1ZBCA

Crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the porcine signalling protein liganded with the peptide Trp-Pro-Trp (WPW) at 2.3 A resolution
rcsb
molecule tags Signaling protein
molecule keywords signal processing protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbcA01
4JL1A 4QP0A 1NOWA 2V5CA 4JCMA 2JFEX 3U7BA 3D3AA 4JL2A 5A8PA 3MO4A 3ZM8A 2G3IA 2J8GA 3W26A 3WQWA 3J7HA 1FP8A 2QV4A 1QBBA 2XUCA 1U2YA 3UESA 4GZIA 3ZJKA 1DHKA 1TCMA 3VIHA 4HOXA 5BXTA 2FDMA 3MMDA 1Q6EA 4LPCA 5GNYA 3ZJ8A 1QPKA 2ZXAA 5CQ1A 1H0GA 3CZLA 3FHAA 3BAJA 2JE8A 1PIFA 3AHYA 2FH6A 2YLAA 2VCCA 3AICA 4X0NA 4CU8A 3L2MA 3IJ9A 3SCPA 2ZUTA 1JDDA 2D0FA 1E72M 2X05A 5LA1A 3MUIA 3GZAA 2YBUA 1UZ1A 3AIUA 3MSGA 3PZ9A 4BQ2A 2E9LA 4AZHA 1HP5A 4J27A 3SUVA 9CGTA 4OOUA 1GQIA 2FHBA 1OCQA 1KGUA 1MW3A 2J7FA 3EMCA 3GXIA 1W91A 2W63A 4NF7A 3WL1A 1M53A 2WWCA 3VMNA 1PX4A 4YN5A 2EEXA 1AQ0A 3CHCA 3CO4A 2F61A 4N0RA 2XJ7A 3WIJA 4ACYA 3VD5A 5FD0A 2VR5A 5CG0A 4MNLA 4AIUA 2ZXBA 2J7HA 2TAAA 4QFUA 4F66A 3K8LA 4NI3A 4TXEA 2CKSA 3HMCA 2X0YA 2BHZA 2BNJA 1V3KA 4PCSA 1XCWA 4H8VA 1CLXA 3RCNA 2BVYA 3AXHA 4B15A 1OGSA 1K9DA 1J10A 1GCYA 1B3WA 1SMAA 4HOZA 5CLWA 2CYGA 5A3HA 4AD3A 3VIGA 2ZWYA 2PWGA 2Y24A 4PMUA 1E4NA 3BAYA 4OKDA 1E5NA 1HKIA 1ISWA 3MUY1 3PN8A 1UHVA 1UKPA 4MJ4A 4BZYA 1V08A 3L4WA 2CKRA 1QW9A 7A3HA 1VEPA 5ABFA 1E55A 1V3IA 2VQUA 2V3GA 4UFMA 2WMKA 4Z2HA 1GNXA 1OGGA 3ARUA 3QHOA 4CD7A 3VX1A 2DDXA 1JI1A 3F5LA 2WVTA 4UOJA 4PMDA 1V6XA 5DEZA 3VIPA 7TAAA 1XD0A 4LXFA 3UG5A 5LA2A 2ZIDA 4CN1A 3VGHA 3WUBA 1E6NA 2ZOXA 4FLOA 4CCDA 4NSBA 2OWXA 5A8NA 1WAWA 1C7SA 3VNZA 2VURA 1BG9A 3W27A 1HVQA 3EBVA 3EDJA 1M01A 3LMYA 2ZX8A 1OIMA 5E0CA 1XH0A 5F7UA 4M80A 1BYDA 3NDZA 4CCCA 5E9AA 4M56A 1CYGA 4HPGA 3K1DA 1CXIA 1EO5A 4BQ4A 5KEZA 1DP0A 1GQKA 1US2A 1UD2A 3PHAA 5A8OA 5AY7A 5GNXA 3WUEA 4AZCB 3WNNA 4HA1A 8CGTA 3VO0A 4H04A 1BFNA 1UWRA 2D2OA 1UD4A 3BGAA 1WB0A 3LPOA 3CZKA 4AD4A 3GH5A 3GH4A 1V6YA 4TTUA 3W29A 3TA9A 3SCVA 4HTYA 3WEMA 1ISYA 1CGVA 3RIKA 2CIPA 4H41A 3VIMA 4YHEA 1CXEA 1H41A 3VNYA 6A3HA 3AJ7A 4CU7A 3K8KA 3W82A 2AOSA 4MNMA 2CERA 4IPLA 1V0KA 2PBGA 1BYCA 4P7QA 5C8BB 3AS2A 1UZ4A 1HXJA 1UH2A 1EOMA 1V6VA 1MQPA 5ECUA 1CLVA 2YDSA 4DUXA 4W7VA 4PSPA 4PSRA 1C8QA 3WH5A 2VRJA 3CBWA 3MANA 3WDPP 2V3DA 4ATWA 3NSNA 1BQCA 3BAIA 3BLPX 1B0IA 1XSJA 3UR8A 3M6DA 1PX8A 2OSXA 1SFSA 4UNIA 1QNPA 3ARVA 1UR0A 2QMJA 3VKKA 1M03A 1G9HA 5AC4A 3T2OA 4R5EA 4MB1A 1PPIA 5A6LA 3W6LA 4GI6A 3BSHA 3BCFA 4JCLA 5A8MA 3MV11 1KXTA 4TVCA 4RE2A 3VD4A 3DYPA 4DUWA 4QAWA 4PYSA 5I5RA 2EO7A 4D6HA 2ZX7A 4PMOA 1GJUA 4UFJA 2J47A 3GBDA 2WYSA 1VFOA 1VJSA 2WVVA 3I3EA 4U33A 1ODUA 3KL5A 3HN3A 3KE0A 1J0HA 1ISVA 5I0DA 3B9AA 2GDVA 2GJRA 2OWWA 1KXHA 1CNVA 2O9TA 2VZTA 1NP0A 2CNCA 2OYLA 1BGAA 1CXLA 2ZUSA 1GQJA 4W86A 2XTKA 2W92A 3PZIA 1C90A 4HA4A 2VZUA 2QPSA 1TG7A 4GQRA 1B30A 4PMXA 5E70A 3WDIA 4ZE4A 3NDYA 4KMQA 4HP5A 5CSYA 3ARRA 3SUWA 4GO9A 3AQUA 1J11A 5DT7A 2PBOA 3RJXA 4CD4A 1QHOA 3T2PA 1J01A 1UH4A 1MQQA 1G94A 4PTMA 2YA0A 4MNJA 1E1EA 3ZJ7A 2XGIA 3M07A 1V3HA 4HU8A 3LPGA 3NSXA 5BCAA 4A3HA 3RPMA 2E0PA 4D1IA 5HBFA 1R85A 1V02A 2D3NA 2XVPA 1OINA 2NSXA 1LWJA 3VD3A 1SMDA 2PWDA 5A6BD 4D6CA 2ZUWA 1QVBA 4JKKA 1OT2A 1LF1A 3SCRA 1F4HA 3KZSA 4J3XA 3PTKA 4IISA 5JBEA 1CIUA 1WE5A 5FIPA 3T09A 2BXZA 2BY1A 1BPLB 1H2JA 1UD6A 4UQCA 2YA1A 2O9PA 2CHOA 1ZU8A 2CBVA 4MADA 3MMUA 1E6RA 3OA5A 1NWUA 4OOZA 2E3ZA 4MB5A 5EFDA 2GK1A 3SCSA 4B9ZA 3AISA 4TOQA 3NSMA 2XM1A 2D0HA 1GONA 2EXOA 2O9OA 3WH7A 1JZ5A 3RMEA 3BAWA 1RP9A 4IPNB 4LYPA 1XYZA 2IXUA 1DWAM 2VX6A 1PIGA 1JAKA 2JEQA 4PUDA 2VO5A 4RL3A 2X2YA 2VMFA 4P8XA 1HN1A 2E9BA 3PZOA 1EXPA 4AZBA 1FH7A 1N82A 3AIWA 2PWHA 3CHEA 2WHKA 5D9MA 5IFPA 1BF2A 4GINA 2WMIB 1VIWA 1J0IA 1JXJA 3BMVA 4ATLA 3NYDA 2YIHA 3L4TA 1FHLA 3WF0A 3PBGA 1E1FA 4D6IA 4Z2LA 2O92A 4W5UA 1JXKA 1BTCA 1B3VA 1ISZA 4LX4A 3MS8A 3PZTA 4BA0A 1JNEA 1DEDA 4U5IA 4B9YA 1HX0A 1RH9A 1W3KA 3VMOA 4V28A 4PBGA 3ZQ9A 3VGFA 2W66A 5JIWA 4JFSA 2WZHA 4CD6A 2OSWA 1G1YA 3AHXA 1U30A 1W1YA 2ZE0A 2WZIA 2VRKA 1X6LA 1B31A 1E6SM 1E0WA 3ALGA 2V38A 2WC4A 1ZBVA 1ESWA 3W6MA 3T0BA 3L4ZA 1TE1A 3NJ3A 1NWRA 4W84A 2VX5A 3FAWA 3VIKA 3W38A 3CUJA 1AMYA 1HT6A 1VENA 4OJYA 4F9JA 4D6EA 2J7DA 5I6SA 3GNOA 1TVNA 1Q6GA 1LJYA 4ZEPA 1VFMA 2E8ZA 2BV9A 3DYOA 2CESA 4LYQA 1LL6A 1E71M 4TTGA 2ZUUA 4F9DA 5IFTA 1V6WA 1JF5A 1JYXA 2X09A 3OG2A 3AROA 4JHZA 4H8HA 4UFLA 3CGTA 3WDQA 4R27A 3OGVA 3AIEA 4GKLA 1G5AA 4JHOA 4DWSD 3GDBA 3WH8A 2GJXA 1HNYA 1GOMA 2WKLA 1J0JA 3VU2A 4AMCA 3THCA 1WZAA 3VIFA 1HJSA 2DT1A 1C8YA 1BSIA 2XYLA 1V03A 3AXXA 3PZVA 2UY4A 5D8WA 1DTUA 4AW7A 2XVLA 3N11A 3QR3A 1VJZA 2CHNA 4TVDA 1EDGA 2VR4A 1XGZA 3TONA 4E8CA 2V5DA 4QLKA 3BMWA 4DWSC 2G3MA 1XV8A 1G01A 1EHAA 3BAKA 2VZSA 3B8SA 3VGDA 4HA3A 4WKAA 2J77A 4TVUA 3U57A 4D6DA 2XM2A 4E8DA 1TFVA 1JI2A 2CXGA 3AMDA 7CGTA 2CITA 2YDQA 4M81A 1VFUA 4L4OA 4PMRA 3OGSA 3WDJA 2VX4A 2FHCA 3CZ8A 4QCFA 5AYBA 2J79A 3IAQA 1R86A 4JIEA 3UEQA 1KCKA 3ARSA 1CPUA 3LPPA 3OLDA 3TTOA 3VGEA 2EPLX 3I3DA 3VM5A 1NWTA 5EMYA 3M46A 1MVYA 2YL6A 4Z2JA 2C8NA 1E3XA 3G6MA 1V3MA 1XYFA 1R7OA 5BRQA 3SIMA 1R87A 3THDA 4LGXA 1ECEA 3AS1A 3QHNA 1W3HA 1V0NA 5GPRA 1H09A 2CCRA 3TTQA 3MSDA 2GJPA 4AZGA 5D9OA 3CHFA 3WENA 2VT0A 3GNPA 5I79A 1TUXA 1W9DM 2X1IA 4XX6A 5A6BA 1J18A 3ARQA 4MDPA 3BC9A 2JF6A 1DWGM 2IUZA 2ZICA 2ZX5A 4U5KA 2WBGA 1IT0A 1OT1A 4KRUA 5CPQA 2CBIA 1QNRA 2W61A 2WVVB 3OZPA 3IK2A 2XFFA 2OWCA 1UKTA 4Q7NA 4P8VA 1EA9C 4WSKA 1KBBA 1W3JA 2J74A 3DHPA 4WLCA 4CD5A 1E4IA 2DT0A 4P7NA 3VPLA 3UR7A 2YLLA 3WQVA 1ZBWA 3GNRA 2DPEA 1Q6CA 4KGJA 1HJWA 1S46A 5I78A 1H0IA 4GXPA 4W8BA 3LPFA 1EQPA 6TAAA 1FH8A 4AIEA 5HPOA 1W9BM 4GO8A 1GZJA 2D1ZA 2WMHA 3EMQA 4HMCA 3WDRA 1CXHA 5I24A 4NZCA 1CECA 1MW0A 3F5JA 1PBGA 1HL8A 3K4DA 2W67A 1L0PA 2JIEA 1O7AA 2XPKA 2ZX6A 1UA7A 3IJ8A 5A6SA 2WB5A 1KR0A 1Q6FA 2VI0A 2QF8A 5IDIA 1JDAA 4GQQA 2A3EA 3DHUA 1WO2A 1JF6A 4CD8A 2GJXB 1D3CA 3AFBA 1C7TA 4P8WA 2BXYA 4S3JA 1J0KA 1CWYA 3OLEA 2A3AA 1WZKA 3A4XA 4UZSA 3WNKA 3AS0A 4P7LA 5BRPA 1CXFA 3W25A 3VGGA 1QNSA 3F5KA 5HXMA 1JZ4A 1KGXA 1HJXA 2J7GA 4KRTA 2C0HA 5A69A 4E2OA 3A6OA 4JKLA 1RPKA 4P7RA 2CPUA 3KL0A 4GI8A 4NRRA 4M82A 3WMCA 4CVUA 1KR1A 1VBRA 1M7XA 5JIPA 1LL7A 2DT2A 4HOWA 3AZTA 2DIEA 1E15A 3A3HA 4HPHA 2VZOA 1KB3A 4K68A 3VD9A 1DWFM 1A47A 4P7OA 1CGUA 5D4YA 1E4MM 4ZFMA 1UWUA 2UY5A 1JZ6A 5FOOA 1WCGA 1MYRA 2DGAA 3AIQA 2VNCA 3K46A 5LA0A 2RGMA 4JAWA 1HKMA 1B3YA 1E40A 3DC0A 4D6FA 4UQEA 5C71A 1GOQA 4LYRA 2WM0A 4U3AA 4W88A 2D22A 1BVNP 1XCXA 1VF8A 1US3A 3APGA 2JALA 4AD0A 3AOFA 4M1RA 1ZJAA 1MXDA 1IZKA 1L8NA 1CGXA 5IHSA 5ABGA 3TTSA 1V0LA 2YL8A 3WF4A 3ECQA 1AVAA 3W53A 5CLTA 1WDPA 3VX0A 1CDGA 3ZOAA 5BYWA 1NARA 1WZLA 3AHVA 3VVGA 5CGMA 1MWOA 1UYQA 1V02E 1Z32X 3CIVA 1UQZA 3GXDA 3EYPA 1MXGA 2W4XA 2NT1A 4QLLA 1OD0A 1FFRA 2UWFA 1M04A 3OIHA 3CZEA 5I77A 5I3DA 2WANA 1RD6A 1UWSA 4UQBA 1NOUA 1ZL1A 1UD5A 1XSIA 1JFHA 4ACZB 1WDQA 2E4TA 2J8FA 1H5VA 4JZ5A 4F79A 5KZ6A 3RILA 4B16A 4MB4A 1TVPA 1E6PA 4X0VA 1H4PA 4PTXA 1E6ZA 1E56A 3SUTA 1EHNA 3U7VA 1JD9A 4B3KA 1E43A 1OB0A 4W5ZA 4OBRA 3WELA 3WEOA 4MB3A 1W1PA 2HVMA 4KGLA 1HJQA 4CKQA 4HZ6A 4E4PA 3ZSTA 2WHMA 3ZT6A 4PCTA 4DM2A 1EH9A 5HNNA 3W0KA 4D6GA 3ARXA 2EPOA 1NH6A 3QOMA 4HZ8A 4W87A 1JD7A 1W9XA 4FLSA 1SYTA 3SCUA 4IUGA 3ARPA 4Q22A 1KCLA 3FXYA 2XSBA 3QGVA 2XVKA 4M8UA 5DT5A 3EDEA 1W9UA 4MDOA 1MW1A 5FL1A 1ZJBA 1ZBCA 3GXFA 1UR1A 2WKGA 4DWSB 1J0YA 4AIOA 2WMIA 2VX7A 4AC1X 1WNOA 2PI6A 4AEEA 3W37A 3RO8A 2RGLA 4EE9A 4J3VA 2XWDA 2YJQA 2E8YA 5DF0A 2XFYA 3GBEA 2QMKA 2J7EA 1QNQA 4B3LA 1E0XA 2BY0A 4CVWA 5M5DA 1ZB5A 1LQ0A 5EFFA 2A3CA 4D71A 3OBAA 4PEEA 3WNMA 1W9VA 3HU7A 3CLWA 4ML4A 4ZE5A 1XRVA 3VMPA 1E3ZA 3WFZA 1EO7A 1QBAA 3RJYA 3WQ4A 4UOZA 2J4GA 2WLZA 1H11A 3FY1A 3WQ6A 2GFTA 4P8UA 1V3LA 3SCTA 1JIBA 5CPTA 2DQXA 5A2AA 2XVNA 2Y5EA 3GYCA 1HF6A 1BAGA 2WC7A 3AS3A 3ARZA 1HP4A 3CMGA 2G3JA 1K9TA 3GH7A 4FLRA 3FW6A 2XSAA 2JEPA 3WY1A 1JGIA 4A4AA 1UKQA 2EQDA 4HU0A 4MTVA 2ZXQA 3AHTA 1V3JA 3E1F1 1UOKA 1YHTA 1JYWA 2V3EA 2UY3A 4U31A 2D24A 2GUYA 1J9YA 4W85A 1PZ2A 4KH2A 2IXVA 3VOCA 4CCEA 1W1TA 3L4UA 3VDHA 1FOBA 2VCAA 2DSUA 1KXQA 2Y8VA 2WHJA 1AQMA 1JFXA 4BS0A 4CUCA 2WZEA 1OWQA 5D9PA 4J28A 3JUGA 3PZQA 4NRSA 2EPMX 3EDKA 3ZSSA 1B1YA 5IHRA 1CGTA 2O9RA 4AZ7A 1SR0A 3O9NA 3VUPA 2WPGA 3UERA 3O6AA 1NP2A 2FHFA 1Y7VA 4HMEA 3VD7A 1UA3A 5GQBA 3PZNA 1JZ3A 1JZ2A 2QPUA 2WMFA 5DFAA 2CBJA 1LL4A 3N18A 5BXPA 2WNWA 1I1XA 4WF7A 2MANA 3VDBA 5JUVA 4URIA 4AD5A 3KEHA 4JFWA 4MPKA 1LWHA 1VBUA 1QNOA 3WUFA 1QW8A 1OM0A 1J12A 1VAHA 2Y8KA 3W28A 1XH1A 2DT3A 1K9FA 5FCZA 1KQZA 2GSJA 3OZOA 3VILA 4PMYA 1UQYA 4H8UA 4WKFA 4MAVA 1UWQA 2WCSA 4UCFA 1K9EA 3POHA 1JG9A 1UWTA 2XHYA 1GPFA 1PEZA 4U2YA 2EJ1A 1D7FA 4BQ3A 2DSVA 1WDRA 1Q4NX 5M3WA 4X9YA 3VIJA 5ABEA 2WAGA 3A4AA 1DWHM 3WD0A 2DSKA 1W3LA 3U5YA 4AYSA 1TA3B 1GQLA 3WNLA 4PRWA 2WCGA 4UFIA 2Z1SA 1UD3A 5E6ZA 5A8QA 3WQ8A 3WMBA 4H7VA 4MNKA 3VGBA 4IM4A 2JF7A 2W5FA 4ZXOA 4QLJA 5JBDA 3N17A 1UKOA 2G3NA 2VL4A 4JFUA 4XZBA 3BLKA 4C7DA 5BROA 2YKKA 4XV0A 1UR9A 1KWGA 1TR1A 3WF3A 1GUVA 4WJXA 2ZUNA 1E4LA 2BVDA 4QCEA 3AMKA 2Y2WA 3SCNA 1UR4A 2GDUA 3WQ5A 2NT0A 2WCAA 2ZUVA 2XVGA 2FGZA 4PTWA 4M29A 1HKJA 5HDRA 2FH8A 1K6AA 3L4VA 2BVTA 3N9KA 3SCWA 3UETA 4AY1A 3SEPA 2G41A 3BSGA 4DWSA 5EB8A 2XFRA 3VTRA 4W8AA 3ZO9A 2ZX9A 1V0MA 2G4FA 2WWDA 1HKKA 3BXWA 1E0VA 1CGWA 1JYVA 4UQAA 3A47A 4FF5A 3KWXA 4JKMA 4XUYA 2VQTA 1EOKA 1UD8A 5D9NA 1ODZA 1B90A 4N42A 1NM9A 4FK9A 2J78A 4CN4A 1R7AA 1GW1A 5D8ZA 1P6WA 2Z1KA 3AYRA 3PZMA 5E09A 4AZ5A 4PMVA 1ITXA 2EPKX 5ABHA 3WNOA 1GVIA 1JYNA 4CGTA 3WF1A 2DIJA 2VTFA 3SCOA 3ARYA 3W81A 2VCBA 1E70M 2D0GA 3FNDA 3PZUA 1U33A 3SCQA 1UG6A 1EDQA 3MUZ1 1QI4A 4Z2GA 4GIAA 1OBAA 1NOFA 5LYRA 3UCQA 1EQCA 4ACZA 4AD2A 1QI3A 3ARTA 4PMZA 3WUGA 5A2BA 1FP9A 4D72A 3BCDA 3CTTA 1IV8A 2OSYA 3WD3A 5A2CA 1AQHA 1G0CA 3AZRA 5JH8A 4OIFA 5HPCA 2YA2A 1E73M 1WPCA 4W7UA 3RDKA 3ARWA 5M17A 2Q8XA 4MAZA 3AIBA 1CGYA 1XC6A 1ITCA 3L2LA 2WSKA 3ZMRA 4D6JA 5IXEA 5TD4A 4UFHA 1PZ3A 3AMLA 3BH4A 1QHPA 1HL9A 1C91A 3WH6A 1UR2A 4S3KA 2EBNA 2XIIA 2DH2A 3F4VA 1BHGA 2DSZA 4AEFA 1QI0A 1GOWA 4J3TA 4JFVA 5GNZA 1FHDA 8A3HA 4AD1A 1MFVA 1A3HA 3GM8A 4J3WA 1ZS2A 3MU7A 3WD1A 5FL0A 4M24A 3VINA 1UH3A 3M7SA 3FHQA 4EKJA 4F8XA 2YDRA 4TX6A 1H49A 4BCEA 2ZWZA 1GOIA 1E6QM 3AIVA 2AMGA 4QDMA 3I3BA 2X0HA 3N15A 1GJWA 3RM9A 2BFGA 3IAPA 2D23A 3T2QA 4HMDA 2ZXDA 2JIWA 4UOQA 3WMSA 1I1WA 5C70A 1MW2A 4V27A 1E6XM 2WMGA 3GTNA 1FFQA 1W9PA 1B3XA 1B2YA 5CXPA 5CGTA 1GHRA 3CHDA 1OSEA 3CUGA 3WF2A 1VB9A 4EANA 4H2CA 2WC3A 4W8LA 2J7CA 1IZJA 1E5JA 1C92A 2PWEA 3AZSA 3O2LA 4YHGA 3FN9A 3VIIA 1MFUA 2YBTA 2VUYA 2WBKA 1JNDA 2FGLA 3CPUA 4UR9A 4WIWA 4A3YA 3KL3A 1PAMA 3WFLA 3IJ7A 3AMCA 3PTQA 4Z2KA 1XH2A 3VIOA 4WKHA 3TOPA 1R8LA 2OYMA 4GI9A 2BY3A 3S2CA 3D5HA 3OLGA 4V2XA 1QI2A 1GORA 4J3UA 4UQ9A 4AZ6A 4HZ7A 3AMGA 4RE4A 4BQ5A 5BWFA 4GPNA 4J7RA 1DWJM 3WSUA 3DECA 3N13A 2HISA 4PTVA 1J0ZA 1XD1A 1EIBA 3CZJA 5EBAA 4ZENA 1E9LA 5CZKA 1V6UA 2XGBA 1QI5A 3L4YA 4MJ2A 2XIBA 4W89A 4C7FA 5DMYA 3BAXA 2GK1B 2YOCA 1B9ZA 4BF7A 2QHAA 1CBGA 2WLYA 4D1JA 2F2HA 1HJUA 2VRQA 4LQ1A 4UFKA 1DWIM 1KFWA 3CUFA 1KWKA 3K4AA 3U5UA 2A3BA 5E6YA 4OZOA 2XWEA 3SUUA 3WNPA 1KBKA 1XHGA 1TZ7A 2VJXA 3S6TA 2W91A 5CJ5A 1PJ9A 3MMWA 3ALFA 2OLHA 1KXVA 3UG4A 1WP6A 4PN2A 3TP4A 3WD4A 3W4RA 1XSKA 3T0AA 6CGTA 3AIRA 2W62A 3W24A 4UTFA 3TTYA 1JL8A 5A6JA 3CH9A 4TUFA 3RM8A 2Y4SA 2UY2A 3AHZA 4ATDA 1YQ2A 1BYAA 2BS9A 4Y7EA 1CTNA 1GVYA 2WXDM 4PUEA 2WSPA 4PMQA 1X6NA 1C8XA 1UWIA 2WHLA 3AI0A 1HVXA 1HJVA 1EGZA 4GZJA 5ABFB 2CBUA 5BXRA 4OBSA 3UG3A 2BHUA 2A3HA 2J25A 4PMNA 2VVNA 1ZBKA 3NIYA 1GHSA 5E0FA 5I2UA 3A4WA 3VDCA 1JAEA 1W1VA 2DH3A 5I23A 4EK7A 3OLIA 5AYIA 3GXMA 3MV01 1RP8A 1ISXA 5DO8A 2BHYA 1UR8A 1JZ7A 1GOKA 5M03A 4WSJA 1VEMA 1MQRA 1CXKA 4CN6A 2VC9A 2YL5A 4JFTA 1TA3A 2WK2A 3NUKA 3G6LA 2VOTA 3WEZA 4W93A 3T0DA 3WBEA 2GVYA 2XG9A 4TX8A 3WL0A 1HIZA 4WK9A 1KGWA 3VM7A 2J62A 3WKZA 1F4AA 5HOSA 1FA2A 1BVZA 1NQ6A 4Z2IA 5A6MA 1EDTA 4AZCA 5CPSA 1LLOA 2WVSA 4J3SA 1H3GA 5FKYA 5JBFA 3II1A 1LG1A 1CEOA 2J7BA 4XB3A 3CUIA 1BYBA 3WDHA 4XZWA 3NCOA 1VFFA 1OIFA 2PWFA 5BXSA 4L4PA 3VDAA 3EMZA 5A6AA 1VEOA 4DM1A 1UUQA 1CENA 1VRXA 3OGRA 2X8RA 1BGGA 3SURA 3L4XA 1C93A 2G8ZA 4U3CA 1CZ1A 3MKKA 1B3ZA 4W7WA 1NWSA 2PF0A 4FLQA 4FMVA 2CEQA 4OUEA 4YPJA 1TMQA 3WH9A 5CSUA 2WMJA 1FH9A 3DYMA 2D20A 3QOKA 2WW5A 3PZGA 2PB1A 3ZT5A 3HJEA 1BLIA 2CETA 3IANA 3B9DA 1LG2A 1JZ8A 3N04A 2EPNA 1PX3A 2E9MA 3ZIZA 3FAXA 3N12A 3ZJ6A 3ZR6A 4ZXLA 4UZUA 1KQYA 2QLYA 4AXNA 3T08A 2OYKA 4GZEA 3POCA 3CUHA 3RM4A 4RE3A 1C3FA 3B9EA 1BG4A 2D3LA 3PTMA 1OGBA 2DEPA 2YL9A 2E40A 3EDDA 1W32A 2ESCA 2VZVA 4KWUA 2C7FA 2F8QA 2J75A 3SUSA 2DSWA 3MUAA 1O6IA 1W2PA 4AZIA 4AISA 1I75A 4U2ZA 1D2KA 1H1NA 4C7GA 3K8MA 3OB8A 3ZR5A 1WKYA 3N1AA 1GOOA 3AYSA 1JDCA 5A95A 3QHMA 1WZMA 3EDFA 5A6KA 4AWEA 2V3FA 2ZUMA 3WN6A 2VVSA 1QHZA 5A94A 3WD2A 3CZGA 2BY2A 3ZT7A 4UQDA 2NW0A 1WDSA 3CMJA 1QOXA 1Q6DA 2PC8A 1W2VA 2B31A 5A1AA 4DUVA 1OD8A 5AC5A 2AAAA 1UKSA 4CU6A 2WVUA 1X1NA 3AXIA 4EAMA 3WBAA
chains in the Genus database with same CATH superfamily
1YPIA 4JL1A 4IICA 4JTJA 1NOWA 4V33A 2NX3A 3DI1A 2DJLA 3VZYA 3U7BA 3BANA 3FVDA 1R38A 2QCHA 3LCLA 4US5D 1JPKA 4XTIA 4IMAA 3IGUA 3W00A 4H6QA 2XUCA 3WBWA 4YYFA 3ZJKA 4H1ZA 3KBMA 1TPDA 3SGGA 2QCDA 1Q63A 3VNMA 2FDMA 3R10A 2V68A 4HN8A 1Q6EA 4LPCA 1EJRC 3I68A 4DF2A 5CQ1A 5BNKA 1H0GA 5TF0A 3BAJA 3C52A 3PK7A 3AHYA 4KCTA 5D2YA 2VCCA 2WSRA 1YYAA 3REQB 3Q67A 1QNVA 3B8VA 4DNMA 1W5MA 3TMLA 3CAVA 1JDDA 5LA1A 3MUIA 3GZAA 2YBUA 1UZ1A 1KM5A 2D2GA 3KOWA 4NAEA 2E9LA 3H53A 4J27A 3T0CA 4Y8FA 3S8HA 1GQIA 2FHBA 3KW3A 2BGQA 2M1IA 4C6OA 3C56A 2J7FA 4ES4A 1K1DA 4JXCA 4IIGA 4QROA 4IMGA 4NF7A 3WL1A 4QSFA 4W9TA 1MUCA 3SRFA 3JYJA 1XYCA 1IX5A 3NVDA 2OVLA 2VR5A 3NPXA 4F0RA 1H7NA 1KRMA 4IPPA 3OP2A 1OX5A 4MNLA 3A21A 1U5JA 2ZXBA 4GVFA 2TAAA 3TQVA 3LUTA 3TXVA 4XTDA 4S2CA 3UR5A 3EXTA 4PCSA 3G8RA 5LKYA 5LGXA 2JKAA 4AC7C 3SY5A 3GVQA 4LT9A 1H7PA 3GG8A 5FJPA 3U2EA 2F6UA 3D47A 1J10A 4HOZA 4C6BA 3TYDA 3G1FA 4AD3A 1FKFA 3UG8A 4PMUA 4MZ1A 1MDRA 3BAYA 1K8ZA 1UHVA 2OKTA 4MJ4A 4S3FA 2YCLA 1QW9A 1VEPA 3E2VA 3UBPC 4LUTB 1ALDA 2VQUA 3TC6A 4L1XA 1GNXA 1OGGA 5KITA 4MJMA 4QG6A 5E0KA 6XIAA 4MMWA 4H4IA 3VX1A 2YXOA 1JI1A 4RR4A 1WV2A 4PMDA 1V6XA 5DEZA 1ICSA 4QE5A 5J8LA 3FA3A 5HK4A 4R0XA 1XD0A 1E9ZB 3UG5A 2E28A 3TJLA 1E6NA 4FLOA 4N02A 4LOCA 5A8NA 1RY8A 4GUFA 5F1VA 3VXGA 3BOFA 2YX0A 3VNZA 2VURA 1SZNA 3MJMA 5LIUX 3VNLA 3EDJA 1XRFA 4Y9PA 4JNZA 3OQ8A 3S9YA 4M80A 3SI9A 3STPA 3W7QA 4NASA 1UMYA 1ZCNA 1CXIA 2X1UA 4LC8A 4BQ4A 3VCNA 2FIQA 1DP0A 4MM1A 1XINA 1R3VA 3O5LA 3TN5A 3WUEA 3WNNA 1KT1A 1ZENA 1ZFJA 4DJEA 3UQAA 4H04A 2D2OA 3BGAA 3QEZA 2HE8A 3CZKA 1RUSA 1V6YA 4WY0F 2RUDA 3TE9A 3WEMA 3RIKA 5AC7A 4TNSA 3NQ8A 4YHEA 1CXEA 4KWOA 2OTDA 3KDOA 1YEYA 2FZ8A 3K8KA 5CZJA 1AODA 3VZXA 1EYEA 1J8VA 4IFOA 5CPMA 4F40A 2IS7A 4IPLA 3INPA 5I06A 3STEA 1MSSA 1HXJA 4OV9A 1QMLA 4J5NA 3C2RA 4IQEA 1MQPA 3OYXA 1H61A 3P8JA 1CLVA 4FSAA 2YDSA 2FB3A 4W7VA 5JMUA 2M2AA 2GQ3A 3MANA 3VKJA 1LYXA 3BLEA 2HXTA 4QT3A 1PX8A 2OSXA 3LQGA 2XH7A 4Z1CA 4UNIA 4DZIA 4GY0A 3VKKA 4IJRA 1G9HA 1H1ZA 2PD5A 1PPIA 5A6LA 1PV8A 3NXLA 4Z1YA 5A8MA 4AG0A 3MV11 2GYIA 1KXTA 3VD4A 4RXFA 4PYSA 3M0YA 3RCYA 2EO7A 5CSRA 1GJUA 2WYSA 4DRJA 3STFA 3EEZA 3ZWTA 4GCAA 4J4OA 3I3EA 1PL9A 3HN3A 2ABBA 1SJDA 2WJEA 2UZ5A 1J0HA 5D30A 1Q45A 2D2JA 2GDVA 1UZDA 3C2OA 1H51A 2OWWA 1KXHA 5H8PA 2H9AB 2O9TA 2VZTA 3WFAA 2OYLA 1B57A 4N9EA 2NSOA 1GQJA 1RJPA 2OODA 1C90A 1C9DA 2O7SA 4N6EA 3WDIA 2PTDA 3JS3A 2W3ZA 4HP5A 2GGJA 3GTHA 2PGWA 3ARRA 3SUWA 1M65A 4ZB5A 5A6TC 4IJCA 3KX6A 4PTMA 3I7QA 4FNQA 3M07A 3SRDA 1GVFA 4DPPA 5DIUA 3LPGA 4XKMA 1S5VA 5HBFA 4OUIA 2AQWA 2D3NA 3A3XA 3CV7A 1O94A 2HRWA 4B4HA 3H2CA 4DRMA 3VI2A 3LOTA 4OQVA 1JPMA 3E02A 4IMDA 4KQNA 4JKKA 4JFMA 1E9YB 2PEVA 3GHUA 1FKDA 2BGNE 2A21A 5JBEA 3QSTA 2NXGA 3KAIA 4X2PA 1H2JA 3Q37A 4UQCA 4WEVX 2CHOA 1E6RA 3NR0A 4GACA 1ONEA 2WZTA 2DP3A 4C90A 4MB5A 2C1HA 3EX6A 2GK1A 4FX6M 2XM1A 1GONA 5FEPA 2O9OA 4KQZA 3LZ3A 3E0WA 3BAWA 1DWAM 3WQGA 1I2OA 1DE5A 3BE7A 2V6AA 4JYEA 3N2TA 3XISA 1FH7A 3AIWA 4OVXA 4U86A 3FEMA 4XZHA 5D9MA 5IFPA 3H4WA 3M0HA 4DXVA 1AA1B 1VIWA 3F03K 1J6PA 3BMVA 3NL3A 4ATLA 3NYDA 1XKJA 3L4TA 3WF0A 3IGSA 1FWJC 2LGOA 4JICA 5G5IA 1LLWA 3IV3A 3R79A 4NZ3A 1DEDA 1GVEA 2PGRA 2GGGA 1XQLA 2J9YA 4B9YA 3JVAA 2GOUA 1RH9A 1W3KA 3VMOA 2NUWA 2W66A 4DJFC 2WZHA 4CD6A 2OSWA 4MVAA 1G4PA 3OYZA 3GW3A 4LAWA 3U0HA 4Q8NA 2ZE0A 2IKJA 4M5PA 1X6LA 2H3BA 3BMXA 4DBEA 1E6SM 3GAYA 4C6JA 1E0WA 3ALGA 3TYUA 2V38A 3UGVA 3O0KA 1ZBVA 4S1FA 3WLLA 4AX7A 1O1ZA 3P8IA 1UC5A 4FR1A 1RD5A 2HS8A 5I6SA 1TVNA 3SSZA 1A5LC 1VFMA 4DUOA 3IUIA 1AW2A 1UIPA 4GVHA 1JRCA 4OWGA 3W1MA 4K1GA 2R24A 1ZCCA 1K77A 1JF5A 3TCSA 4PA8A 1DJHA 3CGTA 3WDQA 2FAPA 4CQBA 3CIXA 4R27A 3AIEA 2X16A 1RK6A 3W1LA 3GDBA 1JRBA 3N19B 2XP3A 1GOMA 2WKLA 1A5NC 4AMCA 1W5QA 3VIFA 1GT8A 1UIOA 4RW3A 5DCDA 4F0SA 3PZVA 4LJ3A 1TJ0A 1ZAHA 2XVLA 2QCDB 3N11A 3M5ZA 4TVDA 2EHHA 1EDGA 5BOEA 2VR4A 3QTPA 3W1PA 3TONA 4E8CA 2HZGA 1DJNA 2XN0A 1YADA 4K2SA 4JYFA 1XV8A 2F2DA 4QS6A 3VYLA 1FD9A 3LBCA 3U57A 3OZMA 3O5DA 3E74A 3NQ2A 3O8AA 1TFVA 1U22A 1JI2A 1SFTA 1OFRA 1S1PA 7CGTA 4M81A 4PMRA 1TPUA 2XH0A 3I4EA 1L2UA 1TJPA 4QCFA 5AYBA 2J79A 4HNUA 1OHLA 3EX4A 1R86A 2NUXA 5L9FA 4JQ3A 3RLUA 1ZTVA 4OTKA 4H7CA 3W07A 3N2BA 3E2RA 3O5MA 1MVYA 4Z2JA 4S3EA 1DIDA 1EF3A 1E3XA 4IT4A 5AYYA 1QPRA 2FZNA 5E9XA 4QDPA 1ECEA 3OIXA 3QHNA 2GDQA 4S2BA 3I10A 1H09A 3W84A 2XP7A 1N8FA 3RHGA 3CASA 1BWLA 1LRTA 1CCWB 2HROA 2PUZA 3WENA 2VT0A 2V63A 3MKVA 5I79A 1XYMA 1Y65A 4HCHA 4ZPTR 6REQB 3UXIA 3SR7A 2BZNA 3KVLA 1J18A 3ARQA 3W73A 1W8SA 5FI8A 1FKBA 3P80A 4H6RA 3FA5A 2ZICA 1IZCA 4KRUA 2J13A 3KP0A 5DN1A 4OBTA 4IH3A 1V7YA 2W61A 2WVVB 1R3QA 1WBHA 3OZPA 2GPTA 3LB0A 1IE7C 3B9OA 4MZYA 2P50A 3MP4A 4WLCA 1FWWA 3O06A 3QYQA 3UR7A 2AGKA 2CZVA 1KFCA 3FJNA 3GNRA 2DPEA 4X2RA 4A21A 3N2CA 4RZ4A 2PDIA 1EQPA 1ZP3A 1FH8A 4LV9A 1W9BM 3EWXA 4GO8A 2D1ZA 3EMQA 1LUCB 3A3WA 3W83A 1H60A 1JCNA 1XYLA 1MW0A 3F5JA 4XO6A 3K4DA 1HL8A 1L0PA 2JIEA 2J9XA 3QR1A 1O7AA 2XPKA 2ZX6A 1Q6FA 2NWSA 4NXKA 3HGRA 2I17A 2OO6A 3AO0A 1PKMA 1JF6A 3Q65A 4WGHA 3H9RB 2GJXB 4H6KA 4P8WA 2HBXA 1J0KA 2RSEA 1WZKA 3RUBL 3A4XA 1XIIA 4UZSA 3WNKA 4F0MA 2CZDA 3IKDA 2PDMA 2DZBA 1H7OA 2E6YA 3QMTA 3SQMA 1HJXA 3P0WA 1NU5A 2WJZA 3A64A 4MKNA 3UP8A 3KRZA 2CPUA 4L9YA 5XINA 3KL0A 4LBRA 1VBRA 1XW8A 5JIPA 4H2HA 2DIEA 1A0EA 4NNRA 1UWUA 2OZ0A 1IR1A 3WJSA 2DIKA 4TO8A 1BXCA 3VOFA 3CIWA 4FO4A 2DGAA 3AIQA 1XLFA 1GYNA 4YCPA 5GJPA 1XLGA 2WZMA 3V0SA 2JBMA 1E40A 4ZOBA 4D6FA 5C71A 3TQKA 1YBQB 4W88A 3DGRA 3GK0A 3APGA 3N4FA 1DJZA 2HTMA 1ICPA 3GO2A 1VJIA 3SB0A 3MDYB 1A5OC 1HL2A 2QV5A 4PTDA 3K2GA 4JTCA 2IPWA 3NYZA 4LAKA 1N7KA 1CDGA 3ZOAA 4GY1A 3VVGA 5DMMA 2RH9A 3O07A 1Z32X 3UZ5A 3W74A 3B7XA 1UQZA 3GXDA 3EYPA 1TWWA 4QLLA 3LNMA 1A5CA 3MVIA 1M04A 2Z4GA 1RD6A 1SW0A 2MLXA 1NOUA 1ZL1A 1UD5A 1TJRA 3B0VC 3PRBA 4U10A 1A5KC 4L72B 5TIMA 5B7YA 4B16A 3VFCA 1H4PA 3G24A 1E6ZA 5C7HA 1EHNA 4AY8A 1JD9A 4B3KA 2J8TA 2ACRA 3SIZA 1HXVA 1C9HA 4PRRA 1EEXA 1XIFA 3O6YX 3WELA 3WEOA 3KOFA 4Y96A 4I6KA 1TVLA 4A22A 1T11A 3M0ZA 1ZGDA 1THFD 3ZSTA 2EKCA 4WCJA 1UP2A 4WDXA 1EH9A 5HNNA 4D6GA 3M0MA 1NH6A 4HMNA 1PHQA 4HZ8A 2PDXA 3W01A 1AFSA 4DYJA 4OFCA 3RXZA 3W2LA 2A3LA 1LRNA 3QGVA 1J93A 2XVKA 5DT5A 1JUBA 5B7ZA 4MDOA 3G1SA 1DIKA 3KBVA 1ZBCA 2R14A 2WKGA 1J0YA 4AIOA 4LBSA 4DXXA 3UFYA 2FDSA 2VX7A 4AC1X 4GQBA 1O60A 1WNOA 3B03A 2FVKA 1HQTA 3EPNA 2FTWA 2PTZA 4EE9A 4QQ3A 3EWCA 2W27A 4QIBA 2PLKA 2KE0A 4Z17A 2YJQA 3SN4A 1J2BA 2XFYA 3GBEA 3S4TA 1YTKA 3UR2A 4P61A 1P0BA 4B3LA 2BY0A 4CVWA 4FF7A 4GIRA 1LQ0A 4LY8A 4D71A 5HJYA 1FWGC 5A8GA 3Q94A 4HYWA 4WXYA 4MUZA 3RRXA 3BSMA 4GH1A 1W9VA 3WNMA 1QRQA 4ML4A 2C71A 4HTBA 3WQ4A 1QBAA 3RJYA 2PPGA 3R5EA 3I4KA 4P2VA 1VGAA 2WLZA 1FKRA 2YFOA 3PC0A 4DAIA 2DQXA 4O12A 3NTPA 4RDVA 5A2AA 3QYSA 3NL2A 3QGKC 3IIZA 2R1PA 4JDYA 3RX4A 4R9XA 1FCVA 3TYAA 2PGFA 2G3JA 3HGOA 1K9TA 4WOQA 3GH7A 4KFNA 1IEVA 1XBVA 3C61A 3FW6A 3WY1A 3NXFA 1FCQA 3SQSA 1MEWA 4G6CA 3GFYA 4MTVA 4DEFA 4JTAA 1V3JA 3QQ1A 3GC4A 2VFIA 1UOKA 3G2GA 2V3EA 4KH2A 3BLDA 4ZA0A 3BW4A 4X61A 1ZZMA 3L4UA 3VDHA 1QJWA 2DSUA 1KXQA 2WHJA 3E0IA 1AQMA 3HQ1A 3KFTA 4BS0A 1OWQA 5D9PA 5AVHA 3JUGA 2EPMX 3EDKA 1EC9A 5IHRA 1QPOA 2DZVA 3EWZA 1SR0A 2GGHA 4BI7A 4NT0A 3QN3A 3O6AA 4PUMA 1M7OA 4HMEA 4HK5A 3MYPA 5GQBA 3PZNA 3W1UA 1NFGA 4PGLA 3TU9A 4LRSA 5LNSA 4DH0A 4UB9A 3GIYA 4DROA 1QDSA 2WMFA 3LD5A 2CBJA 4IIDA 2PDYA 3F7JA 5BXPA 2WNWA 4PEKA 3S5YA 4QJ4B 3APTA 2DORA 1QASA 3MMTA 1FWNA 1YXCA 3N2XA 3DBNA 1QNOA 2FGBA 2X1SA 1OM0A 1E9IA 2HQAA 4MHBA 2Y8KA 1TSIA 4UXDA 3FX4A 1OK4A 3B05A 1KQZA 4XIMA 3OEXA 4WKFA 3GWQA 5I03A 1K9EA 3PB0A 3IVSA 3POHA 1JG9A 2MF9A 3QFWA 3P2VA 1GPFA 3CEUA 4U2YA 3DBPA 3DX5A 4JQAA 3B0YA 3R4IA 3ZLHA 4X9YA 4JY9A 4MFEA 1A0DA 3VIJA 1JNSA 1SVDA 4IXXA 2O7QA 3A4AA 2ONEA 2DSKA 1W3LA 5K9DA 2E68A 1V6TA 2PDBA 3FKRA 1K02A 1GQLA 2VC7A 1PZ1A 3PA7A 1UD3A 5D05A 3KHDA 5A8QA 2VDGA 3WQ8A 3TLLA 1V51A 2DG4A 2QKFA 4NILA 1RCXB 3LLDA 3V75A 4PUKA 2PDCA 4IHCA 1DVJA 5JBDA 5CAHA 5C55A 3M4HA 3MHFA 1UKOA 4ZL1A 4C7DA 2ZR4A 4X9SA 3TNOA 3TOYA 5T9CE 1XIMA 1TO3A 1UR9A 4DX3A 2BVWA 1DJGA 2PPNA 3UWVA 3EWBX 1G4EA 4GXWA 4O0QA 3R13A 3ZXWA 2GDUA 3G0SA 5HTGA 4KWSA 5C54A 1DORA 3O5EA 4XZMX 2XVGA 3QW3A 1CW2A 1LZOA 4DZHA 4KFPA 3N9KA 2CLKA 3SCWA 1ZHAA 2Y62A 4HSNA 4JTLA 3B8UA 4DWSA 1W56A 5EB8A 3QZ6A 1GVSA 2XFRA 3S3GA 1QZ2A 3ZO9A 1QCWA 1N2VA 1HKKA 1JYVA 3DCPA 4E2DA 1GPWA 4FNUA 1ZSXA 4JNYA 3NEVA 1KFKA 1UD8A 2YYUA 1XCFA 2BGSA 1B3OA 1C9WA 4M7SA 4N42A 1TB3A 1D8CA 1Q13A 4Q4PA 1R7AA 1P6WA 3AYRA 3LTYA 5ABHA 1REQB 4TYOA 3L0GA 4LF1A 1IGSA 3DU0A 1EJSC 3OODA 1M6JA 2VCBA 1A5SA 3OZYA 2Z2AA 1XGDA 3MUZ1 2B0MA 3UCQA 2GWGA 1Y5WA 4AD2A 2K8IA 4IFKA 3P93A 3R58A 3CTTA 4I7UA 1MNZA 2ZFAA 4Q7BA 5AN7A 3WD3A 1HO4A 1KLZA 3S5ZA 2XIOA 1V77A 4P5UA 4FXJA 3GQYA 1XYAA 3VOGA 1GJPA 3G22A 3AIBA 2GLKA 3ABRA 3L2LA 3ZMRA 1R3SA 4DWDA 5TD4A 3AMLA 4YJ5A 1XBYA 1QHPA 3W70A 4I6VA 3HTWA 1UR2A 4LANA 2EBNA 1UP3A 5LGZA 2X1TA 5DY3A 1ME8A 4AEFA 1FHDA 3BPWA 1O1HA 3CL7A 4AD1A 3S5NA 8A3HA 1MFVA 4EWJA 4DJED 4N7QA 1LORA 1D7JA 4M24A 1UH3A 3M7SA 2ATSA 3WLMA 3IRSA 3DG6A 4L1GA 3DFOA 1H49A 2ICSA 1PO9A 1E6QM 1LRQA 5IM51 5LIYX 3AIVA 5GJMA 1OVDA 4US5A 3I3BA 3N15A 1GJWA 3LNPA 4WDWA 1DE6A 2FPVA 2OR2A 2D23A 3N73A 4HHHA 3DIPA 3GB6A 1OFOA 2A79A 5K9CA 1MW2A 3UVAA 5I3KA 4AX6A 1E6XM 2WMGA 3GTNA 1W9PA 8XIAA 4Q4SA 3KTXA 4EANA 1KBLA 4XZ9A 1IZJA 4LAYA 4NNBA 1YW5A 1C92A 1EWEA 1IGWA 3VIIA 1MFUA 3SW6A 2VUYA 2WBKA 3LCWA 3MUCA 2DZXA 1JNDA 3CPUA 4K37A 4RXGA 3S9IA 4C6KA 3B0PA 4FZIA 1XH2A 5EKYA 3TOPA 2R91A 4JX4A 1SPQA 2RUSA 4LS1A 1JCXA 2PF8A 1UBPC 4C65A 4V2XA 1WYIA 1F05A 1JQVA 2F7FA 1A3XA 3BZJA 3AMGA 4HZ7A 1AD1A 2ZQTA 7REQB 4BQ5A 1TV8A 5HWBA 1OX4B 3HV9A 1F5ZA 2HISA 2ISWA 3CZJA 3PULA 5H91A 4IL2A 1FTXA 1V6UA 2XGBA 4B90A 3TLQA 2OJPA 1QI5A 3DUGA 4DZ3A 5G2IA 4C7FA 2VGBA 4YTSA 2PRLA 1B9ZA 1OX6A 4I3GA 3WQPA 4RPPA 4X60A 1UC4A 3URBA 2F2HA 1QXLA 1EJVC 4DAFA 3GNXA 1S5TA 1DWIM 4MPQA 2VM8A 3U5UA 3ME3A 3MC5A 2XWEA 4KESA 2XP9A 4JQ2A 3W7LA 4JFKA 2VGIA 2VJXA 2W91A 1OFQA 2ZTKA 3ZZ1A 3MMWA 2PGEA 1GTEA 2Q3OA 2ALDA 1XSKA 5FF3A 1J96A 4UMCA 2ZBTA 3TTYA 1JL8A 5A6JA 3CH9A 4TUFA 3W7CA 2IKGA 2BS9A 1OY0A 1SSDA 4R33A 1CTNA 4JN6A 7TIMA 1ROTA 2PCQA 2ZADA 4PMQA 4QDWA 3GNNA 4GC3A 3AI0A 2NV9A 3RPTA 4DXKA 1HVXA 1HJVA 1EGZA 3UG3A 4IT1A 2A3HA 3BL3A 4G7EA 3CAWA 3STCA 5D03A 5I3IA 2VVNA 3LHUA 5D2VA 3VKAA 3IIXA 1GHSA 2PCEA 1AH4A 2DG9A 5I2UA 3U4AA 4EK7A 4IL0A 4HJFA 3PFRA 3SADA 3MV01 1RP8A 1X7FA 2FVMA 4KEVA 2BHYA 5G1YA 5CC3A 1UR8A 1JZ7A 1VRDA 3BQ5A 3GDLA 5EA9A 5M03A 1S2TA 2EJAA 2X7WA 4LEQA 2QJJA 3QQ0A 2LLEA 4N4PA 7REQA 1R47A 1YDOA 3QPZA 4FX7A 1RSCA 2YL5A 2G3FA 4D8AA 3HPZA 3LTSA 4AYGA 3O5KA 3PWAA 1AD4A 3KOZA 4FIRA 4M1BA 4QE4A 2KGJA 3WBEA 5HQEA 3NQ7A 3CHVA 3URAA 5DLCA 3PWGA 4BF5A 2HXUA 3VAWA 2IKIA 4ZOAA 3HG3A 1NQ6A 5A6MA 1EDTA 2W79A 4O1FA 5CPSA 1IXQA 1LOLA 4YLWA 4AHOA 3UWYA 3L9CA 3SJNA 3QY6A 4IP4A 1LG1A 1CEOA 2J7BA 4XVDA 3CUIA 4O8AA 4JR5A 4UMAA 2VYOA 3JZUA 5HANA 1XG4A 1TTIA 1NDWA 5DQPA 1UUQA 1VRXA 2RUQA 2X8RA 3C0JA 3MB9A 1D3HA 3SURA 3CV6A 3MYOA 3P5ZA 4DELA 1UCWA 2VCDA 4ZSUA 2C1IA 1T96A 3WH9A 1JULA 3IWPA 2VGFA 3QOKA 3ZT5A 3IJLA 5HWNA 3UWUA 1TV2A 2E6FA 3IANA 1YDVA 3B9DA 1X96A 1ZUAX 3IUHA 4G9PA 3FAXA 1JPDX 4MUPA 3ZR6A 1FUYA 4IIBA 2E7FA 1KQYA 2QLYA 4AXNA 1T8XA 3SECA 4C6FA 3B9EA 1BG4A 3LLFA 2YL9A 2E40A 3LRKA 3EDDA 3QY7A 3TXZA 4BEQA 2DSWA 1KT0A 3R0KA 3TW7A 4O57A 3O6CA 4JIHA 4AZIA 3FCPA 1DJXA 3V1HA 1XIHA 3WX7A 1GOOA 2PTWA 5CZSA 1QTWA 2ZCGA 4HBOA 4BHYA 1R2RA 1POJA 2V3FA 4NVTA 4JTHA 2ZUMA 5T26A 4JBRA 3WD2A 3CZGA 4UBPC 3N6JA 1KFEA 1R9HA 2RURA 2NW0A 2PC8A 1W2VA 5A1AA 4MYAA 1L6SA 2ACSA 1DV7A 1OD8A 4Q8QA 5E93A 3TUUA 1NSGA 1UKSA 4UTLA 1DTNA 3L0NA 1ZAIA 2V5CA 2KX9A 3NPWA 3D3AA 3F2DA 4JL2A 1A50A 1LOSA 3J7HA 2QV4A 1S3TC 2L2SA 1U2YA 3QZEA 5MKGA 2IW0A 2CC0A 4O1AA 5BOOA 2X0SA 2V5JA 3EIPA 5BXJA 4RLIA 5GNYA 1QPKA 2ZXAA 4IPJA 1PDZA 4QEEA 4HHPA 2IPGA 3FHAA 4Z08A 4ZCWA 2YLAA 5C9ZA 5FJJA 3V5FA 4CU8A 1YMYA 3IJ9A 3L12A 2MNRA 2D0FA 1E72M 4GG9A 4CQAA 3AIUA 1XG3A 3BG3A 5TNVA 4AZHA 3SUVA 2Q01A 4OOUA 2MNTA 4NHVA 1WKFA 2PWUA 2QDEA 4QX4A 3HB9A 3TDBA 4QISA 2XPBA 4HPXA 4JIRA 2WWCA 4ZO9A 3RGTA 3JRKA 4NP7A 3G1VA 3NNTA 4KEZA 5EL1A 2PDGA 4N0RA 2YYTA 2XJ7A 3WIJA 3PNZA 1XM3A 1R2TA 1WKDA 2I5QA 4Y9NA 2IQDA 3PG9A 3M6YA 1EEPA 4F66A 1TWZA 1VFLA 4TXEA 2CLLA 2CKSA 2BHZA 1GOXA 3VNKA 3HFYA 4ROQA 3Q45A 1GVRA 4H9VA 2EG7A 4KEUA 4S3GA 4GCXA 1KV8A 4G50A 4B15A 1SMAA 4U4MA 2OLSA 2OB3A 2E6DA 5CLWA 3W7HA 4NX5A 4DB7A 3IS4A 1HKIA 3MUY1 1KBIA 1RQEA 3WJYA 3GVRA 3L4WA 5K4ZA 1O4UA 3W6YA 1TREA 1MZRA 5ABFA 5JH2A 1V3IA 2BOGX 1OYCA 4UFMA 4MZ8A 2WMKA 4Z2HA 3O16A 3BGJA 2DZUA 2PDWA 3GE7A 3ARUA 2HE5A 3CB3A 4CD7A 1ADOA 1MZHA 3F5LA 4UOJA 3W71A 7TAAA 1PINA 1KFJA 4LXFA 1WUEA 1QO5A 1ZALA 4WZHA 4CN1A 4O8RA 2ZOXA 1XIJA 1ADDA 3TROA 1WAWA 3A9BA 3KXQA 4JFIA 2YGYA 4AQLA 4IX0A 1HVQA 1M01A 4OE7A 1UPPA 4ZQNA 1RV8A 5F7UA 3CWOX 1FDJA 3UWWA 1BYDA 3NDZA 4CCCA 1ZNNA 1YBQA 4H3DA 3GDRA 1CYGA 4HPGA 4MFDA 3EOUA 5KEZA 1GQKA 1VQTA 2YCIX 4CNOA 2IPJA 2O0TA 2QXWA 1W1A1 2DVXA 1EX1A 8CGTA 4O2TA 2ZVRA 1BFNA 2CLHA 1WB0A 2DV0A 3G1HA 4AD4A 1KD0A 3GD6A 2CU0A 3SCVA 3H12A 2CFFA 2E6AA 3TVAA 4HTYA 6A3HA 1EX5A 4MLRA 1WDDA 3W82A 3B8DA 4MNMA 1RY0A 3M1ZA 2PBGA 1AH0A 3OVRA 4E8GA 3KCOA 1UZ4A 2HVOA 3MVTA 3DG7A 2ON3A 4DQWA 2E77A 1TIWA 1F07A 3ZWSA 5DELA 4DUXA 4CNNA 4N9CA 2VRJA 2V3DA 3NSNA 1BQCA 1NFBA 1N55A 1F6YA 1XSJA 2QJMA 3KTSA 1SFSA 3A5VA 3M64A 1QNPA 1UR0A 3R8HA 1M03A 4W9PA 1LP6A 1W3IA 2XPAA 4MB1A 1EP3A 1S5WA 3BSHA 4ILSA 3PTDA 4TVCA 4RE2A 2RDWA 4UTWC 2VC6A 2NX9A 3SN1A 2WOQA 4LUYA 4G1KA 4Q4RA 3CQHA 1POKA 1W8GA 3GHSA 4U33A 3KE0A 4JTFA 1C8VA 5K4XA 4GRSA 2CNCA 2YZ5A 3H7RA 4XAPA 1BGAA 1CXLA 4W86A 3GIQA 2J9ZA 2VZUA 2QPSA 4GNJA 3LEPA 1B30A 4PMXA 4L5ZA 3NDYA 3QLDA 1RBOB 4AUBA 3FYOA 1XLLA 1QHOA 3WLHA 2XFWA 2KZHA 2YA0A 4I9JA 4R3UA 1F3XA 2XGIA 3TKFA 1V3HA 2J66A 4GZ7A 1TV3A 5BCAA 3RPMA 3BUVA 2E0PA 2WNNA 4U84A 1R85A 1V02A 5IOBA 3GIPA 1LWJA 4FX8A 3VD3A 1SMDA 5HKGA 2AKZA 3GXNA 1LCOA 2NQLA 5A6BD 4D6CA 3SCRA 3PTKA 2F23A 2P53A 4BI6A 1AJZA 2X42A 4LU0A 5FIPA 3T09A 3WLRA 2BXZA 4LNCA 2NQJA 3UXAA 2O9PA 4UR7A 1Q6UA 1NWUA 2R6OA 3SCSA 2YB4A 3AISA 4TOQA 3NSMA 1H5YA 4AWUA 3WH7A 1JZ5A 4D8LA 1RP9A 2OEKA 4GIYA 1DKWA 4NJHA 1PIGA 4GISA 3C3NA 3NA8A 1TIMA 2XH4A 2VO5A 3P5YA 1XLAA 3A22A 3UXKA 2VOMA 4EWND 1EXPA 2ZRVA 4AZBA 1R3YA 4MIMA 2PWHA 2E5DA 2WHKA 1D7HA 2EAWA 2NZLA 4LWWA 1H62A 2BB0A 1I2QA 4NI8A 4GINA 1IXOA 1QPQA 3EOLA 4FIQA 4XD6A 4ERGA 2YIHA 4PUJA 1FHLA 2FTPA 4DNHA 1VKFA 2FKPA 2PE4A 2O92A 2Z27A 1OQFA 1BTCA 1KM2A 1B3VA 1ISZA 3V0TA 3CM4A 3MS8A 4HYRA 4RCXA 3EXSA 4DO5A 1HX0A 1D8WA 9XIAA 3ICJA 1BVWA 3S6OA 1A7XA 2B7PA 3U3HA 3BWWA 1W1YA 1QU4A 4MY8A 2WZIA 3TA6A 3W6MA 3T0BA 3E2SA 4WRHA 1PYFA 3L4ZA 1TE1A 3TQPA 2X1RA 3MCMA 2VX5A 3FAWA 3VDGA 4OJYA 4F9JA 4ZEPA 1R3WA 3KLKA 5GVJA 4TTGA 3KZ7A 5D38A 2QUVA 2C6QA 5AHLA 1JYXA 2BMBA 3QRHA 3AROA 3NL6A 4UTJA 1RVGA 3FYYA 3G5EA 9RUBA 5KZEA 3CXOA 3H21A 4C6IA 2WO5A 1L6GA 1PZ0A 1L6YA 1A53A 1G5AA 4JHOA 4XAYA 4DWSD 2GJXA 3R6IA 1OFAA 1J0JA 3VU2A 3OHIA 1M5YA 3IEBA 2P0OA 1K03A 2XYLA 4Z0SA 2UY4A 2ANUA 4DIAA 1XIEA 3GU1A 4XO7A 1Q6HA 5AOUA 3LI0A 4E2VA 4DYKA 2VD8A 2Z00A 1O5KA 3WYZA 1IWPA 3UD6A 1YNYA 2H3DA 2QAFA 4DWSC 2G3MA 4DZ2A 1QWKA 3LXAA 4GNVA 1XLMA 2J77A 4TVUA 4D6DA 1NY1A 3LERA 1W37A 2XM2A 4E8DA 3FA4A 2CXGA 4HCDA 1XISA 4TQTA 2CITA 2YDQA 3WDJA 3OGSA 2VX4A 2FHCA 2PDJA 3NZPA 1U5VA 1BWVA 1J5SA 2CZFA 4H01A 3FSTA 3PUGA 1Y0EA 3UEQA 3KLLA 1CPUA 3MY9A 3OLDA 1JVWA 4R88A 3NEHA 5EMYA 4FHAA 1S5NA 1HKVA 1VLIA 5HUOA 2YL6A 3LCXA 1FKSA 3VK5A 1LBFA 3SIMA 3TC3A 1R87A 4LGXA 4QXIA 3QF0A 1W3HA 5GPRA 3AXMA 5KZDA 4RPQA 2YCEA 1I60A 3MSDA 1YRRA 2I7GA 2Y8UA 3GDTA 1JPHA 3AWNA 3CHFA 3GNPA 2E25A 5HMEA 1TUXA 2V5LA 1YDNA 4JS3A 4LAOA 2IPFA 1W9DM 3T78A 2X1IA 4XX6A 4DRSA 5A6BA 1FDYA 1OABA 4O4WA 4MDPA 3K4WA 2N87A 4L9ZA 4WOZA 4KS0A 3N6HA 4WY0A 4IFKB 2ZX5A 3KVKA 2VENA 3PPGA 2PP1A 3O5OA 4MY1A 6PTDA 1OT1A 5KTLA 2IQ0A 4W9OA 4DJDA 1UKTA 4P8VA 1EA9C 4NAFB 1W3JA 3S2MA 2GJNA 3DHPA 3W1AA 1UBSA 4S39A 2H9AA 2POZA 3GVVA 2DT0A 5CSSA 4P7NA 3VPLA 2Y70A 3WQVA 1Q6CA 1HJWA 4B5UA 5I78A 2FZ9A 4DHGA 3AYVA 4MY9A 4PB4A 3UF9A 2PLMA 4AIEA 2XSXA 5HPOA 4Y2WA 1NDYA 3M44A 4DRPA 3V3WA 3WDRA 4R9OA 1XBZA 3NI6A 4Z0JA 2KO7A 2J27A 1L9WA 3BQ6A 4UTUA 2QUNA 2VI0A 2PBCA 4IT6A 1JDAA 5EGRA 3NM1A 2A3EA 1LT8A 3DHUA 5AHIA 1F9CA 3LG3A 3KBSA 1PS9A 1UW9A 1EP2A 3MUXA 4RDZA 3G18A 3MBFA 3FYPA 2Q5AA 3AS0A 4L7ZA 1QNSA 5HXMA 4H00A 4QT2A 3BMBA 1QWGA 4JEJA 4KRTA 2C0HA 4GE8A 1R3TA 1LROA 2OX4A 2OGJA 4GI8A 4NRRA 5HR7A 3EPMA 2KAUC 4PUUA 4YWSA 1N1AA 4HNNA 3H26A 4K68A 4GUGA 3VD9A 4P7OA 3W75A 2UY5A 4AHQA 5BZAA 3BJTA 2VNCA 3KRSA 2RGMA 3H2FA 1DIEA 3UPMA 1HKMA 2QJIA 4UNKA 3T4WA 4YVPA 3AUOA 2BASA 1BTMA 1PB0A 3BJSA 4LYRA 1XBXA 2WM0A 2D22A 1BVNP 4DBSA 1XCXA 3B4YA 2NQ5A 3TR2A 1ME7A 1US3A 3SGZA 5DX7A 3KDNA 4A3RA 5BMXA 1ELSA 3T07A 1I6NA 1L8NA 2BDQA 4KERA 1QPFA 5ABGA 3TTSA 2ITKA 3ECQA 1NQKA 4HK7A 1KW1A 2RQSA 4H9YA 1RCQA 3VX0A 3AHVA 4AFYA 1VPXA 1MWOA 1UYQA 5CGQA 3KUMA 4MGVA 3AJXA 1F8IA 3CC1A 2W4XA 3DG3A 1LT7A 1OD0A 2PZ0A 1FFRA 3W2JA 3H2EA 2D2HA 2X7VA 4ZO7A 3CZEA 3RCMA 4Q6JA 2KR7A 2WANA 4EXQA 5HW6A 3HZ3A 5D09A 3APYA 1UWSA 4UQBA 3WJZA 1JFHA 1AJ0A 3L65A 3W2MA 4F79A 2ZA1A 4DBDA 3MP3A 2V8ZA 4RKAA 4KEMA 3B9NA 1E43A 4OBRA 3PBWA 3LCIA 2VEFA 2A4AA 4HKPA 2DUZA 4Z1AA 1XKYA 2HVMA 1TPVA 2SFPA 4KGLA 5AECA 4HN4A 4DRHA 4C91A 2G5WA 2VHLA 4AF0B 1S38A 3CV1A 2WHMA 3DAQA 3ZT6A 1W1IE 1FXPA 4PCTA 3DFTA 2RDTA 4O10A 1AW5A 4NJJA 3ARXA 8XIMA 3NFUA 1ZK6A 1XLJA 3K1GA 1O66A 1W9XA 5D2WA 1MXSA 4IUGA 2OU4A 2VR2A 1Q1CA 4ADUA 2Y85A 2XSBA 4PUNA 3EDEA 3WBYA 1W9UA 1MW1A 2AL1A 5I3HA 4N19A 3DGBA 1XYBA 3GXFA 1UR1A 1I2PA 4DWSB 1SZRA 2WMIA 3PR2A 2CLMA 1ML1A 1VIZA 3GVGA 4I9AA 3RO8A 2INFA 4DF1A 2RGLA 1U5HA 1GGOA 2XWDA 4ZSTA 3HQOA 4AVFA 3N2MA 2QJHA 1JCLA 4NYUA 3M0VA 2DU2A 2BODX 4IFRA 1LBLA 4A8IA 1QNQA 3TYEA 3W7IA 3NO3A 3U2CA 1DQXA 3IGHX 3DFSA 2PRHA 3OBAA 1TE6A 4YXGA 1WUFA 2VFHA 3VNJA 1AZ2A 1EB3A 3HU7A 1NF0A 2HNHA 3HM7A 4ZE5A 1XRVA 4ZGYA 1EO7A 2A6LA 2E09A 1NTHA 3TSDA 5FAGA 3WQ6A 4N9DA 1F6PA 1V3LA 1XLDA 2QJGA 2XVNA 3BJFA 2Y5EA 1HF6A 1OG6A 5DANA 1BAGA 2WC7A 4ODKA 4H83A 1HP4A 1G4TA 3O5RA 3CMGA 1MO0A 1GG0A 4XIAA 1KV5A 5I7GA 2X40A 2QCNA 4J1OA 1UKQA 2EQDA 4HU0A 1FWAC 2ZXQA 3AHTA 1FBAA 1YHTA 1JYWA 2UY3A 4U31A 2GUYA 2EGZA 1OC7A 3W88A 2IXVA 3RMJA 4CCEA 4J40A 3KVJA 3G3DA 2WZEA 4TMBA 3T7VA 3ZSSA 1GVOA 2O9RA 3BLLA 4TV6A 4RNJA 4RDYA 1Q8AA 3XINA 3H2AA 3MT1A 3VE9A 2WPGA 4MYXA 1JVNA 2PV3A 2A5HA 4H19A 1FKWA 1PIIA 4KKXA 4NUWA 1SQ7A 3A4JA 3H55A 4C6MA 2ATMA 4FAMA 5AHEA 1H7WA 3NQEA 5JUVA 1H1YA 1EF2A 4NYYA 2E5BA 3KEHA 4IGHA 4OT7A 3L66A 3CNYA 3IHZA 1NIUA 4HQVA 3LDVA 1J12A 3RR1A 1TJ1A 1VAHA 3NO5A 1FKKA 3OPSA 3MSYA 4DRQA 5FCZA 1UASA 5D2XA 4PMYA 4H8UA 1W5PA 4MAVA 2HPIA 1VHCA 2WCSA 4UCFA 3ZFHA 3PUEA 1P6BA 4ZPWR 2XHYA 3EX3A 5JVLA 1PEZA 2EJ1A 1RHCA 1D7FA 3ATYA 5ABEA 2OXNA 4B2DD 4A2RA 5HMFA 4K8EA 4Q8TA 4Q3MA 1XICA 1TA3B 1DJWA 4ZMGA 1DQUA 3NPVA 5E6ZA 4GOAA 2FB2A 4F2TA 3QR0A 1UUOA 3WMBA 1EC7A 1TV5A 4IM4A 2W5FA 4G8TA 4A05A 1YXYA 2QUTA 2G3NA 4K7YA 2QPXA 3GU2A 3BLKA 4ZOEA 3TCZA 2QF7A 2NVAA 2RKXA 5BROA 2YKKA 4GA8A 1VPQA 1I9CB 4XV0A 1KWGA 3D46A 3DHDA 1XRTA 3O7UA 4LVAA 5FJOA 3W86A 3U4FA 2OCZA 3HPFA 3L68A 3E5PA 3IARA 4EXBA 1QK0A 3PBVA 4X3ZA 3UQNA 4JTIA 1ONXA 1UR4A 4IMFA 3SCNA 3WQ5A 3S0CA 2NT0A 4QGCA 4G7FA 3W3OA 1W1B1 2ZZ1A 4MWAB 2AL2B 3I6RA 4AMAA 1HKJA 3L4VA 4FS9A 2BVTA 1P6CA 3FSUA 3WLJA 4D2JA 4J4NA 4YVVA 3SEPA 2G41A 3BSGA 3VTRA 2ZX9A 4PL1A 4ECLA 1IXNA 1RVKA 4DRIA 2TMDA 2WWDA 1S2UA 3KWXA 2G4JA 2VQTA 4L80A 3LXBA 1EOKA 1EQ3A 1EKOA 1TWDA 5D9NA 4ZVJA 4YYCA 5MKGB 3S42A 4F2UA 5G4EA 3MJYA 3PJXA 3OO2A 4FK9A 3DI0A 4G7EB 3QXBA 5HWJA 3UJ2A 3W7PA 3QM3A 1IF2A 4WD0A 5M2FX 4U85A 3HG5A 4B92A 2EPKX 3TJ4A 5I3GA 2CLPA 3WNOA 4JTQA 4WUIA 1ZJIA 3JW7A 5U4NA 2I5IA 1A80A 1EXBA 3SCOA 1K4HA 3CUXA 3LMZA 3W02A 1QOQA 4WR3A 1SZFA 1QI4A 4Z2GA 2PV2A 4ROPA 3CEPA 3M0KA 2OOFA 2WNZA 4O14A 4Q4MA 3TR9A 2ZDRA 3WUGA 5A2BA 1FP9A 4D72A 5EMKA 1F73A 2OSYA 2LKNA 3LCGA 5F2GA 1Q6LA 1US0A 2C0AA 4XZLX 3BZGA 4IIFA 4OIFA 1D7KA 2Y0FA 3NRKA 3FJ4A 1WPCA 3ARWA 1LBMA 2X41A 1DOSA 3DH7A 1AK5A 2I5GA 1XC6A 3TZNA 1ITCA 1GQNA 2WSKA 2O56A 3BH4A 3O0FA 3U9IA 4V1YA 1HL9A 1C91A 1TWSA 3WH6A 2PSNA 4B5XA 2XIIA 2TRSA 2DH2A 4NJKA 4AY7A 3LS9A 1BF6A 5CBIA 1M41A 7PTDA 1QI0A 3IK8A 2R1KA 1EC8A 3RK8A 3ITCA 1XJBA 1U79A 3GM8A 3HURA 4J3WA 1LQ2A 3T40A 4EKJA 3FHQA 3UPWA 1FCUA 3QV6A 1GOIA 1K7FA 2AMGA 2Y5SA 1I2RA 1K8YA 3KS5A 2PFHA 1XFCA 4O1CA 4HMDA 2PDUA 4ZOCA 2JIWA 3MO7A 1AUSL 4J3ZA 4LCRA 2JK2A 4RX0A 7ODCA 3GFZA 3FFSA 2UBPC 3VE7A 3MCOA 2ZA2A 1PHWA 4N4QA 5CGTA 4YMZA 1GHRA 3CUGA 3KADA 5LZLA 1VB9A 5HR6A 1PTGA 3M0JA 2J7CA 4ZQRA 4KCUA 1X97A 1E5JA 4WQ6A 3RPDA 2YBTA 3TW9A 2FFCA 5C9WA 3IVTA 4E0CA 5IBXC 5BU9A 2FGLA 4UR9A 3QTGA 3UF8A 4A3YA 1PAMA 3V0UA 3BVJA 3AMCA 4LAZA 4OGZA 1KA9F 1Q65A 4GI9A 2BY3A 4DJDD 4ZTYA 3Q4DA 4Y90A 4IWWA 3OLGA 4B2DA 4S23A 1GORA 4UQ9A 4AZ6A 1V93A 4JGDA 1XRSA 4TW7A 2YXXA 4GJ1A 5BWFA 3PAOA 4EIVA 5HW7A 2ISSA 4H7ZA 4PTVA 3HPSA 5EBAA 1KKRA 2JGQA 5CC5A 3RRAA 3W1QA 5CZKA 4HJWA 3L4YA 4A2SA 4MJ2A 3ZVIA 3W1NA 2C91A 2GK1B 1F7BA 5KZMA 3A12A 1PCWA 3H8AA 5T8GA 2YR1A 4D1JA 5G4WA 2DZSA 1DYSA 1HJUA 1A0CA 4REQA 4UFKA 5FJTA 3CUFA 4K39A 1SJAA 3E0FA 2ABAA 4OZOA 3VKCA 1KBKA 1TZ7A 4R7OA 2DG3A 2VFEA 3S6TA 2PZNA 4KWVA 4ZODA 4IZGA 4NZFA 1PJ9A 2ZC8A 3EKZA 3CYVA 1KXVA 4XWUA 3ID7A 1WP6A 1Z9AA 3LQLA 3W4RA 1RA5A 2VP8A 3W24A 5ENLA 2VEPA 4NNAA 3DKLA 2VFGA 2DZTA 4ATDA 1CB7B 1BYAA 2R1NA 2W6RA 5AB3A 1JCHB 2WSPA 4UR8A 1CLKA 4QJ1A 3EGJA 3UI4A 1BWKA 2TSYA 3L5LA 3CQ0A 4GFIA 4GZJA 3UCDA 2AGTA 4OBSA 2BHUA 1IQ8A 4L6DA 1ENUA 4C1LA 1ZBKA 1TPC1 2VDHA 4INFA 3IJDA 3NIYA 1P0KA 3CK5A 3H23A 3WK1A 2F38A 1UP0A 2DH3A 2ZE3A 3N3TA 2P3EA 2Y6ZA 3OLIA 5JU6A 3AYTA 4YU1A 2CLOA 2FJUB 1GOKA 4WSJA 3DC8A 4NIRA 3B8IA 1T8QA 1UB3A 3CYJA 4I90A 4CN6A 1H63A 2VC9A 4ALDA 1UZHA 3NDOA 4JFTA 3TN6A 3NUKA 3G6LA 4L56A 4QHRA 2VOTA 3WEZA 4ZO6A 5MHBA 3T44A 4W93A 5EPDA 3TWAA 5C7VA 4TX8A 3CJPA 2EG8A 5LXEA 4ODLA 2RJGA 1XGEA 2I9UA 1F4AA 2ZC1A 1FA2A 1XX1A 4W9QA 4NXSA 4Z2IA 2A6NA 3BLFA 1YW1A 1Z3NA 5G2HA 2WVSA 4J3SA 5FKYA 5JBFA 3II1A 4XQ6A 4KRZA 2CXEA 3WDHA 4XZWA 4YS1A 2X2GA 3CL6A 1VFFA 2PWFA 1Z8AA 3KAHA 3EMZA 5A6AA 1J4RA 4DM1A 1VCGA 3QMSA 4PUWA 5CZTA 2VWSA 3SM0A 5FEWA 3OGRA 1BGGA 3L4XA 4U3CA 1CZ1A 4XZIA 2IF4A 4FMVA 4I9MA 2TPSA 4YPJA 1EZWA 3O3RA 3U8GA 5CSUA 2PAJA 2WSYA 2D20A 3N6QA 3ELFA 4XBKA 3PZGA 1BLIA 1IEWA 2OFJA 1ZY9A 4UIOA 5AZ0A 1A5BA 1TTPA 1LG2A 1JZ8A 2BSLA 2EPNA 3N34A 2ZYFA 4I5UA 3ZIZA 4QQUA 3N12A 2QVNA 1B5TA 3LSCA 3T08A 3QH2A 3POCA 4IQCA 3CUHA 2ZKMX 4RE3A 3PTMA 1OGBA 4DN1A 4HARA 4K8GA 2R9RA 2H6RA 1I0DA 2J75A 4EACA 1O6IA 4YTUA 1UUMA 5G1TA 1HW6A 4C7GA 5DITA 2HK1A 1A3WA 1MEHA 3LBOA 2Z6IA 1Z42A 5CZ0A 1JDCA 5A95A 3EX2A 3QHMA 3WLIA 1X1ZA 2CLIA 1NVMA 3BGGA 3THAA 5HNTA 5A94A 1S2WA 1SGJA 3UXLA 2QDDA 4UQDA 1RXOB 3TSMA 1S2CA 4ODMA 3GSMA 4RK8A 4AIBA 4RZBA 1QT1A 5JXQA 4FPSA 5BOFA 5FAJA 4L9XA 1D3GA 1TRDA 4EAMA 4FNPA 3WBAA 4LAVA 4TU1A 2QCFA 4QP0A 3QMRA 4GBDA 2JFEX 4O13A 3MO4A 3ZM8A 2G3IA 4E3TA 2J8GA 3WQWA 3TTEA 1FP8A 2G96A 1ZCOA 3ZLFA 2Z26A 3C3UA 3PUOA 2Q8LA 4JFJA 3UESA 3WLOA 4UDMA 4WGXA 3TSBA 3E96A 1XUZA 1KTBA 1YLVA 3WLTA 1UROA 4GABA 2ZR6A 4JIPA 5D2TA 2PMQA 3M5XA 4B5TA 1KTNA 3TCEA 3BOXA 1LUCA 4XUGA 5FF7A 2FH6A 3AUJA 2FTYA 4QJ3B 4X0NA 3GRIA 3L2MA 3WQEA 3WLKX 3OVQA 1TJ2A 1ZPTA 2X05A 3FLUA 4NZ1A 3PZ9A 4RUBA 2DJXA 1HP5A 3U48A 2QCLA 9CGTA 1Q85A 1VBHA 3LV6A 1OCQA 2OX1A 4UTWA 3EMCA 4ZZ9A 3M0LA 4DRKA 1SO6A 2W63A 1V79A 2FPTA 4B3ZA 5C9UA 4YN5A 1VPYA 4TIMA 2Y78A 4M7TA 3CHCA 1YNQA 3CO4A 1K8CA 1F74A 3ANYA 1D6OA 4XISA 4ACYA 1FHUA 1LWIA 1OCJA 3GNDA 3BO9A 2BXVA 1PUDA 5FD0A 4BK9A 3S47A 1VCFA 1FWDC 5CG0A 4Y9MA 4O4VA 2J7HA 5FEZA 3W1TA 4IIHA 1XDLA 3K8LA 4NI3A 3W7GA 1A4MA 4E38A 4DIPA 3HMCA 1V3KA 4EP8C 3ISIX 1CLXA 1GZGA 3QY8A 5HMSA 3AXHA 2VWTA 5KETA 3EZ4A 2HEJA 1B3WA 3CAQA 5A3HA 3L67A 3VIGA 3O6DA 3MA8A 4OKDA 1E5NA 2JQXA 1V08A 4J2PA 7A3HA 1LDCA 3LZ5A 3KAGA 4GIEA 1E55A 3DESA 4ENLA 1IEIA 1R9XA 1U83A 1PVNA 2E5CA 3QHOA 2ZRYA 3CQKA 1TV7A 4LUSA 2DDXA 4F0LA 1LTDA 1R0MA 3CMFA 3THUA 2QDGA 2ZIDA 3VGHA 1W1ZA 3WUBA 5DBTA 1FX6A 2OWXA 4ADSA 3CS2A 3W9ZA 1C7SA 3MDWA 1Y8BA 4HPNA 1QPNA 3W27A 3EBVA 4ZB0A 3LMYA 1JCMP 4YTQA 4Q8MA 2ZX8A 3VABA 3EWDA 3C0QA 2KI3A 2GSEA 1TMHA 3NGFA 4LS0A 2Y7DA 2E67A 1US2A 4DLMA 1EL3A 2PA6A 5AY7A 3NPUA 2GGIA 2G0WA 5FJIA 5GNXA 2BTMA 4AZCB 5TBOA 4O16A 3VO0A 1UWRA 3U2OA 3EEGA 1UD4A 4GLEA 3LPOA 3BICA 3GH5A 1X8CA 3GH4A 3V5OA 4TTUA 3W29A 1AL7A 1UMLA 4NY2A 2QULA 3MI3A 4C60A 1CGVA 1JCYA 2CIPA 1FKJA 4ASTA 3EA2A 3PB2A 1H50A 3VNYA 4PCPA 2AKMA 3AJ7A 4CU7A 5LHFA 3CUZA 2AOSA 3FKKA 3CPRA 4PBFA 1V0KA 4ZS6A 1EWDA 2ALRA 3VUSA 4P7QA 5C8BB 1O5XA 5CG7A 3AS2A 1YTDA 1P1XA 1UH2A 1V6VA 2INEA 3R7MA 5AHNA 3O5IA 3O5JA 1EGMA 3DEQA 3NQAA 5ECUA 1VYRA 4PSPA 1C8QA 3FDGA 3NGJA 3BLPX 3WG6A 3EXRA 4NL1A 1BXBA 3SGUA 1P0EA 2E1DA 2QMJA 4HYVA 3F4CA 3GPKA 1UPMB 3OVGA 4ZBCA 5AC4A 4US6A 3T2OA 4G2PA 4R5EA 5I98A 3LI1A 3W6LA 1KC7A 4JYDA 3MWAA 4ORMA 2A2IA 4C6QA 1YXDA 2OZ3A 3DYPA 4DUWA 4QAWA 2OLAA 5DO2A 1HO1A 5I5RA 4D6HA 4PMOA 3T05A 4O54A 4UFJA 2J47A 3PPHA 1VFOA 1AH3A 3N9SA 2QCGA 1VJSA 1ODUA 1PBKA 2QAPA 1ISVA 5I0DA 1NELA 2GJRA 5JQ9A 2AAMA 5DMNA 1X39A 1CNVA 1P7TB 5C2GA 1RA0A 3I7RA 2RHGA 2ZUSA 2XTKA 3TYBA 1LLZA 1TG7A 4MGGA 4ZE4A 3WLPA 3KAFA 3MKCA 2VFDA 2VKZG 5KMYA 3ZR4A 4GO9A 3AQUA 2HMCA 2PU1A 3FV9A 2ZVIA 2V30A 3T2PA 1J01A 2CW6A 3S5SA 2R82A 4H8NA 3PBUA 1G7UA 4IMEA 3ZJ7A 2GGEA 3NSXA 3W2UA 5MF5A 1F3EA 3FVMA 1DBTA 2XVPA 2NSXA 1UJQA 1B9BA 4KBXA 5DIVA 2PWDA 4MWAD 1F4HA 3KZSA 4C02B 2ZRWA 4Q8PA 2EG6A 4IISA 1K8XA 1WE5A 3QKZA 2Z1XA 4IQJA 2D73A 2BY1A 2YA1A 3ABZA 1ZU8A 2CBVA 1JGMA 4MADA 3GR8A 4OOZA 2E3ZA 3H4XA 3PUDA 5EFDA 4B9ZA 2D0HA 2C16A 2BLEA 4EOUA 4JY8A 5FEXA 4IPNB 4LYPA 3CGNA 1XYZA 2IXUA 2VX6A 4HPJA 1JAKA 1EIXA 4IQ2A 4A8LA 4PUDA 2HK0A 2X2YA 3QC0A 2E9BA 5REQB 3W76A 1N82A 4EVZA 1Y5XA 4L64A 1W26A 2WMIB 1J0IA 2ZRUA 1I8JA 4GQ0A 2GVGA 1BKHA 4W5UA 1JXKA 5CKSA 2X30A 4AVNA 4ICMA 1ADSA 3PZTA 1TTQA 2NV2A 4BA0A 1JNEA 3PVFA 4U5IA 3LHTA 1XLHA 1AMKA 3TK7A 3PJWA 4O52A 2XZ9A 5JIWA 2WJDA 3D0CA 1G1YA 2NX1A 2WJFA 1FKIA 4TR9A 4DJFD 4AWTA 3AHXA 3WLQA 4YIWA 4KIRA 1FWIC 4LVFA 1VCVA 2VDIA 4Q8WA 1B31A 2XIQA 3MWCA 1ESWA 1I2NA 3WQOA 3PBYA 4BEUA 3NJ3A 3NO1A 3VIKA 3W38A 1PWLA 1HT6A 1VENA 3QJAA 4YTRA 3IJ6A 2J7DA 4F0KA 3MZNA 1GWJA 2E8ZA 2XP6A 2VEGA 3ITTA 4LYQA 1LL6A 3OJGA 2P0IA 3ANUA 2Z1VA 3BTNA 5C9XA 3CT7A 2ZUUA 4C6NA 5IFTA 4KR0B 2RFGA 4L61A 2CLEA 4RNHA 3OG2A 5EY5A 2A7RA 5FA5A 5C6MA 2XIJA 3DDMA 4JHZA 3IGXA 4MSSA 3OGVA 2BG5A 4GKLA 4HHLA 3WH0A 1SM9A 3T8QA 3EPOA 1G4SA 2MUCA 1HNYA 3COTA 4HGXA 2PD9A 3THCA 1RLDA 1C8YA 4EX4A 2HCVA 3AXXA 4ODOA 5D8WA 3IIPA 4O28A 2DUXA 3QR3A 1VJZA 1TCDA 4RNIA 4AU0A 2V5DA 3BMWA 2CWXA 2INZA 9XIMA 1JCTA 1TQJA 3NOEA 2VZSA 4HNTA 1QUMA 1EPXA 4ERAA 4WKAA 3ABSA 4M6QA 2Z6JA 4XG1A 4KWWA 1AJ2A 3RGCA 5DXYA 3GTXA 3AMDA 1F3TA 3S83A 4L4OA 3T0TA 3STGA 3UVIA 1F8AB 1DQWA 3IAQA 3XIMA 3C0LA 2VELA 1HGWA 4JIEA 1KCKA 3M43A 3UXDA 1W5NA 3LPPA 4IPIA 4DYEA 3PANA 2EPLX 2QJNA 4E4UA 2Y7FA 1VFSA 3VCCA 3M46A 5D37A 4LUIA 1RLCL 3AXKA 3NQBA 3R43A 3G6MA 1V3MA 1XYFA 5BRQA 1T40A 3THDA 3T6CA 3AS1A 1FKTA 1V0NA 2CZ5A 1NDZA 3A13A 2PWVA 3UCCA 4KT2A 1Q2SA 5BU6A 1KRBC 3NQDA 2QEZA 1WAUA 1SO4A 2A7PA 2UZ9A 1SU5A 2H90A 3LU2A 3O05A 3QV8A 3TN3A 1EPVA 1YKWA 3BC9A 3UNDA 4NKCA 1EFZA 1DWGM 4F0HA 1TQXA 3GUWA 3KACA 2IUZA 1ITUA 2A1YA 1M7JA 2ISFA 4DPQA 3EA1A 3TH6A 2WBGA 2CBIA 4UTTA 5CH9A 1QNRA 4JNMA 4ICNA 3IK2A 2OWCA 3UZJA 4QRNA 5GPGA 2GJLA 3EOOA 3LGDA 1FAPA 4CD5A 5AC8A 4IQLA 1Z6KA 4I7WA 2J88A 1YPXA 2FMOA 3LM7A 3W7RA 4KGJA 2F9RA 3UPBA 2HSAA 4GH3A 3LPFA 1OYAA 2NQHA 5KSWA 5AYXA 4BWLC 3KM8A 2Q09A 4J2MA 4B5VA 1CXHA 3REQA 3P14A 1CECA 1Q6QA 1PBGA 3ITYA 3LENA 2W67A 3C5QA 2RDXA 1JQXA 2GSHA 3UWZA 2GZXA 1VFHA 3IJ8A