1ZBE2

Foot-and mouth disease virus serotype a1061
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
b'DRLLTTRNGHTTSTTQSSVGVTYGYSTEEDHVAGPNTSGLETRVVQAERFFKKFLFDWTTDKPFGYLTKLELPTDHHGVFGHLVDSYAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKAFDTREKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVLSPLTVSNTAAPQIKVYANIAPTYVHVAGELPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
molecule tags Virus
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
total genus 41
structure length 207
sequence length 207
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zbe200
1FOD2 4NWWA 1TME2 2R062 2ZTNA 3J8F1 4BCUA 1NY72 1R1A1 2MEV3 3DPRA 1RUH3 1K5MA 4YVSC 3ZFEC 1AYN3 4CEYC 5ABJB 1FMD1 2IZWA 1VB4A 2ZAHA 2ZZQA 5JZGA 1PGW1 1PO13 1TME1 1AL21 5J96B 1AR93 3J8F2 2XPJA 1NCQB 1E57A 2R042 1HXS2 5BNPC 3JD73 1COV2 1RUJ3 1VBA3 4GMP1 1AL22 5ACA2 3CJIA 5BNOB 1RHI3 1HQNA 1RUD3 4FTBA 3VBFC 1VBE3 4N53C 1NOVA 1RUH2 1BEV2 1RUE3 1QQP1 4JGYC 3DPRC 2XBO1 1MQTB 1AL23 1BBT2 1TMF3 1OOPA 2WWSA 4Y5Z0 4CDWA 5AC93 1BMV2 2R071 4N43A 5C4WB 1FMD3 3VBHA 2R043 5BNNA 1NA1C 1ND2A 1RUH1 2RM22 1BEV1 4Q4V2 3HAGA 4GB31 2MEV1 3FBMA 4AEDB 1R083 1QQP2 4RR3C 5C9AB 4Q4W2 3ZFFC 2R072 1MQTC 2HWE2 3VBUB 3ZFEA 2RR13 1TMF1 2RM21 4WM8A 1NY71 1PIV2 4CDXB 2WZR1 2DF7A 1CJDA 5BNPA 4RS5C 1VBE1 4CEWC 3M8LA 1FMD2 1ZBA3 2HWE1 4CDQB 1VBC2 1EAH2 4RFT0 1ND3A 1VBC3 1TMF2 1RVF2 1OOPB 1C8M2 1R093 1H8TB 4QPGB 2WLPA 1MEC3 5A32A 1VBE2 1VBA1 1RUJ1 1NA1B 4PDWA 1VBC1 3VBFA 1EAH1 2RR12 1VBD2 1AR83 3ZFFA 1COV1 1QJX1 2QQPA 4RR3A 2HWB3 5ACA3 1R082 3ZFGA 5DDJ3 2RM23 1RUJ2 1VBA2 1ND3B 1H8TA 1PO22 1AYN1 1AR63 4WM8C 1CD3G 1RUI2 1IHMA 1OHFA 1R1A3 1NA1A 4JGZA 2HWC2 1BBT1 2WFF3 1AR61 2X5IC 3VBHB 3VBOC 1M06G 1RUD2 2RS33 1VAKA 1RUC1 4YVWB 1AYN2 1MQTA 1AUYA 5AC91 5C8CC 4Q4V1 5DDJ1 3VBUA 2MEV2 5JZGB 2HWD3 2R063 1HRI3 2HWC1 4Q4W1 1AR62 1NG0A 1F2NA 3JD72 3NAPC 4AEDA 1RUC3 3VBSC 5DDJ2 1ND3C 1OPOA 1PIV1 1D4M3 2WZR2 4IV1C 3VBRB 5CFDC 1VBB3 5A33A 3JD71 1RVF1 4CDXA 1C8M1 1VB2A 5BNPB 1NCRC 1HRV2 1V9U1 1VRH1 1K5MC 1GFF2 4GH4C 2X5IB 1VRH3 1PO11 5D8AB 2RR11 1VBD1 1QJU3 4N53A 2HWF1 1QJX3 1QJX2 3DPRB 1EAH3 1VRH2 1R081 4GB33 3VBFB 2RS52 1RUG1 1D4M1 1AYM1 3NAPB 5C8CA 1POV1 4NWVA 1PO21 2X5IA 1OOPC 2WS93 1RUI1 4IV1A 5CFDA 1WCDJ 4RHV1 4Q4W3 2RS51 4IV3A 1D4M2 2WZR3 4RHV3 4YVWC 2GH8A 2PLV2 1RUD1 4Q4X2 4Q4V3 1NCRB 1RUC2 1Z7S1 5AC92 1B35B 2RS12 1QJU2 3NAPA 1RMU3 1AYM3 4QPIA 1BBT3 2WFF1 1RUG3 4CDQC 4JGYB 1QJY3 1HRV3 1RUE2 4CDXC 1BEV3 1PVC1 2RMU1 3TN91 2HWF3 4N43B 5LK7B 1AR71 1F8VA 2WFF2 4PDWB 4Z92B 4WM7C 4FTEA 1NCRA 3VDDA 1V9U3 4RR3B 5C9AC 1RUE1 1AL0G 5CFCB 2RS13 4CEWA 1HXS3 4RQPA 4YVSA 1PVC2 2RMU2 3TN92 4CEYA 1COV3 1PVC3 2RMU3 3JBG1 2GSYA 4JGZB 4Q4X3 4Q4Y1 1AR72 1HRV1 1RHI1 1V9U2 5CFCC 1ASJ1 4QPIC 4WM7B 1HRI2 1PO12 5K0UC 4SBVA 4WM8B 5D8AC 2HWF2 4GMP3 1PGL1 1B35C 1RUF2 3JBG2 4Q4Y2 4JGZC 4CDQA 1H8TC 2RS53 4YVSB 4CEYB 1ASJ2 3VBOA 1RUG2 5BNOC 2BFUL 1AYM2 1AR91 3ZFGC 5FMOL 1X36A 1RUI3 4IV3C 1POV3 5A32B 1EV11 5C8CB 4RS5B 4WM7A 4RHV2 1FPN2 1ASJ3 1K5MB 4CDWB 3IDEA 2HWB2 2PLV1 3JBG3 4Q4X1 4Q4Y3 5C4WC 5K0UA 5FMOS 1ND2B 4IV3B 1Z7S2 4CDUB 5L7OB 2RS11 4GMP0 5D8AA 1QJU1 2R073 1ZBE1 4FTSA 1QJZA 1X33A 3VBSB 2XBO3 1ZBE3 3ZFEB 4CDWC 1AR73 2BFUS 4RQPC 1QQP3 4EJRA 2BBVA 3TN93 4FSJA 1C8M3 3VBOB 3VBHC 5BNNC 1RVF3 5C9AA 3VBUC 1NCQA 1QJY1 5CFCA 1VBB1 1SMVA 3VDDB 5BNOA 5FOJB 4CEWB 3S6PA 1RMU1 4N53B 4GH4B 4N43C 2FZ2A 1EV13 1DDLA 1PIV3 1RUF3 3VBSA 2RS32 1QJY2 3JB4C 1RHI2 1ZBA1 2HWE3 3LOBA 5K0UB 1FOD1 5ABJA 2HWC3 3ZFFB 4CDUA 5L7OA 1ND2C 1RMU2 2VQ0A 1R1A2 1HRI1 5C4WA 4IV1B 4QPIB 2HWD1 2FZ1A 3VBRC 2WS91 5J98B 1RB8G 1PGL2 2RS31 1PO23 4QPGA 1RUF1 4LLFA 1PGW2 2Y26A 1NCQC 4GH4A 5A33B 4PDWC 2HWD2 1AR92 3J8F3 2WS92 5JZGC 5BNNB 2R041 3CJIB 1HXS1 4RS5A 1VBD3 1EV12 1C8NA 1FPN1 2BPA2 1MEC2 5ACA1 1R092 2HWB1 4CDUC 5GKAC 5L7OC 1FOD3 5CFDB 1AR81 2PLV3 5ABJC 1ZBE2 4RQPB 1MEC1 4YVWA 1R091 2XBO2 1A6CA 1BMV1 1Z7S3 3ZFGB 3VDDC 1AR82 2BUKA 4Y4YA 1VBB2 4JGYA 3ZXAC 4AEDC 1W39A 4GB32 2R061 4QPGC 1B35A 1TME3 3JB8A 1FPN3 3CJIC 3VBRA 1HX6A 1POV0 1ZBA2 2TBVA
chains in the Genus database with same CATH superfamily
1DGWX 4F3JA 3WDXA 1GYKA 3BIEA 2CYFA 3WP3A 4UAPA 1DZQA 3RYKA 4K8FA 3DPRA 1K5MA 1X9PA 3ZFEC 2UYAA 2ZMLA 4C1XA 3AKTA 2DUPA 1DP0A 1RGSA 1I3HA 2AH2A 3DKQA 5KWRA 2IZWA 1JOJA 4HPKA 4D6QA 1S55A 4L11A 1DIWA 3R4UA 5GZFA 5FZFA 4LJHA 3NRUA 5FO7B 4YW7A 3AXDA 1CN1A 1CVNA 2XPJA 3PJQA 3NW4A 5LBCA 2R7EB 1N3OA 1NCQB 2VQTA 2XR4A 4FO9A 5F2SA 4D8MA 2DU1A 2R042 3MPPG 5EJ1B 4BM8A 1SLIA 3T3YA 3JD73 4LHLA 4LPLA 1EPWA 2Y6JA 2OYZA 4YZ5A 4OZXA 4XZUG 3KVAA 4QX5A 1AL22 5ACA2 1JOPA 4FOVA 4NE9A 4B1LA 4Q0PA 4JV4A 1VIWB 2BVBA 3KQRA 3ITQA 3K2OA 1IS6A 1MS8A 1UWWA 3D6EA 2RJ2A 1W8WA 3HN1A 4YARA 5BNOB 2ES3A 4QX3A 3ZXKA 3D8CA 2Q30A 1MS3A 4HETA 4YGDA 3THPA 4XCBA 3TEXA 4IEQA 5I93A 1JZ5A 1IPJA 1REEA 2ADDA 1QJFA 3FHAA 3NNMA 1VBE3 3P3PA 1NOVA 4JDOA 4QKBA 3RWKX 4NJ4A 1OLMA 5T54A 3ZR6A 3T1MA 1LODA 3I2KA 5JSOA 3HQUA 2W1UA 3IDCB 3WINE 2TNFA 4RA0A 2JG9C 1MQTB 4LOSA 4CDWA 1BMV2 3H0OA 1OQ1A 4RGKA 3J7NA 3D5OA 2FDIA 1XSQA 1HLCA 2VMIA 4M4RA 4RSUA 1SG3A 1OKQA 4QX2A 1BEV1 1H0BA 2JE8A 3VZJA 5IHRA 3HAGA 2BGPA 3FBMA 4X8PA 4AEDB 3NKTA 5EZWA 2OPKA 5D2AA 3KSCA 1UN1A 4PF1A 5T5JA 5C9AB 5CBLA 3D4KA 4NRQA 2R1DA 5FRAA 2GMPA 3B3QE 1L3JA 4MYEA 2XWJB 3KT1A 1ULGA 1LGBA 1M4WA 3OEAA 5F5CA 1X7NA 3VLBB 4LBLA 4LITA 4XOGA 4Y1VA 1DFQA 4DQAA 1JYNA 3DECA 2R16A 5DZGA 2ZGMA 4K9SA 1E5SA 1QXPA 3SH5A 2IVJA 4QX1A 4WM8A 1O5LA 1ZX5A 3PUQA 1NY71 1SCRA 3FMGA 1VALA 2VAUA 2WZR1 3WQBA 1YFXA 2YV8A 4BQ4A 2XJUA 4QDQA 1FMD2 1ZBA3 2HWE1 3OUHA 4CDQB 4GALA 4RFT0 1NQJA 5FUIA 5FUNA 1HB2A 2WT1A 1TMF2 1LHOA 1RVF2 2CDOA 3AYCA 3BGAA 3PMEA 3ZSKA 5DZEA 4YW5A 4DUXA 2TEPA 1NXMA 5T3NA 3ZSMA 4AI2A 2XLAA 4H14A 3PUHA 4I09A 4BJ0A 2NYYA 1MEC3 3AKSA 3LEGA 5A32A 4XCAA 1D2SA 3WW2A 3BODA 3GNEA 3USUA 2K46A 1IQDC 3A0KA 1VBC1 3PUSA 4WV8A 2CGOA 2GZWA 5EPAA 4XIOA 1WMFA 3ZFFA 2ZHMA 1JZ4A 3ZMNA 3WG4A 5FZOA 1CIWA 4DO0A 4AVAA 1WCUA 3VDCA 1UZ0A 2PHWA 4RR3A 3B5LB 2HWB3 4ASKA 5GJ6A 2PAKA 3ZFGA 5FO9B 2VM9A 4H55A 1H2NA 4HK9A 2QQVA 2W08A 3IT8A 3O1UA 1T6GC 1NAEA 3WD5A 2W1QA 1H8TA 2VOTA 4GKYA 4YGCA 4PIYA 3AZXA 4QQPA 1YJKA 4I02A 4MSVA 1XNCA 4CPBA 3AZVA 1RTVA 1OHFA 5DG2A 2J1RA 3H50A 1NA1A 1SLTA 2JDMA 2WO1A 1O3QA 2O14A 5EXOA 2EXKA 3OSDA 2WLQA 4UFIA 3VBHB 1PHMA 5DAVA 2LW8A 3MIFA 5EJZB 1NZCA 3MFCA 3SISA 1PMHX 1UYPA 2RS33 5CIRA 1RUC1 2C1FA 2XHKA 2KXLA 2VJXA 3ETPA 4YVWB 3I2DA 4JZRA 3O7OA 1JHNA 1NT0A 2XJRA 4QKDA 2GH2A 4Q4V1 3O14A 2X05A 3VBUA 1N1TA 3HD8B 3I97A 3Q8EA 3O1MA 1O8PA 3PTRB 2R063 1SQ4A 4JKMA 2AC1A 4YGBA 5JCTA 4Q4W1 4K6BA 3MGUA 1QGLA 1RINA 2E51A 2B9UA 3WG2A 3DV8A 4AVVA 1LULA 1CZSA 3N9QA 3WQ7A 1SFNA 3JD72 1WW7A 3WR0A 3CJXA 4KGQA 4AEDA 3SHRA 1HDKA 5DDJ2 5FY0A 2XMLA 2QNKA 4FPHA 1PIV1 2KM2A 3SH4A 4IE7A 2C24A 1CX4A 1W0OA 2VUDA 4IEPA 3P5BA 5HV0A 2CU5A 3NNJA 2ETEA 4FAGA 1W2AX 2D6MA 1DHKB 4QXKA 3U75A 4AE2A 3WQ0A 2A6XA 2CWMA 4YG0A 5EFUA 1RL3A 5FJHA 1TEIA 1ONAA 4OZOA 3SCGA 2BGOA 4OLLA 3KT4A 4FOWA 3UT0A 4UYBA 2WABA 3I4IA 2DFBA 4A4AA 4MGIE 5FYCA 3OJBA 3GGLA 4D6SA 4CCMA 1MS0A 2X5IB 3B9IA 1CAVB 2D6KA 2Y33A 1JH5A 3CQOA 2QUOA 4F8AA 5JI9A 4B4QA 1WD3A 2LM3A 3B01A 1VBD1 1W99A 1QJU3 3IWZA 4MO3M 4N53A 4DS0A 5SV5A 3E5QA 2EIDA 2JIGA 5FLHA 2YXSA 5IK5A 4XW3A 1ULFA 1W3XA 2Y6LA 4BZ4A 4J6GA 4LQRA 5KXDA 3U10A 1W6PB 1JN2P 2OS2A 4FXGB 3IDAA 4IE6A 4FPOB 4JDMA 5CVRA 1RJ7A 3I2GA 3TNPB 4EN7B 1G9AA 1AYM1 3FC0A 1PMJX 1J59A 2NPIA 2MNGA 3NAPB 4L99A 1PO21 3POIA 2W0XA 4NIHA 2X5IA 2WSUA 1H2MA 5H9QA 4M0NA 2BV4A 2GDFA 4ZPIA 1RUI1 2VTXA 2SLIA 2VY0A 4IV1A 3EHKA 4BHPA 3E6CC 3IM0A 1IZ3A 1WLWA 3ZYPA 2YC4A 4PI2A 2RS51 4EQVA 1V6NA 2JDNA 1RITA 2LROA 4INDA 4FPGA 4KGGA 2VCCA 1MACA 3PJYA 4Q4X2 4TN7A 4IGOA 2BVVA 2Y0OA 1DLCA 4XVHA 1WBLA 3A0NA 3BPZA 2RS12 2RG4A 4JQRA 5IAVA 1YLLA 2PHTA 4DUWA 5A1AA 1Y9MA 3FHQA 3NAPA 4JHTA 4XABA 1RMU3 4CZSA 3J7HA 3KGZA 4QB2A 2ARXA 4AFAA 4IDZA 1GU3A 5HPOA 2JEMA 1ULOA 2D5FA 4YPJA 2B8MA 1HRV3 4ASMB 2BU9A 2D6LX 3W5NA 4HKWA 1FT9A 5L73A 4XFIA 5IVVA 1ZRRA 3PURA 2WRAA 5FQ0B 4DY5A 2HWF3 4YW6A 5LK7B 4Z1VA 3S57A 1AR71 4LOTA 1PX4A 1POQA 2VZ3A 4GULA 4PDWB 3OYWA 4B4PA 4CUAA 3LKJA 4TSVA 2X8KA 2OVUA 3JZVA 1KQRA 1IPKA 3VDDA 4P9LA 2YBSA 4TYSA 2W9XA 4RR3B 2VZRA 3GHMA 1JYCA 1DF0A 2RMU2 4ITCA 1COV3 2R30A 2YFZA 5IVFA 3ZYRA 1CAWA 4XQ4A 3POGA 5FP3A 1X9TA 2B46X 2W46A 3INAA 1HRV1 1WKYA 1X8EA 3VB9A 3AJZA 2Q1MA 4CP0A 4B7EA 2W68A 5CFCC 1R1ZA 3RZJA 2QQJA 4ZU5A 5FTTC 1N1YA 1XNBA 4EWEA 2PMWB 3VD4A 5SV8A 4ORFA 5FBJA 1QNWA 5ISLA 5D8AC 2W1WA 3JQXA 3JU9A 3U14A 1HJFA 3VDBA 1B35C 4Q4Y2 3K48A 5DQ0A 4N9HA 3KV4A 2C26A 2PHFA 2XJPA 3IB3A 3LDRA 5LRRA 1QIQA 4HKLA 2YB7A 3FLPA 1W6NA 2IXKA 3POBA 4CSWA 5FK8A 4CRQA 1AR91 5FMOL 3ZSLA 4XJZA 1C5IA 4IV3C 1RUI3 1AJKA 2X09A 2UWAA 2ZGTA 1O5UA 4KWJA 5T55A 3SEPA 1OC1A 4W6YA 5F5QA 4AG4A 2ZZJA 2ARAA 2E9QA 2J1UA 3POSA 5FY8A 1EV11 4QXHA 4D7YA 5C8CB 1FPN2 4Q0SA 4K20A 1AXKA 4UFMA 2D5HA 2E7QA 5F32A 3OOXA 3VHNA 2YFUA 4H2AA 4AVSA 2AYHA 1W8UA 3N9PA 2VZQA 3K77A 5K0UA 3WVJA 3A23A 1REDA 1Z7S2 2EIGA 4ZONA 5L7OB 5GLTA 3IMMA 1FYUA 2D3SA 4GMP0 5D8AA 2BTVC 3RG0A 3ZXEA 3IKWA 4LKFA 4OUSA 1QJU1 5GZEA 2Q8DA 4KG0A 1QJZA 1B09A 4UFJA 2OQ6A 1XNDA 4A7KA 2XBO3 4Y22A 4O65A 4BYYA 1AR73 2B5HA 4MHRA 3ELNA 1LOFC 2JG8C 3N4MA 1JZ3A 3VBOB 2ARBA 2HYKA 2WNOA 3IPVA 4IGQA 5T50A 4DNYA 1ZZ8A 5C9AA 2WT0A 2VW0A 1H4GA 4QM8A 5CFCA 1LR5A 1VBB1 2F4LA 4DMIA 1H4HA 1RJ8A 1ZZ6A 4MZUA 1SFYA 3ENRA 4AHYA 3T09A 1UF2C 4XF0A 1WD4A 2JD4A 4I3GA 2GN7A 1RMU1 2VBBA 3OGJA 4N43C 4OCTA 3WG3A 4BIFA 4F7ZA 4MOAA 1PIV3 3GHNA 4OI2A 4EN0A 1FATA 3PLQA 1CZTA 1RUF3 2XONA 3E5UA 5T52A 2UURA 4NR1A 5CA6A 1QJY2 3O1TA 3A4UA 2V72A 5FDBA 3AZYA 2EIBA 3PVBB 1QEXA 2PYTA 2VVDA 3USUB 5C6CA 2GC3A 3BN6A 1QOOA 1W8ZA 5B4NA 2WAAA 1YXWA 1UZVA 2HEYF 4IV1B 1VJ2A 2QVSB 4QPIB 4RN5A 4UI9L 3RDIA 2W92A 1UZWA 1U5IA 2WO2A 1HB4A 3OTFA 4IEZA 4IL7A 3TBDA 4EE2A 4O9GA 5D21A 1PO23 3H3ZA 1NKGA 4CPBD 1SDDB 2HBTA 2WN3A 4YZ1A 1S0DA 3MUY1 3WF1A 2Y26A 2HEWF 1BCXA 3ZXLA 1SPPA 2BWAA 5A33B 2PQQA 3R4DB 5KR7A 5TSWA 2P34A 3NJXA 1LOFA 3LIGA 4HFSA 4CUGA 5F37A 1O3RA 1DQ1A 4Q5OA 5GLUA 3WCSA 2R041 2DFCA 4RS5A 3WHUA 1VBD3 2JDZA 3THDA 5BYNA 2OUHA 2WQZC 2EICA 1QMJA 1C8NA 3G7DA 1MVQA 1TG7A 1W8FA 1D7PM 5ACA1 2HWB1 4KH9A 2Y6HA 4QXBA 5JOYA 4WZCA 3T4HB 4ZZ5A 3NNFA 4I0WB 3I54A 4HXCA 1UMIA 3OEBA 2PLV3 3NV4A 1HQLA 4RFRB 5E88A 4FPCA 1MS1A 1W6OB 1XB9A 3LA2A 5DUUA 4DB5A 1A34A 1OA2A 4Q0VA 1OH4A 1NLQA 4YVWA 1R091 2ZX2A 2IC1A 3BI3A 3WUDA 1A6CA 1DU3D 1MVEA 1NLRA 4WZFA 3KWVA 1BMV1 1Z7S3 1SEFA 2W52A 1YQ5A 5T5OA 1L7LA 4XUQA 3ZFGB 3V0BB 2AACA 3NJZA 2DUQA 2YHJA 3M2MA 4JGYA 2O1QA 2Q5TA 3DXUA 5IFPA 1UOJA 2JDPA 5E89A 1W9WA 2ZXQA 2E32A 1CJPA 1S0JA 2R061 5IJRA 4XQDA 3ZYFA 1E5HA 1US3A 3X29B 3ZIXA 2D6OX 1DQ0A 5HCHA 2HBUA 4QPGC 3HJRA 2A5ZA 1UZZA 1TME3 2QQKA 2YROA 3LF7A 3CJIC 1CQ9A 1KD7A 3R05A 5LBBA 3OPZA 4Y20B 1POV0 1HB1A 1J3RA 1CWPA 1ULPA 5FKBA 1F31A 2Q8EA 1FOD2 2BYVE 4LBJA 4NAMA 1VMFA 1JI6A 1TME2 3LOIA 4GQ7A 1NLSA 1NY72 2CNAA 4CUCA 2MEV3 3N7MA 4QB6A 1YEWA 1SLLA 3HNBM 1LOGA 1GICA 1RUH3 1BVVA 3NJVA 5ABJB 1FMD1 4NHKA 3P6BA 3GZTB 3T2TA 4GWIA 2YDEA 1PGW1 4Y22B 4HG6B 4BK5A 4OYUA 4R4XA 4Y1UA 3U4SA 5J96B 2FQPA 3OGVA 4BA6A 1AR93 2V4VA 3HNYM 3J8F2 4R8HA 2MHFA 2OA2A 4Y24A 3IPVB 3ALQA 4A7YA 2W5FA 1CIYA 5A3PA 4LO8A 2F17A 1E57A 4AQ2A 5BNPC 1S1AA 4LTAA 2AEYA 5F3GA 2Y8KA 1O4ZA 3POEA 5F5IA 3AMHA 1G9CA 1UY4A 4X6RB 1QF3A 4XTMA 5B2GB 4QKFA 4EWDA 3CZJA 1AZDA 4K8RB 2I07B 4ASLA 2GMEA 4BXFA 3N36A 4XUOA 4E9KA 4RYDA 2W2IA 4JHZA 3MPBA 3UL2A 4A6SA 5DXDA 5JLVA 4FTBA 2G9GA 4IW3A 1RUH2 5FPZA 2A1XA 3TEYA 4M01A 5L19A 1SHWB 3WP5A 3FUQA 3O1RA 5LY2A 2WKKA 1WUVA 1SLAA 4M3CB 1J3QA 3POJA 3DGTA 4FBFA 4N43A 2WQ4A 3U11A 4ZS2A 3FX3A 2KD7A 1D4VB 3HEIA 4LUKA 4YZ4A 1MZEA 1YFWA 1ND2A 3HWJA 2IFWA 1YQ6A 2RM22 4YRDA 4LO4B 2OW4A 3KQ4B 4Q4V2 4XJ8A 5IVCA 1QQP2 1UO9A 4QQHA 2AZ5A 2BQPA 2VZSA 4LE3A 5FZ6A 3MF9A 4YM3A 3V0BA 2V5YA 3MV11 3RJRA 4Q4W2 1BVP1 2VULA 4URTA 4ARXA 3VD9A 2R072 1MQTC 2A3WA 3K46A 4MADA 5LATA 3VBUB 3AVRA 1UIJA 1O7FA 2VCAA 1H9WA 3HR9A 4Z8BA 4RD7A 4XFAA 2WL1A 3ZDVA 1PIV2 4CDXB 4B1MA 1JW6A 1VPHA 5A3NA 5BNPA 1N47A 5I91A 1VBE1 4W65A 5FBZA 4JRLA 4R52A 3I49A 1EAH2 4GZ9A 4AAXA 2X10A 1F4HA 2PFWA 4IXLA 4AZZA 4IQPA 5EYXA 4D6RA 1C28A 4AGRA 4RGGA 2GC0A 3VKLA 2XQXA 1JYVA 1QH6A 1WWYA 2HKXA 3BOWA 2LRPA 1UX6A 2WIIB 4AL9A 5J7MA 4QPGB 4IEOA 4HT1T 4QAWA 2JX9A 1NA1B 2QJVA 3LB9A 1VRBA 4KG8A 4PDWA 2ZEZA 1DQ6A 3BVCA 1DGLA 2PN5A 1VBD2 1KJRA 2ADEA 3OD4A 4WBBA 1Z0HA 4WVWA 2VW1A 1XE7A 3OBZA 3MLKA 4IE5A 1BYHA 1W9TA 5JOZA 2XUEA 3AKQA 4K1ZA 4KMQA 1RUNA 1V00A 5DDJ3 5GLWA 1RUJ2 1VBA2 4ZY9A 4Z2WA 5T5PA 5F3IA 3I59A 3AYDA 3WW1A 1PO22 3I2IA 4Y5SA 4QM9A 2VL4A 2NZ9A 4WM8C 1CD3G 2ZGKA 1RUI2 1IHMA 1GV9A 3QLQA 2D3PA 1CAUB 1QDCA 3QD6A 5F5AA 1UY0A 4QGNA 2C5DA 1BXHA 4JGZA 5CB7A 3V65A 5JR2A 4LE4A 4HZFA 1GSLA 1KFXL 1BBT1 2WFF3 1AR61 4R9CA 4XMIA 3WP4A 5IATA 2R0HA 1N1SA 3LEIA 2W1SA 5JSRA 5LZ6A 1BQPA 1MZFA 1VAKA 1ZNPA 2VTXJ 3GBGA 4MV2A 1DZRA 1AYN2 1G8WA 3ME2A 1MQTA 3RQ0A 3RYPA 2RJLA 4LKEA 4EYUA 3CL1A 4LMFA 2ZGUA 4OHWA 3KZ4C 5FYSA 4J25A 3OG2A 3WF3A 4YZ2A 3SMHA 3LPFA 4XUPA 2HWD3 5BXXA 1GNHA 2HWC1 4SLIA 1O3SA 4FAHA 1AXZA 3T0AA 3TB0A 1HIXA 5JVVA 3TRSB 1LENA 4OHXA 4QPWA 1NG0A 3RI8A 5JAXA 5IW0A 3R6SA 1RUC3 4HOOA 3MIGA 3VBSC 1OLRA 1DYPA 1GZCA 2O8OA 5C7GA 5I0DA 1ZRCA 1W05A 2ERFA 2WNVA 4IUGA 4IV1C 2WFPA 4CP9B 1UXZA 5J09A 1RC6A 5E1RA 1VMJA 5K8SA 4BMBA 1NXD1 3RNSA 3M3QA 1K42A 2JJ6A 1SPPB 3WNXA 1HN1A 3K4ZA 1QU0A 1G86A 4MGTA 4CDXA 3RZZA 1C8M1 3UGGA 4N90A 4XC9A 5BNPB 2H6CA 1MR5A 1HRV2 1LEMA 1VRH1 4IERA 1DLLA 4IESA 2QFEA 3WDTA 4OUEA 3FE5A 4FPFA 1VRH3 5FYTA 2EIEA 2J42A 1W2OA 2RR11 1JHJA 1UYXA 4OHYA 2JB8A 5JXHA 2VUJA 4I0AA 4JKLA 5HCFA 1W9FA 4QU1A 4UWDA 3SH3A 3UJOA 1JYXA 1KDMA 1QXJA 5C33A 2DCTA 3M1HA 4XJWA 4S2DA 4LUMA 1Q8OA 1FV2A 3GYDA 1WMDA 5LK5A 4UFHA 1GLHA 1R081 1X50A 2ZOEB 3DYPA 4GB33 4JX0A 4XAEA 5A7OA 3GBFA 4I3PA 4V2VA 1XYOA 1OKOA 4COVA 4R9AA 1S0CA 4NWVA 2ORZA 3VHPA 3GBWA 5FO8B 3VKNA 2NM1A 4Z07A 1W8OA 2IXHA 3OB8A 3K3OA 4XFHA 3KB5A 2P3IA 2ILMA 4IV3A 2XXZA 3ETQA 1D4M2 1OT5A 2WZR3 1X82A 4RHV3 2W91A 4JDNA 4DUVA 2GH8A 2XLGA 1RUD1 3OD0A 5L36A 4Y3OA 1CAXB 1UOFA 5CISA 1Z7S1 3A7QA 4W6XA 1IG3A 4PQ9A 1QJU2 4FPJA 3C7HA 2Q4SA 1BBT3 2WFF1 4PIXA 3HBZA 1RUG3 3BTAA 4FFHA 3I8TA 4P5YA 2VMHA 3AC0A 3ACIA 1HV1A 1ZM1A 3DL3A 3KHBA 2UYBA 3MHZA 4GD4A 4JGYB 4K7JA 2BW8A 4LBOA 4OHVA 1RUE2 5A1FA 1BEV3 1YQ2A 3ZR5A 4FOQA 4RL7A 5FPLA 1S2BA 2DVFA 3N9OA 4L0PA 3SLIA 4K21A 3TN91 4AI8A 5FY7A 3G6JB 4B4RA 3DYMA 2BGCA 4A7ZA 1MZ5A 1W0PA 2ZGLA 4C91A 2D6PA 4AWDA 1YFUA 2BERA 1PMIA 2OXBA 4AGGA 4F83A 5I0RA 4DRRA 4NHMA 4AI0A 4ZHNA 4Z92B 2E31A 1S4CA 3FUOA 4NPRA 1V9U3 2O0OA 3Q8FA 1DYKA 1PZ7A 2DCKA 2Y6KA 3CNAA 2DCYA 5CFCB 2AENA 2RS13 2WC2A 2D7FA 3WNMA 4OFGA 2C6SA 4RQPA 1PVC2 5FP7A 4CEYA 1SDWA 3W58A 1PVC3 3JBG1 4JGZB 4Q4X3 1HKDA 4GJZA 3NNGA 1XXNA 3WNKA 3NL1A 3ZN6A 4Q27A 1V9U2 2WJSA 3CLPA 3ZLIA 4UF0A 2GNMA 1ASJ1 1LHWA 1Q8QA 3I3MA 4XUTA 1G9BA 2IXCA 1E5IA 3BB6A 2VCBA 3ILFA 5CG9A 4QKNA 3NWKA 3VKFC 1H2LA 4AEKA 4CUBA 3ES4A 1U0AA 1J83A 3KCXA 2QTWB 3Q9OA 3SKVA 4CEYB 5FPUA 3T4VA 1O59A 3M3OA 4AVCA 4GA9A 3C3VA 2K9ZA 3VBOA 1YQ8A 3O0VA 4ZKTB 1RUG2 1CZVA 3U07A 4X6QB 5A1LA 1O4TA 3ZN6B 4AK3A 4AVTA 2ZX0A 1FX5A 2HEVF 2MPFA 2UU8A 1X36A 4Q2FA 1XQNA 4XJAA 1BKZA 2W39A 4PBPA 2NQYA 1UMHA 4QX8A 1QOTA 1POV3 2WNVB 5HXVA 2E63A 5JXJA 2CHHA 2PELA 1REFA 4CP9A 1JZ7A 2VECA 3EYPA 5FXVA 2WWUA 2ZACA 2XVKA 4WM7A 2V09A 4RHV2 3V64A 5JWPA 2YGLA 4CDWB 4AEMA 3OGGA 4QQOA 3WNPA 1W2NA 1YIFA 3PNAA 4QX0A 3AZWA 2WZ8A 5I0TA 4CU8A 1TNRA 1Y3TA 3OUIA 2EXIA 3IDEA 2HWB2 2PHUA 3VN4A 1WCQA 1BHGA 3RFRA 1J1LA 5AVPA 1U5ZA 5FMOS 1GWMA 1O91A 2J1VA 3KV9A 3H8XA 2DVGA 1C4RA 2A70A 3KT7A 1F5FA 1X33A 3VBSB 3U4XA 4XPVA 4CDWC 5F6LB 5M0TA 3ZN5A 2QDRA 2UWBA 3N7KA 2FDJA 1OFSA 4U2AA 1GKBA 2B42B 5IK8A 4FSJA 2VNGA 5FPBA 1RVF3 3MZHA 2R32A 2W3JA 5JI7A 4ATEA 2FCUA 1IGOA 1JBCA 4OMDA 5HV4A 1GP5A 5FMDA 4CEWB 3ST7A 3BU0A 1EV13 1XYNA 1PX3A 2QBXA 3M70A 5HBAA 5A7WB 2DVBA 3WDYA 3VBSA 2RS32 4HN0A 3MF6A 1V6MA 3JB4C 1RHI2 4YZ3A 1FOD1 4ISQA 1LTEA 4CDUA 3B02A 4UOJA 1US2A 2GC2A 4LBMA 3VDAA 3JUUA 5FY1A 3RGBA 2WS91 1PGL2 2XVLA 3IIAA 2Q0AA 4HSJA 4QPGA 3BALA 1W8NA 4YW4A 3QOPA 3WF2A 4EN6B 1GBGA 2YU2A 3FL7A 3APBA 1PGW2 2QQNA 1F15A 3MIDA 1NCQC 4GH4A 2PHLA 1CPMA 3ZDSA 2VW2A 3AP5A 2HWD2 2Z5WA 2A75A 3H1WA 4YFWA 1H9PA 2LS6A 3UKVA 4P9WA 3PIJA 4WVZA 4XFGA 3I2HA 4XXPA 5BNNB 1K5JA 2WUHA 2LTNA 2BBAA 1AF9A 2GNDA 3CJIB 3K51A 3LSDA 4NPLA 4S2GA 1EUTA 1XU2A 4ZXEA 3USSA 1D0HA 2RHPA 2ZX3A 2JECA 4MX3A 3LFIA 4P08A 1DYOA 3I59B 4LKSA 3MBWA 4KNCA 1MEC2 4CCKA 3JQWA 2XHNA 2YBPA 4BDVB 1OI6A 4CDUC 1KXGA 5GKAC 1RIRA 2DBIA 1UCXA 2P6HA 3WNNA 2ET1A 3W9AA 1KS4A 2XLFA 1IS4A 2EF6A 3AP7A 4MG2A 4MXVA 1AR81 2Z69A 1OVPA 3H1MA 3OF1A 4TTGA 3WLUA 2IXIA 5JMCA 4Q0UA 4RQPB 1UX7A 4DFSA 2HYXA 2GP5A 4YW2A 4A2UA 5JOXA 2CDPA 4WVMB 3IDBB 2VO5A 3AJYA 5C8WA 2ZMNA 3KGLA 4D7TA 4UF0B 5LB6A 3ZM8A 4Y1XA 3UYJA 2Y6FA 3AMQA 5FYYA 3T2OA 3VDDC 4KU8A 3U0ZA 2G19A 1LOCA 1LOAA 4AFCA 3RZGA 1S2KA 3OUJA 5L9VA 5KHHA 3MEPA 3ZXAC 3MW2A 1W39A 2OX0A 5EHDA 4AGVA 2PAEA 3M3IA 1J84A 4LIUA 5FYMA 3FBYA 2OPWA 2VZOA 3PUIA 4E27A 1CGPA 1XSRA 1PK6B 4LR4A 3RJ2X 4DZGA 2VUCA 1G6NA 4URAA 4UFLA 1BJQA 2A3YA 2XDVA 1W6MB 3HVDA 4BQ3A 2R1BA 4XF3A 4W4ZA 4HSLA 5FY9A 4FQ4A 3WCRA 4FOYA 3VHOA 3PHMA 2G9ZA 4NWWA 4YSFA 5IUQA 1SLBA 4BCUA 3TAYA 3B93A 5JPMB 4YVSC 1S0GA 1AYN3 2FDHA 4LBQB 1JZ6A 1K3IA 3POWA 2IXLA 5C5UA 3EMRA 4ZZ8A 2ZZQA 2P2KA 5JZGA 3TEZA 2WNVC 4XJ9A 5DPNA 1UAIA 5CKMA 5EYYA 1QY4A 4QQ2A 3GXUA 1AL21 4AAPA 3KHCA 2QE3A 3KD4A 2CAUA 3M3CA 2VZPA 1K45A 2XGXA 3DUIA 2JXAA 4LBQD 2JB4A 5HCAA 3AP9A 1DG6A 2ZA9A 3C7EA 5KBFA 2QQIA 4D7SA 4QU2A 2XUMA 1TVGA 1HXS2 3H3UA 1RXGA 1ULEA 3KCYA 5T5LA 1TE1B 1XU1A 1RUJ3 1VBA3 1IG0A 4ZU4A 4IETA 5LRSA 3ZXDA 3WW4A 1MPXA 1QHDA 5FJKA 2WZEA 1OBNA 2JG9B 3CJIA 4FVVA 4HONA 4GAZA 3UNPA 5IK7A 3C2UA 2ZGRA 3LDBA 1D0GA 1A8MA 1JYIA 3AX4A 1GWLA 2OQ7A 1RUD3 2ZS6B 1XC6A 1OMIA 2DTYA 5FY4A 3MLJA 5A7PA 1N3QA 2QKDA 3GZAA 3VBFC 3ZPYA 4N53C 1T6BX 2C4XA 1RUOA 1BEV2 2XKPA 2O8QA 1RUE3 2XOMA 5EWSA 5FYUA 3MI8A 3PIGA 4M0HA 4DIQA 5JXIA 3NQHA 3DPRC 4NPMA 2XBO1 1FI2A 3KF3A 3NV3A 4QMAA 3ZSEA 1EPZA 4XBLA 3RPQA 1BBT2 2WWSA 4FPKA 5FYVA 1I9RA 3UKTA 2IVIB 4JVAA 1SACA 2EAAA 4Y26A 1ZA4A 3AFKA 2XJQA 4I30A 4B7KA 4YFZA 3VBHA 1XNAA 3O12A 3RI9A 5IT6A 4WVMA 5FZCA 3UK9A 5IAXA 3H8OA 2B4KA 5FZ3A 4AW7A 1GP6A 4B8EA 4GB31 3P3NA 1R083 1V70A 2QZ3A 2B9VA 2A71A 3MDPA 3IAQA 3CIHA 1NE6A 2AR6A 2OZJA 3IN9A 4AQTA 5F3EA 1XOYA 3ZFFC 3AKRA 2HWE2 3EJKA 4NVPA 1C1LA 2A3XA 3ATGA 2H0BA 3OCPA 2VZTA 2Q8OA 1ZZ9A 2RR13 1LHNA 4YG3A 1TMF1 4DEQA 2FMYA 1N1VA 4QXCA 1JUIA 3GZEA 5ANQA 4Q29A 1UKGA 5FZMA 2FMDA 2VPVA 4XFCA 2E53A 2DF7A 4HPKB 4L92A 2D98A 4Q26A 4LT5A 1G9FA 4AFDA 2Y38A 1O3TA 3VZNA 1VBC2 2DV9A 1W8HA 3RMYA 4GWNA 5J36A 3PVEA 2A6WA 2R0FA 3CMGA 1VBC3 5J3UA 4YW3A 4UFKA 3WEZA 3PL0A 3GJAA 1OOPB 3RSJA 1C8M2 2IWGB 3LZZA 3OGSA 2PHDA 1GMMA 3WXPA 1H8TB 2GN3A 3IAPA 3POFA 1AVBA 4LBQA 3M3EA 1UY2A 2Q1ZB 4P9YA 1X8MA 3MW3A 5HXMA 5JIUA 2ENRA 4QT6A 1DGWA 2RR12 1Y7BA 5FCCA 5FYBA 4C90A 1COV1 1OLQA 5I8SA 4ONUA 1DBNA 5GLVA 1ZVFA 1EUUA 5FYIA 3KV6A 2BNNA 1DZTA 2QQPA 1UIKA 4HVQA 1HJGA 1ODNA 1OFNA 1R082 3WX5A 4BOWA 5DN2A 1UPIA 3JXSA 3VZKA 1U5XA 2VZUA 1DCSA 1ND3B 1F4AA 1H6XA 3E6DA 1W6QA 4FQZA 3UKNA 3ZIWA 1I5PA 4BQ5A 1AR63 1QWRA 3NNLA 1PZ8A 3MIBA 2XB6C 1MS5A 1R1A3 5FZEA 2DCZA 3DCQA 2P5BA 4KWLA 4JRAA 4BWOA 1QH7A 1M06G 4CXWA 5FZHA 4IE0A 3OPTA 2D6NA 2ZGOA 1RUD2 4KBBA 4O9EA 3WOGA 1DQ2A 5FKCA 1AUYA 3N3HA 1XPWA 3QH6A 2QQMA 5DDJ1 2MEV2 2VG9A 5IVJA 5JZGB 3DEMA 1JUHA 2GC1A 3NV1A 1HRI3 2DYCA 4FPYA 3WY6A 2EXJA 3WNLA 2YU1A 1ZRFA 3BYWA 4L2NA 2OKXA 1PNGA 5FWJA 1ZA7A 1UU6A 3NAPC 2VU9A 3GCWA 5FMBA 2ZEXA 3BUCA 1UU5A 1LOBA 3O0XA 5J1XA 1JMUB 2BOIA 5A7WA 2EXHA 2E7AA 1ND3C 2FBEA 3D0SA 5IYYA 1YUDA 2WWJA 4KWKA 3RZMA 3U1XA 2WNEA 1W2TA 4TLFA 1JYWA 1URXA 3N9MA 2D93A 5CFDC 5H9PA 4J1XA 2B39A 2XKOA 1W6PA 3AYAA 2VNVA 2CAVA 3JD71 2H6BA 1GQPA 5LWBA 5A70A 4A3ZA 4XFBA 1UNBA 4NIAA 4NHYA 5JDBA 4BXSV 1NX9A 2D44A 2DVDA 4BH9A 1AXYA 3HN3A 1VB2A 4PLNA 4AVBA 1NCRC 3EQEA 4DY3A 2KR2A 1V9U1 4N8MA 2WAOA 3BU7A 1AX2A 1OUSA 3SCFA 3BTYA 2WNUC 4BISA 1SCSA 3S30A 3T2PA 4BQYA 4P5HA 3VD3A 2RE9A 5DG1A 1HQWA 4COYA 2DU0A 5FZ1A 3UETA 4MLOA 1DQ4A 1QJX3 1OQDA 5FYHA 1QJX2 4A3XA 4CCLA 4KBZA 2QCSB 1EAH3 4BK4A 2YC0A 2JDAA 1SBFA 4O7XA 3SC7X 2VNRA 2VMCA 4LK6A 2Y0IA 3KV5A 2RS52 1RUG1 4E4ZA 2P3YA 4CCDA 4FPEA 1V6KA 1FNZA 3EXUA 4MGQA 5KHJA 4CCNA 2VNOA 3LQCA 1POV1 4PT6A 2GALA 2E26A 4M00A 2VQUA 4TWTA 5K7PA 4CU6A 5LBFA 5C71A 4Q8KA 1OOPC 3D3AA 1GZWA 3O5SA 3WG1A 4COZA 4E8DA 1G7YA 2UY8A 4LO5B 4QPYA 3T30A 2ZX1A 4AI3A 2XQRA 5E8AA 4RHV1 4AHXA 3O1OA 3FHIB 4Q4W3 4XIKA 5BNQA 1VE0A 4IE4A 4Z82A 1W6QB 4R4ZA 4YVWC 3IZOA 1MS9A 1H30A 1G9DA 4E8CA 1XRUA 1LCLA 4Q4V3 4CXYA 1GQHA 1JU4A 4BE3A 3TYJA 2WYSA 2AGSA 1B35B 1WCKA 1W06A 4UW3A 5HCBA 5AC92 1S0EA 3AXEA 1XBFA 4FCAA 2QQOA 1A3KA 3DN7A 4OQ9A 3FLTA 3WV6A 1JODA 2Z79A 1W6MA 1YCIA 4BMEA 2LALA 2CGNA 4LEJA 4ISRA 4QD2A 4KWUA 1H2KA 1QJY3 3I2OA 3WDUA 2K0GA 2CGPA 4CDXC 4V2WA 2AREA 3LAGA 4JCKA 5JUVA 2FCTA 2RMU1 2J1TA 5FREA 3ILNA 5CNAA 1F8VA 2ZEWA 2CV6A 1GNYA 5EP9A 4EN9B 4Y4RA 4YWAA 1HV0A 1Y4WA 1KRIA 2JG8A 3CU7A 1OVSA 4S2HA 4FTEA 1NCRA 1ODMA 4D3WA 5C3QA 5CKQA 2DCJA 1SFPA 5GALA 5FZDA 3MIEA 1YFYA 3AFGA 4ES9A 1IPSA 4YVSA 4JTOA 3C7GA 2RMU3 4Q4Y1 5AFBA 5JPNB 3AMPA 1AR72 1RHI1 2Z2SB 5A3UA 4QHZA 1QJEA 1Y43B 5GZCA 1VR3A 4QPIC 4YGEA 4WM7B 2BRTA 4CU9A 4QQLA 1PO12 3B9CA 4BQ1A 4SBVA 4H7LA 1PGL1 2HWF2 2VH9A 4GMP3 2JG8B 4EZHA 1YNAA 2BNMA 3KLSA 3N7JA 4META 3WZ1A 3M4FA 1JXNA 1YI7A 2PQSA 3LFMA 4EN8B 2VZ1A 2JDHA 4FP2A 4YVSB 5A80A 1C5HA 4XQWA 2ZGNA 3M7AA 5I0UA 1STMA 2NMOA 2VMGA 5DAPA 5FZLA 3WP6A 2RDRA 4D69A 1XNTA 5BUVA 4QGMA 3NKGA 5FV3A 2BOJA 3WF4A 2GNTA 3K75B 5JSPA 4UBHA 5KXCA 3H42B 4M3CF 4CCEA 4RS5B 2VGDA 4PF5A 2OT7A 4E2QA 4LBKA 1NQDA 4XUNA 1W8TA 3V56A 5FPVA 5FR3A 4I01A 1WMEA 1WLCA 2PLV1 3N7LA 1QNYA 4Q4Y3 4K3UA 2WSVA 4K40A 4DRVA 1E5RA 1ND2B 4IV3B 2JKXA 4CDUB 2ZBJA 5FOBB 1LEDA 3OPWA 4HL0A 4LO7A 1OD3A 1UY3A 2CWSA 2FHRA 1OURA 2PXJA 3SXWA 5LEJA 2B45X 2DBNA 4QDSA 1CR7A 4MUVA 1F9KA 4YW1A 4Q0QA 4CYDA 1ZBE3 1UMZA 2BFUS 2W87A 4LHKA 4RQPC 3WDWA 4EJRA 2ZHNA 1CONA 4M4PA 1Y9GA 2BBVA 1S0BA 2JDYA 4GJYA 1RXFA 4NAOA 3S5QA 3WF0A 4E2GA 3RYRA 4CXXA 1W3VA 1CAUA 2WO7A 3C7FA 2VBDA 4E4HA 4CP1A 1QJY1 1V6IA 2D97A 2NN8A 4I0BA 1H6YA 4XXAA 3VDDB 2ZEYA 5FOJB 1V0AA 2XL9A 2CY6A 2ZGSA 4E2SA 3S6PA 2E33A 5K4LA 4GH4B 3TNQA 1DDLA 1PVXA 3E1F1 5EV7A 1YO8A 3WQ1A 5D1IA 5LA9A 4DOUA 3QH7A 3E5XA 2YUEA 1SBEA 4GWMA 3FFQA 2NMNA 3U78A 2HH9A 3F95A 3ZYJB 2BNOA 5F2WA 2P6CA 1GOGA 3LSEA 4LKDA 5F9TA 5CEHA 2JWPA 1W03A 2HWC3 2Q1FA 3N9LA 3ZFFB 4AFBA 1RMU2 1UU4A 2JDKA 5CADA 3THCA 1HRI1 5C4WA 3VBRC 1W04A 2I74A 4V1PA 2OUJA 4GKXA 3OBTA 1TZOA 1RUF1 4BLIA 3LEKA 3AL6A 4AI9A 2RDNA 3CKHA 3NO8A 1JZ2A 1W6NB 2Y64A 3H7JA 3PDQA 2CTVA 2WNUA 4Y1ZA 5G04L 3AP6A 2G9FA 2DVAA 5I8YA 1ACCA 2FDKA 1ULDA 3LDKA 2PHRA 2SBAA 4PDWC 2JIJA 4NO4A 3KMHA 5FP4A 1A8DA 4D94A 3RWNA 3PVNA 5FZ4A 2A6YA 2WA4A 2A6VA 2XJVA 3TOJA 1HXS1 3LCPA 4GIQA 1AX1A 2J7MA 1ENXA 1I5ZA 2ARCA 1YYNA 5CZKA 3ZYBA 4A6OA 1YJLA 4FPLA 5FMCA 5JOWA 4QHBA 3U37A 1DQ5A 1PM4A 2YBKA 4Y1YA 2VXRA 5IVYA 1NUKA 2JKBA 3GZUC 1R092 3VL9A 2PTMA 1UOBA 1AJOA 3GJBA 4Q8LA 1EYBA 1LNSA 4XETA 5A6XA 2VE1A 3MV01 5CFDB 2ZMKA 3UV9A 1UY1A 5JXGA 4R9DA 1NZIA 1WW4A 2UWCA 2P3JA 3ES1A 1ZBE2 4C0HA 3MFAA 1LGNA 5EQUA 5F1RA 2WR9A 4YM2A 4XF1A 3UGHA 2XBO2 3EO6A 3Q8BA 2P1BA 1JZ8A 5J37A 5DMYA 3PU3A 5FZKA 3AMMA 4BQWA 1BLZA 4QHOA 2WT2A 4Y4YA 4JQTA 4XYXA 4UW6A 2QQLA 4TLGA 4AEDC 3CEWA 1GOFA 1TNFA 1J3PA 1XE0A 4NN0A 4S2FA 4GB32 5DAXA 3OBAA 5I8TA 2FDGA 3BPSA 5DUWA 5ANNA 5FAXA 2GNBA 4O61A 3N9NA 5CU1A 4IEXA 2YMZA 1MZ6A 2VOVA 3ZPOA 3B00A 1LJ7A 1FPN3 4AQ6A 3O1PA 3UGFA 5FP8A 1W9YA 2A73B 4FI9A 5FPAA 3VD5A 5FZ7A 4LBNA 5K9YA 1FAYA 2WO3A 4LXLA 4KQ7A 5FZGA 2GMMA 1ZBA2 2ZJCA 5FQ0A 4W50A 1WZXA 3R0RA 1W2UA 5LBEA 5CAZA 3ZSJA 1U5YA 2R062 4H3WA 3BIWE 1ST8A 2ZTNA 3J8F1 3IIIA 1R1A1 2XWBB 5BY5A 5GZDA 3OBRA 4CP2A 4CEYC 4RGAA 4DPNA 1Q56A 2Y60A 3ZVXA 4MXWA 2JG9A 1VB4A 2OIIA 3C8XA 1F5JA 2ZAHA 4CA9A 1C3HA 1PO13 4NRPA 4DXZA 3BKZA 1BK1A 2RDQA 1TME1 3CO2A 1LHUA 2RV9A 2C0ZA 3CF6E 2Z4FA 3BCWA 1JOBA 1KGYA 3NJYA 5C4WC 5J48A 4XURA 3O0WA 2A7AA 1LHVA 3LGRA 5FZOB 4LA2A 1UPSA 5IVBA 4FP3A 3FFZA 4XFFA 3L2HA 1COV2 1EP0A 3WSOA 4AXOA 3VHRA 4B29A 2VXJA 4GMP1 1ZYBA 4N9IA 3H7YA 3NMBA 4OMCA 5FIXA 2X29A 2W95A 3FJSA 4OULA 1LECA 1ENQA 4MHUA 1JS9A 3Q8AA 3ZKUA 5LY1A 1WLTA 4XEZA 2WA3A 5A6YA 3AK0A 1RHI3 1Z78A 3NSTA 5E16A 3ZKYA 2XVGA 5F7UA 5F6KA 2HJIA 5FZ9A 3VKOA 1HQNA 5BV6A 4X8NA 1GWKA 2PHXA 2ZX4A 1V6JA 2EALA 4FFGA 4XJUA 4P9JA 3I2FA 1UYZA 4LLOA 4GWJA 1OQEA 4PQQA 1O8SA 4P00B 1QQP1 4JGYC 5IVEA 1OSGA 1KFUL 3SEEA 1UYYA 3AM2A 2WZPP 2YPDA 1BZWA 1AL23 1XYPA 1FXZA 1OOPA 1TMF3 4Y5Z0 4C8DA 5AC93 2R071 3OYWB 4R9BA 1QKQA 4OI1A 5C4WB 3RRDA 4QDRA 2PAMA 1FMD3 2BZDA 1WA6X 3DKWA 2VOWA 3WHTA 2R043 5BNNA 1NA1C 1RUH1 2IFRA 2I45A 3AP4A 2BP6A 3AVSA 5JIAA 2E7TA 2MEV1 4N7UA 4TXWA 1KJLA 5IK4A 2ZGPA 3VKMA 5C70A 1WMXA 1CAWB 1PM7A 4LK7A 4RR3C 4XE9A 1LRHA 4ZS3A 3RMXA 4C0BA 2XJTA 3FWEA 4CVUA 5I0SA 4OI0A 1VLNA 3EBRA 3T2QA 4EV0A 4UW4A 2OZ6A 5A3OA 3AB0A 1OA4A 3TWIA 3ZFEA 1LGCA 1PK6A 2ZAAA 2RM21 5DZFA 5KC6A 1N3PA 2B7YA 3HOBA 2CSGA 1GUIA 4XMAA 4LIVA 3HPNA 2W94A 4LNVA 5C3OA 1DGRA 4EROA 1CJDA 3ZXFA 3T0BA 5A3TA 4RS5C 4YNIA 4CEWC 3H9AA 3K4DA 1ENSA 1IOAA 1KEXA 3M8LA 5FZBA 4TZDA 2BDRA 4Y5TA 3UJQA 5KXBA 1AX0A 1OUXA 1WLDA 4LA3A 3L2YA 4NIGA 1CESA 1ND3A 1SZBA 3MYXA 3VV1A 1R093 3GALA 5FPXA 2Z42A 1XE8A 2WLPA 3B94A 2F4PA 2WN2A 3CDZB 1VBE2 4AYUA 4A42A 3I2JA 1RUJ1 1VBA1 4UXAA 3VBFA 1EAH1 3FN9A 3LWCA 3K3NA 3O1SA 3SNMA 1AR83 2TUNA 4UBGA 5A3WA 4B3NA 3E6BA 2VZVA 1QJX1 3J7MA 5LA2A 1O6UA 1AHSA 1C57A 2VBPA 3DYOA 1WBFA 3ZXJA 3IBMA 4ZU7A 5ACA3 3TEWA 1IKQA 3NV2A 3RZHA 2DURA 4K1YA 2RM23 2V73A 2C9AA 2I2SA 1UKRA 3D82A 1JTZX 5F39A 3ZYHA 2K2SA 5A7NA 2VOXA 3QCWA 1AYN1 1C1FA 1Y9QA 2ZKNA 4NHXA 3WW3A 3I3DA 2XJSA 1DGRN 2HWC2 3ECQA 3DF0A 5FZ0A 4I2OA 3ZN4A 2BWCA 1L7RA 3ABZA 2R6QA 2X5IC 3LEMA 3VBOC 2P17A 5C3SA 1PK6C 5C3PA 1GR3A 5EJ3A 1CX1A 2J1AA 3H8UA 4DINB 5AC91 5FY5A 5C8CC 1UD1A 3BOPA 1H8VA 1QXRA 2VQAA 5FXZA 4ZXKA 4HVOA 3AZZA 1PGSA 4MGKE 2A6ZA 2LUWA 4OHZA 2YY1A 1W6OA 1AR62 2HLEA 3IMNA 3AMNA 1ZREA 3ZOIA 2RDSA 5KXEA 5FLIA 1F2NA 3B7MA 3S7EA 3SKJE 1GOHA 4P14A 4NIDA 4G3YC 4HN1A 5LW9A 5GLZA 3ZYIB 1W0NA 3L9JT 4NIIA 4OUMA 1S2EA 1OPOA 2EAKA 5B4XA 1L7QA 1D4M3 1H1AA 2WZR2 3VBRB 3ASIA 4MGYE 1OD5A 1LAJA 1VBB3 2L9LA 3H1YA 4OQ8A 1HW5A 2VOKA 5A33A 2BJSA 3URFA 5A3LA 5H9RA 3RZKA 3GCXA 1RVF1 2ID4A 2EA7A 3OY8A 3T0DA 1R64A 3H8RA 1QOSA 2ZHKA 1Q8PA 4NMIA 4G9SB 4JKKA 3CHXA 3PVOA 2DTWA 3KS7A 1K5MC 1GFF2 3OGRA 4GH4C 5LA1A 3VUOA 2G1MA 3ZMOA 3KM5A 5L9BA 1PO11 1GNZA 1GQGA 2H0VA 5D8AB 1GP4A 5LCWL 3KF5A 2HWF1 1IQAA 2VUAA 5CKNA 2YPJA 3HNMA 2XH6A 2N7GA 3DPRB 1ENRA 4G4FA 1J1TA 3ACLA 2VVFA 3HMYA 1OF4A 4GXLA 1VRH2 5A6QA 5DABA 4XF4A 3R4SA 4W8JA 3ACHA 2ORXA 3VBFB 2RVAA 5FWEA 2VMDA 4CCCA 3FZ3A 1A78A 1D4M1 2QQUA 4HK8A 3UESA 2D40A 3VZOA 4KU7A 4EWAA 5C8CA 1OPMA 4AHZA 4W6WA 2VCMA 2YG0A 5JR7B 2WS93 3E97A 4FFFA 1YHFA 3AYEA 5EIYB 4LHSA 1IS5A 1WCDJ 5CFDA 5LA0A 2W47A 4PCRA 2GAUA 4QGLA 1YQCA 5E6HA 4BB3A 3DXTA 4ARYA 4P9GA 2PLV2 1D2QA 2ZGQA 3GM8A 4JC1A 4YM0A 1NCRB 4HANA 4XHXA 4QX7A 1S0IA 1RUC2 5DUVA 5C5TA 3AL5A 3J7LA 1YRZA 2VR4A 3PUAA 2PA7A 4J1WA 2JE7A 2DWRA 4XBQA 4Y33A 3RVHA 2YYOA 3SITA 3THTA 1AYM3 1UQXA 2WBKA 1Q8VA 2VMEA 3Q8CA 4QPIA 4U36A 4Y20A 4BU2A 4CDQC 1H1MA 4KL1A 5APAA 4KI5M 2DDUA 1ZZ7A 1WW6A 3GF6A 2AEZA 3MLLA 3MO4A 4XAAA 1GZTA 1PVC1 2ZHLA 5A7SA 4AI1A 3MIHA 1PNFA 4DEVA 4N43B 2WYFA 2R49A 2GU9A 5LEKA 2WFF2 4Q1PA 1I6XA 4A44A 4L8QA 3WT3A 4WM7C 4COUA 5CG8A 1CPNA 4AOCA 2ZABA 5C9AC 1RUE1 1AL0G 1NE4A 3T08A 4CEWA 2CL2A 1HXS3 4EZ4A 1GANA 3FLRA 1SLCA 4YYOA 3TN92 1ZRDA 3V0AB 1FNYA 2GSYA 3K4AA 4HLTA 3EB7A 4HMZA 4MGZE 1OA3A 4NUBA 4P02B 1Q5OA 1WW5A 1ULCA 1F35A 2XL7A 1W28A 1V6LA 2G4IA 5AVAA 5L9RA 5KHKA 2JD9A 3I3EA 1ZZBA 4BIOA 4PLOA 2WINB 4NRMA 5DAWA 2Q8CA 4A41A 4D0QA 3ZO0B 1LKNA 1HRI2 5K0UC 1U12A 2UY9A 4HKOA 1W90A 2ZPXA 4WM8B 4BQXA 2BEOA 3OY8B 3I3BA 4QWNA 3CBNA 3A22A 1RUF2 3LE0A 3JBG2 5DUXA 2P3KA 1V6OA 4PIZA 1RYYA 2F6BA 4COWA 3SQOA 4P9XA 2FDFA 4JGZC 1LB2A 4LHNA 1LU1A 4CDQA 1H8TC 4CU7A 5GZGA 2RS53 3B69A 3WDVA 2JE9A 4IGPA 1ASJ2 3V0AA 5A3MA 2VTFA 1NYWA 2WQ8A 3J26N 2ET7A 5BNOC 3PTYA 1LESA 1YIPA 2BFUL 1AYM2 3RS6A 2FCVA 3ZFGC 5HI0A 3ACGA 4XDOA 1GZ9A 4XBNA 1LOEA 4IEVA 4L97A 4OVEA 4CTEA 5A32B 4LO6B 4CCJA 2J22A 4PLMA 3BTXA 3I7DA 3W20A 1K5MB 1ASJ3 1YC61 5BPXA 1J58A 3HQRA 1Q3EA 1CAXA 4MGSA 3MW4A 1JU3A 1Q8SA 5A7QA 3JBG3 1SBDA 2C9KA 4Q4X1 4QB1A 4YG6A 1T2XA 1WGPA 1YWKA 3LPGA 4PHZA 5FK7A 5FXXA 1VP6A 3H3LA 5FZAA 2YC2A 3GDBA 2RS11 3D0JA 3VD7A 3T1LA 4NROA 2R073 4FFIA 3CZUA 3MICA 1ZBE1 4FTSA 3ZXGA 3LIHA 4ES8A 3S7IA 2X53S 2ZKLA 3PU8A 2YZ4A 3ZFEB 1QQP3 3F2ZA 4BPZA 1K12A 2QDNA 1KDKA 3SCHA 3HT2A 4UT5A 4AR2A 2IUWA 5LASA 1C8M3 5CYYA 3TN93 3VBHC 4YLZA 3HBKA 5BNNC 4AFMA 4MH0E 1NCQA 3HQXA 4IEWA 4L9BA 4LORA 4XDPA 3VBUC 1VAVA 4XACA 5IFTA 2VVEA 1SMVA 2E6VA 4OI4A 5BNOA 1GZWB 1W9SA 3NVCA 3P1IA 2IXJA 3ZX7A 4XILA 4N53B 4CE8A 2WNUB 3BTZA 2FZ2A 5FLJA 4MVTA 5G05L 1KITA 2Y34A 5FZIA 2XG3A 5ERLA 3W5MA 3AKPA 4XDQA 1ZZCA 3LD8A 5A6ZA 1OF3A 1UOGA 3C7OA 1KS5A 2AUYA 2D43A 3WUCA 4WVVA 1P8JA 1ZBA1 2HWE3 5IWFA 5K0UB 1PZ9A 5FYZA 3LOBA 5ABJA 1O4YA 2VD7A 2DUOA 1OLME 2EVXA 3HT1A 4P9IA 5L7OA 1ND2C 2VQ0A 1R1A2 4DXTA 3J4UH 2HWD1 2FZ1A 3J9SA 2P37A 5J98B 1RB8G 4JTNA 3KCCA 2RS31 4NOTA 4HBNA 4LLFA 2VC9A 4AQSA 4ET7A 5GM0A 1LU2A 1QDOA 3LA3A 4PBOA 4H7MA 4XZPA 2NP0A 4FT8A 4LULA 4M3CA 4XTPA 4E4SA 2ATFA 2GP3A 3S5AA 3ORJA 5H9SA 4Z2AA 3MUZ1 3I3QA 4A45A 5KHGA 1AR92 3J8F3 4C1WA 5KHIA 2WS92 3ILRA 5JZGC 1TQ5A 3W59A 3QBQA 3WNOA 1VMHA 1JYTA 4AEJA 4NHLA 3VZLA 5C3RA 1BK0A 3POYA 3QACA 3VL8A 4FXKB 3S0MA 1EV12 1CAVA 4PJYA 3ZYGA 2WDBA 1XNKA 1FPN1 4BLJA 3LA7A 2BPA2 4AF9A 1HB3A 3HIFA 1HN0A 1ZRIA 5FZ8A 1UXXX 2QZ2A 2D3RA 3JCIA 2P4EA 5L7OC 1MS4A 4JAAA 1FOD3 2V5DA 1IKPA 1OXCA 4M3CE 2J1EA 1APNA 5ABJC 4PI0A 1IS3A 2JENA 1EY2A 2RJKA 2VMFA 2NLRA 1MEC1 1S0FA 3N35A 2FD8A 1UW8A 1H1IA 4DXSA 4ATFA 4AHWA 4HVRA 4IEYA 4YM1A 1OH3A 5FP9A 4UW5A 3VGIA 1FV3A 4Q1RA 2YGMA 1AR82 4XHBA 1ALYA 1UZYA 1YI9A 2BUKA 2Y6GA 1VBB2 1WCSA 4MXWB 5FFOC 3RZLA 3W21A 3ROUA 3ON7A 2V4AA 4XF9A 1Q43A 4CCOA 5F3CA 3O1VA 3KVBA 2JDUA 5FUPA 4DXRA 1WA4A 5F8PA 3A21A 4E4DX 4N7IA 5JMOA 5KC5A 2KA3A 1B35A 2ZCWA 5AFEA 3JB8A 4IEUA 2J1SA 3VBRA 1HX6A 3VZMA 2JICA 3ACFA 3PMSA 5DAQA 1VAMA 5FXWA 2QQWA 1XJAA 4BQ2A 2TBVA 1UL9A 1I1EA
chains in the Genus database with same CATH topology
1DGWX 4F3JA 3WDXA 1GYKA 2CYFA 3WP3A 1DZQA 3RYKA 4K8FA 3DPRA 1K5MA 3ZFEC 2UYAA 2ZMLA 4C1XA 3AKTA 2DUPA 1RGSA 5KWRA 1I3HA 2AH2A 2IZWA 1JOJA 4HPKA 1S55A 4L11A 1DIWA 3R4UA 5GZFA 5FO7B 3AXDA 1CN1A 1CVNA 2XPJA 3PJQA 3NW4A 1N3OA 1NCQB 4FO9A 2DU1A 2R042 3MPPG 4BM8A 1SLIA 3JD73 4LHLA 4YZ5A 1EPWA 2OYZA 4OZXA 4QX5A 1AL22 5ACA2 4FOVA 4Q0PA 4JV4A 1VIWB 2BVBA 3KQRA 1IS6A 1MS8A 3D6EA 4YARA 3HN1A 5BNOB 2ES3A 3D8CA 2Q30A 1MS3A 4HETA 4YGDA 3THPA 4IEQA 5I93A 1IPJA 1REEA 3P3PA 1VBE3 1NOVA 4JDOA 5T54A 3T1MA 1LODA 5JSOA 3IDCB 3WINE 2TNFA 4RA0A 2JG9C 1MQTB 4CDWA 1BMV2 3H0OA 1OQ1A 3D5OA 1HLCA 2VMIA 4RSUA 1OKQA 1BEV1 1H0BA 3VZJA 3HAGA 4X8PA 3FBMA 4AEDB 3NKTA 5EZWA 2OPKA 5CBLA 3KSCA 1UN1A 5T5JA 5C9AB 3D4KA 2R1DA 5FRAA 2GMPA 3B3QE 1L3JA 4MYEA 2XWJB 3KT1A 1ULGA 1LGBA 1M4WA 1X7NA 3VLBB 4LBLA 4XOGA 4Y1VA 1DFQA 4DQAA 2R16A 5DZGA 2ZGMA 4K9SA 1QXPA 3SH5A 4WM8A 1O5LA 1ZX5A 1NY71 1SCRA 3FMGA 1VALA 2WZR1 1YFXA 2YV8A 2XJUA 1FMD2 1ZBA3 2HWE1 4CDQB 4GALA 4RFT0 1NQJA 2WT1A 1TMF2 1LHOA 1RVF2 3AYCA 3PMEA 3ZSKA 5DZEA 4YW5A 2TEPA 1NXMA 5T3NA 3ZSMA 4AI2A 2XLAA 4H14A 4I09A 2NYYA 1MEC3 3AKSA 5A32A 3WW2A 1D2SA 3BODA 3GNEA 3USUA 3A0KA 4WV8A 1VBC1 2CGOA 2GZWA 4XIOA 1WMFA 3ZFFA 2ZHMA 3ZMNA 3WG4A 1CIWA 4AVAA 2PHWA 4RR3A 3B5LB 2HWB3 5GJ6A 2PAKA 3ZFGA 5FO9B 4H55A 1H2NA 4HK9A 2W08A 3IT8A 1T6GC 3WD5A 1H8TA 4GKYA 4YGCA 4PIYA 3AZXA 4QQPA 1YJKA 4I02A 4MSVA 1XNCA 3AZVA 1RTVA 1OHFA 5DG2A 3H50A 1NA1A 1SLTA 1O3QA 5EXOA 2EXKA 2WLQA 3VBHB 1PHMA 3MIFA 1NZCA 3MFCA 3SISA 2RS33 5CIRA 1RUC1 2C1FA 2XHKA 2KXLA 4YVWB 3I2DA 4COUA 3O7OA 1JHNA 2XJRA 3ZXKA 2GH2A 4Q4V1 3O14A 3VBUA 1N1TA 3HD8B 2R063 1SQ4A 4YGBA 5JCTA 4Q4W1 4K6BA 3MGUA 1QGLA 1RINA 2E51A 2B9UA 3WG2A 3DV8A 4AVVA 1LULA 3WQ7A 1SFNA 3JD72 1WW7A 3WR0A 3CJXA 4KGQA 4AEDA 3SHRA 1HDKA 5DDJ2 2QNKA 4FPHA 1PIV1 2KM2A 3SH4A 1CX4A 1W0OA 4IEPA 2ETEA 4FAGA 2D6MA 4AE2A 1DHKB 4QXKA 3WQ0A 2A6XA 2CWMA 4YG0A 5EFUA 1RL3A 3SCGA 1TEIA 1ONAA 4OLLA 3KT4A 4FOWA 3I4IA 2DFBA 4MGIE 3OJBA 1MS0A 2X5IB 3B9IA 1CAVB 2D6KA 4F8AA 1JH5A 5JI9A 2QUOA 4B4QA 1WD3A 2LM3A 3B01A 1VBD1 3IWZA 1QJU3 4N53A 4DS0A 5SV5A 3E5QA 5FLHA 2YXSA 5IK5A 4XW3A 1ULFA 4BZ4A 4J6GA 3U10A 1W6PB 1JN2P 4FXGB 4FPOB 4JDMA 5CVRA 1RJ7A 3TNPB 4EN7B 1G9AA 1AYM1 3FC0A 1J59A 2NPIA 2MNGA 3NAPB 4L99A 1PO21 2W0XA 2X5IA 2WSUA 1H2MA 5H9QA 4M0NA 2GDFA 1RUI1 2SLIA 2VY0A 4IV1A 3EHKA 4BHPA 3E6CC 3IM0A 1IZ3A 1WLWA 3ZYPA 2RS51 1V6NA 1RITA 4INDA 4FPGA 4KGGA 1MACA 3PJYA 4Q4X2 2BVVA 2Y0OA 1WBLA 3A0NA 3BPZA 2RS12 4JQRA 1YLLA 2PHTA 3NAPA 1RMU3 4CZSA 3KGZA 2ARXA 4AFAA 2JEMA 2D5FA 2B8MA 1HRV3 2D6LX 4HKWA 1FT9A 5L73A 4XFIA 1ZRRA 5FQ0B 4DY5A 2HWF3 5LK7B 4Z1VA 1AR71 4GULA 4PDWB 3OYWA 4B4PA 3LKJA 4TSVA 2X8KA 2OVUA 3JZVA 1KQRA 1IPKA 3VDDA 4P9LA 4TYSA 4RR3B 3GHMA 1JYCA 1DF0A 2RMU2 4ITCA 1COV3 2R30A 3ZYRA 1CAWA 4XQ4A 2B46X 3INAA 1HRV1 1X8EA 3AJZA 2Q1MA 4CP0A 4B7EA 2W68A 5CFCC 1R1ZA 4EWEA 4ZU5A 5FTTC 1N1YA 1XNBA 5SV8A 4ORFA 1QNWA 5D8AC 3JQXA 3JU9A 1B35C 4Q4Y2 3K48A 4N9HA 2PHFA 2XJPA 5LRRA 4HKLA 3FLPA 1W6NA 2IXKA 4CRQA 1AR91 5FMOL 3ZSLA 4XJZA 1C5IA 4IV3C 2ZGTA 1AJKA 1RUI3 2UWAA 1O5UA 4KWJA 5T55A 4W6YA 5F5QA 4AG4A 2ZZJA 2E9QA 3POSA 1EV11 5C8CB 4D7YA 1FPN2 4Q0SA 4K20A 1AXKA 2D5HA 2E7QA 3VHNA 4AVSA 2AYHA 3WVJA 5K0UA 1REDA 1Z7S2 2EIGA 5L7OB 5GLTA 1FYUA 2D3SA 4GMP0 5D8AA 2BTVC 3RG0A 3ZXEA 3IKWA 4OUSA 1QJU1 5GZEA 4KG0A 1QJZA 1B09A 1XNDA 4A7KA 2XBO3 4Y22A 4BYYA 1AR73 2B5HA 3ELNA 1LOFC 2JG8C 3N4MA 3VBOB 2ARBA 2HYKA 3IPVA 5T50A 4DNYA 1ZZ8A 5C9AA 2WT0A 2VW0A 1H4GA 4QM8A 5CFCA 1LR5A 1VBB1 4DMIA 1H4HA 1RJ8A 1ZZ6A 4MZUA 1SFYA 3ENRA 4AHYA 1UF2C 4XF0A 1WD4A 2JD4A 4I3GA 2GN7A 1RMU1 3OGJA 4N43C 3WG3A 4BIFA 4F7ZA 1PIV3 3GHNA 4OI2A 4EN0A 1FATA 3PLQA 1RUF3 3E5UA 5T52A 2UURA 4NR1A 5CA6A 1QJY2 3A4UA 5FDBA 3AZYA 3PVBB 3USUB 2PYTA 2VVDA 5C6CA 2GC3A 1QOOA 1YXWA 2HEYF 3RDIA 4IV1B 1VJ2A 2QVSB 4QPIB 3OTFA 1U5IA 4IEZA 3TBDA 4IL7A 4O9GA 1PO23 3H3ZA 4YZ1A 1S0DA 2Y26A 2HEWF 1BCXA 3ZXLA 2BWAA 5A33B 2PQQA 3R4DB 5TSWA 2P34A 1LOFA 4HFSA 1O3RA 1DQ1A 5GLUA 3WCSA 2R041 2DFCA 4RS5A 3WHUA 1VBD3 2JDZA 5BYNA 2OUHA 2WQZC 1QMJA 1C8NA 3G7DA 1MVQA 5ACA1 2HWB1 4KH9A 5JOYA 4WZCA 4I0WB 3I54A 2PLV3 3NV4A 1HQLA 5E88A 4FPCA 1MS1A 1W6OB 5DUUA 3LA2A 4DB5A 1OA2A 4Q0VA 4YVWA 1R091 2ZX2A 2IC1A 3WUDA 1A6CA 1DU3D 1MVEA 1NLRA 4WZFA 1BMV1 1Z7S3 1SEFA 2W52A 5T5OA 3V0BB 3ZFGB 3NJZA 2DUQA 2YHJA 3M2MA 4JGYA 2O1QA 2Q5TA 5E89A 5KHJA 1CJPA 1S0JA 2R061 4XQDA 3X29B 3ZIXA 2D6OX 1DQ0A 4QPGC 2A5ZA 1UZZA 1TME3 2YROA 3CJIC 1CQ9A 1KD7A 3R05A 3OPZA 4Y20B 1POV0 1J3RA 1F31A 1FOD2 2BYVE 4LBJA 4GQ7A 1TME2 3LOIA 1NLSA 1NY72 2CNAA 2MEV3 3N7MA 1SLLA 1LOGA 1GICA 1RUH3 1BVVA 5ABJB 1FMD1 4NHKA 3GZTB 3T2TA 2YDEA 1PGW1 4Y22B 4R4XA 4Y1UA 5J96B 2FQPA 4BA6A 1AR93 3J8F2 4R8HA 2MHFA 2OA2A 4Y24A 3IPVB 3ALQA 4A7YA 4LO8A 1E57A 4AQ2A 5BNPC 1S1AA 4LTAA 1O4ZA 3AMHA 1G9CA 4X6RB 1QF3A 4XTMA 5B2GB 4EWDA 1AZDA 4ASLA 2I07B 2GMEA 3N36A 4E9KA 3MPBA 3UL2A 5JLVA 5DXDA 4FTBA 2G9GA 1RUH2 5FPZA 4M01A 5L19A 3WP5A 3FUQA 2WKKA 1WUVA 1SLAA 4M3CB 1J3QA 3DGTA 4FBFA 4N43A 2WQ4A 3U11A 3FX3A 1D4VB 4LUKA 4YZ4A 4YRDA 1MZEA 1YFWA 1ND2A 3HWJA 2IFWA 2RM22 4LO4B 2OW4A 4Q4V2 4XJ8A 1QQP2 4QQHA 2AZ5A 2BQPA 4LE3A 4YM3A 3MF9A 3V0BA 2V5YA 3RJRA 4Q4W2 1BVP1 2VULA 4URTA 2R072 1MQTC 2A3WA 3VBUB 1UIJA 1O7FA 3HR9A 1H9WA 4Z8BA 4RD7A 4XFAA 2WL1A 1PIV2 4CDXB 1JW6A 5BNPA 5I91A 1N47A 1VBE1 4W65A 5FBZA 4JRLA 4R52A 1EAH2 4IXLA 2PFWA 4IQPA 5EYXA 1C28A 4AGRA 4RGGA 2GC0A 3VKLA 1QH6A 2HKXA 3BOWA 1UX6A 2WIIB 5J7MA 4QPGB 4IEOA 4HT1T 2JX9A 1NA1B 2QJVA 3LB9A 4KG8A 4PDWA 1DQ6A 1DGLA 2PN5A 1VBD2 1KJRA 3OD4A 4WBBA 1Z0HA 4WVWA 2VW1A 1XE7A 3MLKA 1BYHA 5JOZA 3AKQA 4K1ZA 1RUNA 1V00A 5DDJ3 5GLWA 1RUJ2 1VBA2 4Z2WA 5T5PA 3I59A 3AYDA 3WW1A 1PO22 4QM9A 2NZ9A 4WM8C 1CD3G 2ZGKA 1RUI2 1IHMA 1GV9A 3QLQA 2D3PA 1CAUB 1QDCA 3QD6A 4QGNA 3V65A 2C5DA 1BXHA 4JGZA 5CB7A 4LE4A 4HZFA 1GSLA 1KFXL 1BBT1 2WFF3 1AR61 4R9CA 4XMIA 3WP4A 2R0HA 1N1SA 5JSRA 1BQPA 1MZFA 1VAKA 1ZNPA 3GBGA 3RYPA 4MV2A 1DZRA 1AYN2 1G8WA 3ME2A 1MQTA 3RQ0A 2RJLA 3CL1A 2ZGUA 4OHWA 3KZ4C 4YZ2A 3SMHA 5BXXA 2HWD3 1GNHA 2HWC1 4SLIA 1O3SA 4FAHA 1AXZA 3TB0A 1HIXA 5JVVA 3TRSB 1LENA 4OHXA 1NG0A 3RI8A 5JAXA 3R6SA 1RUC3 3MIGA 3VBSC 1OLRA 1DYPA 1GZCA 2O8OA 1ZRCA 2ERFA 2WNVA 4IV1C 2WFPA 5J09A 1RC6A 5E1RA 5K8SA 4BMBA 1NXD1 3RNSA 3M3QA 2JJ6A 3WNXA 1QU0A 1G86A 4CDXA 3RZZA 1C8M1 4N90A 5BNPB 2H6CA 1MR5A 1HRV2 1LEMA 1VRH1 4IERA 1DLLA 4IESA 2QFEA 3WDTA 3FE5A 4FPFA 1VRH3 2RR11 4OHYA 2VUJA 4I0AA 5HCFA 3SH3A 3UJOA 1KDMA 1QXJA 5C33A 2DCTA 3M1HA 4XJWA 4S2DA 4LUMA 1Q8OA 1FV2A 3GYDA 1WMDA 5LK5A 1GLHA 1R081 1X50A 2ZOEB 4GB33 3GBFA 4I3PA 1XYOA 4COVA 4R9AA 1S0CA 4NWVA 3VHPA 3GBWA 5FO8B 3VKNA 2NM1A 4Z07A 2IXHA 4XFHA 3KB5A 2P3IA 2ILMA 4IV3A 3ETQA 1D4M2 2WZR3 1X82A 4RHV3 4JDNA 2GH8A 2XLGA 1RUD1 3OD0A 5L36A 1CAXB 1Z7S1 4W6XA 4PQ9A 1QJU2 4FPJA 2Q4SA 1BBT3 2WFF1 4PIXA 3HBZA 1RUG3 3BTAA 3I8TA 2VMHA 3DL3A 1HV1A 1ZM1A 4JGYB 2UYBA 4K7JA 2BW8A 4LBOA 4OHVA 1RUE2 1BEV3 4FOQA 4RL7A 1S2BA 2DVFA 3SLIA 4K21A 3TN91 4AI8A 4B4RA 3G6JB 2BGCA 4A7ZA 1MZ5A 1W0PA 2ZGLA 4C91A 2D6PA 4AWDA 1YFUA 5I0RA 1PMIA 4AGGA 4F83A 4Z92B 4DRRA 4NHMA 4AI0A 3FUOA 4NPRA 1V9U3 2O0OA 1DYKA 1PZ7A 2DCKA 3CNAA 2DCYA 5CFCB 2RS13 2AENA 2WC2A 2D7FA 4OFGA 4RQPA 4CEYA 1PVC2 1SDWA 3W58A 1PVC3 3JBG1 4JGZB 4Q4X3 1HKDA 1XXNA 3NL1A 3ZN6A 4Q27A 1V9U2 2WJSA 3CLPA 2GNMA 1ASJ1 1LHWA 1Q8QA 1G9BA 2IXCA 3BB6A 3ILFA 5CG9A 3NWKA 3VKFC 1H2LA 4AEKA 3ES4A 1U0AA 3KCXA 3Q9OA 4CEYB 5KXDA 2NP0A 3M3OA 4AVCA 4GA9A 3C3VA 2K9ZA 3VBOA 3O0VA 4ZKTB 1RUG2 3U07A 4X6QB 1O4TA 3ZN6B 4AK3A 4AVTA 2ZX0A 1FX5A 2UU8A 2HEVF 2MPFA 1X36A 4Q2FA 1XQNA 4XJAA 1BKZA 2W39A 4PBPA 2NQYA 1QOTA 1POV3 2WNVB 5HXVA 2E63A 2PELA 1REFA 2VECA 2ZACA 4WM7A 2XVKA 2V09A 4RHV2 3V64A 5JWPA 2YGLA 4CDWB 4AEMA 3OGGA 4QQOA 1YIFA 3PNAA 5I0TA 3AZWA 1TNRA 1Y3TA 2EXIA 3IDEA 2HWB2 2PHUA 3VN4A 1J1LA 5AVPA 1U5ZA 5FMOS 1O91A 2DVGA 1C4RA 2A70A 3KT7A 1F5FA 1X33A 3VBSB 3U4XA 4XPVA 4CDWC 5F6LB 3ZN5A 2QDRA 2UWBA 3N7KA 1OFSA 4U2AA 1GKBA 2B42B 5IK8A 4FSJA 2VNGA 1RVF3 3MZHA 2R32A 5JI7A 4ATEA 1IGOA 1JBCA 4CEWB 3ST7A 1EV13 1XYNA 3M70A 5HBAA 2DVBA 3WDYA 3VBSA 2RS32 4HN0A 3MF6A 1V6MA 3JB4C 1RHI2 4YZ3A 1FOD1 4ISQA 1LTEA 4CDUA 3B02A 2GC2A 4LBMA 3JUUA 2WS91 1PGL2 2XVLA 3IIAA 2Q0AA 4HSJA 4QPGA 3BALA 4YW4A 3QOPA 4EN6B 1GBGA 3APBA 1PGW2 3MIDA 1NCQC 4GH4A 2PHLA 1CPMA 3ZDSA 2VW2A 3AP5A 2HWD2 2Z5WA 2A75A 3H1WA 4YFWA 1H9PA 3UKVA 4P9WA 4WVZA 4XFGA 4XXPA 5BNNB 3CJIB 2LTNA 2GNDA 1AF9A 3K51A 3LSDA 3SITA 4D69A 4S2GA 1XU2A 3USSA 1D0HA 2RHPA 2ZX3A 2JECA 4MX3A 3I59B 4KNCA 1MEC2 3JQWA 1OI6A 4CDUC 1KXGA 5GKAC 1RIRA 1UCXA 2ET1A 3W9AA 1KS4A 2XLFA 1IS4A 2EF6A 3AP7A 4MXVA 1AR81 2Z69A 3OF1A 3H1MA 3WLUA 2IXIA 5JMCA 4Q0UA 4RQPB 4DFSA 4YW2A 4A2UA 5JOXA 4WVMB 3IDBB 3AJYA 5C8WA 2ZMNA 3KGLA 4D7TA 4Y1XA 3AMQA 3VDDC 4KU8A 3U0ZA 1LOCA 1LOAA 4AFCA 1S2KA 5KHHA 3MEPA 3ZXAC 3MW2A 1W39A 4AGVA 2PAEA 3M3IA 3FBYA 4E27A 1CGPA 1PK6B 4LR4A 3RJ2X 4DZGA 1G6NA 1BJQA 2A3YA 1W6MB 2R1BA 4XF3A 4HSLA 4FQ4A 3WCRA 4FOYA 3VHOA 3PHMA 4NWWA 4YSFA 5IUQA 1SLBA 4BCUA 3TAYA 3B93A 5JPMB 4YVSC 1S0GA 1AYN3 4LBQB 3POWA 2IXLA 2ZZQA 2P2KA 5JZGA 2WNVC 4XJ9A 1UAIA 5EYYA 1QY4A 4QQ2A 1AL21 2QE3A 3KD4A 2CAUA 3M3CA 3DUIA 2XGXA 2JXAA 4LBQD 5HCAA 3AP9A 1DG6A 2ZA9A 5KBFA 4D7SA 4QU2A 2XUMA 1HXS2 3H3UA 1ULEA 3KCYA 5T5LA 1TE1B 1XU1A 1RUJ3 1VBA3 5LRSA 4ZU4A 4IETA 3ZXDA 3WW4A 1QHDA 2JG9B 3CJIA 4FVVA 5IK7A 3C2UA 2ZGRA 1D0GA 1A8MA 1JYIA 3AX4A 1RUD3 2ZS6B 1OMIA 2DTYA 3ZPYA 3MLJA 1N3QA 2QKDA 3GZAA 3VBFC 4N53C 1RUOA 1BEV2 2XKPA 2O8QA 1RUE3 5EWSA 3MI8A 4M0HA 3DPRC 2XBO1 1FI2A 3NV3A 4QMAA 3ZSEA 1EPZA 4XBLA 3RPQA 1BBT2 2WWSA 4FPKA 3UKTA 1I9RA 4JVAA 1SACA 2EAAA 4Y26A 1ZA4A 3AFKA 2XJQA 4I30A 4B7KA 4YFZA 3VBHA 3O12A 3RI9A 5IT6A 4WVMA 3UK9A 4AW7A 4B8EA 4GB31 3P3NA 1R083 1V70A 2QZ3A 2A71A 3MDPA 4AQTA 1NE6A 2AR6A 2OZJA 3IN9A 3ZFFC 3AKRA 2HWE2 3EJKA 4NVPA 1C1LA 2A3XA 3ATGA 2H0BA 3OCPA 2Q8OA 1ZZ9A 2RR13 1LHNA 4YG3A 1TMF1 2FMYA 1N1VA 1JUIA 4Q29A 1UKGA 2FMDA 2VPVA 4XFCA 2E53A 2DF7A 4HPKB 4L92A 2D98A 4Q26A 4LT5A 1G9FA 4AFDA 2Y38A 1O3TA 3VZNA 1VBC2 2DV9A 3RMYA 4GWNA 5J36A 3PVEA 2A6WA 2R0FA 1VBC3 5J3UA 4YW3A 3RSJA 1OOPB 1C8M2 2IWGB 3LZZA 2PHDA 3WXPA 1H8TB 2GN3A 4LBQA 1AVBA 3M3EA 2Q1ZB 4P9YA 1X8MA 3MW3A 5JIUA 2ENRA 4QT6A 1DGWA 2RR12 1Y7BA 5FCCA 4C90A 1COV1 1OLQA 5I8SA 4ONUA 1DBNA 5GLVA 1ZVFA 2BNNA 1DZTA 2QQPA 1UIKA 4HVQA 1OFNA 1R082 3WX5A 4BOWA 1UPIA 3VZKA 1U5XA 1ND3B 3E6DA 1W6QA 4FQZA 3UKNA 3ZIWA 1AR63 1QWRA 1PZ8A 3MIBA 2XB6C 1MS5A 1R1A3 2DCZA 4KWLA 4JRAA 4BWOA