 2D0HA 3IANA 2EXOA 4ACZA 1B3ZA 4DWSD 3QR3A 1CGTA 1VAHA 2WLYA 4MB5A 3ARVA 3AYSA 1CZ1A 2CBUA 3WELA 1WZLA 3WEOA 4XUYA 1SMDA 1FH8A 4W88A 1FH7A 2OWWA 3ZT6A 1HX0A 1U33A 1JF6A 3WF1A 5AC4A 2WBKA 1HJUA 2WC7A 4MJ2A 2WZHA 1KB3A 3VMPA 1UR4A 2CCRA 3MSGA 2DH3A 3O9NA 3PTQA 1V02A 3T2QA 2WXDM 1QI3A 4PMZA 1CXEA 1VEMA 1GVYA 1GUVA 1HL9A 4IISA 5E70A 4Z2JA 1KWGA 2A3HA 1JZ4A 2WMGA 1H5VA 1RPKA 2FGZA 4J28A 3VIFA 1WDSA 3W38A 3VDAA 4EK7A 4E8DA 2YOCA 3QHMA 2WPGA 5D8ZA 2EPKX 1E1FA 2GSJA 7A3HA 2Y4SA 2BHUA 3KWXA 3WQ6A 1K9DA 1E5NA 4AWEA 1PPIA 4KRUA 4HP5A 2J75A 2NT0A 5A8QA 4XZBA 1DWFM 3UEQA 2QMKA 2W92A 5JH8A 3WNMA 1MW0A 4QLJA 1R85A 5FL0A 3VO0A 2W62A 2GK1B 3BAXA 1NP2A 3II1A 5A6KA 3WQWA 3L4ZA 3VGHA 3ZM8A 1CPUA 4LYQA 5DT7A 2DQXA 3CH9A 4AD5A 3T2PA 4UFKA 1HVQA 2WWDA 3ZO9A 4BQ4A 1A3HA 5E09A 3BGAA 2EPMX 3OB8A 2ZOXA 1UD5A 4RE3A 2ZX8A 2A3CA 1VJZA 2D20A 3G6MA 4GIAA 1OM0A 4BS0A 4UFIA 4MDPA 4IPNB 3UETA 3UR8A 1ZJBA 1E6NA 5EMYA 4WKFA 4AEEA 5FIPA 1W1YA 1V6VA 3TOPA 4W86A 2VMFA 4UZUA 3BLKA 4OBRA 1LL6A 3SCRA 1DWHM 1W2VA 3ARRA 4AD1A 2E0PA 3MUAA 1HXJA 4TVCA 4UQDA 3FN9A 1NP0A 2E9LA 3VX0A 1KBBA 1ISYA 1MVYA 4M24A 2OYMA 3WQ8A 3VU2A 1V0LA 3SCWA 1MYRA 4N42A 5I0DA 1KCLA 5ABFB 2J4GA 2Y5EA 4FLRA 3DHPA 4AC1X 1MWOA 3CZGA 4CD8A 3U5YA 1M53A 2WCAA 3SUSA 1W3LA 3T0DA 4GZIA 2DT3A 1FP9A 1G01A 3WD2A 3WUBA 1W1TA 2DIJA 4M8UA 2JALA 4PMQA 2FDMA 4AZ7A 4Z2GA 4UTFA 4ZENA 2BY1A 3W53A 3VIGA 3BAIA 3AMDA 5A95A 2WC4A 1R8LA 1WDQA 1W9PA 1FHLA 2WHLA 1XSIA 1JZ7A 2J8GA 1NM9A 2FH8A 3K8MA 1ZBCA 4ZE4A 1GQKA 3CZEA 1FFQA 1Q6GA 4PSRA 4J3WA 4HPGA 2ZUTA 4AD4A 3CBWA 4PMOA 1JNDA 1D2KA 1KQYA 1MQQA 4QDMA 4IPLA 2GJXB 2YL6A 3VX1A 3U5UA 2BHYA 1UQYA 4D6CA 5CJ5A 2VQTA 4Q22A 5A3HA 4GI9A 4AIEA 1H3GA 2V3DA 3ZOAA 2OYLA 5GNXA 1H49A 5HDRA 4EKJA 1UKQA 5LA2A 4A4AA 1JGIA 5A6MA 1E6XM 1US2A 1GONA 4HU0A 5CLWA 1OGSA 4CKQA 1MFUA 2CEQA 2JIWA 4UOQA 3GNRA 2PC8A 1O6IA 5E6ZA 3OZOA 2CHOA 4OOZA 3RMEA 1BFNA 1R7AA 4UOZA 1E4NA 5A69A 2G3NA 1BF2A 3J7HA 5C70A 3PTKA 1ZS2A 1AQHA 1QOXA 1OGBA 3N9KA 3RM9A 1JYXA 4JHZA 4OKDA 1JYWA 4V28A 2G4FA 4LPCA 5BROA 1W3HA 1BYAA 1BYBA 5ABFA 1JZ5A 3BAWA 2WANA 1UYQA 3WH9A 2Y2WA 2D1ZA 3WNPA 2V5CA 3U7VA 3WL0A 4W93A 2PBOA 3AS1A 3WDIA 4XB3A 5FCZA 1UKPA 1ITCA 3ZR5A 3GXDA 3WDJA 1C3FA 2NW0A 5I78A 2WB5A 4PMNA 1V0NA 1W1VA 3PZGA 1WAWA 4UFJA 4Z2LA 4NZCA 4FLSA 3OBAA 4W7WA 4J27A 4PMYA 4JFWA 4LQ1A 4HMDA 5FKYA 3T0BA 4KRTA 2PWDA 2UY5A 1HF6A 3TTQA 2ZE0A 5D9NA 1MQPA 2WKLA 2YA0A 2WHMA 1JNEA 3OLEA 4JFUA 2PWGA 1J0IA 3HN3A 1B3VA 4PTWA 5BRPA 4Z2HA 1GJWA 1HP4A 4BQ2A 4F8XA 4GKLA 1JL8A 2GJXA 3VUPA 1MW3A 2BVYA 4HA3A 4PMRA 1F4AA 3CMJA 1WKYA 3S2CA 2VCBA 3ZT5A 1J10A 1WZKA 3RILA 1QBBA 4CVUA 1P6WA 4GO8A 2J7CA 2Q8XA 2UY3A 1CLXA 3WQ4A 3VDCA 3TTYA 1OT1A 5E6YA 5A2AA 2YL5A 3WBEA 4JKMA 4AMCA 4WKHA 1VEOA 2BFGA 2D0FA 2VNCA 4MJ4A 3RM4A 2DT1A 4K68A 4PMUA 3VIKA 1CXFA 1ZBWA 1C8YA 5HNNA 4DM1A 5A1AA 4LYRA 4J3UA 2WZEA 1PJ9A 2XSAA 1CGXA 2OSYA 2VVSA 2D22A 3WNKA 3UG4A 5CQ1A 3RIKA 3LPOA 1MW1A 3IJ7A 3VM7A 3BCDA 1V03A 4ATLA 2W4XA 4Q7NA 1UR2A 4WLCA 4PTMA 2VO5A 5CPQA 1YHTA 4MB1A 1BLIA 2J8FA 2WCSA 4WIWA 1JIBA 4QCFA 1B3WA 3MSDA 3VGBA 3SCVA 3VIHA 5HPOA 3AXIA 1W9XA 1J18A 3UG5A 1VJSA 4TX8A 2X1IA 1WZAA 4OUEA 2VX5A 3UESA 2WBGA 5DMYA 3PZOA 2CERA 3UR7A 3U7BA 2ZIDA 5AC5A 3AIVA 1XV8A 1LF1A 1AMYA 1HJQA 1EHNA 1GZJA 4UQBA 4ACZB 2XPKA 4HMCA 1M7XA 4PYSA 3RJYA 3CGTA 2O92A 1TVPA 4JHOA 4P7NA 5E0CA 2GJRA 3NSNA 1V3MA 3K46A 5CPSA 5BWFA 3OG2A 1QNRA 1OCQA 2CBVA 3SUWA 1UKOA 1WPCA 2G3JA 3PHAA 1W91A 3ALFA 4GQRA 5D8WA 4JKKA 4U5IA 2G3IA 4FMVA 1H0IA 1N82A 1LQ0A 3SEPA 1RD6A 2ZWZA 3AMCA 2Y8VA 3EYPA 3WD4A 1LLOA 3AS2A 1JXJA 1SR0A 1BGGA 1TVNA 3SCQA 1H2JA 4CU6A 4PUEA 1XC6A 2AMGA 1GNXA 3S6TA 1PX8A 3IAQA 3AICA 1K6AA 1CENA 4WK9A 3FXYA 3FAXA 1B1YA 1E0XA 3MV01 1EQPA 5A6JA 3GDBA 2CKRA 2DH2A 4EAMA 4PMDA 4ZE5A 3RPMA 4AZHA 1XHGA 3IJ9A 3PZQA 3VDHA 3WN6A 3AISA 1HKKA 1JFXA 3K8LA 1ZL1A 1UUQA 1QHZA 5JIWA 1K9EA 3KZSA 1B2YA 2OYKA 1ECEA 4JFSA 3SURA 1JG9A 4MAVA 2OLHA 3WNNA 3SIMA 4UQCA 4AZCB 3JUGA 5M03A 3EDFA 2CBIA 1QI5A 3PTMA 3WY1A 2VZOA 3WSUA 2DSZA 3MS8A 2QPSA 5GQBA 4LGXA 2XWDA 3WNOA 1GQJA 4U31A 2WCGA 3SCPA 4GO9A 3CO4A 1VENA 3LPGA 3THDA 1B30A 3ARSA 1MFVA 4MB3A 4D6EA 1I1WA 3LPPA 4P7QA 1OWQA 1Q6EA 4U2ZA 2VQUA 4M1RA 2FGLA 1QI0A 1KCKA 2D24A 2BHZA 4MPKA 1NWUA 3WUGA 1CWYA 1E0WA 1CYGA 2IUZA 1BG9A 1ISXA 2ZUSA 3T09A 1CBGA 4NRRA 1E73M 1V6UA 5ABHA 1G9HA 1LL4A 3KE0A 4YPJA 4HOWA 1J11A 1DWAM 4FLOA 4U33A 1XSKA 1HKIA 1OBAA 3EDJA 3ARQA 2BY2A 2YL8A 2WAGA 2XM2A 3SCSA 2VZSA 3ARTA 2WMFA 1YQ2A 1LWHA 1US3A 1BYDA 5IFTA 1W1PA 1OIMA 3WF4A 4HU8A 4L4OA 1HKJA 3GM8A 1FHDA 1GORA 1M04A 3L4VA 2RGMA 4GINA 3NIYA 2BY3A 3LMYA 1XCWA 2QF8A 2A3AA 5IHRA 1V02E 3EMQA 4QP0A 3OGRA 3B9DA 3VIPA 3I3EA 1WNOA 4DUWA 4NSBA 3BC9A 2RGLA 2WMKA 3OLDA 4TTGA 1JI2A 3MUZ1 3ZSTA 3BAKA 4GPNA 3IJ8A 2VCAA 2VZUA 4MNMA 3U57A 4AZCA 2WZIA 1UH4A 5D9PA 3WUFA 1GOWA 3MMDA 1XYZA 5A6BD 1CXKA 3M46A 3W26A 1PX4A 2J7EA 2XWEA 2OWXA 3POCA 2WSPA 4PSPA 1OSEA 5I23A 5I5RA 1J01A 4W8AA 2D3LA 2XJ7A 1DTUA 4S3KA 3VD7A 4XZWA 1E71M 2VCCA 1V6YA 2OWCA 1UZ4A 3CMGA 1A47A 4OBSA 4AD3A 4CD4A 1W9BM 2DEPA
chains in the Genus database with same CATH superfamily
2CESA 3KS5A 4D1IA 3B40A 3MMUA 4V1XA 2J62A 5G5IA 2E28A 4TVUA 5U4NA 3AZRA 4TX6A 2ZR5A 4RXFA 4CN4A 3NQBA 4WKAA 3GYCA 3S3GA 1I9CB 1YTEA 2ZVIA 1GQNA 1OZMA 2CBJA 3NVTA 1E3ZA 3ZMRA 1AJ2A 1L9WA 1M1BA 3E0IA 3MB9A 4F40A 1E0TA 4EE9A 2Y5JA 2G41A 1VFMA 4H9MA 3KVLA 4DN1A 1GOXA 1FWGC 1QI2A 3OLIA 2FFIA 4H2CA 1E4MM 3Q58A 2YLAA 3SUTA 3TXVA 3TV8A 5AYBA 4RPQA 1M7OA 5JBDA 1UWRA 3THCA 1PZ3A 1S1RA 3T0CA 1DHPA 4DQWA 1XYLA 4HU3A 2GSHA 3LHWA 4D8LA 4R5EA 2YA2A 4GY7A 3AJ7A 2VL4A 2E3ZA 2F61A 1C9HA 3AMLA 3L5LA 5HNUA 2W63A 1SYTA 1MRAA 5LNRA 1BVZA 3CUGA 4MWAC 1IV8A 5AFDA 2FJUB 4ODKA 3AIBA 5IOBA 4FB7A 1HZYA 3UF9A 3EDDA 4QS5A 1RH9A 5JH2A 4S3JA 4M7SA 2PDYA 2OLSA 5HJYA 1ZAHA 3W7QA 3VYLA 5FI8A 1GW9A 2TAAA 1FWRA 1QZ2A 2ESCA 3FHAA 3CHEA 2P76A 5T8GA 2DT0A 2BY0A 1XG3A 3L4XA 2AQWA 3ZLFA 1MXGA 2Z24A 2V3EA 2HNEA 1X6UA 3T08A 1K3UA 2HBXA 2QCHA 1JXKA 1KXQA 3G1FA 4WRHA 3W7OA 4KWWA 3OPSA 1HN1A 3PC0A 4YWIA 1VRXA 3OG3A 3L2LA 3G22A 3LD5A 2YBUA 4I90A 4ATWA 3K2GA 4N4PA 3USBA 4DI9A 3AHYA 2QCMA 2ZZ3A 3B9NA 2XIBA 5J04A 1ZZMA 5FJIA 3RR4A 3IGSA 4C6JA 1YLVA 4XAGA 1TV7A 1Q6OA 3BWWA 1AH3A 3CZKA 3VAVA 5CLTA 4BFAA 3DHFA 4J5NA 4F9JA 3W7DA 4H04A 5HWCA 2XGBA 3R7MA 1QPLA 1E51A 4AD0A 3QLLA 1XKJA 3K4WA 3EXTA 3CYJA 3A3XA 3LUOA 3JU2A 2P53A 2DSWA 1G5AA 2QJGA 3RX4A 1F5ZA 3PUDA 5HR6A 1UWQA 1O94A 1C91A 5D4YA 2M08A 4FOKA 4XSMA 1E4IA 4AYSA 1PL9A 3GU1A 4JIRA 3O5GA 1IWPA 3OBEA 3IJIA 1QPNA 3KBJA 2FH6A 3GZAA 4GABA 3VIIA 4YYCA 3DYPA 1H1NA 2ZBTA 1F4HA 4X0NA 4B91A 5C2GA 4GNJA 2FPYA 3MHFA 2XVPA 4QE1A 1T7LA 3P5ZA 3VD3A 2PWEA 3FW6A 2ACUA 4JTSA 3B8TA 1NMWA 1V7AA 4Y9OA 3KL5A 4YHEA 1B0IA 3HPZA 4ODRA 4ZQPA 2WVSA 4PCFA 3B0XA 3TYCA 2HXTA 1VFSA 3T42A 4LJ3A 3CUJA 2W61A 1BSIA 4JYFA 3MWAA 1XICA 4QJ1A 4MKVA 1YYAA 1J6PA 2ZUWA 4MJMA 3APGA 1WXYA 3HV8A 1L6YA 2HQAA 1ZRQA 4BJHA 2OO6A 3LHTA 3BLIA 2VRQA 3LBCA 1JCLA 2EF9A 1K9FA 3WMLA 3FA3A 5TD4A 2YSWA 3W83A 2BNJA 1H09A 4L1WA 3FNDA 1EGVA 2AAMA 4P7RA 4ECLA 3W02A 4S3EA 5CEWA 2ZVRA 3AUOA 1F8IA 1XW8A 2WMIA 4XD3A 2XVGA 3GAYA 4G50A 3B05A 4RDVA 1KR0A 3M5VA 3M41A 1UP3A 3SO7A 3W71A 3MBDA 1Q2SA 5JBEA 1SJDA 3MI3A 1TPB1 4IQLA 1L6WA 2WKJA 3HIJA 1WP6A 3O6YX 4Z2IA 5E0KA 2DW7A 3E0LA 3VFLA 4ZQMA 4JYDA 4NKCA 4M6UA 3VGFA 4XZMX 3UI6A 4FX8A 4G2DA 4LB3A 2VD9A 2ZUNA 1QFEA 3LCXA 3HQPA 1AQ0A 2V68A 2VGIA 3CTLA 6TIMA 1RBOB 1LOLA 2WKGA 4CD5A 1B6CA 4MWAB 5HUPA 1FBAA 3DG7A 2CPUA 4N0RA 3ZJ6A 3WL1A 3ZXWA 4XAFA 2DUAA 3M0HA 3VM5A 1WKDA 4AISA 5A94A 1LP6A 2J25A 2X30A 1ITUA 5I3JA 3F2CA 1H4PA 3S2NA 1V93A 2ISSA 3LMZA 3VMOA 3C56A 1LOSA 2O9TA 3VPLA 4IIDA 3FSUA 2I56A 4PUMA 2QDHA 3A5FA 6REQA 3MHUA 5D05A 2GQ8A 4PUUA 5M17A 1FH9A 1E6SM 4KIRA 4R27A 5HNTA 4JFJA 3CIVA 3EPNA 3ZT7A 4WX2A 4BF8A 1HQTA 1DWJM 2E6AA 3SECA 2JQXA 3FJ6A 3VZZA 3N2OA 1SUXA 2UV8G 3Q67A 5EMLA 2EKGA 1R3YA 1DOSA 1YBQA 3H2NA 4UB9A 2E8YA 4E4UA 3JXVA 2QCLA 1BWLA 2P0OA 3RCYA 3S5SA 4LVFA 4R85A 4ZOEA 1KFCA 3TC7A 4O18A 3NZGA 2UY4A 3CUIA 4JFVA 4LBUA 1ZK6A 3PPGA 1XI3A 1ONRA 4G56A 4QEEA 3GB6A 4AZGA 1ZJAA 4IT4A 2YLLA 2PDXA 3M7WA 4ZODA 3GDRA 1OX6A 1WDDA 5M1TA 3B7XA 3GXPA 3B3DA 3P80A 2VFEA 3MT1A 4YL2A 2J78A 3LENA 3GO2A 3W7GA 1WO2A 1R3VA 4HMEA 3PS7A 1M9HA 1TRDA 3IK4A 1G94A 3LRMA 2XH7A 4J3TA 3GW3A 2V69A 5FF3A 1UUOA 1U83A 3FHQA 4LAZA 3MMWA 4HNNA 4HSOA 4YTTA 1TUXA 4CGTA 1UWAA 3EPOA 1WE5A 1YE6A 4J35A 3ATZA 3PP7A 2Z2AA 1LT8A 1VPYA 1JCMP 3CAQA 5A8MA 5I07A 3AS3A 4J3ZA 3RX2A 3LN3A 3V0SA 4ERGA 1AL7A 4NAEA 3W88A 2X09A 3LV5A 4DJEA 4IZGA 2V82A 3O5DA 3PFMA 1KCXA 1TMQA 3ZR4A 4N4QA 3SRDA 4DXXA 4IFOA 5DY2A 3WBWA 4H01A 1EF2A 5EMUA 4P8UA 1IGWA 4LU0A 3CS2A 5HULA 3N9RA 5CGTA 2R1MA 1H62A 1HFBA 1L2UA 2E1WA 1SO5A 1JD7A 3O5OA 1LG1A 3WLOA 4XX6A 4HBEA 5AVNA 3HZ3A 5CPOA 3BO9A 5KZEA 4YCOA 3UBPC 3AIEA 2VURA 1HVXA 3L4WA 5I09A 1ZSXA 4JNYA 2BS9A 1EZ2A 4US5D 1GZ1A 3NL6A 2ZTJA 1BVWA 3RHGA 3XINA 2MPHA 1P6BA 5HWBA 2OGYA 4R0XA 1ZY9A 5DEZA 3NSMA 1LQ2A 4CU7A 3N29A 2P10A 4UDMA 2OFJA 3SY8A 3AZSA 3WDQA 4QTGA 2ZR6A 1NQ6A 4MZ1A 5FD0A 1TA3A 3IWPA 3TEVA 3N1AA 1TO3A 3O8AA 1J96A 4UQ9A 3MP5A 4J3VA 1Y7VA 2WSKA 2X0YA 3QY7A 3OLGA 3WMBA 2W3ZA 3BZJA 2B0MA 3GTIA 1AZ1A 2QIWA 2VRJA 3N2BA 4ZB0A 4TVDA 4PUJA 2B31A 1A5BA 1TTPA 3TAKA 2JKAA 1C29A 5A8NA 4W89A 4GQQA 3O6AA 1QTWA 4M51A 1D3CA 3VZYA 4XVDA 2J6VA 2K8IA 2YW3A 2C0HA 4ZO8A 3CUZA 4LRTA 3R11A 2H8XA 4AB4A 3EMZA 2Q8LA 3AS0A 1M7PA 2QAFA 2CWXA 2FMOA 1AK5A 3RF9A 2GVEA 2DZUA 5MKGA 5HR7A 2GSEA 5TBOA 3KABA 4JQ2A 1JCYA 3KX6A 3VGGA 4AY7A 4B9YA 1B90A 4IX2A 1XBXA 3V75A 2P4VA 5JQ9A 3EPMA 2J66A 1D8WA 1I4NA 3EDKA 1FKRA 1SR9A 3AHVA 1Z48A 1RCQA 4PCSA 5HUOA 1WCGA 4FA3A 4S3AA 4ML4A 1ZUAX 3EWWA 3HV9A 5A6SA 2YZRA 2L2SA 2J6XA 4JFIA 2PDUA 2OZ3A 1GHSA 5A8PA 2YKKA 4GI6A 2VZTA 4GZEA 4AH7A 3QQ1A 4L6OA 1QNSA 5AY7A 2X05A 1W1ZA 1EP2A 5F4XA 3GVGA 1V77A 3G24A 3MVTA 3QY6A 3HMCA 2G50A 2TPSA 3NPWA 4QQUA 1JDAA 2Z00A 4FX6M 3CV6A 1E6RA 1JDCA 4UR8A 2I16A 3LPFA 4JN6A 2W67A 3OZPA 5I6SA 2VFHA 1E1CA 2FHFA 2PLKA 3MU7A 3PPFA 3S2LA 5TF0A 1TPH1 1V5XA 4EX4A 1T41A 1IEQA 1QDSA 2VN1A 3KCLA 5F1VA 3DG3A 5A2BA 4QRNA 2CLLA 1B3YA 3AYVA 3FV9A 4YVPA 1OT2A 4FN2A 4D6FA 4NYUA 3WF0A 4Q8PA 3W0KA 1EC7A 3A4XA 2YX0A 3F4WA 1ICQA 4N02A 3RXZA 4J7RA 4JY9A 1QW8A 1XYFA 2C19A 1XDLA 5DFAA 4IIGA 1DE6A 1Q4NX 2VC7A 3W7CA 3H24A 1W54A 3RRAA 1GOKA 4I6KA 2IPFA 3DI1A 5E1QA 3BMVA 1IIHA 1O4UA 3IV3A 2EJ1A 3MJYA 1N8IA 2IPWA 1M03A 2Q8ZA 4Q8NA 5EGRA 1DJIA 1FKDA 4QE5A 1E55A 3NNTA 1FWEC 1ICPA 3EKZA 5CSYA 3BG9A 1VYRA 5C9RA 3NL2A 3A13A 4BF5A 3QLDA 1AQFA 3S0CA 2VEKA 4WXZA 4B5WA 2YXXA 3OHMB 3OEXA 4YWSA 1PYFA 3TQKA 1XPYA 2X41A 1Q6FA 3LG3A 1EDQA 1A5UA 3SCNA 1J5TA 2C3ZA 1OK6A 3T2OA 1GQIA 5F2GA 3M7SA 4OZOA 3LTSA 1E9YB 4GX8A 4JGDA 4EPDC 3TH6A 7XIMA 1QASA 3QYQA 4U3CA 3VNLA 3RCMA 2B7NA 2WW5A 1H7OA 2E5CA 4XV0A 1E9ZB 2FYMA 3M5YA 2NT1A 3B8DA 4KETA 2WHJA 3S4TA 2DUZA 4BWLC 3OZMA 2ACQA 2WNNA 5L6UA 3SGZA 3V18A 5BMWA 2ZUMA 4DUVA 5LGZA 3FOKA 1HKMA 3GY1A 3SFKA 1NF7A 6ALDA 1BTMA 2Y8KA 1OCBA 2YA1A 2GQAA 2PGRA 5LNUA 1CLVA 4ZQNA 3EIPA 3MKKA 3B03A 8XIMA 2TRSA 3GTYX 1C7TA 1VHCA 3EB3A 1GOIA 3FS2A 3M5ZA 3VDBA 3PSVA 3WLLA 4US6A 4O0QA 3CO8A 1PO9A 3UXAA 4DIPA 1VFOA 1Q2RA 4UQAA 1FVPA 2BSLA 3WFLA 1O7AA 1ZU8A 5BXTA 2UBPC 1Q63A 2GDVA 1IT0A 4ATDA 3PZNA 2GVJA 3HPFA 1KRAC 2BGQA 1MNZA 2WZMA 4O4VA 3NUKA 3WD0A 3Q94A 3BW2A 3BSGA 3NXLA 4OU1A 3W01A 1CGVA 3DIPA 2NLIA 3TN3A 3KBMA 4E5TA 3CC1A 3B06A 2ADAA 1Z44A 3AXHA 3L4TA 1TJRA 1S5NA 1KXVA 3ISIX 3TSMA 3M6DA 4AF0B 2AKZA 2PDIA 3MDUA 4BQ3A 4PC8A 4C1NA 2REQA 3IRSA 4ODMA 3GKAA 1P6CA 3GXMA 3M43A 3QPZA 4PRTA 3WKZA 1PEZA 4A3QA 1D3HA 4QT2A 5A8OA 1PTAA 5G1YA 3QTGA 1CGYA 4BF7A 3MI6A 4G7EB 2JBMA 1TE1A 1ME7A 1CGUA 4JBRA 4B4HA 2Z6JA 4H6RA 1PXGA 1JRBA 2XHYA 1WOBA 4GY1A 3CTTA 4JAWA 1A3XA 3NL3A 4NAFA 1OB0A 3BAYA 1HGWA 3E0FA 1OC5A 1K70A 4E4PA 3NGJA 5D2YA 3DXIA 2GDUA 5A6BA 1K8ZA 1XLBA 3K8KA 3S9ZA 4GI8A 4Q3MA 3F4VA 3EX1A 3MDWA 5I77A 1SW3A 1M5WA 1EIXA 4HSNA 5G2HA 2WLYA 2J24A 3ARVA 1CZ1A 3MVIA 2CBUA 3Q37A 4DRQA 4F0RA 5AVHA 2PP3A 3P60A 4KEMA 1VKFA 2ZA1A 4WVXA 5L9FA 1GTEA 4W88A 1TSIA 1DQUA 1HX0A 4YYFA 1T40A 4TV5A 2YXOA 8TIMA 1TQXA 4DJDC 4OQVA 2OQLA 3A9IA 4Q8QA 2WZHA 3WQPA 3UQBA 3VMPA 4S3FA 2CCRA 3MSGA 3RITA 3G0SA 3W1LA 3AALA 1NFGA 1QI3A 3UA3A 1VEMA 1RUSA 4IISA 5E70A 1XIIA 1JZ4A 4AIBA 2WMGA 2PTDA 3IKGA 1RPKA 3W38A 4Z42C 1DKWA 4HKPA 1TPDA 1THFD 3UQAA 2WPGA 2EPKX 8RUCA 1XIEA 3CQKA 2Y4SA 4LS2A 3WQ6A 1K9DA 3MPGA 1HGYA 1Q7MA 1WXJA 5D04C 4NL1A 1Q65A 3TR2A 2EG6A 2QMKA 5J5RA 5JH8A 1H7PA 2OOGA 4JFLA 3WNMA 4QLJA 3HO8A 2W62A 1QPFA 2GK1B 3GG1A 3W2KA 3BAXA 2F7FA 3WQWA 2AGKA 3SADA 3GWQA 3L4ZA 3VGHA 3CUXA 1H50A 3W00A 4LYQA 3RMJA 4UFKA 1AL8A 5E09A 1RXOB 3RRXA 2XN2A 2ZOXA 3FFSA 2ZX8A 4LFYA 1Y8BA 3G6MA 4OT7A 1UJQA 2R82A 2CLPA 3WQEA 4IPNB 3UETA 1P48A 3UR8A 1U1UA 3IVSA 4JTFA 4PR4A 5FIPA 1W1YA 2FTWA 3TOPA 1TWWA 1F3EA 3WLNA 4H9UA 4AX7A 4JN7A 2QULA 1GRJA 1HXJA 2PDCA 2QEZA 1Z69A 1NP0A 1KBBA 3WQ8A 3VU2A 1V0LA 1POJA 1MYRA 1Q1CA 2Z29A 3IPWA 1MDLA 5LXEA 4QHRA 2VHLA 4GWEA 4AWTA 1M53A 2CLMA 3ORWA 1PWMA 1QOQA 2VEFA 3UCDA 4GZIA 2DT3A 4IPXA 5AHMA 2VWTA 2RQSA 3B0YA 4H9XA 3WUBA 3PWIA 2FDMA 4IG2A 4TX0A 3O16A 2BY1A 3W53A 3AMDA 5CKSA 4CQBA 2J8GA 4IGHA 1BXNA 2ZZ2A 4X63A 4KF1A 2FH8A 2ZZ4A 4EACA 1H63A 1Q6GA 4PSRA 3NYZA 3SIZA 3CBWA 3OVQA 1TWSA 4FR6A 2Z4GA 1XQLA 3U0HA 3VX1A 3U5UA 1UQYA 4OV9A 3PM6A 1N7KA 1OFPA 3TJIA 5A3HA 4AIEA 5C9WA 4JTEA 5FEPA 1H3GA 2V3DA 1XPGA 3ZOAA 1H49A 4E0CA 1KBLA 4QZVB 4HGXA 4A4AA 2Y7DA 2O4MA 1XG4A 2VC5A 1E6XM 3M0ZA 1A4LA 2XH4A 3M4HA 2PDPA 5E6ZA 2FIQA 4OOZA 3FLUA 1JRCA 3FKRA 4JS3A 4A2RA 1RLCL 1BFNA 1R7AA 4WD0A 1SFJA 4QAIA 1BF2A 1TPUA 2PGWA 2AL1A 4S1FA 4OTKA 1KCZA 1EJTC 3S83A 2A3LA 1AQHA 1JYXA 1ZPTA 2BG5A 3UXKA 4JHZA 4WUIA 3O7UA 1YIXA 3UP8A 1JYWA 2G4FA 5BROA 2WJDA 1XLGA 1M65A 4KCTA 3N4EA 3N2CA 3GNDA 4L64A 1QATA 5ABFA 1JDFA 1XIDA 2WANA 4GQGA 3WH9A 1EC8A 3WNPA 3ATYA 2HK1A 2PBOA 4DRKA 1UKPA 3ZR5A 3EB2A 3IGXA 2O0TA 3TFXA 5D2XA 4GKTA 2DZVA 4I9AA 2ODOA 1U5JA 4Y8FA 4Z2LA 4DPQA 3OJGA 4F0HA 2P0IA 3MO7A 4C6DA 1YPFA 2WSRA 4PMYA 4JFWA 4ZQCA 1BEUA 5T9CE 5I3GA 4LQ1A 1YXDA 3REQB 1SJAA 2Y63A 3RFAA 4RE0A 1P7TA 2UY5A 2GQ9A 3TTQA 4NNBA 2ZE0A 4ROPA 1MQPA 2WKLA 2YA0A 4WGXA 3I6TA 4ICCX 4JDYA 2MUCA 4JFUA 3HN3A 1OFDA 5AHEA 3R94A 3K5XA 4LAWA 4LB4A 4UNLA 4DO6A 1MW3A 2BVYA 4PMRA 3CMJA 3NR0A 5CPLA 4AVNA 4O2TA 4AHQA 1QBBA 1X96A 1OVDA 2P8CA 1L8PA 3TWBA 3KDNA 3B97A 3VDCA 1K7XA 1YTKA 1Z8AA 3LHVA 4G2PA 2Y5SA 5EMJA 2Q09A 1CX9A 2YCLB 3SBFA 4AMCA 2NQLA 1ECQA 3CT2A 3EX6A 1VEOA 3UZZA 2VNCA 1N1AA 1XYBA 4IIHA 4ALDA 1NFPA 4K68A 3NPVA 4PMUA 3VIKA 4NZ3A 1RD5A 3DFTA 3O6CA 1W3IA 5HNNA 5A1AA 4LYRA 2WZEA 2PLCA 9XIMA 1TKKA 3GDKA 4LTSA 1EFZA 1VCVA 1PDYA 3W84A 4WJEA 2VVSA 3GIPA 5IDZA 2Y70A 3UG4A 3RIKA 1FAPA 1W5MA 1W5QA 1PZ0A 4FPSA 1V03A 4WLCA 1OEPA 1FKHA 3B9OA 1BWKA 4S39A 5CPQA 3VE9A 1YHTA 1ZAIA 4L72B 1G7UA 2Z28A 1XGEA 1UZDA 3MSDA 2WV8A 3VIHA 5HPOA 1W9XA 3IIVA 5CSSA 2PGEA 1J18A 4ZOCA 1WV2A 3KZPA 1VJSA 3H70A 2X1IA 1UMYA 5KZMA 2WBGA 2YR1A 4HNOA 3EEZA 2XIOA 5HANA 1J4RA 1LF1A 1AMYA 3TCEA 1GZJA 1W5PA 4ACZB 4HMCA 1M7XA 3ANVA 5DMMA 4C02B 3RNDA 4ZTYA 3NSNA 1FRBA 3OG2A 4Q4SA 1UKOA 1WPCA 4REQA 2P1FA 3PHAA 4N9BA 1W91A 4GQRA 5EKYA 3NA8A 5A8GA 2G3IA 3EWZA 4IL2A 2A85A 1TZZA 4HK7A 4R7WA 1LQ0A 4XD6A 3SEPA 4ODLA 4K37A 3AMCA 2PE4A 3WD4A 3JVAA 1LLOA 2BOGX 3AS2A 2RUDA 4MF4A 5FACA 5HQMA 1XC6A 2AMGA 2R1NA 5DBUA 3BANA 1I2RA 3C86A 3V3WA 3GRIA 3IAQA 2HCVA 3NOYA 3TNBA 3HGSA 5HW6A 2X7VA 2Z1XA 4DNMA 1DXFA 2R14A 4GJJA 5LIYX 1R5YA 2RAGA 4PMDA 4ZE5A 2OLAA 3RPMA 1U79A 4KIEA 3TW6A 1YTDA 3PUGA 4AVOA 3AISA 4EXBA 4JTRA 1UUQA 5JIWA 5C2XA 3FJLA 1B2YA 1ECEA 4JFSA 2I5QA 2XSXA 3SURA 2J9YA 4MAVA 3WNNA 4LV9A 3SIMA 4AZCB 2PRMA 1DJYA 4H9YA 3KLLA 2CBIA 4L9ZA 1JNSA 2Z7KA 1YXCA 2Q5AA 2VZOA 2X1RA 1J8VA 5KITA 1VLWA 3WNOA 4DRIA 4U31A 5DELA 2JKPA 2WCGA 1LBLA 3NXFA 3CO4A 3M0JA 2NLYA 1RVGA 4M6PA 1IYXA 3THDA 1B30A 3ARSA 4NJHA 4XZLX 3LPPA 1Q45A 3ABSA 3V5FA 2YCKX 3GIYA 4LUSA 3SW6A 4QIUA 4CNSA 1H5YA 2ZZ5A 1EKOA 4RV8A 2BHZA 5F1UA 4MPKA 2M2AA 1A4MA 3KRUA 1CWYA 2RHGA 3RPDA 1BG9A 1Z3NA 2V0TA 1V6UA 4QG8A 1LL4A 1RLDA 4RCXA 3TYZA 3WQOA 4Q6JA 5HKGA 1W0MA 4MWAA 2HS8A 2PF8A 1R3SA 2KGJA 2WAGA 1YQ2A 1US3A 4OGZA 3QYSA 1P0NA 1W1PA 2WQPA 4GYJA 4NILA 4HU8A 4L4OA 4HZMA 1HKJA 3EGJA 2DFAA 3NQ2A 1TTQA 1FHDA 2RGMA 1CB7B 3LMYA 1EP3A 1OYBA 2A3AA 5IHRA 1QR7A 3EMQA 5T91A 1RQBA 4QP0A 4TU1A 1ADSA 1K77A 1UW9A 3BC9A 3OLDA 2ZFAA 2BX7A 2ZDSA 3MUZ1 4C1KA 3BAKA 1FKBA 2VZUA 2XISA 1Q6HA 3ZVIA 3TCZA 2ISVA 2Q3RA 5RUBA 3CGMA 2IQDA 1XYZA 1TPFA 3W26A 1DJNA 1OSEA 3BQ6A 2D3LA 4S3KA 1JPIA 2VFFA 3F1QA 2OWCA 3D3FA 2PS2A 3CMGA 2YYUA 1V4YA 3QPEA 5K9DA 3M0KA 5EU9A 1Q6RA 3A4AA 3R43A 3LLDA 1Q66A 4WY0F 4GUFA 1DJZA 4O14A 1X6LA 3W25A 4L4PA 1TPC1 1DJXA 5AHIA 2RH9A 1E6ZA 3EB4A 2PF0A 3RLHA 5DF0A 1PUDA 3EWYA 1KBIA 5EPDA 4QM1A 5I3HA 3ARYA 3VILA 1F9CA 2BXYA 4KH2A 4J40A 3UWEA 2Y88A 3KVKA 3W2UA 4Z2KA 5CPMA 3AIWA 1X38A 4O4WA 3S8HA 3NQ7A 4C6LA 4E6MA 1B31A 3EMCA 5F4SA 4DXVA 1FCQA 3BJTA 4YN5A 2ONEA 1M7JA 1E56A 3F2DA 4L80A 4X2PA 3CHDA 4I8DA 3BLPX 4BCEA 1R47A 1B3XA 3CAKA 4WJXA 3LHYA 3QF0A 3WLTA 1X39A 3L2MA 4F4RA 1A80A 4IPJA 2PZNA 4HOZA 4GC3A 1V79A 2F8QA 3F5KA 3LXAA 1JCXA 2X16A 1PCKA 3QY8A 4GRSA 4A6GA 3IK2A 3UERA 3WYZA 3UR5A 4N6FA 3NDZA 4JQ1A 3BSMA 4IJCA 2AAAA 4XBSA 3ITTA 2XH2A 1I2OA 3QZ6A 3NJ3A 5KZDA 1ME9A 2Z1BA 2BGSA 2NZLA 2ZRVA 4DUXA 1PX3A 3V16A 3WH8A 4ZL1A 4MAZA 4WHBA 4A21A 4HK6A 4FAMA 4NRSA 5CZJA 3AQUA 4IFRA 3A3WA 3CZJA 4NYYA 4ZXOA 1F8MA 3PRDA 2WM0A 1RP9A 3EXRA 3G1YA 3VD4A 3IIOA 4DJEC 1QVBA 1FCBA 3GTHA 2V5LA 4S3CA 5CC5A 5KEZA 3OQEA 1PWLA 3L65A 3NQEA 1XYMA 4PA8A 3DFOA 3WUEA 4JZ5A 3IRDA 4QNWA 1AFSA 3WH5A 2DG4A 4NZFA 4OIFA 2B7OA 2JF6A 1Y0EA 3HG5A 4IUGA 3NSXA 2OTDA 2OT0A 1REQB 2UWFA 3LA4A 3TW9A 1YATA 2EEXA 5D2VA 2FKEA 3DAQA 4CU8A 2KX9A 2A21A 4QITA 2OVLA 1CEOA 2FZMA 1E72M 1EYMA 4Z1YA 1E9IA 2VEPA 2DSUA 3EZ4A 1W32A 2J88A 4W84A 4GJ1A 2YBTA 5BRQA 4BHYA 3DFPA 3CYVA 1XRFA 2WMIB 3W7MA 2FZ8A 3A4JA 4BI6A 4WGHA 1JUKA 1SMAA 2VD8A 1EBGA 4B16A 1R2RA 3O15A 4S2CA 2EG7A 2QHAA 5EB8A 2DSVA 5A2CA 1E43A 1V3KA 3D46A 4YHGA 4ZSUA 3KP0A 4A3YA 3KHDA 3N14A 4RNJA 3IUIA 4GQ0A 1W2PA 5LIWX 1X7IA 2Z1SA 4C7FA 1HKVA 3VMNA 3KL3A 4WY0A 1E9LA 1UH2A 5AC6A 4O1FA 3PA7A 2I17A 2QDEA 4HNUA 5LNWA 4L1GA 1OY0A 1GVIA 2XUCA 4ERAA 4B3LA 3H12A 5LHEA 5IDIA 1LCOA 3HG3A 4B5TA 4MPQA 3SUVA 1CB2A 1E6QM 1K7FA 1NDYA 4LUIA 4S38A 5GPRA 2OELA 4LCRA 4BQ5A 9RUBA 4WSHA 2GDQA 2W5FA 1XCXA 3RDKA 4QCEA 1NOWA 8CGTA 2YYTA 1FDJA 3D3AA 4U2YA 1IXPA 2J47A 4Z1AA 3EBVA 3PR9A 5CAHA 3CQ0A 1VBUA 3ODKA 2ZX5A 1E70M 2V2HA 2J7GA 1EOMA 2DGAA 2ZKMX 3BLFA 2CWNA 1YBQB 1QRQA 3YPIA 4XVEA 4X60A 3O5KA 5FEZA 2F6XA 4OECA 3TTSA 1XRVA 3OOBA 2YDRA 3CH0A 5DX7A 4AZBA 1MXDA 1O68A 4RR4A 3O07A 1US0A 2ZE3A 4GACA 4LVBA 1SZRA 1V0KA 4GG9A 2C1GA 2CC0A 3C2EA 3VOHA 5BOOA 5E0FA 4WEVX 1SM9A 5DRIA 5C71A 4C90A 1U2YA 2ASHA 4JIHA 1VR6A 1XBZA 3KTSA 4AEFA 1OD8A 2WO5A 3LBOA 1D7KA 2HE5A 2ZTKA 3H2FA 3PBGA 1BKHA 3OIHA 3DKLA 4C6KA 2PBGA 1MEWA 3ABZA 1XD0A 2XP6A 1LJYA 2VOTA 2J7DA 1XSJA 3N3MA 2YB1A 5C55A 4DRHA 1E5JA 4IP4A 3CL7A 2G37A 2F6UA 4UR7A 2CHRA 1VFHA 3TTEA 1IE7C 4F48A 1DP0A 4H83A 1DXEA 1L2QA 1GOOA 4NAEB 5DY3A 3MQTA 1TIWA 1KQZA 3W6LA 2BASA 3RGTA 1O66A 4A35A 1H7WA 4AW7A 4LV4A 4Y9PA 3M07A 1TFVA 5AYZA 4W5UA 4DJDD 5KZ6A 4AAJA 3EOLA 4F2UA 2Y24A 1Y5VA 3E74A 4UCFA 4O0KA 1ZB5A 2ZXBA 2IKJA 4JTIA 3S47A 3O5FA 4KMQA 9CGTA 1QHOA 2PWFA 2QCFA 3HPSA 3W75A 4JTUA 2V38A 2PB1A 2ZX6A 3UI5A 4JTQA 3E6EA 3UGRA 1FKFA 2XINA 3I7RA 1ODZA 1AJZA 3RM8A 3GH7A 3KRBA 3GNPA 3U48A 4A22A 4C6OA 3DBNA 4ORIA 4DZHA 3WMSA 3W7HA 2VR2A 5G4EA 5EFFA 5MHBA 3W1UA 2B5UB 1JYNA 3T44A 1Q85A 4W9OA 4DZAA 3EEGA 3EXSA 2XVKA 2ZADA 2LPVA 2QQ6A 3EX3A 4DY1A 1VBGA 3HF3A 2IS7A 4GVIA 4PUDA 3P93A 1EH9A 1TA3B 1YKWA 2JGQA 1HJSA 1RR2A 3F4NA 1ZJIA 4GY0A 4Q4QA 4DM2A 4LAMA 2GZXA 3PPHA 4ZGYA 3CB3A 3TWAA 3WLIA 1TVLA 2VFGA 3BMWA 2QDGA 1MW2A 5AZ1A 4TW7A 4AQLA 2FHCA 1J0HA 3FEQA 1QOPA 5FOOA 4XBJA 1VF8A 4DRPA 4LOCA 3O5JA 3INPA 3ZVHA 3RO8A 1UPPA 4HB7A 1FKXA 5HQEA 4DWSC 3M1ZA 1H41A 3CZLA 4AZ6A 2VR4A 3RK8A 3WFZA 3CHVA 1MRQA 3DDMA 2EPNA 1C8QA 1R3RA 1V6TA 4BKNA 4QJ3B 1F07A 5MKGB 4BZYA 4L6HA 1CTNA 2AKMA 2NVDA 4QAWA 3I3DA 5HQLA 3LI0A 5K3VA 2ANUA 2QCEA 1MZRA 4MDOA 1FKJA 2IKIA 3WDHA 2ZRWA 5BXRA 1UQZA 3DYMA 2Z25A 4HNCA 1G1YA 3MO4A 1V6XA 1CCWB 4FS9A 4CUCA 3ENLA 3HFYA 2H8ZA 1PVNA 1S5MA 2F9RA 4KWSA 2VX4A 3W70A 3O5IA 4L9YA 4CNTA 1BRLA 2XP4A 3AIQA 3SI9A 3L0KA 1KRBC 3PULA 2H6RA 4O17A 3R0KA 5BXSA 4GBDA 4AMAA 1OG0A 1WBJA 2TSYA 4DJFA 2D73A 3A3HA 4LSBA 4I7VA 3VDGA 3W29A 1DJGA 3TONA 2XPAA 3GAKA 4IXXA 4W7UA 2VRKA 2YDAA 4MTVA 1JCTA 4YTUA 1JCJA 3FYYA 1IHIA 1E1CB 3PBVA 1OYAA 1EA0A 1KT1A 1A49A 3VD9A 3ICJA 1A5NC 4HPHA 4AWSA 2DT2A 4HZ6A 3BG3A 2RFGA 3PTDA 1JGMA 1ZNNA 3NGFA 3W7RA 4BF9A 1IT7A 4R33A 2OKOA 4ZCWA 1BVNP 3VGDA 2PPOA 3EOOA 5CZ0A 3W28A 1W6TA 1S2TA 3W1AA 4IGSA 3URAA 1RVKA 1VIWA 1P5BA 2RKXA 3VTRA 2DZSA 4KR0B 2OGJA 1X97A 3M5XA 2FFCA 3GNOA 4JCMA 3VKBA 3BMBA 2PU0A 3QV8A 1R30A 1R2SA 1V3LA 1JDDA 2GK1A 4NP7A 5BCAA 2V5DA 1UD2A 2HVMA 4A8RA 4PMVA 1YNQA 4NQ1A 3PK7A 1EO7A 3FK4A 1K9TA 2OX1A 3C2YA 3QOMA 4C6EA 1J4EA 4XTDA 1SJCA 3D5HA 4LC8A 2ZQ0A 4PRWA 3P84A 4AIOA 2X1UA 3KP1A 1CECA 2X0HA 5JBFA 3VNYA 2HRWA 1ZLPA 3LXCA 4B5NA 2V5KA 7CGTA 3CAWA 3AU2A 2QJHA 1O1HA 4C5ZA 1VZWA 1XH2A 3L21A 1GT8A 3QEZA 1M5YA 1KGXA 1JI1A 3IJ6A 3VKAA 1G0CA 2FB2A 1NF0A 1E6PA 4FIQA 4IP5A 4KGLA 1A0EA 1V3JA 1R9YA 3FA5A 1JPDX 4AHOA 3GDMA 3UXIA 3S5NA 1N2VA 3PZTA 2XFFA 3NQ6A 1GYMA 1XGZA 5LHFA 4IIBA 3SN1A 2C13A 1UOZA 2BLEA 3W6YA 2VM8A 1SZEA 2WVVB 3VINA 2ZXAA 3ZSSA 1QNOA 1SSDA 5IFPA 1XLCA 2GL5A 4LUJA 4FF5A 3PJTA 1BKFA 2NV1A 4XO6A 4KERA 3W24A 2R9RA 4W8LA 2JKEA 3R0DA 3GU0A 2PD9A 3N73A 4QE4A 2OZ0A 3NPUA 3ZJ7A 2FAPA 1UR0A 5AHLA 3IAPA 3FY1A 3DHUA 4H8UA 4U85A 1WUEA 3UU0A 4K6AA 1XH0A 3N17A 3G0XA 4I7UA 3BJFA 1TZ9A 3LLFA 4DO5A 1T11A 3B9AA 4U3AA 1J4HA 4GVFA 1EA9C 1G7VA 3WIJA 4ZA0A 3VCRA 2MANA 1MUMA 2INEA 2O9PA 5FSEC 5H8UA 3TOYA 4S3DA 4M19A 3WLJA 3STCA 3BVJA 3R89A 5HNRA 4B3ZA 3W2NA 4MM1A 4H6KA 1AVAA 2PDFA 4RPPA 4JKLA 1LROA 3LHZA 4J3SA 1TCOC 4HOXA 1AH4A 3QRHA 4KFOA 1ALDA 4PL1A 1KBKA 1LZOA 4AG0A 5ABGA 2DIEA 3BH4A 3H6OA 3IVUA 4C1NB 2REQB 1C9DA 3TC5A 3EKLA 1I45A 3VI2A 1YNPA 3S1XA 3PZVA 2EPLX 3C3NA 3HQNA 1TV3A 1TREA 3PBWA 3AZTA 5B8IC 3TC6A 3WLHA 2XFWA 2QIIA 3R12A 4G9PA 3NPXA 2NSXA 5CSUA 7PTDA 3HGRA 2CITA 4JY8A 3E2RA 4RZ4A 3KL0A 4O50A 1TPVA 1TV4A 4IXHA 2OEMA 4NAFB 4UZSA 1RP8A 4DF2A 3D47A 2CYGA 4B3KA 2PRLA 3DGBA 3V4BA 3SRFA 1HL8A 5CJMA 2PV1A 1JCHB 1YXYA 4KFNA 4UFMA 2AWGA 1W3NA 3TJ4A 3ARWA 1J6OA 3QTPA 3GU2A 4XZNX 2XG9A 3CQHA 3PAJA 1KWKA 1CNVA 4LUTB 6A3HA 2F2HA 1EIBA 3DFYA 2OODA 3CQIA 4GOAA 1IT8A 4ILSA 4F79A 5BWAA 1SZNA 2ZUUA 4Y7EA 3MZNA 4FIRA 1MSSA 4KGJA 2OFNA 4MYXA 3GBEA 1GGOA 1H0GA 4D9PA 1KKOA 1G4EA 2CLEA 1C93A 4TXEA 1NFBA 5K2ZA 1VP5A 4J3XA 2ZQVA 1XLHA 2JGYA 4AUBA 3CHFA 2ZWYA 1GW1A 1JAKA 2V81A 1JQXA 2HK0A 4O0ZA 4PE8A 4TNSA 1HKWA 2XP9A 1XR2A 2QCGA 3VIMA 3OIXA 1PZ1A 4EXAA 3UFYA 4I3GA 1ESWA 3NO1A 3GC4A 4HNVA 1CT5A 1W3JA 5E5CA 4NZ4A 4KEUA 2PGFA 3EOEA 1NSGA 2RURA 4LS0A 1Z9AA 3VZXA 1GKQA 1C90A 1UHVA 3F5LA 3BLDA 1UWSA 3L5MA 4X0VA 3DYOA 4WXYA 2NXGA 2VGBA 3APYA 2P3EA 3H23A 5I79A 3QFEA 1UA7A 2FJKA 3GC2A 3L0NA 2OG9A 1DE5A 3UA4A 1ELSA 2XFRA 4CQ8A 2O9RA 3I6CA 1Z42A 1TCMA 5IBXC 1O5KA 4OHQA 5JUVA 1XLIA 3SCTA 4J1OA 2GVYA 2YDSA 3WQVA 3H22A 4CCCA 2RJHA 3F2BA 3I65A 4UBPC 1TJ0A 4IQDA 1JNTA 4KQZA 2C7FA 4KT2A 4L5ZA 4ACZA 1B3ZA 3GXNA 5LIXX 3QKEA 3U3HA 4B5SA 1XLAA 1CGTA 1QWKA 4AXKA 2XP3A 4TMBA 3S2JA 3NQFA 1O5XA 3UI4A 3WQGA 3WJZA 1Q5MA 3HBLA 2WBKA 1X7FA 4H9ZA 2WM1A 4MJ2A 1J2BA 2Y8UA 2MLZA 4HYVA 1TUFA 5CBIA 1NSJA 2DH3A 3CASA 3B04A 4HPJA 2WXDM 3GVVA 1CXEA 3P8IA 5LIUX 1GVYA 3R5EA 1GUVA 1L6GA 4YTSA 2UZ5A 1VFTA 3VXGA 4F2TA 2FGZA 4J28A 4EK7A 5HK4A 5KINA 4CNOA 5FAGA 4I5UA 1QMLA 1J93A 4WOQA 7A3HA 1PPIA 4UMCA 2Q02A 4IG2B 3KS6A 5BZAA 1TR9A 2J75A 2NT0A 5D33A 4I6VA 4XZBA 1DWFM 2I9EA 3SRHA 2PODA 3CEUA 1MW0A 4N9EA 2HBVA 1TTJA 3GHSA 3S6OA 1NP2A 3KVJA 5GJNA 4W9TA 3STFA 1OFEA 3K1GA 2DQXA 4NNAA 5LNSA 3VOGA 1HVQA 1A3HA 2PDWA 3V1PA 4QJ5B 4K1GA 4MY9A 1YRRA 1XJBA 1FHVA 3C52A 2A7PA 4RE3A 2A3CA 4MIMA 3E02A 3TCSA 1FHUA 1RZMA 2DVXA 2TMDA 4O53A 3UVIA 1F3XA 1E6NA 4KS0A 1Z89A 3TYAA 4AC7C 4LAUA 2GWGA 1O1ZA 4OBRA 2BB0A 3LNMA 3ARRA 1NDVA 3IGUA 3TN4A 4KQNA 4HT3A 4W4QA 4JOMA 3FN9A 2E9LA 3HGOA 2OYMA 4GNVA 2PLJA 3NZ1A 1LYXA 4N42A 3A64A 5ABFB 5AC7A 4FLRA 3DHPA 5F2LA 4AC1X 3CIXA 1MWOA 5C7HA 4HK5A 1LTDA 4M6QA 2O7SA 4DJED 1OC6A 4DBEA 1W3LA 2X2GA 2ZZ7A 4BK9A 3WD2A 4LH8A 3P0WA 3RG6A 4M8UA 2JALA 4UTFA 3EA1A 3H2EA 1E0UA 3SJ3A 1I0DA 1HW6A 3CV2A 1FHLA 1P7TB 2WHLA 1XSIA 3FVMA 1GTHA 1JZ7A 3S1UA 3E9AA 1EPVA 4N7QA 4ODQA 3UT0A 4A3UA 1ZBCA 3VNDA 4P61A 1P0KA 4HPGA 1WKEA 2PLMA 1LLWA 1VCFA 4PMOA 4QGCA 3BOXA 1KQYA 4IPLA 3IJQA 2BHYA 1TELA 3TXZA 2Y89A 5CJ5A 3NZQA 3EA3A 4RW3A 3UYIA 4PULA 2FPVA 5GNXA 3VA8A 1UKQA 5LA2A 1ZTVA 4OWGA 3VOFA 1OGSA 3PG8A 3GNRA 2PC8A 1O6IA 2CHOA 1L6SA 1FKSA 3C0JA 3RMEA 4DXKA 1TWZA 3B4YA 1HG3A 2XIJA 1ZS2A 3KCJA 3NQAA 3KOWA 1QOXA 1OGBA 3KAFA 3N9KA 4H7ZA 3RLGA 1NVMA 3ITXA 4OKDA 5G1MA 1W3HA 4YS1A 3IKDA 1XX1A 1BYAA 1BYBA 2VXNA 2PDLA 4LW7A 4L7ZA 2Y2WA 3U4FA 4IQCA 2V5CA 3WL0A 2GJLA 3P67A 3AS1A 4HNLA 1W5NA 3ANYA 3GXDA 3KOYA 3C8NA 4DO7A 2NW0A 4D8ZA 4U84A 1F2JA 1AUSL 4TX9A 1V0NA 1W1VA 3PZGA 4TMCA 4GHRA 3G3DA 3PR2A 3UZWA 4X9SA 4UFJA 4HNTA 2DG9A 1DTNA 1TPEA 3LCWA 4DBWA 5C7VA 4PRRA 4RZBA 4O13A 1TWDA 1TYGA 4HMDA 5FKYA 1HF6A 4MVAA 4CNPA 5BRBA 2BZNA 4DF0A 2PWGA 4HN4A 2E6DA 1J0IA 2DW6A 4L9XA 1B3VA 4XAYA 3TVAA 5IRPA 3PUOA 5DCBA 3TMLA 1HP4A 4F8XA 1JL8A 2GJXA 4HA3A 1F4AA 3S2CA 2V9DA 3GIQA 2ZR4A 3SSZA 1R2TA 1W1IE 3WLPA 3WQ4A 4HHHA 4REQB 3WJWA 3TLQA 4OFCA 1OT1A 5E6YA 5KMYA 3WBEA 4Q8WA 2QUUA 4JKMA 1ZALA 3URNA 4MJ4A 3PG9A 5DANA 2YW4A 4B5UA 3QQ0A 1X1ZA 3IIZA 4G8TA 4Q33A 3FXGA 3WFAA 4FXSA 2XGZA 3F03K 1BKSA 2OSYA 1Q6LA 3DHDA 2FKPA 4JTLA 3WNKA 1KTNA 5CQ1A 3LPOA 1REQA 3VM7A 4ATLA 4Q7NA 1UR2A 4EXQA 4ZO6A 4XISA 1GWJA 1D6OA 2HJPA 4PUWA 1D3GA 3SY1A 4PTMA 1G67A 1I2NA 4H8NA 2VO5A 1A5LC 4MB1A 1OYCA 1BLIA 3H2OA 4WIWA 1JIBA 4QCFA 2PAJA 4UTTC 3AXIA 1J6YA 1TX0A 1TJ2A 3G1HA 4TX8A 3CB8A 1AA1B 4NIRA 1T5AA 2DVUA 3LGEA 4MSPA 4U10A 2PTZA 4BI7A 4IMGA 3TSDA 3U7BA 4XKMA 3BLEA 4NU7A 1D7IA 3QW3A 1XV8A 3P61A 4Q8UA 4UQBA 3DCPA 2HPIA 3GDTA 3GG8A 4LUSB 4HPNA 1HUVA 3SQMA 3RLUA 1TVPA 3R0UA 1TX2A 3KBSA 4TV6A 1FXPA 4MUPA 2HDJA 3N4FA 1HTIA 1QNRA 3N2XA 3HG4A 5LSMA 1I60A 4ZPTR 2NVCA 5K9XA 5D8WA 4JTTA 4KKXA 3W7PA 4DH0A 4JIPA 2ZWZA 4DB7A 1SR0A 4NHVA 3R4IA 1TVNA 3SCQA 1H2JA 1LUCA 3IV8A 3NQGA 3HURA 2XZ9A 4TYOA 3AICA 2RSEA 4DAFA 1K6AA 3MI2A 1S2WA 1QUMA 4JQ4A 3MV01 2FLIA 1B1YA 1QU4A 3NWRA 4WCJA 5A6JA 1G6CA 2DH2A 2AQOA 1JQVA 2G5WA 3M0YA 3LSBA 3VDHA 3WN6A 2A0NA 3WLSA 1HKKA 1JFXA 4IIEA 3NVDA 3KZSA 1MMFA 7TIMA 2H90A 2OYKA 4UTHA 1GKPA 1EYEA 3FVDA 2VDGA 1JG9A 2OLHA 3TZNA 3DC8A 4E38A 4TO8A 1RHCA 2PBCA 3GHUA 3UWVA 3ITCA 1QI5A 3PTMA 5CAKA 2DSZA 3MS8A 2QPSA 5GQBA 3C2FA 5D02A 2G3FA 3O0KA 5FJPA 2RJGA 3SCPA 4GO9A 3C2RA 3KAGA 1VENA 3E5PA 3L0GA 1MFVA 4MB3A 4D6EA 4GIYA 3H9RB 2ZDRA 1OWQA 2OO0A 3B0PA 2VQUA 4M1RA 2D24A 4QXIA 4FNPA 4E4FA 1KFKA 3QBUA 3WUGA 4PMJA 1VFLA 1MUWA 2VP8A 4O15A 4MUZA 1E73M 3S6DA 2QYGA 4DAIA 4YPJA 3C8FA 2X40A 2VEGA 2V5BA 1SQ7A 4K7VA 3STPA 4GXMA 4DRMA 2WSQA 4YTRA 3EDJA 5FA5A 3WLMA 3BARA 1K8CA 4Y6GA 2YL8A 1YE4A 5IFTA 1GZGA 4XTIA 1OG6A 2PDJA 3WF4A 4GNKB 1G69A 1Z6KA 2F84A 2NWRA 3R8HA 3GDLA 3NIYA 3FYPA 2BY3A 1ICSA 2QF8A 1VCGA 1XCWA 1K03A 2QJMA 4MMWA 3N2MA 1F73A 2XN1A 3UPMA 3M47A 3OGRA 3B9DA 5I3IA 3LV6A 1WNOA 4DUWA 3NO3A 3PNUA 1HL2A 2RGLA 2WMKA 3ZSTA 4UTJA 1TB3A 2HEJA 4IWWA 3IJ8A 3GNNA 3RX3A 3LU2A 1SGJA 3LUTA 5D9PA 1AW2A 2BOFX 4KEVA 4GYFA 4M5PA 3MMDA 5A6BD 1CXKA 2XZ7A 3P2VA 2XWEA 2WSPA 4PSPA 1SW0A 5I23A 1J01A 4W8AA 2XJ7A 1DTUA 1FWSA 3LX9A 1BSLA 2PTXA 2R6OA 1V6YA 4A8IA 2I1OA 4QG9A 3KOXA 1A5AA 3OBKA 1GVQA 4AD3A 1LBMA 1W9BM 5G4HC 3LM7A 3WD1A 1EWEA 1S46A 1J0KA 4LWWA 3DEQA 5B80A 4WSKA 5EBUA 4FZIA 1OD0A 2HSAA 4V33A 3VE7A 2GPTA 3PB0A 4JYEA 2VVNA 1BQCA 3CV7A 4D1JA 1J0JA 4NG3A 2A4AA 3P62A 2DP3A 4FR1A 3H4GA 1GQLA 3WENA 1OABA 1DJHA 4LAOA 4ADUA 4KESA 2OZTA 3NOEA 3WBAA 1RCOB 3K1DA 2PDQA 4ZXLA 4DZIA 4F0MA 5AHNA 1JFHA 2QUMA 1JPHA 3VC6A 4MZYA 2GJPA 3O05A 1VB9A 1EX5A 1DVJA 3DI0A 1IZJA 4PTXA 3CPUA 1IIGA 5BOEA 3CL8A 1VQTA 1O12A 1D7FA 1FP8A 3WDPP 2QGHA 1KLZA 1XIFA 5LZLA 4GI4A 3V36A 3SUUA 3W1RA 4P7LA 1F3WA 5HOSA 3UJEA 3WO8A 4NI3A 2WMHA 1L0PA 1KM6A 4DT4A 2PC4A 3N15A 3DN5A 4WSJA 1TPWA 3ONCA 1F3TA 2WK2A 2PURA 4K1WA 4WY0B 1K1DA 2PWVA 3FX4A 3KBVA 1FWHC 3QOKA 4DYEA 2JEQA 2KE0A 1VLIA 1H1ZA 1HJVA 3VOCA 2Z27A 2IF4A 5TIMA 3O2LA 2RUCA 1Y65A 3VAWA 3HQOA 2CLKA 2D23A 1P1MA 3AROA 1FWIC 1TJ1A 2DPEA 4H41A 3R8GA 5D2WA 1W8SA 2CLHA 4P8WA 2XN0A 4JTGA 1O5QA 4M56A 3TKFA 5EL1A 2XP8A 4ZO7A 1TV2A 1K4HA 4F9DA 1H11A 1VRDA 1XISA 4A3RA 4MNKA 1Q13A 1U5HA 1QPKA 3G1RA 1PBGA 3S5OA 1UWIA 3N11A 2DZAA 3S9IA 3H55A 3RR1A 1F61A 3HJZA 2C91A 3GNXA 3UWQA 5HATA 4IP7A 2CXGA 1UD4A 3WCZA 4B5VA 5HWNA 3E2SA 1C7SA 3GXTA 1PDZA 4MY8A 5AECA 3BL3A 3OZYA 4UTWC 3O5QA 2QW5A 2DUXA 3CZ8A 5EBAA 2PFHA 2VZVA 2TODA 3WEZA 2R8WA 3WMCA 2B81A 2XIIA 1OADA 4HIBA 3U8GA 5FESA 3VKDA 1G4PA 3O1NA 4DJFC 2I14A 4MNJA 1UR1A 2D69A 2WVUA 3HU7A 4H9VA 2JE8A 1MQRA 1LOQA 3UXLA 1BF6A 2E9MA 4F0LA 3GFXA 4JCLA 2QLYA 1VBRA 3B8IA 1XH1A 2V5JA 4ZBCA 3NYDA 4AZIA 5G4WA 2BMBA 2Q6ZA 1BXBA 3UWYA 7TAAA 3H2AA 2LKNA 4YNGA 5HW8A 3W86A 1EWDA 3PNZA 4RX0A 3CUHA 4M81A 5LIKX 3DFSA 4GC4A 1AD1A 1JPMA 2FVKA 5I24A 2DDXA 3KM8A 1DEDA 1KV5A 5MF5A 2HWGA 2VEIA 2NV9A 2J8TA 4KEZA 1J2WA 1GPFA 1CLKA 2IW0A 3MUY1 2WHKA 1UZ1A 4W8BA 3E2QA 4PH6A 1DL3A 1RBLA 1WAUA 2OXNA 4L61A 2QUVA 4HARA 4NF7A 4HHPA 1ZBKA 4OV4A 5LA0A 1JZ6A 3FAWA 4U5KA 1J79A 1LBFA 4ZQRA 2RDUA 5ENLA 1EOKA 3WLQA 2YCEA 5HMEA 2ETNA 4D6DA 1FA2A 4ZZ9A 3P74A 4QBXA 3MJMA 2WVVA 1ZP4A 4PFMA 4Y8EA 3ZIZA 3W1PA 3C3UA 1XIGA 1B9BA 3CM4A 4KFPA 4C6QA 5C6MA 3I3BA 3VKKA 4FEZA 1L1PA 4M82A 2WZTA 2XP7A 5IHSA 1F05A 4FAPA 2PUZA 1QNPA 1HT6A 4LNCA 3NI6A 4S3GA 2V63A 1BGAA 4QG6A 4RXGA 4LEQA 2A5HA 2HISA 4E8CA 4UFHA 3ZWSA 2QAPA 1D7JA 1EDGA 4KBXA 4RE2A 2GYIA 1NY1A 2POTA 4QQ3A 3LB0A 1VEPA 5LXXA 4DWSA 5CZKA 4RW5A 2BDQA 1KR1A 3ZQ9A 1RY0A 5D9OA 5BXJA 4GFIA 1CGWA 3IHZA 1NARA 2VX6A 2VJXA 1A5OC 5ABEA 3OP2A 2J77A 1NJJA 1P0EA 1CIUA 5D03A 3VC5A 3TA6A 5CXPA 2F2DA 4FNQA 1EQ3A 4CN1A 1AZ2A 1ONEA 2NXIA 1QNQA 2HVOA 5J8LA 3ELFA 5LGXA 2J74A 1UZHA 4IPIA 4K8EA 3MV11 1NH6A 3A23A 2PRHA 4FLQA 2OB3A 3ZVHB 2XFYA 4O19A 2J7FA 4Z0SA 2P5NA 3D0CA 2VGGA 3ERPA 3GC5A 4Q4OA 1UOKA 4NX0A 4DELA 3ECQA 5FF2A 3W3OA 2NXHA 3UPBA 1C92A 5GNZA 2EO7A 4K8HA 4FOUA 4Y9MA 3UG8A 1WX0A 2YFNA 4J4KA 4OJYA 1UA3A 1FKKA 4MG4A 3ITGA 4GLEA 2FMNA 3TN6A 3QM3A 4Q6XA 1ZCCA 1M6JA 4POCA 2X1TA 3GG0A 3ITOA 1OHLA 3R1ZA 3GW0A 2WOQA 1C9WA 3VABA 2D3NA 4ZB2A 1NELA 1JCNA 3NO5A 1UKSA 3ZS4A 1WBHA 5LNVA 1GVOA 1OFOA 2XSBA 4J2PA 1EUAA 2E6YA 4LUTA 4GUJA 4CVWA 4GQBA 4K7YA 3C61A 2X42A 1BRLB 2VCDA 4UTMA 3PZIA 4PN2A 3C5QA 2VI0A 3PRAA 3HB9A 4FHAA 3W27A 2IPJA 1WOAA 5BU6A 3QC0A 4HA4A 3WQDA 1AQMA 2AMXA 3NTYA 2ZUVA 3ABRA 1IXQA 1KLYA 1RJPA 1JZ8A 3MYOA 4GBUA 3W72A 5ABTA 1RSCA 2ZRUA 1W9VA 1V3IA 2CU0A 1E40A 1SFLA 5LYRA 4CCZA 1XD1A 4GJIA 5AKQA 5HW7A 5AYIA 2XIQA 4XK2A 1HXVA 2NV2A 3HM7A 1IWBA 1T96A 3KOZA 2GVLA 2DJXA 4Z17A 1PZ2A 3WF3A 4BA0A 3FJ4A 4JTJA 3E2VA 2F6KA 3SFWA 3QHOA 4LAVA 2ALRA 2EGZA 3DGRA 1GJUA 1Q6DA 6XIAA 3T81A 3K13A 1I2PA 2CFFA 4ROQA 1KM1A 3NFUA 4Y9NA 5DN1A 1JJKA 2ACSA 3CT7A 3CUFA 3FAPA 4Y90A 1IEXA 2VELA 5BXPA 3APTA 4Q32A 2F21A 5AZ0A 1PHQA 1WA3A 4ITZA 1EGZA 1XBVA 1I8JA 1KXHA 3UQNA 3AHTA 4UWMA 1UD8A 2BVWA 4U28A 4D6HA 3PY2A 3DU0A 2NQJA 1UD3A 1ZFJA 5I2UA 3UJFA 3P14A 3TDBA 1VFUA 1JF5A 4B2DA 1QXLA 3WNLA 5H2ZA 3MYPA 5J5DA 3M0LA 2H3BA 2DZXA 3L4UA 1FQ0A 1YW5A 2MF9A 4MWAD 3SN0A 4V2XA 4C1LA 2XGIA 3CU2A 4C5YA 2A3EA 2CKSA 1SU5A 3W2JA 1F6PA 4PEEA 4NJGA 2PDKA 1YDNA 3TNOA 3QGVA 3A47A 4PODA 3E1F1 2NQ9A 3BG5A 3E49A 4Y2WA 4OE7A 1EGMA 2CZEA 4W7VA 1VC4A 3BLOA 1NAL1 2DQWA 3WEMA 2FZNA 3CHCA 3PSWA 1QW9A 3B8SA 1DJWA 2X1SA 1PIGA 1NEYA 4AYGA 3GBDA 1W8GA 3QMRA 3TJXA 4XIMA 4F2BA 3LNPA 4PBGA 4X22A 4E2DA 4C7DA 3CEPA 4AU0A 2HS6A 5HBFA 1NIUA 2VTFA 4C6FA 3G6LA 3GXFA 3MKCA 2YCJA 4NNCA 3U2OA 1TG7A 1V6WA 3HJEA 4K2SA 1YPXA 1W37A 4HA1A 5I06A 4Q7IA 2R1KA 1ITXA 1BWVA 2EBNA 4QSFA 1V08A 3CIWA 2VX7A 2ATSA 4IUOA 1UWUA 4QT3A 2PZ0A 2ZA3A 3GG7A 1R38A 4IX0A 3P6LA 3CPRA 1S5WA 2XYLA 4Q8VA 3KRZA 2Y7FA 4V27A 1H51A 1GVSA 1FX6A 2LGOA 1VS1A 3IEBA 3QMTA 3SRKA 5DCDA 5G2WA 4QFUA 2XVNA 4RZ5A 5CGMA 1SJBA 4A29A 3FSTA 3SCUA 1DORA 3AWOA 2V2CA 5FEWA 4MLJA 3EWUA 1DJQA 5DQPA 1YDVA 4HBKA 1EXBA 1PKYA 4NZ1A 2WVTA 3WBYA 3CJPA 1UB3A 4EPEC 1DHKA 4LT9A 3B0VC 4CQDA 4GXWA 4MHBA 4GMEA 3NRKA 1Z7AA 3PN8A 5TQLA 1F6KA 4BEQA 3WF2A 1XRSA 2A3BA 1R87A 5AN7A 1OQFA 3M0VA 4K3ZA 3JRKA 2FTPA 4D6IA 2J27A 1KFBA 3LBMA 1EP1A 3KHJA 3E12A 3TU9A 3SCOA 5DRCA 4XO7A 3UY7A 1X8CA 3VVGA 5EFDA 3K4AA 2PWHA 2PCEA 3H21A 3GUWA 3L2IA 3NZRA 1OCNA 1H7XA</