1ZBHA

3'-end specific recognition of histone mrna stem-loop by 3'-exonuclease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
DFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPNCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*GP*GP*CP*UP*CP*UP*UP*UP*UP*CP*AP*GP*AP*GP*CP*CP*
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 87
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.30 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 SAP domain 1zbhA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbhA02
1J53A 4WE1A 4LY7A 2YNFA 4CEAA 4DQPA 4M3XA 1JL1A 3AA3A 1IKWA 4N56A 4M3WA 1HYSA 3HVTA 3HVRA 4DTXA 4CJEA 3NGZA 5J2MA 2WOMA 3KTQA 3T1AA 4KHQA 3KK2A 1RDDA 4Q0BA 4KKOA 5J2NA 5HRRA 4FLVA 1NKCA 1NKBA 4C8MA 4CE9A 1TGOA 3CQ8A 2P51A 4DFJA 1QSLA 2DTUA 4CHZA 4CJ5A 5D3GA 5CZ1A 4KB0A 5I42A 1IKYA 4CEZA 1N6QA 5EU7A 2HB5A 3MXJA 3OYCA 1D9FA 1JLAA 4JS4A 4CJFA 2RNOA 4CJRA 1WSHA 1S1VA 4E7KA 3PV8A 1D9DA 3AVHA 3LDSA 4O0JA 3TR8A 1A5XA 3SI6A 4FJMA 1UOCA 4CJ4A 3AO2A 2DFEA 4DTNA 1EETA 1EP4A 1IG9A 4M3ZA 5C25A 4FM2A 2Z1GA 4KFBA 1BI4A 5FRMA 2RKIA 4M3UA 4FJNA 5KTQA 3NCIA 3LP1A 4KV8A 3CM6A 3C95A 3OJSA 4F2RA 4CIFA 3VQAA 3EZ5A 1B9FA 3P83D 4C8LA 4E1MA 3K57A 4HHTA 4O5BA 2FBTA 3BGRA 4E7IA 1RT3A 5KRTA 4J2BA 3SYZA 2OPSA 3ZSYA 3VQQA 3L2UA 1BQMA 3WNHA 1U4BA 2HMIA 3PX4A 1ASVA 1C1AA 1BHLA 2Z1IA 1RNHA 4ID1A 1UAXA 3SQ2A 4AHSA 3AVLA 5K14A 1RBUA 1S1XA 4AILC 5DK5A 1X9SA 4Z4GA 3U3GA 3QEVA 3VQ4A 1KRPA 1RDCA 4CEQA 1WNSA 1KFDA 3QNOA 3SPYA 2ZQBA 2HW3A 1S1UA 4BDZA 4B9VA 3I0SA 1L3VA 2IDOA 1FXXA 4FK0A 3ZSWA 3VN5A 4DTJA 4OGCA 3NGIA 1TKZA 5FROA 2HHQA 3OYNA 3AVCA 3O3GA 4B9MA 1BIUA 3AA5X 4FXDA 4FW2A 3WNFA 1L5UA 5J2QA 4CGIA 4Z4IA 3QEIA 1KVCA 2XHBA 5HRNA 3NGYA 4RW8A 3HPOA 2Y1IA 3M8SA 4OKJA 3TI0A 1YTAA 3O3FA 3ZSQA 5I3UA 1ASWA 1REVA 4HUFA 3MXMA 3HJFA 2KFZA 1LWCA 3C6TA 3ZT2A 4OLBA 3S9HA 2XY8A 3KIOA 4AHRA 4CF9A 1I39A 4W5NA 5SZTA 3DMJA 2QKKA 3DLHA 1ZBFA 4E7HA 2A1RA 4CHNA 3P1GA 3VQ8A 4IFYA 2D0CA 3KLHA 1NK0A 4NCAA 1JLCA 1DLOA 5FDLA 3HYFA 1RT2A 4AHUA 3THVA 1TAQA 4FLYA 2XY6A 1SKSA 1RT5A 1JEQA 2O4IA 1C6VA 4QAGA 4ELTA 3HPHA 1RBVA 3QESA 1ZYQA 4B9UA 3V1QA 1CXUA 3DRSA 1BCOA 4CHQA 4DLGA 1NJXA 2HNZA 4K8ZA 1TVRA 3SNNA 2FC0A 4BWMA 2ITGA 4O0IA 4KHNA 2G8IA 3QEPA 3RMCA 4ZTFA 3C94A 4CJTA 3SPZA 4CEEA 2QK9A 4HCBA 1JXBA 4CGFA 5SWMA 2X78A 3L3UA 4HTUA 3RTVA 1CXQA 5HBMA 4CCHA 2YHBA 4DSEA 3AVKA 1U47A 3ZSVA 2BDPA 1BISA 4KAZA 4RW4A 3TABA 4FJJA 1A5VA 3EY1A 3VQCA 1FKOA 1Y97A 4CF8A 1NJWA 2BGGA 4FLTA 4EP5A 1N5YA 3B6OA 1B92A 1HRHA 4CEDA 4PA1A 4M45A 3QEXA 2FBYA 3HP6A 1TKTA 5E41A 3OYJA 1T8EA 4Y1CA 4B8CA 2RN2A 4YNQA 5T7BA 4CIGA 3M8PA 1XC9A 2AJQA 3JYTA 2FBVA 4DU4A 4UZWA 4PUOA 4E0DA 3VQDA 4CHPA 5HP1A 2FBXA 4FJIA 4Z4EA 2O4GA 2WONA 3V1OA 1KSPA 3V9SA 2B6AA 3QETA 2P5GA 4FM0A 4FLUA 1BI4B 3CYMA 1LAVA 4ELVA 1ITGA 3MEDA 4HUEA 3T3FA 3B6PA 4N5SA 4QOZB 3KKRA 4B08A 4UQGA 3TANA 1NOZA 4CK3A 4DF4A 1L3SA 4E19A 3V9ZA 4H4OA 3QEWA 1VSHA 3TAPA 1GOAA 4AH9A 1RT6A 2YNIA 3QO9A 3SUPA 3VQEA 4Z4FA 3LAMA 3OYFA 4JRPA 3AO5A 4CK2A 3K5MA 4FCYA 3OS2A 3SV3A 1BGXT 3U6FA 3L2QA 4I9LA 3LANA 3ZT0A 5CYQA 5KGWA 1EX4A 1TV6A 3KLEA 3DLKA 4EZ9A 3LWLA 2OPQA 4KHSA 1DTQA 2IOCA 2Z1JA 2B4JA 4HUGA 2Y1JA 1XHXA 2E6LA 3AVGA 4CJ3A 4DTRA 2XY5A 1YT3A 1XI1A 3O4NA 1TK5A 3PUFA 3AVNA 4I9QA 4F4KA 2DFHA 1IKVA 4IG3A 2G8FA 4KHWA 3OJUA 2HHTA 3QLHA 4FW1A 1LV5A 4IFVA 4ZHRA 4CEOA 3HP9A 3OYAA 3S3NA 1J5OA 1CZ9A 4OVLA 3OVNA 4I2QA 4H8KA 2HVHA 3ITHA 4DFPA 4CJLA 1FK9A 4L8RB 1BIZA 1D5AA 2F96A 2GBZA 1IKXA 1NK8A 1RILA 3AVFA 1TK0A 2HHSA 1UA0A 2RPIA 4N76A 4KO0A 2HHXA 5FRNA 2X6NA 4OGEA 4I2PA 1UA1A 1WSJA 1I3AA 4LH4A 4OPKA 4GVMA 3RMAA 5HROA 3SJJA 4IBNA 1HMVA 2GUIA 3ULDA 1SL1A 3ASMA 3L8BA 5JS2A 2R7YA 1RDBA 4F2SA 4W5RA 4M3RA 1L3TA 5J2PA 3K5OA 3VQBA 1NK9A 3PO4A 4DFMA 1JL2A 4DF8A 3ZT1A 3ISNC 3S3OA 4BDPA 2QKBA 1BQNA 3F9KA 2YV0X 4ICLA 3TAGA 2YKNA 3NF9A 3OYLA 4I7FA 3SQ4A 3OS1A 3IG1A 4LSLA 3VQPA 3ZT4A 3LWMA 1KLNA 4J2DA 1RT1A 1LWFA 3P5JA 1S6PA 4CJPA 1BL3A 4KB1A 1W9HA 4FM1A 3AV9A 4RW7A 1T03A 4RW6A 1WLJA 4FJLA 1GOBA 4IKFA 3O3HA 2KVEA 3RMDA 2NUBA 4CGGA 4DFKA 1KVBA 4B3OA 3KK3A 4F8RA 4B9NA 4O55A 4E1NA 4DQIA 2IGIA 2IAJA 1WAFA 2KQ2A 3TWHA 4E7JA 4XIUA 4KHYA 4DWIA 2Q3SA 3OYBA 2PY5A 5CYMA 1VSIA 4M42A 3QNNA 4CF2A 2KVDA 2HNYA 4DTOA 3PO5A 3OYEA 3E01A 4R5PA 2W42A 1RCHA 3LP0A 3NE6A 1JLBA 4DQRA 4KPYA 1KTQA 3ZSOA 3AA2A 3DOKA 1SL0A 2KW4A 4C8KA 3RRHA 1HNVA 1J54A 4DS4A 3SUOA 1TAUA 1HNIA 3V1RA 2A1SA 1Z26A 4CF0A 1VSMA 4C8NA 3SQ0A 1S1WA 4M3YA 2KFNA 3K5LA 4KHUA 1ZBIA 2KZMA 5DMRA 4IDKA 2D0AA 1FKPA 4FJGA 3HK2A 1RTIA 2KTQA 4DS5A 3OYMA 1X9MA 2E6MA 1RTJA 2PZSA 3M8QA 1TKXA 1HQEA 4GW6A 4CJVA 3OYDA 3HSTB 1VRUA 4MQ3A 4CESA 4YFUA 1LW2A 1KCFA 4NYNA 4EP4A 4FVMA 1LWEA 4M41A 1JLGA 2HVIA 3S3MA 2RF2A 4FJ8A 2D0BA 4Y1DA 3ZCMA 4Z0UA 4BDYA 1A5WA 3DM2A 3M8RA 3PY8A 1MU2A 4B8AB 3NBPA 4FLWA 1RBRA 3JSMA 3HXMA 2RNNA 1RT7A 4CHYA 2EHGA 4N47A 2ZE2A 1C0UA 5KI6A 5C42A 4O4GA 3AVIA 3QERA 1NKEA 4CJKA 1TL1A 1G15A 2VG5A 3TAQA 4NCBA 3OY9A 3VQ7A 1JLFA 3DRRA 1RTHA 1VK0A 1ZBHA 1VSLA 4FZYA 5HLFA 4PY5A 4KREA 3IRXA 3A2FA 3LPTA 4OJRA 1VSFA 3AVBA 3KLGA 4LH5A 4W5QA 1C1CA 1T05A 4M3TA 4FYDA 2XO7A 2LSNA 1RDAA 3NF6A 3HT3A 3KK1A 4IG0A 2YNGA 1Z25A 4FJ7A 2HHVA 2Z1HA 2EX3A 3L2RA 2D5RA 1SKWA 3DOLA 4J2EA 3ALYA 2ATQA 3MEGA 4B9SA 1SKRA 3DLBA 4QCLA 1S9EA 2GV9A 3IS9A 3AO4A 4DLEA 3V9XA 3KD5E 4BWJA 1Q9YA 3KLIA 3K5NA 1QS4A 3SCXA 2OA8A 1XWLA 5KGXA 3QIOA 3L3VA 3ZSXA 4FLXA 3U3YA 1WN7A 4Z4CA 3NH1A 1WSGA 4KTZA 3SV4A 3DI6A 3MEEA 4DTSA 1U48A 1CLQA 3RWUA 2F8TA 1U49A 4CERA 4FK4A 1ZBUA 4CFCA 4CHOA 4CJSA 4C8OA 5C24A 3DRPA 4NYFA 3WNEA 1SUQA 2IS3A 5KRSA 4W5OA 4PQUA 4CK1A 4FJXA 4CGDA 4DU1A 4F3OA 1C0MA 1IO2A 2XRIA 1NJZA 4KI6A 1WAJA 2KW9A 2KZZA 3NFAA 2VG7A 1JLEA 3SUNA 4CJQA 3NF8A 1X1PA 5J1EA 1R0AA 1QSYA 3DLRA 3SQ1A 2DY4A 3HPGA 4DG1A 2VWJA 3RRGA 4AHTA 4FK2A 1U04A 2OPRA 4DMNA 3TAMA 1SV5A 3I8DA 4DSKA 3ZSZA 4BACA 2F8SA 3ZSRA 1YTUA 3DLEA 2BANA 4G1QA 3NAEA 4BE0A 1B9DA 3DYAA 4AHVA 4B9LA 1S5JA 2QXFA 1RTDA 4MFBA 2WQGA 4DTUA 2B5JA 3K59A 1S6QA 3RMBA 1RBSA 1QE1A 4CECA 4CFDA 3OYGA 1SL2A 1C1BA 2OPPA 3CG7A 2PYJA 2OZMA 3AA4A 2X6SA 4KI4A 1T7PA 2YHAA 2DFFA 1TK8A 4BITA 1KLMA 3MXIA 4B9TA 4TSXA 2P5OA 4RW9A 1VSDA 4F3TA 1WSIA 4O44A 2BE2A 2JGUA 3HM9A 3SZ2A 3HL8A 3VA0A 2X74A 3NF7A 4KTQA 3VA3A 3TAEA 3NH2A 4BE2A 4DQSA 4OKKA 3T19A 3NDKA 1RBTA 5HRSA 4ID5A 3AVJA 1NK4A 1VSKA 1C0TA 4CGJA 4Q5VA 1HYZA 1QHTA 4FJ5A 1EXQA 4LD0A 4E3SA 2G8HA 2JVWA 3NHGA 2VG6A 4K8XA 1V66A 1HQUA 2PYLA 3V6DA 1WSFA 4ELUA 1NK6A 3LALA 3OS0A 3WNGA 3AVAA 3L2WA 3FFIA 3MECA 1K6YA 4FJKA 3O4QA 4CFAA 3OYIA 1TL3A 3G0ZA 3VQ6A 1HYVA 1NJYA 2OZSA 2IC3A 3CM5A 4JS5A 4OPJA 3IAYA 3CFPA 3VQ5A 1NK7A 1BCMA 4GMJB 1ASUA 4E7LA 4CIEA 2G8UA 2HHUA 2HHWA 1JXEA 3KJVA 1ZBLA 3AO1A 4DTMA 3TAFA 2YNHA 1NOYA 4DSJA 4CJWA 4H4MA 3KKSA 1QSSA 2VWKA 3DLGA 1W0HA 2ETJA 1VSEA 3G10A 1LW0A 4JLHA 1S1TA 4CGHA 3F73A 3V9UA 4DTPA 4DSIA 4DSFA 2P1JA 3VQ9A 3NH0A 1DTTA 4E89A 5HRPA 4DU3A 3OYKA 1GOCA 4RG8A 3QIPA 2ZD1A 2E4LA 3CFRA 3RR8A 3HO1A 5JS1A 1H1JS 3V4IA 2KVUA 1JLQA 4KRFA 4FZXC 1YVUA 4OKEA 1CZBA 1TKDA 4KTWA 4FJ9A 3LP2A 4CFBA 1HPZA 3LPUA 1L3UA 1WSEA 1NK5A 4FJHA 4CEBA 4CEFA 3KD1E 2G8KA 5CY4A 4ZTJA 3D45A 1KFSA 4N41A 1J9AA 4NCGA 3LAKA 4W5TA 1RT4A 1UWBA 1D8YA 1JKHA 3SUQA 4LSNA 5CZ2A 2JLEA 1HJRA 1IH7A 3L2VA 1VSJA 3KLFA 3BDPA 3AO3A 3RR7A 4FZZA 1S9GA 3K2PA 3ZT3A 1VRTA 1QTMA 3EYZA 4FLZA 3V81A 4EZ6A 3PX6A 3V9WA 1EKEA 2G8WA 4OLAA 2G8VA 3I0RA 2XY7A 4PWDA 3UIQA 2OYQA 3AVMA 2I5JA 4DSLA 1KVAA 3QINA 3PX0A 4JRQA 3LZJA 3TARA 3OYHA 3C6UA 4BE1A 4CF1A 4HCCA 4HVJA 4J2AA 1LAWA 4CJUA 4Z4HA 3MAQA 1XHZA 4AHCA 3K58A 2YKMA 3LZIA 4DQQA 1Q9XA 1Q8IA 1JJRA 1O1WA 3CFOA 3D0PA 1QQCA 2HNDA 1F21A 3LP3A 1U45A 3H08A 1X9WA
chains in the Genus database with same CATH superfamily
1ATRA 1NGBA 4LY7A 2YNFA 4CEAA 5JLFA 4M3WA 4DTXA 3NGZA 3SAGA 5J2MA 2O8CB 3T1AA 3F5TA 4RTFD 1VQ7N 4WF9L 3LDPA 4CE9A 3G4SN 3FFKB 4JKBA 3CQ8A 2NRRA 5D3GA 4KB0A 1GLCG 2HB5A 3U9DA 5JVHL 4JS4A 4E7KA 2RNOA 1S1VA 3AVHA 4H0PA 3LDSA 4DTNA 1IG9A 5C25A 3KHYA 2D0OA 4KFBA 1BI4A 4DHYA 3CPEA 4FJNA 3FZKA 2P9UA 3CM6A 2D4WA 4F9OA 3G25A 2GX9A 3TU5A 4IO9L 4F2RA 5BR9A 3P83D 4OO1J 5AQIA 4HHTA 4YHHK 2FBTA 4YOVA 1RT3A 4J2BA 3AY9A 3ZSYA 5DM6L 2VGNA 4GNIA 4BC3A 3R6MA 1ASVA 1RNHA 2DPNA 1UAXA 4ID1A 5AQFA 3H1QA 4AILC 1X9SA 3VMFB 3QB0A 1KFDA 4CZEA 4BRCA 3I56N 3CCMN 1YJNN 2HW3A 1S1UA 1T6CA 5A2QO 1L3VA 1X3NA 4J8FA 3IMXA 3CXCM 3OYNA 5AJ3K 4Z4IA 1EN7A 3M8SA 3P38A 4JKFA 1ZBSA 3C6TA 2I7NA 4OLBA 3S9HA 3KIOA 4W5NA 4AHRA 1QZ5A 4IWVA 5SZTA 4BR0A 3TTCA 3WXJA 1ZBFA 4H0OA 4CJ7A 3KLHA 3BEXA 3HYFA 3VEOA 4AHUA 3THVA 3AAQA 1TAQA 1RT5A 2O8EA 1C6VA 1DGKN 2CH6A 4ELTA 3A8YA 1CXUA 2D1KA 3MWTA 4MLHA 2UXBK 1TVRA 3SNNA 2ITGA 3QEPA 2UU9K 4HCBA 4CGFA 2X78A 3L3UA 5B8HA 5AQXA 4JYAK 1GJJA 2YHYA 3VEXA 4I6MA 4K42A 1NG9A 4A2AA 4CF8A 2BGGA 1NJWA 4CZMA 3B6OA 1JEIA 1YJ9N 1JJ2M 3U8XA 5F0XA 2YCHA 4FWRA 3QEXA 3HP6A 1TKTA 4B8CA 5T7BA 3CCJN 1XC9A 3FE1A 3THXB 4PUOA 3L4QA 3MCAB 2FBXA 2O4GA 3V1OA 1KSPA 2B6AA 2P5GA 4NB4A 4HUEA 3PIOL 3T3FA 4O8UA 3EL2A 3WEEB 4FPBA 1GOAA 3BZKA 4Z4FA 4YDUC 2WTUA 4PKHA 4FCYA 4X66K 1BGXT 4DFKA 4EZ9A 5KGWA 4KHSA 3WQTA 2E6LA 3CQXA 2XY5A 4JI4K 4FWSA 4F4KA 1IKVA 4BR2A 3L0OA 4KHWA 3FGUA 3OJUA 2HHTA 4JKCA 2Q0UA 3AAPA 4ZHRA 1J5OA 3S3NA 1VQMN 4OVLA 2HVHA 4H8KA 4H5TA 4HTLA 4CJLA 3C0BA 1NK8A 1RILA 3AVFA 1UA0A 2RPIA 2HHXA 4GKKK 2O8BA 4CZHA 1WSJA 2O8DB 2GUIA 3ULDA 2UUCK 2R7YA 3T69A 1L3TA 3ZETB 1DEJA 1NK9A 3PO4A 1JL2A 4DF8A 3ISNC 3TAGA 4FOIA 4I7FA 3MN7A 5EXWA 3FLGA 1RT1A 1LWFA 2YJFA 3VF2A 5KPZA 1BL3A 4FM1A 1T03A 3O9UA 1WLJA 2CH5A 4CGGA 3HBTA 1SQKA 3T7ZA 1P8ZA 3KK3A 4B3RK 4DQIA 4DKWA 4RCHA 3TWHA 1VQNN 4DWIA 1YJWN 4Y0WA 1T6DA 2HNYA 4LF4K 1RCHA 4ISEA 3CMAN 1GLFO 4KPYA 3AA2A 1SL0A 4C8KA 3Q7BA 3VEZA 1TAUA 1MWKA 1HNIA 4CF0A 4LC9B 2KFNA 1E4GT 5M1OA 4KHUA 1ZBIA 4CJVA 1HQEA 2E1ZA 4LF7K 3OYDA 1NGJA 1KCFA 4FVMA 4M41A 1JLGA 2WUSA 4B1UB 4IJNA 3ZCMA 5M1PA 4B8AB 3NBPA 1RBRA 3JSMA 2RNNA 1C0UA 5C42A 1NKEA 2A8VA 1G15A 2CGJA 4FSVA 1ZBHA 4A61A 1VSLA 4FZYA 4KREA 3LPTA 4OJRA 3KLGA 5AQLA 1NGGA 2XO7A 3L2RA 1RDUA 2D5RA 4H0XB 4A2BA 3MEGA 1QVFM 4DLEA 3D2FA 5JVGL 3K5NA 2OA8A 5M1KA 3UE5A 3U3YA 2JWKA 3CETA 1CLQA 1U48A 3RWUA 2F8TA 1ZBUA 4B1XB 4CFCA 1NNEA 4CJSA 4C8OA 5C24A 3TPQA 3QKJA 4BGAA 1KC8O 4CGDA 4F3OA 1C0MA 1GLDG 3DXMB 2UUAK 1NJIO 1WAJA 2KW9A 1ESVA 1X1PA 3WQUA 5J1EA 5F2RA 4IOAL 2I7PA 5C12A 1HX1A 2OPRA 4Z94A 1N34K 1SV5A 3ENBA 4BACA 3ZSRA 1YTUA 1VQ6N 4QS8A 5GADP 2O8CA 2WQGA 4JD2B 3K59A 1RBSA 1QE1A 3CG7A 4IFEA 2OZMA 3AA4A 4KI4A 4BRAA 2DFFA 4L3QA 1TK8A 4H0YB 1VSDA 2P9SB 4XH5A 1HKGA 4KBOA 2BE2A 1K73O 4OX9K 3HL8A 1J6ZA 3VA3A 3NH2A 1EO1A 3GBTA 3O6WA 3T19A 3NDKA 1WBDA 4RWTA 1RBTA 1A62A 3EE8A 2VWBA 5HRSA 4BR7A 5KQDA 1C0TA 4LD0A 4E3SA 5AQQA 1MWMA 1V66A 4YOUA 1HQUA 2PYLA 4ELUA 3LALA 1JCEA 4OPAA 1K6YA 4FJKA 3G0ZA 2OZSA 3CI5A 4BR4A 3CM5A 3IAYA 4PHTX 1IV0A 2HHWA 3A5MC 5FPNA 1JXEA 3AO1A 3TAFA 2VWKA 3OBYA 4JLHA 4FLVA 3F73A 3VERA 1S1TA 4DSFA 3GOIA 1BOTO 2E2NA 2FSNA 4WCEL 4E89A 4JAXA 4RG8A 4CBUA 2D0PA 3I8BA 3RR8A 5JS1A 3V4IA 2KVUA 4BQLA 3A5NC 4M7YA 3LP2A 2P9IB 3LPUA 2G8KA 1KFSA 4JI7K 2HF3A 2Q1NA 4MO4A 3RVCA 4JEPA 2HMPA 3KLFA 3BDPA 2P9LA 3BY5A 3CC7N 1QTMA 4FLZA 4EZ6A 3PX6A 4PWDA 5AQHA 3HTVA 1KVAA 3QINA 4DR2K 2GWJA 3LZJA 5DM7L 3C6UA 3KWGA 1XHZA 4AHCA 3K58A 3IFRA 4BRDA 1O1WA 2LC3A 1QQCA 2HNDA 3LDLA 2ZJRL 3DWLA 3H08A 2A40A 4JHDB 3CJ7A 4CI6A 4M3XA 1JL1A 4LFBK 2JWLA 2WOMA 4DV4K 4Q0BA 2NRHA 4JI3K 1NKCA 1NKBA 3SAHA 1TGOA 2DTUA 1EQYA 4CHZA 4CJ5A 5I42A 2ZWHA 1IKYA 3MXJA 3OYCA 1D9FA 3THXA 1WSHA 4CZFA 5BR8K 4O0JA 5TKWA 1UOCA 2ASOA 4CJ4A 1EETA 2FF3B 4FM2A 2Z1GA 4XH4A 2ITMA 2RKIA 1IBMK 3NCIA 3LP1A 3ZYYX 3PSFA 3C95A 1ATSA 5JMVA 4CIFA 4WFAL 3EZ5A 3P31A 3BGRA 4E7IA 3SYZA 1KHCA 1BQMA 4DR4K 2HMIA 3PX4A 4LFAK 1FJGK 4AHSA 3AVLA 1RBUA 5DK5A 5FLXO 1BWFO 2BTFA 3QEVA 2DK4A 4CEQA 3QNOA 5LY3A 3FR0A 2QWRA 4B9VA 1HKCA 1FXXA 4FK0A 3ZSWA 4B1YB 4DTJA 1TKZA 5FROA 2HHQA 2VQEK 1MA9B 3O3GA 3AA5X 4FXDA 1K8AO 3WNFA 4E1JA 3CJCA 5J2QA 2KHOA 1KVCA 3R8EA 2A6AA 3U4LA 2XHBA 4IZ9A 1VQPN 2E5LK 2O8DA 1YTAA 4O8KA 3HJFA 3ZT2A 4M7XA 3ZETA 3J80O 1HR0K 3J81O 3ZLJA 1I39A 2PBDA 1V4TA 2QKKA 3DLHA 4CHNA 3M3ZA 1NGAA 4DB3A 3P1GA 1JLCA 1DLOA 5FDLA 5AQPA 2ZGZA 2VQFK 4FLYA 1SKSA 5ELZA 1T3VA 1KQSM 3H46O 4QAGA 5AZJB 1BCOA 4CHQA 4DLGA 1BG3A 4K8ZA 5BRDA 4BWMA 4O0IA 1VQ4N 3RMCA 4ZTFA 4FWNA 4CJTA 3SPZA 4CEEA 2QK9A 4DV5K 3RTVA 4CCHA 5HBMA 1U47A 2AP1A 1ZS9A 2QWQA 3I33A 5C15A 2O8FB 4FLTA 1N5YA 3RSEB 4PA1A 5AZIB 3QDKA 2FBYA 4CD3A 5E41A 4Y1CA 4CIGA 4JK7A 2G80A 3M8PA 2AJQA 2FBVA 3EO3A 4AM7A 4CHPA 5BPLA 4FM0A 3CYMA 4ELVA 1EWQA 4QOZB 4UQGA 3WUHA 5M1FA 4AQYK 1NGFA 5GAEP 3CD6N 4CZGA 4E19A 3V9ZA 1RT6A 2YNIA 5CHIA 2VCPA 3AO5A 2QEXN 3U6FA 3L2QA 3LANA 3MX5A 1EX4A 1TV6A 2OTLN 3DLKA 2OPQA 3A5LC 2Z1JA 3E66A 4CJ3A 2NRVA 3O1WA 1XI1A 3O4NA 1TK5A 3PUFA 3QLHA 3OYAA 4CEOA 3HP9A 3LLRA 3ITHA 1FK9A 4WFBL 4NXNK 2HHSA 1TK0A 3L6QA 4DR1K 4N76A 5FRNA 2X6NA 4XH1A 4I2PA 3MN9A 4LH4A 1I3AA 3A5OC 4GVMA 3SJJA 2QWPA 1HMVA 3H3NO 3DXMA 3L8BA 4GY2B 3OTOK 3LDNA 1W97L 2P9PB 2QKBA 1BQNA 3SQ4A 4K41A 3OYLA 3OS1A 3IG1A 4LSLA 2VYPA 3LWMA 2QNCA 1EWRA 3SJHA 4CJPA 3AV9A 4RW7A 4JD2A 1GOBA 4GV6A 4BC5A 2KVEA 2NUBA 1NU0A 4ILJA 5AQUA 4E1NA 2IAJA 4E7JA 1XMQK 2E20A 5LJVA 4GV3A 1BA1A 3ATVA 2P9SA 3D6RA 2KVDA 4DTOA 3E01A 4BRHA 3DOKA 3RRHA 3LM2A 4MLEA 3V1RA 2A1SA 4M3YA 5AR0A 2KZMA 1X9MA 1GLAG 3CERA 1TUUA 4KH5A 1HNXK 1H1VA 3HSTB 1VRUA 3THWB 4YFUA 2E88A 4B1VA 4EP4A 2PAVA 2RF2A 2D0BA 3THYB 1JCFA 3M8RA 1OH8A 1OH6A 4GV9A 4MDAA 4H5WA 3HXMA 1NGIA 1RT7A 1K8KB 4N47A 3AVIA 3QERA 4CJKA 4WQ5C 3OY9A 3VQ7A 1JLFA 4EAHD 5HLFA 4PY5A 1RGIA 3IRXA 2OANA 4K43A 4LH5A 4W5QA 2W6KA 3IDHA 1T05A 4FYDA 1Z25A 2P9IA 2HHVA 3O80A 3VETA 2Z1HA 2EX3A 4WFNL 1SKWA 5E84A 3DOLA 1QQNA 1SKRA 3HI0A 5BPNA 5HL7L 3V9XA 4BWJA 3ZEUB 3KLIA 1Q9YA 2UUBK 1U2VB 3QIOA 4KTZA 3DI6A 4BC2A 3CQYA 3CPWM 4CERA 1U49A 4FK4A 4ILGB 3JXUA 1X3MA 4CK1A 3ZX0A 1YAGA 3CCRN 4IXCA 4KI6A 4U67L 2KZZA 3SUNA 2VG7A 3TTFA 4CJQA 3NF8A 3O5BA 2ODGC 3FZHA 3SQ1A 1VAZA 4OPHA 4JHDA 4JKEA 3J7AP 4DMNA 3TAMA 3O9SA 1SS6A 2WBNA 4JI6K 3DLEA 2BANA 4G1QA 3NAEA 4BE0A 4FO0A 1VQ5N 1S5JA 3RMBA 3SK3A 4CECA 2V51B 4CFDA 3OYGA 2IIRA 2X6SA 2YHAA 1HPMA 4BITA 1KLMA 4CBWA 2P5OA 4RW9A 2ASPA 3SAFA 3SZ2A 3TTDA 2QA4N 1YI2N 1NGDA 5AQYA 4DQSA 2CGLA 4OKKA 4CZLA 3LDOA 3ENOA 4JN4A 1HYZA 4FJ5A 3NHGA 4ILHA 3VF6A 3V6DA 1WOQA 3W0LA 2IVOA 3WNGA 3VTIA 5C0YA 4JKHA 4JI2K 4CZIA 4OPJA 1KXPA 3CFPA 2HHUA 1ZBLA 4DTMA 4DR7K 3KKSA 2P9NA 3DLGA 4K25A 1W0HA 4DTPA 3V9UA 5GAHP 3DXKB 5LJWA 4YOWA 1M1KO 4BY9C 1GOCA 1IBKK 3QMLA 3CFRA 3HO1A 4A5AA 4KRFA 1TKDA 4KTWA 3KK7A 4ISGA 1XUPO 4CEBA 3VOVA 3SMSA 4CEFA 3ZX3A 3DAWA 1KAYA 3CC4N 1RT4A 1YVNA 4H0VB 1D8YA 1JKHA 2JLEA 3O9RA 1HJRA 1VSJA 5IT9O 3AO3A 3RR7A 4FZZA 1S9GA 3K2PA 3ZT3A 1VRTA 2QWNA 1VQON 3EYZA 3V81A 3V9WA 1EKEA 2XY7A 3UIQA 2I5JA 5AZJA 4JRQA 1Z05A 3C65A 4DV3K 4BE1A 4HCCA 4J2AA 2ZJQL 4Z4HA 3CCVN 2YKMA 1Q9XA 3O08A 1JJRA 4WQ4C 3D0PA 3SUOA 2HHHK 3BZCA 3LP3A 1J53A 4DQPA 3HVTA 3HVRA 5BRHA 1NGCA 5J2NA 4C8MA 1E7DA 5GAGP 5E26A 2O8FA 3RSEA 2P51A 3HSCA 4JI5K 5AZIA 3AGKA 4CEZA 3WXMB 5EU7A 1JLAA 4V19S 4CJFA 4CJRA 3OA9A 1D9DA 3PV8A 4H5NA 1A5XA 4FJMA 3NMUA 3HM8A 3AO2A 2WFBA 1C0FA 4IEIA 5KPTA 2J4RA 5KTQA 5C2FA 3O1BA 1Z6RA 4KV8A 2W41A 5AQKA 1B9FA 4C8LA 4E1MA 3K57A 4O5BA 4KHPK 2KKZA 4LFCK 2GTDA 5KRTA 3SMPA 3VQQA 3L2UA 1QVGM 3WNHA 1U4BA 1OVYA 1C1AA 1BHLA 3SQ2A 2Q97A 3EZWA 5K14A 1S1XA 4Z4GA 3U3GA 3M6GA 1KRPA 3VQ4A 1IBLK 1RDCA 4IDHA 1WNSA 5AQJA 3SPYA 2ZQBA 4BDZA 4DV0K 2IDOA 3VN5A 4OGCA 3NGIA 4DQ8A 3CJBA 5LMNK 1BIUA 3QEIA 3F9MA 5HRNA 2NZTA 5GINA 2E2PA 2Q36A 2Y1IA 4OKJA 2ASMA 1ASWA 4HUFA 3MXMA 1LWCA 4FL9A 2P9PA 2V52B 3FZLA 4CF9A 3PLAA 3DMJA 4E7HA 2A1RA 3VQ8A 1NK0A 4IFYA 3O8MA 1RFQA 3QFPA 2XY6A 1JEQA 5I9EB 4BREA 3HPHA 5EVZA 5JLHA 1Q81O 3V1QA 4B9UA 3QBXA 3MWPA 1NJXA 1LCUA 2HNZA 1XC3A 3KZBA 3SBGA 4KHNA 4WYBA 1K9MO 1JXBA 3R1XA 4O5FA 1HKBA 1QQOA 1CXQA 3HRGA 4IO8A 3MCPA 3AVKA 4KAZA 2A5XA 4RW4A 4FJJA 3EY1A 1FKOA 1Y97A 1ZC6A 4EP5A 1B92A 1HRHA 4UY8O 4JKDA 3R9PA 3OYJA 4GKJK 4FPAA 3ATUA 3THWA 1T8EA 2RN2A 3EEQA 4NLCA 2ZGYA 4JV5K 3LM9A 3JYTA 4DU4A 4UZWA 4GVEA 1Q86O 4Z4EA 3IUCA 3THYA 2NRXA 3UKUB 1S72N 1ITGA 3MEDA 3B6PA 4N5SA 3KKRA 1G99A 3L0QA 3TANA 3MN6A 4CK3A 1OVQA 3F2KA 1K8KA 5CE3A 4IOCL 5ADXH 3C6AA 4H4OA 3QEWA 3U9ZA 3QO9A 3SUPA 1XMOK 3VQEA 3LAMA 3T1HK 5KQ8A 2FF6A 1O13A 2WC9A 5AQGA 3OS2A 5AQNA 4I9LA 2KFZA 3ZT0A 5CYQA 1C0GA 2W40A 4HUGA 1A63A 5JICA 2HOEA 3AVNA 1YF5L 3WEEA 4IG3A 3TSUA 4PKIA 4FW1A 1LV5A 4IFVA 3ZEUA 4I2QA 4DFPA 4BRFA 3LDQA 4U7BA 4L8RB 1U2VA 3VF4A 1J5EK 4QS9A 2E2OA 3P39A 4KO0A 2HJQA 3RMAA 4IBNA 1Q82O 2QW9A 3ASMA 1RDBA 4F2SA 4G9ZA 4W5RA 4M3RA 4CVNE 4A62A 4DFMA 4M63C 3ZT1A 4BQZA 3F9KA 4A59A 2YV0X 2YKNA 4J2DA 2QWOA 3ZT4A 2GUPA 2QWLA 3P5JA 3R3LA 3VGLA 1W9HA 4FJLA 3Q7CA 4RW6A 3PSIA 3QFUA 2RHKA 3E9PA 1KVBA 4B3OA 2YHXA 2W51A 3GDQA 5ADXA 4JKGB 4B9NA 2IGIA 1WAFA 3H45C 3OYBA 5CYMA 4DR6K 4AM6A 3QNNA 4CF2A 3PO5A 3CJAA 4X65K 3NE6A 4CBXA 1JLBA 1KTQA 2KW4A 1J54A 4DS4A 3K9JA 1TYQB 3CHWA 1VSMA 3A0IX 1S1WA 2QTDA 5DMRA 4IDKA 2D0AA 1FKPA 5MLCQ 4FJGA 2KTQA 3OYMA 1RTJA 3FLCO 1YHQN 3IKMA 2PZSA 3M8QA 1TKXA 5AQMA 1YIJN 3S41A 4MQ3A 4CESA 4CD1A 1LW2A 1GL9B 1QZ6A 4NYNA 1LWEA 2KLAA 4FVUA 3S3MA 4FJ8A 1FW6A 4BDYA 1A5WA 1MU2A 2FSKA 3CMEN 2ZE2A 4DV6K 3VEYA 2A41A 3VTHA 3DXKA 2NRTA 4NCBA 1NGHA 5AFUH 1M90O 3A2FA 1E4FT 3ULEB 2LSNA 4IG0A 2YNGA 1GLLO 5BREA 1ZXOA 2HBLA 4EIAA 4B9QA 2NLXA 2YHWA 3CCSN 4DUZK 2E2QA 4B9SA 1WB9A 3DLLL 3VPZA 5C2DA 1XWLA 5KGXA 3L3VA 2ZJPL 2ODCI 4Z4CA 1WSGA 3E1YA 3J8AA 2Q2RA 5F1XA 4NYFA 1T44A 3WNEA 4W5OA 1S3XA 1IO2A 2XRIA 3GL1A 4PKGA 1JLEA 4NXMK 1Q18A 3VESA 4EFHA 3DLRA 4JK8A 1N8RO 3HPGA 4DG1A 3RRGA 4FK2A 2F8SA 2LD7A 4DCHA 3ZSZA 3FZMA 1B9DA 3DYAA 4B9LA 1RTDA 2V7ZA 4R79A 4DTUA 2B5JA 4BRLA 2PYJA 1C1BA 5M1NA 4FWOA 1RDWX 4B1ZA 4CZKA 4B9TA 4TSXA 4JKAA 4DR5K 5AFUA 4F3TA 1WSIA 4FWLA 2JGUA 4FOEA 3CJ9A 3VA0A 2RE2A 4A5BA 2HF4A 3TAEA 1GKUB 4BR5A 3VEVA 3VEWA 3AVJA 1VSKA 1NMDA 4CGJA 4Q5VA 2YI1A 1QHTA 1EXQA 2JVWA 4K8XA 2VG6A 1JCGA 1YNSA 1WSFA 3AVAA 3E9LA 3M1FA 3L2WA 3FFIA 1HNZK 4CFAA 1S22A 1TL3A 3C7NB 3VQ6A 1NJYA 4PL7A 3OW2M 1NK7A 1BCMA 4E7LA 1ASUA 3KJVA 4CZJA 4DSJA 1WUAA 2YNHA 4H4MA 2UXCK 2F7TA 4YOXA 1VSEA 2ETJA 3G10A 4DSIA 4CGHA 3OBWA 4JI1K 2ZM6K 1DTTA 1U6ZA 5HRPA 4DU3A 2UYTA 3OYKA 2VGMA 2E4LA 2P9LB 1BDGA 4BG9A 5LMUK 2W6LA 5AQRA 1YVUA 4CFBA 1KAXA 1HPZA 1L3UA 1SZ2A 1NK5A 4FJHA 2ZF5O 3KD1E 4N41A 3D45A 1J9AA 4W5TA 4ISFA 1UWBA 4BRPA 3SUQA 5CZ2A 1QQMA 3L2VA 1IG8A 2G8WA 4OLAA 5C10A 3I0RA 5FPDA 5GIOA 3AVMA 3QBWA 2GEMA 4WQ5A 5AQOA 4PL8A 3TARA 4CJUA 4EHTA 1BUPA 1Q8IA 3CFOA 2QWMA 1TUYA 2E1YA 4BRQA 1F21A 1U45A 4C23A 1X9WA 4WE1A 3E9OA 3AA3A 1IKWA 4N56A 1HYSA 1SAZA 3K9KA 4CJEA 3KTQA 4KHQA 3KK2A 1RDDA 4NO7A 4KKOA 3T1YK 5HRRA 4YDUA 4DFJA 4A57A 1QSLA 2UXDK 5CZ1A 1ILYA 3EE9A 1N6QA 2HBJA 4JK9A 2NRZA 3H3OB 4FWKA 1V4SA 3MX2A 3TR8A 2FLOA 1MDUB 3SI6A 2DFEA 1XNRK 4M3ZA 1EP4A 3UKUA 5FRMA 4M3UA 3UKRB 3KVGA 3AARA 3OJSA 4B1WB 3VQAA 2BH1A 1H9EA 3SBTA 4FWPA 2OCEA 5AQZA 2OPSA 1CZAN 2YX6A 1I94K 1GLJO 2Z1IA 1OKJA 4IJAA 2QI2A 1Y02A 2EWSA 3CCUN 1A8VA 1DT9A 4BRMA 2MPHA 2P9KB 4JI8K 4H03B 1DKGD 3B8AX 5BN9A 5CIUA 3I0SA 3FZFA 1QHAA 3AVCA 4B9MA 4YY3K 4FW2A 4EHUA 1BU6O 1L5UA 4CGIA 3I55N 5LL6Z 4JNEA 3NGYA 4RW8A 3HPOA 3NVKA 3TI0A 3O3FA 3ZSQA 5I3UA 1REVA 3DJCA 4MDBA 1KAZA 3TSPA 2XY8A 2HSTA 5HOOA 3D7EO 3HOSA 2D0CA 5KPRA 4NCAA 1RT2A 3C6HA 4CW7B 1X9JA 4XEIA 5FPEA 1N32K 2O4IA 2Q0RA 4HWIA 3QESA 1RBVA 3QICA 2F9WA 1ZYQA 1NGEA 4H5RA 4JKGA 3DRSA 4FWMA 4LF5K 3D2EB 2FC0A 2G8IA 3C94A 1OH7A 2F9TA 2H3GX 5SWMA 4HTUA 1Q7YO 1XQSC 2YHBA 4DSEA 3ZSVA 2V7YA 1BISA 2BDPA 1TYQA 1ATNA 3TABA 1A5VA 1VHXA 5IWAK 4H5VA 3VQCA 3G71N 3MK6A 4CEDA 3P4IA 2QNFA 4X62K 4M45A 4BRKA 3WXLA 4YNQA 3SLCA 1OH5A 4IEEA 1KD1O 3ZX2A 4E0DA 3VQDA 5HP1A 4FJIA 2WONA 3V9SA 3QETA 4FLUA 1BI4B 1LAVA 4BG8A 5BRFA 4B08A 2P9UB 4BVOA 1NOZA 4DF4A 1L3SA 1N36K 4WQ4A 2IVPA 4LF8K 3TAPA 1VSHA 2F4VK 4AH9A 1VQLN 5CR4A 3OYFA 4JRPA 2QM1A 4CK2A 3J7YP 3K5MA 2Q31A 3SV3A 5TKYA 5EY4A 3ULEA 3KLEA 3LWLA 1DTQA 2IOCA 2B4JA 2Y1JA 1XHXA 3AVGA 4DTRA 3EKSA 4LF9K 1YT3A 1W7AA 3L4IA 4YOTA 4I9QA 2DFHA 2G8FA 3MDQA 1CZ9A 3OVNA 3EN9A 3ID8A 1NM1A 3GG4A 3CF5L 1BIZA 1D5AA 2F96A 2GBZA 1IKXA 4BRIA 2YJEA 3N4PA 4LF6K 1D4XA 1YUWA 4OGEA 4DV1K 1UA1A 3CIPA 4OPKA 1IJJA 5HROA 3VGKA 1SL1A 5JS2A 1GLBG 4DV2K 5J2PA 3K5OA 3VQBA 4DUYK 5GIPA 3S3OA 4BDPA 3WT0A 4B3MK 2AA4A 3VGMA 4ICLA 3NF9A 3VQPA 3UB5A 1KLNA 3M5RA 1S6PA 3TSQA 1HNWK 4KB1A 2IVNA 3NVMA 2O8EB 4IKFA 3O3HA 3RMDA 4DR3K 2KFVA 4F8RA 2NNWA 4O55A 2KQ2A 2FSJA 4XIUA 4KHYA 2Q3SA 2PY5A 1VSIA 4M42A 5BPMA 3O9QA 3OYEA 4R5PA 2W42A 3LP0A 4QS7A 1HUXA 4DQRA 3ZSOA 3ID6A 1HNVA 1BA0A 4I6MB 1Z26A 3SQ0A 4C8NA 1NWKA 3K5LA 5AQSA 3HK2A 1YITN 1RTIA 4DS5A 2E6MA 3H1VX 4GW6A 3K0SA 5AQTA 3BF1A 1E3MA 2PFUA 1VQ8N 3C7NA 2HVIA 4Y1DA 3HZ6A 4BRNA 4Z0UA 5AQWA 3DM2A 3PY8A 4FLWA 1WBBA 4BRGA 3OHRA 4CHYA 2EHGA 5BN8A 5KI6A 4O4GA 3EKUA 1TL1A 2VG5A 3TAQA 4JI0K 3CCLN 3DRRA 1RTHA 1VK0A 4B3TK 1HLUA 1VSFA 3AVBA 3JAMO 1C1CA 4M3TA 3HT3A 3NF6A 1RDAA 3KK1A 4FJ7A 2CGKA 4NLBA 4J2EA 3ALYA 4BVPA 2ATQA 3DLBA 4QCLA 1S9EA 2GV9A 3IS9A 3AO4A 3KD5E 3PIPL 1QS4A 3SCXA 2FXUA 4FLXA 3ZSXA 3BF3A 1WN7A 3SV4A 3NH1A 4BR9A 4DTSA 3MEEA 1NBWA 4CHOA 2O8BB 3DRPA 3H6EA 5KRSA 1SUQA 2IS3A 3BP8A 1XNQK 4PQUA 3W3DA 4FJXA 1NLVA 4AF1A 4DU1A 1NJZA 3CCQN 4IOXA 3AGRA 3NFAA 2OTJN 4YOYA 1R0AA 1QSYA 5M1QA 2DY4A 2VWJA 4AHTA 1U04A 5H1SQ 3I8DA 1VQ9N 4DSKA 2GWKA 4AHVA 2QXFA 4MFBA 3KWIA 1S6QA 3WXIA 3GE1A 1SL2A 2OPPA 3CJ1A 1T7PA 3MXIA 4BROA 3J7ZO 3BUZB 4B3SK 4O44A 3HM9A 2X74A 3NF7A 5EX5A 4YORA 4C1NI 4KTQA 4BE2A 2A3ZA 1P90A 1HJOA 4ID5A 3UKRA 1NK4A 5FPMA 3LL3A 3CCEN 2P9NB 1BO5O 2G8HA 4KH6A 1LOTB 1YXQA 1NK6A 1R59O 3OS0A 1E7LA 2QXLA 3MECA 3O4QA 3OYIA 1HYVA 1N33K 2IC3A 4JS5A 4X64K 3VQ5A 4GMJB 2G8UA 4CIEA 3O4WA 3ENHA 4H0TB 1NOYA 4CJWA 2P9KA 2A42A 1QSSA 1GLEG 1Y64A 1LW0A 3JS6A 2P1JA 3VQ9A 3NH0A 1H9FA 3QIPA 2ZD1A 4C1NK 1H1JS 1JLQA 2GELA 4FZXC 4OKEA 1CZBA 4FJ9A 3O9TA 3HOTA 3MMVA 1WSEA 5CY4A 4ZTJA 4KH4A 3VENA 4NCGA 4BGBA 1NMNA 2E8AA 3LAKA 4K0KK 4LSNA 2NRWA 3D2FB 1VQKN 1IH7A 4DV7K 5AQVA 5EOYA 1W2BM 2HBKA 4MO5A 2BUPA 3WXKA 2G8VA 2OYQA 2HBMA 4FWQA 4DSLA 3PX0A 3N4QA 3OYHA 4CF1A 3CC2N 4HVJA 1LAWA 3MAQA 3MN5A 3D2EA 4BC4A 3LZIA 4DQQA 3G6EN
chains in the Genus database with same CATH topology
1J53A 4WE1A 4LY7A 2YNFA 4CEAA 4DQPA 4M3XA 1JL1A 3AA3A 1IKWA 4N56A 4M3WA 1HYSA 3HVTA 3HVRA 4DTXA 4CJEA 3NGZA 5J2MA 2WOMA 3KTQA 3T1AA 4KHQA 3KK2A 1RDDA 4Q0BA 4KKOA 5J2NA 5HRRA 4FLVA 1NKCA 1NKBA 4C8MA 4CE9A 1TGOA 3CQ8A 2P51A 4DFJA 1QSLA 2DTUA 4CHZA 4CJ5A 5D3GA 5CZ1A 4KB0A 5I42A 1IKYA 4CEZA 1N6QA 5EU7A 2HB5A 3MXJA 3OYCA 1D9FA 1JLAA 4JS4A 4CJFA 2RNOA 4CJRA 1WSHA 1S1VA 4E7KA 3PV8A 1D9DA 3AVHA 3LDSA 4O0JA 3TR8A 1A5XA 3SI6A 4FJMA 1UOCA 4CJ4A 3AO2A 2DFEA 4DTNA 1EETA 1EP4A 1IG9A 4M3ZA 5C25A 4FM2A 2Z1GA 4KFBA 1BI4A 5FRMA 2RKIA 4M3UA 4FJNA 5KTQA 3NCIA 3LP1A 4KV8A 3CM6A 3C95A 3OJSA 4F2RA 4CIFA 3VQAA 3EZ5A 1B9FA 3P83D 4C8LA 4E1MA 3K57A 4HHTA 4O5BA 2FBTA 3BGRA 4E7IA 1RT3A 5KRTA 4J2BA 3SYZA 2OPSA 3ZSYA 3VQQA 3L2UA 1BQMA 3WNHA 1U4BA 2HMIA 3PX4A 1ASVA 1C1AA 1BHLA 2Z1IA 1RNHA 4ID1A 1UAXA 3SQ2A 4AHSA 3AVLA 5K14A 1RBUA 1S1XA 4AILC 5DK5A 1X9SA 4Z4GA 3U3GA 3QEVA 3VQ4A 1KRPA 1RDCA 4CEQA 1WNSA 1KFDA 3QNOA 3SPYA 2ZQBA 2HW3A 1S1UA 4BDZA 4B9VA 3I0SA 1L3VA 2IDOA 1FXXA 4FK0A 3ZSWA 3VN5A 4DTJA 4OGCA 3NGIA 1TKZA 5FROA 2HHQA 3OYNA 3AVCA 3O3GA 4B9MA 1BIUA 3AA5X 4FXDA 4FW2A 3WNFA 1L5UA 5J2QA 4CGIA 4Z4IA 3QEIA 1KVCA 2XHBA 5HRNA 3NGYA 4RW8A 3HPOA 2Y1IA 3M8SA 4OKJA 3TI0A 1YTAA 3O3FA 3ZSQA 5I3UA 1ASWA 1REVA 4HUFA 3MXMA 3HJFA 2KFZA 1LWCA 3C6TA 3ZT2A 4OLBA 3S9HA 2XY8A 3KIOA 4AHRA 4CF9A 1I39A 4W5NA 5SZTA 3DMJA 2QKKA 3DLHA 1ZBFA 4E7HA 2A1RA 4CHNA 3P1GA 3VQ8A 4IFYA 2D0CA 3KLHA 1NK0A 4NCAA 1JLCA 1DLOA 5FDLA 3HYFA 1RT2A 4AHUA 3THVA 1TAQA 4FLYA 2XY6A 1SKSA 1RT5A 1JEQA 2O4IA 1C6VA 4QAGA 4ELTA 3HPHA 1RBVA 3QESA 1ZYQA 4B9UA 3V1QA 1CXUA 3DRSA 1BCOA 4CHQA 4DLGA 1NJXA 2HNZA 4K8ZA 1TVRA 3SNNA 2FC0A 4BWMA 2ITGA 4O0IA 4KHNA 2G8IA 3QEPA 3RMCA 4ZTFA 3C94A 4CJTA 3SPZA 4CEEA 2QK9A 4HCBA 1JXBA 4CGFA 5SWMA 2X78A 3L3UA 4HTUA 3RTVA 1CXQA 5HBMA 4CCHA 2YHBA 4DSEA 3AVKA 1U47A 3ZSVA 2BDPA 1BISA 4KAZA 4RW4A 3TABA 4FJJA 1A5VA 3EY1A 3VQCA 1FKOA 1Y97A 4CF8A 1NJWA 2BGGA 4FLTA 4EP5A 1N5YA 3B6OA 1B92A 1HRHA 4CEDA 4PA1A 4M45A 3QEXA 2FBYA 3HP6A 1TKTA 5E41A 3OYJA 1T8EA 4Y1CA 4B8CA 2RN2A 4YNQA 5T7BA 4CIGA 3M8PA 1XC9A 2AJQA 3JYTA 2FBVA 4DU4A 4UZWA 4PUOA 4E0DA 3VQDA 4CHPA 5HP1A 2FBXA 4FJIA 4Z4EA 2O4GA 2WONA 3V1OA 1KSPA 3V9SA 2B6AA 3QETA 2P5GA 4FM0A 4FLUA 1BI4B 3CYMA 1LAVA 4ELVA 1ITGA 3MEDA 4HUEA 3T3FA 3B6PA 4N5SA 4QOZB 3KKRA 4B08A 4UQGA 3TANA 1NOZA 4CK3A 4DF4A 1L3SA 4E19A 3V9ZA 4H4OA 3QEWA 1VSHA 3TAPA 1GOAA 4AH9A 1RT6A 2YNIA 3QO9A 3SUPA 3VQEA 4Z4FA 3LAMA 3OYFA 4JRPA 3AO5A 4CK2A 3K5MA 4FCYA 3OS2A 3SV3A 1BGXT 3U6FA 3L2QA 4I9LA 3LANA 3ZT0A 5CYQA 5KGWA 1EX4A 1TV6A 3KLEA 3DLKA 4EZ9A 3LWLA 2OPQA 4KHSA 1DTQA 2IOCA 2Z1JA 2B4JA 4HUGA 2Y1JA 1XHXA 2E6LA 3AVGA 4CJ3A 4DTRA 2XY5A 1YT3A 1XI1A 3O4NA 1TK5A 3PUFA 3AVNA 4I9QA 4F4KA 2DFHA 1IKVA 4IG3A 2G8FA 4KHWA 3OJUA 2HHTA 3QLHA 4FW1A 1LV5A 4IFVA 4ZHRA 4CEOA 3HP9A 3OYAA 3S3NA 1J5OA 1CZ9A 4OVLA 3OVNA 4I2QA 4H8KA 2HVHA 3ITHA 4DFPA 4CJLA 1FK9A 4L8RB 1BIZA 1D5AA 2F96A 2GBZA 1IKXA 1NK8A 1RILA 3AVFA 1TK0A 2HHSA 1UA0A 2RPIA 4N76A 4KO0A 2HHXA 5FRNA 2X6NA 4OGEA 4I2PA 1UA1A 1WSJA 1I3AA 4LH4A 4OPKA 4GVMA 3RMAA 5HROA 3SJJA 4IBNA 1HMVA 2GUIA 3ULDA 1SL1A 3ASMA 3L8BA 5JS2A 2R7YA 1RDBA 4F2SA 4W5RA 4M3RA 1L3TA 5J2PA 3K5OA 3VQBA 1NK9A 3PO4A 4DFMA 1JL2A 4DF8A 3ZT1A 3ISNC 3S3OA 4BDPA 2QKBA 1BQNA 3F9KA 2YV0X 4ICLA 3TAGA 2YKNA 3NF9A 3OYLA 4I7FA 3SQ4A 3OS1A 3IG1A 4LSLA 3VQPA 3ZT4A 3LWMA 1KLNA 4J2DA 1RT1A 1LWFA 3P5JA 1S6PA 4CJPA 1BL3A 4KB1A 1W9HA 4FM1A 3AV9A 4RW7A 1T03A 4RW6A 1WLJA 4FJLA 1GOBA 4IKFA 3O3HA 2KVEA 3RMDA 2NUBA 4CGGA 4DFKA 1KVBA 4B3OA 3KK3A 4F8RA 4B9NA 4O55A 4E1NA 4DQIA 2IGIA 2IAJA 1WAFA 2KQ2A 3TWHA 4E7JA 4XIUA 4KHYA 4DWIA 2Q3SA 3OYBA 2PY5A 5CYMA 1VSIA 4M42A 3QNNA 4CF2A 2KVDA 2HNYA 4DTOA 3PO5A 3OYEA 3E01A 4R5PA 2W42A 1RCHA 3LP0A 3NE6A 1JLBA 4DQRA 4KPYA 1KTQA 3ZSOA 3AA2A 3DOKA 1SL0A 2KW4A 4C8KA 3RRHA 1HNVA 1J54A 4DS4A 3SUOA 1TAUA 1HNIA 3V1RA 2A1SA 1Z26A 4CF0A 1VSMA 4C8NA 3SQ0A 1S1WA 4M3YA 2KFNA 3K5LA 4KHUA 1ZBIA 2KZMA 5DMRA 4IDKA 2D0AA 1FKPA 4FJGA 3HK2A 1RTIA 2KTQA 4DS5A 3OYMA 1X9MA 2E6MA 1RTJA 2PZSA 3M8QA 1TKXA 1HQEA 4GW6A 4CJVA 3OYDA 3HSTB 1VRUA 4MQ3A 4CESA 4YFUA 1LW2A 1KCFA 4NYNA 4EP4A 4FVMA 1LWEA 4M41A 1JLGA 2HVIA 3S3MA 2RF2A 4FJ8A 2D0BA 4Y1DA 3ZCMA 4Z0UA 4BDYA 1A5WA 3DM2A 3M8RA 3PY8A 1MU2A 4B8AB 3NBPA 4FLWA 1RBRA 3JSMA 3HXMA 2RNNA 1RT7A 4CHYA 2EHGA 4N47A 2ZE2A 1C0UA 5KI6A 5C42A 4O4GA 3AVIA 3QERA 1NKEA 4CJKA 1TL1A 1G15A 2VG5A 3TAQA 4NCBA 3OY9A 3VQ7A 1JLFA 3DRRA 1RTHA 1VK0A 1ZBHA 1VSLA 4FZYA 5HLFA 4PY5A 4KREA 3IRXA 3A2FA 3LPTA 4OJRA 1VSFA 3AVBA 3KLGA 4LH5A 4W5QA 1C1CA 1T05A 4M3TA 4FYDA 2XO7A 2LSNA 1RDAA 3NF6A 3HT3A 3KK1A 4IG0A 2YNGA 1Z25A 4FJ7A 2HHVA 2Z1HA 2EX3A 3L2RA 2D5RA 1SKWA 3DOLA 4J2EA 3ALYA 2ATQA 3MEGA 4B9SA 1SKRA 3DLBA 4QCLA 1S9EA 2GV9A 3IS9A 3AO4A 4DLEA 3V9XA 3KD5E 4BWJA 1Q9YA 3KLIA 3K5NA 1QS4A 3SCXA 2OA8A 1XWLA 5KGXA 3QIOA 3L3VA 3ZSXA 4FLXA 3U3YA 1WN7A 4Z4CA 3NH1A 1WSGA 4KTZA 3SV4A 3DI6A 3MEEA 4DTSA 1U48A 1CLQA 3RWUA 2F8TA 1U49A 4CERA 4FK4A 1ZBUA 4CFCA 4CHOA 4CJSA 4C8OA 5C24A 3DRPA 4NYFA 3WNEA 1SUQA 2IS3A 5KRSA 4W5OA 4PQUA 4CK1A 4FJXA 4CGDA 4DU1A 4F3OA 1C0MA 1IO2A 2XRIA 1NJZA 4KI6A 1WAJA 2KW9A 2KZZA 3NFAA 2VG7A 1JLEA 3SUNA 4CJQA 3NF8A 1X1PA 5J1EA 1R0AA 1QSYA 3DLRA 3SQ1A 2DY4A 3HPGA 4DG1A 2VWJA 3RRGA 4AHTA 4FK2A 1U04A 2OPRA 4DMNA 3TAMA 1SV5A 3I8DA 4DSKA 3ZSZA 4BACA 2F8SA 3ZSRA 1YTUA 3DLEA 2BANA 4G1QA 3NAEA 4BE0A 1B9DA 3DYAA 4AHVA 4B9LA 1S5JA 2QXFA 1RTDA 4MFBA 2WQGA 4DTUA 2B5JA 3K59A 1S6QA 3RMBA 1RBSA 1QE1A 4CECA 4CFDA 3OYGA 1SL2A 1C1BA 2OPPA 3CG7A 2PYJA 2OZMA 3AA4A 2X6SA 4KI4A 1T7PA 2YHAA 2DFFA 1TK8A 4BITA 1KLMA 3MXIA 4B9TA 4TSXA 2P5OA 4RW9A 1VSDA 4F3TA 1WSIA 4O44A 2BE2A 2JGUA 3HM9A 3SZ2A 3HL8A 3VA0A 2X74A 3NF7A 4KTQA 3VA3A 3TAEA 3NH2A 4BE2A 4DQSA 4OKKA 3T19A 3NDKA 1RBTA 5HRSA 4ID5A 3AVJA 1NK4A 1VSKA 1C0TA 4CGJA 4Q5VA 1HYZA 1QHTA 4FJ5A 1EXQA 4LD0A 4E3SA 2G8HA 2JVWA 3NHGA 2VG6A 4K8XA 1V66A 1HQUA 2PYLA 3V6DA 1WSFA 4ELUA 1NK6A 3LALA 3OS0A 3WNGA 3AVAA 3L2WA 3FFIA 3MECA 1K6YA 4FJKA 3O4QA 4CFAA 3OYIA 1TL3A 3G0ZA 3VQ6A 1HYVA 1NJYA 2OZSA 2IC3A 3CM5A 4JS5A 4OPJA 3IAYA 3CFPA 3VQ5A 1NK7A 1BCMA 4GMJB 1ASUA 4E7LA 4CIEA 2G8UA 2HHUA 2HHWA 1JXEA 3KJVA 1ZBLA 3AO1A 4DTMA 3TAFA 2YNHA 1NOYA 4DSJA 4CJWA 4H4MA 3KKSA 1QSSA 2VWKA 3DLGA 1W0HA 2ETJA 1VSEA 3G10A 1LW0A 4JLHA 1S1TA 4CGHA 3F73A 3V9UA 4DTPA 4DSIA 4DSFA 2P1JA 3VQ9A 3NH0A 1DTTA 4E89A 5HRPA 4DU3A 3OYKA 1GOCA 4RG8A 3QIPA 2ZD1A 2E4LA 3CFRA 3RR8A 3HO1A 5JS1A 1H1JS 3V4IA 2KVUA 1JLQA 4KRFA 4FZXC 1YVUA 4OKEA 1CZBA 1TKDA 4KTWA 4FJ9A 3LP2A 4CFBA 1HPZA 3LPUA 1L3UA 1WSEA 1NK5A 4FJHA 4CEBA 4CEFA 3KD1E 2G8KA 5CY4A 4ZTJA 3D45A 1KFSA 4N41A 1J9AA 4NCGA 3LAKA 4W5TA 1RT4A 1UWBA 1D8YA 1JKHA 3SUQA 4LSNA 5CZ2A 2JLEA 1HJRA 1IH7A 3L2VA 1VSJA 3KLFA 3BDPA 3AO3A 3RR7A 4FZZA 1S9GA 3K2PA 3ZT3A 1VRTA 1QTMA 3EYZA 4FLZA 3V81A 4EZ6A 3PX6A 3V9WA 1EKEA 2G8WA 4OLAA 2G8VA 3I0RA 2XY7A 4PWDA 3UIQA 2OYQA 3AVMA 2I5JA 4DSLA 1KVAA 3QINA 3PX0A 4JRQA 3LZJA 3TARA 3OYHA 3C6UA 4BE1A 4CF1A 4HCCA 4HVJA 4J2AA 1LAWA 4CJUA 4Z4HA 3MAQA 1XHZA 4AHCA 3K58A 2YKMA 3LZIA 4DQQA 1Q9XA 1Q8IA 1JJRA 1O1WA 3CFOA 3D0PA 1QQCA 2HNDA 1F21A 3LP3A 1U45A 3H08A 1X9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J53 A;  4WE1 A;  4LY7 A;  2YNF A;  4CEA A;  4DQP A;  4M3X A;  1JL1 A;  3AA3 A;  1IKW A;  4N56 A;  4M3W A;  1HYS A;  3HVT A;  3HVR A;  4DTX A;  4CJE A;  3NGZ A;  5J2M A;  2WOM A;  3KTQ A;  3T1A A;  4KHQ A;  3KK2 A;  1RDD A;  4Q0B A;  4KKO A;  5J2N A;  5HRR A;  4FLV A;  1NKC A;  1NKB A;  4C8M A;  4CE9 A;  1TGO A;  3CQ8 A;  2P51 A;  4DFJ A;  1QSL A;  2DTU A;  4CHZ A;  4CJ5 A;  5D3G A;  5CZ1 A;  4KB0 A;  5I42 A;  1IKY A;  4CEZ A;  1N6Q A;  5EU7 A;  2HB5 A;  3MXJ A;  3OYC A;  1D9F A;  1JLA A;  4JS4 A;  4CJF A;  2RNO A;  4CJR A;  1WSH A;  1S1V A;  4E7K A;  3PV8 A;  1D9D A;  3AVH A;  3LDS A;  4O0J A;  3TR8 A;  1A5X A;  3SI6 A;  4FJM A;  1UOC A;  4CJ4 A;  3AO2 A;  2DFE A;  4DTN A;  1EET A;  1EP4 A;  1IG9 A;  4M3Z A;  5C25 A;  4FM2 A;  2Z1G A;  4KFB A;  1BI4 A;  5FRM A;  2RKI A;  4M3U A;  4FJN A;  5KTQ A;  3NCI A;  3LP1 A;  4KV8 A;  3CM6 A;  3C95 A;  3OJS A;  4F2R A;  4CIF A;  3VQA A;  3EZ5 A;  1B9F A;  3P83 D;  4C8L A;  4E1M A;  3K57 A;  4HHT A;  4O5B A;  2FBT A;  3BGR A;  4E7I A;  1RT3 A;  5KRT A;  4J2B A;  3SYZ A;  2OPS A;  3ZSY A;  3VQQ A;  3L2U A;  1BQM A;  3WNH A;  1U4B A;  2HMI A;  3PX4 A;  1ASV A;  1C1A A;  1BHL A;  2Z1I A;  1RNH A;  4ID1 A;  1UAX A;  3SQ2 A;  4AHS A;  3AVL A;  5K14 A;  1RBU A;  1S1X A;  4AIL C;  5DK5 A;  1X9S A;  4Z4G A;  3U3G A;  3QEV A;  3VQ4 A;  1KRP A;  1RDC A;  4CEQ A;  1WNS A;  1KFD A;  3QNO A;  3SPY A;  2ZQB A;  2HW3 A;  1S1U A;  4BDZ A;  4B9V A;  3I0S A;  1L3V A;  2IDO A;  1FXX A;  4FK0 A;  3ZSW A;  3VN5 A;  4DTJ A;  4OGC A;  3NGI A;  1TKZ A;  5FRO A;  2HHQ A;  3OYN A;  3AVC A;  3O3G A;  4B9M A;  1BIU A;  3AA5 X;  4FXD A;  4FW2 A;  3WNF A;  1L5U A;  5J2Q A;  4CGI A;  4Z4I A;  3QEI A;  1KVC A;  2XHB A;  5HRN A;  3NGY A;  4RW8 A;  3HPO A;  2Y1I A;  3M8S A;  4OKJ A;  3TI0 A;  1YTA A;  3O3F A;  3ZSQ A;  5I3U A;  1ASW A;  1REV A;  4HUF A;  3MXM A;  3HJF A;  2KFZ A;  1LWC A;  3C6T A;  3ZT2 A;  4OLB A;  3S9H A;  2XY8 A;  3KIO A;  4AHR A;  4CF9 A;  1I39 A;  4W5N A;  5SZT A;  3DMJ A;  2QKK A;  3DLH A;  1ZBF A;  4E7H A;  2A1R A;  4CHN A;  3P1G A;  3VQ8 A;  4IFY A;  2D0C A;  3KLH A;  1NK0 A;  4NCA A;  1JLC A;  1DLO A;  5FDL A;  3HYF A;  1RT2 A;  4AHU A;  3THV A;  1TAQ A;  4FLY A;  2XY6 A;  1SKS A;  1RT5 A;  1JEQ A;  2O4I A;  1C6V A;  4QAG A;  4ELT A;  3HPH A;  1RBV A;  3QES A;  1ZYQ A;  4B9U A;  3V1Q A;  1CXU A;  3DRS A;  1BCO A;  4CHQ A;  4DLG A;  1NJX A;  2HNZ A;  4K8Z A;  1TVR A;  3SNN A;  2FC0 A;  4BWM A;  2ITG A;  4O0I A;  4KHN A;  2G8I A;  3QEP A;  3RMC A;  4ZTF A;  3C94 A;  4CJT A;  3SPZ A;  4CEE A;  2QK9 A;  4HCB A;  1JXB A;  4CGF A;  5SWM A;  2X78 A;  3L3U A;  4HTU A;  3RTV A;  1CXQ A;  5HBM A;  4CCH A;  2YHB A;  4DSE A;  3AVK A;  1U47 A;  3ZSV A;  2BDP A;  1BIS A;  4KAZ A;  4RW4 A;  3TAB A;  4FJJ A;  1A5V A;  3EY1 A;  3VQC A;  1FKO A;  1Y97 A;  4CF8 A;  1NJW A;  2BGG A;  4FLT A;  4EP5 A;  1N5Y A;  3B6O A;  1B92 A;  1HRH A;  4CED A;  4PA1 A;  4M45 A;  3QEX A;  2FBY A;  3HP6 A;  1TKT A;  5E41 A;  3OYJ A;  1T8E A;  4Y1C A;  4B8C A;  2RN2 A;  4YNQ A;  5T7B A;  4CIG A;  3M8P A;  1XC9 A;  2AJQ A;  3JYT A;  2FBV A;  4DU4 A;  4UZW A;  4PUO A;  4E0D A;  3VQD A;  4CHP A;  5HP1 A;  2FBX A;  4FJI A;  4Z4E A;  2O4G A;  2WON A;  3V1O A;  1KSP A;  3V9S A;  2B6A A;  3QET A;  2P5G A;  4FM0 A;  4FLU A;  1BI4 B;  3CYM A;  1LAV A;  4ELV A;  1ITG A;  3MED A;  4HUE A;  3T3F A;  3B6P A;  4N5S A;  4QOZ B;  3KKR A;  4B08 A;  4UQG A;  3TAN A;  1NOZ A;  4CK3 A;  4DF4 A;  1L3S A;  4E19 A;  3V9Z A;  4H4O A;  3QEW A;  1VSH A;  3TAP A;  1GOA A;  4AH9 A;  1RT6 A;  2YNI A;  3QO9 A;  3SUP A;  3VQE A;  4Z4F A;  3LAM A;  3OYF A;  4JRP A;  3AO5 A;  4CK2 A;  3K5M A;  4FCY A;  3OS2 A;  3SV3 A;  1BGX T;  3U6F A;  3L2Q A;  4I9L A;  3LAN A;  3ZT0 A;  5CYQ A;  5KGW A;  1EX4 A;  1TV6 A;  3KLE A;  3DLK A;  4EZ9 A;  3LWL A;  2OPQ A;  4KHS A;  1DTQ A;  2IOC A;  2Z1J A;  2B4J A;  4HUG A;  2Y1J A;  1XHX A;  2E6L A;  3AVG A;  4CJ3 A;  4DTR A;  2XY5 A;  1YT3 A;  1XI1 A;  3O4N A;  1TK5 A;  3PUF A;  3AVN A;  4I9Q A;  4F4K A;  2DFH A;  1IKV A;  4IG3 A;  2G8F A;  4KHW A;  3OJU A;  2HHT A;  3QLH A;  4FW1 A;  1LV5 A;  4IFV A;  4ZHR A;  4CEO A;  3HP9 A;  3OYA A;  3S3N A;  1J5O A;  1CZ9 A;  4OVL A;  3OVN A;  4I2Q A;  4H8K A;  2HVH A;  3ITH A;  4DFP A;  4CJL A;  1FK9 A;  4L8R B;  1BIZ A;  1D5A A;  2F96 A;  2GBZ A;  1IKX A;  1NK8 A;  1RIL A;  3AVF A;  1TK0 A;  2HHS A;  1UA0 A;  2RPI A;  4N76 A;  4KO0 A;  2HHX A;  5FRN A;  2X6N A;  4OGE A;  4I2P A;  1UA1 A;  1WSJ A;  1I3A A;  4LH4 A;  4OPK A;  4GVM A;  3RMA A;  5HRO A;  3SJJ A;  4IBN A;  1HMV A;  2GUI A;  3ULD A;  1SL1 A;  3ASM A;  3L8B A;  5JS2 A;  2R7Y A;  1RDB A;  4F2S A;  4W5R A;  4M3R A;  1L3T A;  5J2P A;  3K5O A;  3VQB A;  1NK9 A;  3PO4 A;  4DFM A;  1JL2 A;  4DF8 A;  3ZT1 A;  3ISN C;  3S3O A;  4BDP A;  2QKB A;  1BQN A;  3F9K A;  2YV0 X;  4ICL A;  3TAG A;  2YKN A;  3NF9 A;  3OYL A;  4I7F A;  3SQ4 A;  3OS1 A;  3IG1 A;  4LSL A;  3VQP A;  3ZT4 A;  3LWM A;  1KLN A;  4J2D A;  1RT1 A;  1LWF A;  3P5J A;  1S6P A;  4CJP A;  1BL3 A;  4KB1 A;  1W9H A;  4FM1 A;  3AV9 A;  4RW7 A;  1T03 A;  4RW6 A;  1WLJ A;  4FJL A;  1GOB A;  4IKF A;  3O3H A;  2KVE A;  3RMD A;  2NUB A;  4CGG A;  4DFK A;  1KVB A;  4B3O A;  3KK3 A;  4F8R A;  4B9N A;  4O55 A;  4E1N A;  4DQI A;  2IGI A;  2IAJ A;  1WAF A;  2KQ2 A;  3TWH A;  4E7J A;  4XIU A;  4KHY A;  4DWI A;  2Q3S A;  3OYB A;  2PY5 A;  5CYM A;  1VSI A;  4M42 A;  3QNN A;  4CF2 A;  2KVD A;  2HNY A;  4DTO A;  3PO5 A;  3OYE A;  3E01 A;  4R5P A;  2W42 A;  1RCH A;  3LP0 A;  3NE6 A;  1JLB A;  4DQR A;  4KPY A;  1KTQ A;  3ZSO A;  3AA2 A;  3DOK A;  1SL0 A;  2KW4 A;  4C8K A;  3RRH A;  1HNV A;  1J54 A;  4DS4 A;  3SUO A;  1TAU A;  1HNI A;  3V1R A;  2A1S A;  1Z26 A;  4CF0 A;  1VSM A;  4C8N A;  3SQ0 A;  1S1W A;  4M3Y A;  2KFN A;  3K5L A;  4KHU A;  1ZBI A;  2KZM A;  5DMR A;  4IDK A;  2D0A A;  1FKP A;  4FJG A;  3HK2 A;  1RTI A;  2KTQ A;  4DS5 A;  3OYM A;  1X9M A;  2E6M A;  1RTJ A;  2PZS A;  3M8Q A;  1TKX A;  1HQE A;  4GW6 A;  4CJV A;  3OYD A;  3HST B;  1VRU A;  4MQ3 A;  4CES A;  4YFU A;  1LW2 A;  1KCF A;  4NYN A;  4EP4 A;  4FVM A;  1LWE A;  4M41 A;  1JLG A;  2HVI A;  3S3M A;  2RF2 A;  4FJ8 A;  2D0B A;  4Y1D A;  3ZCM A;  4Z0U A;  4BDY A;  1A5W A;  3DM2 A;  3M8R A;  3PY8 A;  1MU2 A;  4B8A B;  3NBP A;  4FLW A;  1RBR A;  3JSM A;  3HXM A;  2RNN A;  1RT7 A;  4CHY A;  2EHG A;  4N47 A;  2ZE2 A;  1C0U A;  5KI6 A;  5C42 A;  4O4G A;  3AVI A;  3QER A;  1NKE A;  4CJK A;  1TL1 A;  1G15 A;  2VG5 A;  3TAQ A;  4NCB A;  3OY9 A;  3VQ7 A;  1JLF A;  3DRR A;  1RTH A;  1VK0 A;  1ZBH A;  1VSL A;  4FZY A;  5HLF A;  4PY5 A;  4KRE A;  3IRX A;  3A2F A;  3LPT A;  4OJR A;  1VSF A;  3AVB A;  3KLG A;  4LH5 A;  4W5Q A;  1C1C A;  1T05 A;  4M3T A;  4FYD A;  2XO7 A;  2LSN A;  1RDA A;  3NF6 A;  3HT3 A;  3KK1 A;  4IG0 A;  2YNG A;  1Z25 A;  4FJ7 A;  2HHV A;  2Z1H A;  2EX3 A;  3L2R A;  2D5R A;  1SKW A;  3DOL A;  4J2E A;  3ALY A;  2ATQ A;  3MEG A;  4B9S A;  1SKR A;  3DLB A;  4QCL A;  1S9E A;  2GV9 A;  3IS9 A;  3AO4 A;  4DLE A;  3V9X A;  3KD5 E;  4BWJ A;  1Q9Y A;  3KLI A;  3K5N A;  1QS4 A;  3SCX A;  2OA8 A;  1XWL A;  5KGX A;  3QIO A;  3L3V A;  3ZSX A;  4FLX A;  3U3Y A;  1WN7 A;  4Z4C A;  3NH1 A;  1WSG A;  4KTZ A;  3SV4 A;  3DI6 A;  3MEE A;  4DTS A;  1U48 A;  1CLQ A;  3RWU A;  2F8T A;  1U49 A;  4CER A;  4FK4 A;  1ZBU A;  4CFC A;  4CHO A;  4CJS A;  4C8O A;  5C24 A;  3DRP A;  4NYF A;  3WNE A;  1SUQ A;  2IS3 A;  5KRS A;  4W5O A;  4PQU A;  4CK1 A;  4FJX A;  4CGD A;  4DU1 A;  4F3O A;  1C0M A;  1IO2 A;  2XRI A;  1NJZ A;  4KI6 A;  1WAJ A;  2KW9 A;  2KZZ A;  3NFA A;  2VG7 A;  1JLE A;  3SUN A;  4CJQ A;  3NF8 A;  1X1P A;  5J1E A;  1R0A A;  1QSY A;  3DLR A;  3SQ1 A;  2DY4 A;  3HPG A;  4DG1 A;  2VWJ A;  3RRG A;  4AHT A;  4FK2 A;  1U04 A;  2OPR A;  4DMN A;  3TAM A;  1SV5 A;  3I8D A;  4DSK A;  3ZSZ A;  4BAC A;  2F8S A;  3ZSR A;  1YTU A;  3DLE A;  2BAN A;  4G1Q A;  3NAE A;  4BE0 A;  1B9D A;  3DYA A;  4AHV A;  4B9L A;  1S5J A;  2QXF A;  1RTD A;  4MFB A;  2WQG A;  4DTU A;  2B5J A;  3K59 A;  1S6Q A;  3RMB A;  1RBS A;  1QE1 A;  4CEC A;  4CFD A;  3OYG A;  1SL2 A;  1C1B A;  2OPP A;  3CG7 A;  2PYJ A;  2OZM A;  3AA4 A;  2X6S A;  4KI4 A;  1T7P A;  2YHA A;  2DFF A;  1TK8 A;  4BIT A;  1KLM A;  3MXI A;  4B9T A;  4TSX A;  2P5O A;  4RW9 A;  1VSD A;  4F3T A;  1WSI A;  4O44 A;  2BE2 A;  2JGU A;  3HM9 A;  3SZ2 A;  3HL8 A;  3VA0 A;  2X74 A;  3NF7 A;  4KTQ A;  3VA3 A;  3TAE A;  3NH2 A;  4BE2 A;  4DQS A;  4OKK A;  3T19 A;  3NDK A;  1RBT A;  5HRS A;  4ID5 A;  3AVJ A;  1NK4 A;  1VSK A;  1C0T A;  4CGJ A;  4Q5V A;  1HYZ A;  1QHT A;  4FJ5 A;  1EXQ A;  4LD0 A;  4E3S A;  2G8H A;  2JVW A;  3NHG A;  2VG6 A;  4K8X A;  1V66 A;  1HQU A;  2PYL A;  3V6D A;  1WSF A;  4ELU A;  1NK6 A;  3LAL A;  3OS0 A;  3WNG A;  3AVA A;  3L2W A;  3FFI A;  3MEC A;  1K6Y A;  4FJK A;  3O4Q A;  4CFA A;  3OYI A;  1TL3 A;  3G0Z A;  3VQ6 A;  1HYV A;  1NJY A;  2OZS A;  2IC3 A;  3CM5 A;  4JS5 A;  4OPJ A;  3IAY A;  3CFP A;  3VQ5 A;  1NK7 A;  1BCM A;  4GMJ B;  1ASU A;  4E7L A;  4CIE A;  2G8U A;  2HHU A;  2HHW A;  1JXE A;  3KJV A;  1ZBL A;  3AO1 A;  4DTM A;  3TAF A;  2YNH A;  1NOY A;  4DSJ A;  4CJW A;  4H4M A;  3KKS A;  1QSS A;  2VWK A;  3DLG A;  1W0H A;  2ETJ A;  1VSE A;  3G10 A;  1LW0 A;  4JLH A;  1S1T A;  4CGH A;  3F73 A;  3V9U A;  4DTP A;  4DSI A;  4DSF A;  2P1J A;  3VQ9 A;  3NH0 A;  1DTT A;  4E89 A;  5HRP A;  4DU3 A;  3OYK A;  1GOC A;  4RG8 A;  3QIP A;  2ZD1 A;  2E4L A;  3CFR A;  3RR8 A;  3HO1 A;  5JS1 A;  1H1J S;  3V4I A;  2KVU A;  1JLQ A;  4KRF A;  4FZX C;  1YVU A;  4OKE A;  1CZB A;  1TKD A;  4KTW A;  4FJ9 A;  3LP2 A;  4CFB A;  1HPZ A;  3LPU A;  1L3U A;  1WSE A;  1NK5 A;  4FJH A;  4CEB A;  4CEF A;  3KD1 E;  2G8K A;  5CY4 A;  4ZTJ A;  3D45 A;  1KFS A;  4N41 A;  1J9A A;  4NCG A;  3LAK A;  4W5T A;  1RT4 A;  1UWB A;  1D8Y A;  1JKH A;  3SUQ A;  4LSN A;  5CZ2 A;  2JLE A;  1HJR A;  1IH7 A;  3L2V A;  1VSJ A;  3KLF A;  3BDP A;  3AO3 A;  3RR7 A;  4FZZ A;  1S9G A;  3K2P A;  3ZT3 A;  1VRT A;  1QTM A;  3EYZ A;  4FLZ A;  3V81 A;  4EZ6 A;  3PX6 A;  3V9W A;  1EKE A;  2G8W A;  4OLA A;  2G8V A;  3I0R A;  2XY7 A;  4PWD A;  3UIQ A;  2OYQ A;  3AVM A;  2I5J A;  4DSL A;  1KVA A;  3QIN A;  3PX0 A;  4JRQ A;  3LZJ A;  3TAR A;  3OYH A;  3C6U A;  4BE1 A;  4CF1 A;  4HCC A;  4HVJ A;  4J2A A;  1LAW A;  4CJU A;  4Z4H A;  3MAQ A;  1XHZ A;  4AHC A;  3K58 A;  2YKM A;  3LZI A;  4DQQ A;  1Q9X A;  1Q8I A;  1JJR A;  1O1W A;  3CFO A;  3D0P A;  1QQC A;  2HND A;  1F21 A;  3LP3 A;  1U45 A;  3H08 A;  1X9W A; 
#chains in the Genus database with same CATH topology
 1ATR A;  1NGB A;  4LY7 A;  2YNF A;  4CEA A;  5JLF A;  4M3W A;  4DTX A;  3NGZ A;  3SAG A;  5J2M A;  2O8C B;  3T1A A;  3F5T A;  4RTF D;  1VQ7 N;  4WF9 L;  3LDP A;  4CE9 A;  3G4S N;  3FFK B;  4JKB A;  3CQ8 A;  2NRR A;  5D3G A;  4KB0 A;  1GLC G;  2HB5 A;  3U9D A;  5JVH L;  4JS4 A;  4E7K A;  2RNO A;  1S1V A;  3AVH A;  4H0P A;  3LDS A;  4DTN A;  1IG9 A;  5C25 A;  3KHY A;  2D0O A;  4KFB A;  1BI4 A;  4DHY A;  3CPE A;  4FJN A;  3FZK A;  2P9U A;  3CM6 A;  2D4W A;  4F9O A;  3G25 A;  2GX9 A;  3TU5 A;  4IO9 L;  4F2R A;  5BR9 A;  3P83 D;  4OO1 J;  5AQI A;  4HHT A;  4YHH K;  2FBT A;  4YOV A;  1RT3 A;  4J2B A;  3AY9 A;  3ZSY A;  5DM6 L;  2VGN A;  4GNI A;  4BC3 A;  3R6M A;  1ASV A;  1RNH A;  2DPN A;  1UAX A;  4ID1 A;  5AQF A;  3H1Q A;  4AIL C;  1X9S A;  3VMF B;  3QB0 A;  1KFD A;  4CZE A;  4BRC A;  3I56 N;  3CCM N;  1YJN N;  2HW3 A;  1S1U A;  1T6C A;  5A2Q O;  1L3V A;  1X3N A;  4J8F A;  3IMX A;  3CXC M;  3OYN A;  5AJ3 K;  4Z4I A;  1EN7 A;  3M8S A;  3P38 A;  4JKF A;  1ZBS A;  3C6T A;  2I7N A;  4OLB A;  3S9H A;  3KIO A;  4W5N A;  4AHR A;  1QZ5 A;  4IWV A;  5SZT A;  4BR0 A;  3TTC A;  3WXJ A;  1ZBF A;  4H0O A;  4CJ7 A;  3KLH A;  3BEX A;  3HYF A;  3VEO A;  4AHU A;  3THV A;  3AAQ A;  1TAQ A;  1RT5 A;  2O8E A;  1C6V A;  1DGK N;  2CH6 A;  4ELT A;  3A8Y A;  1CXU A;  2D1K A;  3MWT A;  4MLH A;  2UXB K;  1TVR A;  3SNN A;  2ITG A;  3QEP A;  2UU9 K;  4HCB A;  4CGF A;  2X78 A;  3L3U A;  5B8H A;  5AQX A;  4JYA K;  1GJJ A;  2YHY A;  3VEX A;  4I6M A;  4K42 A;  1NG9 A;  4A2A A;  4CF8 A;  2BGG A;  1NJW A;  4CZM A;  3B6O A;  1JEI A;  1YJ9 N;  1JJ2 M;  3U8X A;  5F0X A;  2YCH A;  4FWR A;  3QEX A;  3HP6 A;  1TKT A;  4B8C A;  5T7B A;  3CCJ N;  1XC9 A;  3FE1 A;  3THX B;  4PUO A;  3L4Q A;  3MCA B;  2FBX A;  2O4G A;  3V1O A;  1KSP A;  2B6A A;  2P5G A;  4NB4 A;  4HUE A;  3PIO L;  3T3F A;  4O8U A;  3EL2 A;  3WEE B;  4FPB A;  1GOA A;  3BZK A;  4Z4F A;  4YDU C;  2WTU A;  4PKH A;  4FCY A;  4X66 K;  1BGX T;  4DFK A;  4EZ9 A;  5KGW A;  4KHS A;  3WQT A;  2E6L A;  3CQX A;  2XY5 A;  4JI4 K;  4FWS A;  4F4K A;  1IKV A;  4BR2 A;  3L0O A;  4KHW A;  3FGU A;  3OJU A;  2HHT A;  4JKC A;  2Q0U A;  3AAP A;  4ZHR A;  1J5O A;  3S3N A;  1VQM N;  4OVL A;  2HVH A;  4H8K A;  4H5T A;  4HTL A;  4CJL A;  3C0B A;  1NK8 A;  1RIL A;  3AVF A;  1UA0 A;  2RPI A;  2HHX A;  4GKK K;  2O8B A;  4CZH A;  1WSJ A;  2O8D B;  2GUI A;  3ULD A;  2UUC K;  2R7Y A;  3T69 A;  1L3T A;  3ZET B;  1DEJ A;  1NK9 A;  3PO4 A;  1JL2 A;  4DF8 A;  3ISN C;  3TAG A;  4FOI A;  4I7F A;  3MN7 A;  5EXW A;  3FLG A;  1RT1 A;  1LWF A;  2YJF A;  3VF2 A;  5KPZ A;  1BL3 A;  4FM1 A;  1T03 A;  3O9U A;  1WLJ A;  2CH5 A;  4CGG A;  3HBT A;  1SQK A;  3T7Z A;  1P8Z A;  3KK3 A;  4B3R K;  4DQI A;  4DKW A;  4RCH A;  3TWH A;  1VQN N;  4DWI A;  1YJW N;  4Y0W A;  1T6D A;  2HNY A;  4LF4 K;  1RCH A;  4ISE A;  3CMA N;  1GLF O;  4KPY A;  3AA2 A;  1SL0 A;  4C8K A;  3Q7B A;  3VEZ A;  1TAU A;  1MWK A;  1HNI A;  4CF0 A;  4LC9 B;  2KFN A;  1E4G T;  5M1O A;  4KHU A;  1ZBI A;  4CJV A;  1HQE A;  2E1Z A;  4LF7 K;  3OYD A;  1NGJ A;  1KCF A;  4FVM A;  4M41 A;  1JLG A;  2WUS A;  4B1U B;  4IJN A;  3ZCM A;  5M1P A;  4B8A B;  3NBP A;  1RBR A;  3JSM A;  2RNN A;  1C0U A;  5C42 A;  1NKE A;  2A8V A;  1G15 A;  2CGJ A;  4FSV A;  1ZBH A;  4A61 A;  1VSL A;  4FZY A;  4KRE A;  3LPT A;  4OJR A;  3KLG A;  5AQL A;  1NGG A;  2XO7 A;  3L2R A;  1RDU A;  2D5R A;  4H0X B;  4A2B A;  3MEG A;  1QVF M;  4DLE A;  3D2F A;  5JVG L;  3K5N A;  2OA8 A;  5M1K A;  3UE5 A;  3U3Y A;  2JWK A;  3CET A;  1CLQ A;  1U48 A;  3RWU A;  2F8T A;  1ZBU A;  4B1X B;  4CFC A;  1NNE A;  4CJS A;  4C8O A;  5C24 A;  3TPQ A;  3QKJ A;  4BGA A;  1KC8 O;  4CGD A;  4F3O A;  1C0M A;  1GLD G;  3DXM B;  2UUA K;  1NJI O;  1WAJ A;  2KW9 A;  1ESV A;  1X1P A;  3WQU A;  5J1E A;  5F2R A;  4IOA L;  2I7P A;  5C12 A;  1HX1 A;  2OPR A;  4Z94 A;  1N34 K;  1SV5 A;  3ENB A;  4BAC A;  3ZSR A;  1YTU A;  1VQ6 N;  4QS8 A;  5GAD P;  2O8C A;  2WQG A;  4JD2 B;  3K59 A;  1RBS A;  1QE1 A;  3CG7 A;  4IFE A;  2OZM A;  3AA4 A;  4KI4 A;  4BRA A;  2DFF A;  4L3Q A;  1TK8 A;  4H0Y B;  1VSD A;  2P9S B;  4XH5 A;  1HKG A;  4KBO A;  2BE2 A;  1K73 O;  4OX9 K;  3HL8 A;  1J6Z A;  3VA3 A;  3NH2 A;  1EO1 A;  3GBT A;  3O6W A;  3T19 A;  3NDK A;  1WBD A;  4RWT A;  1RBT A;  1A62 A;  3EE8 A;  2VWB A;  5HRS A;  4BR7 A;  5KQD A;  1C0T A;  4LD0 A;  4E3S A;  5AQQ A;  1MWM A;  1V66 A;  4YOU A;  1HQU A;  2PYL A;  4ELU A;  3LAL A;  1JCE A;  4OPA A;  1K6Y A;  4FJK A;  3G0Z A;  2OZS A;  3CI5 A;  4BR4 A;  3CM5 A;  3IAY A;  4PHT X;  1IV0 A;  2HHW A;  3A5M C;  5FPN A;  1JXE A;  3AO1 A;  3TAF A;  2VWK A;  3OBY A;  4JLH A;  4FLV A;  3F73 A;  3VER A;  1S1T A;  4DSF A;  3GOI A;  1BOT O;  2E2N A;  2FSN A;  4WCE L;  4E89 A;  4JAX A;  4RG8 A;  4CBU A;  2D0P A;  3I8B A;  3RR8 A;  5JS1 A;  3V4I A;  2KVU A;  4BQL A;  3A5N C;  4M7Y A;  3LP2 A;  2P9I B;  3LPU A;  2G8K A;  1KFS A;  4JI7 K;  2HF3 A;  2Q1N A;  4MO4 A;  3RVC A;  4JEP A;  2HMP A;  3KLF A;  3BDP A;  2P9L A;  3BY5 A;  3CC7 N;  1QTM A;  4FLZ A;  4EZ6 A;  3PX6 A;  4PWD A;  5AQH A;  3HTV A;  1KVA A;  3QIN A;  4DR2 K;  2GWJ A;  3LZJ A;  5DM7 L;  3C6U A;  3KWG A;  1XHZ A;  4AHC A;  3K58 A;  3IFR A;  4BRD A;  1O1W A;  2LC3 A;  1QQC A;  2HND A;  3LDL A;  2ZJR L;  3DWL A;  3H08 A;  2A40 A;  4JHD B;  3CJ7 A;  4CI6 A;  4M3X A;  1JL1 A;  4LFB K;  2JWL A;  2WOM A;  4DV4 K;  4Q0B A;  2NRH A;  4JI3 K;  1NKC A;  1NKB A;  3SAH A;  1TGO A;  2DTU A;  1EQY A;  4CHZ A;  4CJ5 A;  5I42 A;  2ZWH A;  1IKY A;  3MXJ A;  3OYC A;  1D9F A;  3THX A;  1WSH A;  4CZF A;  5BR8 K;  4O0J A;  5TKW A;  1UOC A;  2ASO A;  4CJ4 A;  1EET A;  2FF3 B;  4FM2 A;  2Z1G A;  4XH4 A;  2ITM A;  2RKI A;  1IBM K;  3NCI A;  3LP1 A;  3ZYY X;  3PSF A;  3C95 A;  1ATS A;  5JMV A;  4CIF A;  4WFA L;  3EZ5 A;  3P31 A;  3BGR A;  4E7I A;  3SYZ A;  1KHC A;  1BQM A;  4DR4 K;  2HMI A;  3PX4 A;  4LFA K;  1FJG K;  4AHS A;  3AVL A;  1RBU A;  5DK5 A;  5FLX O;  1BWF O;  2BTF A;  3QEV A;  2DK4 A;  4CEQ A;  3QNO A;  5LY3 A;  3FR0 A;  2QWR A;  4B9V A;  1HKC A;  1FXX A;  4FK0 A;  3ZSW A;  4B1Y B;  4DTJ A;  1TKZ A;  5FRO A;  2HHQ A;  2VQE K;  1MA9 B;  3O3G A;  3AA5 X;  4FXD A;  1K8A O;  3WNF A;  4E1J A;  3CJC A;  5J2Q A;  2KHO A;  1KVC A;  3R8E A;  2A6A A;  3U4L A;  2XHB A;  4IZ9 A;  1VQP N;  2E5L K;  2O8D A;  1YTA A;  4O8K A;  3HJF A;  3ZT2 A;  4M7X A;  3ZET A;  3J80 O;  1HR0 K;  3J81 O;  3ZLJ A;  1I39 A;  2PBD A;  1V4T A;  2QKK A;  3DLH A;  4CHN A;  3M3Z A;  1NGA A;  4DB3 A;  3P1G A;  1JLC A;  1DLO A;  5FDL A;  5AQP A;  2ZGZ A;  2VQF K;  4FLY A;  1SKS A;  5ELZ A;  1T3V A;  1KQS M;  3H46 O;  4QAG A;  5AZJ B;  1BCO A;  4CHQ A;  4DLG A;  1BG3 A;  4K8Z A;  5BRD A;  4BWM A;  4O0I A;  1VQ4 N;  3RMC A;  4ZTF A;  4FWN A;  4CJT A;  3SPZ A;  4CEE A;  2QK9 A;  4DV5 K;  3RTV A;  4CCH A;  5HBM A;  1U47 A;  2AP1 A;  1ZS9 A;  2QWQ A;  3I33 A;  5C15 A;  2O8F B;  4FLT A;  1N5Y A;  3RSE B;  4PA1 A;  5AZI B;  3QDK A;  2FBY A;  4CD3 A;  5E41 A;  4Y1C A;  4CIG A;  4JK7 A;  2G80 A;  3M8P A;  2AJQ A;  2FBV A;  3EO3 A;  4AM7 A;  4CHP A;  5BPL A;  4FM0 A;  3CYM A;  4ELV A;  1EWQ A;  4QOZ B;  4UQG A;  3WUH A;  5M1F A;  4AQY K;  1NGF A;  5GAE P;  3CD6 N;  4CZG A;  4E19 A;  3V9Z A;  1RT6 A;  2YNI A;  5CHI A;  2VCP A;  3AO5 A;  2QEX N;  3U6F A;  3L2Q A;  3LAN A;  3MX5 A;  1EX4 A;  1TV6 A;  2OTL N;  3DLK A;  2OPQ A;  3A5L C;  2Z1J A;  3E66 A;  4CJ3 A;  2NRV A;  3O1W A;  1XI1 A;  3O4N A;  1TK5 A;  3PUF A;  3QLH A;  3OYA A;  4CEO A;  3HP9 A;  3LLR A;  3ITH A;  1FK9 A;  4WFB L;  4NXN K;  2HHS A;  1TK0 A;  3L6Q A;  4DR1 K;  4N76 A;  5FRN A;  2X6N A;  4XH1 A;  4I2P A;  3MN9 A;  4LH4 A;  1I3A A;  3A5O C;  4GVM A;  3SJJ A;  2QWP A;  1HMV A;  3H3N O;  3DXM A;  3L8B A;  4GY2 B;  3OTO K;  3LDN A;  1W97 L;  2P9P B;  2QKB A;  1BQN A;  3SQ4 A;  4K41 A;  3OYL A;  3OS1 A;  3IG1 A;  4LSL A;  2VYP A;  3LWM A;  2QNC A;  1EWR A;  3SJH A;  4CJP A;  3AV9 A;  4RW7 A;  4JD2 A;  1GOB A;  4GV6 A;  4BC5 A;  2KVE A;  2NUB A;  1NU0 A;  4ILJ A;  5AQU A;  4E1N A;  2IAJ A;  4E7J A;  1XMQ K;  2E20 A;  5LJV A;  4GV3 A;  1BA1 A;  3ATV A;  2P9S A;  3D6R A;  2KVD A;  4DTO A;  3E01 A;  4BRH A;  3DOK A;  3RRH A;  3LM2 A;  4MLE A;  3V1R A;  2A1S A;  4M3Y A;  5AR0 A;  2KZM A;  1X9M A;  1GLA G;  3CER A;  1TUU A;  4KH5 A;  1HNX K;  1H1V A;  3HST B;  1VRU A;  3THW B;  4YFU A;  2E88 A;  4B1V A;  4EP4 A;  2PAV A;  2RF2 A;  2D0B A;  3THY B;  1JCF A;  3M8R A;  1OH8 A;  1OH6 A;  4GV9 A;  4MDA A;  4H5W A;  3HXM A;  1NGI A;  1RT7 A;  1K8K B;  4N47 A;  3AVI A;  3QER A;  4CJK A;  4WQ5 C;  3OY9 A;  3VQ7 A;  1JLF A;  4EAH D;  5HLF A;  4PY5 A;  1RGI A;  3IRX A;  2OAN A;  4K43 A;  4LH5 A;  4W5Q A;  2W6K A;  3IDH A;  1T05 A;  4FYD A;  1Z25 A;  2P9I A;  2HHV A;  3O80 A;  3VET A;  2Z1H A;  2EX3 A;  4WFN L;  1SKW A;  5E84 A;  3DOL A;  1QQN A;  1SKR A;  3HI0 A;  5BPN A;  5HL7 L;  3V9X A;  4BWJ A;  3ZEU B;  3KLI A;  1Q9Y A;  2UUB K;  1U2V B;  3QIO A;  4KTZ A;  3DI6 A;  4BC2 A;  3CQY A;  3CPW M;  4CER A;  1U49 A;  4FK4 A;  4ILG B;  3JXU A;  1X3M A;  4CK1 A;  3ZX0 A;  1YAG A;  3CCR N;  4IXC A;  4KI6 A;  4U67 L;  2KZZ A;  3SUN A;  2VG7 A;  3TTF A;  4CJQ A;  3NF8 A;  3O5B A;  2ODG C;  3FZH A;  3SQ1 A;  1VAZ A;  4OPH A;  4JHD A;  4JKE A;  3J7A P;  4DMN A;  3TAM A;  3O9S A;  1SS6 A;  2WBN A;  4JI6 K;  3DLE A;  2BAN A;  4G1Q A;  3NAE A;  4BE0 A;  4FO0 A;  1VQ5 N;  1S5J A;  3RMB A;  3SK3 A;  4CEC A;  2V51 B;  4CFD A;  3OYG A;  2IIR A;  2X6S A;  2YHA A;  1HPM A;  4BIT A;  1KLM A;  4CBW A;  2P5O A;  4RW9 A;  2ASP A;  3SAF A;  3SZ2 A;  3TTD A;  2QA4 N;  1YI2 N;  1NGD A;  5AQY A;  4DQS A;  2CGL A;  4OKK A;  4CZL A;  3LDO A;  3ENO A;  4JN4 A;  1HYZ A;  4FJ5 A;  3NHG A;  4ILH A;  3VF6 A;  3V6D A;  1WOQ A;  3W0L A;  2IVO A;  3WNG A;  3VTI A;  5C0Y A;  4JKH A;  4JI2 K;  4CZI A;  4OPJ A;  1KXP A;  3CFP A;  2HHU A;  1ZBL A;  4DTM A;  4DR7 K;  3KKS A;  2P9N A;  3DLG A;  4K25 A;  1W0H A;  4DTP A;  3V9U A;  5GAH P;  3DXK B;  5LJW A;  4YOW A;  1M1K O;  4BY9 C;  1GOC A;  1IBK K;  3QML A;  3CFR A;  3HO1 A;  4A5A A;  4KRF A;  1TKD A;  4KTW A;  3KK7 A;  4ISG A;  1XUP O;  4CEB A;  3VOV A;  3SMS A;  4CEF A;  3ZX3 A;  3DAW A;  1KAY A;  3CC4 N;  1RT4 A;  1YVN A;  4H0V B;  1D8Y A;  1JKH A;  2JLE A;  3O9R A;  1HJR A;  1VSJ A;  5IT9 O;  3AO3 A;  3RR7 A;  4FZZ A;  1S9G A;  3K2P A;  3ZT3 A;  1VRT A;  2QWN A;  1VQO N;  3EYZ A;  3V81 A;  3V9W A;  1EKE A;  2XY7 A;  3UIQ A;  2I5J A;  5AZJ A;  4JRQ A;  1Z05 A;  3C65 A;  4DV3 K;  4BE1 A;  4HCC A;  4J2A A;  2ZJQ L;  4Z4H A;  3CCV N;  2YKM A;  1Q9X A;  3O08 A;  1JJR A;  4WQ4 C;  3D0P A;  3SUO A;  2HHH K;  3BZC A;  3LP3 A;  1J53 A;  4DQP A;  3HVT A;  3HVR A;  5BRH A;  1NGC A;  5J2N A;  4C8M A;  1E7D A;  5GAG P;  5E26 A;  2O8F A;  3RSE A;  2P51 A;  3HSC A;  4JI5 K;  5AZI A;  3AGK A;  4CEZ A;  3WXM B;  5EU7 A;  1JLA A;  4V19 S;  4CJF A;  4CJR A;  3OA9 A;  1D9D A;  3PV8 A;  4H5N A;  1A5X A;  4FJM A;  3NMU A;  3HM8 A;  3AO2 A;  2WFB A;  1C0F A;  4IEI A;  5KPT A;  2J4R A;  5KTQ A;  5C2F A;  3O1B A;  1Z6R A;  4KV8 A;  2W41 A;  5AQK A;  1B9F A;  4C8L A;  4E1M A;  3K57 A;  4O5B A;  4KHP K;  2KKZ A;  4LFC K;  2GTD A;  5KRT A;  3SMP A;  3VQQ A;  3L2U A;  1QVG M;  3WNH A;  1U4B A;  1OVY A;  1C1A A;  1BHL A;  3SQ2 A;  2Q97 A;  3EZW A;  5K14 A;  1S1X A;  4Z4G A;  3U3G A;  3M6G A;  1KRP A;  3VQ4 A;  1IBL K;  1RDC A;  4IDH A;  1WNS A;  5AQJ A;  3SPY A;  2ZQB A;  4BDZ A;  4DV0 K;  2IDO A;  3VN5 A;  4OGC A;  3NGI A;  4DQ8 A;  3CJB A;  5LMN K;  1BIU A;  3QEI A;  3F9M A;  5HRN A;  2NZT A;  5GIN A;  2E2P A;  2Q36 A;  2Y1I A;  4OKJ A;  2ASM A;  1ASW A;  4HUF A;  3MXM A;  1LWC A;  4FL9 A;  2P9P A;  2V52 B;  3FZL A;  4CF9 A;  3PLA A;  3DMJ A;  4E7H A;  2A1R A;  3VQ8 A;  1NK0 A;  4IFY A;  3O8M A;  1RFQ A;  3QFP A;  2XY6 A;  1JEQ A;  5I9E B;  4BRE A;  3HPH A;  5EVZ A;  5JLH A;  1Q81 O;  3V1Q A;  4B9U A;  3QBX A;  3MWP A;  1NJX A;  1LCU A;  2HNZ A;  1XC3 A;  3KZB A;  3SBG A;  4KHN A;  4WYB A;  1K9M O;  1JXB A;  3R1X A;  4O5F A;  1HKB A;  1QQO A;  1CXQ A;  3HRG A;  4IO8 A;  3MCP A;  3AVK A;  4KAZ A;  2A5X A;  4RW4 A;  4FJJ A;  3EY1 A;  1FKO A;  1Y97 A;  1ZC6 A;  4EP5 A;  1B92 A;  1HRH A;  4UY8 O;  4JKD A;  3R9P A;  3OYJ A;  4GKJ K;  4FPA A;  3ATU A;  3THW A;  1T8E A;  2RN2 A;  3EEQ A;  4NLC A;  2ZGY A;  4JV5 K;  3LM9 A;  3JYT A;  4DU4 A;  4UZW A;  4GVE A;  1Q86 O;  4Z4E A;  3IUC A;  3THY A;  2NRX A;  3UKU B;  1S72 N;  1ITG A;  3MED A;  3B6P A;  4N5S A;  3KKR A;  1G99 A;  3L0Q A;  3TAN A;  3MN6 A;  4CK3 A;  1OVQ A;  3F2K A;  1K8K A;  5CE3 A;  4IOC L;  5ADX H;  3C6A A;  4H4O A;  3QEW A;  3U9Z A;  3QO9 A;  3SUP A;  1XMO K;  3VQE A;  3LAM A;  3T1H K;  5KQ8 A;  2FF6 A;  1O13 A;  2WC9 A;  5AQG A;  3OS2 A;  5AQN A;  4I9L A;  2KFZ A;  3ZT0 A;  5CYQ A;  1C0G A;  2W40 A;  4HUG A;  1A63 A;  5JIC A;  2HOE A;  3AVN A;  1YF5 L;  3WEE A;  4IG3 A;  3TSU A;  4PKI A;  4FW1 A;  1LV5 A;  4IFV A;  3ZEU A;  4I2Q A;  4DFP A;  4BRF A;  3LDQ A;  4U7B A;  4L8R B;  1U2V A;  3VF4 A;  1J5E K;  4QS9 A;  2E2O A;  3P39 A;  4KO0 A;  2HJQ A;  3RMA A;  4IBN A;  1Q82 O;  2QW9 A;  3ASM A;  1RDB A;  4F2S A;  4G9Z A;  4W5R A;  4M3R A;  4CVN E;  4A62 A;  4DFM A;  4M63 C;  3ZT1 A;  4BQZ A;  3F9K A;  4A59 A;  2YV0 X;  2YKN A;  4J2D A;  2QWO A;  3ZT4 A;  2GUP A;  2QWL A;  3P5J A;  3R3L A;  3VGL A;  1W9H A;  4FJL A;  3Q7C A;  4RW6 A;  3PSI A;  3QFU A;  2RHK A;  3E9P A;  1KVB A;  4B3O A;  2YHX A;  2W51 A;  3GDQ A;  5ADX A;  4JKG B;  4B9N A;  2IGI A;  1WAF A;  3H45 C;  3OYB A;  5CYM A;  4DR6 K;  4AM6 A;  3QNN A;  4CF2 A;  3PO5 A;  3CJA A;  4X65 K;  3NE6 A;  4CBX A;  1JLB A;  1KTQ A;  2KW4 A;  1J54 A;  4DS4 A;  3K9J A;  1TYQ B;  3CHW A;  1VSM A;  3A0I X;  1S1W A;  2QTD A;  5DMR A;  4IDK A;  2D0A A;  1FKP A;  5MLC Q;  4FJG A;  2KTQ A;  3OYM A;  1RTJ A;  3FLC O;  1YHQ N;  3IKM A;  2PZS A;  3M8Q A;  1TKX A;  5AQM A;  1YIJ N;  3S41 A;  4MQ3 A;  4CES A;  4CD1 A;  1LW2 A;  1GL9 B;  1QZ6 A;  4NYN A;  1LWE A;  2KLA A;  4FVU A;  3S3M A;  4FJ8 A;  1FW6 A;  4BDY A;  1A5W A;  1MU2 A;  2FSK A;  3CME N;  2ZE2 A;  4DV6 K;  3VEY A;  2A41 A;  3VTH A;  3DXK A;  2NRT A;  4NCB A;  1NGH A;  5AFU H;  1M90 O;  3A2F A;  1E4F T;  3ULE B;  2LSN A;  4IG0 A;  2YNG A;  1GLL O;  5BRE A;  1ZXO A;  2HBL A;  4EIA A;  4B9Q A;  2NLX A;  2YHW A;  3CCS N;  4DUZ K;  2E2Q A;  4B9S A;  1WB9 A;  3DLL L;  3VPZ A;  5C2D A;  1XWL A;  5KGX A;  3L3V A;  2ZJP L;  2ODC I;  4Z4C A;  1WSG A;  3E1Y A;  3J8A A;  2Q2R A;  5F1X A;  4NYF A;  1T44 A;  3WNE A;  4W5O A;  1S3X A;  1IO2 A;  2XRI A;  3GL1 A;  4PKG A;  1JLE A;  4NXM K;  1Q18 A;  3VES A;  4EFH A;  3DLR A;  4JK8 A;  1N8R O;  3HPG A;  4DG1 A;  3RRG A;  4FK2 A;  2F8S A;  2LD7 A;  4DCH A;  3ZSZ A;  3FZM A;  1B9D A;  3DYA A;  4B9L A;  1RTD A;  2V7Z A;  4R79 A;  4DTU A;  2B5J A;  4BRL A;  2PYJ A;  1C1B A;  5M1N A;  4FWO A;  1RDW X;  4B1Z A;  4CZK A;  4B9T A;  4TSX A;  4JKA A;  4DR5 K;  5AFU A;  4F3T A;  1WSI A;  4FWL A;  2JGU A;  4FOE A;  3CJ9 A;  3VA0 A;  2RE2 A;  4A5B A;  2HF4 A;  3TAE A;  1GKU B;  4BR5 A;  3VEV A;  3VEW A;  3AVJ A;  1VSK A;  1NMD A;  4CGJ A;  4Q5V A;  2YI1 A;  1QHT A;  1EXQ A;  2JVW A;  4K8X A;  2VG6 A;  1JCG A;  1YNS A;  1WSF A;  3AVA A;  3E9L A;  3M1F A;  3L2W A;  3FFI A;  1HNZ K;  4CFA A;  1S22 A;  1TL3 A;  3C7N B;  3VQ6 A;  1NJY A;  4PL7 A;  3OW2 M;  1NK7 A;  1BCM A;  4E7L A;  1ASU A;  3KJV A;  4CZJ A;  4DSJ A;  1WUA A;  2YNH A;  4H4M A;  2UXC K;  2F7T A;  4YOX A;  1VSE A;  2ETJ A;  3G10 A;  4DSI A;  4CGH A;  3OBW A;  4JI1 K;  2ZM6 K;  1DTT A;  1U6Z A;  5HRP A;  4DU3 A;  2UYT A;  3OYK A;  2VGM A;  2E4L A;  2P9L B;  1BDG A;  4BG9 A;  5LMU K;  2W6L A;  5AQR A;  1YVU A;  4CFB A;  1KAX A;  1HPZ A;  1L3U A;  1SZ2 A;  1NK5 A;  4FJH A;  2ZF5 O;  3KD1 E;  4N41 A;  3D45 A;  1J9A A;  4W5T A;  4ISF A;  1UWB A;  4BRP A;  3SUQ A;  5CZ2 A;  1QQM A;  3L2V A;  1IG8 A;  2G8W A;  4OLA A;  5C10 A;  3I0R A;  5FPD A;  5GIO A;  3AVM A;  3QBW A;  2GEM A;  4WQ5 A;  5AQO A;  4PL8 A;  3TAR A;  4CJU A;  4EHT A;  1BUP A;  1Q8I A;  3CFO A;  2QWM A;  1TUY A;  2E1Y A;  4BRQ A;  1F21 A;  1U45 A;  4C23 A;  1X9W A;  4WE1 A;  3E9O A;  3AA3 A;  1IKW A;  4N56 A;  1HYS A;  1SAZ A;  3K9K A;  4CJE A;  3KTQ A;  4KHQ A;  3KK2 A;  1RDD A;  4NO7 A;  4KKO A;  3T1Y K;  5HRR A;  4YDU A;  4DFJ A;  4A57 A;  1QSL A;  2UXD K;  5CZ1 A;  1ILY A;  3EE9 A;  1N6Q A;  2HBJ A;  4JK9 A;  2NRZ A;  3H3O B;  4FWK A;  1V4S A;  3MX2 A;  3TR8 A;  2FLO A;  1MDU B;  3SI6 A;  2DFE A;  1XNR K;  4M3Z A;  1EP4 A;  3UKU A;  5FRM A;  4M3U A;  3UKR B;  3KVG A;  3AAR A;  3OJS A;  4B1W B;  3VQA A;  2BH1 A;  1H9E A;  3SBT A;  4FWP A;  2OCE A;  5AQZ A;  2OPS A;  1CZA N;  2YX6 A;  1I94 K;  1GLJ O;  2Z1I A;  1OKJ A;  4IJA A;  2QI2 A;  1Y02 A;  2EWS A;  3CCU N;  1A8V A;  1DT9 A;  4BRM A;  2MPH A;  2P9K B;  4JI8 K;  4H03 B;  1DKG D;  3B8A X;  5BN9 A;  5CIU A;  3I0S A;  3FZF A;  1QHA A;  3AVC A;  4B9M A;  4YY3 K;  4FW2 A;  4EHU A;  1BU6 O;  1L5U A;  4CGI A;  3I55 N;  5LL6 Z;  4JNE A;  3NGY A;  4RW8 A;  3HPO A;  3NVK A;  3TI0 A;  3O3F A;  3ZSQ A;  5I3U A;  1REV A;  3DJC A;  4MDB A;  1KAZ A;  3TSP A;  2XY8 A;  2HST A;  5HOO A;  3D7E O;  3HOS A;  2D0C A;  5KPR A;  4NCA A;  1RT2 A;  3C6H A;  4CW7 B;  1X9J A;  4XEI A;  5FPE A;  1N32 K;  2O4I A;  2Q0R A;  4HWI A;  3QES A;  1RBV A;  3QIC A;  2F9W A;  1ZYQ A;  1NGE A;  4H5R A;  4JKG A;  3DRS A;  4FWM A;  4LF5 K;  3D2E B;  2FC0 A;  2G8I A;  3C94 A;  1OH7 A;  2F9T A;  2H3G X;  5SWM A;  4HTU A;  1Q7Y O;  1XQS C;  2YHB A;  4DSE A;  3ZSV A;  2V7Y A;  1BIS A;  2BDP A;  1TYQ A;  1ATN A;  3TAB A;  1A5V A;  1VHX A;  5IWA K;  4H5V A;  3VQC A;  3G71 N;  3MK6 A;  4CED A;  3P4I A;  2QNF A;  4X62 K;  4M45 A;  4BRK A;  3WXL A;  4YNQ A;  3SLC A;  1OH5 A;  4IEE A;  1KD1 O;  3ZX2 A;  4E0D A;  3VQD A;  5HP1 A;  4FJI A;  2WON A;  3V9S A;  3QET A;  4FLU A;  1BI4 B;  1LAV A;  4BG8 A;  5BRF A;  4B08 A;  2P9U B;  4BVO A;  1NOZ A;  4DF4 A;  1L3S A;  1N36 K;  4WQ4 A;  2IVP A;  4LF8 K;  3TAP A;  1VSH A;  2F4V K;  4AH9 A;  1VQL N;  5CR4 A;  3OYF A;  4JRP A;  2QM1 A;  4CK2 A;  3J7Y P;  3K5M A;  2Q31 A;  3SV3 A;  5TKY A;  5EY4 A;  3ULE A;  3KLE A;  3LWL A;  1DTQ A;  2IOC A;  2B4J A;  2Y1J A;  1XHX A;  3AVG A;  4DTR A;  3EKS A;  4LF9 K;  1YT3 A;  1W7A A;  3L4I A;  4YOT A;  4I9Q A;  2DFH A;  2G8F A;  3MDQ A;  1CZ9 A;  3OVN A;  3EN9 A;  3ID8 A;  1NM1 A;  3GG4 A;  3CF5 L;  1BIZ A;  1D5A A;  2F96 A;  2GBZ A;  1IKX A;  4BRI A;  2YJE A;  3N4P A;  4LF6 K;  1D4X A;  1YUW A;  4OGE A;  4DV1 K;  1UA1 A;  3CIP A;  4OPK A;  1IJJ A;  5HRO A;  3VGK A;  1SL1 A;  5JS2 A;  1GLB G;  4DV2 K;  5J2P A;  3K5O A;  3VQB A;  4DUY K;  5GIP A;  3S3O A;  4BDP A;  3WT0 A;  4B3M K;  2AA4 A;  3VGM A;  4ICL A;  3NF9 A;  3VQP A;  3UB5 A;  1KLN A;  3M5R A;  1S6P A;  3TSQ A;  1HNW K;  4KB1 A;  2IVN A;  3NVM A;  2O8E B;  4IKF A;  3O3H A;  3RMD A;  4DR3 K;  2KFV A;  4F8R A;  2NNW A;  4O55 A;  2KQ2 A;  2FSJ A;  4XIU A;  4KHY A;  2Q3S A;  2PY5 A;  1VSI A;  4M42 A;  5BPM A;  3O9Q A;  3OYE A;  4R5P A;  2W42 A;  3LP0 A;  4QS7 A;  1HUX A;  4DQR A;  3ZSO A;  3ID6 A;  1HNV A;  1BA0 A;  4I6M B;  1Z26 A;  3SQ0 A;  4C8N A;  1NWK A;  3K5L A;  5AQS A;  3HK2 A;  1YIT N;  1RTI A;  4DS5 A;  2E6M A;  3H1V X;  4GW6 A;  3K0S A;  5AQT A;  3BF1 A;  1E3M A;  2PFU A;  1VQ8 N;  3C7N A;  2HVI A;  4Y1D A;  3HZ6 A;  4BRN A;  4Z0U A;  5AQW A;  3DM2 A;  3PY8 A;  4FLW A;  1WBB A;  4BRG A;  3OHR A;  4CHY A;  2EHG A;  5BN8 A;  5KI6 A;  4O4G A;  3EKU A;  1TL1 A;  2VG5 A;  3TAQ A;  4JI0 K;  3CCL N;  3DRR A;  1RTH A;  1VK0 A;  4B3T K;  1HLU A;  1VSF A;  3AVB A;  3JAM O;  1C1C A;  4M3T A;  3HT3 A;  3NF6 A;  1RDA A;  3KK1 A;  4FJ7 A;  2CGK A;  4NLB A;  4J2E A;  3ALY A;  4BVP A;  2ATQ A;  3DLB A;  4QCL A;  1S9E A;  2GV9 A;  3IS9 A;  3AO4 A;  3KD5 E;  3PIP L;  1QS4 A;  3SCX A;  2FXU A;  4FLX A;  3ZSX A;  3BF3 A;  1WN7 A;  3SV4 A;  3NH1 A;  4BR9 A;  4DTS A;  3MEE A;  1NBW A;  4CHO A;  2O8B B;  3DRP A;  3H6E A;  5KRS A;  1SUQ A;  2IS3 A;  3BP8 A;  1XNQ K;  4PQU A;  3W3D A;  4FJX A;  1NLV A;  4AF1 A;  4DU1 A;  1NJZ A;  3CCQ N;  4IOX A;  3AGR A;  3NFA A;  2OTJ N;  4YOY A;  1R0A A;  1QSY A;  5M1Q A;  2DY4 A;  2VWJ A;  4AHT A;  1U04 A;  5H1S Q;  3I8D A;  1VQ9 N;  4DSK A;  2GWK A;  4AHV A;  2QXF A;  4MFB A;  3KWI A;  1S6Q A;  3WXI A;  3GE1 A;  1SL2 A;  2OPP A;  3CJ1 A;  1T7P A;  3MXI A;  4BRO A;  3J7Z O;  3BUZ B;  4B3S K;  4O44 A;  3HM9 A;  2X74 A;  3NF7 A;  5EX5 A;  4YOR A;  4C1N I;  4KTQ A;  4BE2 A;  2A3Z A;  1P90 A;  1HJO A;  4ID5 A;  3UKR A;  1NK4 A;  5FPM A;  3LL3 A;  3CCE N;  2P9N B;  1BO5 O;  2G8H A;  4KH6 A;  1LOT B;  1YXQ A;  1NK6 A;  1R59 O;  3OS0 A;  1E7L A;  2QXL A;  3MEC A;  3O4Q A;  3OYI A;  1HYV A;  1N33 K;  2IC3 A;  4JS5 A;  4X64 K;  3VQ5 A;  4GMJ B;  2G8U A;  4CIE A;  3O4W A;  3ENH A;  4H0T B;  1NOY A;  4CJW A;  2P9K A;  2A42 A;  1QSS A;  1GLE G;  1Y64 A;  1LW0 A;  3JS6 A;  2P1J A;  3VQ9 A;  3NH0 A;  1H9F A;  3QIP A;  2ZD1 A;  4C1N K;  1H1J S;  1JLQ A;  2GEL A;  4FZX C;  4OKE A;  1CZB A;  4FJ9 A;  3O9T A;  3HOT A;  3MMV A;  1WSE A;  5CY4 A;  4ZTJ A;  4KH4 A;  3VEN A;  4NCG A;  4BGB A;  1NMN A;  2E8A A;  3LAK A;  4K0K K;  4LSN A;  2NRW A;  3D2F B;  1VQK N;  1IH7 A;  4DV7 K;  5AQV A;  5EOY A;  1W2B M;  2HBK A;  4MO5 A;  2BUP A;  3WXK A;  2G8V A;  2OYQ A;  2HBM A;  4FWQ A;  4DSL A;  3PX0 A;  3N4Q A;  3OYH A;  4CF1 A;  3CC2 N;  4HVJ A;  1LAW A;  3MAQ A;  3MN5 A;  3D2E A;  4BC4 A;  3LZI A;  4DQQ A;  3G6E N; 
#chains in the Genus database with same CATH homology
 1J53 A;  4WE1 A;  4LY7 A;  2YNF A;  4CEA A;  4DQP A;  4M3X A;  1JL1 A;  3AA3 A;  1IKW A;  4N56 A;  4M3W A;  1HYS A;  3HVT A;  3HVR A;  4DTX A;  4CJE A;  3NGZ A;  5J2M A;  2WOM A;  3KTQ A;  3T1A A;  4KHQ A;  3KK2 A;  1RDD A;  4Q0B A;  4KKO A;  5J2N A;  5HRR A;  4FLV A;  1NKC A;  1NKB A;  4C8M A;  4CE9 A;  1TGO A;  3CQ8 A;  2P51 A;  4DFJ A;  1QSL A;  2DTU A;  4CHZ A;  4CJ5 A;  5D3G A;  5CZ1 A;  4KB0 A;  5I42 A;  1IKY A;  4CEZ A;  1N6Q A;  5EU7 A;  2HB5 A;  3MXJ A;  3OYC A;  1D9F A;  1JLA A;  4JS4 A;  4CJF A;  2RNO A;  4CJR A;  1WSH A;  1S1V A;  4E7K A;  3PV8 A;  1D9D A;  3AVH A;  3LDS A;  4O0J A;  3TR8 A;  1A5X A;  3SI6 A;  4FJM A;  1UOC A;  4CJ4 A;  3AO2 A;  2DFE A;  4DTN A;  1EET A;  1EP4 A;  1IG9 A;  4M3Z A;  5C25 A;  4FM2 A;  2Z1G A;  4KFB A;  1BI4 A;  5FRM A;  2RKI A;  4M3U A;  4FJN A;  5KTQ A;  3NCI A;  3LP1 A;  4KV8 A;  3CM6 A;  3C95 A;  3OJS A;  4F2R A;  4CIF A;  3VQA A;  3EZ5 A;  1B9F A;  3P83 D;  4C8L A;  4E1M A;  3K57 A;  4HHT A;  4O5B A;  2FBT A;  3BGR A;  4E7I A;  1RT3 A;  5KRT A;  4J2B A;  3SYZ A;  2OPS A;  3ZSY A;  3VQQ A;  3L2U A;  1BQM A;  3WNH A;  1U4B A;  2HMI A;  3PX4 A;  1ASV A;  1C1A A;  1BHL A;  2Z1I A;  1RNH A;  4ID1 A;  1UAX A;  3SQ2 A;  4AHS A;  3AVL A;  5K14 A;  1RBU A;  1S1X A;  4AIL C;  5DK5 A;  1X9S A;  4Z4G A;  3U3G A;  3QEV A;  3VQ4 A;  1KRP A;  1RDC A;  4CEQ A;  1WNS A;  1KFD A;  3QNO A;  3SPY A;  2ZQB A;  2HW3 A;  1S1U A;  4BDZ A;  4B9V A;  3I0S A;  1L3V A;  2IDO A;  1FXX A;  4FK0 A;  3ZSW A;  3VN5 A;  4DTJ A;  4OGC A;  3NGI A;  1TKZ A;  5FRO A;  2HHQ A;  3OYN A;  3AVC A;  3O3G A;  4B9M A;  1BIU A;  3AA5 X;  4FXD A;  4FW2 A;  3WNF A;  1L5U A;  5J2Q A;  4CGI A;  4Z4I A;  3QEI A;  1KVC A;  2XHB A;  5HRN A;  3NGY A;  4RW8 A;  3HPO A;  2Y1I A;  3M8S A;  4OKJ A;  3TI0 A;  1YTA A;  3O3F A;  3ZSQ A;  5I3U A;  1ASW A;  1REV A;  4HUF A;  3MXM A;  3HJF A;  2KFZ A;  1LWC A;  3C6T A;  3ZT2 A;  4OLB A;  3S9H A;  2XY8 A;  3KIO A;  4AHR A;  4CF9 A;  1I39 A;  4W5N A;  5SZT A;  3DMJ A;  2QKK A;  3DLH A;  1ZBF A;  4E7H A;  2A1R A;  4CHN A;  3P1G A;  3VQ8 A;  4IFY A;  2D0C A;  3KLH A;  1NK0 A;  4NCA A;  1JLC A;  1DLO A;  5FDL A;  3HYF A;  1RT2 A;  4AHU A;  3THV A;  1TAQ A;  4FLY A;  2XY6 A;  1SKS A;  1RT5 A;  1JEQ A;  2O4I A;  1C6V A;  4QAG A;  4ELT A;  3HPH A;  1RBV A;  3QES A;  1ZYQ A;  4B9U A;  3V1Q A;  1CXU A;  3DRS A;  1BCO A;  4CHQ A;  4DLG A;  1NJX A;  2HNZ A;  4K8Z A;  1TVR A;  3SNN A;  2FC0 A;  4BWM A;  2ITG A;  4O0I A;  4KHN A;  2G8I A;  3QEP A;  3RMC A;  4ZTF A;  3C94 A;  4CJT A;  3SPZ A;  4CEE A;  2QK9 A;  4HCB A;  1JXB A;  4CGF A;  5SWM A;  2X78 A;  3L3U A;  4HTU A;  3RTV A;  1CXQ A;  5HBM A;  4CCH A;  2YHB A;  4DSE A;  3AVK A;  1U47 A;  3ZSV A;  2BDP A;  1BIS A;  4KAZ A;  4RW4 A;  3TAB A;  4FJJ A;  1A5V A;  3EY1 A;  3VQC A;  1FKO A;  1Y97 A;  4CF8 A;  1NJW A;  2BGG A;  4FLT A;  4EP5 A;  1N5Y A;  3B6O A;  1B92 A;  1HRH A;  4CED A;  4PA1 A;  4M45 A;  3QEX A;  2FBY A;  3HP6 A;  1TKT A;  5E41 A;  3OYJ A;  1T8E A;  4Y1C A;  4B8C A;  2RN2 A;  4YNQ A;  5T7B A;  4CIG A;  3M8P A;  1XC9 A;  2AJQ A;  3JYT A;  2FBV A;  4DU4 A;  4UZW A;  4PUO A;  4E0D A;  3VQD A;  4CHP A;  5HP1 A;  2FBX A;  4FJI A;  4Z4E A;  2O4G A;  2WON A;  3V1O A;  1KSP A;  3V9S A;  2B6A A;  3QET A;  2P5G A;  4FM0 A;  4FLU A;  1BI4 B;  3CYM A;  1LAV A;  4ELV A;  1ITG A;  3MED A;  4HUE A;  3T3F A;  3B6P A;  4N5S A;  4QOZ B;  3KKR A;  4B08 A;  4UQG A;  3TAN A;  1NOZ A;  4CK3 A;  4DF4 A;  1L3S A;  4E19 A;  3V9Z A;  4H4O A;  3QEW A;  1VSH A;  3TAP A;  1GOA A;  4AH9 A;  1RT6 A;  2YNI A;  3QO9 A;  3SUP A;  3VQE A;  4Z4F A;  3LAM A;  3OYF A;  4JRP A;  3AO5 A;  4CK2 A;  3K5M A;  4FCY A;  3OS2 A;  3SV3 A;  1BGX T;  3U6F A;  3L2Q A;  4I9L A;  3LAN A;  3ZT0 A;  5CYQ A;  5KGW A;  1EX4 A;  1TV6 A;  3KLE A;  3DLK A;  4EZ9 A;  3LWL A;  2OPQ A;  4KHS A;  1DTQ A;  2IOC A;  2Z1J A;  2B4J A;  4HUG A;  2Y1J A;  1XHX A;  2E6L A;  3AVG A;  4CJ3 A;  4DTR A;  2XY5 A;  1YT3 A;  1XI1 A;  3O4N A;  1TK5 A;  3PUF A;  3AVN A;  4I9Q A;  4F4K A;  2DFH A;  1IKV A;  4IG3 A;  2G8F A;  4KHW A;  3OJU A;  2HHT A;  3QLH A;  4FW1 A;  1LV5 A;  4IFV A;  4ZHR A;  4CEO A;  3HP9 A;  3OYA A;  3S3N A;  1J5O A;  1CZ9 A;  4OVL A;  3OVN A;  4I2Q A;  4H8K A;  2HVH A;  3ITH A;  4DFP A;  4CJL A;  1FK9 A;  4L8R B;  1BIZ A;  1D5A A;  2F96 A;  2GBZ A;  1IKX A;  1NK8 A;  1RIL A;  3AVF A;  1TK0 A;  2HHS A;  1UA0 A;  2RPI A;  4N76 A;  4KO0 A;  2HHX A;  5FRN A;  2X6N A;  4OGE A;  4I2P A;  1UA1 A;  1WSJ A;  1I3A A;  4LH4 A;  4OPK A;  4GVM A;  3RMA A;  5HRO A;  3SJJ A;  4IBN A;  1HMV A;  2GUI A;  3ULD A;  1SL1 A;  3ASM A;  3L8B A;  5JS2 A;  2R7Y A;  1RDB A;  4F2S A;  4W5R A;  4M3R A;  1L3T A;  5J2P A;  3K5O A;  3VQB A;  1NK9 A;  3PO4 A;  4DFM A;  1JL2 A;  4DF8 A;  3ZT1 A;  3ISN C;  3S3O A;  4BDP A;  2QKB A;  1BQN A;  3F9K A;  2YV0 X;  4ICL A;  3TAG A;  2YKN A;  3NF9 A;  3OYL A;  4I7F A;  3SQ4 A;  3OS1 A;  3IG1 A;  4LSL A;  3VQP A;  3ZT4 A;  3LWM A;  1KLN A;  4J2D A;  1RT1 A;  1LWF A;  3P5J A;  1S6P A;  4CJP A;  1BL3 A;  4KB1 A;  1W9H A;  4FM1 A;  3AV9 A;  4RW7 A;  1T03 A;  4RW6 A;  1WLJ A;  4FJL A;  1GOB A;  4IKF A;  3O3H A;  2KVE A;  3RMD A;  2NUB A;  4CGG A;  4DFK A;  1KVB A;  4B3O A;  3KK3 A;  4F8R A;  4B9N A;  4O55 A;  4E1N A;  4DQI A;  2IGI A;  2IAJ A;  1WAF A;  2KQ2 A;  3TWH A;  4E7J A;  4XIU A;  4KHY A;  4DWI A;  2Q3S A;  3OYB A;  2PY5 A;  5CYM A;  1VSI A;  4M42 A;  3QNN A;  4CF2 A;  2KVD A;  2HNY A;  4DTO A;  3PO5 A;  3OYE A;  3E01 A;  4R5P A;  2W42 A;  1RCH A;  3LP0 A;  3NE6 A;  1JLB A;  4DQR A;  4KPY A;  1KTQ A;  3ZSO A;  3AA2 A;  3DOK A;  1SL0 A;  2KW4 A;  4C8K A;  3RRH A;  1HNV A;  1J54 A;  4DS4 A;  3SUO A;  1TAU A;  1HNI A;  3V1R A;  2A1S A;  1Z26 A;  4CF0 A;  1VSM A;  4C8N A;  3SQ0 A;  1S1W A;  4M3Y A;  2KFN A;  3K5L A;  4KHU A;  1ZBI A;  2KZM A;  5DMR A;  4IDK A;  2D0A A;  1FKP A;  4FJG A;  3HK2 A;  1RTI A;  2KTQ A;  4DS5 A;  3OYM A;  1X9M A;  2E6M A;  1RTJ A;  2PZS A;  3M8Q A;  1TKX A;  1HQE A;  4GW6 A;  4CJV A;  3OYD A;  3HST B;  1VRU A;  4MQ3 A;  4CES A;  4YFU A;  1LW2 A;  1KCF A;  4NYN A;  4EP4 A;  4FVM A;  1LWE A;  4M41 A;  1JLG A;  2HVI A;  3S3M A;  2RF2 A;  4FJ8 A;  2D0B A;  4Y1D A;  3ZCM A;  4Z0U A;  4BDY A;  1A5W A;  3DM2 A;  3M8R A;  3PY8 A;  1MU2 A;  4B8A B;  3NBP A;  4FLW A;  1RBR A;  3JSM A;  3HXM A;  2RNN A;  1RT7 A;  4CHY A;  2EHG A;  4N47 A;  2ZE2 A;  1C0U A;  5KI6 A;  5C42 A;  4O4G A;  3AVI A;  3QER A;  1NKE A;  4CJK A;  1TL1 A;  1G15 A;  2VG5 A;  3TAQ A;  4NCB A;  3OY9 A;  3VQ7 A;  1JLF A;  3DRR A;  1RTH A;  1VK0 A;  1ZBH A;  1VSL A;  4FZY A;  5HLF A;  4PY5 A;  4KRE A;  3IRX A;  3A2F A;  3LPT A;  4OJR A;  1VSF A;  3AVB A;  3KLG A;  4LH5 A;  4W5Q A;  1C1C A;  1T05 A;  4M3T A;  4FYD A;  2XO7 A;  2LSN A;  1RDA A;  3NF6 A;  3HT3 A;  3KK1 A;  4IG0 A;  2YNG A;  1Z25 A;  4FJ7 A;  2HHV A;  2Z1H A;  2EX3 A;  3L2R A;  2D5R A;  1SKW A;  3DOL A;  4J2E A;  3ALY A;  2ATQ A;  3MEG A;  4B9S A;  1SKR A;  3DLB A;  4QCL A;  1S9E A;  2GV9 A;  3IS9 A;  3AO4 A;  4DLE A;  3V9X A;  3KD5 E;  4BWJ A;  1Q9Y A;  3KLI A;  3K5N A;  1QS4 A;  3SCX A;  2OA8 A;  1XWL A;  5KGX A;  3QIO A;  3L3V A;  3ZSX A;  4FLX A;  3U3Y A;  1WN7 A;  4Z4C A;  3NH1 A;  1WSG A;  4KTZ A;  3SV4 A;  3DI6 A;  3MEE A;  4DTS A;  1U48 A;  1CLQ A;  3RWU A;  2F8T A;  1U49 A;  4CER A;  4FK4 A;  1ZBU A;  4CFC A;  4CHO A;  4CJS A;  4C8O A;  5C24 A;  3DRP A;  4NYF A;  3WNE A;  1SUQ A;  2IS3 A;  5KRS A;  4W5O A;  4PQU A;  4CK1 A;  4FJX A;  4CGD A;  4DU1 A;  4F3O A;  1C0M A;  1IO2 A;  2XRI A;  1NJZ A;  4KI6 A;  1WAJ A;  2KW9 A;  2KZZ A;  3NFA A;  2VG7 A;  1JLE A;  3SUN A;  4CJQ A;  3NF8 A;  1X1P A;  5J1E A;  1R0A A;  1QSY A;  3DLR A;  3SQ1 A;  2DY4 A;  3HPG A;  4DG1 A;  2VWJ A;  3RRG A;  4AHT A;  4FK2 A;  1U04 A;  2OPR A;  4DMN A;  3TAM A;  1SV5 A;  3I8D A;  4DSK A;  3ZSZ A;  4BAC A;  2F8S A;  3ZSR A;  1YTU A;  3DLE A;  2BAN A;  4G1Q A;  3NAE A;  4BE0 A;  1B9D A;  3DYA A;  4AHV A;  4B9L A;  1S5J A;  2QXF A;  1RTD A;  4MFB A;  2WQG A;  4DTU A;  2B5J A;  3K59 A;  1S6Q A;  3RMB A;  1RBS A;  1QE1 A;  4CEC A;  4CFD A;  3OYG A;  1SL2 A;  1C1B A;  2OPP A;  3CG7 A;  2PYJ A;  2OZM A;  3AA4 A;  2X6S A;  4KI4 A;  1T7P A;  2YHA A;  2DFF A;  1TK8 A;  4BIT A;  1KLM A;  3MXI A;  4B9T A;  4TSX A;  2P5O A;  4RW9 A;  1VSD A;  4F3T A;  1WSI A;  4O44 A;  2BE2 A;  2JGU A;  3HM9 A;  3SZ2 A;  3HL8 A;  3VA0 A;  2X74 A;  3NF7 A;  4KTQ A;  3VA3 A;  3TAE A;  3NH2 A;  4BE2 A;  4DQS A;  4OKK A;  3T19 A;  3NDK A;  1RBT A;  5HRS A;  4ID5 A;  3AVJ A;  1NK4 A;  1VSK A;  1C0T A;  4CGJ A;  4Q5V A;  1HYZ A;  1QHT A;  4FJ5 A;  1EXQ A;  4LD0 A;  4E3S A;  2G8H A;  2JVW A;  3NHG A;  2VG6 A;  4K8X A;  1V66 A;  1HQU A;  2PYL A;  3V6D A;  1WSF A;  4ELU A;  1NK6 A;  3LAL A;  3OS0 A;  3WNG A;  3AVA A;  3L2W A;  3FFI A;  3MEC A;  1K6Y A;  4FJK A;  3O4Q A;  4CFA A;  3OYI A;  1TL3 A;  3G0Z A;  3VQ6 A;  1HYV A;  1NJY A;  2OZS A;  2IC3 A;  3CM5 A;  4JS5 A;  4OPJ A;  3IAY A;  3CFP A;  3VQ5 A;  1NK7 A;  1BCM A;  4GMJ B;  1ASU A;  4E7L A;  4CIE A;  2G8U A;  2HHU A;  2HHW A;  1JXE A;  3KJV A;  1ZBL A;  3AO1 A;  4DTM A;  3TAF A;  2YNH A;  1NOY A;  4DSJ A;  4CJW A;  4H4M A;  3KKS A;  1QSS A;  2VWK A;  3DLG A;  1W0H A;  2ETJ A;  1VSE A;  3G10 A;  1LW0 A;  4JLH A;  1S1T A;  4CGH A;  3F73 A;  3V9U A;  4DTP A;  4DSI A;  4DSF A;  2P1J A;  3VQ9 A;  3NH0 A;  1DTT A;  4E89 A;  5HRP A;  4DU3 A;  3OYK A;  1GOC A;  4RG8 A;  3QIP A;  2ZD1 A;  2E4L A;  3CFR A;  3RR8 A;  3HO1 A;  5JS1 A;  1H1J S;  3V4I A;  2KVU A;  1JLQ A;  4KRF A;  4FZX C;  1YVU A;  4OKE A;  1CZB A;  1TKD A;  4KTW A;  4FJ9 A;  3LP2 A;  4CFB A;  1HPZ A;  3LPU A;  1L3U A;  1WSE A;  1NK5 A;  4FJH A;  4CEB A;  4CEF A;  3KD1 E;  2G8K A;  5CY4 A;  4ZTJ A;  3D45 A;  1KFS A;  4N41 A;  1J9A A;  4NCG A;  3LAK A;  4W5T A;  1RT4 A;  1UWB A;  1D8Y A;  1JKH A;  3SUQ A;  4LSN A;  5CZ2 A;  2JLE A;  1HJR A;  1IH7 A;  3L2V A;  1VSJ A;  3KLF A;  3BDP A;  3AO3 A;  3RR7 A;  4FZZ A;  1S9G A;  3K2P A;  3ZT3 A;  1VRT A;  1QTM A;  3EYZ A;  4FLZ A;  3V81 A;  4EZ6 A;  3PX6 A;  3V9W A;  1EKE A;  2G8W A;  4OLA A;  2G8V A;  3I0R A;  2XY7 A;  4PWD A;  3UIQ A;  2OYQ A;  3AVM A;  2I5J A;  4DSL A;  1KVA A;  3QIN A;  3PX0 A;  4JRQ A;  3LZJ A;  3TAR A;  3OYH A;  3C6U A;  4BE1 A;  4CF1 A;  4HCC A;  4HVJ A;  4J2A A;  1LAW A;  4CJU A;  4Z4H A;  3MAQ A;  1XHZ A;  4AHC A;  3K58 A;  2YKM A;  3LZI A;  4DQQ A;  1Q9X A;  1Q8I A;  1JJR A;  1O1W A;  3CFO A;  3D0P A;  1QQC A;  2HND A;  1F21 A;  3LP3 A;  1U45 A;  3H08 A;  1X9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...