1ZBE2

Foot-and mouth disease virus serotype a1061
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
DRLLTTRNGHTTSTTQSSVGVTYGYSTEEDHVAGPNTSGLETRVVQAERFFKKFLFDWTTDKPFGYLTKLELPTDHHGVFGHLVDSYAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKAFDTREKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVLSPLTVSNTAAPQIKVYANIAPTYVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Foot-and-mouth disease virus serotype A1061 alone and complexed with oligosaccharide receptor: receptor conservation in the face of antigenic variation.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 41
structure length 207
sequence length 207
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zbe200
3VDDB 2PLV3 2RMU2 2WLPA 1RHI1 4CEYC 3VBUB 5J96B 1VBD1 3J8F3 1RUC3 5BNPC 1AR92 1HX6A 1ZBA3 3JD72 1RUF2 4JGZA 1BMV1 3VBFB 1AR82 4N43B 4IV3A 1VBD3 3J8F1 1HXS2 1A6CA 1FPN3 2HWC3 1RUC2 4N43C 3NAPC 2BUKA 1RUF1 1HRI2 1ND3C 5D8AC 1RUI3 1H8TA 1K5MC 1VBC3 4Q4X3 1QJZA 4QPIC 4WM7B 5BNOB 5L7OA 3ZFGA 1D4M2 1K5MB 1RMU3 1VB4A 2GSYA 2RS33 4JGZC 1NCQC 1B35C 4Q4Y2 1BEV3 1FPN1 2HWC1 1PO22 2X5IA 3JB4C 1TMF3 1VBA3 4Q4V1 1RUG2 5ABJA 5A32B 1AYM3 5J98B 1PO11 4AEDB 4QPGC 1AR93 4YVWC 3JBG1 4N53A 1PVC2 3DPRB 1Z7S3 2R072 5CFDA 5JZGC 1ND2B 3ZFEB 5AC92 1V9U1 3VBSA 1W39A 5BNNC 1RUI1 3ZFFA 3DPRA 4Q4W1 1AYM1 4RS5A 1PO23 2QQPA 1WCDJ 5ACA1 4CDQA 1VAKA 1BMV2 1ZBE3 2HWB3 1QJY2 4FSJA 4AEDC 3VBFC 1RUH2 1VBD2 1ND3B 4RS5B 1RUD1 1AL22 4CDWA 1AR62 1RB8G 5D8AA 1QJU2 1ASJ2 1X36A 4GB32 1NCRC 1PGW2 2X5IB 1C8M1 1VB2A 4GMP1 4PDWC 1RHI3 2WZR2 1COV3 1MQTA 1CD3G 1MEC1 4YVSB 1VBA2 1AYN3 1NCQA 2RR12 1OHFA 1HRV3 4Z92B 2ZTNA 1MQTB 2XBO2 1R1A3 5BNPB 3VBHA 4WM8A 1AYN1 1BEV2 1BBT3 3DPRC 3VBFA 5ACA3 1QJX1 1VBE1 1TMF1 4Q4V3 4RQPA 4RHV3 4Q4X1 4NWWA 5C9AA 2X5IC 4WM7C 2RS11 1EAH2 4Q4X2 5BNNA 1NY72 1TME1 1POV0 1PIV3 1RUJ2 1B35B 1BEV1 1VRH3 1MQTC 5JZGB 4JGYB 3VBOC 1E57A 2IZWA 3VBRC 1AL23 1AR63 1NG0A 1AR83 1CJDA 2RS51 4JGYC 2FZ1A 1RUH3 1PGW1 4IV1C 1RUF3 5C8CB 1NA1C 1NCQB 2WFF2 5FMOS 4CEYB 3JB8A 5ABJB 4RS5C 1PIV2 5BNPA 4Q4W3 2RMU3 5K0UC 2HWE1 4FTBA 4YVWB 2HWF3 4NWVA 4CDUC 3VBSC 4PDWB 1GFF2 2WFF3 5DDJ2 1TME2 5ACA2 1QJU3 5C9AB 1RUG3 1POV1 2BFUL 3FBMA 4IV1B 2TBVA 1AYM2 1FOD3 4CDWC 3ZXAC 1H8TB 2GH8A 2RS31 2XBO3 2RM21 5L7OC 1RVF1 1PGL2 5AC91 4JGZB 2R071 4IV3B 1K5MA 1FMD2 5CFCA 2R042 2BBVA 1HRI3 2RS13 1VBC2 1V9U3 4GH4C 2R062 2RR11 3ZFFC 4Q4V2 1Z7S1 1R081 2ZZQA 1MEC2 4LLFA 1OOPC 4QPIA 1FPN2 2HWC2 2HWD3 1EV13 4GMP0 4IV3C 1D4M1 5CFDB 3VDDA 1QJU1 1AR61 4BCUA 2MEV1 1RUD2 3ZFFB 3ZFEC 2ZAHA 1RUH1 4GH4B 1HRI1 1OPOA 1QJY1 3S6PA 3VBUC 1M06G 3VBSB 1HRV1 4RFT0 5DDJ3 2R073 2RR13 4CDUB 3CJIA 4CEWC 1RUC1 4WM8B 3VBRB 1RUI2 2HWD1 1C8M3 1HXS1 4GMP3 5LK7B 2HWF2 1IHMA 4RHV1 1H8TC 1NCRA 1B35A 3LOBA 1QJY3 3JD71 1BBT1 1PVC1 5FMOL 1AR91 1HXS3 1FOD2 3NAPA 1QQP3 1PO12 2RMU1 1RUG1 3JD73 3TN92 4CEWB 1QJX3 1VBE3 5FOJB 4N53C 2BFUS 2WS93 2RM23 1NA1B 1PVC3 1AUYA 2PLV2 1R082 4CDWB 3TN91 1Z7S2 1FMD3 2R061 4RR3C 5CFDC 1RUD3 4Q4Y3 3VDDC 1VBB1 1FOD1 2R041 1F8VA 1BBT2 3CJIB 1FMD1 3ZFEA 4RHV2 1ND2A 2HWF1 1SMVA 2HWD2 2RS32 1COV2 1EV12 1ND2C 2WS91 1X33A 3J8F2 2HWE3 4YVSC 1AR81 2RS53 5DDJ1 1HRV2 2VQ0A 4QPGB 4CDXA 3VBOB 5A33A 1AL0G 2BPA2 5ABJC 2HWE2 2MEV2 1RHI2 2WZR3 4CEWA 3TN93 1ZBE2 2HWB2 5C8CC 2WFF1 1HQNA 2WWSA 3HAGA 1VBB3 1R092 1R1A2 4RQPC 2Y26A 4CEYA 1ZBA2 1TME3 3IDEA 5K0UB 1POV3 3VBHC 1VRH2 5BNOA 5L7OB 2XPJA 4YVWA 1QQP1 4GB33 1VBC1 3VBUA 1RUE1 1DDLA 1EAH3 5C9AC 3VBHB 4Y5Z0 1RUJ1 4RR3A 1NOVA 4N53B 4CDUA 4Y4YA 4N43A 5GKAC 1RVF2 1PGL1 4GH4A 4WM8C 1EAH1 3VBRA 2RM22 2FZ2A 3ZFGC 4QPGA 4CDXB 1TMF2 5BNNB 1AYN2 4IV1A 1RMU2 4FTEA 3JBG3 3CJIC 2MEV3 2XBO1 1RUE3 2DF7A 5C4WC 1ND3A 1PIV1 2R063 4WM7A 4QPIB 1VRH1 1RUJ3 1ASJ3 1AR72 1C8NA 1R1A1 1F2NA 5A32A 5K0UA 4AEDA 1ASJ1 4CDXC 1AR71 2RS52 1ZBE1 2HWB1 4YVSA 1AL21 1NA1A 4RR3B 5CFCC 1R093 5C4WB 1RMU1 1NCRB 1R083 4PDWA 1MEC3 4FTSA 1OOPB 1NY71 1RVF3 4SBVA 1AR73 4Q4W2 2R043 5C4WA 3NAPB 1EV11 2WS92 1COV1 2RS12 5BNOC 1OOPA 1V9U2 1QJX2 1VBE2 4CDQB 5CFCB 4RQPB 5A33B 3JBG2 5D8AB 3M8LA 4EJRA 1VBB2 1RUE2 1PO13 5C8CA 1QQP2 1VBA1 3VBOA 1D4M3 2PLV1 5AC93 1ZBA1 1PO21 5JZGA 4Q4Y1 2WZR1 3ZFGB 1C8M2 1R091 4JGYA 4CDQC 4GB31
chains in the Genus database with same CATH superfamily
3VDDB 3K2OA 1UZZA 2AACA 5A3UA 2X09A 1HQLA 5EJ3A 5F5AA 1SCSA 1DYOA 1GNHA 1J3PA 3K3NA 5DXDA 2DCZA 4CEYC 4A7YA 4YRDA 3AP6A 3WOGA 3WDTA 4K40A 3J8F3 3FE5A 1ZBA3 3BPZA 3JD72 4OHWA 4DRVA 4KWJA 3PMEA 2JICA 1CZTA 3KV6A 3V0BB 1VBD3 1U5IA 3TEXA 3PIGA 1W6QA 3USUB 2HWC3 1REFA 2JD4A 3ZOIA 1NAEA 1WD3A 4QX5A 2VMDA 3MW4A 5BXXA 4UBHA 5FQ0B 5H9SA 5F7UA 1J1TA 3NAPC 1WW7A 3WT3A 1I3HA 4P00B 2C9AA 2BJSA 3POIA 4YGDA 3ZN6B 3OGJA 4QGMA 4D6SA 2J1SA 3H1YA 1RUOA 2K46A 2BDRA 2XLFA 4LO5B 3WNMA 5FY5A 4CCMA 1SHWB 3AB0A 4Q4X3 3SKVA 3KZ4C 2WNUA 5E89A 1QJZA 4LKFA 3RJ2X 2CV6A 4I0AA 1CVNA 1UAIA 4XVHA 3ZFGA 1W2AX 4BLIA 2VZVA 1RMU3 1JOPA 1VB4A 2VZQA 3OY8B 2JIGA 2RS33 2VOVA 4IGPA 4JGZC 3ACFA 1NLQA 4WVMB 4Z8BA 1H1IA 1QY4A 4X6QB 3ZDVA 5FZIA 4AQ2A 2AC1A 3ZXFA 1CZVA 2ZHMA 5T52A 4YM0A 2CGNA 2NM1A 2JKBA 1RUG2 2VQAA 3WG4A 4PBPA 5KXCA 2E26A 3C7HA 4IEVA 4DY3A 3UESA 5FXZA 3ZKUA 1MZEA 3TEZA 4CA9A 4YVWC 1EY2A 2GDFA 5FYCA 1V6MA 1YQ5A 2BGOA 1YIFA 3DPRB 1RXGA 2XWBB 3FUOA 3R4SA 5HXVA 1ZA4A 2RV9A 4FFFA 1X50A 3A21A 1ND2B 1AF9A 3MGUA 3ZFEB 4C0HA 3VBSA 1W39A 4IL7A 4NIHA 3TNQA 5SV5A 5BNNC 2HBTA 2KA3A 2OPKA 3WQ7A 3AL5A 5KXDA 4Q0UA 5GM0A 2J22A 3KVAA 4MGSA 3USSA 4HZFA 2LW8A 1AYM1 4NRMA 2W92A 1YQCA 1QOOA 2OUHA 4IGOA 4CDQA 1VAKA 5KXBA 1XE7A 1GANA 3FC0A 4L99A 5FP8A 1QJY2 4B1LA 4AEDC 3VBFC 4EV0A 1RUH2 5F2WA 3C7OA 4RS5B 2RDQA 5C5TA 1W6PB 1VMJA 1WMDA 4NRPA 5KHIA 1GQPA 1AL22 1DZTA 4RFRB 5HCHA 3ECQA 1YNAA 4CTEA 3GZEA 1OVPA 3U1XA 1UPIA 1ASJ2 1D2QA 4GB32 4AEJA 2VOTA 3ABZA 1GR3A 1PGW2 4LBNA 4YM3A 1C8M1 4PDWC 1UYPA 4ISQA 1RHI3 2WZR2 2XONA 3H8OA 3OG2A 2ZABA 1VLNA 1MQTA 5T5JA 4BMEA 5C3SA 3B93A 3LIGA 3C8XA 5FJKA 3L2HA 3AJYA 4AHYA 3AKRA 2D3PA 1DQ4A 1VBA2 5FPUA 1AYN3 2RR12 3HR9A 4S2DA 2EF6A 3ZO0B 2XUEA 2VCCA 5F8PA 4QB1A 1CX4A 2W3JA 4CCKA 4JVAA 2JG9C 2E32A 4Z82A 4XDOA 5FPLA 3ZR6A 1S0CA 1KJLA 1CQ9A 2AEYA 3VBHA 3OBRA 2WNVB 1AYN1 1BBT3 3NNGA 4CCNA 2QQLA 3DPRC 3VZMA 1VBE1 4RL7A 4I3PA 4RQPA 5JI9A 3RRDA 3TWIA 2YPDA 5FY0A 3S30A 4P9LA 1OLME 4FPGA 1NLSA 4Q4X2 3E5UA 5M0TA 3O1RA 1POV0 3I3DA 1PIV3 4FOVA 3T3YA 5JSPA 5LCWL 1RUJ2 4TLGA 1BEV1 1VRH3 3NSTA 4MYEA 3MV01 1Y9MA 2HEVF 5JZGB 4QMAA 4XXPA 2HYKA 1W8HA 3A7QA 4GALA 1YJKA 1GSLA 1O4YA 4AEMA 4KMQA 5FY8A 1IS5A 1AL23 4BM8A 1UO9A 4ASKA 4QX0A 1LCLA 2NZ9A 4AE2A 4XIKA 2RS51 5JOXA 1REDA 1GOHA 1DIWA 1BLZA 2UWBA 3ACLA 4IDZA 4JGYC 3RI8A 1UXZA 2GALA 5GALA 2BBVA 1D0HA 1PZ9A 4XIOA 2FQPA 5IK7A 1LOFA 1XU2A 1OLQA 2PQSA 4L8QA 2O14A 5FMOS 4CEYB 2DCJA 3JB8A 1G86A 1TNRA 3H8UA 4Q4W3 5I91A 3O0VA 5K0UC 2TUNA 2BNOA 1MZ5A 2HWE1 2XJRA 4FTBA 5KWRA 4COWA 4MADA 4YVWB 3M3EA 1STMA 1OVSA 1S2EA 1GICA 1BK0A 4XZUG 4XILA 2GN3A 2GC2A 1W03A 1TME2 4IEPA 1QJU3 4YZ3A 5LY2A 3ZVXA 3OGVA 2XUMA 3I54A 4QX7A 3FBMA 5F6KA 4IV1B 1E5RA 1YYNA 4P9WA 4JQTA 3ZN6A 5DUVA 2XG3A 1H8TB 2PHWA 1MVQA 2UURA 4QQLA 3ZXAC 5CEHA 2RS31 4NPLA 2ZBJA 2RM21 4ZKTB 2DVBA 5A7WA 4EN6B 1F15A 5L7OC 1RVF1 2VZSA 3W58A 1PGL2 3NMBA 1LU2A 2BU9A 3I2FA 4IUGA 3V65A 5IK8A 4K7JA 2R071 4MH0E 4QU2A 5E6HA 1H2KA 2YV8A 2ZAAA 4P02B 3ES1A 3W59A 2D6MA 1WLTA 1HRI3 4N90A 2Y6LA 2D6NA 4XFBA 3PVNA 3DF0A 3M3CA 3SNMA 3NKGA 3S5QA 4CCJA 1S0DA 2Y6HA 3I97A 4Q4V2 3IM0A 3THPA 1R081 2D6KA 1OOPC 4U36A 5F37A 1M4WA 3NWKA 3VZLA 5KHGA 3RVHA 3LA7A 2BOIA 1AZDA 2YGMA 1EV13 5LZ6A 4IV3C 3N7JA 2YFUA 3Q8AA 3VDDA 3KF5A 3SH4A 2BVVA 2I2SA 3K48A 3ROUA 2BNMA 3PVOA 4CUBA 3ZPYA 2VU9A 1V6JA 5A3WA 4AHXA 2JG9B 3EQEA 1RUD2 5K4LA 4PI0A 3ZM8A 4XETA 1OH3A 4BB3A 3BI3A 2DBIA 2ZGNA 1OF3A 3FJSA 2B7YA 1GNZA 4HVOA 2YBKA 1KEXA 1IOAA 3VV1A 1V70A 1KFXL 1WCUA 3D4KA 4FCAA 4RFT0 3WF1A 3WF3A 3CJIA 4CDUB 3RMYA 1W8ZA 3ES4A 3ZYRA 4ZPIA 5FXVA 3OYWB 1LODA 1RC6A 1UD1A 4ZXEA 3VBRB 1HKDA 2E7TA 1C8M3 1CGPA 1GUIA 2O0OA 4OMDA 3V0AA 4RGKA 4RGAA 4RHV1 1F5FA 4META 4Y20A 3DKWA 4GZ9A 1DU3D 4BZ4A 4BQ4A 4YG3A 1KRIA 4MGYE 1GZCA 1QJY3 1RXFA 1W6PA 1PVC1 2ADEA 3AVSA 4NHMA 4OLLA 1AR91 2OKXA 1HXS3 4DEVA 5FYMA 1FOD2 3FL7A 3GZAA 1J59A 3ORJA 1LTEA 1QQP3 1WW4A 3AZZA 3H0OA 3MIDA 2Y38A 4AVSA 1U5XA 2RMU1 1JYXA 4CPBA 1W9YA 2D3RA 2CGPA 3TN92 5CG9A 4CEWB 1JI6A 2J1UA 4AW7A 4XUOA 4YLZA 4LR4A 4F8AA 5EJ1B 1HDKA 4QKFA 2VZOA 1LOFC 2RM23 2JDUA 3WQBA 5IVBA 2EIEA 2UWAA 2ZGQA 4AI9A 1PHMA 4YZ2A 5J09A 2JEMA 5CBLA 1X8EA 3I2JA 3ZSEA 1N1YA 4XJAA 4LQRA 5FZ8A 5K7PA 1UU5A 5FZ1A 1IKQA 4DEQA 4UFLA 5FPAA 5LB6A 1DHKB 4OI0A 1GQGA 3LEGA 3EB7A 1BVP1 5AVPA 3VZNA 1F8VA 1BBT2 3NJYA 2C24A 2G9ZA 4R9CA 1AX1A 4A2UA 1UIJA 4Y1YA 4R4XA 3ZFEA 2C26A 5LATA 1ND2A 4JDOA 3FX3A 3BGAA 2HYXA 1I5ZA 2W1QA 4JAAA 3CF6E 3WP4A 2Y6FA 2Y8KA 4K1YA 2HWE3 4YVSC 4KWLA 4B1MA 4LKSA 2P3JA 1K5JA 2CY6A 2BZDA 2RS53 2G9FA 4JC1A 2VQ0A 3GHNA 5DDJ1 4AL9A 2E63A 2NP0A 4QPGB 5FLJA 3R6SA 1H8VA 2BRTA 1JW6A 2Y6JA 2FDFA 5A33A 5IVJA 3KT7A 2D97A 2Q1FA 1IPKA 5ABJC 1A8DA 3LEKA 3E6BA 4A41A 5LK7B 3OD4A 5CVRA 1UU4A 1XU1A 2JIJA 1ZBE2 4P9JA 1HQNA 3BIWE 1F5JA 2Y0OA 2QTWB 2ZGSA 4NHXA 1ULOA 2JDNA 2XJPA 3NNFA 1XSQA 2RDSA 2ZGTA 4RQPC 1GOFA 3K3OA 3V56A 1Y43B 1YQ2A 2ZA9A 2F17A 4PQ9A 5K0UB 2PAKA 3VBHC 5FAXA 3VKLA 1UZ0A 4YVWA 4DQAA 2BWAA 3AMPA 4I09A 1VBC1 2QZ2A 3LF7A 3RI9A 4I02A 4ASMB 4CCEA 5EV7A 5BY5A 4WBBA 1DDLA 2Q0AA 2XJUA 3KV5A 5C9AC 2DUOA 4Y5Z0 2VH9A 4RSUA 3O5SA 5FY9A 1IS4A 4CDUA 5IAXA 4AFAA 4IEZA 4YGEA 2HH9A 4GH4A 4HN0A 4Q8LA 2Y60A 3MLLA 1MR5A 4CCLA 2FZ2A 2N7GA 3I3BA 4OUEA 3ZFGC 4D69A 2ET1A 2ZOEB 1MS9A 5FIXA 4IE4A 5JMCA 1ST8A 1NZCA 1RYYA 2EAAA 5CYYA 1N3QA 2XXZA 2L9LA 2WNUC 5TSWA 2VXRA 1G9CA 4DIQA 2ZEZA 2R1DA 3AZYA 4EYUA 4FTEA 2P4EA 4HBNA 3RZJA 3JBG3 1KDKA 5HI0A 2XBO1 1VPHA 3AC0A 2NQYA 1IGOA 4IGQA 5C4WC 3MIHA 2JWPA 3RWKX 2JG8B 3MIBA 4SLIA 5L19A 4WM7A 2CWMA 2CDOA 1ODMA 5DG1A 4DXSA 4FQZA 4ARYA 1YXWA 2DCKA 4FPOB 2CWSA 1UKGA 2D40A 1N47A 3T30A 3OB8A 3ACGA 3LE0A 1R1A1 3WP5A 4MXVA 1ENXA 4LHKA 3LEMA 2VJXA 5HV4A 1KS4A 2TEPA 3LA2A 3VDAA 1LB2A 2QVSB 2D98A 3THDA 5FZ6A 4PF5A 4QHBA 4V1PA 2WYSA 1AJKA 3ZMNA 4YVSA 1KQRA 4XYXA 5FKBA 5FYYA 2JDYA 4LXLA 4XDQA 4XCAA 4C1XA 4FQ4A 2VZPA 3GALA 3HD8B 3I3EA 4AFMA 4BA6A 2IXCA 4HFSA 5LY1A 4QDQA 4FOQA 1GMMA 1CIYA 3HNYM 3D82A 3N9LA 5CAZA 4MSVA 3TRSB 3H3LA 2D43A 3O0WA 1V00A 2LM3A 4Q4W2 3NAPB 1EV11 3I8TA 3PJQA 2BEOA 4B7EA 1OQDA 1S0BA 1DQ2A 3LQCA 1YFYA 4W6WA 4BXFA 4R9AA 4LBQD 3ZSMA 4HN1A 3ZR5A 2PN5A 2PAEA 2JDPA 1FI2A 4JDMA 4QXKA 3SKJE 1LEDA 5CFCB 3C2UA 1E5IA 3POWA 1O4TA 3A23A 4JHTA 2FCUA 4BK4A 5A33B 1SPPA 3G6JB 3JBG2 1JBCA 5KBFA 3UKNA 1GV9A 1VBB2 3SEEA 1UX7A 3O1PA 5A7PA 5C8CA 2V09A 3S57A 5IYYA 3AKTA 5DMYA 4AQSA 2GN7A 2ZJCA 2Y6GA 3N7MA 1D4M3 2JB8A 2A6XA 5LWBA 5FP7A 2PLV1 5B4NA 1Y9GA 5EYYA 1WCSA 3E5XA 4XMAA 4BQYA 1DFQA 2WIIB 2WAAA 1SACA 2AR6A 3CHXA 1DYKA 4LUMA 4XBNA 5C8WA 2GMMA 2PHLA 1H9WA 2XQXA 5C3PA 2PLV3 3BALA 1FV3A 3FUQA 1Q8PA 2H6CA 2K2SA 5LBCA 2D5HA 5A6XA 3H8RA 1DLLA 1S0JA 4HETA 1ZZ6A 3T4VA 4G9SB 3OUHA 4CP1A 3QD6A 5EYXA 3LB9A 2Y34A 4BK5A 2IXJA 2GC3A 1RUF2 4OHYA 2DYCA 2WRAA 2Q8OA 3VBFB 3WEZA 3IWZA 3TBDA 3N9OA 4Y22B 5F2SA 3U78A 5DPNA 1HXS2 3LFMA 3A22A 2NMNA 4INDA 1OMIA 2VBBA 5JXHA 4BQ3A 5J3UA 4R9DA 3AFKA 1RUC2 2XB6C 4ITCA 2ARAA 4M0HA 3BB6A 2BUKA 2WNUB 2MNGA 1YQ6A 1RUF1 1ZRDA 1ENRA 3HOBA 1RUI3 2VCAA 3W9AA 1CZSA 4H3WA 1JN2P 1VBC3 4E4HA 3EMRA 5IK4A 3AJZA 4WM7B 3PVEA 4DY5A 2FDIA 3GGLA 3RQ0A 1XYOA 3MLKA 4K20A 5BNOB 4R9BA 1SLTA 1D4M2 3T4HB 5JR2A 3WW3A 1KDMA 1V6IA 4H14A 2VW1A 5JLVA 4BQWA 1B35C 2VM9A 4J6GA 4GJYA 1BEV3 2HWC1 3J7MA 4X6RB 4XF4A 2OW4A 3ZYPA 1J84A 2X5IA 3BKZA 2V72A 4BIFA 1UOGA 4YNIA 4QD2A 4LOTA 1TMF3 3ELNA 4FPCA 2DTWA 5ABJA 1XQNA 4LUKA 2ZX0A 5A32B 1AYM3 5J98B 3OEBA 4XF0A 3I4IA 3E97A 2VZ1A 3AKPA 4JZRA 3JBG1 1V6OA 1IS6A 1PVC2 2EIGA 2G9GA 1IQDC 3SCHA 4CYDA 1RJ7A 5CFDA 4ZU7A 5A7WB 4XUQA 5JZGC 3RNSA 5A6ZA 5AC92 4DB5A 4QX2A 1PMHX 1VIWB 1LECA 3DXTA 3RYRA 3O1MA 2ET7A 4ARXA 1G9AA 4Q4W1 3KLSA 4CU7A 2W1UA 4KWKA 2O8QA 3BVCA 1UZWA 4OQ8A 1JZ4A 4N7UA 5ACA1 1D4VB 1NE6A 3ME2A 4IEOA 4Z1VA 2AGSA 3ITQA 3O1SA 1BMV2 4A7ZA 5LW9A 2RG4A 1VBD2 3FFZA 3R4UA 4ET7A 1KFUL 1LENA 3MIEA 4K8RB 1OBNA 1RUD1 3DL3A 2E31A 3GNEA 3JCIA 1WW5A 3OCPA 4FFGA 4AI1A 4XF1A 5DABA 1GOGA 1JZ8A 2JJ6A 5JPNB 1ULFA 1SLIA 2R0FA 4FPJA 4QKBA 1T2XA 4C91A 1NCRC 1O8SA 5FLHA 3TNPB 2X5IB 3K75B 5DQ0A 1KS5A 2WT1A 4C0BA 3KT4A 4QU1A 3GYDA 4XW3A 1LOEA 3I2OA 2HBUA 5JCTA 4NE9A 4OHZA 4O9GA 3PLQA 4A6OA 3GBFA 5JOZA 4JTOA 3OBTA 2ZTNA 1OT5A 1XC6A 4N9IA 2XBO2 4ZS2A 3BCWA 4IERA 1JYWA 1H1AA 5F32A 4JTNA 3OYWA 1MACA 1WZXA 3HQUA 1N3OA 1Q5OA 4QXCA 1XBFA 1T6GC 2XWJB 5AVAA 2GNDA 1U0AA 1PX4A 3CU7A 1RITA 3P3PA 4XQDA 1AXZA 1ULCA 4Q4V3 5GJ6A 4Y26A 1BQPA 5F1RA 4A7KA 1FNYA 1QEXA 3POEA 1DGLA 2Z42A 2DURA 1W9WA 1ZRCA 3UGHA 3CZUA 4N7IA 5CU1A 1O3QA 1C5HA 1NY72 3B9CA 1TME1 4CU9A 2QQNA 4TWTA 1OURA 3IIIA 1XNTA 2VR4A 3N35A 1UXXX 1MQTC 1Q8OA 4ONUA 1CESA 1W2OA 1DBNA 1OA4A 2B45X 4P9GA 2IFWA 4LLOA 2WZPP 4JGYB 4AGRA 4YYOA 4X8PA 4YW3A 2V4VA 3K46A 3NNMA 4C1WA 2IXHA 2QZ3A 5GZFA 4XHXA 3KVBA 3UGFA 1AR83 2P37A 1HN1A 2WZ8A 1CAXA 4A45A 1RGSA 2K0GA 2LROA 4M3CE 3POGA 1Q8QA 3PMSA 1J1LA 3WF0A 2WABA 2YC2A 4IEUA 4LHLA 1RUH3 3H7YA 4LTAA 1XNDA 1XE0A 3O14A 4IV1C 1RUF3 4XABA 5C8CB 1R64A 2YMZA 3DYMA 3GHMA 1NCQB 2Z69A 2W52A 2LTNA 1W6OB 1LGBA 3W21A 1RIRA 2W1SA 2FMDA 5JXJA 2X8KA 5BNPA 3H8XA 2RMU3 1LHUA 4AEKA 1ULGA 1QH7A 2WNVA 2WN2A 3K4DA 4CUCA 4PJYA 2VZRA 1UCXA 2HWF3 4Q5OA 3VKMA 3D5OA 4CDUC 1US3A 3GCWA 3VBSC 1HB2A 3WG3A 3WW1A 2WFPA 3S7EA 1OKQA 2BV4A 2DUQA 4PCRA 5DDJ2 3WG1A 3VD4A 4ZHNA 3BIEA 4QX3A 1RUG3 1POV1 1S55A 4JDNA 2VZUA 4MLOA 3SQOA 5GLTA 4CDWC 4OVEA 2VUCA 1PNGA 4EZHA 1CAVA 2VMHA 4MOAA 2DCTA 2WAOA 3I2HA 2VY0A 1KXGA 3POBA 5CZKA 4JGZB 2C5DA 5T3NA 4FI9A 4A3ZA 2VZTA 1K42A 5FBZA 4XUPA 3OOXA 1UY3A 4IV3B 5KHKA 4HANA 1UNBA 1SZBA 3TOJA 2P3YA 3VL9A 5DUUA 5DAVA 3W5MA 4AR2A 2ETEA 5FZOA 1V9U3 3T1LA 4GH4C 4XFGA 2R6QA 4YM2A 2KXLA 4KH9A 1N3PA 3VUOA 2PTMA 2RR11 1XSRA 3I2DA 4FVVA 2ZZQA 4LLFA 5I8TA 4J25A 4E8CA 2JDKA 1ZYBA 5FK8A 2D7FA 5T5LA 1FPN2 2YBSA 3THTA 3PTYA 1XNBA 5A3LA 2G4IA 3JQWA 2KM2A 2NPIA 4XFCA 1VALA 2AZ5A 5FKCA 5CB7A 3SC7X 5IAVA 2VNGA 3GBGA 4AFBA 5FP4A 4BCUA 5IT6A 2OX0A 2MEV1 3NL1A 4N9HA 2EALA 3E1F1 3ZFEC 1U5ZA 2ZAHA 1RUH1 2YZ4A 4LOSA 1HRI1 3T08A 1OPOA 3MICA 4F83A 4MGKE 1QJY1 2ZHLA 4EN9B 4KNCA 2VW2A 4Y1UA 5A6QA 2EIBA 4MGZE 3RGBA 1HRV1 2WQ8A 5FYSA 3FN9A 3VBSB 4BLJA 5H9QA 2R073 4AI3A 1O91A 1H2MA 1QKQA 4LBOA 2H0BA 2PMWB 3LPFA 5FZKA 4HL0A 1CAUA 1OUSA 2V4AA 1L7RA 1Z78A 1JMUB 4NRQA 4FFHA 3WW2A 2HWD1 3CL1A 3IDBB 2EXJA 1Q3EA 1IHMA 4CUGA 2NMOA 2SBAA 1F4HA 3C7GA 3OPZA 1NCRA 3OUJA 1ODNA 2W46A 1Q8SA 4W4ZA 4CXWA 1KITA 1GNYA 4WZFA 4XUTA 2A3YA 1E5HA 3N9NA 3EYPA 3RFRA 5FV3A 3UJQA 3I49A 1BK1A 1YCIA 3NAPA 3PL0A 4ZONA 4MGIE 3ZKYA 4UXAA 3I2GA 4YPJA 4M01A 5KC5A 4B3NA 3GZUC 4MGQA 1IQAA 1RUG1 1YJLA 2VUAA 1WWYA 3JD73 3MUZ1 5JXIA 1ZZ8A 4TYSA 1OI6A 3O7OA 5DAXA 2VVFA 5GLWA 5FOJB 2RHPA 4N53C 3N3HA 2BFUS 1XOYA 4L92A 1DGWX 1JYNA 5CKMA 4XJUA 4Q27A 2VW0A 4QB2A 3T2OA 1PVC3 4CU6A 5GZDA 1G9BA 3NJVA 3PVBB 4HVQA 1J58A 1R082 3DKQA 4OZOA 1K45A 1O6UA 1LHWA 1FMD3 1WUVA 5E88A 4ATFA 3L9JT 2FDJA 4OHVA 5CFDC 4QQPA 1RUD3 4MHUA 1EUTA 3KGZA 4LKEA 5DZEA 4R4ZA 2QE3A 5KR7A 3NV1A 3QH6A 3FLRA 5C3QA 5FMBA 1RJ8A 2VCMA 2F4PA 4XQWA 3CJIB 3M70A 4Y3OA 1W2NA 4IE6A 2W87A 2YYOA 3FHIB 3T2QA 1WBLA 1UY4A 4H2AA 3E5QA 1DYPA 1YEWA 2WYFA 3J4UH 3I59A 5IVVA 3DYPA 1SMVA 1F4AA 2HWD2 3KV9A 5JAXA 2RS32 5EP9A 1COV2 4Y20B 2WS91 5IVYA 2DDUA 2R30A 4J1WA 4D0QA 4XURA 4COYA 3J7NA 3HQRA 4Y1XA 2WINB 2PHRA 3GJBA 1HRV2 4AQ6A 4HPKB 2W1WA 1LGCA 2V73A 4CDXA 3ILNA 3NQHA 4TLFA 4FOYA 5BNQA 2A7AA 1OFSA 3H3ZA 3LPGA 2BPA2 2ARCA 2JE9A 2PAMA 2HWE2 2MEV2 3B02A 1W8FA 3P3NA 2IUWA 4CCCA 1RUNA 2FDGA 1WLCA 2R0HA 3JU9A 3U14A 5C3RA 3LZZA 2Y33A 1TE1B 1ZRIA 2VVEA 4GXLA 2J7MA 3AKQA 1YC61 1DQ5A 3ZYGA 1AJOA 1R092 1VBB3 3RS6A 4A3XA 5F5IA 5F6LB 2Y26A 4B8EA 3AMQA 1XNCA 3KB5A 2IXLA 1DQ0A 5C71A 4D7YA 5J48A 3IDEA 2IXIA 2J1TA 5EIYB 2IVJA 2V5YA 3QCWA 4NVPA 1FX5A 2ZZJA 1I9RA 5L7OB 2BBAA 1S2BA 5C70A 2XPJA 2LALA 3SISA 4UOJA 1ZRRA 2R49A 1SFNA 3B7MA 3VBUA 4AG4A 4PLOA 2DUPA 5D21A 5FY1A 2GP5A 2Q4SA 3BU0A 1RUJ1 4RR3A 1CN1A 1CONA 4JKLA 2PHFA 3M3OA 5GLZA 3PUQA 4QX8A 4FOWA 3PUAA 5GKAC 1GZ9A 1JXNA 1ZNPA 2EXKA 1S0GA 1H6YA 1XRUA 3M4FA 2WT0A 4V2VA 4XBQA 1CAUB 2BTVC 1W8WA 1DZRA 2QQUA 4MX3A 4QAWA 4A42A 4CZSA 4DZGA 5BYNA 3WP6A 1OLMA 3P6BA 5F3EA 1WA6X 4CDXB 1HW5A 2E6VA 3NV3A 1XYPA 3AYCA 2OT7A 3M1HA 3OBAA 1R1ZA 2Q8DA 3T0DA 1AYN2 4IV1A 3MO4A 4D6RA 2Y0IA 5J37A 4PHZA 3KD4A 2MEV3 4LO7A 1UZVA 1TVGA 3NKTA 2IC1A 4BPZA 4LIUA 1RL3A 4YGCA 5A3PA 4LE3A 3X29B 4URAA 3NNLA 3THCA 5I93A 3MF9A 1L3JA 1UYZA 4YW1A 1ASJ3 4C90A 4DXRA 2I45A 4P5YA 4NIDA 4OUMA 4BWOA 1JYIA 1WKYA 4M3CA 3IPVA 2W68A 1F2NA 1H4HA 1ZZ9A 2D5FA 3GBWA 1MZFA 5K0UA 4EWDA 1ASJ1 2Z4FA 4XTPA 4EROA 1AR71 5JPMB 3H3UA 5IUQA 1QGLA 1CPMA 4M3CB 1QF3A 2DTYA 5I0UA 5FUIA 1AL21 1V0AA 5KHHA 4IQPA 4GWIA 2E33A 4P08A 4RR3B 4D94A 1QDOA 5CFCC 2DVAA 2EVXA 4XAAA 4XCBA 3RMXA 4LPLA 3RDIA 1MEC3 4FTSA 2D6PA 2NN8A 4FP3A 1NY71 3FMGA 1POQA 3DECA 3LGRA 3WDWA 2R043 1ZM1A 4LBMA 2WS92 3RJRA 1COV1 2ATFA 2EICA 3JQXA 4BE3A 4FBFA 3H42B 3TAYA 4FPFA 5IVFA 4WVZA 1VMHA 4FAGA 5BNOC 4Q29A 1YI7A 1DGWA 3RYKA 2W08A 5EZWA 3ACIA 3MBWA 4E9KA 1SLLA 2PHTA 4RQPB 2P3KA 4CU8A 2QDNA 1GZWA 3FWEA 4XMIA 1RUE2 4LA3A 3KCYA 5LA2A 3VHOA 2XJQA 3WQ1A 3VBOA 5FPBA 2F4LA 1QU0A 5AC93 1SCRA 4NJ4A 4S2HA 2XDVA 5JZGA 2UY9A 3WDXA 2B39A 4D8MA 4RYDA 1AHSA 4CDQC 1PM7A 3N9MA 1ZZBA 3N9QA 1C4RA 3MPPG 4MXWA 3OD0A 2KR2A 1GLHA 4XZPA 3B5LB 2P17A 5FYTA 3B94A 1W6OA 5DZFA 1MZ6A 2RVAA 3D0JA 4GULA 4PQQA 4DXTA 1ONAA 1VBD1 3HN3A 5BNPC 1HX6A 1VAVA 3ZXJA 4QPYA 4JGZA 4AVTA 5FZGA 1PK6A 1BMV1 1LJ7A 2O8OA 1AR82 4IV3A 2ZS6B 4HONA 1FNZA 3AP9A 2WL1A 4OHXA 3U11A 3J8F1 4AVAA 1S0FA 4DINB 3PIJA 2JG8C 3IDCB 5HCFA 5I8YA 2C6SA 3AMNA 5FZOB 2OZJA 4RN5A 4N43C 4IEXA 2OQ6A 2JDZA 1W2UA 3MPBA 4W65A 3K51A 4CUAA 2QQJA 1TEIA 1SFPA 4Q1PA 4M0NA 4XTMA 1SBFA 4QDSA 1HRI2 2PHDA 1JYVA 3MHZA 1C28A 1H8TA 3APBA 4HOOA 4O9EA 5JOWA 1GZTA 4CXXA 1WCQA 2A3XA 1GP6A 5FZAA 5KC6A 2ZGMA 4URTA 3NRUA 1DP0A 4IE5A 1HIXA 5L7OA 2XKOA 2PHXA 4B4RA 1K5MB 5HBAA 4D6QA 1MS5A 4XEZA 3TEWA 1DGRA 1QNWA 1NCQC 3KT1A 2YFZA 2XHNA 4KGQA 4MZUA 2VBPA 4Q4Y2 5FXXA 1FPN1 2F6BA 4Y5TA 3S0MA 4LHSA 3Q8CA 4UF0B 2A1XA 3FHQA 4COVA 1NXMA 3ZX7A 3MZHA 4UW6A 4OCTA 4YGBA 4FPYA 3JZVA 4QB6A 4IE0A 3SH5A 4AEDB 1GYKA 4QPGC 1EUUA 1AR93 4QKNA 3RZMA 2WJSA 1EPZA 1ZZ7A 4N53A 5EPAA 4FXGB 5FP3A 4IXLA 1UMIA 3D0SA 1Z7S3 1JZ5A 1BVVA 3IAQA 2JDAA 4D3WA 1DGRN 1OKOA 1N1VA 1QXPA 1H1MA 2JKXA 2W95A 4CRQA 2DFBA 5FRAA 1RUI1 4AZZA 3URFA 1WD4A 3DPRA 3ZFFA 1JZ2A 2VE1A 4HLTA 2QQMA 4I3GA 5F5QA 1PO23 2QQPA 3R0RA 4UFMA 2JE8A 2OS2A 4KBBA 2VECA 2HWB3 2XL7A 1QHDA 4CP9B 1HV0A 1H6XA 3RZLA 5FUPA 5AFBA 5FZFA 3KGLA 1HV1A 2J1AA 3KCCA 3O12A 1JUIA 1JOJA 1WBFA 1AR62 2Q1MA 3OY8A 4K3UA 1F35A 1MPXA 1QJU2 2GAUA 3A0NA 5D8AA 4LIVA 5K9YA 2D93A 3GXUA 5EQUA 2BQPA 2WR9A 4GQ7A 5CG8A 1X36A 3B01A 4XFFA 2VNVA 4Y33A 1O5UA 1OD5A 4GMP1 4AI8A 3QACA 1COV3 1I5PA 3POFA 4DOUA 1Y7BA 2WUHA 3PURA 4S2GA 3ZXGA 4EE2A 2JG8A 3W5NA 1MEC1 4YVSB 3ZSKA 1QWRA 1W90A 5CISA 1NCQA 2B4KA 1OHFA 3EXUA 2W9XA 2HKXA 3WXPA 1U5YA 2XJTA 3FZ3A 2VUJA 3HT1A 2DU1A 1R1A3 5BNPB 4OI1A 3VD9A 2XVLA 1UL9A 3WDUA 1CIWA 5ACA3 1S4CA 2XVKA 1LR5A 1UU6A 4RHV3 3ZDSA 5A80A 5C9AA 3SHRA 4UYBA 1W3XA 1G9DA 3T09A 4WM7C 3CO2A 1BKZA 1HJFA 5C5UA 5JOYA 3OPWA 1GBGA 2CTVA 4Y1ZA 4G3YC 2WWJA 1W6NA 2R32A 3MEPA 1CAVB 5HXMA 2CAVA 4WZCA 1UMZA 1VP6A 3HNBM 4YW7A 1WW6A 1HB1A 1ULEA 5AFEA 1B35B 2JECA 2VMCA 4W6YA 3VLBB 3ZLIA 4LNVA 4L11A 4LITA 4P9XA 1PZ8A 4TN7A 3Q9OA 4WV8A 2ZMKA 2Q1ZB 3WHTA 1NLRA 2YU1A 4FXKB 1UQXA 2VTXA 4Y4RA 3RWNA 2ZACA 2VNOA 3VZJA 4KBZA 2W94A 1NG0A 1CJDA 2ES3A 1JS9A 1ALYA 3G7DA 3D6EA 3HVDA 4ZU4A 5FYBA 3VHPA 2X10A 3LD8A 2J1VA 4JHZA 2I07B 3MUY1 2CHHA 4RA0A 2VGDA 1NA1C 2YHJA 3B00A 3SMHA 3GDBA 2WFF2 1VE0A 3ETQA 4AYUA 3DXUA 2YGLA 4LMFA 3PUHA 4B4PA 1HB4A 4PBOA 1SBDA 3NNJA 4RS5C 3LEIA 5FZCA 4YZ5A 4EN8B 4YW4A 4NWVA 3DUIA 3I7DA 2ZHKA 5BV6A 4XF9A 3I2IA 1ZVFA 4EN7B 3AX4A 4Q0VA 1GFF2 1CAWB 4E4DX 3MYXA 4GWNA 4BH9A 5ACA2 5J36A 4YW5A 5JMOA 2DBNA 1IG3A 3O0XA 1WCKA 2WA3A 4I0BA 3CBNA 2MPFA 1LULA 2GH8A 5IVEA 1W9FA 1W06A 3RG0A 5AC91 1JH5A 1B09A 4HK8A 4UW5A 1DZQA 4YSFA 2JDHA 1LHVA 4HVRA 1FMD2 1D2SA 1SDDB 4FP2A 4LORA 3WW4A 1AXKA 1XB9A 3EHKA 3KMHA 4XJ8A 1UOFA 2R042 2A71A 4QQHA 3IPVB 4AAXA 4ZZ5A 5BUVA 1LU1A 2OPWA 2VQUA 3USUA 2LUWA 2QNKA 1VBC2 1UKRA 3TEYA 2G19A 3LA3A 2A6ZA 2JE7A 3RZKA 1JZ6A 3PDQA 2R062 4QT6A 3P1IA 3WF4A 3OGGA 1Z7S1 4HT1T 1SG3A 5DN2A 2GP3A 2H0VA 4NROA 4QPIA 3UT0A 1QJEA 2HWC2 2ZKLA 3KHBA 5FZBA 2HWD3 4YARA 3PU3A 1A78A 3WUDA 2WSVA 1A8MA 1NKGA 2H6BA 3NJZA 4GKYA 4MGTA 1D4M1 4L2NA 2W39A 4M4RA 3KCXA 4MXWB 3WF2A 5CFDB 3RZGA 1OUXA 1LAJA 5DG2A 2ZCWA 2YDEA 3AP5A 2YPJA 4X8NA 3U4SA 5EWSA 3ZFFB 3MV11 4NPMA 3QH7A 4GA9A 1G9FA 2VVDA 4IW3A 3F2ZA 3H1MA 3OGSA 1OLRA 1OH4A 2E7AA 3S6PA 3VBUC 2GMEA 1M06G 4BQXA 2ZHNA 4P5HA 1ZZCA 5DDJ3 5A70A 1G7YA 2RR13 3KHCA 4CEWC 4XAEA 2XGXA 3MFCA 3OEAA 4HKOA 1RUC1 2R16A 4YZ1A 4AK3A 3HEIA 1LESA 4XPVA 5I0TA 1LHNA 2E7QA 4H7LA 1W8NA 1W8OA 4GKXA 4LEJA 3VZKA 4GMP3 1JHNA 1HXS1 5A7QA 5B2GB 1C1FA 4W50A 5CA6A 2ZGPA 2XLGA 4P14A 5D2AA 5I0RA 3BN6A 4LBQB 1B35A 3WNOA 5F5CA 3DN7A 1BBT1 2XL9A 5F3GA 5FMOL 3WZ1A 1JTZX 2YC4A 3ZYFA 3V0AB 1MS4A 1W6NB 2OXBA 3PNAA 1PO12 5FCCA 2C4XA 1Q43A 5FFOC 2IVIB 2WWUA 1VBE3 3ATGA 4UI9L 5FK7A 1KD7A 1PK6C 1EP0A 1RINA 1UYYA 1WGPA 4YM1A 2WS93 5T5PA 2BGCA 1NA1B 4MHRA 1X82A 1AUYA 2KD7A 3M3IA 2PLV2 3RYPA 3LDKA 2OVUA 1EPWA 4CDWB 3CLPA 3TN91 1W0PA 3EBRA 3WP3A 2QQVA 1W04A 3IB3A 2YG0A 2WO7A 2JENA 3NJXA 4RR3C 5FZ3A 3WDYA 2JD9A 2Y64A 1W9SA 5E1RA 3MLJA 1VBB1 3VDDC 2YBPA 1FOD1 2CYFA 3I59B 1W99A 5FZ9A 2P5BA 3OGRA 5A7NA 4Q8KA 4CCOA 5FPXA 4YW6A 4BU2A 1GKBA 1JU3A 1YFUA 2J42A 2P6CA 1NUKA 2VOWA 2VTFA 4TSVA 1DCSA 4RHV2 4XXAA 4AVVA 4A4AA 3C3VA 5KHJA 2UY8A 2XJSA 4WVVA 5JXGA 3IAPA 3FFQA 3DGTA 2QBXA 3CEWA 4GIQA 1EV12 1SPPB 5FYZA 5LRRA 4FO9A 2C1FA 3VKNA 4AAPA 5ISLA 4LBJA 3VDBA 3K77A 5FXWA 2JXAA 1UPSA 4Q0PA 3MW3A 4DUWA 2CSGA 1CAXB 2PFWA 4KU8A 4Y22A 1TG7A 1QNYA 4R8HA 4O7XA 4AOCA 1AL0G 4GWJA 3P5BA 4UFIA 4DMIA 3AXEA 3UL2A 2LRPA 2YB7A 1LOGA 4QGNA 1RHI2 2WZR3 3T0BA 4ISRA 5ANNA 1APNA 3CKHA 4Q26A 3U75A 4XFIA 3IN9A 3TYJA 1O7FA 5C8CC 5FZ4A 5FP9A 3UNPA 1BYHA 2OA2A 5GLUA 3BYWA 5A1FA 4QXBA 3POJA 1R1A2 2D6LX 5FYHA 2XHKA 2QFEA 3AYAA 2BWCA 2B46X 3QOPA 4R52A 1ZBA2 2PA7A 2WKKA 4NHYA 1W05A 3POSA 3WLUA 4KWUA 3UKVA 2A3WA 2R1BA 3VDCA 5BNOA 4BHPA 1CR7A 5A6YA 3F95A 1QQP1 1T6BX 5T54A 1GQHA 3BTXA 4BIOA 5LA9A 2B5HA 3CIHA 1EAH3 1Z0HA 3ILRA 2Q8EA 3WD5A 1W6QB 3ZN5A 5C7GA 2Z5WA 1ENQA 1H30A 2ENRA 5FYUA 3BODA 4Y4YA 4NIAA 5FREA 5GZGA 4IEQA 4JX0A 1RVF2 1LOAA 3AP4A 2D44A 4ZXKA 1PGL1 1EAH1 4IESA 2RM22 5A3OA 3VBRA 2EAKA 5JWPA 2W0XA 3INAA 1GWLA 5FR3A 1KGYA 2DFCA 3TB0A 3KSCA 4ZU5A 5GLVA 3WVJA 3MW2A 5L9VA 1Q56A 4QPGA 5FZLA 1W0NA 1TMF2 5BNNB 4KL1A 1I6XA 2X29A 3BTZA 1WLDA 1OD3A 5J7MA 5HPOA 1RMU2 4O65A 4AI2A 1FV2A 3V64A 3IMMA 3T2PA 2ERFA 5A7OA 1HB3A 1LRHA 3KWVA 1RUE3 1VAMA 2WN3A 3SITA 1ND3A 2R063 5IJRA 1HQWA 1OA2A 3HIFA 4MV2A 4QPIB 3IMNA 4COZA 5EJZB 3LSEA 4B29A 1RUJ3 5F3CA 2ZGRA 1UN1A 2E9QA 2VTXJ 3WX5A 1REEA 1O4ZA 1IG0A 3AM2A 1H9PA 4HKWA 2WDBA 1W3VA 3SCGA 1GP5A 3FBYA 4HK9A 5FZDA 4FFIA 5A32A 3PUSA 3GF6A 4AGGA 4AEDA 5JUVA 1NX9A 5L9BA 4F3JA 5IFTA 2NLRA 5L36A 3AYEA 2RS52 1ZBE1 1YQ8A 3LCPA 4UF0A 3CZJA 5LEJA 1PGSA 2VMFA 1JOBA 2DWRA 3H9AA 3LDBA 2ZMNA 3OSDA 4AGVA 4A44A 3ZYBA 2EXHA 3WNLA 1R093 2XMLA 5C4WB 1RMU1 5GZCA 2CNAA 5FPVA 2VMGA 1R083 4PDWA 1OOPB 3KV4A 1RVF3 4MO3M 4EWEA 5EFUA 1V6NA 1G6NA 3IT8A 4SBVA 3VGIA 1AR73 1IPJA 2TNFA 3ACHA 5C4WA 3ZIXA 4E2SA 4E8DA 1YLLA 3PU8A 2VMIA 4O61A 2XVGA 4E2QA 4BJ0A 1OOPA 5JIUA 3JUUA 1V9U2 4UAPA 5FO8B 4PF1A 2B42B 3ZYJB 5A3TA 4LHNA 1VBE2 4C8DA 2FMYA 2YU2A 4OMCA 4CDQB 1GP4A 4ORFA 5C9AB 3NO8A 4JV4A 3I3QA 4HMZA 2DVDA 4LO4B 1JYCA 5D8AB 5FBJA 3M8LA 4EJRA 4OI2A 5FYVA 1MVEA 1W8UA 1PO13 5IATA 1QQP2 2VCBA 2Z79A 2W91A 3HBZA 1QMJA 4AFCA 4RGGA 5SV8A 5JIAA 1VBA1 1JZ3A 1N1TA 4DXZA 3AL6A 1QH6A 1UF2C 1OQ1A 5FO9B 1D0GA 1ZBA1 1QOSA 1PO21 1QXRA 5G05L 5GZEA 2WZR1 1LKNA 3S7IA 1JHJA 3NV2A 3ZFGB 1C8M2 1GWMA 3OBZA 2W47A 3HQXA 4JKKA 3FHAA 4GB31 4NR1A 5FMCA 1ZREA 3K4AA 2ZMLA 3PUIA 5JDBA 2RMU2 2WLPA 1QOTA 2WT2A 1RHI1 3ZYIB 3VBUB 5A3NA 4BXSV 4OQ9A 1OXCA 4K9SA 5J96B 4AFDA 2VOKA 1RUC3 3WQ0A 1AR92 4LO6B 2GU9A 4UFHA 2A73B 4XJ9A 2GC0A 2VZ3A 4IEYA 5HV0A 4CP2A 4N43B 2GNBA 4ZY9A 5JR7B 4PIZA 1G8WA 2YY1A 1LHOA 2PXJA 1AX2A 4L9BA 4MUVA 5LBBA 1A6CA 5FZ7A 1YFWA 1FPN3 3ZIWA 3H7JA 2A5ZA 4GAZA 1HLCA 2GC1A 3IBMA 3O1OA 2C0ZA 1FATA 3CDZB 3LFIA 5DAPA 3HWJA 3ZN4A 2J1EA 4XHBA 1S0IA 5FYIA 3BOWA 4K6BA 2Z2SB 4M3CF 4OI4A 4YW2A 3LSDA 1ND3C 4BDVB 1IKPA 1JUHA 3R4DB 3SH3A 5D8AC 4EN0A 4OFGA 2OIIA 1K5MC 5IK5A 1O8PA 4WVMA 3BU7A 4QPIC 2RJLA 1JU4A 2FCVA 3AZXA 3FLPA 4YG0A 2BERA 1PM4A 4NO4A 1DQ1A 2D3SA 1OQEA 2WC2A 2GSYA 5FY7A 2BGPA 2D6OX 1X9PA 1YO8A 5DAQA 3O1UA 4HSLA 1S2KA 2FBEA 3CNAA 3U37A 1PO22 1TNFA 1XNAA 4K21A 3RZHA 3JB4C 3I3MA 3GCXA 3WINE 4Q4V1 1VBA3 1ULDA 1FAYA 2CGOA 3A0KA 3ZXLA 2O1QA 1FYUA 3RPQA 1LEMA 1KJRA 1PO11 2XKPA 3I2KA 1SQ4A 5JSOA 3U4XA 1W9TA 5DUWA 3E6DA 2ZX1A 3WHUA 1SFYA 3ZMOA 2R072 4AQTA 3VHNA 2DVGA 1GU3A 5EHDA 1BZWA 1WMEA 2XOMA 1SEFA 1ULPA 1L7QA 4GWMA 2AUYA 1V9U1 2XJVA 2IWGB 1WLWA 2PHUA 3Q8EA 1YWKA 3D8CA 2WO3A 1SLCA 1LNSA 3ZXDA 4QQ2A 5L73A 3WR0A 5LA1A 2VG9A 3W20A 1XJAA 2W2IA 4EZ4A 3N7KA 4RS5A 2DV9A 4LK6A 4DUXA 4UW3A 2QQIA 1ACCA 1WCDJ 1O59A 2VBDA 4XC9A 4XJWA 1AVBA 4HPKA 5F39A 1ZBE3 4UT5A 3NVCA 4LKDA 4FSJA 3Q8BA 1GZWB 3T2TA 4W8JA 4M00A 1ND3B 3D3AA 5HCBA 2ARBA 3DEMA 3LKJA 1OF4A 4CDWA 5FWEA 2VD7A 1RB8G 4KGGA 2DVFA 3LOIA 4XFHA 1CX1A 1U12A 2HLEA 1CPNA 2QKDA 1W6MA 1JODA 2RDRA 1VB2A 1YRZA 4DPNA 4XQ4A 4NIIA 2AENA 5J1XA 5FZHA 1MS1A 2ID4A 2OQ7A 1JZ7A 1JYTA 1CD3G 1OSGA 3OUIA 1I1EA 2P6HA 1UY2A 2ZX3A 1K12A 3CJXA 1HRV3 4MVTA 3Q8FA 4XF3A 3B3QE 4Z92B 5LBFA 1UWWA 1MQTB 4DFSA 3AP7A 3MIFA 4AWDA 2A6WA 1D7PM 4Q2FA 2NYYA 3VD7A 1NZIA 4WM8A 5FUNA 1BEV2 3KF3A 2BOJA 4ASLA 2EA7A 3VBFA 5FTTC 3ZSJA 1QJX1 2ZEWA 3KQRA 5FDBA 1TMF1 1C5IA 4ES9A 4I0WB 4Q4X1 5JVVA 4NWWA 4HXCA 2X5IC 3ZXKA 2RS11 3VD5A 4L0PA 1F9KA 2WA4A 1EAH2 3N9PA 1QDCA 3POYA 1VMFA 4LBKA 3K4ZA 5BNNA 1PMJX 1W8TA 1YIPA 3J9SA 3UJOA 1J3RA 1PVXA 1BHGA 2Y6KA 3WSOA 2RE9A 4Q0SA 5CFCA 1N1SA 1MS0A 2ZX4A 4QM8A 1YFXA 4ZZ8A 3N7LA 5FQ0A 1H2NA 3VBOC 4ATEA 1E57A 4I01A 4XUNA 3SCFA 3WNPA 2QQWA 4AHWA 2IZWA 3VBRC 2WNEA 4J1XA 5CKQA 2V5DA 2FDHA 1OFNA 2P34A 1AR63 1WMXA 4IETA 5LRSA 2FHRA 4JRLA 4IE7A 1V6LA 3U10A 2R7EB 2VXJA 4JCKA 2FZ1A 1IZ3A 4G4FA 2VMEA 5APAA 1PGW1 3LWCA 5HCAA 4BMBA 3ENRA 5CADA 4AVCA 2BYVE 3OJBA 2HEWF 5LBEA 3E6CC 1A34A 4V2WA 4LE4A 4I2OA 5ABJB 2YUEA 1E5SA 4UFKA 5E8AA 1PIV2 2C9KA 3FLTA 1YI9A 5IWFA 5T55A 4KG8A 3U0ZA 4XFAA 1AXYA 3EJKA 4QM9A 2ORZA 4PDWB 2VAUA 2WFF3 3NV4A 2EXIA 1TZOA 2PELA 4YG6A 2GMPA 2BFUL 2AYHA 5FPZA 3VD3A 3SEPA 4CSWA 2EIDA 2TBVA 2ARXA 1AYM2 1FOD3 2OZ6A 5FY4A 3AKSA 3KQ4B 4YFZA 4RD7A 5F9TA 2XBO3 5FZEA 2YXSA 4LO8A 3WDVA 2OUJA 3GM8A 3JXSA 1W28A 2FD8A 2JDMA 1PNFA 4PLNA 1ENSA 2GH2A 1PK6B 5D1IA 4YWAA 1C1LA 1BCXA 1VJ2A 1K5MA 2B8MA 3O1TA 5DZGA 3PTRB 3VKFC 4K8FA 5DUXA 3T1MA 4DO0A 4H7MA 2B9UA 3HPNA 5I8SA 4UW4A 4D7SA 2RS13 3ILFA 4FPLA 5KXEA 5H9PA 1SLAA 3ZFFC 1LOBA 5IVCA 1MEC2 1DF0A 2W5FA 1Y4WA 4BYYA 4TZDA 1X9TA 2A6YA 3VKOA 3PHMA 3S5AA 4NAMA 4PIYA 3ZPOA 1NXD1 1UY0A 5A1LA 4GMP0 5ERLA 4BISA 3UETA 1UYXA 4EWAA 1YHFA 5LA0A 1XE8A 1QJU1 2WQ4A 5I0SA 4D7TA 1NT0A 1AR61 5BPXA 1MS8A 2ZKNA 3AYDA 4Q1RA 2E53A 4NPRA 4QQOA 2Q8CA 1C57A 1WA4A 2GNMA 2WO2A 4QPWA 3N4MA 1RTVA 1Y9QA 4CP0A 2IXKA 1VR3A 4B4QA 4XBLA 4LBLA 1UX6A 4GH4B 2OYZA 1OPMA 4NIGA 1UY1A 3LDRA 4JQRA 4QHOA 5C33A 4KU7A 2CU5A 5FO7B 1TQ5A 2JG9A 2Q5TA 5CKNA 4BQ2A 2P3IA 2GNTA 4WM8B 2ZPXA 2G1MA 1BXHA 2ZX2A 3HT2A 5LASA 2FDKA 3VN4A 1PZ7A 1RUI2 2XH6A 3OF1A 2HWF2 4AI0A 1ZX5A 1Y3TA 1H8TC 5LEKA 2BNNA 3RSJA 1O3SA 4NAOA 1QJFA 5T5OA 1P8JA 2JB4A 3IKWA 1UMHA 5G04L 3WY6A 3LOBA 3JD71 1EYBA 2VUDA 2K9ZA 4NN0A 3AFGA 2YC0A 4NHLA 5ANQA 5EXOA 5IFPA 3CQOA 4PIXA 3MIGA 3ALQA 5C6CA 1NQJA 4CPBD 3AK0A 2UYAA 3QLQA 2QUOA 2XQRA 4ZS3A 3WNXA 2SLIA 4COUA 4Y24A 3BPSA 1H4GA 4DNYA 1QJX3 5FLIA 2ZEYA 2ZXQA 2PQQA 3AVRA 4CE8A 4OYUA 1DLCA 2RDNA 3UK9A 1LOCA 1SBEA 4H55A 3ZSLA 2A75A 4QXHA 1SDWA 3MI8A 4OULA 3EO6A 4FPHA 3AXDA 2ZGOA 5A1AA 1Z7S2 3WCSA 3KS7A 4GJZA 1FXZA 2FCTA 3R05A 2R061 4U2AA 2LS6A 2IFRA 3DCQA 4AXOA 2MHFA 2WBKA 4Q4Y3 2I74A 3DV8A 3A4UA 4HG6B 1Q8VA 4LT5A 2R041 3C7FA 4NOTA 3RZZA 1FMD1 4Z2AA 1X7NA 3BOPA 2BW8A 3ZYHA 4JKMA 5T50A 1GWKA 1VRBA 2HJIA 1PMIA 1XPWA 2HWF1 3AMHA 4PT6A 3SLIA 3UKTA 1PX3A 2WLQA 4DS0A 5JSRA 3O1VA 3UGGA 1ND2C 1X33A 2X53S 3MFAA 2VULA 3J8F2 4XDPA 1UW8A 4M4PA 2UWCA 4XACA 1AR81 3B9IA 4Y5SA 5L9RA 4AF9A 4WVWA 4ES8A 3V0BA 3VBOB 1BJQA 2CL2A 2QCSB 4FPEA 1X8MA 4UWDA 1J3QA 1QXJA 1H2LA 4E2GA 1ZRFA 4BQ5A 4FPKA 2WNOA 2J1RA 4NUBA 5C3OA 4CEWA 3WG2A 1J83A 3TN93 4EQVA 1S1AA 1C3HA 1OA3A 2HWB2 4Z2WA 4N8MA 4NHKA 2GZWA 2WFF1 4XE9A 5B4XA 2WWSA 4MG2A 3IZOA 2P1BA 1XXNA 5FZMA 3HAGA 3HMYA 1W6MB 2WQZC 2VNRA 2E51A 2ZGKA 4CEYA 5IW0A 1AX0A 2RJKA 5DAWA 1MS3A 3HJRA 1TME3 1XNKA 2VO5A 3HNMA 5FJHA 3OTFA 1POV3 1SLBA 3LAGA 1VRH2 5E16A 5CNAA 4DUVA 1W0OA 3GZTB 3AZVA 2P2KA 4LK7A 3DYOA 5IHRA 4L97A 4CCDA 2VOXA 2A70A 2QQOA 2DU0A 3NW4A 3ASIA 3QBQA 4GB33 4PLMA 1YUDA 2RJ2A 1OC1A 1RUE1 2Q30A 2XR4A 2ZGLA 4UBGA 1QIQA 3VHRA 3WV6A 3VBHB 2CAUA 4LJHA 3J26N 1NOVA 3J7LA 2PYTA 3IIAA 3H50A 3AZWA 4N53B 1URXA 2YROA 4LULA 4N43A 4HKLA 2HEYF 3HBKA 1UOJA 1DQ6A 4WM8C 4XJZA 3H1WA 4FT8A 3N36A 4Y1VA 1A3KA 1W2TA 2WSUA 5CIRA 4CXYA 4QHZA 2UYBA 3SXWA 4E4ZA 3T0AA 2X05A 5FWJA 4A6SA 3ST7A 4K1ZA 1NQDA 4OZXA 4XOGA 2BP6A 1UOBA 4TTGA 1O3RA 1L7LA 3PJYA 1CJPA 1US2A 4QKDA 2VPVA 1F31A 3U07A 1IPSA 1HN0A 4BQ1A 3ON7A 2CDPA 2QQKA 3AMMA 3CJIC 1UZYA 5FOBB 2DF7A 3OPTA 3WCRA 5A7SA 1PIV1 1VRH1 3C7EA 3CMGA 3UYJA 1O5LA 1WMFA 1AR72 2VL4A 5F3IA 2B9VA 2ZEXA 3UV9A 4DRRA 1NYWA 1UIKA 1C8NA 4I30A 4QX1A 5FMDA 1DG6A 4TXWA 4F7ZA 2ORXA 4LA2A 4PI2A 1IS3A 3L2YA 5JI7A 4CDXC 4Z07A 3M7AA 4JRAA 2HWB1 2QJVA 2ADDA 3BTYA 1HJGA 3WNNA 3ZXEA 4AHZA 1NA1A 2DCYA 3WNKA 1CWPA 4P9IA 2BVBA 1CAWA 1NCRB 3BTAA 2WNVC 3KM5A 3ETPA 3VL8A 2VC9A 2ILMA 3WUCA 1K3IA 1H0BA 4FAHA 2AREA 3HN1A 4E27A 2RS12 2VQTA 2A6VA 1S0EA 2WZEA 3GJAA 4OUSA 4CP9A 4W6XA 3B69A 4P9YA 5LK5A 3M3QA 2AEZA 4KI5M 4LBQA 1XYNA 3MF6A 4BOWA 1QJX2 4KQ7A 5I0DA 2WO1A 2ZGUA 3VB9A 2UU8A 3M2MA 4YFWA 3MDPA 3J7HA 2AH2A 5H9RA 4QWNA 4UFJA 4NMIA 1FT9A 4QGLA 2XLAA 4HSJA 4QDRA 4B7KA 4E4SA 4IEWA 4CVUA 2JX9A 4YZ4A 4GD4A 1LGNA 3LIHA 5FZ0A 1O3TA 4KG0A 2QDRA 1NE4A 5K8SA 3BUCA 1V6KA 5A3MA 4Q4Y1 1ZA7A 1R091 3IDAA 4JGYA 4Q0QA 4S2FA 4AVBA 3VZOA
chains in the Genus database with same CATH topology
3VDDB 1UZZA 5EJ3A 1HQLA 1SCSA 1GNHA 1J3PA 5DXDA 2DCZA 4CEYC 4A7YA 4YRDA 3AP6A 3WOGA 3WDTA 4K40A 3J8F3 3FE5A 1ZBA3 3BPZA 3JD72 4OHWA 4DRVA 4KWJA 3PMEA 2JICA 3V0BB 1VBD3 1U5IA 1W6QA 3USUB 2HWC3 1REFA 2JD4A 1WD3A 4QX5A 3MW4A 5BXXA 4UBHA 5FQ0B 5H9SA 1J1TA 3NAPC 1WW7A 3WT3A 1I3HA 2C9AA 4YGDA 3ZN6B 3OGJA 4QGMA 3H1YA 1RUOA 2XLFA 4LO5B 3AB0A 4Q4X3 3KZ4C 2WNUA 5E89A 1QJZA 3RJ2X 2CV6A 4I0AA 1CVNA 1UAIA 3ZFGA 4BLIA 1RMU3 1VB4A 3OY8B 2RS33 2VOVA 4JGZC 4WVMB 4Z8BA 1H1IA 1QY4A 4X6QB 4AQ2A 3ZXFA 2ZHMA 5T52A 4YM0A 2CGNA 2NM1A 2JKBA 1RUG2 2VQAA 3WG4A 4PBPA 5KXCA 4IEVA 4DY3A 1MZEA 4YVWC 1EY2A 2GDFA 3WD5A 1V6MA 3R4SA 1YIFA 3DPRB 2XWBB 3FUOA 5HXVA 1ZA4A 1X50A 1ND2B 1AF9A 3MGUA 3ZFEB 4C0HA 3VBSA 1W39A 4IL7A 3TNQA 5SV5A 5BNNC 2OPKA 2KA3A 3WQ7A 5KXDA 4Q0UA 5GM0A 3USSA 4HZFA 1AYM1 1QOOA 2OUHA 4CDQA 5KXBA 1VAKA 1XE7A 1GANA 3FC0A 4L99A 1QJY2 4EV0A 4AEDC 3VBFC 1RUH2 4RS5B 1W6PB 1WMDA 5KHIA 1AL22 1DZTA 3ECQA 1YNAA 4CTEA 1UPIA 1ASJ2 1D2QA 4GB32 4AEJA 4LBNA 1GR3A 1PGW2 4YM3A 1C8M1 4PDWC 4ISQA 1RHI3 2WZR2 2ZABA 1VLNA 1MQTA 5T5JA 4BMEA 3B93A 3L2HA 3AJYA 4AHYA 3AKRA 2D3PA 1DQ4A 1VBA2 1AYN3 2RR12 3HR9A 4S2DA 2EF6A 3ZO0B 1CX4A 4JVAA 2JG9C 4Z82A 1S0CA 1KJLA 1CQ9A 3VBHA 3OBRA 2WNVB 1AYN1 1BBT3 3DPRC 3VZMA 1VBE1 4RL7A 4I3PA 4RQPA 5JI9A 3RRDA 3TWIA 3S30A 4P9LA 4FPGA 1NLSA 4Q4X2 3E5UA 1POV0 4FOVA 1PIV3 5JSPA 1RUJ2 1BEV1 1VRH3 3NSTA 4MYEA 2HEVF 5JZGB 4QMAA 4XXPA 2HYKA 4GALA 1YJKA 1GSLA 1O4YA 4AEMA 1IS5A 1AL23 4BM8A 1LCLA 2NZ9A 4AE2A 4XIKA 2RS51 5JOXA 1REDA 2UWBA 1DIWA 3ACLA 3RI8A 4JGYC 2GALA 5GALA 1D0HA 1PZ9A 4XIOA 2FQPA 5IK7A 1LOFA 1XU2A 1OLQA 4L8QA 5FMOS 4CEYB 2DCJA 3JB8A 1G86A 1TNRA 3H8UA 4Q4W3 5I91A 3O0VA 5K0UC 2TUNA 2BNOA 1MZ5A 2HWE1 2XJRA 4FTBA 5KWRA 4COWA 4YVWB 3M3EA 1GICA 4XILA 2GN3A 2GC2A 4IEPA 1TME2 4YZ3A 1QJU3 3ZVXA 5C9AB 5F6KA 2XUMA 3I54A 3FBMA 4IV1B 1YYNA 4P9WA 3ZN6A 5DUVA 2XG3A 1H8TB 2PHWA 1MVQA 2UURA 4QQLA 3ZXAC 2RS31 2ZBJA 2RM21 4ZKTB 2DVBA 4EN6B 5L7OC 1RVF1 1PGL2 3W58A 1LU2A 5IK8A 3V65A 4K7JA 2R071 4MH0E 4QU2A 1H2KA 2YV8A 2ZAAA 3ES1A 3W59A 2D6MA 1WLTA 1HRI3 4N90A 2D6NA 4XFBA 3PVNA 3DF0A 3M3CA 3SNMA 3NKGA 1S0DA 4Q4V2 3IM0A 3THPA 1R081 2D6KA 1OOPC 4U36A 1M4WA 3NWKA 3VZLA 5KHGA 3LA7A 2YGMA 1AZDA 1EV13 4IV3C 3N7JA 3VDDA 3SH4A 2BVVA 2I2SA 3K48A 3ROUA 2BNMA 3PVOA 3ZPYA 2VU9A 1V6JA 4AHXA 2JG9B 3EQEA 1RUD2 4XETA 2ZGNA 3FJSA 2B7YA 1GNZA 4HVOA 1IOAA 3VV1A 1V70A 1KFXL 3D4KA 4FCAA 4RFT0 4CDUB 3CJIA 3RMYA 3ES4A 3ZYRA 3OYWB 1LODA 1RC6A 1UD1A 3VBRB 1HKDA 2E7TA 1C8M3 1CGPA 2O0OA 3V0AA 4RGAA 4RHV1 1F5FA 4META 4Y20A 3DKWA 1DU3D 4BZ4A 4YG3A 1KRIA 4MGYE 1GZCA 1QJY3 4NHMA 1W6PA 1PVC1 4OLLA 1AR91 1HXS3 1J59A 1FOD2 3GZAA 1LTEA 1QQP3 1WW4A 3AZZA 3H0OA 3MIDA 2Y38A 4AVSA 1U5XA 2RMU1 2D3RA 2CGPA 3TN92 5CG9A 4CEWB 4AW7A 4YLZA 4LR4A 4F8AA 1HDKA 1LOFC 2RM23 2UWAA 2ZGQA 1PHMA 4YZ2A 5J09A 2JEMA 5CBLA 1X8EA 3ZSEA 1N1YA 4XJAA 5K7PA 1UU5A 1IKQA 1DHKB 4OI0A 1GQGA 1BVP1 5AVPA 3VZNA 1F8VA 1BBT2 4R9CA 1AX1A 4A2UA 1UIJA 4Y1YA 4R4XA 3ZFEA 1ND2A 4JDOA 3FX3A 4JAAA 1I5ZA 3CF6E 3WP4A 4K1YA 2HWE3 4YVSC 4KWLA 2P3JA 2CY6A 2RS53 2G9FA 4JC1A 2VQ0A 3GHNA 5DDJ1 2NP0A 2E63A 4QPGB 5FLJA 3R6SA 1H8VA 1JW6A 5A33A 3KT7A 2D97A 1IPKA 5ABJC 1A8DA 3E6BA 3OD4A 5CVRA 1UU4A 1XU1A 1ZBE2 4P9JA 1HQNA 3BIWE 1F5JA 2Y0OA 2ZGSA 2XJPA 2ZGTA 4RQPC 3V56A 1Y43B 2ZA9A 4PQ9A 5K0UB 2PAKA 3VBHC 5FAXA 3VKLA 4DQAA 4YVWA 2BWAA 3AMPA 4I09A 1VBC1 2QZ2A 5BY5A 3RI9A 4I02A 4ASMB 5EV7A 4WBBA 1DDLA 2Q0AA 2XJUA 5C9AC 2DUOA 4Y5Z0 2VH9A 4RSUA 3O5SA 1IS4A 4CDUA 4AFAA 4IEZA 4YGEA 4GH4A 4HN0A 4Q8LA 3MLLA 1MR5A 2FZ2A 2N7GA 4D69A 3ZFGC 2ET1A 2ZOEB 1MS9A 5JMCA 1NZCA 2EAAA 1N3QA 2WNUC 5TSWA 2VXRA 1G9CA 2R1DA 3AZYA 4FTEA 4HBNA 3JBG3 1KDKA 5HI0A 2XBO1 2NQYA 1IGOA 5C4WC 3MIHA 5L19A 2JG8B 3MIBA 4SLIA 4WM7A 2CWMA 5DG1A 4FQZA 1YXWA 2DCKA 4FPOB 2CWSA 1UKGA 2D40A 1N47A 1R1A1 3WP5A 4MXVA 1ENXA 4LHKA 1KS4A 2TEPA 3LA2A 1LB2A 2QVSB 2D98A 4PF5A 4QHBA 4V1PA 1AJKA 3ZMNA 4YVSA 1KQRA 4XYXA 4XDQA 4C1XA 4FQ4A 3HD8B 3GALA 4AFMA 4BA6A 2IXCA 4HFSA 4FOQA 3D82A 5CAZA 4MSVA 3TRSB 4Q4W2 2D43A 3O0WA 1V00A 2LM3A 3NAPB 1EV11 3I8TA 3PJQA 2BEOA 4B7EA 1OQDA 1S0BA 1DQ2A 4W6WA 1YFYA 4R9AA 4LBQD 3ZSMA 4HN1A 2PN5A 2PAEA 4JDMA 1FI2A 4QXKA 1LEDA 5CFCB 3C2UA 3POWA 1O4TA 5A33B 3G6JB 3JBG2 1JBCA 5KBFA 3UKNA 1GV9A 1VBB2 5C8CA 2V09A 3AKTA 4AQSA 2GN7A 2ZJCA 3N7MA 1D4M3 2A6XA 2PLV1 5EYYA 1WCSA 3E5XA 4XMAA 1DFQA 2WIIB 1SACA 2AR6A 4LUMA 1DYKA 4XBNA 5C8WA 2GMMA 2PHLA 1H9WA 2PLV3 3BALA 1FV3A 3FUQA 1Q8PA 2H6CA 2K2SA 2D5HA 1DLLA 1S0JA 4HETA 1ZZ6A 4G9SB 4CP1A 3QD6A 5EYXA 3LB9A 2IXJA 2GC3A 1RUF2 4OHYA 2DYCA 2Q8OA 3VBFB 3IWZA 3TBDA 4Y22B 1HXS2 4INDA 2NMNA 1OMIA 5J3UA 4R9DA 3AFKA 1RUC2 2XB6C 4ITCA 4M0HA 3BB6A 2BUKA 2WNUB 2MNGA 1RUF1 1ZRDA 1ENRA 1RUI3 3W9AA 4H3WA 1JN2P 1VBC3 5IK4A 3AJZA 4WM7B 3PVEA 4DY5A 3RQ0A 1XYOA 3MLKA 4K20A 5BNOB 4R9BA 1SLTA 1D4M2 3WW3A 1KDMA 1V6IA 4H14A 2VW1A 5JLVA 1B35C 4J6GA 1BEV3 2HWC1 4X6RB 3ZYPA 4XF4A 2OW4A 2X5IA 4BIFA 4YNIA 4QD2A 1TMF3 3ELNA 4FPCA 2DTWA 5ABJA 1XQNA 4LUKA 2ZX0A 5A32B 1AYM3 5J98B 4XF0A 3I4IA 3E97A 3AKPA 3JBG1 1V6OA 1IS6A 1PVC2 2EIGA 2G9GA 3SCHA 4CYDA 1RJ7A 5CFDA 4ZU7A 5JZGC 3RNSA 5AC92 4DB5A 1VIWB 1LECA 3RYRA 2ET7A 1G9AA 4Q4W1 3KLSA 4KWKA 2O8QA 4N7UA 5ACA1 1D4VB 1NE6A 3ME2A 4IEOA 4Z1VA 2AGSA 1BMV2 4A7ZA 1VBD2 3FFZA 3R4UA 1KFUL 1LENA 3MIEA 1RUD1 3DL3A 3JCIA 3GNEA 3OCPA 1WW5A 4AI1A 4XF1A 2JJ6A 5JPNB 1ULFA 1SLIA 2R0FA 4FPJA 4C91A 1NCRC 5FLHA 3TNPB 2X5IB 1KS5A 2WT1A 4C0BA 3KT4A 3GYDA 4XW3A 1LOEA 5JCTA 4OHZA 4O9GA 3PLQA 3GBFA 5JOZA 4JTOA 3OBTA 2ZTNA 4N9IA 2XBO2 3BCWA 4IERA 1H1AA 4JTNA 3OYWA 1MACA 1N3OA 1Q5OA 1T6GC 2XWJB 5AVAA 2GNDA 1U0AA 3CU7A 3P3PA 1RITA 4XQDA 1AXZA 1ULCA 4Q4V3 5GJ6A 4Y26A 1BQPA 5F1RA 4A7KA 1FNYA 1DGLA 2Z42A 2DURA 1ZRCA 4N7IA 5CU1A 1O3QA 1C5HA 1NY72 3B9CA 1TME1 4TWTA 3N35A 1MQTC 1Q8OA 4ONUA 1CESA 4P9GA 1DBNA 1OA4A 2B45X 2IFWA 4LLOA 2WZPP 4JGYB 4AGRA 4YYOA 4X8PA 4YW3A 4C1WA 2IXHA 2QZ3A 5GZFA 4XHXA 1AR83 2P37A 1CAXA 1RGSA 2K0GA 4M3CE 1Q8QA 3PMSA 1J1LA 4IEUA 4Q0QA 4LHLA 1RUH3 3H7YA 4LTAA 1XNDA 3O14A 4IV1C 1RUF3 5C8CB 2YMZA 3GHMA 1NCQB 2Z69A 2W52A 2LTNA 1W6OB 1LGBA 1RIRA 2FMDA 2X8KA 5BNPA 2RMU3 1LHUA 4AEKA 1ULGA 1QH7A 2WNVA 4PJYA 1UCXA 2HWF3 3VKMA 4CDUC 3D5OA 3VBSC 3WW1A 3WG3A 2WFPA 3S7EA 1OKQA 4PCRA 2DUQA 5DDJ2 3WG1A 1RUG3 1POV1 1S55A 4JDNA 4MLOA 5GLTA 4CDWC 4OVEA 1PNGA 1CAVA 2VMHA 2DCTA 2VY0A 1KXGA 4JGZB 2C5DA 5T3NA 5FBZA 4IV3B 5KHKA 4HANA 3TOJA 3VL9A 5DUUA 2ETEA 1V9U3 3T1LA 4GH4C 4XFGA 2R6QA 4YM2A 2KXLA 4KH9A 1N3PA 3VUOA 2PTMA 2RR11 3I2DA 4FVVA 2ZZQA 4LLFA 5I8TA 1ZYBA 2D7FA 5T5LA 1FPN2 3THTA 3PTYA 1XNBA 5A3LA 2G4IA 3JQWA 2KM2A 2NPIA 4XFCA 1VALA 2AZ5A 5CB7A 2VNGA 3GBGA 4AFBA 4BCUA 5IT6A 2MEV1 3NL1A 4N9HA 2EALA 3ZFEC 1U5ZA 2ZAHA 1RUH1 2YZ4A 1HRI1 1OPOA 3MICA 4F83A 4MGKE 1QJY1 2ZHLA 4EN9B 4KNCA 2VW2A 4Y1UA 4MGZE 3VBSB 1HRV1 4BLJA 5H9QA 2R073 4AI3A 1O91A 1H2MA 1QKQA 4LBOA 2H0BA 4HL0A 1CAUA 3WW2A 1Z78A 2HWD1 3CL1A 3IDBB 2EXJA 1Q3EA 1IHMA 5LK7B 2NMOA 2SBAA 3OPZA 1NCRA 1Q8SA 1KITA 4WZFA 2A3YA 3UJQA 1BK1A 1YCIA 3NAPA 4MGIE 4UXAA 4M01A 5KC5A 4B3NA 3GZUC 1IQAA 1RUG1 1YJLA 2VUAA 3JD73 1ZZ8A 4TYSA 1OI6A 3O7OA 2VVFA 5GLWA 5FOJB 2RHPA 4N53C 3N3HA 2BFUS 4L92A 1DGWX 4XJUA 4Q27A 2VW0A 1PVC3 5GZDA 1G9BA 3PVBB 4HVQA 1J58A 1R082 1LHWA 1FMD3 1WUVA 5E88A 4ATFA 3L9JT 4OHVA 5CFDC 4QQPA 1RUD3 5DZEA 3KGZA 4R4ZA 2QE3A 3NV1A 3QH6A 3FLRA 1RJ8A 2F4PA 4XQWA 3CJIB 3M70A 2YYOA 3FHIB 1WBLA 3E5QA 1DYPA 3J4UH 3I59A 1SMVA 2HWD2 5JAXA 2RS32 1COV2 4Y20B 2WS91 2R30A 4J1WA 4COYA 4Y1XA 2WINB 2PHRA 1HRV2 4AQ6A 4HPKB 1LGCA 2V73A 4CDXA 3ILNA 4TLFA 4FOYA 5BNQA 2A7AA 1OFSA 3H3ZA 2BPA2 2PAMA 2JE9A 2HWE2 2MEV2 3B02A 3P3NA 1RUNA 1WLCA 2R0HA 3JU9A 3LZZA 1TE1B 2VVEA 4GXLA 3AKQA 1DQ5A 3ZYGA 1AJOA 1R092 1VBB3 3RS6A 4A3XA 5F6LB 2Y26A 4B8EA 3AMQA 1XNCA 3KB5A 2IXLA 1DQ0A 4D7YA 5J48A 3IDEA 2IXIA 2V5YA 3QCWA 4NVPA 1FX5A 2ZZJA 1I9RA 5L7OB 1S2BA 2XPJA 2LALA 3SISA 1ZRRA 2R49A 1SFNA 3B7MA 3VBUA 4AG4A 4PLOA 2DUPA 2Q4SA 1RUJ1 4RR3A 1CN1A 1CONA 2PHFA 3M3OA 5GLZA 4FOWA 5GKAC 1GZ9A 1JXNA 1ZNPA 1S0GA 2EXKA 3M4FA 1XRUA 2WT0A 4XBQA 1CAUB 2BTVC 4MX3A 1DZRA 4CZSA 4DZGA 5BYNA 3WP6A 4CDXB 1HW5A 2E6VA 3NV3A 1XYPA 3AYCA 3M1HA 1R1ZA 1AYN2 4IV1A 2Y0IA 5J37A 3KD4A 2MEV3 4LO7A 3NKTA 2IC1A 4BPZA 4YGCA 1RL3A 4LE3A 3X29B 5I93A 3MF9A 1L3JA 4YW1A 4C90A 1ASJ3 2I45A 4OUMA 4BWOA 1JYIA 4M3CA 3IPVA 2W68A 1F2NA 1H4HA 1ZZ9A 2D5FA 3GBWA 1MZFA 5K0UA 4EWDA 1ASJ1 4XTPA 4EROA 1AR71 5JPMB 3H3UA 5IUQA 1QGLA 1CPMA 4M3CB 1QF3A 2DTYA 5I0UA 1AL21 5KHHA 4IQPA 4RR3B 4D94A 1QDOA 5CFCC 2DVAA 2EVXA 3RMXA 3RDIA 1MEC3 4FTSA 2D6PA 2NN8A 4FP3A 1NY71 3FMGA 3LGRA 3WDWA 2R043 1ZM1A 4LBMA 2WS92 3RJRA 1COV1 2ATFA 4BE3A 3JQXA 4FBFA 3TAYA 4FPFA 4WVZA 4FAGA 5BNOC 4Q29A 1YI7A 1DGWA 3RYKA 2W08A 5EZWA 4E9KA 1SLLA 2PHTA 4RQPB 2P3KA 2QDNA 1GZWA 3FWEA 4XMIA 1RUE2 4LA3A 3KCYA 3VHOA 2XJQA 3WQ1A 3VBOA 1QU0A 5AC93 1SCRA 5JZGA 4S2HA 2UY9A 3WDXA 2B39A 1AHSA 4CDQC 1PM7A 1ZZBA 1C4RA 3MPPG 4MXWA 3OD0A 1GLHA 4XZPA 3B5LB 2P17A 3B94A 1W6OA 5DZFA 1MZ6A 3D0JA 4GULA 1ONAA 1VBD1 5BNPC 1HX6A 1VAVA 3ZXJA 4QPYA 4JGZA 4AVTA 1PK6A 1BMV1 1LJ7A 2O8OA 1AR82 4IV3A 2ZS6B 1FNZA 3AP9A 2WL1A 4OHXA 3U11A 3J8F1 4AVAA 1S0FA 4DINB 2JG8C 3IDCB 5HCFA 5I8YA 3AMNA 2OZJA 4N43C 4IEXA 2JDZA 1W2UA 3MPBA 4W65A 3K51A 1TEIA 4Q1PA 4M0NA 4XTMA 1SBFA 1HRI2 2PHDA 1C28A 1H8TA 3APBA 4O9EA 5JOWA 2A3XA 5KC6A 2ZGMA 4URTA 1HIXA 5L7OA 2XKOA 2PHXA 4B4RA 1K5MB 5HBAA 1MS5A 4XEZA 1DGRA 1QNWA 1NCQC 3KT1A 4KGQA 4MZUA 4QQOA 4Q4Y2 1FPN1 2F6BA 3S0MA 4COVA 1NXMA 3ZX7A 3MZHA 4UW6A 4YGBA 4FPYA 3JZVA 3SH5A 4AEDB 1GYKA 4QPGC 1AR93 2WJSA 1EPZA 1ZZ7A 4N53A 4FXGB 4IXLA 3D0SA 1Z7S3 1BVVA 4D3WA 1DGRN 1N1VA 1QXPA 1H1MA 4CRQA 2DFBA 5FRAA 1RUI1 3URFA 1WD4A 3DPRA 3ZFFA 4HLTA 4I3GA 5F5QA 1PO23 2QQPA 3R0RA 4KBBA 2VECA 2HWB3 2XL7A 1QHDA 1HV0A 5AFBA 3KGLA 1HV1A 3KCCA 3O12A 1JUIA 1JOJA 1WBFA 1AR62 2Q1MA 3OY8A 4K3UA 5D8AA 1QJU2 2GAUA 3A0NA 5K9YA 2D93A 2BQPA 4GQ7A 5CG8A 1X36A 3B01A 4XFFA 1O5UA 1OD5A 4GMP1 4AI8A 3QACA 1COV3 4DOUA 1Y7BA 4S2GA 3ZXGA 2JG8A 1MEC1 4YVSB 3ZSKA 1QWRA 1NCQA 1OHFA 3EXUA 2HKXA 3WXPA 1U5YA 2XJTA 3FZ3A 2VUJA 3HT1A 2DU1A 1R1A3 5BNPB 4OI1A 2XVLA 1UL9A 3WDUA 1CIWA 5ACA3 2XVKA 1LR5A 1UU6A 4RHV3 3ZDSA 5C9AA 3SHRA 1G9DA 4WM7C 3CO2A 1BKZA 5JOYA 1GBGA 2CTVA 4Y1ZA 4G3YC 3MEPA 1W6NA 2R32A 1CAVB 2CAVA 4WZCA 1UMZA 1VP6A 1WW6A 1ULEA 5AFEA 1B35B 2JECA 4W6YA 3VLBB 4LNVA 4L11A 4P9XA 1PZ8A 3Q9OA 4WV8A 2ZMKA 2Q1ZB 3WHTA 1NLRA 4FXKB 3RWNA 2ZACA 2VNOA 3VZJA 1NG0A 1CJDA 2ES3A 1ALYA 3G7DA 3D6EA 4ZU4A 3VHPA<