1ZBHA

3'-end specific recognition of histone mrna stem-loop by 3'-exonuclease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
DFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPNCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
molecule keywords 5'-R(*CP*CP*GP*GP*CP*UP*CP*UP*UP*UP*UP*CP*AP*GP*AP*GP*CP*CP*
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 87
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.30 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 SAP domain 1zbhA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbhA02
1HJRA 4CF2A 3K5MA 2Y1JA 1RT4A 3S3OA 1O1WA 5EU7A 5I42A 3DLRA 4CJPA 5CZ2A 1LV5A 2RNNA 4B9MA 4OPJA 4DFMA 1DLOA 4Y1CA 3NH1A 4KREA 1WNSA 3DYAA 3V9SA 3V9WA 2BANA 1WSGA 3L2UA 4DFJA 1NKBA 1BI4A 1W9HA 1KRPA 1BISA 2YKMA 1JLFA 2AJQA 3QLHA 4QOZB 1F21A 1C0TA 4DLEA 4IBNA 4KB0A 4I2QA 3KLGA 4C8OA 3HYFA 4LD0A 3EZ5A 1BQMA 3HVRA 3LZIA 1NK8A 3NFAA 2VWKA 3AVLA 4HUFA 4W5TA 4BWJA 1VRUA 2KVEA 3IS9A 1RTDA 3LPUA 2FC0A 4H4OA 3ZSZA 4AILC 2JVWA 3TR8A 4KHWA 3BDPA 4W5QA 3NDKA 4PA1A 4DTMA 4M3XA 3VQQA 2X78A 1SL1A 3O4NA 1FKOA 2Z1IA 4I9QA 4O0IA 4CK1A 4AHUA 3OYLA 1SV5A 3I0SA 3RRHA 4ZTFA 3EYZA 4KRFA 1EP4A 3OS1A 3VQEA 1QSSA 3OYAA 3O3FA 5FDLA 1NK4A 4PQUA 3KK3A 3LWMA 1BGXT 4W5NA 3THVA 1I39A 4ZHRA 3OJUA 1W0HA 3C6UA 3P5JA 4B9SA 1QHTA 5JS1A 4CHZA 4RW7A 5SWMA 1LAWA 3WNHA 3ZT1A 4LY7A 4AHSA 4E0DA 2KFNA 2F96A 4DTXA 4DU1A 2RF2A 3D45A 4OKEA 1DTTA 2KTQA 3AVHA 4LH5A 2Q3SA 1WAFA 5T7BA 3QESA 3LALA 5JS2A 4CCHA 1DTQA 2W42A 1RILA 3VQ4A 1LWFA 3ZCMA 3SZ2A 1L5UA 1EXQA 3LAMA 4JS4A 1S1UA 3HVTA 3DLBA 1KTQA 3SUPA 5HROA 1S1TA 3OS2A 4HTUA 1CLQA 1VSJA 4DSIA 4FJKA 3OVNA 2DFFA 4B8CA 5HRSA 3M8PA 4ID1A 1U45A 1RT6A 4CEFA 4ZTJA 4KHNA 2XY6A 1NJXA 1X9SA 4CE9A 3LP2A 1YTUA 4AHTA 3T19A 4IFVA 4CECA 3RR7A 1RCHA 3ZSQA 2GBZA 1KLNA 1BI4B 2OA8A 4E89A 3SV3A 3OYJA 3OYEA 4M3TA 3ISNC 1BIZA 2XY8A 1NK9A 1LWEA 4DTRA 3OYFA 3K59A 4DSKA 3L2RA 1S1XA 4OPKA 2HHTA 1HMVA 4PWDA 4YNQA 3DRRA 1TL1A 4B9VA 1H1JS 3I0RA 4DFKA 1UA0A 3VQDA 4DU3A 3LP3A 1RBUA 3QINA 2EX3A 4F3TA 4HUGA 1HQEA 4ELVA 3DRSA 4OKKA 4KI4A 2OPRA 3AA3A 4DTJA 4J2EA 2HHXA 4IFYA 4M42A 3HM9A 5D3GA 3L3VA 3ALYA 1YT3A 2JGUA 4I9LA 3HXMA 1N5YA 3DLHA 4Z4HA 1IKWA 4HUEA 1D9DA 4QCLA 1UOCA 2Y1IA 3CFPA 1J9AA 5KI6A 2X74A 4CHQA 1TK5A 4DWIA 2B4JA 3VQAA 4K8XA 4AHVA 3DI6A 3VQ6A 4R5PA 3NGYA 3M8RA 4DTNA 2OYQA 4C8NA 3UIQA 4Z4IA 1SKRA 2Z1JA 1Q9XA 1RDAA 3KKSA 2YNHA 4J2AA 2IS3A 2WOMA 4CEZA 2B6AA 2Z1HA 3M8QA 4FZZA 4Z4EA 1JLEA 3CQ8A 4CJQA 3HSTB 3CM6A 3OY9A 3AVBA 4BWMA 4O5BA 2WQGA 4DSFA 4BDPA 1JXEA 4DSEA 5C24A 2FBVA 2PZSA 1RDDA 3OYDA 4E7IA 1IO2A 1VK0A 2WONA 3C6TA 4RW4A 1JEQA 4FJLA 2G8IA 3ZSWA 1MU2A 3QNNA 2YKNA 2G8WA 1TKXA 3P1GA 4EZ6A 2HHQA 1T03A 2QKKA 1XHZA 3U6FA 2IGIA 3M8SA 3PV8A 1L3SA 3MECA 4WE1A 4CJ3A 4Q5VA 4FLUA 1SKSA 1KLMA 1HQUA 3NGIA 3HK2A 2BDPA 4OLBA 3MXJA 4HCCA 1RT7A 2IAJA 4FCYA 3O3HA 4DLGA 4EZ9A 4E3SA 1XC9A 4Z4CA 2XHBA 1GOBA 1CZBA 4FJ8A 4FLVA 3AO3A 3VN5A 3HJFA 4ELUA 1T05A 1B9FA 1BHLA 2X6SA 4CEAA 4Z4FA 3NCIA 1L3UA 4DQIA 1J53A 1EX4A 2RN2A 3AVAA 4F2SA 3WNFA 4FLTA 3JSMA 3ZSVA 3MXIA 1JLCA 4DS4A 3G10A 3L2VA 3MEEA 4OJRA 2OPQA 3A2FA 1C0UA 1S5JA 2HNYA 4Y1DA 4AHRA 2O4IA 3OYBA 1NK5A 2KVDA 3L2QA 1Z25A 1GOCA 3NF7A 3KLEA 4DTUA 4FW1A 4DSLA 1NK0A 3RMCA 1VSLA 3VQPA 4LSLA 1QSLA 1SL2A 4M41A 3OYGA 3PO5A 4CF1A 1C1CA 4M3UA 1LAVA 3V1RA 1QTMA 4M3WA 1TL3A 5KTQA 4CJEA 3QEVA 4B9NA 2HHWA 1SL0A 4OLAA 4FVMA 2OZSA 1C0MA 1L3VA 4NCGA 3TARA 3OYCA 4FZXC 4RW9A 4OKJA 3D0PA 4CEQA 1C1BA 5HRPA 3SNNA 1VSKA 1NKCA 3T1AA 3CFRA 2YHAA 4B08A 3OJSA 3KLHA 1EKEA 4K8ZA 4B9LA 4FK0A 4CJ4A 4F8RA 1QS4A 2F8SA 3KLIA 2D0AA 3PO4A 1FKPA 2E6LA 4CJTA 1VSIA 2LSNA 1B9DA 1C6VA 2OPPA 4KTWA 1TKZA 4W5RA 1KSPA 3PUFA 3NF8A 5FROA 3NBPA 1VSHA 3PX4A 1WLJA 3TAQA 2P5OA 4KHQA 3IRXA 3SUQA 4RW6A 4XIUA 2HW3A 1BQNA 3ZT0A 3VQCA 2QXFA 4PUOA 2RPIA 4CJLA 4DMNA 3L8BA 4FJHA 4FLZA 4BDZA 4BITA 3SPZA 4CEEA 5HRNA 3RRGA 1WN7A 3KJVA 1T7PA 2HNDA 2HMIA 1UA1A 5DK5A 1HNVA 3RMAA 5CZ1A 3VQ9A 1YTAA 3OYIA 2KZMA 3SUOA 3VQ8A 3V9XA 1S1WA 2XO7A 2KFZA 5C42A 1C1AA 1HPZA 3FFIA 3PY8A 1EETA 2ZE2A 4OVLA 3RWUA 4RG8A 4CJUA 4CEOA 4CFBA 1TGOA 4CHNA 1KVBA 3DLGA 1JJRA 1S6QA 3SYZA 4FJ9A 1X9WA 2ETJA 1S1VA 1TVRA 5KGWA 3NH0A 3K58A 4CFCA 1IG9A 1RTHA 3KKRA 3G0ZA 2RNOA 4NYFA 4CGIA 5J2PA 1SUQA 4N41A 4FK2A 3QEPA 4FJXA 4PY5A 2G8HA 4FJ7A 3AVMA 3LP0A 4CK3A 3SQ1A 4CEDA 4FW2A 1D9FA 1TK0A 3QEWA 1HNIA 1Z26A 4KKOA 4CF9A 3LZJA 4FZYA 1ZBUA 3NHGA 4NCBA 2GUIA 3BGRA 4LH4A 3I8DA 4M3YA 3OYMA 3TABA 1IKYA 3AO2A 4O4GA 5K14A 3AVCA 2YV0X 4KHUA 1U48A 1LW0A 4CJSA 4CF8A 5J2NA 1NKEA 1JLGA 4ID5A 2A1RA 4CFDA 3WNGA 3NH2A 3LWLA 3K57A 1RDCA 4GVMA 4F4KA 3U3YA 4CIGA 4Z4GA 4CJFA 1NOZA 3F9KA 3SV4A 3RTVA 1WSIA 3AV9A 2F8TA 4AHCA 3O4QA 3S9HA 1HRHA 1ZBFA 4LSNA 1NK7A 2HHUA 1J54A 1G15A 1Q9YA 4BE0A 4YFUA 1RT5A 2KZZA 4CERA 4JRPA 5HP1A 3MAQA 4DS5A 1KFDA 3KTQA 4HCBA 1FXXA 4Q0BA 4DQRA 4CHYA 2OPSA 3LANA 3NF9A 4DF4A 5KGXA 1U47A 4C8LA 1IKXA 1QSYA 3NF6A 4CJ5A 4IKFA 1S9EA 4CGDA 1GOAA 3SQ0A 2E4LA 4CHPA 3ZSXA 1TAUA 4BACA 3S3MA 4O44A 1X9MA 1WAJA 4DQPA 3QIOA 4FYDA 3V1OA 2R7YA 1RT3A 3K5OA 4M3RA 1VSFA 3S3NA 4RW8A 4CJRA 4CF0A 3IAYA 3SUNA 4CGHA 4HVJA 4GMJB 1QQCA 4FLWA 2G8VA 2VG6A 1T8EA 4ICLA 1NK6A 2QK9A 2BE2A 1JKHA 3B6OA 4G1QA 1JLBA 2NUBA 3OYNA 3HT3A 3E01A 4FM1A 3PX6A 3DOKA 4MQ3A 3EY1A 4E7HA 3RMBA 1HYZA 2FBTA 4E7LA 1KCFA 3TAPA 1VSEA 4FJNA 4N76A 5DMRA 5C25A 1BL3A 4FJIA 4TSXA 1ITGA 1ASVA 3TI0A 4IDKA 3ZSOA 2PYLA 1JL2A 1A5XA 3AVNA 4KTQA 3IG1A 4E7KA 1NJZA 4CIEA 4E1NA 4JRQA 3VA3A 3CYMA 1I3AA 1UAXA 3AVGA 2DTUA 3KIOA 1KFSA 1FK9A 1IH7A 2E6MA 1BIUA 3H08A 3AA2A 3MXMA 1JXBA 4F2RA 3MEDA 1NJYA 3KD5E 4KHYA 3AO5A 3CFOA 3K5NA 1KVCA 3HO1A 3NGZA 4O0JA 2HVIA 1RDBA 4DG1A 4CJKA 3SJJA 4CGJA 3O3GA 4KB1A 4B3OA 2I5JA 5J1EA 3KK1A 4KI6A 2IOCA 3L2WA 3QETA 3AA5X 1A5WA 1JLQA 4DQSA 4FXDA 1S9GA 1XHXA 3AVIA 3HL8A 3MEGA 4FM2A 3V6DA 3V81A 3SPYA 3LP1A 3DM2A 2JLEA 3C94A 5KRSA 4EP4A 2G8KA 4ELTA 1RBRA 3L3UA 2RKIA 2HB5A 4Z0UA 4E19A 2FBYA 4CJVA 3JYTA 2IDOA 1HYVA 2D0BA 1LWCA 3ZSYA 3WNEA 4FLYA 4KFBA 2DFHA 3AVJA 3HPGA 1WSFA 4UQGA 4KAZA 4KV8A 5CYQA 4IG3A 2HHSA 2FBXA 1VSMA 1XI1A 1UWBA 3DLKA 1RT1A 4I2PA 5J2QA 4OGEA 3QNOA 2YNFA 4FLXA 4FJ5A 3SQ2A 4JLHA 1HYSA 3OYHA 1TAQA 1KVAA 1A5VA 1RNHA 3U3GA 2VG5A 3TAMA 3P83D 3K5LA 3V9UA 3ULDA 3TANA 3KD1E 4M3ZA 2DY4A 3CM5A 4CHOA 1CXQA 2ITGA 3KLFA 4NYNA 4KHSA 3VQ7A 2KW9A 2G8UA 3HPOA 2OZMA 4BE2A 3QEXA 1WSHA 1YVUA 2YHBA 3ITHA 4MFBA 3QERA 4IG0A 3QIPA 3NAEA 3C95A 3KK2A 3RR8A 1RTIA 4QAGA 1REVA 4CK2A 1RTJA 2DFEA 4DFPA 3NE6A 1U49A 1RT2A 1CZ9A 4HHTA 5SZTA 4FJMA 2EHGA 2PYJA 1SKWA 4BE1A 3HP9A 4FM0A 3DOLA 4CFAA 1ASUA 2P51A 5KRTA 4J2DA 2HHVA 1VSDA 3QO9A 4FJJA 4N47A 5J2MA 2VWJA 3RMDA 4C8KA 4F3OA 1ZYQA 3AO1A 2YNGA 3AO4A 1L3TA 3LAKA 1ZBLA 3VA0A 2P5GA 2XRIA 1TKDA 4DSJA 4EP5A 1TV6A 2ATQA 2O4GA 4B8AB 2XY5A 3ZT3A 2BGGA 1NJWA 1U04A 3K2PA 4CESA 5FRNA 1ZBIA 4OGCA 4B9TA 4JS5A 5HBMA 2KW4A 3TAEA 3VQ5A 4H8KA 3DRPA 3PX0A 5I3UA 3VQBA 5HRRA 1X1PA 3ZT4A 1QE1A 3LPTA 4BDYA 2VG7A 4C8MA 3F73A 1B92A 4CGGA 2B5JA 1ZBHA 1K6YA 3AVFA 1Q8IA 2HNZA 1IKVA 3LDSA 4DTSA 3TAGA 2XY7A 3V1QA 3HP6A 1U4BA 4E7JA 1RBVA 5E41A 3TAFA 4J2BA 1BCOA 1LW2A 2D5RA 4L8RB 4I7FA 1S6PA 1WSJA 3TWHA 1XWLA 5HLFA 1Y97A 4H4MA 2D0CA 4B9UA 2YNIA 2G8FA 2QKBA 1CXUA 2A1SA 2HVHA 1D5AA 3T3FA 2X6NA 3QEIA 2GV9A 2IC3A 3DMJA 4KO0A 4DTPA 1D8YA 1JLAA 3OS0A 4CIFA 1WSEA 4CEBA 3ZT2A 4FK4A 3V9ZA 1JL1A 4AH9A 1RBSA 3SCXA 4DF8A 5CYMA 1RBTA 4M45A 4FJGA 2ZD1A 1TKTA 5CY4A 1BCMA 1VRTA 4DQQA 4CGFA 3SQ4A 2KQ2A 3AA4A 4N5SA 2ZQBA 3HPHA 4DU4A 4E1MA 3ZSRA 5FRMA 1TK8A 3B6PA 3CG7A 3V4IA 4O55A 1J5OA 4NCAA 4UZWA 2KVUA 2Z1GA 3DLEA 4N56A 1ASWA 3OYKA 4CJWA 4DTOA 2PY5A 3ASMA 2P1JA 4GW6A 4W5OA 1NOYA 3AVKA 4KTZA 4KPYA 1V66A 1R0AA 1N6QA 3SI6A
chains in the Genus database with same CATH superfamily
1HJRA 4CF2A 3K5MA 5EU7A 5I42A 2OTLN 1U2VA 2P9LB 3DLRA 2GUPA 3A0IX 4DFMA 5FPDA 4GNIA 3DYAA 2BANA 4FO0A 4DFJA 1NKBA 2LD7A 1KRPA 2AJQA 1F21A 3HYFA 4LD0A 1BQMA 2VWKA 1SAZA 2JVWA 5AQRA 3T69A 3BDPA 4W5QA 4DTMA 4M3XA 1WBBA 3EN9A 1A62A 4AHUA 4CK1A 4ZTFA 3D2EA 3S41A 4W5NA 2CH5A 2E1ZA 3OJUA 4CJ7A 4DR5K 4ILHA 5AQMA 1LAWA 3WNHA 3ULEA 2KFNA 1NGDA 4BGBA 2F96A 1YJ9N 2KTQA 1DTTA 4JKAA 1QZ5A 2A6AA 1WAFA 1VQ6N 5JS2A 3VQ4A 2HBLA 3DLBA 3OS2A 3BUZB 4B8CA 5GADP 1DKGD 3G71N 3CC7N 4CE9A 3OA9A 5M1FA 3O9SA 4AHTA 1RCHA 5KPZA 3VGLA 1BI4B 3VEVA 3OYJA 3VETA 1YHQN 3AAPA 3MK6A 3ISNC 2XY8A 1NK9A 1LWEA 4BG8A 3JAMO 5C0YA 3BF3A 2E2NA 3VTIA 4PWDA 4YOTA 2H3GX 3M5RA 5HOOA 3E9LA 3QFUA 3WXLA 2ODGC 3QINA 4FWQA 4F3TA 3DRSA 3ZX0A 4DTJA 3HM9A 5D3GA 4PHTX 3ALYA 1BA1A 2Y1IA 3CFPA 1J9AA 5KI6A 4CHQA 4DWIA 1U6ZA 5E84A 3NGYA 4C8NA 1RDAA 1OVYA 3GG4A 2B6AA 3E66A 3TTFA 2DPNA 3CQ8A 4CJQA 3CM6A 4BWMA 2NLXA 4DSEA 2FBVA 3OYDA 3J80O 2YJFA 4E7IA 3FZLA 4L3QA 2WONA 4RW4A 5CE3A 1WUAA 3U6FA 4FVUA 2IGIA 1S22A 4FLUA 3HK2A 2BDPA 4JHDB 3O3HA 3C0BA 1R59O 4BR5A 1GOBA 3O5BA 3AO3A 3U9ZA 1VQNN 1T05A 4GV3A 2PBDA 4F2SA 2RN2A 4DS4A 2OPQA 4BRIA 1C0UA 4BQZA 5ADXH 2O4IA 5BREA 3L2QA 5ADXA 4HWIA 4FW1A 3CJ7A 2PAVA 2YHWA 3VQPA 4JD2A 3SJHA 1QTMA 5AQTA 4CJEA 2HHWA 1SL0A 1L3VA 3TARA 5AJ3K 3OYCA 4FZXC 1XMQK 4KBOA 4RW9A 5AQGA 2BTFA 5HRPA 3SNNA 2O8BA 1NKCA 3T1AA 3P31A 4B1XB 4QS7A 5AZJB 2JWLA 4YOVA 1YUWA 1J5EK 4FWSA 2D0AA 1BWFO 1FKPA 2OANA 1VSIA 2LSNA 4W5RA 4KTWA 1TKZA 5AQHA 3PUFA 3NBPA 3J7YP 4JKDA 4RW6A 2HW3A 1WB9A 4PUOA 4FJHA 3KZBA 2YCHA 1TUUA 4A59A 3SPZA 1T7PA 2HNDA 5DK5A 1GJJA 4BRMA 5I9EB 4B1YB 3OYIA 2KZMA 3V9XA 5C42A 1C1AA 1HPZA 3FFIA 2ZE2A 3RWUA 3SBTA 4CJUA 4CEOA 4CFBA 4BC4A 4BC5A 3WT0A 4CHNA 1JJRA 1SZ2A 3WEEA 3K58A 2QWRA 4NYFA 4FJXA 2D4WA 2G8HA 4FJ7A 1MWMA 1P90A 3BZKA 2I7PA 2QA4N 4CEDA 2Q31A 4FW2A 4LF6K 5AQKA 1Z26A 3LZJA 4GKJK 3WQUA 4JK8A 1NGCA 3AVCA 2YV0X 4KHUA 1Q81O 4CJSA 3GE1A 2P9KA 3D2EB 3NH2A 5AQQA 3VF2A 4CJFA 3SV4A 3AV9A 3L6QA 1Q9YA 3OTOK 1KXPA 1RT5A 3ULEB 4GV9A 2Q0RA 5HP1A 4FPBA 1KFDA 4HCBA 1FXXA 1X9JA 5AZIB 2OPSA 4CJ5A 4O44A 5CR4A 4FYDA 2J4RA 3V1OA 2NRXA 5AFUH 3IFRA 4IXCA 3TPQA 5M1QA 1QQCA 2VG6A 3RSEA 5AFUA 3B6OA 3LDNA 4BRGA 2FF3B 4E7HA 2FSKA 1RFQA 4H0OA 4IO8A 1ITGA 4FWPA 3TI0A 3AVNA 4E7KA 1NJZA 4JRQA 5CIUA 1OKJA 4BVPA 4JI7K 1KFSA 4FPAA 2VQFK 1X3MA 2ZJRL 1NJYA 3H6EA 3CFOA 5LMUK 4O0JA 3SMPA 2HVIA 4DG1A 1XNQK 1GKUB 1QVFM 2IOCA 3AY9A 2WBNA 3ZEUB 1XHXA 2VYPA 1VQON 2HBJA 3LP1A 1QQMA 1ZS9A 3HZ6A 4JK9A 3VMFB 4EP4A 3L3UA 2A3ZA 4E19A 2FBYA 4CJVA 5JMVA 4FLYA 3MCPA 3AGRA 4KV8A 4IG3A 4E1JA 4LFCK 3BZCA 5J2QA 1RT1A 3EKUA 4OGEA 3QNOA 1LOTB 1QZ6A 1IBMK 2F9WA 4JLHA 2IIRA 1TAQA 4JKEA 1A5VA 4M3ZA 3P83D 3G4SN 4FWMA 1YITN 3O80A 3KLFA 1D4XA 3CMAN 4KHSA 3VQ7A 2O8EB 4GV6A 3TTCA 4H5RA 1K8KA 1YVUA 2YHBA 4NLCA 3QERA 3WUHA 3QIPA 3W3DA 3KK2A 1YJNN 5LJVA 3CF5L 1RTIA 4CK2A 1REVA 4MLEA 1P8ZA 2DFEA 5KQ8A 1RT2A 4H0XB 2F7TA 5SZTA 4FJMA 3J81O 2PYJA 3HP9A 4FM0A 3CD6N 4CFAA 2HHVA 3T7ZA 4N47A 5J2MA 4FJJA 2VGMA 2DK4A 1IV0A 2E5LK 4C8KA 1ZBLA 2CH6A 1HX1A 4DSJA 1Q82O 4DKWA 2ATQA 3EE8A 4DB3A 1U04A 4CESA 4B9TA 4JS5A 3CQYA 4NXMK 4BR0A 3DRPA 2E8AA 3H3NO 4BDYA 3DXKA 3F73A 2B5JA 1Q8IA 5F0XA 2LC3A 3V1QA 3J7AP 4JKFA 2D5RA 2NRHA 4K25A 1S6PA 1WSJA 1XWLA 4BRQA 1YNSA 4H4MA 3SBGA 4ISFA 1D5AA 1NWKA 1HPMA 3CPWM 1GLFO 2X6NA 3DMJA 4DTPA 5C10A 1JLAA 3OS0A 1WSEA 4CEBA 4FK4A 1JL1A 5CYMA 2W51A 5EVZA 5AQUA 1BCMA 4XH4A 3WEEB 3AA4A 5BR8K 2WFBA 4FWNA 3R6MA 1H9EA 1YF5L 3DLEA 1ASWA 3OYKA 3ASMA 3D7EO 4W5OA 1NOYA 1R0AA 2D0OA 4YOUA 3H45C 5C2DA 1VQ9N 4Y1CA 3V9SA 1BI4A 4JYAK 2GEMA 2YKMA 1C0TA 4DLEA 4IBNA 4C8OA 3IKMA 5BPNA 4DR7K 3HVRA 1NK8A 3NFAA 4HUFA 5AQVA 4W5TA 1T44A 3IS9A 5GIOA 5CHIA 5GAHP 3VPZA 3TR8A 4WFNL 4CD3A 2VWBA 2X78A 1SL1A 2CGJA 5JLFA 3FFKB 4KH4A 2Z1IA 3H46O 3OYLA 3VQEA 1QSSA 4BC2A 1EQYA 1NK4A 4PQUA 3LWMA 2YX6A 4DV3K 1J6ZA 1ATRA 4FWLA 1QHTA 5JS1A 3THYB 4O8KA 4LY7A 1Z6RA 1HKGA 3RSEB 4DTXA 2RF2A 4OKEA 3AVHA 4DV0K 5FPEA 5T7BA 3QESA 3LALA 3FLCO 1NGHA 4C1NI 4B1WB 1LWFA 3SZ2A 3L4QA 1EXQA 3LAMA 3KVGA 3O4WA 4JS4A 1L5UA 5HROA 4R79A 4FJKA 4DSIA 3GBTA 3MN7A 1GL9B 3M8PA 4CEFA 4K43A 3LP2A 2FXUA 3RR7A 3PSIA 2QWOA 5C15A 1HR0K 1KLNA 2OA8A 3SV3A 2BUPA 2NRVA 3SMSA 5DM6L 4DTRA 3K59A 3L2RA 4OPKA 2HHTA 1HMVA 4PL7A 2E2PA 1TL1A 4B9VA 5AQJA 2QW9A 4OPAA 4BRKA 1UA0A 3VQDA 3LP3A 4DV5K 4GY2B 4ELVA 4OKKA 3O6WA 2HHXA 1DGKN 3CHWA 4IFYA 3GOIA 2MPHA 3L3VA 2JGUA 3LDLA 3DLHA 3QDKA 1TK5A 3HTVA 4AHVA 3VQ6A 4Z4IA 1SKRA 4J2AA 2YNHA 3M8QA 4FZZA 4BREA 5AQZA 2Q1NA 3HSTB 1EO1A 3OY9A 3VENA 4DSFA 2NZTA 1T3VA 5C24A 4X66K 1IO2A 1VK0A 3C6TA 1JEQA 3J8AA 4ISEA 4O8UA 3ZSWA 2G8IA 1K8KB 3QNNA 1TKXA 3R3LA 2QKKA 4JKBA 3M8SA 3MECA 4WE1A 3VESA 5BN9A 4CJ3A 4CBWA 4Q5VA 1KLMA 3BY5A 1YIJN 2ZJPL 4OLBA 3P4IA 1RT7A 3FZHA 2QWPA 5FPNA 1CZBA 3VN5A 4XEIA 1B9FA 3LM9A 1L3UA 1EX4A 5GIPA 2I7NA 3Q7BA 3WNFA 2HF3A 4H0VB 4C1NK 4FLTA 5HL7L 3L2VA 3A2FA 1N8RO 1RGIA 3DWLA 4AHRA 1VAZA 2CGLA 1NK5A 2KVDA 2UXDK 2HOEA 1Z25A 1NGAA 3NF7A 4DSLA 4AF1A 3DXKB 1NK0A 4F9OA 3THWB 1VSLA 1SL2A 4M3UA 1NJIO 4B9NA 2P9IA 4YHHK 3F5TA 1C0MA 4A57A 4LF4K 4LC9B 1XUPO 4FOEA 4DV2K 3QKJA 4K42A 2HF4A 3OJSA 3KLHA 4AM7A 2GTDA 5AQSA 3PO4A 3VEXA 1K9MO 2P9NB 1B9DA 3I55N 1KSPA 2ZGYA 5FROA 1VSHA 1WLJA 4FL9A 4KHQA 3IRXA 3L0OA 3SUQA 4BRPA 1BQNA 5AZIA 2QXFA 3HOSA 2RPIA 4CJLA 3CC2N 4IOCL 4DCHA 4BITA 4DHYA 1KAYA 1NMNA 3KJVA 2FSNA 1UA1A 3A5OC 3O08A 1NGBA 1S1WA 4IO9L 2KFZA 3MWPA 4MO4A 1VQ8N 4FWKA 1QVGM 1V4SA 1S1VA 4CZJA 1TVRA 5BN8A 2RNOA 4N41A 3MX2A 1ZC6A 3SQ1A 2A42A 1D9FA 1TK0A 1HNIA 3CJ9A 4CF9A 4NCBA 2GUIA 3EKSA 3I8DA 3OYMA 3AO2A 5K14A 4BR9A 4CF8A 1NKEA 1BU6O 4EIAA 3K57A 3LWLA 3B8AX 1HJOA 4F4KA 3FLGA 4Z4GA 2HJQA 2KFVA 4LSNA 2HHUA 1J54A 3ZEUA 4CERA 4JRPA 4OO1J 3FR0A 4IDHA 3T1HK 3G6EN 1EWRA 1XQSC 3QMLA 3MX5A 4NXNK 4CHYA 1U47A 3LANA 4C8LA 1IKXA 4CGDA 1GOAA 4CHPA 3ZSXA 3QIOA 4JI2K 1RT3A 3K5OA 4RW8A 3SUNA 4CGHA 1YJWN 2G8VA 1NK6A 2BE2A 1HYSA 3PX6A 2HHQA 3DOKA 2O8EA 2FBTA 3TSUA 1KCFA 2G80A 3GDQA 5DMRA 1ASVA 4LF5K 1KD1O 3IG1A 4E1NA 2KLAA 3P39A 3VA3A 3CYMA 3BP8A 1UAXA 4Y0WA 3AVGA 2DTUA 5F2RA 4WQ4C 3CI5A 5LMNK 5H1SQ 3AA2A 1BG3A 4IEEA 4F2RA 4BRDA 4KHYA 3T1YK 3K5NA 1KVCA 1A63A 3MN6A 4FWOA 2VQEK 3CCLN 1NGJA 4KB1A 4CGJA 2D0PA 3L2WA 3K9KA 1A5WA 1JLQA 1S9GA 3MEGA 4FM2A 4BROA 1Y02A 3DM2A 2V51B 1GLEG 5FLXO 4V19S 4A62A 2RKIA 2HB5A 3SAGA 4DV7K 1Z05A 1V4TA 2YI1A 3WNEA 3ZX2A 1QHAA 2DFHA 3AVJA 3HPGA 2HHSA 2FBXA 1NGEA 3DLKA 5AQIA 4I2PA 4JI5K 4JKGA 2YNFA 4B9QA 4EFHA 3OYHA 4NLBA 3U3GA 3TANA 3UE5A 3CM5A 2ITGA 4O5FA 4QS8A 3K0SA 1G99A 4CD1A 3ZLJA 1W97L 3CCEN 4BE2A 1WSHA 4MFBA 1C0FA 4DR4K 3C95A 3RR8A 3CCQN 3KK7A 4DFPA 1CZ9A 1SKWA 4J2DA 3DOLA 2WUSA 2ZM6K 1E3MA 3QO9A 2P9IB 3CJCA 4CW7B 1TKDA 3HRGA 2OTJN 5AQLA 2XY5A 4B8AB 3VTHA 4CZIA 1LCUA 5AQFA 1NJWA 2BGGA 3K2PA 3TTDA 1ZBIA 3PIOL 5HBMA 4JAXA 1JEIA 3VQ5A 4H8KA 5HRRA 4IEIA 1QE1A 3ZT4A 4MO5A 1B92A 4H03B 4CGGA 1K6YA 3AVFA 3LDSA 4DTSA 3TAGA 4LF9K 4E7JA 1RBVA 2P9UA 1BCOA 3E9OA 4L8RB 2IVOA 5F1XA 3TWHA 2Q97A 2QM1A 1Y97A 4YDUA 2Q2RA 3QICA 2G8FA 2QKBA 2HVHA 3RVCA 3F2KA 3THYA 2E2QA 4PL8A 1N32K 1RBSA 1RBTA 5CY4A 4DQQA 4FSVA 3LM2A 1HKCA 3J7ZO 4M7YA 5FRMA 1EN7A 4E1MA 1TK8A 1J5OA 4UZWA 1KQSM 1E4FT 4KPYA 4GW6A 2ZF5O 4KTZA 4H0TB 1N6QA 2W6KA 1VHXA 4G9ZA 3EZWA 1LV5A 4OPJA 2AP1A 4WCEL 3V9WA 3DXMB 1WSGA 1W9HA 3C6HA 4JEPA 1JLFA 2WTUA 5LJWA 4QOZB 1BOTO 4I2QA 2QNCA 3AVLA 4YY3K 2QWMA 4CZLA 4BWJA 3LPUA 5EXWA 2E1YA 3NDKA 1JJ2M 4PA1A 1TYQA 1FKOA 4CZHA 2AA4A 3I0SA 3RRHA 2ASOA 2V52B 4BRHA 1EP4A 3DJCA 3O3FA 5FDLA 3KK3A 1BGXT 3THVA 1I39A 4ZHRA 5AQXA 1W0HA 3C6UA 3P5JA 4CZKA 4DR3K 4CHZA 1GLDG 3U8XA 5SWMA 3ZT1A 4E0DA 3D45A 3VERA 5M1NA 1N36K 4LH5A 2Q3SA 4JI4K 3THXA 1OH7A 1N33K 1GLCG 4JI0K 1S1UA 3HVTA 2O8DA 1S1TA 4H5NA 4CI6A 3QFPA 3OVNA 2DFFA 4EAHD 4ID1A 1U45A 1RT6A 3IDHA 2XY6A 1NJXA 1YTUA 5AQNA 3T19A 4CECA 4H5WA 2GWKA 4E89A 3P38A 1BIZA 3FZMA 3OYFA 4DSKA 5M1PA 1VQPN 4YNQA 3DRRA 3PSFA 3I0RA 2F9TA 2NRZA 3M6GA 4I6MB 1RBUA 2EX3A 1HQEA 3THWA 4KI4A 3AA3A 4J2EA 4M42A 1YT3A 4I9LA 3HXMA 1N5YA 4HUEA 1D9DA 1UOCA 3C6AA 3CETA 5JLHA 4JKGB 3VQAA 4K8XA 4DTNA 1E7LA 3VGKA 3UIQA 2Z1JA 1Q9XA 3KKSA 1Y64A 2IS3A 2WOMA 4CEZA 1DT9A 4Z4EA 1JLEA 4OPHA 2ODCI 4JI8K 2WQGA 4KH6A 4EHTA 2P9NA 3C65A 5BPMA 4FJLA 1EWQA 4B3MK 1MU2A 3ID8A 2YKNA 3CMEN 4EZ6A 2VGNA 2PFUA 1T03A 1T6DA 3QBXA 4IOXA 3EEQA 4YORA 3H1QA 3CJ1A 3NGIA 4B3SK 3SLCA 4FCYA 1VQ7N 4DLGA 4EZ9A 4E3SA 1XC9A 4CBUA 4Z4CA 2V7YA 2XHBA 2A8VA 3QB0A 4FJ8A 3I8BA 4FLVA 3ZX3A 2QEXN 1XC3A 4Z4FA 4DQIA 1J53A 3ATVA 3AVAA 4A5BA 1Q18A 3ZSVA 2YJEA 3MXIA 3G10A 3A5LC 3MEEA 2EWSA 4Y1DA 4B1ZA 5JICA 3OYBA 3O9TA 1GOCA 3FE1A 4LSLA 3A5NC 1QSLA 3OYGA 4CF1A 1C1CA 3E9PA 4M3WA 1TL3A 5KTQA 3QEVA 1JCEA 4OLAA 2P9UB 3WXJA 4NCGA 4LF7K 4OKJA 3D0PA 4CEQA 1C1BA 3MMVA 1VSKA 2UUAK 3CFRA 1YXQA 3H1VX 2YHAA 4B08A 1EKEA 4BY9C 3SK3A 4B9LA 1M1KO 4FK0A 1QS4A 2F8SA 2GELA 2E6LA 4CJTA 2OPPA 1C6VA 4YOWA 3NF8A 3TAQA 2P5OA 4XIUA 4CVNE 3L8BA 2GX9A 4FLZA 4BDZA 3O8MA 2UYTA 3RRGA 4JV5K 1WN7A 2HMIA 2IVPA 5CZ1A 1VQLN 3VQ9A 1YTAA 3SUOA 3VQ8A 4DQ8A 2XO7A 3PY8A 2O8CA 5C2FA 4H0PA 1TGOA 3SYZA 1S6QA 3UKRB 2ETJA 5GAGP 5KGWA 1OVQA 4CFCA 1RTHA 3KKRA 3ZETA 1SUQA 3QEPA 2QWNA 3PIPL 4PY5A 3AVMA 4BG9A 3O1BA 4CK3A 4K0KK 3QEWA 4KKOA 3L4IA 3MCAB 1ZBUA 1TYQB 1ESVA 4LH4A 3TABA 2O8FA 2E88A 4JI1K 1U48A 1LW0A 3AGKA 5J2NA 3NVKA 1JLGA 3CIPA 4ID5A 2A1RA 3WNGA 2ZJQL 4DR1K 4GVMA 2A5XA 3F9KA 3OHRA 4RTFD 1WSIA 2F8TA 4AHCA 4B3RK 1ZBFA 2QWLA 4BE0A 4B1VA 4J8FA 3VGMA 4JI3K 1KAXA 3MAQA 4JN4A 4ILGB 1FW6A 4YOYA 3THXB 3EL2A 3NF9A 4DF4A 1QSYA 5EOYA 3NF6A 4IWVA 4IKFA 2O8DB 5TKWA 1X9MA 4AQYK 1T6CA 1Q7YO 1RDUA 4M3RA 1VSFA 2KKZA 3S3NA 4CF0A 4MLHA 5TKYA 4GMJB 4FLWA 3CC4N 4IJNA 1T8EA 4ICLA 1JKHA 2NUBA 3HT3A 3E01A 4FM1A 3EY1A 1HYZA 4FJNA 4X65K 4JKCA 4N76A 4H5VA 3U9DA 4TSXA 1ZBSA 3ZSOA 1JL2A 1A5XA 1IH7A 2E6MA 1BIUA 3KHYA 3MXMA 3DAWA 3KD5E 3AO5A 3HO1A 3TSQA 3ENHA 4NO7A 3SJJA 3O3GA 2I5JA 4K41A 5J1EA 1OH5A 2ZGZA 3AA5X 4DQSA 3AVIA 3SPYA 3V6DA 3V81A 1E4GT 2YHYA 3C94A 5AQYA 4AM6A 3CCSN 4KHPK 5KRSA 2G8KA 1RBRA 4Z0UA 2UUBK 1S3XA 1MDUB 3IUCA 3JYTA 4FWRA 3ZSYA 4PKHA 5BRDA 4KAZA 5CYQA 1NG9A 1XI1A 1ATSA 1NM1A 3O9UA 4FJ5A 5LL6Z 4A61A 5E26A 3MDQA 3UB5A 5EY4A 2CGKA 3K5LA 1RNHA 2VG5A 4MDAA 3V9UA 1K8AO 2DY4A 3ULDA 3O9RA 3KD1E 4PKGA 4CHOA 3L0QA 3QEXA 4IG0A 3NAEA 1HNWK 4JNEA 2QWQA 2QNFA 3NE6A 2W41A 3AAQA 5FPMA 3CCJN 4HHTA 2HBMA 3QBWA 2EHGA 4BE1A 3D2FB 2RE2A 1ASUA 2P51A 4BR2A 5KRTA 1VSDA 3WXMB 3RMDA 2NNWA 4Z94A 1ZYQA 4F3OA 3VA0A 1FJGK 3DXMA 3LDPA 1TV6A 3ZT3A 1A8VA 3JS6A 2UU9K 5FRNA 3HM8A 3MN9A 2KW4A 4A2BA 3TU5A 4BRNA 1MA9B 4YDUC 3PX0A 2UXCK 5I3UA 2NRRA 1X1PA 3LPTA 4H5TA 1K73O 1ZBHA 2HNZA 2XY7A 4BQLA 3HP6A 3TAFA 5M1OA 3SAHA 4JKHA 4I7FA 3A8YA 4BRFA 5HLFA 2D0CA 2YHXA 1VQ4N 2A1SA 3T3FA 3MWTA 3K9JA 3WXIA 1NNEA 2O8CB 5AR0A 1IG8A 3V9ZA 1GLLO 1KC8O 3PLAA 4GKKK 2ASMA 4M45A 2ZD1A 1VRTA 2ASPA 4WQ5A 2JWKA 3FZFA 5A2QO 2ZQBA 3HBTA 3ZETB 4DU4A 3B6PA 3CG7A 3W0LA 3WQTA 3V4IA 2KVUA 2Z1GA 4DTOA 4N56A 2PY5A 4CJWA 3AVKA 2FSJA 1V66A 2W6LA 3SI6A 2Y1JA 1RT4A 3S3OA 4ISGA 1O1WA 3C7NB 5BRHA 4CJPA 4B9MA 5CZ2A 2RNNA 2O8FB 1DLOA 3NH1A 3HSCA 5B8HA 4KREA 1JCFA 1WNSA 3L2UA 1W7AA 3VF6A 1BISA 3QLHA 1OH8A 2ITMA 5KPRA 4KB0A 4BGAA 3KLGA 2Q36A 3EZ5A 3LZIA 1VRUA 2KVEA 1X3NA 1RTDA 4AILC 2FC0A 4H4OA 3ZSZA 4KHWA 1YI2N 4I6MA 4YOXA 3VQQA 3O4NA 4I9QA 1NLVA 2VCPA 4O0IA 4KRFA 1SV5A 3OBWA 3EYZA 3H3OB 3OS1A 4WF9L 3OYAA 3OBYA 5JVGL 4B9SA 4RW7A 4AHSA 2NRTA 4DU1A 1IBKK 3WXKA 1O13A 1N34K 4OX9K 1ATNA 4CCHA 1QQOA 4BVOA 1DTQA 2W42A 3CJAA 1RILA 1NMDA 3ZCMA 1KTQA 3SUPA 4HTUA 1CLQA 1VSJA 3GL1A 3R9PA 5AQOA 5HRSA 2HHHK 4KHNA 1VQKN 4ZTJA 4IOAL 1X9SA 4NB4A 1NGFA 1U2VB 4IFVA 3VF4A 3ZSQA 2GBZA 2QXLA 1W2BM 3OYEA 4M3TA 1S1XA 3FGUA 1BO5O 4IFEA 3ENOA 3U4LA 4A2AA 1H1JS 2UUCK 4DFKA 3MN5A 3O1WA 4DU3A 5DM7L 2P9PA 4HUGA 4CBXA 2OPRA 2FLOA 3NVMA 4XH1A 5GINA 4QCLA 5MLCQ 1SS6A 1IKWA 2HBKA 4Z4HA 5KPTA 2X74A 3HI0A 2B4JA 4CZGA 3DI6A 4R5PA 4BRLA 1BDGA 3M8RA 2OYQA 3ENBA 4C23A 4HTLA 2Z1HA 5KQDA 1XNRK 3AVBA 2F4VK 4O5BA 4BDPA 1NGIA 3VOVA 1JXEA 2PZSA 3VEZA 1RDDA 2G8WA 3P1GA 3NMUA 1XHZA 1BA0A 3PV8A 1L3SA 1SKSA 3OW2M 1IBLK 1Q86O 1HQUA 3MXJA 4HCCA 2IAJA 2ZWHA 3AARA 3G25A 1ILYA 2WC9A 3HJFA 4ELUA 1BHLA 2X6SA 4CEAA 2FF6A 3VEYA 3NCIA 3JSMA 1WOQA 1JLCA 3UKRA 4OJRA 3EO3A 2HNYA 1S5JA 3CCVN 3I56N 5AQWA 3KLEA 4DTUA 4LFBK 2W40A 3A5MC 4MDBA 3TSPA 4LFAK 3CQXA 4WFAL 3RMCA 4M41A 3PO5A 2UXBK 4B1UB 1LAVA 3V1RA 3ID6A 4BR7A 2QTDA 4XH5A 1SQKA 5GAEP 4FVMA 2A41A 1VQMN 1I94K 2OZSA 3D6RA 4QS9A 1GLJO 3N4PA 4WQ4A 4K8ZA 4CJ4A 4F8RA 3FZKA 3KLIA 3VEWA 2P9SA 3VEOA 3PX4A 4CZMA 1XMOK 2NRWA 1HLUA 3ZT0A 3UKUA 2QI2A 3N4QA 3VQCA 4DMNA 4GVEA 1DEJA 4CEEA 5JVHL 5HRNA 5ELZA 3RMAA 1HNVA 1HKBA 1EETA 4OVLA 3F9MA 4RG8A 1ZXOA 3ATUA 4ILJA 1KVBA 3DLGA 4FJ9A 3CERA 1X9WA 3M3ZA 3NH0A 4A5AA 5J2PA 1IG9A 3G0ZA 4CGIA 4FK2A 1GLBG 4IZ9A 3LP0A 4B3TK 4BC3A 1QQNA 3I33A 4JD2B 3BF1A 4FZYA 3NHGA 3BGRA 4BR4A 4M3YA 2P9LA 1IKYA 2OCEA 4O4GA 4X64K 1H9FA 4PKIA 4DR2K 4CFDA 2BH1A 1RDCA 2O8BB 3LL3A 3U3YA 4CIGA 1NOZA 1NGGA 3RTVA 3O4QA 3CXCM 1HRHA 3S9HA 1NK7A 5AQPA 3R1XA 1G15A 4YFUA 5M1KA 2KZZA 4U7BA 1CZAN 3JXUA 4DS5A 3KTQA 1TUYA 4DR6K 1HNZK 3BEXA 4DQRA 4Q0BA 1YAGA 5KGXA 2HMPA 3IMXA 1NBWA 1S9EA 3SQ0A 2E4LA 3LDOA 4BACA 1TAUA 3S3MA 1WAJA 4DQPA 2R7YA 1E7DA 3E1YA 4BRAA 1WBDA 2KHOA 4CJRA 3IAYA 4HVJA 2E20A 4DV6K 2QK9A 4G1QA 1JLBA 3OYNA 4LF8K 3RMBA 4MQ3A 4RWTA 5IWAK 4E7LA 3TAPA 1VSEA 3CJBA 3HOTA 3Q7CA 1KAZA 5C25A 1BL3A 4FJIA 3CCMN 2Q0UA 4IDKA 2PYLA 4KTQA 2D1KA 4CIEA 4DV4K 1I3AA 3KIOA 2P9PB 4EHUA 1FK9A 3D2FA 4BRCA 1KHCA 3H08A 1JXBA 3MEDA 1S72N 3NGZA 2P9KB 1RDBA 4CJKA 1RDWX 4B3OA 4KI6A 4DV1K 4H0YB 3KK1A 3QETA 4CZFA 4IJAA 3LLRA 4FXDA 2A40A 3HL8A 2GWJA 3DLLL 3CPEA 2JLEA 1OH6A 4ELTA 5C12A 3KWGA 1VQ5N 4KH5A 2IDOA 1HYVA 2D0BA 1LWCA 4KFBA 4UQGA 1WSFA 1VSMA 5IT9O 1UWBA 1H1VA 2IVNA 3CCRN 4FLXA 3SQ2A 1KVAA 1IJJA 4RCHA 3TAMA 4X62K 1CXQA 4FOIA 4NYNA 3O9QA 2KW9A 5BPLA 2G8UA 3HPOA 2OZMA 3ITHA 4UY8O 1JCGA 4QAGA 1RTJA 4JK7A 1U49A 1MWKA 3R8EA 2V7ZA 4JHDA 4DUZK 3C7NA 2VWJA 3AO1A 2YNGA 1NU0A 3AO4A 3LAKA 3LDQA 1L3TA 2P5GA 2XRIA 1HUXA 4EP5A 4U67L 2O4GA 1C0GA 2HSTA 4OGCA 1HNXK 5BR9A 1BUPA 3TAEA 5EX5A 3VQBA 3KWIA 1YVNA 2VG7A 2P9SB 4C8MA 1M90O 5BRFA 1IKVA 4CZEA 4J2BA 1U4BA 3UKUB 5E41A 3ZYYX 3SAFA 1LW2A 4DUYK 4WQ5C 5LY3A 3M1FA 1GLAG 4JI6K 4B9UA 2YNIA 1CXUA 3QEIA 2GV9A 2IC3A 3EE9A 4KO0A 5AZJA 1D8YA 4CIFA 3ZT2A 4AH9A 4M63C 3SCXA 4DF8A 4FJGA 3CCUN 1TKTA 3SQ4A 4CGFA 2KQ2A 4N5SA 2RHKA 3HPHA 3ZSRA 4WFBL 4NCAA 4O55A 4M7XA 4WYBA 2P1JA 2E2OA
chains in the Genus database with same CATH topology
1HJRA 4CF2A 3K5MA 2Y1JA 1RT4A 3S3OA 1O1WA 5EU7A 5I42A 3DLRA 4CJPA 5CZ2A 1LV5A 2RNNA 4B9MA 4OPJA 4DFMA 1DLOA 4Y1CA 3NH1A 4KREA 1WNSA 3DYAA 3V9SA 3V9WA 2BANA 1WSGA 3L2UA 4DFJA 1NKBA 1BI4A 1W9HA 1KRPA 1BISA 2YKMA 1JLFA 2AJQA 3QLHA 4QOZB 1F21A 1C0TA 4DLEA 4IBNA 4KB0A 4I2QA 3KLGA 4C8OA 3HYFA 4LD0A 3EZ5A 1BQMA 3HVRA 3LZIA 1NK8A 3NFAA 2VWKA 3AVLA 4HUFA 4W5TA 4BWJA 1VRUA 2KVEA 3IS9A 1RTDA 3LPUA 2FC0A 4H4OA 3ZSZA 4AILC 2JVWA 3TR8A 4KHWA 3BDPA 4W5QA 3NDKA 4PA1A 4DTMA 4M3XA 3VQQA 2X78A 1SL1A 3O4NA 1FKOA 2Z1IA 4I9QA 4O0IA 4CK1A 4AHUA 3OYLA 1SV5A 3I0SA 3RRHA 4ZTFA 3EYZA 4KRFA 1EP4A 3OS1A 3VQEA 1QSSA 3OYAA 3O3FA 5FDLA 1NK4A 4PQUA 3KK3A 3LWMA 1BGXT 4W5NA 3THVA 1I39A 4ZHRA 3OJUA 1W0HA 3C6UA 3P5JA 4B9SA 1QHTA 5JS1A 4CHZA 4RW7A 5SWMA 1LAWA 3WNHA 3ZT1A 4LY7A 4AHSA 4E0DA 2KFNA 2F96A 4DTXA 4DU1A 2RF2A 3D45A 4OKEA 1DTTA 2KTQA 3AVHA 4LH5A 2Q3SA 1WAFA 5T7BA 3QESA 3LALA 5JS2A 4CCHA 1DTQA 2W42A 1RILA 3VQ4A 1LWFA 3ZCMA 3SZ2A 1L5UA 1EXQA 3LAMA 4JS4A 1S1UA 3HVTA 3DLBA 1KTQA 3SUPA 5HROA 1S1TA 3OS2A 4HTUA 1CLQA 1VSJA 4DSIA 4FJKA 3OVNA 2DFFA 4B8CA 5HRSA 3M8PA 4ID1A 1U45A 1RT6A 4CEFA 4ZTJA 4KHNA 2XY6A 1NJXA 1X9SA 4CE9A 3LP2A 1YTUA 4AHTA 3T19A 4IFVA 4CECA 3RR7A 1RCHA 3ZSQA 2GBZA 1KLNA 1BI4B 2OA8A 4E89A 3SV3A 3OYJA 3OYEA 4M3TA 3ISNC 1BIZA 2XY8A 1NK9A 1LWEA 4DTRA 3OYFA 3K59A 4DSKA 3L2RA 1S1XA 4OPKA 2HHTA 1HMVA 4PWDA 4YNQA 3DRRA 1TL1A 4B9VA 1H1JS 3I0RA 4DFKA 1UA0A 3VQDA 4DU3A 3LP3A 1RBUA 3QINA 2EX3A 4F3TA 4HUGA 1HQEA 4ELVA 3DRSA 4OKKA 4KI4A 2OPRA 3AA3A 4DTJA 4J2EA 2HHXA 4IFYA 4M42A 3HM9A 5D3GA 3L3VA 3ALYA 1YT3A 2JGUA 4I9LA 3HXMA 1N5YA 3DLHA 4Z4HA 1IKWA 4HUEA 1D9DA 4QCLA 1UOCA 2Y1IA 3CFPA 1J9AA 5KI6A 2X74A 4CHQA 1TK5A 4DWIA 2B4JA 3VQAA 4K8XA 4AHVA 3DI6A 3VQ6A 4R5PA 3NGYA 3M8RA 4DTNA 2OYQA 4C8NA 3UIQA 4Z4IA 1SKRA 2Z1JA 1Q9XA 1RDAA 3KKSA 2YNHA 4J2AA 2IS3A 2WOMA 4CEZA 2B6AA 2Z1HA 3M8QA 4FZZA 4Z4EA 1JLEA 3CQ8A 4CJQA 3HSTB 3CM6A 3OY9A 3AVBA 4BWMA 4O5BA 2WQGA 4DSFA 4BDPA 1JXEA 4DSEA 5C24A 2FBVA 2PZSA 1RDDA 3OYDA 4E7IA 1IO2A 1VK0A 2WONA 3C6TA 4RW4A 1JEQA 4FJLA 2G8IA 3ZSWA 1MU2A 3QNNA 2YKNA 2G8WA 1TKXA 3P1GA 4EZ6A 2HHQA 1T03A 2QKKA 1XHZA 3U6FA 2IGIA 3M8SA 3PV8A 1L3SA 3MECA 4WE1A 4CJ3A 4Q5VA 4FLUA 1SKSA 1KLMA 1HQUA 3NGIA 3HK2A 2BDPA 4OLBA 3MXJA 4HCCA 1RT7A 2IAJA 4FCYA 3O3HA 4DLGA 4EZ9A 4E3SA 1XC9A 4Z4CA 2XHBA 1GOBA 1CZBA 4FJ8A 4FLVA 3AO3A 3VN5A 3HJFA 4ELUA 1T05A 1B9FA 1BHLA 2X6SA 4CEAA 4Z4FA 3NCIA 1L3UA 4DQIA 1J53A 1EX4A 2RN2A 3AVAA 4F2SA 3WNFA 4FLTA 3JSMA 3ZSVA 3MXIA 1JLCA 4DS4A 3G10A 3L2VA 3MEEA 4OJRA 2OPQA 3A2FA 1C0UA 1S5JA 2HNYA 4Y1DA 4AHRA 2O4IA 3OYBA 1NK5A 2KVDA 3L2QA 1Z25A 1GOCA 3NF7A 3KLEA 4DTUA 4FW1A 4DSLA 1NK0A 3RMCA 1VSLA 3VQPA 4LSLA 1QSLA 1SL2A 4M41A 3OYGA 3PO5A 4CF1A 1C1CA 4M3UA 1LAVA 3V1RA 1QTMA 4M3WA 1TL3A 5KTQA 4CJEA 3QEVA 4B9NA 2HHWA 1SL0A 4OLAA 4FVMA 2OZSA 1C0MA 1L3VA 4NCGA 3TARA 3OYCA 4FZXC 4RW9A 4OKJA 3D0PA 4CEQA 1C1BA 5HRPA 3SNNA 1VSKA 1NKCA 3T1AA 3CFRA 2YHAA 4B08A 3OJSA 3KLHA 1EKEA 4K8ZA 4B9LA 4FK0A 4CJ4A 4F8RA 1QS4A 2F8SA 3KLIA 2D0AA 3PO4A 1FKPA 2E6LA 4CJTA 1VSIA 2LSNA 1B9DA 1C6VA 2OPPA 4KTWA 1TKZA 4W5RA 1KSPA 3PUFA 3NF8A 5FROA 3NBPA 1VSHA 3PX4A 1WLJA 3TAQA 2P5OA 4KHQA 3IRXA 3SUQA 4RW6A 4XIUA 2HW3A 1BQNA 3ZT0A 3VQCA 2QXFA 4PUOA 2RPIA 4CJLA 4DMNA 3L8BA 4FJHA 4FLZA 4BDZA 4BITA 3SPZA 4CEEA 5HRNA 3RRGA 1WN7A 3KJVA 1T7PA 2HNDA 2HMIA 1UA1A 5DK5A 1HNVA 3RMAA 5CZ1A 3VQ9A 1YTAA 3OYIA 2KZMA 3SUOA 3VQ8A 3V9XA 1S1WA 2XO7A 2KFZA 5C42A 1C1AA 1HPZA 3FFIA 3PY8A 1EETA 2ZE2A 4OVLA 3RWUA 4RG8A 4CJUA 4CEOA 4CFBA 1TGOA 4CHNA 1KVBA 3DLGA 1JJRA 1S6QA 3SYZA 4FJ9A 1X9WA 2ETJA 1S1VA 1TVRA 5KGWA 3NH0A 3K58A 4CFCA 1IG9A 1RTHA 3KKRA 3G0ZA 2RNOA 4NYFA 4CGIA 5J2PA 1SUQA 4N41A 4FK2A 3QEPA 4FJXA 4PY5A 2G8HA 4FJ7A 3AVMA 3LP0A 4CK3A 3SQ1A 4CEDA 4FW2A 1D9FA 1TK0A 3QEWA 1HNIA 1Z26A 4KKOA 4CF9A 3LZJA 4FZYA 1ZBUA 3NHGA 4NCBA 2GUIA 3BGRA 4LH4A 3I8DA 4M3YA 3OYMA 3TABA 1IKYA 3AO2A 4O4GA 5K14A 3AVCA 2YV0X 4KHUA 1U48A 1LW0A 4CJSA 4CF8A 5J2NA 1NKEA 1JLGA 4ID5A 2A1RA 4CFDA 3WNGA 3NH2A 3LWLA 3K57A 1RDCA 4GVMA 4F4KA 3U3YA 4CIGA 4Z4GA 4CJFA 1NOZA 3F9KA 3SV4A 3RTVA 1WSIA 3AV9A 2F8TA 4AHCA 3O4QA 3S9HA 1HRHA 1ZBFA 4LSNA 1NK7A 2HHUA 1J54A 1G15A 1Q9YA 4BE0A 4YFUA 1RT5A 2KZZA 4CERA 4JRPA 5HP1A 3MAQA 4DS5A 1KFDA 3KTQA 4HCBA 1FXXA 4Q0BA 4DQRA 4CHYA 2OPSA 3LANA 3NF9A 4DF4A 5KGXA 1U47A 4C8LA 1IKXA 1QSYA 3NF6A 4CJ5A 4IKFA 1S9EA 4CGDA 1GOAA 3SQ0A 2E4LA 4CHPA 3ZSXA 1TAUA 4BACA 3S3MA 4O44A 1X9MA 1WAJA 4DQPA 3QIOA 4FYDA 3V1OA 2R7YA 1RT3A 3K5OA 4M3RA 1VSFA 3S3NA 4RW8A 4CJRA 4CF0A 3IAYA 3SUNA 4CGHA 4HVJA 4GMJB 1QQCA 4FLWA 2G8VA 2VG6A 1T8EA 4ICLA 1NK6A 2QK9A 2BE2A 1JKHA 3B6OA 4G1QA 1JLBA 2NUBA 3OYNA 3HT3A 3E01A 4FM1A 3PX6A 3DOKA 4MQ3A 3EY1A 4E7HA 3RMBA 1HYZA 2FBTA 4E7LA 1KCFA 3TAPA 1VSEA 4FJNA 4N76A 5DMRA 5C25A 1BL3A 4FJIA 4TSXA 1ITGA 1ASVA 3TI0A 4IDKA 3ZSOA 2PYLA 1JL2A 1A5XA 3AVNA 4KTQA 3IG1A 4E7KA 1NJZA 4CIEA 4E1NA 4JRQA 3VA3A 3CYMA 1I3AA 1UAXA 3AVGA 2DTUA 3KIOA 1KFSA 1FK9A 1IH7A 2E6MA 1BIUA 3H08A 3AA2A 3MXMA 1JXBA 4F2RA 3MEDA 1NJYA 3KD5E 4KHYA 3AO5A 3CFOA 3K5NA 1KVCA 3HO1A 3NGZA 4O0JA 2HVIA 1RDBA 4DG1A 4CJKA 3SJJA 4CGJA 3O3GA 4KB1A 4B3OA 2I5JA 5J1EA 3KK1A 4KI6A 2IOCA 3L2WA 3QETA 3AA5X 1A5WA 1JLQA 4DQSA 4FXDA 1S9GA 1XHXA 3AVIA 3HL8A 3MEGA 4FM2A 3V6DA 3V81A 3SPYA 3LP1A 3DM2A 2JLEA 3C94A 5KRSA 4EP4A 2G8KA 4ELTA 1RBRA 3L3UA 2RKIA 2HB5A 4Z0UA 4E19A 2FBYA 4CJVA 3JYTA 2IDOA 1HYVA 2D0BA 1LWCA 3ZSYA 3WNEA 4FLYA 4KFBA 2DFHA 3AVJA 3HPGA 1WSFA 4UQGA 4KAZA 4KV8A 5CYQA 4IG3A 2HHSA 2FBXA 1VSMA 1XI1A 1UWBA 3DLKA 1RT1A 4I2PA 5J2QA 4OGEA 3QNOA 2YNFA 4FLXA 4FJ5A 3SQ2A 4JLHA 1HYSA 3OYHA 1TAQA 1KVAA 1A5VA 1RNHA 3U3GA 2VG5A 3TAMA 3P83D 3K5LA 3V9UA 3ULDA 3TANA 3KD1E 4M3ZA 2DY4A 3CM5A 4CHOA 1CXQA 2ITGA 3KLFA 4NYNA 4KHSA 3VQ7A 2KW9A 2G8UA 3HPOA 2OZMA 4BE2A 3QEXA 1WSHA 1YVUA 2YHBA 3ITHA 4MFBA 3QERA 4IG0A 3QIPA 3NAEA 3C95A 3KK2A 3RR8A 1RTIA 4QAGA 1REVA 4CK2A 1RTJA 2DFEA 4DFPA 3NE6A 1U49A 1RT2A 1CZ9A 4HHTA 5SZTA 4FJMA 2EHGA 2PYJA 1SKWA 4BE1A 3HP9A 4FM0A 3DOLA 4CFAA 1ASUA 2P51A 5KRTA 4J2DA 2HHVA 1VSDA 3QO9A 4FJJA 4N47A 5J2MA 2VWJA 3RMDA 4C8KA 4F3OA 1ZYQA 3AO1A 2YNGA 3AO4A 1L3TA 3LAKA 1ZBLA 3VA0A 2P5GA 2XRIA 1TKDA 4DSJA 4EP5A 1TV6A 2ATQA 2O4GA 4B8AB 2XY5A 3ZT3A 2BGGA 1NJWA 1U04A 3K2PA 4CESA 5FRNA 1ZBIA 4OGCA 4B9TA 4JS5A 5HBMA 2KW4A 3TAEA 3VQ5A 4H8KA 3DRPA 3PX0A 5I3UA 3VQBA 5HRRA 1X1PA 3ZT4A 1QE1A 3LPTA 4BDYA 2VG7A 4C8MA 3F73A 1B92A 4CGGA 2B5JA 1ZBHA 1K6YA 3AVFA 1Q8IA 2HNZA 1IKVA 3LDSA 4DTSA 3TAGA 2XY7A 3V1QA 3HP6A 1U4BA 4E7JA 1RBVA 5E41A 3TAFA 4J2BA 1BCOA 1LW2A 2D5RA 4L8RB 4I7FA 1S6PA 1WSJA 3TWHA 1XWLA 5HLFA 1Y97A 4H4MA 2D0CA 4B9UA 2YNIA 2G8FA 2QKBA 1CXUA 2A1SA 2HVHA 1D5AA 3T3FA 2X6NA 3QEIA 2GV9A 2IC3A 3DMJA 4KO0A 4DTPA 1D8YA 1JLAA 3OS0A 4CIFA 1WSEA 4CEBA 3ZT2A 4FK4A 3V9ZA 1JL1A 4AH9A 1RBSA 3SCXA 4DF8A 5CYMA 1RBTA 4M45A 4FJGA 2ZD1A 1TKTA 5CY4A 1BCMA 1VRTA 4DQQA 4CGFA 3SQ4A 2KQ2A 3AA4A 4N5SA 2ZQBA 3HPHA 4DU4A 4E1MA 3ZSRA 5FRMA 1TK8A 3B6PA 3CG7A 3V4IA 4O55A 1J5OA 4NCAA 4UZWA 2KVUA 2Z1GA 3DLEA 4N56A 1ASWA 3OYKA 4CJWA 4DTOA 2PY5A 3ASMA 2P1JA 4GW6A 4W5OA 1NOYA 3AVKA 4KTZA 4KPYA 1V66A 1R0AA 1N6QA 3SI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJR A;  4CF2 A;  3K5M A;  2Y1J A;  1RT4 A;  3S3O A;  1O1W A;  5EU7 A;  5I42 A;  3DLR A;  4CJP A;  5CZ2 A;  1LV5 A;  2RNN A;  4B9M A;  4OPJ A;  4DFM A;  1DLO A;  4Y1C A;  3NH1 A;  4KRE A;  1WNS A;  3DYA A;  3V9S A;  3V9W A;  2BAN A;  1WSG A;  3L2U A;  4DFJ A;  1NKB A;  1BI4 A;  1W9H A;  1KRP A;  1BIS A;  2YKM A;  1JLF A;  2AJQ A;  3QLH A;  4QOZ B;  1F21 A;  1C0T A;  4DLE A;  4IBN A;  4KB0 A;  4I2Q A;  3KLG A;  4C8O A;  3HYF A;  4LD0 A;  3EZ5 A;  1BQM A;  3HVR A;  3LZI A;  1NK8 A;  3NFA A;  2VWK A;  3AVL A;  4HUF A;  4W5T A;  4BWJ A;  1VRU A;  2KVE A;  3IS9 A;  1RTD A;  3LPU A;  2FC0 A;  4H4O A;  3ZSZ A;  4AIL C;  2JVW A;  3TR8 A;  4KHW A;  3BDP A;  4W5Q A;  3NDK A;  4PA1 A;  4DTM A;  4M3X A;  3VQQ A;  2X78 A;  1SL1 A;  3O4N A;  1FKO A;  2Z1I A;  4I9Q A;  4O0I A;  4CK1 A;  4AHU A;  3OYL A;  1SV5 A;  3I0S A;  3RRH A;  4ZTF A;  3EYZ A;  4KRF A;  1EP4 A;  3OS1 A;  3VQE A;  1QSS A;  3OYA A;  3O3F A;  5FDL A;  1NK4 A;  4PQU A;  3KK3 A;  3LWM A;  1BGX T;  4W5N A;  3THV A;  1I39 A;  4ZHR A;  3OJU A;  1W0H A;  3C6U A;  3P5J A;  4B9S A;  1QHT A;  5JS1 A;  4CHZ A;  4RW7 A;  5SWM A;  1LAW A;  3WNH A;  3ZT1 A;  4LY7 A;  4AHS A;  4E0D A;  2KFN A;  2F96 A;  4DTX A;  4DU1 A;  2RF2 A;  3D45 A;  4OKE A;  1DTT A;  2KTQ A;  3AVH A;  4LH5 A;  2Q3S A;  1WAF A;  5T7B A;  3QES A;  3LAL A;  5JS2 A;  4CCH A;  1DTQ A;  2W42 A;  1RIL A;  3VQ4 A;  1LWF A;  3ZCM A;  3SZ2 A;  1L5U A;  1EXQ A;  3LAM A;  4JS4 A;  1S1U A;  3HVT A;  3DLB A;  1KTQ A;  3SUP A;  5HRO A;  1S1T A;  3OS2 A;  4HTU A;  1CLQ A;  1VSJ A;  4DSI A;  4FJK A;  3OVN A;  2DFF A;  4B8C A;  5HRS A;  3M8P A;  4ID1 A;  1U45 A;  1RT6 A;  4CEF A;  4ZTJ A;  4KHN A;  2XY6 A;  1NJX A;  1X9S A;  4CE9 A;  3LP2 A;  1YTU A;  4AHT A;  3T19 A;  4IFV A;  4CEC A;  3RR7 A;  1RCH A;  3ZSQ A;  2GBZ A;  1KLN A;  1BI4 B;  2OA8 A;  4E89 A;  3SV3 A;  3OYJ A;  3OYE A;  4M3T A;  3ISN C;  1BIZ A;  2XY8 A;  1NK9 A;  1LWE A;  4DTR A;  3OYF A;  3K59 A;  4DSK A;  3L2R A;  1S1X A;  4OPK A;  2HHT A;  1HMV A;  4PWD A;  4YNQ A;  3DRR A;  1TL1 A;  4B9V A;  1H1J S;  3I0R A;  4DFK A;  1UA0 A;  3VQD A;  4DU3 A;  3LP3 A;  1RBU A;  3QIN A;  2EX3 A;  4F3T A;  4HUG A;  1HQE A;  4ELV A;  3DRS A;  4OKK A;  4KI4 A;  2OPR A;  3AA3 A;  4DTJ A;  4J2E A;  2HHX A;  4IFY A;  4M42 A;  3HM9 A;  5D3G A;  3L3V A;  3ALY A;  1YT3 A;  2JGU A;  4I9L A;  3HXM A;  1N5Y A;  3DLH A;  4Z4H A;  1IKW A;  4HUE A;  1D9D A;  4QCL A;  1UOC A;  2Y1I A;  3CFP A;  1J9A A;  5KI6 A;  2X74 A;  4CHQ A;  1TK5 A;  4DWI A;  2B4J A;  3VQA A;  4K8X A;  4AHV A;  3DI6 A;  3VQ6 A;  4R5P A;  3NGY A;  3M8R A;  4DTN A;  2OYQ A;  4C8N A;  3UIQ A;  4Z4I A;  1SKR A;  2Z1J A;  1Q9X A;  1RDA A;  3KKS A;  2YNH A;  4J2A A;  2IS3 A;  2WOM A;  4CEZ A;  2B6A A;  2Z1H A;  3M8Q A;  4FZZ A;  4Z4E A;  1JLE A;  3CQ8 A;  4CJQ A;  3HST B;  3CM6 A;  3OY9 A;  3AVB A;  4BWM A;  4O5B A;  2WQG A;  4DSF A;  4BDP A;  1JXE A;  4DSE A;  5C24 A;  2FBV A;  2PZS A;  1RDD A;  3OYD A;  4E7I A;  1IO2 A;  1VK0 A;  2WON A;  3C6T A;  4RW4 A;  1JEQ A;  4FJL A;  2G8I A;  3ZSW A;  1MU2 A;  3QNN A;  2YKN A;  2G8W A;  1TKX A;  3P1G A;  4EZ6 A;  2HHQ A;  1T03 A;  2QKK A;  1XHZ A;  3U6F A;  2IGI A;  3M8S A;  3PV8 A;  1L3S A;  3MEC A;  4WE1 A;  4CJ3 A;  4Q5V A;  4FLU A;  1SKS A;  1KLM A;  1HQU A;  3NGI A;  3HK2 A;  2BDP A;  4OLB A;  3MXJ A;  4HCC A;  1RT7 A;  2IAJ A;  4FCY A;  3O3H A;  4DLG A;  4EZ9 A;  4E3S A;  1XC9 A;  4Z4C A;  2XHB A;  1GOB A;  1CZB A;  4FJ8 A;  4FLV A;  3AO3 A;  3VN5 A;  3HJF A;  4ELU A;  1T05 A;  1B9F A;  1BHL A;  2X6S A;  4CEA A;  4Z4F A;  3NCI A;  1L3U A;  4DQI A;  1J53 A;  1EX4 A;  2RN2 A;  3AVA A;  4F2S A;  3WNF A;  4FLT A;  3JSM A;  3ZSV A;  3MXI A;  1JLC A;  4DS4 A;  3G10 A;  3L2V A;  3MEE A;  4OJR A;  2OPQ A;  3A2F A;  1C0U A;  1S5J A;  2HNY A;  4Y1D A;  4AHR A;  2O4I A;  3OYB A;  1NK5 A;  2KVD A;  3L2Q A;  1Z25 A;  1GOC A;  3NF7 A;  3KLE A;  4DTU A;  4FW1 A;  4DSL A;  1NK0 A;  3RMC A;  1VSL A;  3VQP A;  4LSL A;  1QSL A;  1SL2 A;  4M41 A;  3OYG A;  3PO5 A;  4CF1 A;  1C1C A;  4M3U A;  1LAV A;  3V1R A;  1QTM A;  4M3W A;  1TL3 A;  5KTQ A;  4CJE A;  3QEV A;  4B9N A;  2HHW A;  1SL0 A;  4OLA A;  4FVM A;  2OZS A;  1C0M A;  1L3V A;  4NCG A;  3TAR A;  3OYC A;  4FZX C;  4RW9 A;  4OKJ A;  3D0P A;  4CEQ A;  1C1B A;  5HRP A;  3SNN A;  1VSK A;  1NKC A;  3T1A A;  3CFR A;  2YHA A;  4B08 A;  3OJS A;  3KLH A;  1EKE A;  4K8Z A;  4B9L A;  4FK0 A;  4CJ4 A;  4F8R A;  1QS4 A;  2F8S A;  3KLI A;  2D0A A;  3PO4 A;  1FKP A;  2E6L A;  4CJT A;  1VSI A;  2LSN A;  1B9D A;  1C6V A;  2OPP A;  4KTW A;  1TKZ A;  4W5R A;  1KSP A;  3PUF A;  3NF8 A;  5FRO A;  3NBP A;  1VSH A;  3PX4 A;  1WLJ A;  3TAQ A;  2P5O A;  4KHQ A;  3IRX A;  3SUQ A;  4RW6 A;  4XIU A;  2HW3 A;  1BQN A;  3ZT0 A;  3VQC A;  2QXF A;  4PUO A;  2RPI A;  4CJL A;  4DMN A;  3L8B A;  4FJH A;  4FLZ A;  4BDZ A;  4BIT A;  3SPZ A;  4CEE A;  5HRN A;  3RRG A;  1WN7 A;  3KJV A;  1T7P A;  2HND A;  2HMI A;  1UA1 A;  5DK5 A;  1HNV A;  3RMA A;  5CZ1 A;  3VQ9 A;  1YTA A;  3OYI A;  2KZM A;  3SUO A;  3VQ8 A;  3V9X A;  1S1W A;  2XO7 A;  2KFZ A;  5C42 A;  1C1A A;  1HPZ A;  3FFI A;  3PY8 A;  1EET A;  2ZE2 A;  4OVL A;  3RWU A;  4RG8 A;  4CJU A;  4CEO A;  4CFB A;  1TGO A;  4CHN A;  1KVB A;  3DLG A;  1JJR A;  1S6Q A;  3SYZ A;  4FJ9 A;  1X9W A;  2ETJ A;  1S1V A;  1TVR A;  5KGW A;  3NH0 A;  3K58 A;  4CFC A;  1IG9 A;  1RTH A;  3KKR A;  3G0Z A;  2RNO A;  4NYF A;  4CGI A;  5J2P A;  1SUQ A;  4N41 A;  4FK2 A;  3QEP A;  4FJX A;  4PY5 A;  2G8H A;  4FJ7 A;  3AVM A;  3LP0 A;  4CK3 A;  3SQ1 A;  4CED A;  4FW2 A;  1D9F A;  1TK0 A;  3QEW A;  1HNI A;  1Z26 A;  4KKO A;  4CF9 A;  3LZJ A;  4FZY A;  1ZBU A;  3NHG A;  4NCB A;  2GUI A;  3BGR A;  4LH4 A;  3I8D A;  4M3Y A;  3OYM A;  3TAB A;  1IKY A;  3AO2 A;  4O4G A;  5K14 A;  3AVC A;  2YV0 X;  4KHU A;  1U48 A;  1LW0 A;  4CJS A;  4CF8 A;  5J2N A;  1NKE A;  1JLG A;  4ID5 A;  2A1R A;  4CFD A;  3WNG A;  3NH2 A;  3LWL A;  3K57 A;  1RDC A;  4GVM A;  4F4K A;  3U3Y A;  4CIG A;  4Z4G A;  4CJF A;  1NOZ A;  3F9K A;  3SV4 A;  3RTV A;  1WSI A;  3AV9 A;  2F8T A;  4AHC A;  3O4Q A;  3S9H A;  1HRH A;  1ZBF A;  4LSN A;  1NK7 A;  2HHU A;  1J54 A;  1G15 A;  1Q9Y A;  4BE0 A;  4YFU A;  1RT5 A;  2KZZ A;  4CER A;  4JRP A;  5HP1 A;  3MAQ A;  4DS5 A;  1KFD A;  3KTQ A;  4HCB A;  1FXX A;  4Q0B A;  4DQR A;  4CHY A;  2OPS A;  3LAN A;  3NF9 A;  4DF4 A;  5KGX A;  1U47 A;  4C8L A;  1IKX A;  1QSY A;  3NF6 A;  4CJ5 A;  4IKF A;  1S9E A;  4CGD A;  1GOA A;  3SQ0 A;  2E4L A;  4CHP A;  3ZSX A;  1TAU A;  4BAC A;  3S3M A;  4O44 A;  1X9M A;  1WAJ A;  4DQP A;  3QIO A;  4FYD A;  3V1O A;  2R7Y A;  1RT3 A;  3K5O A;  4M3R A;  1VSF A;  3S3N A;  4RW8 A;  4CJR A;  4CF0 A;  3IAY A;  3SUN A;  4CGH A;  4HVJ A;  4GMJ B;  1QQC A;  4FLW A;  2G8V A;  2VG6 A;  1T8E A;  4ICL A;  1NK6 A;  2QK9 A;  2BE2 A;  1JKH A;  3B6O A;  4G1Q A;  1JLB A;  2NUB A;  3OYN A;  3HT3 A;  3E01 A;  4FM1 A;  3PX6 A;  3DOK A;  4MQ3 A;  3EY1 A;  4E7H A;  3RMB A;  1HYZ A;  2FBT A;  4E7L A;  1KCF A;  3TAP A;  1VSE A;  4FJN A;  4N76 A;  5DMR A;  5C25 A;  1BL3 A;  4FJI A;  4TSX A;  1ITG A;  1ASV A;  3TI0 A;  4IDK A;  3ZSO A;  2PYL A;  1JL2 A;  1A5X A;  3AVN A;  4KTQ A;  3IG1 A;  4E7K A;  1NJZ A;  4CIE A;  4E1N A;  4JRQ A;  3VA3 A;  3CYM A;  1I3A A;  1UAX A;  3AVG A;  2DTU A;  3KIO A;  1KFS A;  1FK9 A;  1IH7 A;  2E6M A;  1BIU A;  3H08 A;  3AA2 A;  3MXM A;  1JXB A;  4F2R A;  3MED A;  1NJY A;  3KD5 E;  4KHY A;  3AO5 A;  3CFO A;  3K5N A;  1KVC A;  3HO1 A;  3NGZ A;  4O0J A;  2HVI A;  1RDB A;  4DG1 A;  4CJK A;  3SJJ A;  4CGJ A;  3O3G A;  4KB1 A;  4B3O A;  2I5J A;  5J1E A;  3KK1 A;  4KI6 A;  2IOC A;  3L2W A;  3QET A;  3AA5 X;  1A5W A;  1JLQ A;  4DQS A;  4FXD A;  1S9G A;  1XHX A;  3AVI A;  3HL8 A;  3MEG A;  4FM2 A;  3V6D A;  3V81 A;  3SPY A;  3LP1 A;  3DM2 A;  2JLE A;  3C94 A;  5KRS A;  4EP4 A;  2G8K A;  4ELT A;  1RBR A;  3L3U A;  2RKI A;  2HB5 A;  4Z0U A;  4E19 A;  2FBY A;  4CJV A;  3JYT A;  2IDO A;  1HYV A;  2D0B A;  1LWC A;  3ZSY A;  3WNE A;  4FLY A;  4KFB A;  2DFH A;  3AVJ A;  3HPG A;  1WSF A;  4UQG A;  4KAZ A;  4KV8 A;  5CYQ A;  4IG3 A;  2HHS A;  2FBX A;  1VSM A;  1XI1 A;  1UWB A;  3DLK A;  1RT1 A;  4I2P A;  5J2Q A;  4OGE A;  3QNO A;  2YNF A;  4FLX A;  4FJ5 A;  3SQ2 A;  4JLH A;  1HYS A;  3OYH A;  1TAQ A;  1KVA A;  1A5V A;  1RNH A;  3U3G A;  2VG5 A;  3TAM A;  3P83 D;  3K5L A;  3V9U A;  3ULD A;  3TAN A;  3KD1 E;  4M3Z A;  2DY4 A;  3CM5 A;  4CHO A;  1CXQ A;  2ITG A;  3KLF A;  4NYN A;  4KHS A;  3VQ7 A;  2KW9 A;  2G8U A;  3HPO A;  2OZM A;  4BE2 A;  3QEX A;  1WSH A;  1YVU A;  2YHB A;  3ITH A;  4MFB A;  3QER A;  4IG0 A;  3QIP A;  3NAE A;  3C95 A;  3KK2 A;  3RR8 A;  1RTI A;  4QAG A;  1REV A;  4CK2 A;  1RTJ A;  2DFE A;  4DFP A;  3NE6 A;  1U49 A;  1RT2 A;  1CZ9 A;  4HHT A;  5SZT A;  4FJM A;  2EHG A;  2PYJ A;  1SKW A;  4BE1 A;  3HP9 A;  4FM0 A;  3DOL A;  4CFA A;  1ASU A;  2P51 A;  5KRT A;  4J2D A;  2HHV A;  1VSD A;  3QO9 A;  4FJJ A;  4N47 A;  5J2M A;  2VWJ A;  3RMD A;  4C8K A;  4F3O A;  1ZYQ A;  3AO1 A;  2YNG A;  3AO4 A;  1L3T A;  3LAK A;  1ZBL A;  3VA0 A;  2P5G A;  2XRI A;  1TKD A;  4DSJ A;  4EP5 A;  1TV6 A;  2ATQ A;  2O4G A;  4B8A B;  2XY5 A;  3ZT3 A;  2BGG A;  1NJW A;  1U04 A;  3K2P A;  4CES A;  5FRN A;  1ZBI A;  4OGC A;  4B9T A;  4JS5 A;  5HBM A;  2KW4 A;  3TAE A;  3VQ5 A;  4H8K A;  3DRP A;  3PX0 A;  5I3U A;  3VQB A;  5HRR A;  1X1P A;  3ZT4 A;  1QE1 A;  3LPT A;  4BDY A;  2VG7 A;  4C8M A;  3F73 A;  1B92 A;  4CGG A;  2B5J A;  1ZBH A;  1K6Y A;  3AVF A;  1Q8I A;  2HNZ A;  1IKV A;  3LDS A;  4DTS A;  3TAG A;  2XY7 A;  3V1Q A;  3HP6 A;  1U4B A;  4E7J A;  1RBV A;  5E41 A;  3TAF A;  4J2B A;  1BCO A;  1LW2 A;  2D5R A;  4L8R B;  4I7F A;  1S6P A;  1WSJ A;  3TWH A;  1XWL A;  5HLF A;  1Y97 A;  4H4M A;  2D0C A;  4B9U A;  2YNI A;  2G8F A;  2QKB A;  1CXU A;  2A1S A;  2HVH A;  1D5A A;  3T3F A;  2X6N A;  3QEI A;  2GV9 A;  2IC3 A;  3DMJ A;  4KO0 A;  4DTP A;  1D8Y A;  1JLA A;  3OS0 A;  4CIF A;  1WSE A;  4CEB A;  3ZT2 A;  4FK4 A;  3V9Z A;  1JL1 A;  4AH9 A;  1RBS A;  3SCX A;  4DF8 A;  5CYM A;  1RBT A;  4M45 A;  4FJG A;  2ZD1 A;  1TKT A;  5CY4 A;  1BCM A;  1VRT A;  4DQQ A;  4CGF A;  3SQ4 A;  2KQ2 A;  3AA4 A;  4N5S A;  2ZQB A;  3HPH A;  4DU4 A;  4E1M A;  3ZSR A;  5FRM A;  1TK8 A;  3B6P A;  3CG7 A;  3V4I A;  4O55 A;  1J5O A;  4NCA A;  4UZW A;  2KVU A;  2Z1G A;  3DLE A;  4N56 A;  1ASW A;  3OYK A;  4CJW A;  4DTO A;  2PY5 A;  3ASM A;  2P1J A;  4GW6 A;  4W5O A;  1NOY A;  3AVK A;  4KTZ A;  4KPY A;  1V66 A;  1R0A A;  1N6Q A;  3SI6 A; 
#chains in the Genus database with same CATH topology
 1HJR A;  4CF2 A;  3K5M A;  5EU7 A;  5I42 A;  2OTL N;  1U2V A;  2P9L B;  3DLR A;  2GUP A;  3A0I X;  4DFM A;  5FPD A;  4GNI A;  3DYA A;  2BAN A;  4FO0 A;  4DFJ A;  1NKB A;  2LD7 A;  1KRP A;  2AJQ A;  1F21 A;  3HYF A;  4LD0 A;  1BQM A;  2VWK A;  1SAZ A;  2JVW A;  5AQR A;  3T69 A;  3BDP A;  4W5Q A;  4DTM A;  4M3X A;  1WBB A;  3EN9 A;  1A62 A;  4AHU A;  4CK1 A;  4ZTF A;  3D2E A;  3S41 A;  4W5N A;  2CH5 A;  2E1Z A;  3OJU A;  4CJ7 A;  4DR5 K;  4ILH A;  5AQM A;  1LAW A;  3WNH A;  3ULE A;  2KFN A;  1NGD A;  4BGB A;  2F96 A;  1YJ9 N;  2KTQ A;  1DTT A;  4JKA A;  1QZ5 A;  2A6A A;  1WAF A;  1VQ6 N;  5JS2 A;  3VQ4 A;  2HBL A;  3DLB A;  3OS2 A;  3BUZ B;  4B8C A;  5GAD P;  1DKG D;  3G71 N;  3CC7 N;  4CE9 A;  3OA9 A;  5M1F A;  3O9S A;  4AHT A;  1RCH A;  5KPZ A;  3VGL A;  1BI4 B;  3VEV A;  3OYJ A;  3VET A;  1YHQ N;  3AAP A;  3MK6 A;  3ISN C;  2XY8 A;  1NK9 A;  1LWE A;  4BG8 A;  3JAM O;  5C0Y A;  3BF3 A;  2E2N A;  3VTI A;  4PWD A;  4YOT A;  2H3G X;  3M5R A;  5HOO A;  3E9L A;  3QFU A;  3WXL A;  2ODG C;  3QIN A;  4FWQ A;  4F3T A;  3DRS A;  3ZX0 A;  4DTJ A;  3HM9 A;  5D3G A;  4PHT X;  3ALY A;  1BA1 A;  2Y1I A;  3CFP A;  1J9A A;  5KI6 A;  4CHQ A;  4DWI A;  1U6Z A;  5E84 A;  3NGY A;  4C8N A;  1RDA A;  1OVY A;  3GG4 A;  2B6A A;  3E66 A;  3TTF A;  2DPN A;  3CQ8 A;  4CJQ A;  3CM6 A;  4BWM A;  2NLX A;  4DSE A;  2FBV A;  3OYD A;  3J80 O;  2YJF A;  4E7I A;  3FZL A;  4L3Q A;  2WON A;  4RW4 A;  5CE3 A;  1WUA A;  3U6F A;  4FVU A;  2IGI A;  1S22 A;  4FLU A;  3HK2 A;  2BDP A;  4JHD B;  3O3H A;  3C0B A;  1R59 O;  4BR5 A;  1GOB A;  3O5B A;  3AO3 A;  3U9Z A;  1VQN N;  1T05 A;  4GV3 A;  2PBD A;  4F2S A;  2RN2 A;  4DS4 A;  2OPQ A;  4BRI A;  1C0U A;  4BQZ A;  5ADX H;  2O4I A;  5BRE A;  3L2Q A;  5ADX A;  4HWI A;  4FW1 A;  3CJ7 A;  2PAV A;  2YHW A;  3VQP A;  4JD2 A;  3SJH A;  1QTM A;  5AQT A;  4CJE A;  2HHW A;  1SL0 A;  1L3V A;  3TAR A;  5AJ3 K;  3OYC A;  4FZX C;  1XMQ K;  4KBO A;  4RW9 A;  5AQG A;  2BTF A;  5HRP A;  3SNN A;  2O8B A;  1NKC A;  3T1A A;  3P31 A;  4B1X B;  4QS7 A;  5AZJ B;  2JWL A;  4YOV A;  1YUW A;  1J5E K;  4FWS A;  2D0A A;  1BWF O;  1FKP A;  2OAN A;  1VSI A;  2LSN A;  4W5R A;  4KTW A;  1TKZ A;  5AQH A;  3PUF A;  3NBP A;  3J7Y P;  4JKD A;  4RW6 A;  2HW3 A;  1WB9 A;  4PUO A;  4FJH A;  3KZB A;  2YCH A;  1TUU A;  4A59 A;  3SPZ A;  1T7P A;  2HND A;  5DK5 A;  1GJJ A;  4BRM A;  5I9E B;  4B1Y B;  3OYI A;  2KZM A;  3V9X A;  5C42 A;  1C1A A;  1HPZ A;  3FFI A;  2ZE2 A;  3RWU A;  3SBT A;  4CJU A;  4CEO A;  4CFB A;  4BC4 A;  4BC5 A;  3WT0 A;  4CHN A;  1JJR A;  1SZ2 A;  3WEE A;  3K58 A;  2QWR A;  4NYF A;  4FJX A;  2D4W A;  2G8H A;  4FJ7 A;  1MWM A;  1P90 A;  3BZK A;  2I7P A;  2QA4 N;  4CED A;  2Q31 A;  4FW2 A;  4LF6 K;  5AQK A;  1Z26 A;  3LZJ A;  4GKJ K;  3WQU A;  4JK8 A;  1NGC A;  3AVC A;  2YV0 X;  4KHU A;  1Q81 O;  4CJS A;  3GE1 A;  2P9K A;  3D2E B;  3NH2 A;  5AQQ A;  3VF2 A;  4CJF A;  3SV4 A;  3AV9 A;  3L6Q A;  1Q9Y A;  3OTO K;  1KXP A;  1RT5 A;  3ULE B;  4GV9 A;  2Q0R A;  5HP1 A;  4FPB A;  1KFD A;  4HCB A;  1FXX A;  1X9J A;  5AZI B;  2OPS A;  4CJ5 A;  4O44 A;  5CR4 A;  4FYD A;  2J4R A;  3V1O A;  2NRX A;  5AFU H;  3IFR A;  4IXC A;  3TPQ A;  5M1Q A;  1QQC A;  2VG6 A;  3RSE A;  5AFU A;  3B6O A;  3LDN A;  4BRG A;  2FF3 B;  4E7H A;  2FSK A;  1RFQ A;  4H0O A;  4IO8 A;  1ITG A;  4FWP A;  3TI0 A;  3AVN A;  4E7K A;  1NJZ A;  4JRQ A;  5CIU A;  1OKJ A;  4BVP A;  4JI7 K;  1KFS A;  4FPA A;  2VQF K;  1X3M A;  2ZJR L;  1NJY A;  3H6E A;  3CFO A;  5LMU K;  4O0J A;  3SMP A;  2HVI A;  4DG1 A;  1XNQ K;  1GKU B;  1QVF M;  2IOC A;  3AY9 A;  2WBN A;  3ZEU B;  1XHX A;  2VYP A;  1VQO N;  2HBJ A;  3LP1 A;  1QQM A;  1ZS9 A;  3HZ6 A;  4JK9 A;  3VMF B;  4EP4 A;  3L3U A;  2A3Z A;  4E19 A;  2FBY A;  4CJV A;  5JMV A;  4FLY A;  3MCP A;  3AGR A;  4KV8 A;  4IG3 A;  4E1J A;  4LFC K;  3BZC A;  5J2Q A;  1RT1 A;  3EKU A;  4OGE A;  3QNO A;  1LOT B;  1QZ6 A;  1IBM K;  2F9W A;  4JLH A;  2IIR A;  1TAQ A;  4JKE A;  1A5V A;  4M3Z A;  3P83 D;  3G4S N;  4FWM A;  1YIT N;  3O80 A;  3KLF A;  1D4X A;  3CMA N;  4KHS A;  3VQ7 A;  2O8E B;  4GV6 A;  3TTC A;  4H5R A;  1K8K A;  1YVU A;  2YHB A;  4NLC A;  3QER A;  3WUH A;  3QIP A;  3W3D A;  3KK2 A;  1YJN N;  5LJV A;  3CF5 L;  1RTI A;  4CK2 A;  1REV A;  4MLE A;  1P8Z A;  2DFE A;  5KQ8 A;  1RT2 A;  4H0X B;  2F7T A;  5SZT A;  4FJM A;  3J81 O;  2PYJ A;  3HP9 A;  4FM0 A;  3CD6 N;  4CFA A;  2HHV A;  3T7Z A;  4N47 A;  5J2M A;  4FJJ A;  2VGM A;  2DK4 A;  1IV0 A;  2E5L K;  4C8K A;  1ZBL A;  2CH6 A;  1HX1 A;  4DSJ A;  1Q82 O;  4DKW A;  2ATQ A;  3EE8 A;  4DB3 A;  1U04 A;  4CES A;  4B9T A;  4JS5 A;  3CQY A;  4NXM K;  4BR0 A;  3DRP A;  2E8A A;  3H3N O;  4BDY A;  3DXK A;  3F73 A;  2B5J A;  1Q8I A;  5F0X A;  2LC3 A;  3V1Q A;  3J7A P;  4JKF A;  2D5R A;  2NRH A;  4K25 A;  1S6P A;  1WSJ A;  1XWL A;  4BRQ A;  1YNS A;  4H4M A;  3SBG A;  4ISF A;  1D5A A;  1NWK A;  1HPM A;  3CPW M;  1GLF O;  2X6N A;  3DMJ A;  4DTP A;  5C10 A;  1JLA A;  3OS0 A;  1WSE A;  4CEB A;  4FK4 A;  1JL1 A;  5CYM A;  2W51 A;  5EVZ A;  5AQU A;  1BCM A;  4XH4 A;  3WEE B;  3AA4 A;  5BR8 K;  2WFB A;  4FWN A;  3R6M A;  1H9E A;  1YF5 L;  3DLE A;  1ASW A;  3OYK A;  3ASM A;  3D7E O;  4W5O A;  1NOY A;  1R0A A;  2D0O A;  4YOU A;  3H45 C;  5C2D A;  1VQ9 N;  4Y1C A;  3V9S A;  1BI4 A;  4JYA K;  2GEM A;  2YKM A;  1C0T A;  4DLE A;  4IBN A;  4C8O A;  3IKM A;  5BPN A;  4DR7 K;  3HVR A;  1NK8 A;  3NFA A;  4HUF A;  5AQV A;  4W5T A;  1T44 A;  3IS9 A;  5GIO A;  5CHI A;  5GAH P;  3VPZ A;  3TR8 A;  4WFN L;  4CD3 A;  2VWB A;  2X78 A;  1SL1 A;  2CGJ A;  5JLF A;  3FFK B;  4KH4 A;  2Z1I A;  3H46 O;  3OYL A;  3VQE A;  1QSS A;  4BC2 A;  1EQY A;  1NK4 A;  4PQU A;  3LWM A;  2YX6 A;  4DV3 K;  1J6Z A;  1ATR A;  4FWL A;  1QHT A;  5JS1 A;  3THY B;  4O8K A;  4LY7 A;  1Z6R A;  1HKG A;  3RSE B;  4DTX A;  2RF2 A;  4OKE A;  3AVH A;  4DV0 K;  5FPE A;  5T7B A;  3QES A;  3LAL A;  3FLC O;  1NGH A;  4C1N I;  4B1W B;  1LWF A;  3SZ2 A;  3L4Q A;  1EXQ A;  3LAM A;  3KVG A;  3O4W A;  4JS4 A;  1L5U A;  5HRO A;  4R79 A;  4FJK A;  4DSI A;  3GBT A;  3MN7 A;  1GL9 B;  3M8P A;  4CEF A;  4K43 A;  3LP2 A;  2FXU A;  3RR7 A;  3PSI A;  2QWO A;  5C15 A;  1HR0 K;  1KLN A;  2OA8 A;  3SV3 A;  2BUP A;  2NRV A;  3SMS A;  5DM6 L;  4DTR A;  3K59 A;  3L2R A;  4OPK A;  2HHT A;  1HMV A;  4PL7 A;  2E2P A;  1TL1 A;  4B9V A;  5AQJ A;  2QW9 A;  4OPA A;  4BRK A;  1UA0 A;  3VQD A;  3LP3 A;  4DV5 K;  4GY2 B;  4ELV A;  4OKK A;  3O6W A;  2HHX A;  1DGK N;  3CHW A;  4IFY A;  3GOI A;  2MPH A;  3L3V A;  2JGU A;  3LDL A;  3DLH A;  3QDK A;  1TK5 A;  3HTV A;  4AHV A;  3VQ6 A;  4Z4I A;  1SKR A;  4J2A A;  2YNH A;  3M8Q A;  4FZZ A;  4BRE A;  5AQZ A;  2Q1N A;  3HST B;  1EO1 A;  3OY9 A;  3VEN A;  4DSF A;  2NZT A;  1T3V A;  5C24 A;  4X66 K;  1IO2 A;  1VK0 A;  3C6T A;  1JEQ A;  3J8A A;  4ISE A;  4O8U A;  3ZSW A;  2G8I A;  1K8K B;  3QNN A;  1TKX A;  3R3L A;  2QKK A;  4JKB A;  3M8S A;  3MEC A;  4WE1 A;  3VES A;  5BN9 A;  4CJ3 A;  4CBW A;  4Q5V A;  1KLM A;  3BY5 A;  1YIJ N;  2ZJP L;  4OLB A;  3P4I A;  1RT7 A;  3FZH A;  2QWP A;  5FPN A;  1CZB A;  3VN5 A;  4XEI A;  1B9F A;  3LM9 A;  1L3U A;  1EX4 A;  5GIP A;  2I7N A;  3Q7B A;  3WNF A;  2HF3 A;  4H0V B;  4C1N K;  4FLT A;  5HL7 L;  3L2V A;  3A2F A;  1N8R O;  1RGI A;  3DWL A;  4AHR A;  1VAZ A;  2CGL A;  1NK5 A;  2KVD A;  2UXD K;  2HOE A;  1Z25 A;  1NGA A;  3NF7 A;  4DSL A;  4AF1 A;  3DXK B;  1NK0 A;  4F9O A;  3THW B;  1VSL A;  1SL2 A;  4M3U A;  1NJI O;  4B9N A;  2P9I A;  4YHH K;  3F5T A;  1C0M A;  4A57 A;  4LF4 K;  4LC9 B;  1XUP O;  4FOE A;  4DV2 K;  3QKJ A;  4K42 A;  2HF4 A;  3OJS A;  3KLH A;  4AM7 A;  2GTD A;  5AQS A;  3PO4 A;  3VEX A;  1K9M O;  2P9N B;  1B9D A;  3I55 N;  1KSP A;  2ZGY A;  5FRO A;  1VSH A;  1WLJ A;  4FL9 A;  4KHQ A;  3IRX A;  3L0O A;  3SUQ A;  4BRP A;  1BQN A;  5AZI A;  2QXF A;  3HOS A;  2RPI A;  4CJL A;  3CC2 N;  4IOC L;  4DCH A;  4BIT A;  4DHY A;  1KAY A;  1NMN A;  3KJV A;  2FSN A;  1UA1 A;  3A5O C;  3O08 A;  1NGB A;  1S1W A;  4IO9 L;  2KFZ A;  3MWP A;  4MO4 A;  1VQ8 N;  4FWK A;  1QVG M;  1V4S A;  1S1V A;  4CZJ A;  1TVR A;  5BN8 A;  2RNO A;  4N41 A;  3MX2 A;  1ZC6 A;  3SQ1 A;  2A42 A;  1D9F A;  1TK0 A;  1HNI A;  3CJ9 A;  4CF9 A;  4NCB A;  2GUI A;  3EKS A;  3I8D A;  3OYM A;  3AO2 A;  5K14 A;  4BR9 A;  4CF8 A;  1NKE A;  1BU6 O;  4EIA A;  3K57 A;  3LWL A;  3B8A X;  1HJO A;  4F4K A;  3FLG A;  4Z4G A;  2HJQ A;  2KFV A;  4LSN A;  2HHU A;  1J54 A;  3ZEU A;  4CER A;  4JRP A;  4OO1 J;  3FR0 A;  4IDH A;  3T1H K;  3G6E N;  1EWR A;  1XQS C;  3QML A;  3MX5 A;  4NXN K;  4CHY A;  1U47 A;  3LAN A;  4C8L A;  1IKX A;  4CGD A;  1GOA A;  4CHP A;  3ZSX A;  3QIO A;  4JI2 K;  1RT3 A;  3K5O A;  4RW8 A;  3SUN A;  4CGH A;  1YJW N;  2G8V A;  1NK6 A;  2BE2 A;  1HYS A;  3PX6 A;  2HHQ A;  3DOK A;  2O8E A;  2FBT A;  3TSU A;  1KCF A;  2G80 A;  3GDQ A;  5DMR A;  1ASV A;  4LF5 K;  1KD1 O;  3IG1 A;  4E1N A;  2KLA A;  3P39 A;  3VA3 A;  3CYM A;  3BP8 A;  1UAX A;  4Y0W A;  3AVG A;  2DTU A;  5F2R A;  4WQ4 C;  3CI5 A;  5LMN K;  5H1S Q;  3AA2 A;  1BG3 A;  4IEE A;  4F2R A;  4BRD A;  4KHY A;  3T1Y K;  3K5N A;  1KVC A;  1A63 A;  3MN6 A;  4FWO A;  2VQE K;  3CCL N;  1NGJ A;  4KB1 A;  4CGJ A;  2D0P A;  3L2W A;  3K9K A;  1A5W A;  1JLQ A;  1S9G A;  3MEG A;  4FM2 A;  4BRO A;  1Y02 A;  3DM2 A;  2V51 B;  1GLE G;  5FLX O;  4V19 S;  4A62 A;  2RKI A;  2HB5 A;  3SAG A;  4DV7 K;  1Z05 A;  1V4T A;  2YI1 A;  3WNE A;  3ZX2 A;  1QHA A;  2DFH A;  3AVJ A;  3HPG A;  2HHS A;  2FBX A;  1NGE A;  3DLK A;  5AQI A;  4I2P A;  4JI5 K;  4JKG A;  2YNF A;  4B9Q A;  4EFH A;  3OYH A;  4NLB A;  3U3G A;  3TAN A;  3UE5 A;  3CM5 A;  2ITG A;  4O5F A;  4QS8 A;  3K0S A;  1G99 A;  4CD1 A;  3ZLJ A;  1W97 L;  3CCE N;  4BE2 A;  1WSH A;  4MFB A;  1C0F A;  4DR4 K;  3C95 A;  3RR8 A;  3CCQ N;  3KK7 A;  4DFP A;  1CZ9 A;  1SKW A;  4J2D A;  3DOL A;  2WUS A;  2ZM6 K;  1E3M A;  3QO9 A;  2P9I B;  3CJC A;  4CW7 B;  1TKD A;  3HRG A;  2OTJ N;  5AQL A;  2XY5 A;  4B8A B;  3VTH A;  4CZI A;  1LCU A;  5AQF A;  1NJW A;  2BGG A;  3K2P A;  3TTD A;  1ZBI A;  3PIO L;  5HBM A;  4JAX A;  1JEI A;  3VQ5 A;  4H8K A;  5HRR A;  4IEI A;  1QE1 A;  3ZT4 A;  4MO5 A;  1B92 A;  4H03 B;  4CGG A;  1K6Y A;  3AVF A;  3LDS A;  4DTS A;  3TAG A;  4LF9 K;  4E7J A;  1RBV A;  2P9U A;  1BCO A;  3E9O A;  4L8R B;  2IVO A;  5F1X A;  3TWH A;  2Q97 A;  2QM1 A;  1Y97 A;  4YDU A;  2Q2R A;  3QIC A;  2G8F A;  2QKB A;  2HVH A;  3RVC A;  3F2K A;  3THY A;  2E2Q A;  4PL8 A;  1N32 K;  1RBS A;  1RBT A;  5CY4 A;  4DQQ A;  4FSV A;  3LM2 A;  1HKC A;  3J7Z O;  4M7Y A;  5FRM A;  1EN7 A;  4E1M A;  1TK8 A;  1J5O A;  4UZW A;  1KQS M;  1E4F T;  4KPY A;  4GW6 A;  2ZF5 O;  4KTZ A;  4H0T B;  1N6Q A;  2W6K A;  1VHX A;  4G9Z A;  3EZW A;  1LV5 A;  4OPJ A;  2AP1 A;  4WCE L;  3V9W A;  3DXM B;  1WSG A;  1W9H A;  3C6H A;  4JEP A;  1JLF A;  2WTU A;  5LJW A;  4QOZ B;  1BOT O;  4I2Q A;  2QNC A;  3AVL A;  4YY3 K;  2QWM A;  4CZL A;  4BWJ A;  3LPU A;  5EXW A;  2E1Y A;  3NDK A;  1JJ2 M;  4PA1 A;  1TYQ A;  1FKO A;  4CZH A;  2AA4 A;  3I0S A;  3RRH A;  2ASO A;  2V52 B;  4BRH A;  1EP4 A;  3DJC A;  3O3F A;  5FDL A;  3KK3 A;  1BGX T;  3THV A;  1I39 A;  4ZHR A;  5AQX A;  1W0H A;  3C6U A;  3P5J A;  4CZK A;  4DR3 K;  4CHZ A;  1GLD G;  3U8X A;  5SWM A;  3ZT1 A;  4E0D A;  3D45 A;  3VER A;  5M1N A;  1N36 K;  4LH5 A;  2Q3S A;  4JI4 K;  3THX A;  1OH7 A;  1N33 K;  1GLC G;  4JI0 K;  1S1U A;  3HVT A;  2O8D A;  1S1T A;  4H5N A;  4CI6 A;  3QFP A;  3OVN A;  2DFF A;  4EAH D;  4ID1 A;  1U45 A;  1RT6 A;  3IDH A;  2XY6 A;  1NJX A;  1YTU A;  5AQN A;  3T19 A;  4CEC A;  4H5W A;  2GWK A;  4E89 A;  3P38 A;  1BIZ A;  3FZM A;  3OYF A;  4DSK A;  5M1P A;  1VQP N;  4YNQ A;  3DRR A;  3PSF A;  3I0R A;  2F9T A;  2NRZ A;  3M6G A;  4I6M B;  1RBU A;  2EX3 A;  1HQE A;  3THW A;  4KI4 A;  3AA3 A;  4J2E A;  4M42 A;  1YT3 A;  4I9L A;  3HXM A;  1N5Y A;  4HUE A;  1D9D A;  1UOC A;  3C6A A;  3CET A;  5JLH A;  4JKG B;  3VQA A;  4K8X A;  4DTN A;  1E7L A;  3VGK A;  3UIQ A;  2Z1J A;  1Q9X A;  3KKS A;  1Y64 A;  2IS3 A;  2WOM A;  4CEZ A;  1DT9 A;  4Z4E A;  1JLE A;  4OPH A;  2ODC I;  4JI8 K;  2WQG A;  4KH6 A;  4EHT A;  2P9N A;  3C65 A;  5BPM A;  4FJL A;  1EWQ A;  4B3M K;  1MU2 A;  3ID8 A;  2YKN A;  3CME N;  4EZ6 A;  2VGN A;  2PFU A;  1T03 A;  1T6D A;  3QBX A;  4IOX A;  3EEQ A;  4YOR A;  3H1Q A;  3CJ1 A;  3NGI A;  4B3S K;  3SLC A;  4FCY A;  1VQ7 N;  4DLG A;  4EZ9 A;  4E3S A;  1XC9 A;  4CBU A;  4Z4C A;  2V7Y A;  2XHB A;  2A8V A;  3QB0 A;  4FJ8 A;  3I8B A;  4FLV A;  3ZX3 A;  2QEX N;  1XC3 A;  4Z4F A;  4DQI A;  1J53 A;  3ATV A;  3AVA A;  4A5B A;  1Q18 A;  3ZSV A;  2YJE A;  3MXI A;  3G10 A;  3A5L C;  3MEE A;  2EWS A;  4Y1D A;  4B1Z A;  5JIC A;  3OYB A;  3O9T A;  1GOC A;  3FE1 A;  4LSL A;  3A5N C;  1QSL A;  3OYG A;  4CF1 A;  1C1C A;  3E9P A;  4M3W A;  1TL3 A;  5KTQ A;  3QEV A;  1JCE A;  4OLA A;  2P9U B;  3WXJ A;  4NCG A;  4LF7 K;  4OKJ A;  3D0P A;  4CEQ A;  1C1B A;  3MMV A;  1VSK A;  2UUA K;  3CFR A;  1YXQ A;  3H1V X;  2YHA A;  4B08 A;  1EKE A;  4BY9 C;  3SK3 A;  4B9L A;  1M1K O;  4FK0 A;  1QS4 A;  2F8S A;  2GEL A;  2E6L A;  4CJT A;  2OPP A;  1C6V A;  4YOW A;  3NF8 A;  3TAQ A;  2P5O A;  4XIU A;  4CVN E;  3L8B A;  2GX9 A;  4FLZ A;  4BDZ A;  3O8M A;  2UYT A;  3RRG A;  4JV5 K;  1WN7 A;  2HMI A;  2IVP A;  5CZ1 A;  1VQL N;  3VQ9 A;  1YTA A;  3SUO A;  3VQ8 A;  4DQ8 A;  2XO7 A;  3PY8 A;  2O8C A;  5C2F A;  4H0P A;  1TGO A;  3SYZ A;  1S6Q A;  3UKR B;  2ETJ A;  5GAG P;  5KGW A;  1OVQ A;  4CFC A;  1RTH A;  3KKR A;  3ZET A;  1SUQ A;  3QEP A;  2QWN A;  3PIP L;  4PY5 A;  3AVM A;  4BG9 A;  3O1B A;  4CK3 A;  4K0K K;  3QEW A;  4KKO A;  3L4I A;  3MCA B;  1ZBU A;  1TYQ B;  1ESV A;  4LH4 A;  3TAB A;  2O8F A;  2E88 A;  4JI1 K;  1U48 A;  1LW0 A;  3AGK A;  5J2N A;  3NVK A;  1JLG A;  3CIP A;  4ID5 A;  2A1R A;  3WNG A;  2ZJQ L;  4DR1 K;  4GVM A;  2A5X A;  3F9K A;  3OHR A;  4RTF D;  1WSI A;  2F8T A;  4AHC A;  4B3R K;  1ZBF A;  2QWL A;  4BE0 A;  4B1V A;  4J8F A;  3VGM A;  4JI3 K;  1KAX A;  3MAQ A;  4JN4 A;  4ILG B;  1FW6 A;  4YOY A;  3THX B;  3EL2 A;  3NF9 A;  4DF4 A;  1QSY A;  5EOY A;  3NF6 A;  4IWV A;  4IKF A;  2O8D B;  5TKW A;  1X9M A;  4AQY K;  1T6C A;  1Q7Y O;  1RDU A;  4M3R A;  1VSF A;  2KKZ A;  3S3N A;  4CF0 A;  4MLH A;  5TKY A;  4GMJ B;  4FLW A;  3CC4 N;  4IJN A;  1T8E A;  4ICL A;  1JKH A;  2NUB A;  3HT3 A;  3E01 A;  4FM1 A;  3EY1 A;  1HYZ A;  4FJN A;  4X65 K;  4JKC A;  4N76 A;  4H5V A;  3U9D A;  4TSX A;  1ZBS A;  3ZSO A;  1JL2 A;  1A5X A;  1IH7 A;  2E6M A;  1BIU A;  3KHY A;  3MXM A;  3DAW A;  3KD5 E;  3AO5 A;  3HO1 A;  3TSQ A;  3ENH A;  4NO7 A;  3SJJ A;  3O3G A;  2I5J A;  4K41 A;  5J1E A;  1OH5 A;  2ZGZ A;  3AA5 X;  4DQS A;  3AVI A;  3SPY A;  3V6D A;  3V81 A;  1E4G T;  2YHY A;  3C94 A;  5AQY A;  4AM6 A;  3CCS N;  4KHP K;  5KRS A;  2G8K A;  1RBR A;  4Z0U A;  2UUB K;  1S3X A;  1MDU B;  3IUC A;  3JYT A;  4FWR A;  3ZSY A;  4PKH A;  5BRD A;  4KAZ A;  5CYQ A;  1NG9 A;  1XI1 A;  1ATS A;  1NM1 A;  3O9U A;  4FJ5 A;  5LL6 Z;  4A61 A;  5E26 A;  3MDQ A;  3UB5 A;  5EY4 A;  2CGK A;  3K5L A;  1RNH A;  2VG5 A;  4MDA A;  3V9U A;  1K8A O;  2DY4 A;  3ULD A;  3O9R A;  3KD1 E;  4PKG A;  4CHO A;  3L0Q A;  3QEX A;  4IG0 A;  3NAE A;  1HNW K;  4JNE A;  2QWQ A;  2QNF A;  3NE6 A;  2W41 A;  3AAQ A;  5FPM A;  3CCJ N;  4HHT A;  2HBM A;  3QBW A;  2EHG A;  4BE1 A;  3D2F B;  2RE2 A;  1ASU A;  2P51 A;  4BR2 A;  5KRT A;  1VSD A;  3WXM B;  3RMD A;  2NNW A;  4Z94 A;  1ZYQ A;  4F3O A;  3VA0 A;  1FJG K;  3DXM A;  3LDP A;  1TV6 A;  3ZT3 A;  1A8V A;  3JS6 A;  2UU9 K;  5FRN A;  3HM8 A;  3MN9 A;  2KW4 A;  4A2B A;  3TU5 A;  4BRN A;  1MA9 B;  4YDU C;  3PX0 A;  2UXC K;  5I3U A;  2NRR A;  1X1P A;  3LPT A;  4H5T A;  1K73 O;  1ZBH A;  2HNZ A;  2XY7 A;  4BQL A;  3HP6 A;  3TAF A;  5M1O A;  3SAH A;  4JKH A;  4I7F A;  3A8Y A;  4BRF A;  5HLF A;  2D0C A;  2YHX A;  1VQ4 N;  2A1S A;  3T3F A;  3MWT A;  3K9J A;  3WXI A;  1NNE A;  2O8C B;  5AR0 A;  1IG8 A;  3V9Z A;  1GLL O;  1KC8 O;  3PLA A;  4GKK K;  2ASM A;  4M45 A;  2ZD1 A;  1VRT A;  2ASP A;  4WQ5 A;  2JWK A;  3FZF A;  5A2Q O;  2ZQB A;  3HBT A;  3ZET B;  4DU4 A;  3B6P A;  3CG7 A;  3W0L A;  3WQT A;  3V4I A;  2KVU A;  2Z1G A;  4DTO A;  4N56 A;  2PY5 A;  4CJW A;  3AVK A;  2FSJ A;  1V66 A;  2W6L A;  3SI6 A;  2Y1J A;  1RT4 A;  3S3O A;  4ISG A;  1O1W A;  3C7N B;  5BRH A;  4CJP A;  4B9M A;  5CZ2 A;  2RNN A;  2O8F B;  1DLO A;  3NH1 A;  3HSC A;  5B8H A;  4KRE A;  1JCF A;  1WNS A;  3L2U A;  1W7A A;  3VF6 A;  1BIS A;  3QLH A;  1OH8 A;  2ITM A;  5KPR A;  4KB0 A;  4BGA A;  3KLG A;  2Q36 A;  3EZ5 A;  3LZI A;  1VRU A;  2KVE A;  1X3N A;  1RTD A;  4AIL C;  2FC0 A;  4H4O A;  3ZSZ A;  4KHW A;  1YI2 N;  4I6M A;  4YOX A;  3VQQ A;  3O4N A;  4I9Q A;  1NLV A;  2VCP A;  4O0I A;  4KRF A;  1SV5 A;  3OBW A;  3EYZ A;  3H3O B;  3OS1 A;  4WF9 L;  3OYA A;  3OBY A;  5JVG L;  4B9S A;  4RW7 A;  4AHS A;  2NRT A;  4DU1 A;  1IBK K;  3WXK A;  1O13 A;  1N34 K;  4OX9 K;  1ATN A;  4CCH A;  1QQO A;  4BVO A;  1DTQ A;  2W42 A;  3CJA A;  1RIL A;  1NMD A;  3ZCM A;  1KTQ A;  3SUP A;  4HTU A;  1CLQ A;  1VSJ A;  3GL1 A;  3R9P A;  5AQO A;  5HRS A;  2HHH K;  4KHN A;  1VQK N;  4ZTJ A;  4IOA L;  1X9S A;  4NB4 A;  1NGF A;  1U2V B;  4IFV A;  3VF4 A;  3ZSQ A;  2GBZ A;  2QXL A;  1W2B M;  3OYE A;  4M3T A;  1S1X A;  3FGU A;  1BO5 O;  4IFE A;  3ENO A;  3U4L A;  4A2A A;  1H1J S;  2UUC K;  4DFK A;  3MN5 A;  3O1W A;  4DU3 A;  5DM7 L;  2P9P A;  4HUG A;  4CBX A;  2OPR A;  2FLO A;  3NVM A;  4XH1 A;  5GIN A;  4QCL A;  5MLC Q;  1SS6 A;  1IKW A;  2HBK A;  4Z4H A;  5KPT A;  2X74 A;  3HI0 A;  2B4J A;  4CZG A;  3DI6 A;  4R5P A;  4BRL A;  1BDG A;  3M8R A;  2OYQ A;  3ENB A;  4C23 A;  4HTL A;  2Z1H A;  5KQD A;  1XNR K;  3AVB A;  2F4V K;  4O5B A;  4BDP A;  1NGI A;  3VOV A;  1JXE A;  2PZS A;  3VEZ A;  1RDD A;  2G8W A;  3P1G A;  3NMU A;  1XHZ A;  1BA0 A;  3PV8 A;  1L3S A;  1SKS A;  3OW2 M;  1IBL K;  1Q86 O;  1HQU A;  3MXJ A;  4HCC A;  2IAJ A;  2ZWH A;  3AAR A;  3G25 A;  1ILY A;  2WC9 A;  3HJF A;  4ELU A;  1BHL A;  2X6S A;  4CEA A;  2FF6 A;  3VEY A;  3NCI A;  3JSM A;  1WOQ A;  1JLC A;  3UKR A;  4OJR A;  3EO3 A;  2HNY A;  1S5J A;  3CCV N;  3I56 N;  5AQW A;  3KLE A;  4DTU A;  4LFB K;  2W40 A;  3A5M C;  4MDB A;  3TSP A;  4LFA K;  3CQX A;  4WFA L;  3RMC A;  4M41 A;  3PO5 A;  2UXB K;  4B1U B;  1LAV A;  3V1R A;  3ID6 A;  4BR7 A;  2QTD A;  4XH5 A;  1SQK A;  5GAE P;  4FVM A;  2A41 A;  1VQM N;  1I94 K;  2OZS A;  3D6R A;  4QS9 A;  1GLJ O;  3N4P A;  4WQ4 A;  4K8Z A;  4CJ4 A;  4F8R A;  3FZK A;  3KLI A;  3VEW A;  2P9S A;  3VEO A;  3PX4 A;  4CZM A;  1XMO K;  2NRW A;  1HLU A;  3ZT0 A;  3UKU A;  2QI2 A;  3N4Q A;  3VQC A;  4DMN A;  4GVE A;  1DEJ A;  4CEE A;  5JVH L;  5HRN A;  5ELZ A;  3RMA A;  1HNV A;  1HKB A;  1EET A;  4OVL A;  3F9M A;  4RG8 A;  1ZXO A;  3ATU A;  4ILJ A;  1KVB A;  3DLG A;  4FJ9 A;  3CER A;  1X9W A;  3M3Z A;  3NH0 A;  4A5A A;  5J2P A;  1IG9 A;  3G0Z A;  4CGI A;  4FK2 A;  1GLB G;  4IZ9 A;  3LP0 A;  4B3T K;  4BC3 A;  1QQN A;  3I33 A;  4JD2 B;  3BF1 A;  4FZY A;  3NHG A;  3BGR A;  4BR4 A;  4M3Y A;  2P9L A;  1IKY A;  2OCE A;  4O4G A;  4X64 K;  1H9F A;  4PKI A;  4DR2 K;  4CFD A;  2BH1 A;  1RDC A;  2O8B B;  3LL3 A;  3U3Y A;  4CIG A;  1NOZ A;  1NGG A;  3RTV A;  3O4Q A;  3CXC M;  1HRH A;  3S9H A;  1NK7 A;  5AQP A;  3R1X A;  1G15 A;  4YFU A;  5M1K A;  2KZZ A;  4U7B A;  1CZA N;  3JXU A;  4DS5 A;  3KTQ A;  1TUY A;  4DR6 K;  1HNZ K;  3BEX A;  4DQR A;  4Q0B A;  1YAG A;  5KGX A;  2HMP A;  3IMX A;  1NBW A;  1S9E A;  3SQ0 A;  2E4L A;  3LDO A;  4BAC A;  1TAU A;  3S3M A;  1WAJ A;  4DQP A;  2R7Y A;  1E7D A;  3E1Y A;  4BRA A;  1WBD A;  2KHO A;  4CJR A;  3IAY A;  4HVJ A;  2E20 A;  4DV6 K;  2QK9 A;  4G1Q A;  1JLB A;  3OYN A;  4LF8 K;  3RMB A;  4MQ3 A;  4RWT A;  5IWA K;  4E7L A;  3TAP A;  1VSE A;  3CJB A;  3HOT A;  3Q7C A;  1KAZ A;  5C25 A;  1BL3 A;  4FJI A;  3CCM N;  2Q0U A;  4IDK A;  2PYL A;  4KTQ A;  2D1K A;  4CIE A;  4DV4 K;  1I3A A;  3KIO A;  2P9P B;  4EHU A;  1FK9 A;  3D2F A;  4BRC A;  1KHC A;  3H08 A;  1JXB A;  3MED A;  1S72 N;  3NGZ A;  2P9K B;  1RDB A;  4CJK A;  1RDW X;  4B3O A;  4KI6 A;  4DV1 K;  4H0Y B;  3KK1 A;  3QET A;  4CZF A;  4IJA A;  3LLR A;  4FXD A;  2A40 A;  3HL8 A;  2GWJ A;  3DLL L;  3CPE A;  2JLE A;  1OH6 A;  4ELT A;  5C12 A;  3KWG A;  1VQ5 N;  4KH5 A;  2IDO A;  1HYV A;  2D0B A;  1LWC A;  4KFB A;  4UQG A;  1WSF A;  1VSM A;  5IT9 O;  1UWB A;  1H1V A;  2IVN A;  3CCR N;  4FLX A;  3SQ2 A;  1KVA A;  1IJJ A;  4RCH A;  3TAM A;  4X62 K;  1CXQ A;  4FOI A;  4NYN A;  3O9Q A;  2KW9 A;  5BPL A;  2G8U A;  3HPO A;  2OZM A;  3ITH A;  4UY8 O;  1JCG A;  4QAG A;  1RTJ A;  4JK7 A;  1U49 A;  1MWK A;  3R8E A;  2V7Z A;  4JHD A;  4DUZ K;  3C7N A;  2VWJ A;  3AO1 A;  2YNG A;  1NU0 A;  3AO4 A;  3LAK A;  3LDQ A;  1L3T A;  2P5G A;  2XRI A;  1HUX A;  4EP5 A;  4U67 L;  2O4G A;  1C0G A;  2HST A;  4OGC A;  1HNX K;  5BR9 A;  1BUP A;  3TAE A;  5EX5 A;  3VQB A;  3KWI A;  1YVN A;  2VG7 A;  2P9S B;  4C8M A;  1M90 O;  5BRF A;  1IKV A;  4CZE A;  4J2B A;  1U4B A;  3UKU B;  5E41 A;  3ZYY X;  3SAF A;  1LW2 A;  4DUY K;  4WQ5 C;  5LY3 A;  3M1F A;  1GLA G;  4JI6 K;  4B9U A;  2YNI A;  1CXU A;  3QEI A;  2GV9 A;  2IC3 A;  3EE9 A;  4KO0 A;  5AZJ A;  1D8Y A;  4CIF A;  3ZT2 A;  4AH9 A;  4M63 C;  3SCX A;  4DF8 A;  4FJG A;  3CCU N;  1TKT A;  3SQ4 A;  4CGF A;  2KQ2 A;  4N5S A;  2RHK A;  3HPH A;  3ZSR A;  4WFB L;  4NCA A;  4O55 A;  4M7X A;  4WYB A;  2P1J A;  2E2O A; 
#chains in the Genus database with same CATH homology
 1HJR A;  4CF2 A;  3K5M A;  2Y1J A;  1RT4 A;  3S3O A;  1O1W A;  5EU7 A;  5I42 A;  3DLR A;  4CJP A;  5CZ2 A;  1LV5 A;  2RNN A;  4B9M A;  4OPJ A;  4DFM A;  1DLO A;  4Y1C A;  3NH1 A;  4KRE A;  1WNS A;  3DYA A;  3V9S A;  3V9W A;  2BAN A;  1WSG A;  3L2U A;  4DFJ A;  1NKB A;  1BI4 A;  1W9H A;  1KRP A;  1BIS A;  2YKM A;  1JLF A;  2AJQ A;  3QLH A;  4QOZ B;  1F21 A;  1C0T A;  4DLE A;  4IBN A;  4KB0 A;  4I2Q A;  3KLG A;  4C8O A;  3HYF A;  4LD0 A;  3EZ5 A;  1BQM A;  3HVR A;  3LZI A;  1NK8 A;  3NFA A;  2VWK A;  3AVL A;  4HUF A;  4W5T A;  4BWJ A;  1VRU A;  2KVE A;  3IS9 A;  1RTD A;  3LPU A;  2FC0 A;  4H4O A;  3ZSZ A;  4AIL C;  2JVW A;  3TR8 A;  4KHW A;  3BDP A;  4W5Q A;  3NDK A;  4PA1 A;  4DTM A;  4M3X A;  3VQQ A;  2X78 A;  1SL1 A;  3O4N A;  1FKO A;  2Z1I A;  4I9Q A;  4O0I A;  4CK1 A;  4AHU A;  3OYL A;  1SV5 A;  3I0S A;  3RRH A;  4ZTF A;  3EYZ A;  4KRF A;  1EP4 A;  3OS1 A;  3VQE A;  1QSS A;  3OYA A;  3O3F A;  5FDL A;  1NK4 A;  4PQU A;  3KK3 A;  3LWM A;  1BGX T;  4W5N A;  3THV A;  1I39 A;  4ZHR A;  3OJU A;  1W0H A;  3C6U A;  3P5J A;  4B9S A;  1QHT A;  5JS1 A;  4CHZ A;  4RW7 A;  5SWM A;  1LAW A;  3WNH A;  3ZT1 A;  4LY7 A;  4AHS A;  4E0D A;  2KFN A;  2F96 A;  4DTX A;  4DU1 A;  2RF2 A;  3D45 A;  4OKE A;  1DTT A;  2KTQ A;  3AVH A;  4LH5 A;  2Q3S A;  1WAF A;  5T7B A;  3QES A;  3LAL A;  5JS2 A;  4CCH A;  1DTQ A;  2W42 A;  1RIL A;  3VQ4 A;  1LWF A;  3ZCM A;  3SZ2 A;  1L5U A;  1EXQ A;  3LAM A;  4JS4 A;  1S1U A;  3HVT A;  3DLB A;  1KTQ A;  3SUP A;  5HRO A;  1S1T A;  3OS2 A;  4HTU A;  1CLQ A;  1VSJ A;  4DSI A;  4FJK A;  3OVN A;  2DFF A;  4B8C A;  5HRS A;  3M8P A;  4ID1 A;  1U45 A;  1RT6 A;  4CEF A;  4ZTJ A;  4KHN A;  2XY6 A;  1NJX A;  1X9S A;  4CE9 A;  3LP2 A;  1YTU A;  4AHT A;  3T19 A;  4IFV A;  4CEC A;  3RR7 A;  1RCH A;  3ZSQ A;  2GBZ A;  1KLN A;  1BI4 B;  2OA8 A;  4E89 A;  3SV3 A;  3OYJ A;  3OYE A;  4M3T A;  3ISN C;  1BIZ A;  2XY8 A;  1NK9 A;  1LWE A;  4DTR A;  3OYF A;  3K59 A;  4DSK A;  3L2R A;  1S1X A;  4OPK A;  2HHT A;  1HMV A;  4PWD A;  4YNQ A;  3DRR A;  1TL1 A;  4B9V A;  1H1J S;  3I0R A;  4DFK A;  1UA0 A;  3VQD A;  4DU3 A;  3LP3 A;  1RBU A;  3QIN A;  2EX3 A;  4F3T A;  4HUG A;  1HQE A;  4ELV A;  3DRS A;  4OKK A;  4KI4 A;  2OPR A;  3AA3 A;  4DTJ A;  4J2E A;  2HHX A;  4IFY A;  4M42 A;  3HM9 A;  5D3G A;  3L3V A;  3ALY A;  1YT3 A;  2JGU A;  4I9L A;  3HXM A;  1N5Y A;  3DLH A;  4Z4H A;  1IKW A;  4HUE A;  1D9D A;  4QCL A;  1UOC A;  2Y1I A;  3CFP A;  1J9A A;  5KI6 A;  2X74 A;  4CHQ A;  1TK5 A;  4DWI A;  2B4J A;  3VQA A;  4K8X A;  4AHV A;  3DI6 A;  3VQ6 A;  4R5P A;  3NGY A;  3M8R A;  4DTN A;  2OYQ A;  4C8N A;  3UIQ A;  4Z4I A;  1SKR A;  2Z1J A;  1Q9X A;  1RDA A;  3KKS A;  2YNH A;  4J2A A;  2IS3 A;  2WOM A;  4CEZ A;  2B6A A;  2Z1H A;  3M8Q A;  4FZZ A;  4Z4E A;  1JLE A;  3CQ8 A;  4CJQ A;  3HST B;  3CM6 A;  3OY9 A;  3AVB A;  4BWM A;  4O5B A;  2WQG A;  4DSF A;  4BDP A;  1JXE A;  4DSE A;  5C24 A;  2FBV A;  2PZS A;  1RDD A;  3OYD A;  4E7I A;  1IO2 A;  1VK0 A;  2WON A;  3C6T A;  4RW4 A;  1JEQ A;  4FJL A;  2G8I A;  3ZSW A;  1MU2 A;  3QNN A;  2YKN A;  2G8W A;  1TKX A;  3P1G A;  4EZ6 A;  2HHQ A;  1T03 A;  2QKK A;  1XHZ A;  3U6F A;  2IGI A;  3M8S A;  3PV8 A;  1L3S A;  3MEC A;  4WE1 A;  4CJ3 A;  4Q5V A;  4FLU A;  1SKS A;  1KLM A;  1HQU A;  3NGI A;  3HK2 A;  2BDP A;  4OLB A;  3MXJ A;  4HCC A;  1RT7 A;  2IAJ A;  4FCY A;  3O3H A;  4DLG A;  4EZ9 A;  4E3S A;  1XC9 A;  4Z4C A;  2XHB A;  1GOB A;  1CZB A;  4FJ8 A;  4FLV A;  3AO3 A;  3VN5 A;  3HJF A;  4ELU A;  1T05 A;  1B9F A;  1BHL A;  2X6S A;  4CEA A;  4Z4F A;  3NCI A;  1L3U A;  4DQI A;  1J53 A;  1EX4 A;  2RN2 A;  3AVA A;  4F2S A;  3WNF A;  4FLT A;  3JSM A;  3ZSV A;  3MXI A;  1JLC A;  4DS4 A;  3G10 A;  3L2V A;  3MEE A;  4OJR A;  2OPQ A;  3A2F A;  1C0U A;  1S5J A;  2HNY A;  4Y1D A;  4AHR A;  2O4I A;  3OYB A;  1NK5 A;  2KVD A;  3L2Q A;  1Z25 A;  1GOC A;  3NF7 A;  3KLE A;  4DTU A;  4FW1 A;  4DSL A;  1NK0 A;  3RMC A;  1VSL A;  3VQP A;  4LSL A;  1QSL A;  1SL2 A;  4M41 A;  3OYG A;  3PO5 A;  4CF1 A;  1C1C A;  4M3U A;  1LAV A;  3V1R A;  1QTM A;  4M3W A;  1TL3 A;  5KTQ A;  4CJE A;  3QEV A;  4B9N A;  2HHW A;  1SL0 A;  4OLA A;  4FVM A;  2OZS A;  1C0M A;  1L3V A;  4NCG A;  3TAR A;  3OYC A;  4FZX C;  4RW9 A;  4OKJ A;  3D0P A;  4CEQ A;  1C1B A;  5HRP A;  3SNN A;  1VSK A;  1NKC A;  3T1A A;  3CFR A;  2YHA A;  4B08 A;  3OJS A;  3KLH A;  1EKE A;  4K8Z A;  4B9L A;  4FK0 A;  4CJ4 A;  4F8R A;  1QS4 A;  2F8S A;  3KLI A;  2D0A A;  3PO4 A;  1FKP A;  2E6L A;  4CJT A;  1VSI A;  2LSN A;  1B9D A;  1C6V A;  2OPP A;  4KTW A;  1TKZ A;  4W5R A;  1KSP A;  3PUF A;  3NF8 A;  5FRO A;  3NBP A;  1VSH A;  3PX4 A;  1WLJ A;  3TAQ A;  2P5O A;  4KHQ A;  3IRX A;  3SUQ A;  4RW6 A;  4XIU A;  2HW3 A;  1BQN A;  3ZT0 A;  3VQC A;  2QXF A;  4PUO A;  2RPI A;  4CJL A;  4DMN A;  3L8B A;  4FJH A;  4FLZ A;  4BDZ A;  4BIT A;  3SPZ A;  4CEE A;  5HRN A;  3RRG A;  1WN7 A;  3KJV A;  1T7P A;  2HND A;  2HMI A;  1UA1 A;  5DK5 A;  1HNV A;  3RMA A;  5CZ1 A;  3VQ9 A;  1YTA A;  3OYI A;  2KZM A;  3SUO A;  3VQ8 A;  3V9X A;  1S1W A;  2XO7 A;  2KFZ A;  5C42 A;  1C1A A;  1HPZ A;  3FFI A;  3PY8 A;  1EET A;  2ZE2 A;  4OVL A;  3RWU A;  4RG8 A;  4CJU A;  4CEO A;  4CFB A;  1TGO A;  4CHN A;  1KVB A;  3DLG A;  1JJR A;  1S6Q A;  3SYZ A;  4FJ9 A;  1X9W A;  2ETJ A;  1S1V A;  1TVR A;  5KGW A;  3NH0 A;  3K58 A;  4CFC A;  1IG9 A;  1RTH A;  3KKR A;  3G0Z A;  2RNO A;  4NYF A;  4CGI A;  5J2P A;  1SUQ A;  4N41 A;  4FK2 A;  3QEP A;  4FJX A;  4PY5 A;  2G8H A;  4FJ7 A;  3AVM A;  3LP0 A;  4CK3 A;  3SQ1 A;  4CED A;  4FW2 A;  1D9F A;  1TK0 A;  3QEW A;  1HNI A;  1Z26 A;  4KKO A;  4CF9 A;  3LZJ A;  4FZY A;  1ZBU A;  3NHG A;  4NCB A;  2GUI A;  3BGR A;  4LH4 A;  3I8D A;  4M3Y A;  3OYM A;  3TAB A;  1IKY A;  3AO2 A;  4O4G A;  5K14 A;  3AVC A;  2YV0 X;  4KHU A;  1U48 A;  1LW0 A;  4CJS A;  4CF8 A;  5J2N A;  1NKE A;  1JLG A;  4ID5 A;  2A1R A;  4CFD A;  3WNG A;  3NH2 A;  3LWL A;  3K57 A;  1RDC A;  4GVM A;  4F4K A;  3U3Y A;  4CIG A;  4Z4G A;  4CJF A;  1NOZ A;  3F9K A;  3SV4 A;  3RTV A;  1WSI A;  3AV9 A;  2F8T A;  4AHC A;  3O4Q A;  3S9H A;  1HRH A;  1ZBF A;  4LSN A;  1NK7 A;  2HHU A;  1J54 A;  1G15 A;  1Q9Y A;  4BE0 A;  4YFU A;  1RT5 A;  2KZZ A;  4CER A;  4JRP A;  5HP1 A;  3MAQ A;  4DS5 A;  1KFD A;  3KTQ A;  4HCB A;  1FXX A;  4Q0B A;  4DQR A;  4CHY A;  2OPS A;  3LAN A;  3NF9 A;  4DF4 A;  5KGX A;  1U47 A;  4C8L A;  1IKX A;  1QSY A;  3NF6 A;  4CJ5 A;  4IKF A;  1S9E A;  4CGD A;  1GOA A;  3SQ0 A;  2E4L A;  4CHP A;  3ZSX A;  1TAU A;  4BAC A;  3S3M A;  4O44 A;  1X9M A;  1WAJ A;  4DQP A;  3QIO A;  4FYD A;  3V1O A;  2R7Y A;  1RT3 A;  3K5O A;  4M3R A;  1VSF A;  3S3N A;  4RW8 A;  4CJR A;  4CF0 A;  3IAY A;  3SUN A;  4CGH A;  4HVJ A;  4GMJ B;  1QQC A;  4FLW A;  2G8V A;  2VG6 A;  1T8E A;  4ICL A;  1NK6 A;  2QK9 A;  2BE2 A;  1JKH A;  3B6O A;  4G1Q A;  1JLB A;  2NUB A;  3OYN A;  3HT3 A;  3E01 A;  4FM1 A;  3PX6 A;  3DOK A;  4MQ3 A;  3EY1 A;  4E7H A;  3RMB A;  1HYZ A;  2FBT A;  4E7L A;  1KCF A;  3TAP A;  1VSE A;  4FJN A;  4N76 A;  5DMR A;  5C25 A;  1BL3 A;  4FJI A;  4TSX A;  1ITG A;  1ASV A;  3TI0 A;  4IDK A;  3ZSO A;  2PYL A;  1JL2 A;  1A5X A;  3AVN A;  4KTQ A;  3IG1 A;  4E7K A;  1NJZ A;  4CIE A;  4E1N A;  4JRQ A;  3VA3 A;  3CYM A;  1I3A A;  1UAX A;  3AVG A;  2DTU A;  3KIO A;  1KFS A;  1FK9 A;  1IH7 A;  2E6M A;  1BIU A;  3H08 A;  3AA2 A;  3MXM A;  1JXB A;  4F2R A;  3MED A;  1NJY A;  3KD5 E;  4KHY A;  3AO5 A;  3CFO A;  3K5N A;  1KVC A;  3HO1 A;  3NGZ A;  4O0J A;  2HVI A;  1RDB A;  4DG1 A;  4CJK A;  3SJJ A;  4CGJ A;  3O3G A;  4KB1 A;  4B3O A;  2I5J A;  5J1E A;  3KK1 A;  4KI6 A;  2IOC A;  3L2W A;  3QET A;  3AA5 X;  1A5W A;  1JLQ A;  4DQS A;  4FXD A;  1S9G A;  1XHX A;  3AVI A;  3HL8 A;  3MEG A;  4FM2 A;  3V6D A;  3V81 A;  3SPY A;  3LP1 A;  3DM2 A;  2JLE A;  3C94 A;  5KRS A;  4EP4 A;  2G8K A;  4ELT A;  1RBR A;  3L3U A;  2RKI A;  2HB5 A;  4Z0U A;  4E19 A;  2FBY A;  4CJV A;  3JYT A;  2IDO A;  1HYV A;  2D0B A;  1LWC A;  3ZSY A;  3WNE A;  4FLY A;  4KFB A;  2DFH A;  3AVJ A;  3HPG A;  1WSF A;  4UQG A;  4KAZ A;  4KV8 A;  5CYQ A;  4IG3 A;  2HHS A;  2FBX A;  1VSM A;  1XI1 A;  1UWB A;  3DLK A;  1RT1 A;  4I2P A;  5J2Q A;  4OGE A;  3QNO A;  2YNF A;  4FLX A;  4FJ5 A;  3SQ2 A;  4JLH A;  1HYS A;  3OYH A;  1TAQ A;  1KVA A;  1A5V A;  1RNH A;  3U3G A;  2VG5 A;  3TAM A;  3P83 D;  3K5L A;  3V9U A;  3ULD A;  3TAN A;  3KD1 E;  4M3Z A;  2DY4 A;  3CM5 A;  4CHO A;  1CXQ A;  2ITG A;  3KLF A;  4NYN A;  4KHS A;  3VQ7 A;  2KW9 A;  2G8U A;  3HPO A;  2OZM A;  4BE2 A;  3QEX A;  1WSH A;  1YVU A;  2YHB A;  3ITH A;  4MFB A;  3QER A;  4IG0 A;  3QIP A;  3NAE A;  3C95 A;  3KK2 A;  3RR8 A;  1RTI A;  4QAG A;  1REV A;  4CK2 A;  1RTJ A;  2DFE A;  4DFP A;  3NE6 A;  1U49 A;  1RT2 A;  1CZ9 A;  4HHT A;  5SZT A;  4FJM A;  2EHG A;  2PYJ A;  1SKW A;  4BE1 A;  3HP9 A;  4FM0 A;  3DOL A;  4CFA A;  1ASU A;  2P51 A;  5KRT A;  4J2D A;  2HHV A;  1VSD A;  3QO9 A;  4FJJ A;  4N47 A;  5J2M A;  2VWJ A;  3RMD A;  4C8K A;  4F3O A;  1ZYQ A;  3AO1 A;  2YNG A;  3AO4 A;  1L3T A;  3LAK A;  1ZBL A;  3VA0 A;  2P5G A;  2XRI A;  1TKD A;  4DSJ A;  4EP5 A;  1TV6 A;  2ATQ A;  2O4G A;  4B8A B;  2XY5 A;  3ZT3 A;  2BGG A;  1NJW A;  1U04 A;  3K2P A;  4CES A;  5FRN A;  1ZBI A;  4OGC A;  4B9T A;  4JS5 A;  5HBM A;  2KW4 A;  3TAE A;  3VQ5 A;  4H8K A;  3DRP A;  3PX0 A;  5I3U A;  3VQB A;  5HRR A;  1X1P A;  3ZT4 A;  1QE1 A;  3LPT A;  4BDY A;  2VG7 A;  4C8M A;  3F73 A;  1B92 A;  4CGG A;  2B5J A;  1ZBH A;  1K6Y A;  3AVF A;  1Q8I A;  2HNZ A;  1IKV A;  3LDS A;  4DTS A;  3TAG A;  2XY7 A;  3V1Q A;  3HP6 A;  1U4B A;  4E7J A;  1RBV A;  5E41 A;  3TAF A;  4J2B A;  1BCO A;  1LW2 A;  2D5R A;  4L8R B;  4I7F A;  1S6P A;  1WSJ A;  3TWH A;  1XWL A;  5HLF A;  1Y97 A;  4H4M A;  2D0C A;  4B9U A;  2YNI A;  2G8F A;  2QKB A;  1CXU A;  2A1S A;  2HVH A;  1D5A A;  3T3F A;  2X6N A;  3QEI A;  2GV9 A;  2IC3 A;  3DMJ A;  4KO0 A;  4DTP A;  1D8Y A;  1JLA A;  3OS0 A;  4CIF A;  1WSE A;  4CEB A;  3ZT2 A;  4FK4 A;  3V9Z A;  1JL1 A;  4AH9 A;  1RBS A;  3SCX A;  4DF8 A;  5CYM A;  1RBT A;  4M45 A;  4FJG A;  2ZD1 A;  1TKT A;  5CY4 A;  1BCM A;  1VRT A;  4DQQ A;  4CGF A;  3SQ4 A;  2KQ2 A;  3AA4 A;  4N5S A;  2ZQB A;  3HPH A;  4DU4 A;  4E1M A;  3ZSR A;  5FRM A;  1TK8 A;  3B6P A;  3CG7 A;  3V4I A;  4O55 A;  1J5O A;  4NCA A;  4UZW A;  2KVU A;  2Z1G A;  3DLE A;  4N56 A;  1ASW A;  3OYK A;  4CJW A;  4DTO A;  2PY5 A;  3ASM A;  2P1J A;  4GW6 A;  4W5O A;  1NOY A;  3AVK A;  4KTZ A;  4KPY A;  1V66 A;  1R0A A;  1N6Q A;  3SI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...