1ZBHA

3'-end specific recognition of histone mrna stem-loop by 3'-exonuclease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
DFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPNCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*GP*GP*CP*UP*CP*UP*UP*UP*UP*CP*AP*GP*AP*GP*CP*CP*
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 87
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.30 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 SAP domain 1zbhA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbhA02
4Z0UA 1JKHA 4OVLA 1NK9A 3DRRA 1T7PA 4FLUA 5D3GA 1KVCA 4CJKA 1JL2A 1MU2A 2RKIA 4BWMA 1QHTA 3L3UA 3KLHA 3ITHA 4DS4A 3V4IA 1KLMA 1CZ9A 5KGXA 1Y97A 3ZSXA 4DTOA 1Q9YA 2KZZA 4CJTA 2GUIA 4N56A 1BI4A 1S6PA 2IGIA 3JYTA 4CJ5A 4BDYA 4DFKA 3SQ2A 1UAXA 4CGJA 4F2RA 1I39A 2QXFA 3QEXA 3RR8A 4JLHA 5FRNA 3HJFA 2AJQA 3WNHA 4Y1DA 1Q8IA 1KTQA 2HHUA 3QERA 4CIGA 5CYQA 4O0JA 1X9WA 1CXQA 3VQPA 1HNIA 4OKEA 3DLEA 1RTIA 1WSIA 3NGYA 1RDCA 3ZSRA 4CGFA 2FBYA 1UA1A 4YFUA 3LANA 1CLQA 1TV6A 1RBVA 4Y1CA 3PY8A 3T1AA 4F3TA 5HRSA 3M8PA 3SI6A 1WNSA 3EYZA 3THVA 3PO5A 1J5OA 4NCBA 4Z4FA 1SKWA 4FLWA 1GOBA 2QK9A 3IAYA 1RT3A 3S9HA 4RW9A 4FW2A 1YT3A 1BQNA 4CJVA 4KHUA 2KVEA 4B8AB 3L2VA 4C8KA 3AA3A 1NJWA 3FFIA 1W0HA 3F9KA 4FXDA 4FZXC 1WN7A 5FDLA 5HRNA 4RG8A 4E89A 5J2MA 4IDKA 3NCIA 1TK8A 3D0PA 4RW8A 2HW3A 4NCAA 3VA0A 1RT4A 1RT7A 4DU3A 3K5LA 5HROA 2JVWA 4F8RA 2FBXA 1HYVA 1TKXA 3ZSYA 4DS5A 3V1RA 5EU7A 3TAGA 5E41A 1N6QA 3BGRA 3HP6A 4DMNA 1NK5A 5CY4A 1TKZA 1O1WA 4BITA 1BI4B 1VK0A 1WSHA 4E7HA 4N41A 4KREA 4ICLA 4DTUA 1NOYA 4RW4A 4B9MA 4RW6A 2F96A 3VQ8A 3AA5X 4FJMA 2YHBA 4QAGA 2WOMA 3ZT1A 2YNFA 1JLFA 4R5PA 4NYNA 3MECA 5HRPA 1F21A 4KHSA 3LZJA 1WSJA 3ZSQA 3VQCA 5T7BA 3SUNA 3SPYA 4M3TA 1T05A 4B9TA 4M3UA 2HHQA 4BWJA 3WNEA 3AA2A 4FJ8A 3B6OA 3MAQA 2DFFA 5I3UA 3PO4A 1Z26A 3V9UA 4DSIA 3AVJA 4IG0A 4CJWA 3DOLA 1RBSA 2DFHA 2G8VA 4F2SA 3DRSA 5KRTA 1WAFA 3TR8A 1NK0A 3OYHA 1HRHA 1YVUA 2PZSA 1ZBFA 3L3VA 4CERA 1K6YA 4I7FA 5DK5A 2BE2A 3TAFA 3PX6A 2VG7A 4NCGA 3D45A 3KLIA 3F73A 3QNOA 2PYLA 3DLBA 4CEAA 3NGZA 4QCLA 1NJXA 3MEEA 1LW2A 3SPZA 1BL3A 4FLVA 4DFMA 1SL1A 2KZMA 4LSNA 1BIZA 3S3OA 2QKBA 1ASUA 3HM9A 3O3HA 3NH0A 4CECA 3OS2A 4AHSA 3L2WA 1TAUA 1NJYA 1X9MA 2FBVA 3K59A 4DQSA 1LAVA 4PY5A 1RDAA 4DQPA 4CHOA 1NKEA 1C6VA 3O3FA 2ETJA 4DG1A 3KD5E 4OGCA 3KD1E 3HXMA 3RRGA 3QIOA 2EHGA 1ZBLA 2E4LA 4AH9A 4CGDA 1X1PA 2QKKA 2EX3A 4DLEA 3IG1A 4I9LA 4KRFA 3I8DA 3VQ4A 2IDOA 4HUEA 4E19A 2Y1IA 3SQ0A 4ZTJA 1G15A 1NKBA 2HHXA 4DSEA 2HVIA 4K8ZA 4FJ5A 3UIQA 2D0CA 3RMCA 3NF7A 4C8OA 4F3OA 3RMBA 1JLBA 2WQGA 1Z25A 3OJSA 2B6AA 3OYGA 4DTXA 1ZBIA 1S1XA 3HYFA 1REVA 3MEGA 4M3WA 1U04A 3T19A 4DTPA 1LW0A 3AO1A 3LP2A 5JS2A 3AO2A 4WE1A 4FLYA 1S9EA 4FM1A 4OKJA 3V1OA 1CZBA 4CF1A 2F8SA 2G8KA 1L3VA 4I2PA 4E7KA 2ZE2A 3AVBA 4OJRA 4AHRA 2PY5A 2E6MA 2G8UA 1B92A 2XY8A 2BDPA 4IG3A 2HNZA 3SCXA 1JLEA 2IS3A 3MXIA 1U47A 4W5NA 3IS9A 1TVRA 1H1JS 3HL8A 1S1WA 4PQUA 5KGWA 2KVUA 4CJ4A 1NKCA 2KFZA 1KFDA 4B9SA 1DTQA 4CFDA 4XIUA 4M42A 4PWDA 4FM2A 2OPPA 4W5OA 3TWHA 3AO4A 4H4MA 4CJPA 3O3GA 3KLEA 4HTUA 3SQ1A 1WSGA 2KQ2A 4DTJA 3V81A 1TK5A 3KLFA 3TI0A 2ITGA 1JJRA 3PX0A 4BE1A 1JXEA 4M3RA 1JEQA 1L5UA 4KTZA 2DFEA 1RBTA 3DLKA 2D0BA 3PV8A 1LWCA 4L8RB 1RT5A 2I5JA 3U3YA 4ELUA 2KTQA 2RF2A 1QQCA 4CJ3A 3KLGA 3DLGA 4LSLA 3KK1A 3TARA 4EP4A 5KI6A 2B5JA 2HNDA 3PX4A 2HHWA 2YKMA 1KCFA 2B4JA 1J54A 3V9SA 2Z1JA 3QETA 2FBTA 4FJ7A 3QEWA 4CEZA 2G8WA 3NF8A 4FVMA 3ZSVA 1DLOA 5HP1A 4F4KA 4B9VA 1JLQA 3QINA 3HP9A 4FJXA 1KVBA 2P1JA 3L2RA 1C0TA 4KV8A 1T03A 2VWKA 4FK4A 3C94A 3OYKA 2YV0X 4LH4A 4QOZB 3K5NA 1U48A 1LAWA 2BGGA 1RBRA 1U45A 3U6FA 1XI1A 3K5OA 1JLGA 3AVIA 4EZ9A 3HT3A 1XWLA 3P83D 4YNQA 1WSFA 2IOCA 3H08A 3P1GA 4CF2A 5HBMA 5SZTA 3QESA 2KFNA 3VQ7A 4GMJB 3V6DA 2HVHA 1XC9A 1RT6A 1EXQA 2D0AA 4ZHRA 3QEVA 2OYQA 4CJSA 1ITGA 3OYJA 4E1NA 3NGIA 4EZ6A 3V9XA 1RCHA 1JL1A 2Z1IA 4HCCA 1HMVA 1RDBA 1A5WA 4H4OA 1WAJA 3EZ5A 1XHXA 2A1SA 4AHTA 1KSPA 1VSEA 3OYEA 3ASMA 3LWMA 5CZ2A 3LZIA 1TL3A 4CGIA 4Z4HA 3VQ5A 1S1VA 4RW7A 1T8EA 4CF0A 2Y1JA 5DMRA 5HLFA 1TL1A 4FZYA 4AILC 3DYAA 3QLHA 3OJUA 4E7JA 2OPQA 4KI6A 1HQUA 4ELTA 3O4QA 4Q5VA 4CFAA 2A1RA 4CF9A 1C1AA 1UA0A 4N76A 4IFYA 1RTDA 2WONA 1TAQA 4BACA 3RRHA 3KKSA 2O4IA 4DQIA 4DQQA 3E01A 3NE6A 4DF8A 3AVCA 3SV4A 1S9GA 4M3YA 4C8NA 4Z4CA 3S3NA 1WSEA 3AVFA 4DFPA 3LAMA 3TAEA 1VSJA 3ZT4A 3WNFA 1L3TA 4OLBA 4AHCA 4CFBA 3NH1A 1IO2A 2VG5A 1GOAA 3HO1A 1WLJA 3I0RA 3MEDA 4MFBA 2LSNA 3WNGA 3V9ZA 3OYIA 3SZ2A 1LV5A 4ELVA 4IFVA 5SWMA 3I0SA 4OGEA 3KJVA 3LAKA 3KTQA 1VSLA 3OYNA 3MXMA 1RILA 4FJLA 3OYAA 4J2EA 3AV9A 1YTUA 1ASVA 3ULDA 3V9WA 5C24A 5C42A 4CHZA 3M8SA 3TAMA 2X78A 2HHTA 2P51A 1BQMA 1BCMA 4CIFA 3OY9A 2E6LA 3CM5A 4C8MA 2HMIA 4C8LA 3C6UA 4LH5A 3AVAA 1KRPA 2RNOA 3CM6A 3DMJA 5FROA 4CK3A 2O4GA 1ZYQA 2OZSA 2DTUA 1FKPA 3VQEA 3ZSZA 2ZQBA 4FW1A 4FJ9A 4E7LA 4EP5A 1VRUA 4CEFA 4KPYA 2W42A 2YKNA 1RT1A 4FJNA 1J53A 3G0ZA 5CZ1A 3VA3A 1SL0A 1L3UA 4O4GA 4FK0A 4FK2A 2FC0A 1KVAA 4CHYA 3OYFA 3K5MA 1NJZA 4CGHA 4BE0A 2IAJA 4AHVA 4G1QA 2XHBA 3HPHA 3LALA 1TK0A 1IKXA 4B8CA 3LPUA 1YTAA 3A2FA 1HJRA 3ZT2A 3NH2A 4JS4A 4CK1A 4DWIA 3ISNC 4FYDA 3NAEA 4AHUA 1S5JA 3VQQA 3TABA 3RTVA 4E1MA 4OKKA 1SKRA 4IKFA 3JSMA 1ZBUA 3VQ6A 3LP0A 4I9QA 1D9FA 3NBPA 3L8BA 1LWFA 1VSDA 2X6NA 1RBUA 4DLGA 4ID1A 2YNGA 4W5RA 4O44A 4GW6A 5KRSA 4CEBA 1IKWA 3S3MA 4CEDA 1BGXT 4HCBA 1ASWA 4MQ3A 3ZT0A 3SUOA 4ZTFA 3QIPA 3LPTA 1HQEA 2OPRA 4LD0A 4KI4A 2YHAA 1ZBHA 1HNVA 3VQBA 1W9HA 3KKRA 3HPGA 4ID5A 3VQ9A 4KHYA 3OYCA 1A5XA 3ZCMA 4Z4IA 3K2PA 4DU4A 1QSLA 4FJJA 1S1TA 3VN5A 4DTSA 3TAPA 3NFAA 4FCYA 1IH7A 1BIUA 1C0UA 3U3GA 4CHPA 1QS4A 4B9UA 1IG9A 2YNHA 1I3AA 1NOZA 2GBZA 4CJRA 3SV3A 4E3SA 3DOKA 1KLNA 2KVDA 1VSMA 4KB0A 4B3OA 1SV5A 3IRXA 3KIOA 2RPIA 4CJEA 1SUQA 4DSJA 4FZZA 1UOCA 5J2NA 3RR7A 1R0AA 4OPKA 4M41A 3CFPA 4OLAA 4HVJA 3OYDA 4H8KA 4HHTA 3HK2A 3RMDA 3C95A 2X6SA 1TGOA 4DTRA 1XHZA 4BE2A 4M3XA 4KFBA 2RN2A 3ZSWA 3LP3A 4CJUA 1VSHA 3VQDA 2HHSA 2HHVA 4KKOA 4J2BA 4M45A 4FLTA 4DFJA 4KAZA 4TSXA 3SUQA 4PUOA 4CEQA 3OYMA 3CFRA 3BDPA 2NUBA 2JLEA 3CYMA 1J9AA 2OZMA 1D8YA 4KTQA 2VWJA 2KW4A 3NF6A 4CFCA 3SNNA 3OVNA 4IBNA 1SL2A 4DTMA 1EETA 4CEEA 3AA4A 4LY7A 5J1EA 4BDZA 1QTMA 1HPZA 1JLAA 4UQGA 1KFSA 3DI6A 3B6PA 5K14A 3OS0A 3OS1A 3ALYA 1SKSA 3SQ4A 1RTJA 1RTHA 1D9DA 4B9NA 4KB1A 4Z4EA 1A5VA 1U49A 1BISA 4E7IA 3TANA 4CJFA 4Z4GA 1EKEA 1S6QA 2JGUA 5I42A 4KTWA 1C0MA 3LDSA 2P5OA 3TAQA 1D5AA 4KHNA 3OYBA 2XY6A 4FJIA 2OPSA 1BHLA 3DRPA 4DSFA 4J2AA 3DLHA 2F8TA 2GV9A 2VG6A 3K58A 2G8FA 2P5GA 4JS5A 2HB5A 3LWLA 2XO7A 4W5QA 1NK4A 1IKYA 3QO9A 3LP1A 3AVGA 4FJGA 1FK9A 2Q3SA 2ZD1A 1VSIA 4I2QA 3RMAA 4CHQA 4HUFA 3HVTA 3M8RA 4BDPA 3CFOA 3VQAA 3EY1A 2PYJA 5FRMA 5J2PA 3DLRA 1CXUA 3M8QA 1QSSA 1B9FA 3KK3A 4FLZA 1IKVA 3MXJA 4HUGA 5J2QA 4DSLA 4B9LA 1VSFA 2RNNA 1UWBA 4CESA 2IC3A 4CHNA 3ZT3A 4JRQA 1HYZA 4KHQA 3AO5A 4CE9A 2DY4A 4FJKA 1C1CA 2X74A 4O5BA 3G10A 3K57A 3CQ8A 4CJLA 2XY7A 1L3SA 4K8XA 4CIEA 3QNNA 1N5YA 3RWUA 5JS1A 3SUPA 1HYSA 4DF4A 4FM0A 4JRPA 4PA1A 3HPOA 4J2DA 1C1BA 4KHWA 3AVHA 4CEOA 1S1UA 1NK7A 4O0IA 1TKTA 4GVMA 4N5SA 4CJQA 3AVNA 3ZSOA 4B08A 3AO3A 1FKOA 4CF8A 2XY5A 2Z1HA 4N47A 1BCOA 4KO0A 5HRRA 3V1QA 3T3FA 1DTTA 4O55A 1NK8A 4CGGA 4FJHA 4CCHA 5KTQA 1EP4A 3HVRA 3KK2A 4OPJA 1JXBA 4FLXA 2D5RA 1EX4A 1JLCA 4W5TA 2R7YA 4DTNA 4E0DA 3AVLA 3NHGA 4Q0BA 1RT2A 2BANA 4M3ZA 2G8HA 3SJJA 1LWEA 3O4NA 1B9DA 1RNHA 1QE1A 3NDKA 5CYMA 1NK6A 2XRIA 3C6TA 2YNIA 4DQRA 3L2QA 3AVKA 2Z1GA 3DM2A 2OA8A 3NF9A 2KW9A 1Q9XA 4DU1A 3QEPA 3PUFA 2G8IA 1QSYA 3P5JA 3L2UA 1GOCA 1VSKA 4DSKA 3AVMA 1RDDA 4CK2A 1VRTA 1U4BA 2ATQA 3CG7A 3QEIA 4NYFA 1FXXA 1X9SA 3HSTB 1TKDA 4UZWA 3SYZA 2HNYA 1V66A 5C25A 3OYLA
chains in the Genus database with same CATH superfamily
2O8EB 4FLUA 5D3GA 1JL2A 5FPDA 4BWMA 1XQSC 1Y97A 3TTFA 1S6PA 4DFKA 3SQ2A 4U7BA 5AQTA 1NJIO 3W3DA 1K8AO 2Q0UA 1DGKN 3HJFA 3WNHA 1Q8IA 1Q86O 2HHUA 5JLHA 3DLEA 1RTIA 3NGYA 1RDCA 3DXKB 2FSKA 4BRCA 1TV6A 4F3TA 5E84A 3T1AA 3SI6A 5AFUH 3THVA 4CZEA 3PO5A 1SKWA 3BY5A 3ZX0A 4FLWA 2QK9A 4RW9A 4KHUA 4CJVA 3VEXA 4C8KA 3MN7A 4A5AA 3LDLA 1W0HA 4FXDA 3DJCA 4BR7A 4FZXC 3ENBA 5HRNA 5AQFA 1ZS9A 4IDKA 1RT4A 2KKZA 1QZ5A 2JVWA 4F8RA 1T7PA 3ZSYA 5E41A 3BGRA 2HJQA 1NK5A 5CY4A 4BITA 3THYA 4ICLA 2ZJRL 1ATRA 4B9MA 4RW6A 5GINA 4FJMA 4QAGA 2WOMA 3ZT1A 1YHQN 1XNRK 1JLFA 5AQRA 3T69A 1WSJA 2QWRA 5T7BA 1E3MA 4J8FA 3SPYA 5AQJA 3T7ZA 3J7YP 3AA2A 3B6OA 3PO4A 1H9EA 3R8EA 2P9SA 2G8VA 1D4XA 3DRSA 1NGJA 3PSIA 3OYHA 2PZSA 1ZBFA 4JI4K 4CERA 1VQNN 4I7FA 4NCGA 3D45A 4H5TA 3DLBA 4QCLA 3MEEA 4FLVA 3S3OA 2OTLN 1ASUA 4BC2A 1E4FT 3NH0A 4AHSA 1WBDA 1RGIA 1TAUA 2QWPA 2FBVA 3K59A 4NXMK 3TPQA 3F5TA 1JCGA 3TTCA 3O3FA 3O9SA 1MDUB 3KD5E 4NXNK 4OGCA 1OH7A 3KD1E 1KAXA 3QIOA 4AH9A 3F2KA 2QKKA 3VEVA 2HSTA 4KRFA 3AY9A 2IDOA 3EKUA 4RWTA 4HUEA 2Y1IA 4ZTJA 4EAHD 2HVIA 3VPZA 4FJ5A 3UIQA 4F3OA 4C8OA 1JLBA 4KBOA 1FJGK 1NMNA 4BRPA 3MEGA 3E66A 3ZX3A 4DTPA 1LW0A 1I94K 4WE1A 2VWBA 4CF1A 2F8SA 2G8KA 4E7KA 2ZE2A 4QS7A 3UKRB 4IG3A 3NVMA 4A57A 1TVRA 1H1JS 3HL8A 5KGWA 4CJ4A 1DTQA 3SMSA 1TYQA 3WXMB 3AO4A 4CJPA 3O3GA 3KLEA 4HTUA 1YI2N 4DTJA 3R9PA 2ITGA 4BE1A 1JXEA 4M3RA 1GLFO 3DLKA 2D0BA 3E9OA 4H0VB 2I5JA 3VF4A 3VGKA 3KLGA 4WYBA 2P9IA 2P9PB 4EP4A 2B5JA 2YKMA 2B4JA 1J54A 4H0YB 1VAZA 4CD1A 2NRWA 1HNWK 2Z1JA 3QETA 1LCUA 3EEQA 4FVMA 3VETA 3C7NA 1DLOA 4B1YB 2P1JA 3L2RA 4CZMA 4GVEA 3OYKA 4LH4A 4QOZB 4AM6A 5AQHA 1XI1A 4LFAK 3MX5A 4EZ9A 2RE2A 1QQOA 1XWLA 3P83D 4YNQA 1WSFA 2IOCA 4B3SK 5HL7L 5GIPA 2KFNA 3VQ7A 1RT6A 3GOIA 4DR6K 1XUPO 2Q0RA 3CETA 3D2EA 3V9XA 4BC4A 2VYPA 4WFBL 4HCCA 1NM1A 1XHXA 2D1KA 3LWMA 4A61A 5M1OA 4H5VA 2ZM6K 4CZGA 3MDQA 4PKIA 1T8EA 1TL1A 1O13A 3QDKA 3DYAA 4K25A 4CFAA 4K41A 1C1AA 3GG4A 1VQ7N 2FSNA 3RRHA 2F4VK 3E01A 3AVCA 3SV4A 1S9GA 5KPTA 3ZT4A 3WNFA 1XC3A 4AHCA 4Z94A 2VG5A 3A8YA 4DQ8A 1GOAA 4IOXA 4BR5A 5ELZA 2QWMA 1ZBSA 4ISEA 3THYB 4PL8A 2LSNA 1LV5A 5SWMA 4YDUA 1VSLA 3D2FA 4PL7A 1XMQK 1ASVA 1ESVA 3ULDA 3V9WA 2ODCI 3MWPA 3TAMA 3OBWA 2P51A 3OY9A 2W51A 1H1VA 4BRAA 4C8LA 3C6UA 2P9SB 3AVAA 4LH5A 2A6AA 3LM9A 5FROA 4H5WA 3K9JA 2O4GA 4FOEA 5AQKA 3ZSZA 3BP8A 5AQXA 1ZC6A 1W97L 4FJNA 1RT1A 1J53A 3CMAN 5JVHL 4B1XB 2FC0A 1KVAA 3OYFA 4B8CA 4LF8K 2QW9A 1RDWX 2QXLA 4ILGB 4CK1A 3U8XA 4H5NA 2UUAK 4A59A 4E1MA 3CCUN 2O8FA 3VQ6A 3QFUA 3NBPA 3J7AP 1QHAA 4DLGA 4ID1A 3O4WA 4W5RA 4O44A 4GW6A 1P8ZA 4CEDA 1BGXT 1HX1A 3QIPA 3LPTA 1HQEA 1OVYA 2F9TA 2PBDA 1W9HA 5AQSA 2UU9K 4I6MA 1WOQA 5AZIB 3ZCMA 4DR2K 1OVQA 1QSLA 4X64K 4DTSA 3MCAB 4JK7A 3VTHA 3TAPA 1C0UA 3HRGA 4JI8K 1NOZA 4CZHA 4KB0A 2YHYA 1T44A 5GAHP 5BN8A 4BC5A 3ULEA 5AQPA 4DTRA 1XHZA 4BE2A 1TYQB 5FPEA 3ZSWA 2HHSA 3L0OA 4KKOA 5EOYA 4JHDA 4BGAA 4J2BA 4KAZA 4PUOA 4CZLA 3OYMA 3BDPA 3LDOA 2JLEA 5LJVA 3U9ZA 4YOTA 2F7TA 3WEEA 4CZKA 2WTUA 1SL2A 3OVNA 3AARA 4BRFA 1E7DA 4UQGA 1KFSA 3DI6A 3OS0A 2P9IB 2AA4A 2FLOA 3ALYA 1SKSA 4OPAA 1D9DA 4BR4A 3BF3A 1A5VA 4ISFA 2Q2RA 3H45C 4Z4GA 2JGUA 1Z05A 5I42A 4CZJA 1C0MA 5EX5A 3LDSA 1Y64A 2ZGZA 3AGRA 5E26A 3VERA 3C7NB 4AM7A 2XY6A 4FJIA 1BHLA 3DRPA 4DSFA 4J2AA 3DLHA 2F8TA 5AZJB 2VG6A 3K58A 2G8FA 3G25A 3LWLA 2XO7A 1IKYA 3CI5A 4I2QA 4CHQA 3HVTA 4BDPA 3CFOA 3EY1A 3OA9A 5M1PA 5BPNA 1B9FA 4FLZA 4M7YA 5J2QA 4DSLA 5JVGL 4MDBA 1VSFA 2RNNA 2IC3A 1NGFA 3BZCA 4GY2B 2DY4A 4BR2A 5FLXO 1N32K 4DR5K 3HTVA 4K8XA 3M1FA 3QNNA 2O8EA 4BC3A 3EL2A 4J2DA 3LDQA 1C1BA 3AVHA 1S1UA 1SAZA 4GVMA 3AVNA 3ZSOA 4B08A 3AO3A 4E1JA 2XY7A 3WXKA 3T3FA 1NK8A 2KFZA 4CVNE 2D5RA 2R7YA 2YJFA 2ASMA 4H0XB 1KAZA 3KVGA 3NHGA 4Q0BA 3CJCA 5MLCQ 5A2QO 2V51B 2WFBA 2G8HA 3SJJA 5KQDA 3DXKA 1QE1A 4JK9A 1NK6A 2XRIA 3VF6A 3AVKA 3PUFA 3L2UA 1VSKA 4FWRA 1RDDA 1U4BA 3CG7A 4NYFA 1FXXA 3BUZB 2UUCK 3D2FB 3SYZA 4WQ5A 1J6ZA 3DRRA 3SAFA 1VQ6N 3N4PA 4CJKA 2V7ZA 2RHKA 4JKCA 2RKIA 4DR7K 1JCFA 1QHTA 3KLHA 1CZ9A 4LF9K 4CJTA 2GUIA 3JYTA 2IGIA 5CR4A 1HUXA 3JXUA 2Q31A 4CGJA 4F2RA 1I39A 2QXFA 3RR8A 4JLHA 1KTQA 4GV9A 4H03B 5CYQA 5AQGA 1X9WA 1CXQA 3VQPA 1XMOK 3ZSRA 1UA1A 3LANA 2W6LA 4Y1CA 5HRSA 4NCBA 3EYZA 4Z4FA 3KWIA 4YDUC 1GOBA 2HBKA 2VGMA 2QNFA 1NMDA 3IAYA 2O8FB 3S9HA 1YT3A 4B8AB 4HTLA 1NJWA 4DV2K 4GV3A 5J2MA 4E89A 4ILHA 3D0PA 3VA0A 5KPRA 5HROA 2J4RA 2FBXA 1HYVA 1TKXA 3D7EO 4JN4A 4DMNA 1U6ZA 4I6MB 4N41A 1NOYA 5BR9A 3G4SN 4R5PA 4KHSA 2KHOA 3ZSQA 5CIUA 3VQCA 3W0LA 1NGDA 4M3TA 4B9TA 4M3UA 1BA1A 1BWFO 3FR0A 2NRHA 4KH4A 3ULEB 2DFFA 1Z26A 1LOTB 3V9UA 3KWGA 1HR0K 4IG0A 3DOLA 2DFHA 4F2SA 5KRTA 3TR8A 1HRHA 4JHDB 5EVZA 1K6YA 3PX6A 2BE2A 3KLIA 3WQTA 3A5MC 1LW2A 1SL1A 4DFMA 4XH5A 2KZMA 5F2RA 3HM9A 4JI6K 3OS2A 3WXIA 3L2WA 4JAXA 4PY5A 1RDAA 3P39A 4PHTX 4CHOA 1NKEA 1C6VA 1BU6O 2E20A 2EHGA 4FOIA 4H0OA 3VQ4A 3SQ0A 1G15A 4K8ZA 5LMNK 2D0CA 1Z25A 3VF2A 2B6AA 3CF5L 3LL3A 2UYTA 2P9PA 1REVA 3LP2A 1GL9B 2A3ZA 2E2PA 3V1OA 3TSQA 2HHHK 4H0PA 4I2PA 1S22A 4YHHK 3SCXA 2IS3A 4ILJA 3ZETA 3IDHA 2GTDA 3CCRN 3RSEB 5AR0A 4B9SA 4XIUA 4FM2A 1BDGA 1GLDG 4W5OA 3TWHA 4JI0K 4H4MA 4KH6A 3V81A 1JJRA 3T1YK 4XEIA 1L5UA 4DV7K 3CCEN 4L8RB 1YXQA 2KTQA 4CJ3A 4DR3K 3DLGA 1YNSA 3KK1A 3TARA 5KI6A 4B1WB 2E1ZA 3QICA 4B1ZA 3DXMB 5HP1A 4F4KA 3QINA 4FJXA 4MLEA 4KV8A 1T03A 4FK4A 1YJ9N 2WBNA 1LAWA 3U6FA 1NGAA 3VMFB 3HT3A 3H08A 5SZTA 4CF2A 3QESA 3MN6A 3CJ7A 3SMPA 4GMJB 1VHXA 2D0AA 3QEVA 2OYQA 2WUSA 3NGIA 2NRTA 3CJBA 4A62A 1JL1A 1RDBA 4H4OA 1GKUB 2A1SA 3IFRA 1VSEA 3ASMA 5CZ2A 1TL3A 3Q7BA 4Z4HA 1VQON 4CF0A 3CJ9A 5DMRA 3ZLJA 4AILC 2OPQA 1TUUA 3LDNA 4ELTA 4K43A 4N76A 1WUAA 4IFYA 1RTDA 3I55N 1TAQA 1NGGA 2DK4A 4DQIA 2IVOA 2O8BA 4C8NA 4JV5K 3TAEA 2JWLA 4GKKK 2HBJA 3FZLA 5IWAK 1EO1A 3U9DA 3HO1A 2O8DA 1WLJA 4BGBA 3OYIA 4FJLA 3MXMA 3OYNA 1NGBA 1RILA 2NZTA 5C24A 2X78A 3SBGA 1BQMA 3CM5A 3O5BA 2NRXA 1YUWA 3KZBA 4ISGA 2KLAA 5AZIA 3CM6A 3DMJA 2HBLA 4CK3A 2OZSA 2ZQBA 4JK8A 4KPYA 3BZKA 3PIOL 2E2NA 4FK0A 2CH6A 4CHYA 1NWKA 4CD3A 4O8KA 3O9UA 2XHBA 3HPHA 5AQLA 2GWKA 1YTAA 2MPHA 1HJRA 3QFPA 3NH2A 4DWIA 4CBWA 1S5JA 5M1QA 3RTVA 3JSMA 3CIPA 4L3QA 1D9FA 1LWFA 1VSDA 2X6NA 3SAGA 1RBUA 4OO1J 5GIOA 1Y02A 3LLRA 4CEBA 5BRFA 1OKJA 4KI4A 1HNVA 2FXUA 4ID5A 3VQ9A 4IJNA 4KHYA 2VQEK 3QB0A 1NGCA 4FVUA 2QA4N 4FJJA 1S1TA 3NFAA 1IH7A 1BIUA 3U3GA 4B9UA 4CHPA 2QWNA 1I3AA 5AZJA 1KLNA 2GBZA 3DOKA 3R1XA 1SV5A 3IRXA 3ZX2A 4FWLA 2ZJPL 5J2NA 3ZETB 3RR7A 1R0AA 1IV0A 4OPKA 4HVJA 3OYDA 2CGJA 3HK2A 4MLHA 3KK7A 3C95A 1TGOA 1YIJN 3LP3A 4CJUA 2QTDA 1VSHA 4JNEA 3WXLA 4FLTA 5BR8K 3PLAA 4CEQA 5AQMA 4O5FA 3M6GA 2KW4A 3CQXA 4JI1K 4IBNA 3J81O 1IBLK 5CHIA 1Q81O 4CEEA 1JCEA 3AA4A 4BDZA 3CCQN 1RDUA 1HPZA 1YJNN 4DHYA 1HNZK 5K14A 5C2DA 3OS1A 2QWOA 1RTJA 2GWJA 4E7IA 3TANA 1EKEA 4KTWA 5LY3A 2P5OA 3TAQA 1D5AA 4KHNA 3OYBA 1ATNA 3QMLA 2HB5A 1NK4A 4W5QA 3QKJA 3QO9A 4MDAA 5C15A 5ADXA 4HUFA 1QQNA 4LC9B 4CW7B 2NRRA 5H1SQ 2PYJA 2F9WA 4IO8A 3VGLA 3KK3A 1UWBA 1BUPA 4FJKA 1L3SA 3K9KA 1K9MO 4CIEA 5JS1A 1Q18A 4PA1A 2LC3A 4C1NI 4NLBA 4LF5K 1TKTA 3MN5A 4CF8A 2Z1HA 3V1QA 1VQ4N 5EY4A 1DTTA 4O55A 4CCHA 1EN7A 1JXBA 4OPJA 4FLXA 3DWLA 3OBYA 5BREA 2O8BB 3L6QA 1MWMA 4DCHA 3FLGA 3O9RA 3CCSN 1B9DA 1RNHA 3QBXA 2KW9A 1HJOA 4JKHA 2CGKA 4H0TB 5M1FA 2G8IA 2O8DB 4U67L 3CCLN 1VRTA 2NNWA 2W41A 4DR4K 2A42A 2ATQA 4DUYK 4IDHA 1TKDA 1X9SA 4UZWA 2QEXN 3UE5A 1KHCA 1V66A 3VESA 3GE1A 1A8VA 4OVLA 1NK9A 3MMVA 1KVCA 1N34K 1MU2A 3L3UA 1N8RO 5KGXA 1Q9YA 1K73O 2P9LA 4BDYA 3R3LA 1KD1O 2E5LK 2P9KA 3G71N 1UAXA 5LJWA 3QEXA 5FRNA 3FZHA 4Y1DA 3GDQA 4O0JA 4OKEA 3E9LA 5BRDA 2ITMA 2A40A 1CLQA 4YOUA 1RBVA 3O9QA 1BG3A 2BUPA 3M8PA 1J5OA 4DUZK 2ASPA 1RT3A 2EWSA 3BEXA 4FW2A 2PAVA 4YOVA 3AGKA 1EQYA 3AAQA 3F9KA 1WN7A 4RG8A 3NCIA 3N4QA 5GAEP 1RT7A 5JLFA 4YY3K 3HP6A 3L4QA 1TKZA 1WSHA 1BI4B 1GLCG 1VK0A 4WFAL 4RW4A 2F96A 2GELA 1Q7YO 1KXPA 4NYNA 3MECA 5HRPA 3LZJA 2P9UA 5AQNA 1E7LA 2HHQA 4CZIA 3WNEA 4FJ8A 3JS6A 3MAQA 5I3UA 4LFBK 4DSIA 3CHWA 4K42A 3T1HK 4CJWA 3THWB 4X65K 1NK0A 5DK5A 3TAFA 3H1VX 2VG7A 1S72N 3F73A 2ODGC 3QNOA 4CEAA 3NGZA 1NJXA 4JI5K 4AQYK 1BL3A 2A8VA 2QKBA 1QVGM 4CECA 3RSEA 4DQPA 2ETJA 3HXMA 4NO7A 3G6EN 4CGDA 3UB5A 4I9LA 2FF6A 4EFHA 4DSEA 5BPLA 2QM1A 3P4IA 3RMCA 2BH1A 3NF7A 3CD6N 3RMBA 3TSPA 4YOXA 3OJSA 4IO9L 3OYGA 4DTXA 1KAYA 3VOVA 1U04A 1GLJO 5JS2A 3AO2A 1N33K 4FM1A 3DXMA 3J8AA 1CZBA 1L3VA 4OJRA 3MK6A 2E6MA 4DV0K 2H3GX 4IZ9A 2BDPA 1U47A 3F9MA 3MXIA 4W5NA 2KVUA 3EO3A 2A5XA 4M42A 4PWDA 2OPPA 3RVCA 3SQ1A 1WSGA 1BOTO 2OCEA 3CC4N 2UXDK 4KTZA 1RBTA 1LWCA 4BRLA 2RF2A 1QQCA 4LSLA 5DM6L 2OTJN 1E4GT 2HNDA 3PX4A 2FBTA 4FJ7A 4B3TK 1CZAN 4CEZA 3NF8A 3TU5A 2V52B 3ZSVA 1V4TA 3CC7N 1JLQA 4B9VA 2KFVA 3C65A 1C0TA 2Q36A 1C0GA 2VWKA 2YV0X 4C1NK 2BGGA 2BTFA 2E88A 1JLGA 3AVIA 3I56N 2P9LB 1VQMN 4LF4K 3LDPA 3V6DA 2HVHA 3WT0A 2P9KB 1TUYA 1EXQA 1XC9A 4ZHRA 1ITGA 4E1NA 2CH5A 1RCHA 1HMVA 1A5WA 4M63C 3QBWA 3EZ5A 1KSPA 5FPMA 3OYEA 3H3OB 4CGIA 3H1QA 5M1NA 5HLFA 2Y1JA 2NRVA 4FZYA 3I33A 3O08A 1FW6A 3P31A 3QLHA 4E7JA 1HQUA 1JJ2M 3O4QA 4Q5VA 1YJWN 3O9TA 4CF9A 4DQQA 5IT9O 4IOAL 3NE6A 4BRMA 3C6AA 4Z4CA 3CJAA 4DFPA 3LAMA 1VSJA 4CFBA 3NH1A 1WBBA 3ZEUB 3GL1A 3H6EA 4FPBA 4WF9L 3VENA 3SBTA 3EN9A 3L0QA 2YJEA 1X3MA 3I0RA 3WNGA 3SZ2A 2YX6A 4IFVA 3I0SA 3KJVA 3LAKA 4JKBA 1SS6A 5C42A 2P9UB 2HHTA 4CIFA 1BCMA 3EE8A 2E6LA 1N36K 2HMIA 1OH5A 2RNOA 3O8MA 4FWMA 2DTUA 1FKPA 4BROA 2D4WA 1HNXK 4FJ9A 4BRIA 3K0SA 2W42A 5CZ1A 3VA3A 4FK2A 3K5MA 4CGHA 3VEZA 4AHVA 3LALA 1GLEG 5ADXH 3ZT2A 1XNQK 3ISNC 3NAEA 3IMXA 1VQ9N 4IKFA 1QQMA 3S41A 4I9QA 3L8BA 4A5BA 2YNGA 4WCEL 5KRSA 3S3MA 4CBXA 5DM7L 5BN9A 1VQ8N 3ZT0A 3SUOA 2GX9A 3WUHA 2D0PA 2VGNA 4YORA 3MN9A 5BPMA 2JWKA 4IXCA 4Z4IA 1R59O 4YOYA 3VN5A 3EE9A 1IG9A 4CJRA 3I8BA 1NGEA 4BR0A 4LFCK 1VSMA 3KIOA 2QWLA 4DSJA 4DKWA 4OLAA 4H8KA 3RMDA 1HKCA 3ID6A 4M3XA 3ATVA 3A0IX 2RN2A 3LM2A 1WB9A 3VQDA 2OANA 3ATUA 2P9NA 2HHVA 5BRHA 4JKGA 4TSXA 3SUQA 2W40A 4QS8A 4A2AA 3CYMA 5AQVA 3IUCA 4CFCA 3SNNA 4DTMA 4DV4K 1GLAG 5J1EA 1QTMA 4DR1K 3B6PA 1HKBA 4KB1A 1GLLO 1Z6RA 1U49A 1BISA 4CJFA 1S6QA 3A5OC 2YI1A 1KQSM 3VEWA 4WQ5C 3TTDA 1W2BM 4JKDA 1A63A 4JS5A 3LP1A 3AVGA 3THXB 4FJGA 1FK9A 5AJ3K 2VCPA 1VSIA 3RMAA 4BRGA 1GJJA 4BRKA 5FRMA 5J2PA 3DLRA 1SZ2A 1QSSA 1IKVA 4HUGA 2W6KA 4B9LA 4CHNA 4KHQA 1RFQA 3AO5A 1EWQA 2ZWHA 3G10A 4CJLA 3RWUA 4FM0A 4JRPA 4CEOA 3H46O 2ZJQL 4O0IA 4CJQA 1FKOA 2XY5A 3M5RA 1BCOA 3CERA 5HRRA 1M1KO 2O8CA 4FJHA 1NLVA 3HVRA 1EX4A 4W5TA 4E0DA 3FLCO 5LL6Z 5GAGP 1RT2A 4CI6A 3CMEN 5C10A 3UKUB 1DKGD 3NDKA 5CYMA 3C6TA 3L2QA 2OA8A 4BQZA 3QEPA 3MWTA 3P5JA 1GOCA 4R79A 4DSKA 5B8HA 3QEIA 3HSTB 2HOEA 4FWQA 2HNYA 3ENOA 5C25A 1VQLN 4Z0UA 1JKHA 3HSCA 4LF6K 3MCPA 1BO5O 1C0FA 2E1YA 4BG8A 1MA9B 4DS4A 3NMUA 3ITHA 3V4IA 1KLMA 4DTOA 3C6HA 3ZSXA 2KZZA 4N56A 3CXCM 1BI4A 3PSFA 4CJ5A 1DEJA 4WQ4A 1A62A 4OPHA 4NB4A 5AQQA 2AJQA 3QERA 4CIGA 5GADP 1YVNA 1IJJA 1HNIA 1WSIA 4CGFA 2FBYA 4YFUA 3PY8A 2LD7A 1WNSA 3THWA 2HF3A 3HM8A 4B1UB 5I9EB 4LF7K 1W7AA 1U2VA 2E2QA 1BQNA 2I7PA 2KVEA 3L2VA 3SK3A 3AA3A 3FFIA 5FDLA 3SAHA 2A41A 1TK8A 3MX2A 4RW8A 2HW3A 5C12A 4NCAA 4DU3A 2QNCA 3K5LA 3IKMA 2YHXA 3NVKA 4M7XA 4DS5A 3TAGA 1OH8A 3V1RA 5EU7A 1N6QA 4GV6A 4C23A 4E7HA 1O1WA 4KREA 4DTUA 4RCHA 3AA5X 3VQ8A 3FZKA 3DLLL 2YHBA 2YNFA 2UXCK 1F21A 3WXJA 4IWVA 4JKEA 2ZGYA 4JI2K 3SUNA 1T05A 3P38A 4BWJA 3L4IA 4IEIA 5AQIA 2GUPA 3A5NC 3AVJA 1RBSA 1WAFA 3VTIA 2NRZA 1NG9A 2P9NB 1YVUA 4JKGB 3L3VA 4FWKA 4O8UA 1VQPN 2E2OA 2PYLA 3SPZA 3AAPA 4JD2A 4DV5K 4BY9C 4LSNA 1BIZA 3ID8A 3O3HA 1NNEA 1YAGA 1SQKA 1NJYA 1X9MA 5EXWA 4DQSA 1LAVA 1ATSA 4GKJK 4JKAA 2UXBK 4DG1A 4GNIA 3RRGA 1ZBLA 1VQKN 2E4LA 3BF1A 1X1PA 2EX3A 4DLEA 3IG1A 1MWKA 3CPEA 3I8DA 5AQZA 2GEMA 4E19A 1NKBA 2HHXA 4QS9A 3SJHA 1IBKK 2WQGA 1ZBIA 1S1XA 3HYFA 4HWIA 4M3WA 3T19A 3AO1A 5AFUA 4XH4A 4FLYA 1S9EA 1ZXOA 4OKJA 4BRDA 3OW2M 1V4SA 4WFNL 1J5EK 4AHRA 3AVBA 4FPAA 2PY5A 2G8UA 1B92A 2XY8A 3Q7CA 1YITN 2HNZA 1JLEA 4B3RK 3IS9A 5FPNA 3TSUA 4PQUA 1S1WA 4A2BA 3OTOK 5CE3A 2WC9A 1NKCA 1KFDA 4CFDA 3U4LA 2G80A 2O8CB 2KQ2A 4IFEA 1TK5A 1OH6A 3KLFA 3TI0A 2D0OA 3PX0A 1JEQA 3EZWA 2DFEA 3PV8A 3E1YA 1RT5A 1HKGA 3U3YA 4ELUA 4PKGA 2HHWA 1KCFA 2Q97A 5LMUK 3PIPL 3V9SA 4UY8O 4XH1A 2YCHA 4YOWA 3QEWA 3FGUA 2AP1A 2G8WA 2FF3B 5AQYA 3HP9A 1DT9A 3EKSA 4MO5A 1KVBA 1IBMK 4G9ZA 4BREA 3C94A 4BRHA 5KPZA 3K5NA 1U48A 1RBRA 1U45A 2YHWA 3K5OA 3ZEUA 3P1GA 2ZF5O 5HBMA 3J80O 4CJSA 3OYJA 3FE1A 3VEOA 4EZ6A 3GBTA 2Z1IA 2HF4A 5JMVA 4KHPK 1JEIA 1WAJA 4AHTA 3LZIA 4JI7K 3D6RA 3OHRA 5AQWA 3VQ5A 1S1VA 4IEEA 4RW7A 3ENHA 3VEYA 3OJUA 4KI6A 1U2VB 2A1RA 1UA0A 1VQ5N 3FZMA 2WONA 4BACA 2O4IA 3KKSA 3J7ZO 4DF8A 4M3YA 1K8KA 4DV3K 3S3NA 1WSEA 3AVFA 1L3TA 4OLBA 1H9FA 3CCMN 4WQ4C 1IO2A 4MO4A 1QZ6A 3CPWM 3CCJN 3MEDA 4MFBA 3V9ZA 4ELVA 4OGEA 3KTQA 2VQFK 4CJ7A 3D2EB 1NU0A 3OYAA 4J2EA 3AV9A 1YTUA 4AF1A 1NGIA 4B1VA 4CHZA 3M8SA 4EIAA 4EHUA 4C8MA 1T6CA 1KRPA 1G99A 1ZYQA 1M90O 3VQEA 3HOTA 4FW1A 1P90A 4E7LA 4EP5A 1VRUA 4CEFA 3C0BA 2YKNA 1HLUA 3G0ZA 1L3UA 1SL0A 4O4GA 4JEPA 1NJZA 4BE0A 1IG8A 2IAJA 4FWPA 4JD2B 4G1QA 5C2FA 1TK0A 1IKXA 3LPUA 3A2FA 3DAWA 2IIRA 4JS4A 4FYDA 3O1WA 4AHUA 4F9OA 3VQQA 3TABA 4OKKA 1SKRA 4BG9A 1ZBUA 4V19S 4RTFD 3LP0A 4X62K 2DPNA 3O80A 1NGHA 3ZYYX 1IKWA 3FZFA 1KC8O 4HCBA 1ASWA 4MQ3A 5JICA 5F1XA 4ZTFA 4Y0WA 4FSVA 5F0XA 2OPRA 4LD0A 2UUBK 2YHAA 5HOOA 1ZBHA 4X66K 2IVNA 3SLCA 3KKRA 4FWNA 3HPGA 3VQBA 3OYCA 1A5XA 3H3NO 2Q1NA 3K2PA 4DU4A 1ILYA 3FFKB 5M1KA 3O6WA 4IJAA 4FCYA 3HOSA 4FL9A 1QVFM 1QS4A 1BA0A 2YNHA 3SV3A 4E3SA 4IOCL 2KVDA 4B3OA 2RPIA 4CJEA 1SUQA 4FZZA 1UOCA 3THXA 4M41A 3CFPA 4HHTA 1GLBG 1S3XA 2X6SA 4FO0A 4KFBA 3CCVN 4PKHA 4BRNA 1T6DA 4KH5A 4BRQA 4M45A 4DFJA 5TKYA 3B8AX 3CFRA 2NUBA 3CJ1A 3E9PA 1J9AA 2OZMA 1D8YA 4KTQA 2VWJA 3NF6A 1NBWA 2QI2A 1EETA 4LY7A 1JLAA 4Z4EA 3SQ4A 1RTHA 4B9NA 1EWRA 5TKWA 4CZFA 5KQ8A 3HBTA 4BR9A 4JYAK 2OPSA 4DV1K 3CQYA 1YF5L 5AQUA 2GV9A 1HPMA 4FWOA 2P5GA 3VGMA 3R6MA 3UKUA 2Q3SA 2ZD1A 2FSJA 4H5RA 3M8RA 3VQAA 4JI3K 1CXUA 3M8QA 1X9JA 3MXJA 4DB3A 4B3MK 4JRQA 4CESA 3ZT3A 1HYZA 4EHTA 4CE9A 3UKRA 1C1CA 2X74A 4O5BA 3WEEB 2PFUA 4BQLA 5C0YA 3K57A 3CQ8A 2IVPA 1N5YA 2QWQA 4BVOA 3SUPA 1HYSA 4OX9K 4DF4A 3A5LC 1Q82O 3HPOA 2V7YA 4KHWA 1NK7A 4NLCA 2I7NA 4N5SA 4N47A 4KO0A 2HMPA 2CGLA 4CGGA 3M3ZA 1EP4A 5KTQA 3KK2A 4DTNA 1JLCA 3WQUA 3AVLA 3KHYA 4K0KK 2BANA 4M3ZA 3CC2N 1K8KB 3O1BA 1LWEA 3O4NA 2YNIA 4DQRA 4JKFA 2ASOA 1T3VA 2Z1GA 3DM2A 3HI0A 1X3NA 3NF9A 1Q9XA 2E8AA 4DU1A 1QSYA 2HBMA 3JAMO 3AVMA 3HZ6A 4CK2A 4DV6K 2NLXA 4CBUA 4B9QA 5AQOA 4BVPA 4FWSA 3OYLA
chains in the Genus database with same CATH topology
4Z0UA 1JKHA 4OVLA 1NK9A 3DRRA 1T7PA 4FLUA 5D3GA 1KVCA 4CJKA 1JL2A 1MU2A 2RKIA 4BWMA 1QHTA 3L3UA 3KLHA 3ITHA 4DS4A 3V4IA 1KLMA 1CZ9A 5KGXA 1Y97A 3ZSXA 4DTOA 1Q9YA 2KZZA 4CJTA 2GUIA 4N56A 1BI4A 1S6PA 2IGIA 3JYTA 4CJ5A 4BDYA 4DFKA 3SQ2A 1UAXA 4CGJA 4F2RA 1I39A 2QXFA 3QEXA 3RR8A 4JLHA 5FRNA 3HJFA 2AJQA 3WNHA 4Y1DA 1Q8IA 1KTQA 2HHUA 3QERA 4CIGA 5CYQA 4O0JA 1X9WA 1CXQA 3VQPA 1HNIA 4OKEA 3DLEA 1RTIA 1WSIA 3NGYA 1RDCA 3ZSRA 4CGFA 2FBYA 1UA1A 4YFUA 3LANA 1CLQA 1TV6A 1RBVA 4Y1CA 3PY8A 3T1AA 4F3TA 5HRSA 3M8PA 3SI6A 1WNSA 3EYZA 3THVA 3PO5A 1J5OA 4NCBA 4Z4FA 1SKWA 4FLWA 1GOBA 2QK9A 3IAYA 1RT3A 3S9HA 4RW9A 4FW2A 1YT3A 1BQNA 4CJVA 4KHUA 2KVEA 4B8AB 3L2VA 4C8KA 3AA3A 1NJWA 3FFIA 1W0HA 3F9KA 4FXDA 4FZXC 1WN7A 5FDLA 5HRNA 4RG8A 4E89A 5J2MA 4IDKA 3NCIA 1TK8A 3D0PA 4RW8A 2HW3A 4NCAA 3VA0A 1RT4A 1RT7A 4DU3A 3K5LA 5HROA 2JVWA 4F8RA 2FBXA 1HYVA 1TKXA 3ZSYA 4DS5A 3V1RA 5EU7A 3TAGA 5E41A 1N6QA 3BGRA 3HP6A 4DMNA 1NK5A 5CY4A 1TKZA 1O1WA 4BITA 1BI4B 1VK0A 1WSHA 4E7HA 4N41A 4KREA 4ICLA 4DTUA 1NOYA 4RW4A 4B9MA 4RW6A 2F96A 3VQ8A 3AA5X 4FJMA 2YHBA 4QAGA 2WOMA 3ZT1A 2YNFA 1JLFA 4R5PA 4NYNA 3MECA 5HRPA 1F21A 4KHSA 3LZJA 1WSJA 3ZSQA 3VQCA 5T7BA 3SUNA 3SPYA 4M3TA 1T05A 4B9TA 4M3UA 2HHQA 4BWJA 3WNEA 3AA2A 4FJ8A 3B6OA 3MAQA 2DFFA 5I3UA 3PO4A 1Z26A 3V9UA 4DSIA 3AVJA 4IG0A 4CJWA 3DOLA 1RBSA 2DFHA 2G8VA 4F2SA 3DRSA 5KRTA 1WAFA 3TR8A 1NK0A 3OYHA 1HRHA 1YVUA 2PZSA 1ZBFA 3L3VA 4CERA 1K6YA 4I7FA 5DK5A 2BE2A 3TAFA 3PX6A 2VG7A 4NCGA 3D45A 3KLIA 3F73A 3QNOA 2PYLA 3DLBA 4CEAA 3NGZA 4QCLA 1NJXA 3MEEA 1LW2A 3SPZA 1BL3A 4FLVA 4DFMA 1SL1A 2KZMA 4LSNA 1BIZA 3S3OA 2QKBA 1ASUA 3HM9A 3O3HA 3NH0A 4CECA 3OS2A 4AHSA 3L2WA 1TAUA 1NJYA 1X9MA 2FBVA 3K59A 4DQSA 1LAVA 4PY5A 1RDAA 4DQPA 4CHOA 1NKEA 1C6VA 3O3FA 2ETJA 4DG1A 3KD5E 4OGCA 3KD1E 3HXMA 3RRGA 3QIOA 2EHGA 1ZBLA 2E4LA 4AH9A 4CGDA 1X1PA 2QKKA 2EX3A 4DLEA 3IG1A 4I9LA 4KRFA 3I8DA 3VQ4A 2IDOA 4HUEA 4E19A 2Y1IA 3SQ0A 4ZTJA 1G15A 1NKBA 2HHXA 4DSEA 2HVIA 4K8ZA 4FJ5A 3UIQA 2D0CA 3RMCA 3NF7A 4C8OA 4F3OA 3RMBA 1JLBA 2WQGA 1Z25A 3OJSA 2B6AA 3OYGA 4DTXA 1ZBIA 1S1XA 3HYFA 1REVA 3MEGA 4M3WA 1U04A 3T19A 4DTPA 1LW0A 3AO1A 3LP2A 5JS2A 3AO2A 4WE1A 4FLYA 1S9EA 4FM1A 4OKJA 3V1OA 1CZBA 4CF1A 2F8SA 2G8KA 1L3VA 4I2PA 4E7KA 2ZE2A 3AVBA 4OJRA 4AHRA 2PY5A 2E6MA 2G8UA 1B92A 2XY8A 2BDPA 4IG3A 2HNZA 3SCXA 1JLEA 2IS3A 3MXIA 1U47A 4W5NA 3IS9A 1TVRA 1H1JS 3HL8A 1S1WA 4PQUA 5KGWA 2KVUA 4CJ4A 1NKCA 2KFZA 1KFDA 4B9SA 1DTQA 4CFDA 4XIUA 4M42A 4PWDA 4FM2A 2OPPA 4W5OA 3TWHA 3AO4A 4H4MA 4CJPA 3O3GA 3KLEA 4HTUA 3SQ1A 1WSGA 2KQ2A 4DTJA 3V81A 1TK5A 3KLFA 3TI0A 2ITGA 1JJRA 3PX0A 4BE1A 1JXEA 4M3RA 1JEQA 1L5UA 4KTZA 2DFEA 1RBTA 3DLKA 2D0BA 3PV8A 1LWCA 4L8RB 1RT5A 2I5JA 3U3YA 4ELUA 2KTQA 2RF2A 1QQCA 4CJ3A 3KLGA 3DLGA 4LSLA 3KK1A 3TARA 4EP4A 5KI6A 2B5JA 2HNDA 3PX4A 2HHWA 2YKMA 1KCFA 2B4JA 1J54A 3V9SA 2Z1JA 3QETA 2FBTA 4FJ7A 3QEWA 4CEZA 2G8WA 3NF8A 4FVMA 3ZSVA 1DLOA 5HP1A 4F4KA 4B9VA 1JLQA 3QINA 3HP9A 4FJXA 1KVBA 2P1JA 3L2RA 1C0TA 4KV8A 1T03A 2VWKA 4FK4A 3C94A 3OYKA 2YV0X 4LH4A 4QOZB 3K5NA 1U48A 1LAWA 2BGGA 1RBRA 1U45A 3U6FA 1XI1A 3K5OA 1JLGA 3AVIA 4EZ9A 3HT3A 1XWLA 3P83D 4YNQA 1WSFA 2IOCA 3H08A 3P1GA 4CF2A 5HBMA 5SZTA 3QESA 2KFNA 3VQ7A 4GMJB 3V6DA 2HVHA 1XC9A 1RT6A 1EXQA 2D0AA 4ZHRA 3QEVA 2OYQA 4CJSA 1ITGA 3OYJA 4E1NA 3NGIA 4EZ6A 3V9XA 1RCHA 1JL1A 2Z1IA 4HCCA 1HMVA 1RDBA 1A5WA 4H4OA 1WAJA 3EZ5A 1XHXA 2A1SA 4AHTA 1KSPA 1VSEA 3OYEA 3ASMA 3LWMA 5CZ2A 3LZIA 1TL3A 4CGIA 4Z4HA 3VQ5A 1S1VA 4RW7A 1T8EA 4CF0A 2Y1JA 5DMRA 5HLFA 1TL1A 4FZYA 4AILC 3DYAA 3QLHA 3OJUA 4E7JA 2OPQA 4KI6A 1HQUA 4ELTA 3O4QA 4Q5VA 4CFAA 2A1RA 4CF9A 1C1AA 1UA0A 4N76A 4IFYA 1RTDA 2WONA 1TAQA 4BACA 3RRHA 3KKSA 2O4IA 4DQIA 4DQQA 3E01A 3NE6A 4DF8A 3AVCA 3SV4A 1S9GA 4M3YA 4C8NA 4Z4CA 3S3NA 1WSEA 3AVFA 4DFPA 3LAMA 3TAEA 1VSJA 3ZT4A 3WNFA 1L3TA 4OLBA 4AHCA 4CFBA 3NH1A 1IO2A 2VG5A 1GOAA 3HO1A 1WLJA 3I0RA 3MEDA 4MFBA 2LSNA 3WNGA 3V9ZA 3OYIA 3SZ2A 1LV5A 4ELVA 4IFVA 5SWMA 3I0SA 4OGEA 3KJVA 3LAKA 3KTQA 1VSLA 3OYNA 3MXMA 1RILA 4FJLA 3OYAA 4J2EA 3AV9A 1YTUA 1ASVA 3ULDA 3V9WA 5C24A 5C42A 4CHZA 3M8SA 3TAMA 2X78A 2HHTA 2P51A 1BQMA 1BCMA 4CIFA 3OY9A 2E6LA 3CM5A 4C8MA 2HMIA 4C8LA 3C6UA 4LH5A 3AVAA 1KRPA 2RNOA 3CM6A 3DMJA 5FROA 4CK3A 2O4GA 1ZYQA 2OZSA 2DTUA 1FKPA 3VQEA 3ZSZA 2ZQBA 4FW1A 4FJ9A 4E7LA 4EP5A 1VRUA 4CEFA 4KPYA 2W42A 2YKNA 1RT1A 4FJNA 1J53A 3G0ZA 5CZ1A 3VA3A 1SL0A 1L3UA 4O4GA 4FK0A 4FK2A 2FC0A 1KVAA 4CHYA 3OYFA 3K5MA 1NJZA 4CGHA 4BE0A 2IAJA 4AHVA 4G1QA 2XHBA 3HPHA 3LALA 1TK0A 1IKXA 4B8CA 3LPUA 1YTAA 3A2FA 1HJRA 3ZT2A 3NH2A 4JS4A 4CK1A 4DWIA 3ISNC 4FYDA 3NAEA 4AHUA 1S5JA 3VQQA 3TABA 3RTVA 4E1MA 4OKKA 1SKRA 4IKFA 3JSMA 1ZBUA 3VQ6A 3LP0A 4I9QA 1D9FA 3NBPA 3L8BA 1LWFA 1VSDA 2X6NA 1RBUA 4DLGA 4ID1A 2YNGA 4W5RA 4O44A 4GW6A 5KRSA 4CEBA 1IKWA 3S3MA 4CEDA 1BGXT 4HCBA 1ASWA 4MQ3A 3ZT0A 3SUOA 4ZTFA 3QIPA 3LPTA 1HQEA 2OPRA 4LD0A 4KI4A 2YHAA 1ZBHA 1HNVA 3VQBA 1W9HA 3KKRA 3HPGA 4ID5A 3VQ9A 4KHYA 3OYCA 1A5XA 3ZCMA 4Z4IA 3K2PA 4DU4A 1QSLA 4FJJA 1S1TA 3VN5A 4DTSA 3TAPA 3NFAA 4FCYA 1IH7A 1BIUA 1C0UA 3U3GA 4CHPA 1QS4A 4B9UA 1IG9A 2YNHA 1I3AA 1NOZA 2GBZA 4CJRA 3SV3A 4E3SA 3DOKA 1KLNA 2KVDA 1VSMA 4KB0A 4B3OA 1SV5A 3IRXA 3KIOA 2RPIA 4CJEA 1SUQA 4DSJA 4FZZA 1UOCA 5J2NA 3RR7A 1R0AA 4OPKA 4M41A 3CFPA 4OLAA 4HVJA 3OYDA 4H8KA 4HHTA 3HK2A 3RMDA 3C95A 2X6SA 1TGOA 4DTRA 1XHZA 4BE2A 4M3XA 4KFBA 2RN2A 3ZSWA 3LP3A 4CJUA 1VSHA 3VQDA 2HHSA 2HHVA 4KKOA 4J2BA 4M45A 4FLTA 4DFJA 4KAZA 4TSXA 3SUQA 4PUOA 4CEQA 3OYMA 3CFRA 3BDPA 2NUBA 2JLEA 3CYMA 1J9AA 2OZMA 1D8YA 4KTQA 2VWJA 2KW4A 3NF6A 4CFCA 3SNNA 3OVNA 4IBNA 1SL2A 4DTMA 1EETA 4CEEA 3AA4A 4LY7A 5J1EA 4BDZA 1QTMA 1HPZA 1JLAA 4UQGA 1KFSA 3DI6A 3B6PA 5K14A 3OS0A 3OS1A 3ALYA 1SKSA 3SQ4A 1RTJA 1RTHA 1D9DA 4B9NA 4KB1A 4Z4EA 1A5VA 1U49A 1BISA 4E7IA 3TANA 4CJFA 4Z4GA 1EKEA 1S6QA 2JGUA 5I42A 4KTWA 1C0MA 3LDSA 2P5OA 3TAQA 1D5AA 4KHNA 3OYBA 2XY6A 4FJIA 2OPSA 1BHLA 3DRPA 4DSFA 4J2AA 3DLHA 2F8TA 2GV9A 2VG6A 3K58A 2G8FA 2P5GA 4JS5A 2HB5A 3LWLA 2XO7A 4W5QA 1NK4A 1IKYA 3QO9A 3LP1A 3AVGA 4FJGA 1FK9A 2Q3SA 2ZD1A 1VSIA 4I2QA 3RMAA 4CHQA 4HUFA 3HVTA 3M8RA 4BDPA 3CFOA 3VQAA 3EY1A 2PYJA 5FRMA 5J2PA 3DLRA 1CXUA 3M8QA 1QSSA 1B9FA 3KK3A 4FLZA 1IKVA 3MXJA 4HUGA 5J2QA 4DSLA 4B9LA 1VSFA 2RNNA 1UWBA 4CESA 2IC3A 4CHNA 3ZT3A 4JRQA 1HYZA 4KHQA 3AO5A 4CE9A 2DY4A 4FJKA 1C1CA 2X74A 4O5BA 3G10A 3K57A 3CQ8A 4CJLA 2XY7A 1L3SA 4K8XA 4CIEA 3QNNA 1N5YA 3RWUA 5JS1A 3SUPA 1HYSA 4DF4A 4FM0A 4JRPA 4PA1A 3HPOA 4J2DA 1C1BA 4KHWA 3AVHA 4CEOA 1S1UA 1NK7A 4O0IA 1TKTA 4GVMA 4N5SA 4CJQA 3AVNA 3ZSOA 4B08A 3AO3A 1FKOA 4CF8A 2XY5A 2Z1HA 4N47A 1BCOA 4KO0A 5HRRA 3V1QA 3T3FA 1DTTA 4O55A 1NK8A 4CGGA 4FJHA 4CCHA 5KTQA 1EP4A 3HVRA 3KK2A 4OPJA 1JXBA 4FLXA 2D5RA 1EX4A 1JLCA 4W5TA 2R7YA 4DTNA 4E0DA 3AVLA 3NHGA 4Q0BA 1RT2A 2BANA 4M3ZA 2G8HA 3SJJA 1LWEA 3O4NA 1B9DA 1RNHA 1QE1A 3NDKA 5CYMA 1NK6A 2XRIA 3C6TA 2YNIA 4DQRA 3L2QA 3AVKA 2Z1GA 3DM2A 2OA8A 3NF9A 2KW9A 1Q9XA 4DU1A 3QEPA 3PUFA 2G8IA 1QSYA 3P5JA 3L2UA 1GOCA 1VSKA 4DSKA 3AVMA 1RDDA 4CK2A 1VRTA 1U4BA 2ATQA 3CG7A 3QEIA 4NYFA 1FXXA 1X9SA 3HSTB 1TKDA 4UZWA 3SYZA 2HNYA 1V66A 5C25A 3OYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0U A;  1JKH A;  4OVL A;  1NK9 A;  3DRR A;  1T7P A;  4FLU A;  5D3G A;  1KVC A;  4CJK A;  1JL2 A;  1MU2 A;  2RKI A;  4BWM A;  1QHT A;  3L3U A;  3KLH A;  3ITH A;  4DS4 A;  3V4I A;  1KLM A;  1CZ9 A;  5KGX A;  1Y97 A;  3ZSX A;  4DTO A;  1Q9Y A;  2KZZ A;  4CJT A;  2GUI A;  4N56 A;  1BI4 A;  1S6P A;  2IGI A;  3JYT A;  4CJ5 A;  4BDY A;  4DFK A;  3SQ2 A;  1UAX A;  4CGJ A;  4F2R A;  1I39 A;  2QXF A;  3QEX A;  3RR8 A;  4JLH A;  5FRN A;  3HJF A;  2AJQ A;  3WNH A;  4Y1D A;  1Q8I A;  1KTQ A;  2HHU A;  3QER A;  4CIG A;  5CYQ A;  4O0J A;  1X9W A;  1CXQ A;  3VQP A;  1HNI A;  4OKE A;  3DLE A;  1RTI A;  1WSI A;  3NGY A;  1RDC A;  3ZSR A;  4CGF A;  2FBY A;  1UA1 A;  4YFU A;  3LAN A;  1CLQ A;  1TV6 A;  1RBV A;  4Y1C A;  3PY8 A;  3T1A A;  4F3T A;  5HRS A;  3M8P A;  3SI6 A;  1WNS A;  3EYZ A;  3THV A;  3PO5 A;  1J5O A;  4NCB A;  4Z4F A;  1SKW A;  4FLW A;  1GOB A;  2QK9 A;  3IAY A;  1RT3 A;  3S9H A;  4RW9 A;  4FW2 A;  1YT3 A;  1BQN A;  4CJV A;  4KHU A;  2KVE A;  4B8A B;  3L2V A;  4C8K A;  3AA3 A;  1NJW A;  3FFI A;  1W0H A;  3F9K A;  4FXD A;  4FZX C;  1WN7 A;  5FDL A;  5HRN A;  4RG8 A;  4E89 A;  5J2M A;  4IDK A;  3NCI A;  1TK8 A;  3D0P A;  4RW8 A;  2HW3 A;  4NCA A;  3VA0 A;  1RT4 A;  1RT7 A;  4DU3 A;  3K5L A;  5HRO A;  2JVW A;  4F8R A;  2FBX A;  1HYV A;  1TKX A;  3ZSY A;  4DS5 A;  3V1R A;  5EU7 A;  3TAG A;  5E41 A;  1N6Q A;  3BGR A;  3HP6 A;  4DMN A;  1NK5 A;  5CY4 A;  1TKZ A;  1O1W A;  4BIT A;  1BI4 B;  1VK0 A;  1WSH A;  4E7H A;  4N41 A;  4KRE A;  4ICL A;  4DTU A;  1NOY A;  4RW4 A;  4B9M A;  4RW6 A;  2F96 A;  3VQ8 A;  3AA5 X;  4FJM A;  2YHB A;  4QAG A;  2WOM A;  3ZT1 A;  2YNF A;  1JLF A;  4R5P A;  4NYN A;  3MEC A;  5HRP A;  1F21 A;  4KHS A;  3LZJ A;  1WSJ A;  3ZSQ A;  3VQC A;  5T7B A;  3SUN A;  3SPY A;  4M3T A;  1T05 A;  4B9T A;  4M3U A;  2HHQ A;  4BWJ A;  3WNE A;  3AA2 A;  4FJ8 A;  3B6O A;  3MAQ A;  2DFF A;  5I3U A;  3PO4 A;  1Z26 A;  3V9U A;  4DSI A;  3AVJ A;  4IG0 A;  4CJW A;  3DOL A;  1RBS A;  2DFH A;  2G8V A;  4F2S A;  3DRS A;  5KRT A;  1WAF A;  3TR8 A;  1NK0 A;  3OYH A;  1HRH A;  1YVU A;  2PZS A;  1ZBF A;  3L3V A;  4CER A;  1K6Y A;  4I7F A;  5DK5 A;  2BE2 A;  3TAF A;  3PX6 A;  2VG7 A;  4NCG A;  3D45 A;  3KLI A;  3F73 A;  3QNO A;  2PYL A;  3DLB A;  4CEA A;  3NGZ A;  4QCL A;  1NJX A;  3MEE A;  1LW2 A;  3SPZ A;  1BL3 A;  4FLV A;  4DFM A;  1SL1 A;  2KZM A;  4LSN A;  1BIZ A;  3S3O A;  2QKB A;  1ASU A;  3HM9 A;  3O3H A;  3NH0 A;  4CEC A;  3OS2 A;  4AHS A;  3L2W A;  1TAU A;  1NJY A;  1X9M A;  2FBV A;  3K59 A;  4DQS A;  1LAV A;  4PY5 A;  1RDA A;  4DQP A;  4CHO A;  1NKE A;  1C6V A;  3O3F A;  2ETJ A;  4DG1 A;  3KD5 E;  4OGC A;  3KD1 E;  3HXM A;  3RRG A;  3QIO A;  2EHG A;  1ZBL A;  2E4L A;  4AH9 A;  4CGD A;  1X1P A;  2QKK A;  2EX3 A;  4DLE A;  3IG1 A;  4I9L A;  4KRF A;  3I8D A;  3VQ4 A;  2IDO A;  4HUE A;  4E19 A;  2Y1I A;  3SQ0 A;  4ZTJ A;  1G15 A;  1NKB A;  2HHX A;  4DSE A;  2HVI A;  4K8Z A;  4FJ5 A;  3UIQ A;  2D0C A;  3RMC A;  3NF7 A;  4C8O A;  4F3O A;  3RMB A;  1JLB A;  2WQG A;  1Z25 A;  3OJS A;  2B6A A;  3OYG A;  4DTX A;  1ZBI A;  1S1X A;  3HYF A;  1REV A;  3MEG A;  4M3W A;  1U04 A;  3T19 A;  4DTP A;  1LW0 A;  3AO1 A;  3LP2 A;  5JS2 A;  3AO2 A;  4WE1 A;  4FLY A;  1S9E A;  4FM1 A;  4OKJ A;  3V1O A;  1CZB A;  4CF1 A;  2F8S A;  2G8K A;  1L3V A;  4I2P A;  4E7K A;  2ZE2 A;  3AVB A;  4OJR A;  4AHR A;  2PY5 A;  2E6M A;  2G8U A;  1B92 A;  2XY8 A;  2BDP A;  4IG3 A;  2HNZ A;  3SCX A;  1JLE A;  2IS3 A;  3MXI A;  1U47 A;  4W5N A;  3IS9 A;  1TVR A;  1H1J S;  3HL8 A;  1S1W A;  4PQU A;  5KGW A;  2KVU A;  4CJ4 A;  1NKC A;  2KFZ A;  1KFD A;  4B9S A;  1DTQ A;  4CFD A;  4XIU A;  4M42 A;  4PWD A;  4FM2 A;  2OPP A;  4W5O A;  3TWH A;  3AO4 A;  4H4M A;  4CJP A;  3O3G A;  3KLE A;  4HTU A;  3SQ1 A;  1WSG A;  2KQ2 A;  4DTJ A;  3V81 A;  1TK5 A;  3KLF A;  3TI0 A;  2ITG A;  1JJR A;  3PX0 A;  4BE1 A;  1JXE A;  4M3R A;  1JEQ A;  1L5U A;  4KTZ A;  2DFE A;  1RBT A;  3DLK A;  2D0B A;  3PV8 A;  1LWC A;  4L8R B;  1RT5 A;  2I5J A;  3U3Y A;  4ELU A;  2KTQ A;  2RF2 A;  1QQC A;  4CJ3 A;  3KLG A;  3DLG A;  4LSL A;  3KK1 A;  3TAR A;  4EP4 A;  5KI6 A;  2B5J A;  2HND A;  3PX4 A;  2HHW A;  2YKM A;  1KCF A;  2B4J A;  1J54 A;  3V9S A;  2Z1J A;  3QET A;  2FBT A;  4FJ7 A;  3QEW A;  4CEZ A;  2G8W A;  3NF8 A;  4FVM A;  3ZSV A;  1DLO A;  5HP1 A;  4F4K A;  4B9V A;  1JLQ A;  3QIN A;  3HP9 A;  4FJX A;  1KVB A;  2P1J A;  3L2R A;  1C0T A;  4KV8 A;  1T03 A;  2VWK A;  4FK4 A;  3C94 A;  3OYK A;  2YV0 X;  4LH4 A;  4QOZ B;  3K5N A;  1U48 A;  1LAW A;  2BGG A;  1RBR A;  1U45 A;  3U6F A;  1XI1 A;  3K5O A;  1JLG A;  3AVI A;  4EZ9 A;  3HT3 A;  1XWL A;  3P83 D;  4YNQ A;  1WSF A;  2IOC A;  3H08 A;  3P1G A;  4CF2 A;  5HBM A;  5SZT A;  3QES A;  2KFN A;  3VQ7 A;  4GMJ B;  3V6D A;  2HVH A;  1XC9 A;  1RT6 A;  1EXQ A;  2D0A A;  4ZHR A;  3QEV A;  2OYQ A;  4CJS A;  1ITG A;  3OYJ A;  4E1N A;  3NGI A;  4EZ6 A;  3V9X A;  1RCH A;  1JL1 A;  2Z1I A;  4HCC A;  1HMV A;  1RDB A;  1A5W A;  4H4O A;  1WAJ A;  3EZ5 A;  1XHX A;  2A1S A;  4AHT A;  1KSP A;  1VSE A;  3OYE A;  3ASM A;  3LWM A;  5CZ2 A;  3LZI A;  1TL3 A;  4CGI A;  4Z4H A;  3VQ5 A;  1S1V A;  4RW7 A;  1T8E A;  4CF0 A;  2Y1J A;  5DMR A;  5HLF A;  1TL1 A;  4FZY A;  4AIL C;  3DYA A;  3QLH A;  3OJU A;  4E7J A;  2OPQ A;  4KI6 A;  1HQU A;  4ELT A;  3O4Q A;  4Q5V A;  4CFA A;  2A1R A;  4CF9 A;  1C1A A;  1UA0 A;  4N76 A;  4IFY A;  1RTD A;  2WON A;  1TAQ A;  4BAC A;  3RRH A;  3KKS A;  2O4I A;  4DQI A;  4DQQ A;  3E01 A;  3NE6 A;  4DF8 A;  3AVC A;  3SV4 A;  1S9G A;  4M3Y A;  4C8N A;  4Z4C A;  3S3N A;  1WSE A;  3AVF A;  4DFP A;  3LAM A;  3TAE A;  1VSJ A;  3ZT4 A;  3WNF A;  1L3T A;  4OLB A;  4AHC A;  4CFB A;  3NH1 A;  1IO2 A;  2VG5 A;  1GOA A;  3HO1 A;  1WLJ A;  3I0R A;  3MED A;  4MFB A;  2LSN A;  3WNG A;  3V9Z A;  3OYI A;  3SZ2 A;  1LV5 A;  4ELV A;  4IFV A;  5SWM A;  3I0S A;  4OGE A;  3KJV A;  3LAK A;  3KTQ A;  1VSL A;  3OYN A;  3MXM A;  1RIL A;  4FJL A;  3OYA A;  4J2E A;  3AV9 A;  1YTU A;  1ASV A;  3ULD A;  3V9W A;  5C24 A;  5C42 A;  4CHZ A;  3M8S A;  3TAM A;  2X78 A;  2HHT A;  2P51 A;  1BQM A;  1BCM A;  4CIF A;  3OY9 A;  2E6L A;  3CM5 A;  4C8M A;  2HMI A;  4C8L A;  3C6U A;  4LH5 A;  3AVA A;  1KRP A;  2RNO A;  3CM6 A;  3DMJ A;  5FRO A;  4CK3 A;  2O4G A;  1ZYQ A;  2OZS A;  2DTU A;  1FKP A;  3VQE A;  3ZSZ A;  2ZQB A;  4FW1 A;  4FJ9 A;  4E7L A;  4EP5 A;  1VRU A;  4CEF A;  4KPY A;  2W42 A;  2YKN A;  1RT1 A;  4FJN A;  1J53 A;  3G0Z A;  5CZ1 A;  3VA3 A;  1SL0 A;  1L3U A;  4O4G A;  4FK0 A;  4FK2 A;  2FC0 A;  1KVA A;  4CHY A;  3OYF A;  3K5M A;  1NJZ A;  4CGH A;  4BE0 A;  2IAJ A;  4AHV A;  4G1Q A;  2XHB A;  3HPH A;  3LAL A;  1TK0 A;  1IKX A;  4B8C A;  3LPU A;  1YTA A;  3A2F A;  1HJR A;  3ZT2 A;  3NH2 A;  4JS4 A;  4CK1 A;  4DWI A;  3ISN C;  4FYD A;  3NAE A;  4AHU A;  1S5J A;  3VQQ A;  3TAB A;  3RTV A;  4E1M A;  4OKK A;  1SKR A;  4IKF A;  3JSM A;  1ZBU A;  3VQ6 A;  3LP0 A;  4I9Q A;  1D9F A;  3NBP A;  3L8B A;  1LWF A;  1VSD A;  2X6N A;  1RBU A;  4DLG A;  4ID1 A;  2YNG A;  4W5R A;  4O44 A;  4GW6 A;  5KRS A;  4CEB A;  1IKW A;  3S3M A;  4CED A;  1BGX T;  4HCB A;  1ASW A;  4MQ3 A;  3ZT0 A;  3SUO A;  4ZTF A;  3QIP A;  3LPT A;  1HQE A;  2OPR A;  4LD0 A;  4KI4 A;  2YHA A;  1ZBH A;  1HNV A;  3VQB A;  1W9H A;  3KKR A;  3HPG A;  4ID5 A;  3VQ9 A;  4KHY A;  3OYC A;  1A5X A;  3ZCM A;  4Z4I A;  3K2P A;  4DU4 A;  1QSL A;  4FJJ A;  1S1T A;  3VN5 A;  4DTS A;  3TAP A;  3NFA A;  4FCY A;  1IH7 A;  1BIU A;  1C0U A;  3U3G A;  4CHP A;  1QS4 A;  4B9U A;  1IG9 A;  2YNH A;  1I3A A;  1NOZ A;  2GBZ A;  4CJR A;  3SV3 A;  4E3S A;  3DOK A;  1KLN A;  2KVD A;  1VSM A;  4KB0 A;  4B3O A;  1SV5 A;  3IRX A;  3KIO A;  2RPI A;  4CJE A;  1SUQ A;  4DSJ A;  4FZZ A;  1UOC A;  5J2N A;  3RR7 A;  1R0A A;  4OPK A;  4M41 A;  3CFP A;  4OLA A;  4HVJ A;  3OYD A;  4H8K A;  4HHT A;  3HK2 A;  3RMD A;  3C95 A;  2X6S A;  1TGO A;  4DTR A;  1XHZ A;  4BE2 A;  4M3X A;  4KFB A;  2RN2 A;  3ZSW A;  3LP3 A;  4CJU A;  1VSH A;  3VQD A;  2HHS A;  2HHV A;  4KKO A;  4J2B A;  4M45 A;  4FLT A;  4DFJ A;  4KAZ A;  4TSX A;  3SUQ A;  4PUO A;  4CEQ A;  3OYM A;  3CFR A;  3BDP A;  2NUB A;  2JLE A;  3CYM A;  1J9A A;  2OZM A;  1D8Y A;  4KTQ A;  2VWJ A;  2KW4 A;  3NF6 A;  4CFC A;  3SNN A;  3OVN A;  4IBN A;  1SL2 A;  4DTM A;  1EET A;  4CEE A;  3AA4 A;  4LY7 A;  5J1E A;  4BDZ A;  1QTM A;  1HPZ A;  1JLA A;  4UQG A;  1KFS A;  3DI6 A;  3B6P A;  5K14 A;  3OS0 A;  3OS1 A;  3ALY A;  1SKS A;  3SQ4 A;  1RTJ A;  1RTH A;  1D9D A;  4B9N A;  4KB1 A;  4Z4E A;  1A5V A;  1U49 A;  1BIS A;  4E7I A;  3TAN A;  4CJF A;  4Z4G A;  1EKE A;  1S6Q A;  2JGU A;  5I42 A;  4KTW A;  1C0M A;  3LDS A;  2P5O A;  3TAQ A;  1D5A A;  4KHN A;  3OYB A;  2XY6 A;  4FJI A;  2OPS A;  1BHL A;  3DRP A;  4DSF A;  4J2A A;  3DLH A;  2F8T A;  2GV9 A;  2VG6 A;  3K58 A;  2G8F A;  2P5G A;  4JS5 A;  2HB5 A;  3LWL A;  2XO7 A;  4W5Q A;  1NK4 A;  1IKY A;  3QO9 A;  3LP1 A;  3AVG A;  4FJG A;  1FK9 A;  2Q3S A;  2ZD1 A;  1VSI A;  4I2Q A;  3RMA A;  4CHQ A;  4HUF A;  3HVT A;  3M8R A;  4BDP A;  3CFO A;  3VQA A;  3EY1 A;  2PYJ A;  5FRM A;  5J2P A;  3DLR A;  1CXU A;  3M8Q A;  1QSS A;  1B9F A;  3KK3 A;  4FLZ A;  1IKV A;  3MXJ A;  4HUG A;  5J2Q A;  4DSL A;  4B9L A;  1VSF A;  2RNN A;  1UWB A;  4CES A;  2IC3 A;  4CHN A;  3ZT3 A;  4JRQ A;  1HYZ A;  4KHQ A;  3AO5 A;  4CE9 A;  2DY4 A;  4FJK A;  1C1C A;  2X74 A;  4O5B A;  3G10 A;  3K57 A;  3CQ8 A;  4CJL A;  2XY7 A;  1L3S A;  4K8X A;  4CIE A;  3QNN A;  1N5Y A;  3RWU A;  5JS1 A;  3SUP A;  1HYS A;  4DF4 A;  4FM0 A;  4JRP A;  4PA1 A;  3HPO A;  4J2D A;  1C1B A;  4KHW A;  3AVH A;  4CEO A;  1S1U A;  1NK7 A;  4O0I A;  1TKT A;  4GVM A;  4N5S A;  4CJQ A;  3AVN A;  3ZSO A;  4B08 A;  3AO3 A;  1FKO A;  4CF8 A;  2XY5 A;  2Z1H A;  4N47 A;  1BCO A;  4KO0 A;  5HRR A;  3V1Q A;  3T3F A;  1DTT A;  4O55 A;  1NK8 A;  4CGG A;  4FJH A;  4CCH A;  5KTQ A;  1EP4 A;  3HVR A;  3KK2 A;  4OPJ A;  1JXB A;  4FLX A;  2D5R A;  1EX4 A;  1JLC A;  4W5T A;  2R7Y A;  4DTN A;  4E0D A;  3AVL A;  3NHG A;  4Q0B A;  1RT2 A;  2BAN A;  4M3Z A;  2G8H A;  3SJJ A;  1LWE A;  3O4N A;  1B9D A;  1RNH A;  1QE1 A;  3NDK A;  5CYM A;  1NK6 A;  2XRI A;  3C6T A;  2YNI A;  4DQR A;  3L2Q A;  3AVK A;  2Z1G A;  3DM2 A;  2OA8 A;  3NF9 A;  2KW9 A;  1Q9X A;  4DU1 A;  3QEP A;  3PUF A;  2G8I A;  1QSY A;  3P5J A;  3L2U A;  1GOC A;  1VSK A;  4DSK A;  3AVM A;  1RDD A;  4CK2 A;  1VRT A;  1U4B A;  2ATQ A;  3CG7 A;  3QEI A;  4NYF A;  1FXX A;  1X9S A;  3HST B;  1TKD A;  4UZW A;  3SYZ A;  2HNY A;  1V66 A;  5C25 A;  3OYL A; 
#chains in the Genus database with same CATH topology
 2O8E B;  4FLU A;  5D3G A;  1JL2 A;  5FPD A;  4BWM A;  1XQS C;  1Y97 A;  3TTF A;  1S6P A;  4DFK A;  3SQ2 A;  4U7B A;  5AQT A;  1NJI O;  3W3D A;  1K8A O;  2Q0U A;  1DGK N;  3HJF A;  3WNH A;  1Q8I A;  1Q86 O;  2HHU A;  5JLH A;  3DLE A;  1RTI A;  3NGY A;  1RDC A;  3DXK B;  2FSK A;  4BRC A;  1TV6 A;  4F3T A;  5E84 A;  3T1A A;  3SI6 A;  5AFU H;  3THV A;  4CZE A;  3PO5 A;  1SKW A;  3BY5 A;  3ZX0 A;  4FLW A;  2QK9 A;  4RW9 A;  4KHU A;  4CJV A;  3VEX A;  4C8K A;  3MN7 A;  4A5A A;  3LDL A;  1W0H A;  4FXD A;  3DJC A;  4BR7 A;  4FZX C;  3ENB A;  5HRN A;  5AQF A;  1ZS9 A;  4IDK A;  1RT4 A;  2KKZ A;  1QZ5 A;  2JVW A;  4F8R A;  1T7P A;  3ZSY A;  5E41 A;  3BGR A;  2HJQ A;  1NK5 A;  5CY4 A;  4BIT A;  3THY A;  4ICL A;  2ZJR L;  1ATR A;  4B9M A;  4RW6 A;  5GIN A;  4FJM A;  4QAG A;  2WOM A;  3ZT1 A;  1YHQ N;  1XNR K;  1JLF A;  5AQR A;  3T69 A;  1WSJ A;  2QWR A;  5T7B A;  1E3M A;  4J8F A;  3SPY A;  5AQJ A;  3T7Z A;  3J7Y P;  3AA2 A;  3B6O A;  3PO4 A;  1H9E A;  3R8E A;  2P9S A;  2G8V A;  1D4X A;  3DRS A;  1NGJ A;  3PSI A;  3OYH A;  2PZS A;  1ZBF A;  4JI4 K;  4CER A;  1VQN N;  4I7F A;  4NCG A;  3D45 A;  4H5T A;  3DLB A;  4QCL A;  3MEE A;  4FLV A;  3S3O A;  2OTL N;  1ASU A;  4BC2 A;  1E4F T;  3NH0 A;  4AHS A;  1WBD A;  1RGI A;  1TAU A;  2QWP A;  2FBV A;  3K59 A;  4NXM K;  3TPQ A;  3F5T A;  1JCG A;  3TTC A;  3O3F A;  3O9S A;  1MDU B;  3KD5 E;  4NXN K;  4OGC A;  1OH7 A;  3KD1 E;  1KAX A;  3QIO A;  4AH9 A;  3F2K A;  2QKK A;  3VEV A;  2HST A;  4KRF A;  3AY9 A;  2IDO A;  3EKU A;  4RWT A;  4HUE A;  2Y1I A;  4ZTJ A;  4EAH D;  2HVI A;  3VPZ A;  4FJ5 A;  3UIQ A;  4F3O A;  4C8O A;  1JLB A;  4KBO A;  1FJG K;  1NMN A;  4BRP A;  3MEG A;  3E66 A;  3ZX3 A;  4DTP A;  1LW0 A;  1I94 K;  4WE1 A;  2VWB A;  4CF1 A;  2F8S A;  2G8K A;  4E7K A;  2ZE2 A;  4QS7 A;  3UKR B;  4IG3 A;  3NVM A;  4A57 A;  1TVR A;  1H1J S;  3HL8 A;  5KGW A;  4CJ4 A;  1DTQ A;  3SMS A;  1TYQ A;  3WXM B;  3AO4 A;  4CJP A;  3O3G A;  3KLE A;  4HTU A;  1YI2 N;  4DTJ A;  3R9P A;  2ITG A;  4BE1 A;  1JXE A;  4M3R A;  1GLF O;  3DLK A;  2D0B A;  3E9O A;  4H0V B;  2I5J A;  3VF4 A;  3VGK A;  3KLG A;  4WYB A;  2P9I A;  2P9P B;  4EP4 A;  2B5J A;  2YKM A;  2B4J A;  1J54 A;  4H0Y B;  1VAZ A;  4CD1 A;  2NRW A;  1HNW K;  2Z1J A;  3QET A;  1LCU A;  3EEQ A;  4FVM A;  3VET A;  3C7N A;  1DLO A;  4B1Y B;  2P1J A;  3L2R A;  4CZM A;  4GVE A;  3OYK A;  4LH4 A;  4QOZ B;  4AM6 A;  5AQH A;  1XI1 A;  4LFA K;  3MX5 A;  4EZ9 A;  2RE2 A;  1QQO A;  1XWL A;  3P83 D;  4YNQ A;  1WSF A;  2IOC A;  4B3S K;  5HL7 L;  5GIP A;  2KFN A;  3VQ7 A;  1RT6 A;  3GOI A;  4DR6 K;  1XUP O;  2Q0R A;  3CET A;  3D2E A;  3V9X A;  4BC4 A;  2VYP A;  4WFB L;  4HCC A;  1NM1 A;  1XHX A;  2D1K A;  3LWM A;  4A61 A;  5M1O A;  4H5V A;  2ZM6 K;  4CZG A;  3MDQ A;  4PKI A;  1T8E A;  1TL1 A;  1O13 A;  3QDK A;  3DYA A;  4K25 A;  4CFA A;  4K41 A;  1C1A A;  3GG4 A;  1VQ7 N;  2FSN A;  3RRH A;  2F4V K;  3E01 A;  3AVC A;  3SV4 A;  1S9G A;  5KPT A;  3ZT4 A;  3WNF A;  1XC3 A;  4AHC A;  4Z94 A;  2VG5 A;  3A8Y A;  4DQ8 A;  1GOA A;  4IOX A;  4BR5 A;  5ELZ A;  2QWM A;  1ZBS A;  4ISE A;  3THY B;  4PL8 A;  2LSN A;  1LV5 A;  5SWM A;  4YDU A;  1VSL A;  3D2F A;  4PL7 A;  1XMQ K;  1ASV A;  1ESV A;  3ULD A;  3V9W A;  2ODC I;  3MWP A;  3TAM A;  3OBW A;  2P51 A;  3OY9 A;  2W51 A;  1H1V A;  4BRA A;  4C8L A;  3C6U A;  2P9S B;  3AVA A;  4LH5 A;  2A6A A;  3LM9 A;  5FRO A;  4H5W A;  3K9J A;  2O4G A;  4FOE A;  5AQK A;  3ZSZ A;  3BP8 A;  5AQX A;  1ZC6 A;  1W97 L;  4FJN A;  1RT1 A;  1J53 A;  3CMA N;  5JVH L;  4B1X B;  2FC0 A;  1KVA A;  3OYF A;  4B8C A;  4LF8 K;  2QW9 A;  1RDW X;  2QXL A;  4ILG B;  4CK1 A;  3U8X A;  4H5N A;  2UUA K;  4A59 A;  4E1M A;  3CCU N;  2O8F A;  3VQ6 A;  3QFU A;  3NBP A;  3J7A P;  1QHA A;  4DLG A;  4ID1 A;  3O4W A;  4W5R A;  4O44 A;  4GW6 A;  1P8Z A;  4CED A;  1BGX T;  1HX1 A;  3QIP A;  3LPT A;  1HQE A;  1OVY A;  2F9T A;  2PBD A;  1W9H A;  5AQS A;  2UU9 K;  4I6M A;  1WOQ A;  5AZI B;  3ZCM A;  4DR2 K;  1OVQ A;  1QSL A;  4X64 K;  4DTS A;  3MCA B;  4JK7 A;  3VTH A;  3TAP A;  1C0U A;  3HRG A;  4JI8 K;  1NOZ A;  4CZH A;  4KB0 A;  2YHY A;  1T44 A;  5GAH P;  5BN8 A;  4BC5 A;  3ULE A;  5AQP A;  4DTR A;  1XHZ A;  4BE2 A;  1TYQ B;  5FPE A;  3ZSW A;  2HHS A;  3L0O A;  4KKO A;  5EOY A;  4JHD A;  4BGA A;  4J2B A;  4KAZ A;  4PUO A;  4CZL A;  3OYM A;  3BDP A;  3LDO A;  2JLE A;  5LJV A;  3U9Z A;  4YOT A;  2F7T A;  3WEE A;  4CZK A;  2WTU A;  1SL2 A;  3OVN A;  3AAR A;  4BRF A;  1E7D A;  4UQG A;  1KFS A;  3DI6 A;  3OS0 A;  2P9I B;  2AA4 A;  2FLO A;  3ALY A;  1SKS A;  4OPA A;  1D9D A;  4BR4 A;  3BF3 A;  1A5V A;  4ISF A;  2Q2R A;  3H45 C;  4Z4G A;  2JGU A;  1Z05 A;  5I42 A;  4CZJ A;  1C0M A;  5EX5 A;  3LDS A;  1Y64 A;  2ZGZ A;  3AGR A;  5E26 A;  3VER A;  3C7N B;  4AM7 A;  2XY6 A;  4FJI A;  1BHL A;  3DRP A;  4DSF A;  4J2A A;  3DLH A;  2F8T A;  5AZJ B;  2VG6 A;  3K58 A;  2G8F A;  3G25 A;  3LWL A;  2XO7 A;  1IKY A;  3CI5 A;  4I2Q A;  4CHQ A;  3HVT A;  4BDP A;  3CFO A;  3EY1 A;  3OA9 A;  5M1P A;  5BPN A;  1B9F A;  4FLZ A;  4M7Y A;  5J2Q A;  4DSL A;  5JVG L;  4MDB A;  1VSF A;  2RNN A;  2IC3 A;  1NGF A;  3BZC A;  4GY2 B;  2DY4 A;  4BR2 A;  5FLX O;  1N32 K;  4DR5 K;  3HTV A;  4K8X A;  3M1F A;  3QNN A;  2O8E A;  4BC3 A;  3EL2 A;  4J2D A;  3LDQ A;  1C1B A;  3AVH A;  1S1U A;  1SAZ A;  4GVM A;  3AVN A;  3ZSO A;  4B08 A;  3AO3 A;  4E1J A;  2XY7 A;  3WXK A;  3T3F A;  1NK8 A;  2KFZ A;  4CVN E;  2D5R A;  2R7Y A;  2YJF A;  2ASM A;  4H0X B;  1KAZ A;  3KVG A;  3NHG A;  4Q0B A;  3CJC A;  5MLC Q;  5A2Q O;  2V51 B;  2WFB A;  2G8H A;  3SJJ A;  5KQD A;  3DXK A;  1QE1 A;  4JK9 A;  1NK6 A;  2XRI A;  3VF6 A;  3AVK A;  3PUF A;  3L2U A;  1VSK A;  4FWR A;  1RDD A;  1U4B A;  3CG7 A;  4NYF A;  1FXX A;  3BUZ B;  2UUC K;  3D2F B;  3SYZ A;  4WQ5 A;  1J6Z A;  3DRR A;  3SAF A;  1VQ6 N;  3N4P A;  4CJK A;  2V7Z A;  2RHK A;  4JKC A;  2RKI A;  4DR7 K;  1JCF A;  1QHT A;  3KLH A;  1CZ9 A;  4LF9 K;  4CJT A;  2GUI A;  3JYT A;  2IGI A;  5CR4 A;  1HUX A;  3JXU A;  2Q31 A;  4CGJ A;  4F2R A;  1I39 A;  2QXF A;  3RR8 A;  4JLH A;  1KTQ A;  4GV9 A;  4H03 B;  5CYQ A;  5AQG A;  1X9W A;  1CXQ A;  3VQP A;  1XMO K;  3ZSR A;  1UA1 A;  3LAN A;  2W6L A;  4Y1C A;  5HRS A;  4NCB A;  3EYZ A;  4Z4F A;  3KWI A;  4YDU C;  1GOB A;  2HBK A;  2VGM A;  2QNF A;  1NMD A;  3IAY A;  2O8F B;  3S9H A;  1YT3 A;  4B8A B;  4HTL A;  1NJW A;  4DV2 K;  4GV3 A;  5J2M A;  4E89 A;  4ILH A;  3D0P A;  3VA0 A;  5KPR A;  5HRO A;  2J4R A;  2FBX A;  1HYV A;  1TKX A;  3D7E O;  4JN4 A;  4DMN A;  1U6Z A;  4I6M B;  4N41 A;  1NOY A;  5BR9 A;  3G4S N;  4R5P A;  4KHS A;  2KHO A;  3ZSQ A;  5CIU A;  3VQC A;  3W0L A;  1NGD A;  4M3T A;  4B9T A;  4M3U A;  1BA1 A;  1BWF O;  3FR0 A;  2NRH A;  4KH4 A;  3ULE B;  2DFF A;  1Z26 A;  1LOT B;  3V9U A;  3KWG A;  1HR0 K;  4IG0 A;  3DOL A;  2DFH A;  4F2S A;  5KRT A;  3TR8 A;  1HRH A;  4JHD B;  5EVZ A;  1K6Y A;  3PX6 A;  2BE2 A;  3KLI A;  3WQT A;  3A5M C;  1LW2 A;  1SL1 A;  4DFM A;  4XH5 A;  2KZM A;  5F2R A;  3HM9 A;  4JI6 K;  3OS2 A;  3WXI A;  3L2W A;  4JAX A;  4PY5 A;  1RDA A;  3P39 A;  4PHT X;  4CHO A;  1NKE A;  1C6V A;  1BU6 O;  2E20 A;  2EHG A;  4FOI A;  4H0O A;  3VQ4 A;  3SQ0 A;  1G15 A;  4K8Z A;  5LMN K;  2D0C A;  1Z25 A;  3VF2 A;  2B6A A;  3CF5 L;  3LL3 A;  2UYT A;  2P9P A;  1REV A;  3LP2 A;  1GL9 B;  2A3Z A;  2E2P A;  3V1O A;  3TSQ A;  2HHH K;  4H0P A;  4I2P A;  1S22 A;  4YHH K;  3SCX A;  2IS3 A;  4ILJ A;  3ZET A;  3IDH A;  2GTD A;  3CCR N;  3RSE B;  5AR0 A;  4B9S A;  4XIU A;  4FM2 A;  1BDG A;  1GLD G;  4W5O A;  3TWH A;  4JI0 K;  4H4M A;  4KH6 A;  3V81 A;  1JJR A;  3T1Y K;  4XEI A;  1L5U A;  4DV7 K;  3CCE N;  4L8R B;  1YXQ A;  2KTQ A;  4CJ3 A;  4DR3 K;  3DLG A;  1YNS A;  3KK1 A;  3TAR A;  5KI6 A;  4B1W B;  2E1Z A;  3QIC A;  4B1Z A;  3DXM B;  5HP1 A;  4F4K A;  3QIN A;  4FJX A;  4MLE A;  4KV8 A;  1T03 A;  4FK4 A;  1YJ9 N;  2WBN A;  1LAW A;  3U6F A;  1NGA A;  3VMF B;  3HT3 A;  3H08 A;  5SZT A;  4CF2 A;  3QES A;  3MN6 A;  3CJ7 A;  3SMP A;  4GMJ B;  1VHX A;  2D0A A;  3QEV A;  2OYQ A;  2WUS A;  3NGI A;  2NRT A;  3CJB A;  4A62 A;  1JL1 A;  1RDB A;  4H4O A;  1GKU B;  2A1S A;  3IFR A;  1VSE A;  3ASM A;  5CZ2 A;  1TL3 A;  3Q7B A;  4Z4H A;  1VQO N;  4CF0 A;  3CJ9 A;  5DMR A;  3ZLJ A;  4AIL C;  2OPQ A;  1TUU A;  3LDN A;  4ELT A;  4K43 A;  4N76 A;  1WUA A;  4IFY A;  1RTD A;  3I55 N;  1TAQ A;  1NGG A;  2DK4 A;  4DQI A;  2IVO A;  2O8B A;  4C8N A;  4JV5 K;  3TAE A;  2JWL A;  4GKK K;  2HBJ A;  3FZL A;  5IWA K;  1EO1 A;  3U9D A;  3HO1 A;  2O8D A;  1WLJ A;  4BGB A;  3OYI A;  4FJL A;  3MXM A;  3OYN A;  1NGB A;  1RIL A;  2NZT A;  5C24 A;  2X78 A;  3SBG A;  1BQM A;  3CM5 A;  3O5B A;  2NRX A;  1YUW A;  3KZB A;  4ISG A;  2KLA A;  5AZI A;  3CM6 A;  3DMJ A;  2HBL A;  4CK3 A;  2OZS A;  2ZQB A;  4JK8 A;  4KPY A;  3BZK A;  3PIO L;  2E2N A;  4FK0 A;  2CH6 A;  4CHY A;  1NWK A;  4CD3 A;  4O8K A;  3O9U A;  2XHB A;  3HPH A;  5AQL A;  2GWK A;  1YTA A;  2MPH A;  1HJR A;  3QFP A;  3NH2 A;  4DWI A;  4CBW A;  1S5J A;  5M1Q A;  3RTV A;  3JSM A;  3CIP A;  4L3Q A;  1D9F A;  1LWF A;  1VSD A;  2X6N A;  3SAG A;  1RBU A;  4OO1 J;  5GIO A;  1Y02 A;  3LLR A;  4CEB A;  5BRF A;  1OKJ A;  4KI4 A;  1HNV A;  2FXU A;  4ID5 A;  3VQ9 A;  4IJN A;  4KHY A;  2VQE K;  3QB0 A;  1NGC A;  4FVU A;  2QA4 N;  4FJJ A;  1S1T A;  3NFA A;  1IH7 A;  1BIU A;  3U3G A;  4B9U A;  4CHP A;  2QWN A;  1I3A A;  5AZJ A;  1KLN A;  2GBZ A;  3DOK A;  3R1X A;  1SV5 A;  3IRX A;  3ZX2 A;  4FWL A;  2ZJP L;  5J2N A;  3ZET B;  3RR7 A;  1R0A A;  1IV0 A;  4OPK A;  4HVJ A;  3OYD A;  2CGJ A;  3HK2 A;  4MLH A;  3KK7 A;  3C95 A;  1TGO A;  1YIJ N;  3LP3 A;  4CJU A;  2QTD A;  1VSH A;  4JNE A;  3WXL A;  4FLT A;  5BR8 K;  3PLA A;  4CEQ A;  5AQM A;  4O5F A;  3M6G A;  2KW4 A;  3CQX A;  4JI1 K;  4IBN A;  3J81 O;  1IBL K;  5CHI A;  1Q81 O;  4CEE A;  1JCE A;  3AA4 A;  4BDZ A;  3CCQ N;  1RDU A;  1HPZ A;  1YJN N;  4DHY A;  1HNZ K;  5K14 A;  5C2D A;  3OS1 A;  2QWO A;  1RTJ A;  2GWJ A;  4E7I A;  3TAN A;  1EKE A;  4KTW A;  5LY3 A;  2P5O A;  3TAQ A;  1D5A A;  4KHN A;  3OYB A;  1ATN A;  3QML A;  2HB5 A;  1NK4 A;  4W5Q A;  3QKJ A;  3QO9 A;  4MDA A;  5C15 A;  5ADX A;  4HUF A;  1QQN A;  4LC9 B;  4CW7 B;  2NRR A;  5H1S Q;  2PYJ A;  2F9W A;  4IO8 A;  3VGL A;  3KK3 A;  1UWB A;  1BUP A;  4FJK A;  1L3S A;  3K9K A;  1K9M O;  4CIE A;  5JS1 A;  1Q18 A;  4PA1 A;  2LC3 A;  4C1N I;  4NLB A;  4LF5 K;  1TKT A;  3MN5 A;  4CF8 A;  2Z1H A;  3V1Q A;  1VQ4 N;  5EY4 A;  1DTT A;  4O55 A;  4CCH A;  1EN7 A;  1JXB A;  4OPJ A;  4FLX A;  3DWL A;  3OBY A;  5BRE A;  2O8B B;  3L6Q A;  1MWM A;  4DCH A;  3FLG A;  3O9R A;  3CCS N;  1B9D A;  1RNH A;  3QBX A;  2KW9 A;  1HJO A;  4JKH A;  2CGK A;  4H0T B;  5M1F A;  2G8I A;  2O8D B;  4U67 L;  3CCL N;  1VRT A;  2NNW A;  2W41 A;  4DR4 K;  2A42 A;  2ATQ A;  4DUY K;  4IDH A;  1TKD A;  1X9S A;  4UZW A;  2QEX N;  3UE5 A;  1KHC A;  1V66 A;  3VES A;  3GE1 A;  1A8V A;  4OVL A;  1NK9 A;  3MMV A;  1KVC A;  1N34 K;  1MU2 A;  3L3U A;  1N8R O;  5KGX A;  1Q9Y A;  1K73 O;  2P9L A;  4BDY A;  3R3L A;  1KD1 O;  2E5L K;  2P9K A;  3G71 N;  1UAX A;  5LJW A;  3QEX A;  5FRN A;  3FZH A;  4Y1D A;  3GDQ A;  4O0J A;  4OKE A;  3E9L A;  5BRD A;  2ITM A;  2A40 A;  1CLQ A;  4YOU A;  1RBV A;  3O9Q A;  1BG3 A;  2BUP A;  3M8P A;  1J5O A;  4DUZ K;  2ASP A;  1RT3 A;  2EWS A;  3BEX A;  4FW2 A;  2PAV A;  4YOV A;  3AGK A;  1EQY A;  3AAQ A;  3F9K A;  1WN7 A;  4RG8 A;  3NCI A;  3N4Q A;  5GAE P;  1RT7 A;  5JLF A;  4YY3 K;  3HP6 A;  3L4Q A;  1TKZ A;  1WSH A;  1BI4 B;  1GLC G;  1VK0 A;  4WFA L;  4RW4 A;  2F96 A;  2GEL A;  1Q7Y O;  1KXP A;  4NYN A;  3MEC A;  5HRP A;  3LZJ A;  2P9U A;  5AQN A;  1E7L A;  2HHQ A;  4CZI A;  3WNE A;  4FJ8 A;  3JS6 A;  3MAQ A;  5I3U A;  4LFB K;  4DSI A;  3CHW A;  4K42 A;  3T1H K;  4CJW A;  3THW B;  4X65 K;  1NK0 A;  5DK5 A;  3TAF A;  3H1V X;  2VG7 A;  1S72 N;  3F73 A;  2ODG C;  3QNO A;  4CEA A;  3NGZ A;  1NJX A;  4JI5 K;  4AQY K;  1BL3 A;  2A8V A;  2QKB A;  1QVG M;  4CEC A;  3RSE A;  4DQP A;  2ETJ A;  3HXM A;  4NO7 A;  3G6E N;  4CGD A;  3UB5 A;  4I9L A;  2FF6 A;  4EFH A;  4DSE A;  5BPL A;  2QM1 A;  3P4I A;  3RMC A;  2BH1 A;  3NF7 A;  3CD6 N;  3RMB A;  3TSP A;  4YOX A;  3OJS A;  4IO9 L;  3OYG A;  4DTX A;  1KAY A;  3VOV A;  1U04 A;  1GLJ O;  5JS2 A;  3AO2 A;  1N33 K;  4FM1 A;  3DXM A;  3J8A A;  1CZB A;  1L3V A;  4OJR A;  3MK6 A;  2E6M A;  4DV0 K;  2H3G X;  4IZ9 A;  2BDP A;  1U47 A;  3F9M A;  3MXI A;  4W5N A;  2KVU A;  3EO3 A;  2A5X A;  4M42 A;  4PWD A;  2OPP A;  3RVC A;  3SQ1 A;  1WSG A;  1BOT O;  2OCE A;  3CC4 N;  2UXD K;  4KTZ A;  1RBT A;  1LWC A;  4BRL A;  2RF2 A;  1QQC A;  4LSL A;  5DM6 L;  2OTJ N;  1E4G T;  2HND A;  3PX4 A;  2FBT A;  4FJ7 A;  4B3T K;  1CZA N;  4CEZ A;  3NF8 A;  3TU5 A;  2V52 B;  3ZSV A;  1V4T A;  3CC7 N;  1JLQ A;  4B9V A;  2KFV A;  3C65 A;  1C0T A;  2Q36 A;  1C0G A;  2VWK A;  2YV0 X;  4C1N K;  2BGG A;  2BTF A;  2E88 A;  1JLG A;  3AVI A;  3I56 N;  2P9L B;  1VQM N;  4LF4 K;  3LDP A;  3V6D A;  2HVH A;  3WT0 A;  2P9K B;  1TUY A;  1EXQ A;  1XC9 A;  4ZHR A;  1ITG A;  4E1N A;  2CH5 A;  1RCH A;  1HMV A;  1A5W A;  4M63 C;  3QBW A;  3EZ5 A;  1KSP A;  5FPM A;  3OYE A;  3H3O B;  4CGI A;  3H1Q A;  5M1N A;  5HLF A;  2Y1J A;  2NRV A;  4FZY A;  3I33 A;  3O08 A;  1FW6 A;  3P31 A;  3QLH A;  4E7J A;  1HQU A;  1JJ2 M;  3O4Q A;  4Q5V A;  1YJW N;  3O9T A;  4CF9 A;  4DQQ A;  5IT9 O;  4IOA L;  3NE6 A;  4BRM A;  3C6A A;  4Z4C A;  3CJA A;  4DFP A;  3LAM A;  1VSJ A;  4CFB A;  3NH1 A;  1WBB A;  3ZEU B;  3GL1 A;  3H6E A;  4FPB A;  4WF9 L;  3VEN A;  3SBT A;  3EN9 A;  3L0Q A;  2YJE A;  1X3M A;  3I0R A;  3WNG A;  3SZ2 A;  2YX6 A;  4IFV A;  3I0S A;  3KJV A;  3LAK A;  4JKB A;  1SS6 A;  5C42 A;  2P9U B;  2HHT A;  4CIF A;  1BCM A;  3EE8 A;  2E6L A;  1N36 K;  2HMI A;  1OH5 A;  2RNO A;  3O8M A;  4FWM A;  2DTU A;  1FKP A;  4BRO A;  2D4W A;  1HNX K;  4FJ9 A;  4BRI A;  3K0S A;  2W42 A;  5CZ1 A;  3VA3 A;  4FK2 A;  3K5M A;  4CGH A;  3VEZ A;  4AHV A;  3LAL A;  1GLE G;  5ADX H;  3ZT2 A;  1XNQ K;  3ISN C;  3NAE A;  3IMX A;  1VQ9 N;  4IKF A;  1QQM A;  3S41 A;  4I9Q A;  3L8B A;  4A5B A;  2YNG A;  4WCE L;  5KRS A;  3S3M A;  4CBX A;  5DM7 L;  5BN9 A;  1VQ8 N;  3ZT0 A;  3SUO A;  2GX9 A;  3WUH A;  2D0P A;  2VGN A;  4YOR A;  3MN9 A;  5BPM A;  2JWK A;  4IXC A;  4Z4I A;  1R59 O;  4YOY A;  3VN5 A;  3EE9 A;  1IG9 A;  4CJR A;  3I8B A;  1NGE A;  4BR0 A;  4LFC K;  1VSM A;  3KIO A;  2QWL A;  4DSJ A;  4DKW A;  4OLA A;  4H8K A;  3RMD A;  1HKC A;  3ID6 A;  4M3X A;  3ATV A;  3A0I X;  2RN2 A;  3LM2 A;  1WB9 A;  3VQD A;  2OAN A;  3ATU A;  2P9N A;  2HHV A;  5BRH A;  4JKG A;  4TSX A;  3SUQ A;  2W40 A;  4QS8 A;  4A2A A;  3CYM A;  5AQV A;  3IUC A;  4CFC A;  3SNN A;  4DTM A;  4DV4 K;  1GLA G;  5J1E A;  1QTM A;  4DR1 K;  3B6P A;  1HKB A;  4KB1 A;  1GLL O;  1Z6R A;  1U49 A;  1BIS A;  4CJF A;  1S6Q A;  3A5O C;  2YI1 A;  1KQS M;  3VEW A;  4WQ5 C;  3TTD A;  1W2B M;  4JKD A;  1A63 A;  4JS5 A;  3LP1 A;  3AVG A;  3THX B;  4FJG A;  1FK9 A;  5AJ3 K;  2VCP A;  1VSI A;  3RMA A;  4BRG A;  1GJJ A;  4BRK A;  5FRM A;  5J2P A;  3DLR A;  1SZ2 A;  1QSS A;  1IKV A;  4HUG A;  2W6K A;  4B9L A;  4CHN A;  4KHQ A;  1RFQ A;  3AO5 A;  1EWQ A;  2ZWH A;  3G10 A;  4CJL A;  3RWU A;  4FM0 A;  4JRP A;  4CEO A;  3H46 O;  2ZJQ L;  4O0I A;  4CJQ A;  1FKO A;  2XY5 A;  3M5R A;  1BCO A;  3CER A;  5HRR A;  1M1K O;  2O8C A;  4FJH A;  1NLV A;  3HVR A;  1EX4 A;  4W5T A;  4E0D A;  3FLC O;  5LL6 Z;  5GAG P;  1RT2 A;  4CI6 A;  3CME N;  5C10 A;  3UKU B;  1DKG D;  3NDK A;  5CYM A;  3C6T A;  3L2Q A;  2OA8 A;  4BQZ A;  3QEP A;  3MWT A;  3P5J A;  1GOC A;  4R79 A;  4DSK A;  5B8H A;  3QEI A;  3HST B;  2HOE A;  4FWQ A;  2HNY A;  3ENO A;  5C25 A;  1VQL N;  4Z0U A;  1JKH A;  3HSC A;  4LF6 K;  3MCP A;  1BO5 O;  1C0F A;  2E1Y A;  4BG8 A;  1MA9 B;  4DS4 A;  3NMU A;  3ITH A;  3V4I A;  1KLM A;  4DTO A;  3C6H A;  3ZSX A;  2KZZ A;  4N56 A;  3CXC M;  1BI4 A;  3PSF A;  4CJ5 A;  1DEJ A;  4WQ4 A;  1A62 A;  4OPH A;  4NB4 A;  5AQQ A;  2AJQ A;  3QER A;  4CIG A;  5GAD P;  1YVN A;  1IJJ A;  1HNI A;  1WSI A;  4CGF A;  2FBY A;  4YFU A;  3PY8 A;  2LD7 A;  1WNS A;  3THW A;  2HF3 A;  3HM8 A;  4B1U B;  5I9E B;  4LF7 K;  1W7A A;  1U2V A;  2E2Q A;  1BQN A;  2I7P A;  2KVE A;  3L2V A;  3SK3 A;  3AA3 A;  3FFI A;  5FDL A;  3SAH A;  2A41 A;  1TK8 A;  3MX2 A;  4RW8 A;  2HW3 A;  5C12 A;  4NCA A;  4DU3 A;  2QNC A;  3K5L A;  3IKM A;  2YHX A;  3NVK A;  4M7X A;  4DS5 A;  3TAG A;  1OH8 A;  3V1R A;  5EU7 A;  1N6Q A;  4GV6 A;  4C23 A;  4E7H A;  1O1W A;  4KRE A;  4DTU A;  4RCH A;  3AA5 X;  3VQ8 A;  3FZK A;  3DLL L;  2YHB A;  2YNF A;  2UXC K;  1F21 A;  3WXJ A;  4IWV A;  4JKE A;  2ZGY A;  4JI2 K;  3SUN A;  1T05 A;  3P38 A;  4BWJ A;  3L4I A;  4IEI A;  5AQI A;  2GUP A;  3A5N C;  3AVJ A;  1RBS A;  1WAF A;  3VTI A;  2NRZ A;  1NG9 A;  2P9N B;  1YVU A;  4JKG B;  3L3V A;  4FWK A;  4O8U A;  1VQP N;  2E2O A;  2PYL A;  3SPZ A;  3AAP A;  4JD2 A;  4DV5 K;  4BY9 C;  4LSN A;  1BIZ A;  3ID8 A;  3O3H A;  1NNE A;  1YAG A;  1SQK A;  1NJY A;  1X9M A;  5EXW A;  4DQS A;  1LAV A;  1ATS A;  4GKJ K;  4JKA A;  2UXB K;  4DG1 A;  4GNI A;  3RRG A;  1ZBL A;  1VQK N;  2E4L A;  3BF1 A;  1X1P A;  2EX3 A;  4DLE A;  3IG1 A;  1MWK A;  3CPE A;  3I8D A;  5AQZ A;  2GEM A;  4E19 A;  1NKB A;  2HHX A;  4QS9 A;  3SJH A;  1IBK K;  2WQG A;  1ZBI A;  1S1X A;  3HYF A;  4HWI A;  4M3W A;  3T19 A;  3AO1 A;  5AFU A;  4XH4 A;  4FLY A;  1S9E A;  1ZXO A;  4OKJ A;  4BRD A;  3OW2 M;  1V4S A;  4WFN L;  1J5E K;  4AHR A;  3AVB A;  4FPA A;  2PY5 A;  2G8U A;  1B92 A;  2XY8 A;  3Q7C A;  1YIT N;  2HNZ A;  1JLE A;  4B3R K;  3IS9 A;  5FPN A;  3TSU A;  4PQU A;  1S1W A;  4A2B A;  3OTO K;  5CE3 A;  2WC9 A;  1NKC A;  1KFD A;  4CFD A;  3U4L A;  2G80 A;  2O8C B;  2KQ2 A;  4IFE A;  1TK5 A;  1OH6 A;  3KLF A;  3TI0 A;  2D0O A;  3PX0 A;  1JEQ A;  3EZW A;  2DFE A;  3PV8 A;  3E1Y A;  1RT5 A;  1HKG A;  3U3Y A;  4ELU A;  4PKG A;  2HHW A;  1KCF A;  2Q97 A;  5LMU K;  3PIP L;  3V9S A;  4UY8 O;  4XH1 A;  2YCH A;  4YOW A;  3QEW A;  3FGU A;  2AP1 A;  2G8W A;  2FF3 B;  5AQY A;  3HP9 A;  1DT9 A;  3EKS A;  4MO5 A;  1KVB A;  1IBM K;  4G9Z A;  4BRE A;  3C94 A;  4BRH A;  5KPZ A;  3K5N A;  1U48 A;  1RBR A;  1U45 A;  2YHW A;  3K5O A;  3ZEU A;  3P1G A;  2ZF5 O;  5HBM A;  3J80 O;  4CJS A;  3OYJ A;  3FE1 A;  3VEO A;  4EZ6 A;  3GBT A;  2Z1I A;  2HF4 A;  5JMV A;  4KHP K;  1JEI A;  1WAJ A;  4AHT A;  3LZI A;  4JI7 K;  3D6R A;  3OHR A;  5AQW A;  3VQ5 A;  1S1V A;  4IEE A;  4RW7 A;  3ENH A;  3VEY A;  3OJU A;  4KI6 A;  1U2V B;  2A1R A;  1UA0 A;  1VQ5 N;  3FZM A;  2WON A;  4BAC A;  2O4I A;  3KKS A;  3J7Z O;  4DF8 A;  4M3Y A;  1K8K A;  4DV3 K;  3S3N A;  1WSE A;  3AVF A;  1L3T A;  4OLB A;  1H9F A;  3CCM N;  4WQ4 C;  1IO2 A;  4MO4 A;  1QZ6 A;  3CPW M;  3CCJ N;  3MED A;  4MFB A;  3V9Z A;  4ELV A;  4OGE A;  3KTQ A;  2VQF K;  4CJ7 A;  3D2E B;  1NU0 A;  3OYA A;  4J2E A;  3AV9 A;  1YTU A;  4AF1 A;  1NGI A;  4B1V A;  4CHZ A;  3M8S A;  4EIA A;  4EHU A;  4C8M A;  1T6C A;  1KRP A;  1G99 A;  1ZYQ A;  1M90 O;  3VQE A;  3HOT A;  4FW1 A;  1P90 A;  4E7L A;  4EP5 A;  1VRU A;  4CEF A;  3C0B A;  2YKN A;  1HLU A;  3G0Z A;  1L3U A;  1SL0 A;  4O4G A;  4JEP A;  1NJZ A;  4BE0 A;  1IG8 A;  2IAJ A;  4FWP A;  4JD2 B;  4G1Q A;  5C2F A;  1TK0 A;  1IKX A;  3LPU A;  3A2F A;  3DAW A;  2IIR A;  4JS4 A;  4FYD A;  3O1W A;  4AHU A;  4F9O A;  3VQQ A;  3TAB A;  4OKK A;  1SKR A;  4BG9 A;  1ZBU A;  4V19 S;  4RTF D;  3LP0 A;  4X62 K;  2DPN A;  3O80 A;  1NGH A;  3ZYY X;  1IKW A;  3FZF A;  1KC8 O;  4HCB A;  1ASW A;  4MQ3 A;  5JIC A;  5F1X A;  4ZTF A;  4Y0W A;  4FSV A;  5F0X A;  2OPR A;  4LD0 A;  2UUB K;  2YHA A;  5HOO A;  1ZBH A;  4X66 K;  2IVN A;  3SLC A;  3KKR A;  4FWN A;  3HPG A;  3VQB A;  3OYC A;  1A5X A;  3H3N O;  2Q1N A;  3K2P A;  4DU4 A;  1ILY A;  3FFK B;  5M1K A;  3O6W A;  4IJA A;  4FCY A;  3HOS A;  4FL9 A;  1QVF M;  1QS4 A;  1BA0 A;  2YNH A;  3SV3 A;  4E3S A;  4IOC L;  2KVD A;  4B3O A;  2RPI A;  4CJE A;  1SUQ A;  4FZZ A;  1UOC A;  3THX A;  4M41 A;  3CFP A;  4HHT A;  1GLB G;  1S3X A;  2X6S A;  4FO0 A;  4KFB A;  3CCV N;  4PKH A;  4BRN A;  1T6D A;  4KH5 A;  4BRQ A;  4M45 A;  4DFJ A;  5TKY A;  3B8A X;  3CFR A;  2NUB A;  3CJ1 A;  3E9P A;  1J9A A;  2OZM A;  1D8Y A;  4KTQ A;  2VWJ A;  3NF6 A;  1NBW A;  2QI2 A;  1EET A;  4LY7 A;  1JLA A;  4Z4E A;  3SQ4 A;  1RTH A;  4B9N A;  1EWR A;  5TKW A;  4CZF A;  5KQ8 A;  3HBT A;  4BR9 A;  4JYA K;  2OPS A;  4DV1 K;  3CQY A;  1YF5 L;  5AQU A;  2GV9 A;  1HPM A;  4FWO A;  2P5G A;  3VGM A;  3R6M A;  3UKU A;  2Q3S A;  2ZD1 A;  2FSJ A;  4H5R A;  3M8R A;  3VQA A;  4JI3 K;  1CXU A;  3M8Q A;  1X9J A;  3MXJ A;  4DB3 A;  4B3M K;  4JRQ A;  4CES A;  3ZT3 A;  1HYZ A;  4EHT A;  4CE9 A;  3UKR A;  1C1C A;  2X74 A;  4O5B A;  3WEE B;  2PFU A;  4BQL A;  5C0Y A;  3K57 A;  3CQ8 A;  2IVP A;  1N5Y A;  2QWQ A;  4BVO A;  3SUP A;  1HYS A;  4OX9 K;  4DF4 A;  3A5L C;  1Q82 O;  3HPO A;  2V7Y A;  4KHW A;  1NK7 A;  4NLC A;  2I7N A;  4N5S A;  4N47 A;  4KO0 A;  2HMP A;  2CGL A;  4CGG A;  3M3Z A;  1EP4 A;  5KTQ A;  3KK2 A;  4DTN A;  1JLC A;  3WQU A;  3AVL A;  3KHY A;  4K0K K;  2BAN A;  4M3Z A;  3CC2 N;  1K8K B;  3O1B A;  1LWE A;  3O4N A;  2YNI A;  4DQR A;  4JKF A;  2ASO A;  1T3V A;  2Z1G A;  3DM2 A;  3HI0 A;  1X3N A;  3NF9 A;  1Q9X A;  2E8A A;  4DU1 A;  1QSY A;  2HBM A;  3JAM O;  3AVM A;  3HZ6 A;  4CK2 A;  4DV6 K;  2NLX A;  4CBU A;  4B9Q A;  5AQO A;  4BVP A;  4FWS A;  3OYL A; 
#chains in the Genus database with same CATH homology
 4Z0U A;  1JKH A;  4OVL A;  1NK9 A;  3DRR A;  1T7P A;  4FLU A;  5D3G A;  1KVC A;  4CJK A;  1JL2 A;  1MU2 A;  2RKI A;  4BWM A;  1QHT A;  3L3U A;  3KLH A;  3ITH A;  4DS4 A;  3V4I A;  1KLM A;  1CZ9 A;  5KGX A;  1Y97 A;  3ZSX A;  4DTO A;  1Q9Y A;  2KZZ A;  4CJT A;  2GUI A;  4N56 A;  1BI4 A;  1S6P A;  2IGI A;  3JYT A;  4CJ5 A;  4BDY A;  4DFK A;  3SQ2 A;  1UAX A;  4CGJ A;  4F2R A;  1I39 A;  2QXF A;  3QEX A;  3RR8 A;  4JLH A;  5FRN A;  3HJF A;  2AJQ A;  3WNH A;  4Y1D A;  1Q8I A;  1KTQ A;  2HHU A;  3QER A;  4CIG A;  5CYQ A;  4O0J A;  1X9W A;  1CXQ A;  3VQP A;  1HNI A;  4OKE A;  3DLE A;  1RTI A;  1WSI A;  3NGY A;  1RDC A;  3ZSR A;  4CGF A;  2FBY A;  1UA1 A;  4YFU A;  3LAN A;  1CLQ A;  1TV6 A;  1RBV A;  4Y1C A;  3PY8 A;  3T1A A;  4F3T A;  5HRS A;  3M8P A;  3SI6 A;  1WNS A;  3EYZ A;  3THV A;  3PO5 A;  1J5O A;  4NCB A;  4Z4F A;  1SKW A;  4FLW A;  1GOB A;  2QK9 A;  3IAY A;  1RT3 A;  3S9H A;  4RW9 A;  4FW2 A;  1YT3 A;  1BQN A;  4CJV A;  4KHU A;  2KVE A;  4B8A B;  3L2V A;  4C8K A;  3AA3 A;  1NJW A;  3FFI A;  1W0H A;  3F9K A;  4FXD A;  4FZX C;  1WN7 A;  5FDL A;  5HRN A;  4RG8 A;  4E89 A;  5J2M A;  4IDK A;  3NCI A;  1TK8 A;  3D0P A;  4RW8 A;  2HW3 A;  4NCA A;  3VA0 A;  1RT4 A;  1RT7 A;  4DU3 A;  3K5L A;  5HRO A;  2JVW A;  4F8R A;  2FBX A;  1HYV A;  1TKX A;  3ZSY A;  4DS5 A;  3V1R A;  5EU7 A;  3TAG A;  5E41 A;  1N6Q A;  3BGR A;  3HP6 A;  4DMN A;  1NK5 A;  5CY4 A;  1TKZ A;  1O1W A;  4BIT A;  1BI4 B;  1VK0 A;  1WSH A;  4E7H A;  4N41 A;  4KRE A;  4ICL A;  4DTU A;  1NOY A;  4RW4 A;  4B9M A;  4RW6 A;  2F96 A;  3VQ8 A;  3AA5 X;  4FJM A;  2YHB A;  4QAG A;  2WOM A;  3ZT1 A;  2YNF A;  1JLF A;  4R5P A;  4NYN A;  3MEC A;  5HRP A;  1F21 A;  4KHS A;  3LZJ A;  1WSJ A;  3ZSQ A;  3VQC A;  5T7B A;  3SUN A;  3SPY A;  4M3T A;  1T05 A;  4B9T A;  4M3U A;  2HHQ A;  4BWJ A;  3WNE A;  3AA2 A;  4FJ8 A;  3B6O A;  3MAQ A;  2DFF A;  5I3U A;  3PO4 A;  1Z26 A;  3V9U A;  4DSI A;  3AVJ A;  4IG0 A;  4CJW A;  3DOL A;  1RBS A;  2DFH A;  2G8V A;  4F2S A;  3DRS A;  5KRT A;  1WAF A;  3TR8 A;  1NK0 A;  3OYH A;  1HRH A;  1YVU A;  2PZS A;  1ZBF A;  3L3V A;  4CER A;  1K6Y A;  4I7F A;  5DK5 A;  2BE2 A;  3TAF A;  3PX6 A;  2VG7 A;  4NCG A;  3D45 A;  3KLI A;  3F73 A;  3QNO A;  2PYL A;  3DLB A;  4CEA A;  3NGZ A;  4QCL A;  1NJX A;  3MEE A;  1LW2 A;  3SPZ A;  1BL3 A;  4FLV A;  4DFM A;  1SL1 A;  2KZM A;  4LSN A;  1BIZ A;  3S3O A;  2QKB A;  1ASU A;  3HM9 A;  3O3H A;  3NH0 A;  4CEC A;  3OS2 A;  4AHS A;  3L2W A;  1TAU A;  1NJY A;  1X9M A;  2FBV A;  3K59 A;  4DQS A;  1LAV A;  4PY5 A;  1RDA A;  4DQP A;  4CHO A;  1NKE A;  1C6V A;  3O3F A;  2ETJ A;  4DG1 A;  3KD5 E;  4OGC A;  3KD1 E;  3HXM A;  3RRG A;  3QIO A;  2EHG A;  1ZBL A;  2E4L A;  4AH9 A;  4CGD A;  1X1P A;  2QKK A;  2EX3 A;  4DLE A;  3IG1 A;  4I9L A;  4KRF A;  3I8D A;  3VQ4 A;  2IDO A;  4HUE A;  4E19 A;  2Y1I A;  3SQ0 A;  4ZTJ A;  1G15 A;  1NKB A;  2HHX A;  4DSE A;  2HVI A;  4K8Z A;  4FJ5 A;  3UIQ A;  2D0C A;  3RMC A;  3NF7 A;  4C8O A;  4F3O A;  3RMB A;  1JLB A;  2WQG A;  1Z25 A;  3OJS A;  2B6A A;  3OYG A;  4DTX A;  1ZBI A;  1S1X A;  3HYF A;  1REV A;  3MEG A;  4M3W A;  1U04 A;  3T19 A;  4DTP A;  1LW0 A;  3AO1 A;  3LP2 A;  5JS2 A;  3AO2 A;  4WE1 A;  4FLY A;  1S9E A;  4FM1 A;  4OKJ A;  3V1O A;  1CZB A;  4CF1 A;  2F8S A;  2G8K A;  1L3V A;  4I2P A;  4E7K A;  2ZE2 A;  3AVB A;  4OJR A;  4AHR A;  2PY5 A;  2E6M A;  2G8U A;  1B92 A;  2XY8 A;  2BDP A;  4IG3 A;  2HNZ A;  3SCX A;  1JLE A;  2IS3 A;  3MXI A;  1U47 A;  4W5N A;  3IS9 A;  1TVR A;  1H1J S;  3HL8 A;  1S1W A;  4PQU A;  5KGW A;  2KVU A;  4CJ4 A;  1NKC A;  2KFZ A;  1KFD A;  4B9S A;  1DTQ A;  4CFD A;  4XIU A;  4M42 A;  4PWD A;  4FM2 A;  2OPP A;  4W5O A;  3TWH A;  3AO4 A;  4H4M A;  4CJP A;  3O3G A;  3KLE A;  4HTU A;  3SQ1 A;  1WSG A;  2KQ2 A;  4DTJ A;  3V81 A;  1TK5 A;  3KLF A;  3TI0 A;  2ITG A;  1JJR A;  3PX0 A;  4BE1 A;  1JXE A;  4M3R A;  1JEQ A;  1L5U A;  4KTZ A;  2DFE A;  1RBT A;  3DLK A;  2D0B A;  3PV8 A;  1LWC A;  4L8R B;  1RT5 A;  2I5J A;  3U3Y A;  4ELU A;  2KTQ A;  2RF2 A;  1QQC A;  4CJ3 A;  3KLG A;  3DLG A;  4LSL A;  3KK1 A;  3TAR A;  4EP4 A;  5KI6 A;  2B5J A;  2HND A;  3PX4 A;  2HHW A;  2YKM A;  1KCF A;  2B4J A;  1J54 A;  3V9S A;  2Z1J A;  3QET A;  2FBT A;  4FJ7 A;  3QEW A;  4CEZ A;  2G8W A;  3NF8 A;  4FVM A;  3ZSV A;  1DLO A;  5HP1 A;  4F4K A;  4B9V A;  1JLQ A;  3QIN A;  3HP9 A;  4FJX A;  1KVB A;  2P1J A;  3L2R A;  1C0T A;  4KV8 A;  1T03 A;  2VWK A;  4FK4 A;  3C94 A;  3OYK A;  2YV0 X;  4LH4 A;  4QOZ B;  3K5N A;  1U48 A;  1LAW A;  2BGG A;  1RBR A;  1U45 A;  3U6F A;  1XI1 A;  3K5O A;  1JLG A;  3AVI A;  4EZ9 A;  3HT3 A;  1XWL A;  3P83 D;  4YNQ A;  1WSF A;  2IOC A;  3H08 A;  3P1G A;  4CF2 A;  5HBM A;  5SZT A;  3QES A;  2KFN A;  3VQ7 A;  4GMJ B;  3V6D A;  2HVH A;  1XC9 A;  1RT6 A;  1EXQ A;  2D0A A;  4ZHR A;  3QEV A;  2OYQ A;  4CJS A;  1ITG A;  3OYJ A;  4E1N A;  3NGI A;  4EZ6 A;  3V9X A;  1RCH A;  1JL1 A;  2Z1I A;  4HCC A;  1HMV A;  1RDB A;  1A5W A;  4H4O A;  1WAJ A;  3EZ5 A;  1XHX A;  2A1S A;  4AHT A;  1KSP A;  1VSE A;  3OYE A;  3ASM A;  3LWM A;  5CZ2 A;  3LZI A;  1TL3 A;  4CGI A;  4Z4H A;  3VQ5 A;  1S1V A;  4RW7 A;  1T8E A;  4CF0 A;  2Y1J A;  5DMR A;  5HLF A;  1TL1 A;  4FZY A;  4AIL C;  3DYA A;  3QLH A;  3OJU A;  4E7J A;  2OPQ A;  4KI6 A;  1HQU A;  4ELT A;  3O4Q A;  4Q5V A;  4CFA A;  2A1R A;  4CF9 A;  1C1A A;  1UA0 A;  4N76 A;  4IFY A;  1RTD A;  2WON A;  1TAQ A;  4BAC A;  3RRH A;  3KKS A;  2O4I A;  4DQI A;  4DQQ A;  3E01 A;  3NE6 A;  4DF8 A;  3AVC A;  3SV4 A;  1S9G A;  4M3Y A;  4C8N A;  4Z4C A;  3S3N A;  1WSE A;  3AVF A;  4DFP A;  3LAM A;  3TAE A;  1VSJ A;  3ZT4 A;  3WNF A;  1L3T A;  4OLB A;  4AHC A;  4CFB A;  3NH1 A;  1IO2 A;  2VG5 A;  1GOA A;  3HO1 A;  1WLJ A;  3I0R A;  3MED A;  4MFB A;  2LSN A;  3WNG A;  3V9Z A;  3OYI A;  3SZ2 A;  1LV5 A;  4ELV A;  4IFV A;  5SWM A;  3I0S A;  4OGE A;  3KJV A;  3LAK A;  3KTQ A;  1VSL A;  3OYN A;  3MXM A;  1RIL A;  4FJL A;  3OYA A;  4J2E A;  3AV9 A;  1YTU A;  1ASV A;  3ULD A;  3V9W A;  5C24 A;  5C42 A;  4CHZ A;  3M8S A;  3TAM A;  2X78 A;  2HHT A;  2P51 A;  1BQM A;  1BCM A;  4CIF A;  3OY9 A;  2E6L A;  3CM5 A;  4C8M A;  2HMI A;  4C8L A;  3C6U A;  4LH5 A;  3AVA A;  1KRP A;  2RNO A;  3CM6 A;  3DMJ A;  5FRO A;  4CK3 A;  2O4G A;  1ZYQ A;  2OZS A;  2DTU A;  1FKP A;  3VQE A;  3ZSZ A;  2ZQB A;  4FW1 A;  4FJ9 A;  4E7L A;  4EP5 A;  1VRU A;  4CEF A;  4KPY A;  2W42 A;  2YKN A;  1RT1 A;  4FJN A;  1J53 A;  3G0Z A;  5CZ1 A;  3VA3 A;  1SL0 A;  1L3U A;  4O4G A;  4FK0 A;  4FK2 A;  2FC0 A;  1KVA A;  4CHY A;  3OYF A;  3K5M A;  1NJZ A;  4CGH A;  4BE0 A;  2IAJ A;  4AHV A;  4G1Q A;  2XHB A;  3HPH A;  3LAL A;  1TK0 A;  1IKX A;  4B8C A;  3LPU A;  1YTA A;  3A2F A;  1HJR A;  3ZT2 A;  3NH2 A;  4JS4 A;  4CK1 A;  4DWI A;  3ISN C;  4FYD A;  3NAE A;  4AHU A;  1S5J A;  3VQQ A;  3TAB A;  3RTV A;  4E1M A;  4OKK A;  1SKR A;  4IKF A;  3JSM A;  1ZBU A;  3VQ6 A;  3LP0 A;  4I9Q A;  1D9F A;  3NBP A;  3L8B A;  1LWF A;  1VSD A;  2X6N A;  1RBU A;  4DLG A;  4ID1 A;  2YNG A;  4W5R A;  4O44 A;  4GW6 A;  5KRS A;  4CEB A;  1IKW A;  3S3M A;  4CED A;  1BGX T;  4HCB A;  1ASW A;  4MQ3 A;  3ZT0 A;  3SUO A;  4ZTF A;  3QIP A;  3LPT A;  1HQE A;  2OPR A;  4LD0 A;  4KI4 A;  2YHA A;  1ZBH A;  1HNV A;  3VQB A;  1W9H A;  3KKR A;  3HPG A;  4ID5 A;  3VQ9 A;  4KHY A;  3OYC A;  1A5X A;  3ZCM A;  4Z4I A;  3K2P A;  4DU4 A;  1QSL A;  4FJJ A;  1S1T A;  3VN5 A;  4DTS A;  3TAP A;  3NFA A;  4FCY A;  1IH7 A;  1BIU A;  1C0U A;  3U3G A;  4CHP A;  1QS4 A;  4B9U A;  1IG9 A;  2YNH A;  1I3A A;  1NOZ A;  2GBZ A;  4CJR A;  3SV3 A;  4E3S A;  3DOK A;  1KLN A;  2KVD A;  1VSM A;  4KB0 A;  4B3O A;  1SV5 A;  3IRX A;  3KIO A;  2RPI A;  4CJE A;  1SUQ A;  4DSJ A;  4FZZ A;  1UOC A;  5J2N A;  3RR7 A;  1R0A A;  4OPK A;  4M41 A;  3CFP A;  4OLA A;  4HVJ A;  3OYD A;  4H8K A;  4HHT A;  3HK2 A;  3RMD A;  3C95 A;  2X6S A;  1TGO A;  4DTR A;  1XHZ A;  4BE2 A;  4M3X A;  4KFB A;  2RN2 A;  3ZSW A;  3LP3 A;  4CJU A;  1VSH A;  3VQD A;  2HHS A;  2HHV A;  4KKO A;  4J2B A;  4M45 A;  4FLT A;  4DFJ A;  4KAZ A;  4TSX A;  3SUQ A;  4PUO A;  4CEQ A;  3OYM A;  3CFR A;  3BDP A;  2NUB A;  2JLE A;  3CYM A;  1J9A A;  2OZM A;  1D8Y A;  4KTQ A;  2VWJ A;  2KW4 A;  3NF6 A;  4CFC A;  3SNN A;  3OVN A;  4IBN A;  1SL2 A;  4DTM A;  1EET A;  4CEE A;  3AA4 A;  4LY7 A;  5J1E A;  4BDZ A;  1QTM A;  1HPZ A;  1JLA A;  4UQG A;  1KFS A;  3DI6 A;  3B6P A;  5K14 A;  3OS0 A;  3OS1 A;  3ALY A;  1SKS A;  3SQ4 A;  1RTJ A;  1RTH A;  1D9D A;  4B9N A;  4KB1 A;  4Z4E A;  1A5V A;  1U49 A;  1BIS A;  4E7I A;  3TAN A;  4CJF A;  4Z4G A;  1EKE A;  1S6Q A;  2JGU A;  5I42 A;  4KTW A;  1C0M A;  3LDS A;  2P5O A;  3TAQ A;  1D5A A;  4KHN A;  3OYB A;  2XY6 A;  4FJI A;  2OPS A;  1BHL A;  3DRP A;  4DSF A;  4J2A A;  3DLH A;  2F8T A;  2GV9 A;  2VG6 A;  3K58 A;  2G8F A;  2P5G A;  4JS5 A;  2HB5 A;  3LWL A;  2XO7 A;  4W5Q A;  1NK4 A;  1IKY A;  3QO9 A;  3LP1 A;  3AVG A;  4FJG A;  1FK9 A;  2Q3S A;  2ZD1 A;  1VSI A;  4I2Q A;  3RMA A;  4CHQ A;  4HUF A;  3HVT A;  3M8R A;  4BDP A;  3CFO A;  3VQA A;  3EY1 A;  2PYJ A;  5FRM A;  5J2P A;  3DLR A;  1CXU A;  3M8Q A;  1QSS A;  1B9F A;  3KK3 A;  4FLZ A;  1IKV A;  3MXJ A;  4HUG A;  5J2Q A;  4DSL A;  4B9L A;  1VSF A;  2RNN A;  1UWB A;  4CES A;  2IC3 A;  4CHN A;  3ZT3 A;  4JRQ A;  1HYZ A;  4KHQ A;  3AO5 A;  4CE9 A;  2DY4 A;  4FJK A;  1C1C A;  2X74 A;  4O5B A;  3G10 A;  3K57 A;  3CQ8 A;  4CJL A;  2XY7 A;  1L3S A;  4K8X A;  4CIE A;  3QNN A;  1N5Y A;  3RWU A;  5JS1 A;  3SUP A;  1HYS A;  4DF4 A;  4FM0 A;  4JRP A;  4PA1 A;  3HPO A;  4J2D A;  1C1B A;  4KHW A;  3AVH A;  4CEO A;  1S1U A;  1NK7 A;  4O0I A;  1TKT A;  4GVM A;  4N5S A;  4CJQ A;  3AVN A;  3ZSO A;  4B08 A;  3AO3 A;  1FKO A;  4CF8 A;  2XY5 A;  2Z1H A;  4N47 A;  1BCO A;  4KO0 A;  5HRR A;  3V1Q A;  3T3F A;  1DTT A;  4O55 A;  1NK8 A;  4CGG A;  4FJH A;  4CCH A;  5KTQ A;  1EP4 A;  3HVR A;  3KK2 A;  4OPJ A;  1JXB A;  4FLX A;  2D5R A;  1EX4 A;  1JLC A;  4W5T A;  2R7Y A;  4DTN A;  4E0D A;  3AVL A;  3NHG A;  4Q0B A;  1RT2 A;  2BAN A;  4M3Z A;  2G8H A;  3SJJ A;  1LWE A;  3O4N A;  1B9D A;  1RNH A;  1QE1 A;  3NDK A;  5CYM A;  1NK6 A;  2XRI A;  3C6T A;  2YNI A;  4DQR A;  3L2Q A;  3AVK A;  2Z1G A;  3DM2 A;  2OA8 A;  3NF9 A;  2KW9 A;  1Q9X A;  4DU1 A;  3QEP A;  3PUF A;  2G8I A;  1QSY A;  3P5J A;  3L2U A;  1GOC A;  1VSK A;  4DSK A;  3AVM A;  1RDD A;  4CK2 A;  1VRT A;  1U4B A;  2ATQ A;  3CG7 A;  3QEI A;  4NYF A;  1FXX A;  1X9S A;  3HST B;  1TKD A;  4UZW A;  3SYZ A;  2HNY A;  1V66 A;  5C25 A;  3OYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...