1ZBHA

3'-end specific recognition of histone mrna stem-loop by 3'-exonuclease
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
b'DFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPNCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*CP*GP*GP*CP*UP*CP*UP*UP*UP*UP*CP*AP*GP*AP*GP*CP*CP*
molecule tags Hydrolase/rna
source organism Homo sapiens
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
total genus 87
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.30 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 SAP domain 1zbhA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbhA02
2D0AA 3DLEA 1S1WA 3F9KA 3NDKA 3LP3A 4C8LA 3K5NA 2HHQA 3OS2A 1HQEA 4OVLA 3MAQA 2PY5A 4DTRA 4NYNA 3L2WA 1W9HA 4CFCA 2YHAA 2YKMA 3RWUA 4HCCA 1F21A 3EY1A 3V9WA 3MEDA 4B9LA 1Z25A 2VG7A 5HRSA 3KKSA 4CJTA 2LSNA 5T7BA 3RMBA 2G8KA 3SQ2A 4W5OA 2KFZA 3MECA 4CFDA 4RW8A 1L3TA 1ASWA 3V9SA 4N56A 1BISA 3OYBA 4OPJA 1T05A 4DTJA 3OYJA 3LAKA 2KZZA 1TK0A 1BI4A 1ZBFA 2G8WA 3AO1A 4F4KA 2HHXA 2HNZA 1S9EA 4JS4A 4PY5A 1EX4A 1TL3A 1YVUA 4N41A 3NF8A 3DLBA 1RT7A 3S3OA 1TK5A 1WNSA 1DLOA 3QLHA 3QNNA 4B9UA 1NKEA 4GVMA 1C0MA 1RT6A 3OS1A 3SUPA 4ZTJA 1X9MA 4FXDA 2HHVA 4CF8A 3SV4A 3VQAA 3ZSVA 1SKSA 3A2FA 1HRHA 1U4BA 1HQUA 3NH1A 5KI6A 4DS5A 4E19A 4DU3A 2RNOA 1VSFA 3S9HA 3KK1A 1S6QA 1VSKA 4DSFA 4KHWA 3AO3A 3NBPA 4FLWA 3TAGA 1IKWA 1LW2A 5C24A 4WE1A 1ZBHA 1IKXA 1LWCA 2WONA 1EXQA 4UQGA 4KTZA 4LD0A 4CJEA 4CHZA 5KRTA 3AO5A 3QEXA 3E01A 4FW2A 4DSJA 2XY7A 1C6VA 4DFMA 1QS4A 3DRRA 5HBMA 1IKVA 3LWMA 1BHLA 1JXBA 1U47A 1Q8IA 3O4QA 3SJJA 2B5JA 1RBRA 2ETJA 2P1JA 3QO9A 3MXIA 3WNFA 4W5NA 3HPGA 1VRUA 4KAZA 2KQ2A 4CEBA 3AVGA 3RTVA 1O1WA 3ZSOA 1T8EA 3U3GA 4Z4FA 1U48A 4IFYA 4B8AB 3OJSA 4DSKA 1C1CA 4I2PA 1FKPA 1B9DA 4CK1A 4DF8A 1FXXA 2IS3A 4FM2A 2FBTA 4F2RA 4M3RA 4FK2A 4FJ8A 4DTPA 3QESA 3NE6A 4NCGA 1KLNA 2NUBA 5CY4A 3HP9A 5DK5A 1NK4A 4B9SA 4ICLA 4FJIA 4L8RB 5K14A 4Z4EA 1NJYA 2X78A 4OKKA 5KGWA 4JRQA 4CECA 4J2DA 3PX4A 4KHYA 1WSHA 1U49A 3K5MA 4B9MA 4FJNA 3OYKA 2DFFA 4DG1A 3B6PA 4E3SA 5J2MA 4AHTA 2OA8A 1JJRA 3AVFA 4CERA 3TAMA 1T7PA 3KLFA 4LY7A 4E7JA 3LANA 4EZ6A 4W5RA 1S1VA 4B9VA 4FJHA 1RNHA 2X6NA 1V66A 4CJ3A 3K57A 4CEDA 3OYNA 3AA2A 3TANA 3G10A 4PA1A 4CCHA 3KIOA 2IDOA 3O4NA 4I9QA 4K8XA 1ASUA 2Y1JA 4M3UA 4FVMA 3WNGA 1B9FA 4KFBA 3LZJA 3SPYA 4AHVA 3CM6A 4DQPA 3HM9A 5CYQA 3P83D 1SL0A 1VSLA 3ZSZA 1EETA 4N47A 4CFBA 2FBYA 4CF2A 4I7FA 3AVNA 5I3UA 4J2EA 3SI6A 2DY4A 2GBZA 3TI0A 3LZIA 1JLQA 3VQ4A 3H08A 4FK4A 1BIZA 2G8VA 4M42A 1KTQA 1LW0A 2E4LA 2JLEA 2E6LA 3D0PA 4DTOA 3V4IA 1D8YA 2ITGA 1S6PA 2XY5A 2BGGA 4DTNA 3QIPA 4O55A 1YT3A 3KTQA 4FLVA 3CFRA 1CXUA 3ITHA 2RN2A 1IKYA 1X1PA 4CGDA 3ZSWA 3NFAA 2OZSA 2GV9A 4CF0A 2D0CA 3C6UA 4FJXA 2F96A 2D0BA 4HCBA 4QCLA 2OPQA 4FJ9A 3L2RA 4FZXC 4DQSA 3MEEA 1TKTA 2X6SA 3HVTA 3KJVA 4IBNA 2HNYA 3OYLA 3F73A 3V9ZA 2HW3A 3M8SA 2EX3A 4CESA 4FW1A 4DQQA 1XI1A 4NYFA 4Y1DA 1S1UA 4RW7A 4KKOA 1RTDA 1SKWA 3VQDA 4KHUA 4CEAA 3T1AA 1J9AA 1WLJA 3NF7A 1L3SA 4O5BA 3ZSXA 3AVMA 3ZSRA 1NOZA 3VQCA 1KCFA 1RDBA 4HUFA 4Z0UA 3QEVA 1VSEA 1YTUA 2VWKA 1K6YA 1CXQA 3CFOA 3G0ZA 3B6OA 4GW6A 4O0IA 3OYIA 3SCXA 1Q9XA 1QTMA 4F8RA 2G8IA 4Y1CA 5I42A 1RDAA 1Q9YA 3RRHA 4YFUA 2RF2A 1HMVA 1TAQA 1NK0A 4DSLA 1TKZA 4FK0A 4FLYA 4NCAA 4FYDA 3RR8A 2YNGA 4EP4A 2G8HA 2KZMA 1XC9A 1CZBA 4FCYA 4KB0A 2VWJA 1JKHA 2QKKA 3SUQA 3NAEA 1U04A 1LWFA 1HNVA 3V6DA 4LSLA 4RW6A 3AVCA 3O3GA 3OYAA 4M3WA 4B9NA 1UOCA 4R5PA 2HMIA 2B6AA 2IOCA 2XY6A 2FC0A 4DS4A 4IDKA 4XIUA 4CGHA 3PV8A 1R0AA 3UIQA 2QK9A 4PQUA 2HB5A 1RDDA 4HUEA 1WSIA 3SUNA 5JS1A 3ZT0A 4Z4CA 4DTXA 4KHQA 4AHSA 2IGIA 1JL1A 2QXFA 3RR7A 3M8PA 2HVIA 1HYVA 1C1BA 4OKJA 2ATQA 5FDLA 3QEIA 3DMJA 1XWLA 1KRPA 4OLBA 1NK8A 2FBXA 4RG8A 2XO7A 1RILA 3VQBA 2GUIA 3ULDA 1QSLA 2ZE2A 3CQ8A 4Q5VA 3SZ2A 4JLHA 3NGYA 3QINA 3KLHA 1S1TA 3RMAA 1JLAA 1Y97A 3LAMA 1HNIA 3M8RA 5HRNA 3K59A 1QQCA 4B8CA 4CGIA 5J2NA 3K5OA 3HVRA 3V9XA 2A1RA 1RTHA 1KLMA 4AH9A 3CYMA 4CHYA 4OGCA 4KHSA 4H4OA 2R7YA 2PZSA 4DSIA 2P5OA 4ELTA 1VSHA 1FKOA 4F2SA 5E41A 1NK9A 4DTSA 3OJUA 1GOAA 5KTQA 2DFEA 3AVJA 3V81A 2IC3A 4OLAA 4CGFA 1I39A 5HP1A 4FJLA 3QEWA 1HJRA 3L3VA 4KO0A 1SL1A 3QIOA 3HSTB 4CEZA 3AV9A 4OKEA 3WNHA 4BDZA 1CLQA 4AHUA 2DTUA 3OYMA 4BITA 4DSEA 3AO2A 1WSGA 3OS0A 2XY8A 1KFDA 3VQQA 1RBVA 4DMNA 1D9FA 1ITGA 1QE1A 1ZBLA 3KD1E 4FJ7A 4CEEA 1NKBA 4NCBA 3BGRA 4FLUA 1I3AA 3DLGA 3DRSA 3OYHA 5HRRA 3KLIA 3AVIA 1NJZA 4OGEA 3RMDA 2F8SA 3SQ4A 1TKDA 4W5TA 1S1XA 2EHGA 4LSNA 3OYGA 3HPOA 4OPKA 3QETA 4M45A 3TAPA 4DF4A 2G8UA 2P5GA 3M8QA 5FROA 5SWMA 3V1OA 1B92A 4AHRA 2KW9A 3IRXA 2BANA 4TSXA 4CGJA 1H1JS 3NHGA 1J5OA 4C8NA 4CEQA 3SQ0A 1SL2A 1WSFA 3U6FA 3TR8A 1A5WA 1CZ9A 3VQEA 4AILC 1TV6A 3LP2A 3LALA 1A5XA 1RBUA 1NK5A 4CJQA 3SUOA 4DTUA 3I8DA 1XHZA 3L2UA 3MXMA 3KD5E 4FZZA 1MU2A 4CJVA 1WSEA 2I5JA 4RW9A 2B4JA 2KVUA 1NOYA 2HHWA 3AA4A 3V9UA 1LWEA 1TK8A 4K8ZA 3P1GA 4UZWA 3EZ5A 3L2QA 3NF9A 5J2PA 4B9TA 1UA0A 3IAYA 3ZT1A 1J54A 4FZYA 4Z4GA 4BACA 3L2VA 2D5RA 5FRMA 3MXJA 4E89A 4KRFA 3WNEA 2RKIA 3PY8A 2O4GA 1BQMA 1REVA 1KVCA 1VSMA 4DQRA 4B3OA 4HTUA 4BWJA 3TAEA 5D3GA 4HVJA 1DTQA 4QOZB 4C8KA 4KTQA 4J2BA 4FM1A 3HL8A 2RNNA 1KSPA 1A5VA 5HRPA 4ELVA 3NH2A 4E7IA 1S9GA 1BI4B 2VG6A 1C0UA 2Z1IA 5CZ1A 1QSYA 1D9DA 3DOKA 4N76A 3LPTA 4E7HA 3TABA 4CIGA 4M3ZA 4ELUA 2KVDA 3O3FA 3MEGA 1BL3A 1RT3A 1C1AA 4CFAA 3ZT4A 1S5JA 3KLGA 1X9SA 4DU1A 3OYCA 3KLEA 2O4IA 4CIFA 4DLGA 4DU4A 1NK6A 5HLFA 2Q3SA 3AO4A 4KV8A 3L8BA 4GMJB 4H8KA 1XHXA 1NJWA 4F3OA 2YNHA 4N5SA 4IKFA 1EP4A 3NH0A 3EYZA 2IAJA 1RT5A 2JGUA 4DFKA 2OZMA 4C8MA 2YHBA 3VQ9A 3SNNA 1U45A 5J1EA 4KPYA 3C6TA 4ID5A 1KVBA 2Z1JA 1NK7A 2HHSA 1ASVA 1L3VA 3IS9A 4Z4HA 1N6QA 4DFPA 1IG9A 2AJQA 1BCMA 1TGOA 3AA3A 4JRPA 1G15A 4W5QA 4HHTA 1W0HA 3K5LA 2KFNA 3TARA 4CJKA 3PO5A 1TAUA 1KFSA 2Z1GA 3ZT3A 2ZD1A 3HPHA 3PX0A 4DLEA 4PWDA 1RBTA 3CM5A 4BE0A 1JXEA 2P51A 4CGGA 4F3TA 3TWHA 3HJFA 2KTQA 1QHTA 5J2QA 3DRPA 4CJWA 2OYQA 3SQ1A 3T3FA 4E1MA 4E0DA 4M3TA 4E1NA 4H4MA 3HXMA 2QKBA 2OPSA 1JLBA 3V1QA 3ZSYA 2F8TA 2PYLA 1JLCA 2KW4A 3JYTA 3VQ7A 1HYZA 1BQNA 1RTJA 4CEFA 3VA0A 4DFJA 4ZTFA 1Z26A 1RTIA 4CF9A 1ZBUA 1X9WA 4EZ9A 1VSJA 4M3YA 1GOBA 4CEOA 3SV3A 4Q0BA 3T19A 4CJFA 3PUFA 3PX6A 1JLGA 3BDPA 3THVA 1ZYQA 4O0JA 3VQ5A 3AA5X 3TAFA 3C95A 4FJKA 4G1QA 4IFVA 4MFBA 3LWLA 3QEPA 3ZCMA 3SPZA 3TAQA 1VK0A 4KTWA 2XRIA 2YKNA 5DMRA 1JLFA 1WSJA 3KKRA 1T03A 4BDPA 5EU7A 5KRSA 3OYEA 3OVNA 1WN7A 1NKCA 4KI4A 4KB1A 1BIUA 4BWMA 1RT1A 1YTAA 3VQ8A 4CK3A 4DQIA 2OPRA 4ID1A 3NF6A 3ZSQA 3NGIA 3LPUA 3SYZA 3ISNC 4IG0A 1ZBIA 4M3XA 4BDYA 4CJ4A 3VQ6A 5FRNA 4O44A 1EKEA 4FM0A 5JS2A 4AHCA 2BDPA 3DLRA 1UAXA 4QAGA 4M41A 1HPZA 2YNFA 4CE9A 5KGXA 2HNDA 3RMCA 4CJ5A 4FJ5A 1IO2A 2WQGA 3HYFA 3V1RA 1NJXA 3DI6A 3VN5A 1UWBA 2Z1HA 3JSMA 4MQ3A 2PYJA 4CK2A 5SZTA 3OYDA 1SUQA 3L3UA 4CHPA 3DM2A 1LAVA 3AVAA 1GOCA 1IH7A 3IG1A 3AVLA 4CHQA 1L3UA 1VRTA 1D5AA 3CFPA 4E7LA 3QERA 1TL1A 2VG5A 2KVEA 1RT2A 2HHTA 2W42A 5HROA 4C8OA 1TKXA 3HP6A 4LH5A 4FJGA 2HVHA 4EP5A 1RBSA 4KI6A 1BGXT 1RCHA 3KK3A 4FLXA 2WOMA 3AVHA 1SV5A 1RT4A 2ZQBA 3OYFA 4JS5A 4HUGA 3AVBA 4Z4IA 4DTMA 4FJJA 4CJSA 3HK2A 2Y1IA 4O4GA 4ZHRA 3HO1A 1VSDA 4RW4A 3I0RA 5C25A 4FLTA 4KREA 1BCOA 3ALYA 1C0TA 3LP0A 5CZ2A 4CJUA 2X74A 1QSSA 3PO4A 3K2PA 4CIEA 3DLHA 3HT3A 1N5YA 3NGZA 3VA3A 3C94A 4FLZA 1HYSA 1KVAA 3OY9A 2YNIA 4J2AA 4IG3A 1LV5A 2OPPA 4CJPA 2RPIA 4CF1A 3RRGA 2JVWA 2HHUA 3O3HA 3I0SA 2G8FA 3DLKA 1VSIA 3FFIA 1JEQA 1FK9A 3ZT2A 3K58A 1LAWA 1L5UA 4E7KA 2DFHA 3P5JA 3LP1A 4DWIA 2XHBA 1WAJA 1JL2A 1UA1A 1DTTA 1SKRA 4FJMA 4KHNA 1RDCA 3D45A 2A1SA 5CYMA 3KK2A 2E6MA 1JLEA 3QNOA 3S3MA 1WAFA 4LH4A 3LDSA 3ASMA 3S3NA 4CJRA 4B08A 3U3YA 3VQPA 4I9LA 4CHOA 4CHNA 3NCIA 2FBVA 4BE2A 5C42A 4YNQA 3AVKA 4I2QA 3DYAA 4OJRA 2BE2A 3DOLA 4CJLA 4BE1A 4PUOA 1J53A 2YV0X 3CG7A 1TVRA
chains in the Genus database with same CATH superfamily
2HHQA 2QWPA 1BUPA 4A5AA 1RDUA 4IEIA 1VQ9N 2YHAA 4KBOA 3V9WA 1NGEA 1NG9A 2QI2A 5HRSA 3L4IA 2LSNA 4Y0WA 5T7BA 1FJGK 3SQ2A 2RE2A 1VQ6N 4NXNK 1J6ZA 3AGKA 2A42A 3OYBA 4DTJA 3OYJA 1YXQA 1M1KO 2A5XA 3ENHA 4N41A 3DLBA 4WQ5A 1TK5A 3QNNA 2FF3B 2YI1A 4GVMA 4ZTJA 4FXDA 2HHVA 2DPNA 3A2FA 1U4BA 3NH1A 5KI6A 3MN5A 1Z6RA 3FLGA 2RNOA 4JKGB 4DU3A 4KHWA 1S6QA 3J7ZO 4H5VA 2OTJN 4FLWA 1LW2A 4IOCL 4CJEA 3AO5A 2GTDA 3DRRA 5FLXO 3TPQA 3LWMA 4YOXA 1EWQA 1A62A 1BHLA 5AQVA 1NGIA 3O1BA 2B5JA 1RBRA 2ZJQL 1VRUA 2KQ2A 3RTVA 1O1WA 2JWLA 2PAVA 4FWLA 5BR9A 4QS7A 1VQNN 4IFYA 1C1CA 1BA0A 4I2PA 3O4WA 1FXXA 5BN9A 3CETA 4M3RA 4KH4A 1KLNA 4B9SA 5K14A 4CECA 1W2BM 1WSHA 3K5MA 4B9MA 5J2MA 3MK6A 4BRQA 4JHDB 1Z05A 1D4XA 1JJRA 3AVFA 3TAMA 3KLFA 4E7JA 1S1VA 3EN9A 4BRGA 3K57A 5AQQA 3AA2A 3G10A 4PA1A 2FLOA 4BRDA 3WNGA 4KFBA 3QB0A 1VSLA 3KWIA 4WFNL 3MN6A 2FBYA 3VGMA 2QNCA 2DY4A 2GBZA 4C1NI 3VQ4A 3GOIA 2E2OA 3J80O 1N33K 2P9PB 4FWNA 3V4IA 2JLEA 3D0PA 5EY4A 1KHCA 2BGGA 3QIPA 3KTQA 4A59A 3VGKA 1X1PA 5F1XA 3VERA 4DR5K 2F96A 5AQKA 4R79A 3WQTA 2X6SA 3OYLA 3M8SA 4CESA 4GY2B 1VQKN 4MO4A 4XEIA 1SKWA 3UKRA 3T1AA 3NF7A 3ZSXA 5M1OA 4MLEA 3AVMA 3ZSRA 1KCFA 5EVZA 1RDBA 4Z0UA 2QXLA 3O9SA 3G0ZA 3H46O 3OYIA 1Q9XA 2YHWA 2G8IA 4FWMA 2ZJRL 1IV0A 1ATSA 1RDAA 4BR0A 4BG9A 1TKZA 4FLYA 4DV3K 3RR8A 4EP4A 4X66K 3FZHA 4FCYA 3QFUA 4BG8A 2QKKA 3I55N 2IVOA 1YNSA 3C7NA 1HNVA 4JK7A 5AQNA 4B9NA 1UOCA 3VGLA 2B6AA 4IDKA 5AQSA 1C0GA 2HB5A 5C12A 4HUEA 1WSIA 3SUNA 4O5FA 4DHYA 4DTXA 4AHSA 3RR7A 1YIJN 1HYVA 4JKGA 1OH8A 5FDLA 2ATQA 4JKDA 1JCGA 5JMVA 5JVGL 2NLXA 1NK8A 2FBXA 2GX9A 4DB3A 4BVOA 2XO7A 1NGFA 2A6AA 1QSLA 3CQ8A 4JLHA 1HJOA 3NGYA 2O8CA 1ATRA 2VGMA 5HRNA 4J8FA 1QQCA 3K59A 3K5OA 4H0YB 3V9XA 3CYMA 4KHSA 1BG3A 2PZSA 1FKOA 4DTSA 2QWLA 3OJUA 2DFEA 4OLAA 2CGKA 4CGFA 1GLDG 1HJRA 2KLAA 1VQ4N 3HSTB 3WNHA 4AHUA 2DTUA 3OS0A 4I6MA 1KFDA 4BQZA 1ZBLA 1SQKA 1NJIO 4NCBA 5LY3A 4DR1K 1NJZA 5HRRA 3KLIA 3AVIA 3N4QA 4OGEA 3H1VX 4XH5A 4W5TA 2FSNA 2P5GA 1HPMA 2P9IB 2QWNA 1B92A 4CGJA 1J5OA 4C8NA 2YHYA 5BR8K 1WSFA 3U6FA 1CZ9A 2FF6A 3EE9A 1ILYA 2E2PA 4Z94A 1A8VA 4X65K 5BRDA 1VQPN 3L2UA 4H0XB 1MU2A 4H5TA 1NOYA 4A57A 4K8ZA 3P1GA 4UZWA 3EE8A 5CIUA 4CVNE 3IAYA 3G4SN 5FRMA 4KRFA 3WNEA 2RKIA 4JI3K 1BQMA 1REVA 3ATUA 4B3OA 3P31A 1DTQA 1H9EA 4KTQA 4J2BA 1A5VA 4ELVA 4E7IA 1S9GA 4F9OA 4CIGA 4ELUA 1RT3A 1YVNA 1C1AA 3VOVA 4CFAA 4WCEL 2O4IA 4CIFA 4DU4A 3AGRA 5HLFA 1J5EK 3L8BA 4H8KA 1XHXA 4ILHA 2HF4A 3K0SA 2YJEA 5JLHA 4K0KK 2V52B 4DR6K 2AJQA 1BCMA 4JI1K 3AA3A 4JRPA 2Q2RA 4HHTA 1WBDA 3ZLJA 2AP1A 3O6WA 2KFNA 3M6GA 1X3NA 2Z1GA 3HBTA 4BR5A 4DLEA 1RBTA 2P51A 4DQ8A 4YOTA 3KK7A 3T3FA 4E1MA 4E1NA 3HXMA 3JYTA 4DFJA 1YJNN 4JNEA 1RTJA 4CEFA 4FYDA 3O5BA 1Z26A 1RTIA 1ZBUA 2NRRA 4EZ9A 1VSJA 1BO5O 3N4PA 4CJFA 3CJ9A 1H1VA 1NM1A 4O0JA 3C95A 3LWLA 3SPZA 2XRIA 5AQOA 5KRSA 1WN7A 3MMVA 4CZGA 5LMUK 3GL1A 2UUAK 3O80A 3FR0A 1QVFM 1BIUA 1JCFA 2HSTA 5JVHL 2OPRA 4DQIA 3NF6A 4JI7K 3ISNC 3CI5A 5FRNA 1YITN 3FZKA 4AHCA 1YJWN 2YNFA 3ZEUB 3K9KA 1MWKA 4CJ5A 5FPMA 1NJXA 2O8FB 3HOTA 3OYDA 2P9NB 3L3UA 4BRAA 4LF5K 3DM2A 3IG1A 4CHQA 3AVLA 1L3UA 2HBJA 2VG5A 3ID6A 2HHTA 2W42A 4OPHA 4C8OA 4LH5A 4KI6A 3KK3A 3SMPA 4CBUA 3R1XA 1SV5A 4HUGA 1RGIA 3NMUA 2NRVA 4DTMA 4CJSA 5C25A 4FLTA 3K2PA 3DLHA 3J8AA 1N32K 1HYSA 4JI5K 4WFBL 1KVAA 1IBKK 4L3QA 4IG3A 4CF1A 4ILJA 2JVWA 3CCUN 5LMNK 3L0OA 3I0SA 4YOUA 4GVEA 1KXPA 1LAWA 4E7KA 3P5JA 4DWIA 3HZ6A 1JL2A 1SKRA 4FJMA 4KHNA 3M1FA 4BC3A 3S3MA 4BR7A 2E2NA 1YF5L 1VAZA 1GL9B 5MLCQ 3PLAA 3DOLA 3PSIA 5FPEA 5CHIA 4PUOA 3ZSZA 2YV0X 3DLEA 1S1WA 3F9KA 3NDKA 4LF4K 4B9QA 3CJBA 5KPTA 4HCCA 2YKMA 1F21A 3EY1A 5AQYA 4B9LA 1Z25A 3D6RA 2VG7A 3MN9A 4CJTA 2G8KA 1CZAN 2KFZA 3MECA 3F9MA 5ELZA 4LF6K 3V9SA 1BISA 4YHHK 3TSUA 2W41A 2F4VK 1TK0A 1S9EA 4PKGA 1TL3A 4UY8O 3NF8A 1SS6A 3LM9A 3S3OA 1JEIA 1DLOA 4O8KA 5BREA 4B9UA 3CD6N 5GAEP 3SUPA 2CGJA 3VQAA 3ZSVA 3SV4A 1SKSA 1HRHA 3NVKA 3DXMB 3E9LA 2E1YA 3BP8A 4BVPA 1VSKA 3NBPA 3TAGA 1IKWA 3A5MC 4BR9A 1ZBHA 4KTZA 1Q86O 4CZFA 4IOAL 4CHZA 3E01A 4ILGB 2XY7A 1C6VA 4DFMA 1QS4A 1IKVA 5BPMA 1JXBA 2H3GX 1T44A 5TKWA 5KPRA 3MXIA 3VETA 3L4QA 2VQFK 1K8KB 2KFVA 1QZ5A 3ZSOA 1KQSM 1T8EA 3O1WA 4X64K 4DV5K 1U48A 4Z4FA 1OH7A 4B8AB 5AQFA 4A2BA 4DSKA 4CK1A 1FKPA 1B9DA 4ISFA 4DF8A 4CD3A 4CJ7A 3QESA 3ZYYX 2NUBA 3QDKA 3CJ1A 1NJYA 3FFKB 5KGWA 1GKUB 4JRQA 2V7YA 4JI6K 4KHYA 1NMDA 2P9KB 3OYKA 2DFFA 4CZMA 4E3SA 2RHKA 5GAGP 4LY7A 3LANA 4W5RA 4FJHA 1RNHA 2X6NA 1U2VA 3U8XA 4FVMA 3FZLA 3LZJA 4AHVA 1E4FT 3HM9A 1DGKN 1SL0A 1EETA 2MPHA 3ENOA 4N47A 4CFBA 3UB5A 3AVNA 2Q1NA 3CMAN 4J2EA 2HF3A 3LZIA 2CH6A 4CBWA 1LCUA 4BROA 2G8VA 2E4LA 4B1ZA 3AAQA 1D8YA 2GWKA 2Q0RA 3MDQA 2XY5A 3H1QA 5GINA 3CFRA 4WQ5C 1IKYA 4CW7B 2D0CA 3C6UA 3J7AP 4FJXA 1NGAA 2QM1A 2HBLA 2OPQA 3FZFA 4FJ9A 4QCLA 3L2RA 4DQSA 3D2FA 1TKTA 3HVTA 3KJVA 1XMQK 3V9ZA 1GLBG 3EEQA 1RTDA 3ULEB 1WLJA 2Q97A 4O5BA 4FOIA 2HMPA 3VQCA 4HUFA 1VSEA 1S22A 3B6OA 1VHXA 3OTOK 1QTMA 4Y1CA 5I42A 4U67L 3F2KA 3RRHA 2YHXA 2HHHK 1HMVA 2RF2A 5IT9O 2KZMA 5AQIA 4KH5A 3R9PA 4KB0A 2OCEA 4FVUA 3SUQA 3NAEA 1U04A 3CCRN 2QA4N 4YY3K 2WBNA 3V6DA 4NLBA 3OYAA 1LOTB 4R5PA 2HMIA 3UIQA 1GLFO 3OW2M 2D4WA 3QBWA 3E1YA 3ZT0A 4Z4CA 4KHQA 4JYAK 3R8EA 1NGDA 3O9RA 4OKJA 1DEJA 3DMJA 1JCEA 5E26A 3ID8A 1RILA 3WQUA 2ZWHA 2ZE2A 4JI4K 2AA4A 3A5LC 4PKIA 4WYBA 3BUZB 1Y97A 1HNIA 1VQ5N 1KAZA 4CBXA 5GIPA 1IBMK 4C23A 2P9KA 4H4OA 2R7YA 4ELTA 1VSHA 2O8EB 5E41A 5KTQA 3V81A 2IC3A 3JXUA 3QEWA 5AZIB 4IZ9A 4CEZA 4BGBA 3MN7A 3KVGA 4DSEA 3AO2A 4IJNA 1RBVA 2ASPA 1D9FA 3EO3A 2YJFA 1ZS9A 3MX2A 4CEEA 1NKBA 3LDPA 4FLUA 1I3AA 4BC2A 3RMDA 3TSPA 2V51B 3CJ7A 3TTCA 3SQ4A 1TKDA 4GKKK 2EHGA 4LSNA 3OYGA 3OBYA 3TTFA 3HPOA 3QETA 3TAPA 5A2QO 5HL7L 5FROA 2VGNA 4AHRA 2KW9A 3MCPA 3TR8A 3VF4A 1MDUB 3LP2A 2PBDA 3LALA 4BREA 2A40A 4JEPA 5GADP 3CPWM 4FZZA 3M5RA 2KVUA 4JKAA 3AA4A 3V9UA 1LWEA 3DXKB 2FSJA 3EZ5A 3L2QA 5J2PA 1UA0A 1J54A 3E66A 2VQEK 4BACA 2P9LB 5AQUA 3B8AX 4BWJA 3TAEA 2ZGYA 4O8UA 3CIPA 4HVJA 2ASOA 4C8KA 1TYQB 3EKUA 4H0PA 1D9DA 1QSYA 5EXWA 3TABA 3M3ZA 3O3FA 3MEGA 1BL3A 4DR4K 1S5JA 3ATVA 1NK6A 5GIOA 4WQ4C 4N5SA 3NH0A 1RT5A 3D2EA 2OZMA 4C8MA 4JI8K 5M1PA 1U45A 4KPYA 2F9TA 4XH4A 1NK7A 2HHSA 1ASVA 5AZJB 4Z4HA 3TSQA 1QVGM 1IG9A 3QBXA 5C0YA 4BR4A 1G15A 1W0HA 1TAUA 4H5RA 3ZT3A 3HPHA 3PX0A 4PWDA 3CM5A 2KTQA 3HJFA 4FWQA 2O8EA 1KAYA 4QS8A 2BH1A 2OANA 4LFBK 4M3TA 2QKBA 5CE3A 1OH5A 1JLCA 2P9NA 3VQ7A 1HYZA 4JKEA 1GLAG 4JKBA 1X9WA 3KWGA 4Q0BA 4FPAA 3IKMA 2FSKA 2O8BB 3BDPA 4CZJA 1ZYQA 4IOXA 1VQ7N 4XH1A 3QEPA 3TAQA 1VK0A 3I33A 5DMRA 1JLFA 4BDPA 1X9JA 1N36K 4KB1A 1RT1A 4B1UB 3QMLA 4CK3A 3CCQN 3ZSQA 3LPUA 3F5TA 4JK9A 2O8DA 4PHTX 4NO7A 3WT0A 3VQ6A 3DLRA 3ZEUA 4QAGA 4EHUA 3A0IX 3THWB 4BRHA 4B1WB 3V1RA 2A3ZA 3DI6A 1UWBA 2NRZA 3JSMA 4CHPA 1LAVA 3AVAA 3JS6A 1VRTA 5ADXA 3CFPA 3QERA 4JKHA 2JWKA 1OVYA 1RT2A 5M1NA 1RBSA 3UE5A 3CCMN 2NRWA 2IVNA 3BEXA 4K25A 4Z4IA 3AVBA 3THYA 2Y1IA 3SAHA 1W97L 1QQNA 4O4GA 3THXA 1KAXA 3VTHA 3I0RA 1C0TA 3ALYA 2WTUA 3HT3A 1N5YA 3NGZA 3SAFA 3OY9A 2YNIA 3SAGA 1LV5A 4CJPA 3D2EB 3G25A 2HHUA 4MDAA 1T6DA 4DV4K 1FK9A 3K58A 1GLJO 5GAHP 2DFHA 1ZBSA 4LF8K 1RDCA 3WEEA 2A1SA 5CYMA 2E6MA 3E9OA 3S3NA 1S72N 3U3YA 1O13A 4I9LA 3NCIA 4G9ZA 4RWTA 5C42A 4YNQA 4CJLA 1J53A 3H3NO 4DV2K 4C8LA 3K5NA 1GLEG 3OS2A 4OVLA 2PY5A 3WXKA 4CFCA 3RWUA 3MEDA 3CPEA 4W5OA 3R3LA 4CFDA 3LDQA 3O08A 4B1YB 5I9EB 2UXCK 2HJQA 4OPJA 1T05A 2KZZA 1ZBFA 2G8WA 2HHXA 2HNZA 4DR2K 4PY5A 1EX4A 1N34K 1WNSA 1NKEA 2BTFA 1X9MA 2Q36A 3CCJN 4CF8A 3EKSA 1HQUA 4BGAA 4DS5A 4E19A 3KK1A 3PIOL 3AO3A 4JKCA 3CCEN 2E88A 1EXQA 4UQGA 4LD0A 5AQHA 3QEXA 4FW2A 5HBMA 1IBLK 2NRTA 2OTLN 1Q8IA 4DUYK 3SJJA 3Q7BA 2ETJA 2P1JA 2Q0UA 1E7LA 2NNWA 3WNFA 4W5NA 4KAZA 4CEBA 5EX5A 3ZETA 3U3GA 3G71N 3K9JA 3KZBA 3O9TA 5LL6Z 3OJSA 3OHRA 5M1FA 3I8BA 4FM2A 2FBTA 4DTPA 5CY4A 3HP9A 5DK5A 1NK4A 3A8YA 4Z4EA 5AQZA 1DKGD 2X78A 4OKKA 5KPZA 4LF7K 3PX4A 3C6AA 1U49A 1NU0A 4FJNA 3IUCA 4DG1A 3B6PA 4E1JA 1NGJA 3LLRA 3WEEB 1V4TA 1Y02A 1T7PA 5C10A 4EZ6A 4CJ3A 1ZXOA 2IDOA 3O4NA 4K8XA 2Y1JA 4M3UA 3THXB 1B9FA 3PSFA 3LDLA 3CCSN 3FE1A 4X62K 4CF2A 5I3UA 3SI6A 4JAXA 2G80A 3QKJA 2W6LA 1LW0A 4DTOA 2E6LA 3SLCA 2ITGA 4DTNA 2P9SB 3LM2A 4O55A 4FLVA 1CXUA 3ITHA 2RN2A 2ITMA 4CGDA 3NFAA 4B3MK 2GV9A 4CF0A 4OX9K 4HCBA 2P9UA 1HR0K 3HSCA 3D2FB 3BZKA 4IBNA 3F73A 2HW3A 4EIAA 2EX3A 4BRPA 4FWRA 3VEXA 4RW7A 1HKCA 3VQDA 4KHUA 4CEAA 3CC4N 1J9AA 5ADXH 2QWOA 3VF6A 1L3SA 2YCHA 4BRNA 3H6EA 1OH6A 3CHWA 3SCXA 4H5NA 4BC4A 3LDNA 1M90O 5F0XA 3E9PA 4NCAA 1TAQA 4DSLA 1NK0A 3SJHA 1GLLO 1RDWX 2G8HA 4IJAA 4IEEA 1CZBA 1XNQK 3VEOA 4IFEA 1LWFA 4LSLA 4RW6A 3O3GA 2A41A 4M3WA 4YOVA 3CERA 1E3MA 2XY6A 2IOCA 2HBMA 2FC0A 2ZJPL 4XIUA 4DS4A 3PV8A 1R0AA 2QK9A 1EO1A 2P9PA 2D0PA 5JS1A 1W7AA 4OO1J 3FLCO 2IGIA 1JL1A 4FWPA 1YHQN 3QEIA 3UKUA 4OLBA 1SAZA 2GUIA 1ATNA 4DUZK 1OKJA 1QQOA 1ZC6A 4PKHA 3ULDA 5AFUA 4Q5VA 4JI0K 3QINA 3DWLA 4DKWA 4MO5A 1HKGA 1EWRA 4B8CA 5J2NA 3U4LA 3HVRA 1WOQA 4MDBA 2A1RA 1RTHA 1KLMA 4AH9A 4CZIA 5H1SQ 4OGCA 1U6ZA 2E1ZA 3BZCA 2P5OA 5FPNA 1GOAA 3AVJA 1I39A 5HP1A 4FJLA 1P90A 3WXMB 1CLQA 4BDZA 4PL8A 4WQ4A 4JN4A 1WSGA 4RCHA 3KD1E 1ITGA 1QE1A 3SBTA 5KQDA 4FJ7A 3DLGA 3DRSA 1VQMN 4CZHA 1S1XA 4OPKA 3W0LA 2G8UA 4DF4A 3M8QA 5SWMA 3IRXA 4IWVA 2BANA 4JD2B 4CEQA 1YI2N 2YX6A 2I7NA 3IDHA 1A5WA 4AILC 1A5XA 1E4GT 2LC3A 3MWTA 3SUOA 1RFQA 3I8DA 1XHZA 5AQPA 3MXMA 3KD5E 4CJVA 2PFUA 1BA1A 1WSEA 2I5JA 2B4JA 5AQLA 3GE1A 4JD2A 3ZT1A 3JAMO 3O8MA 5AQWA 4EHTA 4CZEA 3L2VA 4E89A 3PY8A 2O4GA 1VSMA 4DQRA 1KVCA 4HTUA 5D3GA 3R6MA 4A61A 2E5LK 3RSEB 3D7EO 5DM6L 4FM1A 2WUSA 2VG6A 2Z1IA 3QFPA 5CZ1A 4N76A 3DOKA 3MWPA 3LPTA 4K41A 4M3ZA 3O9QA 3IFRA 4BQLA 4YDUC 2W40A 1GLCG 5TKYA 4DV6K 4DU1A 3OYCA 3KLEA 4DLGA 4GMJB 4F3OA 1EP4A 2IAJA 4DFKA 2YHBA 3HI0A 3VQ9A 3SNNA 3HTVA 5J1EA 3C6TA 4YOYA 3VESA 4A5BA 4DR7K 3IS9A 5FPDA 2KHOA 4IXCA 4W5QA 3O9UA 5IWAK 4B3SK 1VQON 4CJKA 3UKUB 4CI6A 5AZIA 1KFSA 3C0BA 1P8ZA 3SK3A 2GWJA 4BE0A 4F3TA 1JXEA 4CGGA 3TWHA 3DRPA 3W3DA 3SQ1A 2WFBA 3V1QA 2QTDA 2PYLA 5AQMA 4BRIA 3VA0A 4ZTFA 1HKBA 3CCVN 2QWQA 1A63A 3TU5A 4JK8A 3SBGA 3T19A 3PUFA 2CGLA 2VWBA 3VQ5A 3AA5X 4FJKA 4IFVA 2WC9A 4KTWA 3Q7CA 2YKNA 4K43A 1HUXA 1QZ6A 3KKRA 4FO0A 3OYEA 1T03A 3OVNA 3ULEA 4HTLA 1YTAA 3CJCA 4ID1A 1ZBIA 3CC7N 1K8AO 4BDYA 4K42A 4CJ4A 2Q31A 2D0OA 3C7NB 1EKEA 3A5NC 5JS2A 1HPZA 3P4IA 2WQGA 1KC8O 1T6CA 2Z1HA 2PYJA 4MQ3A 2GEMA 4DR3K 1IG8A 1SUQA 1IH7A 2P9UB 3AARA 4E7LA 2UXBK 1TL1A 4AM6A 1OVQA 1TKXA 3HP6A 2D1KA 4EP5A 1RCHA 1S3XA 1YAGA 4FLXA 3LL3A 3AVHA 3OYFA 4NB4A 1KD1O 1BDGA 3HRGA 4RW4A 1BCOA 2X74A 1QSSA 1WUAA 3C94A 4FLZA 1TUYA 3U9ZA 4J2AA 3T7ZA 4V19S 2OPPA 2RPIA 3O3HA 1I94K 2G8FA 1VSIA 1L5UA 5C2DA 3WXLA 2VCPA 1XQSC 2XHBA 1WAJA 2O8DB 1DTTA 3D45A 1JLEA 1MA9B 1SZ2A 1WAFA 4LH4A 3ASMA 1XUPO 4CJRA 3VQPA 4CHNA 2FBVA 4I2QA 3WXJA 4CZLA 2BE2A 4FL9A 4M63C 1C0MA 3MCAB 5BN8A 4DFPA 2D0AA 4GNIA 2QWMA 1DT9A 4KHPK 3LP3A 4DV1K 1HQEA 3MAQA 4DTRA 4NYNA 5AJ3K 3L2WA 1W9HA 2UUBK 2QWRA 5C15A 3HM8A 1E7DA 3IMXA 3KKSA 1HNXK 3RMBA 3GBTA 2E20A 2UU9K 4RW8A 1L3TA 1ASWA 4N56A 1EN7A 2ZF5O 4FWKA 1V4SA 3LAKA 1BI4A 3AO1A 4F4KA 3A5OC 4JS4A 2KKZA 1YVUA 1QQMA 1RT7A 5JLFA 3QLHA 2O8CB 4B3RK 1RT6A 5AQTA 3OS1A 3DAWA 5AZJA 4GV6A 1HNZK 3BF3A 1VSFA 3S9HA 4DSFA 5C24A 4CZKA 4WE1A 3VENA 1IKXA 1LWCA 2WONA 1ESVA 4DCHA 3OA9A 5KRTA 2EWSA 2IIRA 4DSJA 1XC3A 3T1YK 4YORA 1U47A 3O4QA 3VTIA 4GV9A 3QO9A 3L0QA 3HPGA 4DV7K 3AVGA 5AQGA 1R59O 3OBWA 4BC5A 3WXIA 2IS3A 2NRXA 4F2RA 4FK2A 4FJ8A 3NE6A 4NCGA 1BWFO 3VEVA 3THYB 4PL7A 4FJIA 4L8RB 4ICLA 5LJVA 3DXKA 4MLHA 4EFHA 4J2DA 4WF9L 2W51A 3FZMA 3VEYA 3C65A 5EOYA 4YOWA 2F7TA 4AHTA 1K9MO 2OA8A 1MWMA 4CERA 3EZWA 2V7ZA 4B9VA 1V66A 3TANA 4CEDA 3OYNA 4CCHA 3KIOA 5AR0A 4I9QA 1ASUA 1XMOK 3SPYA 4B1VA 3CM6A 4DQPA 5CYQA 3P83D 1IJJA 4ISEA 3LDOA 4GV3A 4I7FA 4B3TK 1NLVA 3P39A 3TI0A 1JLQA 4FSVA 3H08A 4FK4A 1BIZA 4JI2K 4M42A 1KTQA 2BUPA 1S6PA 2FXUA 1YT3A 2O8FA 1NGBA 3THWA 4IDHA 3ZSWA 2QEXN 2OZSA 2D0BA 2ZM6K 4FZXC 1T3VA 3MEEA 1NGGA 5F2RA 1HX1A 2HNYA 5BPNA 4FW1A 4DQQA 1XI1A 4NYFA 4Y1DA 4U7BA 1S1UA 4KKOA 4EAHD 4H0VB 1NMNA 1G99A 4H0TB 1NOZA 4C1NK 1JJ2M 3VEWA 2VWKA 3BF1A 1YTUA 1K6YA 1CXQA 3CFOA 4GW6A 4F8RA 4O0IA 3H3OB 5CR4A 3VPZA 5C2FA 1Q9YA 4YFUA 4QS9A 4FK0A 1NBWA 2YNGA 3S41A 3HOSA 1XC9A 2VWJA 1JKHA 3NVMA 2NZTA 3J7YP 3CMEN 4LFAK 3AVCA 4AQYK 2P9SA 1NWKA 1NGHA 3ZX3A 3ENBA 4PQUA 4CGHA 1HNWK 1RDDA 1N8RO 2A8VA 4FWOA 1TUUA 1GJJA 5B8HA 3ZX0A 2QXFA 4FOEA 3M8PA 2HVIA 1C1BA 3RSEA 4BRFA 1XWLA 1KRPA 4FPBA 3C6HA 4RG8A 3VQBA 4B1XB 3SZ2A 3KLHA 1S1TA 3RMAA 1JLAA 3CXCM 4M7YA 3LAMA 3M8RA 4CGIA 4RTFD 3J81O 4CHYA 4DSIA 4F2SA 2CH5A 5AQJA 1NK9A 3GG4A 4NLCA 3U9DA 1TYQA 4H03B 2NRHA 1HLUA 3L3VA 4KO0A 2E8AA 5HOOA 3QIOA 1SL1A 4M7XA 3AV9A 2ODGC 4OKEA 3KHYA 5BPLA 3OYMA 4BITA 3VQQA 2XY8A 4DMNA 1FW6A 3BGRA 3OYHA 3CQYA 2F8SA 1Y64A 5AQRA 2P9LA 4M45A 2UUCK 3EL2A 3V1OA 3SMSA 1WBBA 4TSXA 3NHGA 1H1JS 3SQ0A 1SL2A 5E84A 3CC2N 3VQEA 4DV0K 1TV6A 1QHAA 1RBUA 1WB9A 1NK5A 4CJQA 4DTUA 1BOTO 5BRFA 4FWSA 4RW9A 2HHWA 1TK8A 4B9TA 3NF9A 1VQLN 4FZYA 2W6KA 4Z4GA 2UYTA 2D5RA 3ZX2A 3CJAA 3MXJA 1H9FA 5M1KA 4QOZB 1Q18A 3CQXA 3FGUA 3HL8A 2RNNA 1KSPA 5HRPA 3NH2A 1BI4B 1C0UA 1K8KA 4E7HA 4JKFA 2KVDA 1X3MA 3ZT4A 1Q82O 3KLGA 1X9SA 1XNRK 4HWIA 4A62A 2Q3SA 3AO4A 4KV8A 3WUHA 2ASMA 2IVPA 4YDUA 1NJWA 4IKFA 2YNHA 2P9IA 3TTDA 3EYZA 3T1HK 2JGUA 1VQ8N 4ID5A 1KVBA 2Z1JA 2HBKA 1L3VA 1N6QA 4OPAA 4BRCA 1TGOA 1NGCA 4ISGA 4I6MB 5DM7L 5KQ8A 3K5LA 3TARA 3PO5A 2ZD1A 4AM7A 3VF2A 2UXDK 4H5WA 3AY9A 1QHTA 5J2QA 2GUPA 4CJWA 2OYQA 4E0DA 4LF9K 1YJ9N 1NNEA 4H4MA 2OPSA 1JLBA 3ZSYA 2F8TA 3H45C 3RVCA 2E2QA 2KW4A 1BQNA 4LC9B 1YUWA 2F9WA 4CF9A 3PIPL 4M3YA 1GOBA 4CEOA 3SV3A 2DK4A 2LD7A 3PX6A 1JLGA 3THVA 4CD1A 3TAFA 4G1QA 4MFBA 3CF5L 3ZCMA 3L6QA 4H0OA 5AFUH 3VMFB 1WSJA 3DLLL 5EU7A 4KI4A 2ODCI 1NKCA 3UKRB 2ZGZA 3QICA 4BWMA 4BRKA 3VQ8A 3AAPA 3MX5A 3NGIA 3SYZA 5AQXA 4IG0A 1C0FA 4M3XA 4BRLA 4BRMA 3CCLN 2HOEA 4A2AA 4O44A 4FM0A 2BDPA 1UAXA 4NXMK 4M41A 5KGXA 1K73O 4CE9A 1U2VB 2HNDA 1EQYA 3RMCA 4IO9L 4FJ5A 5M1QA 1IO2A 2I7PA 3HYFA 3VN5A 4BY9C 1Q81O 4CK2A 5SZTA 4GKJK 4BR2A 1Q7YO 5BRHA 1GOCA 5JICA 1D5AA 2GELA 4JV5K 4WFAL 2KVEA 5HROA 2HVHA 3GDQA 4FJGA 1BGXT 3G6EN 2WOMA 1RT4A 2ZQBA 4JS5A 4FJJA 4IO8A 2J4RA 3HK2A 3I56N 4ZHRA 3VEZA 3HO1A 1VSDA 4KREA 2O8BA 3LP0A 5CZ2A 4CJUA 3PO4A 3P38A 4CIEA 1BU6O 3VA3A 4LFCK 4KH6A 3ZETB 4JHDA 3RRGA 2VYPA 4AF1A 3DLKA 3FFIA 1JEQA 3ZT2A 5LJWA 3LP1A 3T69A 1UA1A 3BY5A 3KK2A 3QNOA 3LDSA 4B08A 4CHOA 2QW9A 2QNFA 4BE2A 3AVKA 3DYAA 4OJRA 4BE1A 3DXMA 3QEVA 3DJCA 3CG7A 1TVRA
chains in the Genus database with same CATH topology
2D0AA 3DLEA 1S1WA 3F9KA 3NDKA 3LP3A 4C8LA 3K5NA 2HHQA 3OS2A 1HQEA 4OVLA 3MAQA 2PY5A 4DTRA 4NYNA 3L2WA 1W9HA 4CFCA 2YHAA 2YKMA 3RWUA 4HCCA 1F21A 3EY1A 3V9WA 3MEDA 4B9LA 1Z25A 2VG7A 5HRSA 3KKSA 4CJTA 2LSNA 5T7BA 3RMBA 2G8KA 3SQ2A 4W5OA 2KFZA 3MECA 4CFDA 4RW8A 1L3TA 1ASWA 3V9SA 4N56A 1BISA 3OYBA 4OPJA 1T05A 4DTJA 3OYJA 3LAKA 2KZZA 1TK0A 1BI4A 1ZBFA 2G8WA 3AO1A 4F4KA 2HHXA 2HNZA 1S9EA 4JS4A 4PY5A 1EX4A 1TL3A 1YVUA 4N41A 3NF8A 3DLBA 1RT7A 3S3OA 1TK5A 1WNSA 1DLOA 3QLHA 3QNNA 4B9UA 1NKEA 4GVMA 1C0MA 1RT6A 3OS1A 3SUPA 4ZTJA 1X9MA 4FXDA 2HHVA 4CF8A 3SV4A 3VQAA 3ZSVA 1SKSA 3A2FA 1HRHA 1U4BA 1HQUA 3NH1A 5KI6A 4DS5A 4E19A 4DU3A 2RNOA 1VSFA 3S9HA 3KK1A 1S6QA 1VSKA 4DSFA 4KHWA 3AO3A 3NBPA 4FLWA 3TAGA 1IKWA 1LW2A 5C24A 4WE1A 1ZBHA 1IKXA 1LWCA 2WONA 1EXQA 4UQGA 4KTZA 4LD0A 4CJEA 4CHZA 5KRTA 3AO5A 3QEXA 3E01A 4FW2A 4DSJA 2XY7A 1C6VA 4DFMA 1QS4A 3DRRA 5HBMA 1IKVA 3LWMA 1BHLA 1JXBA 1U47A 1Q8IA 3O4QA 3SJJA 2B5JA 1RBRA 2ETJA 2P1JA 3QO9A 3MXIA 3WNFA 4W5NA 3HPGA 1VRUA 4KAZA 2KQ2A 4CEBA 3AVGA 3RTVA 1O1WA 3ZSOA 1T8EA 3U3GA 4Z4FA 1U48A 4IFYA 4B8AB 3OJSA 4DSKA 1C1CA 4I2PA 1FKPA 1B9DA 4CK1A 4DF8A 1FXXA 2IS3A 4FM2A 2FBTA 4F2RA 4M3RA 4FK2A 4FJ8A 4DTPA 3QESA 3NE6A 4NCGA 1KLNA 2NUBA 5CY4A 3HP9A 5DK5A 1NK4A 4B9SA 4ICLA 4FJIA 4L8RB 5K14A 4Z4EA 1NJYA 2X78A 4OKKA 5KGWA 4JRQA 4CECA 4J2DA 3PX4A 4KHYA 1WSHA 1U49A 3K5MA 4B9MA 4FJNA 3OYKA 2DFFA 4DG1A 3B6PA 4E3SA 5J2MA 4AHTA 2OA8A 1JJRA 3AVFA 4CERA 3TAMA 1T7PA 3KLFA 4LY7A 4E7JA 3LANA 4EZ6A 4W5RA 1S1VA 4B9VA 4FJHA 1RNHA 2X6NA 1V66A 4CJ3A 3K57A 4CEDA 3OYNA 3AA2A 3TANA 3G10A 4PA1A 4CCHA 3KIOA 2IDOA 3O4NA 4I9QA 4K8XA 1ASUA 2Y1JA 4M3UA 4FVMA 3WNGA 1B9FA 4KFBA 3LZJA 3SPYA 4AHVA 3CM6A 4DQPA 3HM9A 5CYQA 3P83D 1SL0A 1VSLA 3ZSZA 1EETA 4N47A 4CFBA 2FBYA 4CF2A 4I7FA 3AVNA 5I3UA 4J2EA 3SI6A 2DY4A 2GBZA 3TI0A 3LZIA 1JLQA 3VQ4A 3H08A 4FK4A 1BIZA 2G8VA 4M42A 1KTQA 1LW0A 2E4LA 2JLEA 2E6LA 3D0PA 4DTOA 3V4IA 1D8YA 2ITGA 1S6PA 2XY5A 2BGGA 4DTNA 3QIPA 4O55A 1YT3A 3KTQA 4FLVA 3CFRA 1CXUA 3ITHA 2RN2A 1IKYA 1X1PA 4CGDA 3ZSWA 3NFAA 2OZSA 2GV9A 4CF0A 2D0CA 3C6UA 4FJXA 2F96A 2D0BA 4HCBA 4QCLA 2OPQA 4FJ9A 3L2RA 4FZXC 4DQSA 3MEEA 1TKTA 2X6SA 3HVTA 3KJVA 4IBNA 2HNYA 3OYLA 3F73A 3V9ZA 2HW3A 3M8SA 2EX3A 4CESA 4FW1A 4DQQA 1XI1A 4NYFA 4Y1DA 1S1UA 4RW7A 4KKOA 1RTDA 1SKWA 3VQDA 4KHUA 4CEAA 3T1AA 1J9AA 1WLJA 3NF7A 1L3SA 4O5BA 3ZSXA 3AVMA 3ZSRA 1NOZA 3VQCA 1KCFA 1RDBA 4HUFA 4Z0UA 3QEVA 1VSEA 1YTUA 2VWKA 1K6YA 1CXQA 3CFOA 3G0ZA 3B6OA 4GW6A 4O0IA 3OYIA 3SCXA 1Q9XA 1QTMA 4F8RA 2G8IA 4Y1CA 5I42A 1RDAA 1Q9YA 3RRHA 4YFUA 2RF2A 1HMVA 1TAQA 1NK0A 4DSLA 1TKZA 4FK0A 4FLYA 4NCAA 4FYDA 3RR8A 2YNGA 4EP4A 2G8HA 2KZMA 1XC9A 1CZBA 4FCYA 4KB0A 2VWJA 1JKHA 2QKKA 3SUQA 3NAEA 1U04A 1LWFA 1HNVA 3V6DA 4LSLA 4RW6A 3AVCA 3O3GA 3OYAA 4M3WA 4B9NA 1UOCA 4R5PA 2HMIA 2B6AA 2IOCA 2XY6A 2FC0A 4DS4A 4IDKA 4XIUA 4CGHA 3PV8A 1R0AA 3UIQA 2QK9A 4PQUA 2HB5A 1RDDA 4HUEA 1WSIA 3SUNA 5JS1A 3ZT0A 4Z4CA 4DTXA 4KHQA 4AHSA 2IGIA 1JL1A 2QXFA 3RR7A 3M8PA 2HVIA 1HYVA 1C1BA 4OKJA 2ATQA 5FDLA 3QEIA 3DMJA 1XWLA 1KRPA 4OLBA 1NK8A 2FBXA 4RG8A 2XO7A 1RILA 3VQBA 2GUIA 3ULDA 1QSLA 2ZE2A 3CQ8A 4Q5VA 3SZ2A 4JLHA 3NGYA 3QINA 3KLHA 1S1TA 3RMAA 1JLAA 1Y97A 3LAMA 1HNIA 3M8RA 5HRNA 3K59A 1QQCA 4B8CA 4CGIA 5J2NA 3K5OA 3HVRA 3V9XA 2A1RA 1RTHA 1KLMA 4AH9A 3CYMA 4CHYA 4OGCA 4KHSA 4H4OA 2R7YA 2PZSA 4DSIA 2P5OA 4ELTA 1VSHA 1FKOA 4F2SA 5E41A 1NK9A 4DTSA 3OJUA 1GOAA 5KTQA 2DFEA 3AVJA 3V81A 2IC3A 4OLAA 4CGFA 1I39A 5HP1A 4FJLA 3QEWA 1HJRA 3L3VA 4KO0A 1SL1A 3QIOA 3HSTB 4CEZA 3AV9A 4OKEA 3WNHA 4BDZA 1CLQA 4AHUA 2DTUA 3OYMA 4BITA 4DSEA 3AO2A 1WSGA 3OS0A 2XY8A 1KFDA 3VQQA 1RBVA 4DMNA 1D9FA 1ITGA 1QE1A 1ZBLA 3KD1E 4FJ7A 4CEEA 1NKBA 4NCBA 3BGRA 4FLUA 1I3AA 3DLGA 3DRSA 3OYHA 5HRRA 3KLIA 3AVIA 1NJZA 4OGEA 3RMDA 2F8SA 3SQ4A 1TKDA 4W5TA 1S1XA 2EHGA 4LSNA 3OYGA 3HPOA 4OPKA 3QETA 4M45A 3TAPA 4DF4A 2G8UA 2P5GA 3M8QA 5FROA 5SWMA 3V1OA 1B92A 4AHRA 2KW9A 3IRXA 2BANA 4TSXA 4CGJA 1H1JS 3NHGA 1J5OA 4C8NA 4CEQA 3SQ0A 1SL2A 1WSFA 3U6FA 3TR8A 1A5WA 1CZ9A 3VQEA 4AILC 1TV6A 3LP2A 3LALA 1A5XA 1RBUA 1NK5A 4CJQA 3SUOA 4DTUA 3I8DA 1XHZA 3L2UA 3MXMA 3KD5E 4FZZA 1MU2A 4CJVA 1WSEA 2I5JA 4RW9A 2B4JA 2KVUA 1NOYA 2HHWA 3AA4A 3V9UA 1LWEA 1TK8A 4K8ZA 3P1GA 4UZWA 3EZ5A 3L2QA 3NF9A 5J2PA 4B9TA 1UA0A 3IAYA 3ZT1A 1J54A 4FZYA 4Z4GA 4BACA 3L2VA 2D5RA 5FRMA 3MXJA 4E89A 4KRFA 3WNEA 2RKIA 3PY8A 2O4GA 1BQMA 1REVA 1KVCA 1VSMA 4DQRA 4B3OA 4HTUA 4BWJA 3TAEA 5D3GA 4HVJA 1DTQA 4QOZB 4C8KA 4KTQA 4J2BA 4FM1A 3HL8A 2RNNA 1KSPA 1A5VA 5HRPA 4ELVA 3NH2A 4E7IA 1S9GA 1BI4B 2VG6A 1C0UA 2Z1IA 5CZ1A 1QSYA 1D9DA 3DOKA 4N76A 3LPTA 4E7HA 3TABA 4CIGA 4M3ZA 4ELUA 2KVDA 3O3FA 3MEGA 1BL3A 1RT3A 1C1AA 4CFAA 3ZT4A 1S5JA 3KLGA 1X9SA 4DU1A 3OYCA 3KLEA 2O4IA 4CIFA 4DLGA 4DU4A 1NK6A 5HLFA 2Q3SA 3AO4A 4KV8A 3L8BA 4GMJB 4H8KA 1XHXA 1NJWA 4F3OA 2YNHA 4N5SA 4IKFA 1EP4A 3NH0A 3EYZA 2IAJA 1RT5A 2JGUA 4DFKA 2OZMA 4C8MA 2YHBA 3VQ9A 3SNNA 1U45A 5J1EA 4KPYA 3C6TA 4ID5A 1KVBA 2Z1JA 1NK7A 2HHSA 1ASVA 1L3VA 3IS9A 4Z4HA 1N6QA 4DFPA 1IG9A 2AJQA 1BCMA 1TGOA 3AA3A 4JRPA 1G15A 4W5QA 4HHTA 1W0HA 3K5LA 2KFNA 3TARA 4CJKA 3PO5A 1TAUA 1KFSA 2Z1GA 3ZT3A 2ZD1A 3HPHA 3PX0A 4DLEA 4PWDA 1RBTA 3CM5A 4BE0A 1JXEA 2P51A 4CGGA 4F3TA 3TWHA 3HJFA 2KTQA 1QHTA 5J2QA 3DRPA 4CJWA 2OYQA 3SQ1A 3T3FA 4E1MA 4E0DA 4M3TA 4E1NA 4H4MA 3HXMA 2QKBA 2OPSA 1JLBA 3V1QA 3ZSYA 2F8TA 2PYLA 1JLCA 2KW4A 3JYTA 3VQ7A 1HYZA 1BQNA 1RTJA 4CEFA 3VA0A 4DFJA 4ZTFA 1Z26A 1RTIA 4CF9A 1ZBUA 1X9WA 4EZ9A 1VSJA 4M3YA 1GOBA 4CEOA 3SV3A 4Q0BA 3T19A 4CJFA 3PUFA 3PX6A 1JLGA 3BDPA 3THVA 1ZYQA 4O0JA 3VQ5A 3AA5X 3TAFA 3C95A 4FJKA 4G1QA 4IFVA 4MFBA 3LWLA 3QEPA 3ZCMA 3SPZA 3TAQA 1VK0A 4KTWA 2XRIA 2YKNA 5DMRA 1JLFA 1WSJA 3KKRA 1T03A 4BDPA 5EU7A 5KRSA 3OYEA 3OVNA 1WN7A 1NKCA 4KI4A 4KB1A 1BIUA 4BWMA 1RT1A 1YTAA 3VQ8A 4CK3A 4DQIA 2OPRA 4ID1A 3NF6A 3ZSQA 3NGIA 3LPUA 3SYZA 3ISNC 4IG0A 1ZBIA 4M3XA 4BDYA 4CJ4A 3VQ6A 5FRNA 4O44A 1EKEA 4FM0A 5JS2A 4AHCA 2BDPA 3DLRA 1UAXA 4QAGA 4M41A 1HPZA 2YNFA 4CE9A 5KGXA 2HNDA 3RMCA 4CJ5A 4FJ5A 1IO2A 2WQGA 3HYFA 3V1RA 1NJXA 3DI6A 3VN5A 1UWBA 2Z1HA 3JSMA 4MQ3A 2PYJA 4CK2A 5SZTA 3OYDA 1SUQA 3L3UA 4CHPA 3DM2A 1LAVA 3AVAA 1GOCA 1IH7A 3IG1A 3AVLA 4CHQA 1L3UA 1VRTA 1D5AA 3CFPA 4E7LA 3QERA 1TL1A 2VG5A 2KVEA 1RT2A 2HHTA 2W42A 5HROA 4C8OA 1TKXA 3HP6A 4LH5A 4FJGA 2HVHA 4EP5A 1RBSA 4KI6A 1BGXT 1RCHA 3KK3A 4FLXA 2WOMA 3AVHA 1SV5A 1RT4A 2ZQBA 3OYFA 4JS5A 4HUGA 3AVBA 4Z4IA 4DTMA 4FJJA 4CJSA 3HK2A 2Y1IA 4O4GA 4ZHRA 3HO1A 1VSDA 4RW4A 3I0RA 5C25A 4FLTA 4KREA 1BCOA 3ALYA 1C0TA 3LP0A 5CZ2A 4CJUA 2X74A 1QSSA 3PO4A 3K2PA 4CIEA 3DLHA 3HT3A 1N5YA 3NGZA 3VA3A 3C94A 4FLZA 1HYSA 1KVAA 3OY9A 2YNIA 4J2AA 4IG3A 1LV5A 2OPPA 4CJPA 2RPIA 4CF1A 3RRGA 2JVWA 2HHUA 3O3HA 3I0SA 2G8FA 3DLKA 1VSIA 3FFIA 1JEQA 1FK9A 3ZT2A 3K58A 1LAWA 1L5UA 4E7KA 2DFHA 3P5JA 3LP1A 4DWIA 2XHBA 1WAJA 1JL2A 1UA1A 1DTTA 1SKRA 4FJMA 4KHNA 1RDCA 3D45A 2A1SA 5CYMA 3KK2A 2E6MA 1JLEA 3QNOA 3S3MA 1WAFA 4LH4A 3LDSA 3ASMA 3S3NA 4CJRA 4B08A 3U3YA 3VQPA 4I9LA 4CHOA 4CHNA 3NCIA 2FBVA 4BE2A 5C42A 4YNQA 3AVKA 4I2QA 3DYAA 4OJRA 2BE2A 3DOLA 4CJLA 4BE1A 4PUOA 1J53A 2YV0X 3CG7A 1TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0A A;  3DLE A;  1S1W A;  3F9K A;  3NDK A;  3LP3 A;  4C8L A;  3K5N A;  2HHQ A;  3OS2 A;  1HQE A;  4OVL A;  3MAQ A;  2PY5 A;  4DTR A;  4NYN A;  3L2W A;  1W9H A;  4CFC A;  2YHA A;  2YKM A;  3RWU A;  4HCC A;  1F21 A;  3EY1 A;  3V9W A;  3MED A;  4B9L A;  1Z25 A;  2VG7 A;  5HRS A;  3KKS A;  4CJT A;  2LSN A;  5T7B A;  3RMB A;  2G8K A;  3SQ2 A;  4W5O A;  2KFZ A;  3MEC A;  4CFD A;  4RW8 A;  1L3T A;  1ASW A;  3V9S A;  4N56 A;  1BIS A;  3OYB A;  4OPJ A;  1T05 A;  4DTJ A;  3OYJ A;  3LAK A;  2KZZ A;  1TK0 A;  1BI4 A;  1ZBF A;  2G8W A;  3AO1 A;  4F4K A;  2HHX A;  2HNZ A;  1S9E A;  4JS4 A;  4PY5 A;  1EX4 A;  1TL3 A;  1YVU A;  4N41 A;  3NF8 A;  3DLB A;  1RT7 A;  3S3O A;  1TK5 A;  1WNS A;  1DLO A;  3QLH A;  3QNN A;  4B9U A;  1NKE A;  4GVM A;  1C0M A;  1RT6 A;  3OS1 A;  3SUP A;  4ZTJ A;  1X9M A;  4FXD A;  2HHV A;  4CF8 A;  3SV4 A;  3VQA A;  3ZSV A;  1SKS A;  3A2F A;  1HRH A;  1U4B A;  1HQU A;  3NH1 A;  5KI6 A;  4DS5 A;  4E19 A;  4DU3 A;  2RNO A;  1VSF A;  3S9H A;  3KK1 A;  1S6Q A;  1VSK A;  4DSF A;  4KHW A;  3AO3 A;  3NBP A;  4FLW A;  3TAG A;  1IKW A;  1LW2 A;  5C24 A;  4WE1 A;  1ZBH A;  1IKX A;  1LWC A;  2WON A;  1EXQ A;  4UQG A;  4KTZ A;  4LD0 A;  4CJE A;  4CHZ A;  5KRT A;  3AO5 A;  3QEX A;  3E01 A;  4FW2 A;  4DSJ A;  2XY7 A;  1C6V A;  4DFM A;  1QS4 A;  3DRR A;  5HBM A;  1IKV A;  3LWM A;  1BHL A;  1JXB A;  1U47 A;  1Q8I A;  3O4Q A;  3SJJ A;  2B5J A;  1RBR A;  2ETJ A;  2P1J A;  3QO9 A;  3MXI A;  3WNF A;  4W5N A;  3HPG A;  1VRU A;  4KAZ A;  2KQ2 A;  4CEB A;  3AVG A;  3RTV A;  1O1W A;  3ZSO A;  1T8E A;  3U3G A;  4Z4F A;  1U48 A;  4IFY A;  4B8A B;  3OJS A;  4DSK A;  1C1C A;  4I2P A;  1FKP A;  1B9D A;  4CK1 A;  4DF8 A;  1FXX A;  2IS3 A;  4FM2 A;  2FBT A;  4F2R A;  4M3R A;  4FK2 A;  4FJ8 A;  4DTP A;  3QES A;  3NE6 A;  4NCG A;  1KLN A;  2NUB A;  5CY4 A;  3HP9 A;  5DK5 A;  1NK4 A;  4B9S A;  4ICL A;  4FJI A;  4L8R B;  5K14 A;  4Z4E A;  1NJY A;  2X78 A;  4OKK A;  5KGW A;  4JRQ A;  4CEC A;  4J2D A;  3PX4 A;  4KHY A;  1WSH A;  1U49 A;  3K5M A;  4B9M A;  4FJN A;  3OYK A;  2DFF A;  4DG1 A;  3B6P A;  4E3S A;  5J2M A;  4AHT A;  2OA8 A;  1JJR A;  3AVF A;  4CER A;  3TAM A;  1T7P A;  3KLF A;  4LY7 A;  4E7J A;  3LAN A;  4EZ6 A;  4W5R A;  1S1V A;  4B9V A;  4FJH A;  1RNH A;  2X6N A;  1V66 A;  4CJ3 A;  3K57 A;  4CED A;  3OYN A;  3AA2 A;  3TAN A;  3G10 A;  4PA1 A;  4CCH A;  3KIO A;  2IDO A;  3O4N A;  4I9Q A;  4K8X A;  1ASU A;  2Y1J A;  4M3U A;  4FVM A;  3WNG A;  1B9F A;  4KFB A;  3LZJ A;  3SPY A;  4AHV A;  3CM6 A;  4DQP A;  3HM9 A;  5CYQ A;  3P83 D;  1SL0 A;  1VSL A;  3ZSZ A;  1EET A;  4N47 A;  4CFB A;  2FBY A;  4CF2 A;  4I7F A;  3AVN A;  5I3U A;  4J2E A;  3SI6 A;  2DY4 A;  2GBZ A;  3TI0 A;  3LZI A;  1JLQ A;  3VQ4 A;  3H08 A;  4FK4 A;  1BIZ A;  2G8V A;  4M42 A;  1KTQ A;  1LW0 A;  2E4L A;  2JLE A;  2E6L A;  3D0P A;  4DTO A;  3V4I A;  1D8Y A;  2ITG A;  1S6P A;  2XY5 A;  2BGG A;  4DTN A;  3QIP A;  4O55 A;  1YT3 A;  3KTQ A;  4FLV A;  3CFR A;  1CXU A;  3ITH A;  2RN2 A;  1IKY A;  1X1P A;  4CGD A;  3ZSW A;  3NFA A;  2OZS A;  2GV9 A;  4CF0 A;  2D0C A;  3C6U A;  4FJX A;  2F96 A;  2D0B A;  4HCB A;  4QCL A;  2OPQ A;  4FJ9 A;  3L2R A;  4FZX C;  4DQS A;  3MEE A;  1TKT A;  2X6S A;  3HVT A;  3KJV A;  4IBN A;  2HNY A;  3OYL A;  3F73 A;  3V9Z A;  2HW3 A;  3M8S A;  2EX3 A;  4CES A;  4FW1 A;  4DQQ A;  1XI1 A;  4NYF A;  4Y1D A;  1S1U A;  4RW7 A;  4KKO A;  1RTD A;  1SKW A;  3VQD A;  4KHU A;  4CEA A;  3T1A A;  1J9A A;  1WLJ A;  3NF7 A;  1L3S A;  4O5B A;  3ZSX A;  3AVM A;  3ZSR A;  1NOZ A;  3VQC A;  1KCF A;  1RDB A;  4HUF A;  4Z0U A;  3QEV A;  1VSE A;  1YTU A;  2VWK A;  1K6Y A;  1CXQ A;  3CFO A;  3G0Z A;  3B6O A;  4GW6 A;  4O0I A;  3OYI A;  3SCX A;  1Q9X A;  1QTM A;  4F8R A;  2G8I A;  4Y1C A;  5I42 A;  1RDA A;  1Q9Y A;  3RRH A;  4YFU A;  2RF2 A;  1HMV A;  1TAQ A;  1NK0 A;  4DSL A;  1TKZ A;  4FK0 A;  4FLY A;  4NCA A;  4FYD A;  3RR8 A;  2YNG A;  4EP4 A;  2G8H A;  2KZM A;  1XC9 A;  1CZB A;  4FCY A;  4KB0 A;  2VWJ A;  1JKH A;  2QKK A;  3SUQ A;  3NAE A;  1U04 A;  1LWF A;  1HNV A;  3V6D A;  4LSL A;  4RW6 A;  3AVC A;  3O3G A;  3OYA A;  4M3W A;  4B9N A;  1UOC A;  4R5P A;  2HMI A;  2B6A A;  2IOC A;  2XY6 A;  2FC0 A;  4DS4 A;  4IDK A;  4XIU A;  4CGH A;  3PV8 A;  1R0A A;  3UIQ A;  2QK9 A;  4PQU A;  2HB5 A;  1RDD A;  4HUE A;  1WSI A;  3SUN A;  5JS1 A;  3ZT0 A;  4Z4C A;  4DTX A;  4KHQ A;  4AHS A;  2IGI A;  1JL1 A;  2QXF A;  3RR7 A;  3M8P A;  2HVI A;  1HYV A;  1C1B A;  4OKJ A;  2ATQ A;  5FDL A;  3QEI A;  3DMJ A;  1XWL A;  1KRP A;  4OLB A;  1NK8 A;  2FBX A;  4RG8 A;  2XO7 A;  1RIL A;  3VQB A;  2GUI A;  3ULD A;  1QSL A;  2ZE2 A;  3CQ8 A;  4Q5V A;  3SZ2 A;  4JLH A;  3NGY A;  3QIN A;  3KLH A;  1S1T A;  3RMA A;  1JLA A;  1Y97 A;  3LAM A;  1HNI A;  3M8R A;  5HRN A;  3K59 A;  1QQC A;  4B8C A;  4CGI A;  5J2N A;  3K5O A;  3HVR A;  3V9X A;  2A1R A;  1RTH A;  1KLM A;  4AH9 A;  3CYM A;  4CHY A;  4OGC A;  4KHS A;  4H4O A;  2R7Y A;  2PZS A;  4DSI A;  2P5O A;  4ELT A;  1VSH A;  1FKO A;  4F2S A;  5E41 A;  1NK9 A;  4DTS A;  3OJU A;  1GOA A;  5KTQ A;  2DFE A;  3AVJ A;  3V81 A;  2IC3 A;  4OLA A;  4CGF A;  1I39 A;  5HP1 A;  4FJL A;  3QEW A;  1HJR A;  3L3V A;  4KO0 A;  1SL1 A;  3QIO A;  3HST B;  4CEZ A;  3AV9 A;  4OKE A;  3WNH A;  4BDZ A;  1CLQ A;  4AHU A;  2DTU A;  3OYM A;  4BIT A;  4DSE A;  3AO2 A;  1WSG A;  3OS0 A;  2XY8 A;  1KFD A;  3VQQ A;  1RBV A;  4DMN A;  1D9F A;  1ITG A;  1QE1 A;  1ZBL A;  3KD1 E;  4FJ7 A;  4CEE A;  1NKB A;  4NCB A;  3BGR A;  4FLU A;  1I3A A;  3DLG A;  3DRS A;  3OYH A;  5HRR A;  3KLI A;  3AVI A;  1NJZ A;  4OGE A;  3RMD A;  2F8S A;  3SQ4 A;  1TKD A;  4W5T A;  1S1X A;  2EHG A;  4LSN A;  3OYG A;  3HPO A;  4OPK A;  3QET A;  4M45 A;  3TAP A;  4DF4 A;  2G8U A;  2P5G A;  3M8Q A;  5FRO A;  5SWM A;  3V1O A;  1B92 A;  4AHR A;  2KW9 A;  3IRX A;  2BAN A;  4TSX A;  4CGJ A;  1H1J S;  3NHG A;  1J5O A;  4C8N A;  4CEQ A;  3SQ0 A;  1SL2 A;  1WSF A;  3U6F A;  3TR8 A;  1A5W A;  1CZ9 A;  3VQE A;  4AIL C;  1TV6 A;  3LP2 A;  3LAL A;  1A5X A;  1RBU A;  1NK5 A;  4CJQ A;  3SUO A;  4DTU A;  3I8D A;  1XHZ A;  3L2U A;  3MXM A;  3KD5 E;  4FZZ A;  1MU2 A;  4CJV A;  1WSE A;  2I5J A;  4RW9 A;  2B4J A;  2KVU A;  1NOY A;  2HHW A;  3AA4 A;  3V9U A;  1LWE A;  1TK8 A;  4K8Z A;  3P1G A;  4UZW A;  3EZ5 A;  3L2Q A;  3NF9 A;  5J2P A;  4B9T A;  1UA0 A;  3IAY A;  3ZT1 A;  1J54 A;  4FZY A;  4Z4G A;  4BAC A;  3L2V A;  2D5R A;  5FRM A;  3MXJ A;  4E89 A;  4KRF A;  3WNE A;  2RKI A;  3PY8 A;  2O4G A;  1BQM A;  1REV A;  1KVC A;  1VSM A;  4DQR A;  4B3O A;  4HTU A;  4BWJ A;  3TAE A;  5D3G A;  4HVJ A;  1DTQ A;  4QOZ B;  4C8K A;  4KTQ A;  4J2B A;  4FM1 A;  3HL8 A;  2RNN A;  1KSP A;  1A5V A;  5HRP A;  4ELV A;  3NH2 A;  4E7I A;  1S9G A;  1BI4 B;  2VG6 A;  1C0U A;  2Z1I A;  5CZ1 A;  1QSY A;  1D9D A;  3DOK A;  4N76 A;  3LPT A;  4E7H A;  3TAB A;  4CIG A;  4M3Z A;  4ELU A;  2KVD A;  3O3F A;  3MEG A;  1BL3 A;  1RT3 A;  1C1A A;  4CFA A;  3ZT4 A;  1S5J A;  3KLG A;  1X9S A;  4DU1 A;  3OYC A;  3KLE A;  2O4I A;  4CIF A;  4DLG A;  4DU4 A;  1NK6 A;  5HLF A;  2Q3S A;  3AO4 A;  4KV8 A;  3L8B A;  4GMJ B;  4H8K A;  1XHX A;  1NJW A;  4F3O A;  2YNH A;  4N5S A;  4IKF A;  1EP4 A;  3NH0 A;  3EYZ A;  2IAJ A;  1RT5 A;  2JGU A;  4DFK A;  2OZM A;  4C8M A;  2YHB A;  3VQ9 A;  3SNN A;  1U45 A;  5J1E A;  4KPY A;  3C6T A;  4ID5 A;  1KVB A;  2Z1J A;  1NK7 A;  2HHS A;  1ASV A;  1L3V A;  3IS9 A;  4Z4H A;  1N6Q A;  4DFP A;  1IG9 A;  2AJQ A;  1BCM A;  1TGO A;  3AA3 A;  4JRP A;  1G15 A;  4W5Q A;  4HHT A;  1W0H A;  3K5L A;  2KFN A;  3TAR A;  4CJK A;  3PO5 A;  1TAU A;  1KFS A;  2Z1G A;  3ZT3 A;  2ZD1 A;  3HPH A;  3PX0 A;  4DLE A;  4PWD A;  1RBT A;  3CM5 A;  4BE0 A;  1JXE A;  2P51 A;  4CGG A;  4F3T A;  3TWH A;  3HJF A;  2KTQ A;  1QHT A;  5J2Q A;  3DRP A;  4CJW A;  2OYQ A;  3SQ1 A;  3T3F A;  4E1M A;  4E0D A;  4M3T A;  4E1N A;  4H4M A;  3HXM A;  2QKB A;  2OPS A;  1JLB A;  3V1Q A;  3ZSY A;  2F8T A;  2PYL A;  1JLC A;  2KW4 A;  3JYT A;  3VQ7 A;  1HYZ A;  1BQN A;  1RTJ A;  4CEF A;  3VA0 A;  4DFJ A;  4ZTF A;  1Z26 A;  1RTI A;  4CF9 A;  1ZBU A;  1X9W A;  4EZ9 A;  1VSJ A;  4M3Y A;  1GOB A;  4CEO A;  3SV3 A;  4Q0B A;  3T19 A;  4CJF A;  3PUF A;  3PX6 A;  1JLG A;  3BDP A;  3THV A;  1ZYQ A;  4O0J A;  3VQ5 A;  3AA5 X;  3TAF A;  3C95 A;  4FJK A;  4G1Q A;  4IFV A;  4MFB A;  3LWL A;  3QEP A;  3ZCM A;  3SPZ A;  3TAQ A;  1VK0 A;  4KTW A;  2XRI A;  2YKN A;  5DMR A;  1JLF A;  1WSJ A;  3KKR A;  1T03 A;  4BDP A;  5EU7 A;  5KRS A;  3OYE A;  3OVN A;  1WN7 A;  1NKC A;  4KI4 A;  4KB1 A;  1BIU A;  4BWM A;  1RT1 A;  1YTA A;  3VQ8 A;  4CK3 A;  4DQI A;  2OPR A;  4ID1 A;  3NF6 A;  3ZSQ A;  3NGI A;  3LPU A;  3SYZ A;  3ISN C;  4IG0 A;  1ZBI A;  4M3X A;  4BDY A;  4CJ4 A;  3VQ6 A;  5FRN A;  4O44 A;  1EKE A;  4FM0 A;  5JS2 A;  4AHC A;  2BDP A;  3DLR A;  1UAX A;  4QAG A;  4M41 A;  1HPZ A;  2YNF A;  4CE9 A;  5KGX A;  2HND A;  3RMC A;  4CJ5 A;  4FJ5 A;  1IO2 A;  2WQG A;  3HYF A;  3V1R A;  1NJX A;  3DI6 A;  3VN5 A;  1UWB A;  2Z1H A;  3JSM A;  4MQ3 A;  2PYJ A;  4CK2 A;  5SZT A;  3OYD A;  1SUQ A;  3L3U A;  4CHP A;  3DM2 A;  1LAV A;  3AVA A;  1GOC A;  1IH7 A;  3IG1 A;  3AVL A;  4CHQ A;  1L3U A;  1VRT A;  1D5A A;  3CFP A;  4E7L A;  3QER A;  1TL1 A;  2VG5 A;  2KVE A;  1RT2 A;  2HHT A;  2W42 A;  5HRO A;  4C8O A;  1TKX A;  3HP6 A;  4LH5 A;  4FJG A;  2HVH A;  4EP5 A;  1RBS A;  4KI6 A;  1BGX T;  1RCH A;  3KK3 A;  4FLX A;  2WOM A;  3AVH A;  1SV5 A;  1RT4 A;  2ZQB A;  3OYF A;  4JS5 A;  4HUG A;  3AVB A;  4Z4I A;  4DTM A;  4FJJ A;  4CJS A;  3HK2 A;  2Y1I A;  4O4G A;  4ZHR A;  3HO1 A;  1VSD A;  4RW4 A;  3I0R A;  5C25 A;  4FLT A;  4KRE A;  1BCO A;  3ALY A;  1C0T A;  3LP0 A;  5CZ2 A;  4CJU A;  2X74 A;  1QSS A;  3PO4 A;  3K2P A;  4CIE A;  3DLH A;  3HT3 A;  1N5Y A;  3NGZ A;  3VA3 A;  3C94 A;  4FLZ A;  1HYS A;  1KVA A;  3OY9 A;  2YNI A;  4J2A A;  4IG3 A;  1LV5 A;  2OPP A;  4CJP A;  2RPI A;  4CF1 A;  3RRG A;  2JVW A;  2HHU A;  3O3H A;  3I0S A;  2G8F A;  3DLK A;  1VSI A;  3FFI A;  1JEQ A;  1FK9 A;  3ZT2 A;  3K58 A;  1LAW A;  1L5U A;  4E7K A;  2DFH A;  3P5J A;  3LP1 A;  4DWI A;  2XHB A;  1WAJ A;  1JL2 A;  1UA1 A;  1DTT A;  1SKR A;  4FJM A;  4KHN A;  1RDC A;  3D45 A;  2A1S A;  5CYM A;  3KK2 A;  2E6M A;  1JLE A;  3QNO A;  3S3M A;  1WAF A;  4LH4 A;  3LDS A;  3ASM A;  3S3N A;  4CJR A;  4B08 A;  3U3Y A;  3VQP A;  4I9L A;  4CHO A;  4CHN A;  3NCI A;  2FBV A;  4BE2 A;  5C42 A;  4YNQ A;  3AVK A;  4I2Q A;  3DYA A;  4OJR A;  2BE2 A;  3DOL A;  4CJL A;  4BE1 A;  4PUO A;  1J53 A;  2YV0 X;  3CG7 A;  1TVR A; 
#chains in the Genus database with same CATH topology
 2HHQ A;  2QWP A;  1BUP A;  4A5A A;  1RDU A;  4IEI A;  1VQ9 N;  2YHA A;  4KBO A;  3V9W A;  1NGE A;  1NG9 A;  2QI2 A;  5HRS A;  3L4I A;  2LSN A;  4Y0W A;  5T7B A;  1FJG K;  3SQ2 A;  2RE2 A;  1VQ6 N;  4NXN K;  1J6Z A;  3AGK A;  2A42 A;  3OYB A;  4DTJ A;  3OYJ A;  1YXQ A;  1M1K O;  2A5X A;  3ENH A;  4N41 A;  3DLB A;  4WQ5 A;  1TK5 A;  3QNN A;  2FF3 B;  2YI1 A;  4GVM A;  4ZTJ A;  4FXD A;  2HHV A;  2DPN A;  3A2F A;  1U4B A;  3NH1 A;  5KI6 A;  3MN5 A;  1Z6R A;  3FLG A;  2RNO A;  4JKG B;  4DU3 A;  4KHW A;  1S6Q A;  3J7Z O;  4H5V A;  2OTJ N;  4FLW A;  1LW2 A;  4IOC L;  4CJE A;  3AO5 A;  2GTD A;  3DRR A;  5FLX O;  3TPQ A;  3LWM A;  4YOX A;  1EWQ A;  1A62 A;  1BHL A;  5AQV A;  1NGI A;  3O1B A;  2B5J A;  1RBR A;  2ZJQ L;  1VRU A;  2KQ2 A;  3RTV A;  1O1W A;  2JWL A;  2PAV A;  4FWL A;  5BR9 A;  4QS7 A;  1VQN N;  4IFY A;  1C1C A;  1BA0 A;  4I2P A;  3O4W A;  1FXX A;  5BN9 A;  3CET A;  4M3R A;  4KH4 A;  1KLN A;  4B9S A;  5K14 A;  4CEC A;  1W2B M;  1WSH A;  3K5M A;  4B9M A;  5J2M A;  3MK6 A;  4BRQ A;  4JHD B;  1Z05 A;  1D4X A;  1JJR A;  3AVF A;  3TAM A;  3KLF A;  4E7J A;  1S1V A;  3EN9 A;  4BRG A;  3K57 A;  5AQQ A;  3AA2 A;  3G10 A;  4PA1 A;  2FLO A;  4BRD A;  3WNG A;  4KFB A;  3QB0 A;  1VSL A;  3KWI A;  4WFN L;  3MN6 A;  2FBY A;  3VGM A;  2QNC A;  2DY4 A;  2GBZ A;  4C1N I;  3VQ4 A;  3GOI A;  2E2O A;  3J80 O;  1N33 K;  2P9P B;  4FWN A;  3V4I A;  2JLE A;  3D0P A;  5EY4 A;  1KHC A;  2BGG A;  3QIP A;  3KTQ A;  4A59 A;  3VGK A;  1X1P A;  5F1X A;  3VER A;  4DR5 K;  2F96 A;  5AQK A;  4R79 A;  3WQT A;  2X6S A;  3OYL A;  3M8S A;  4CES A;  4GY2 B;  1VQK N;  4MO4 A;  4XEI A;  1SKW A;  3UKR A;  3T1A A;  3NF7 A;  3ZSX A;  5M1O A;  4MLE A;  3AVM A;  3ZSR A;  1KCF A;  5EVZ A;  1RDB A;  4Z0U A;  2QXL A;  3O9S A;  3G0Z A;  3H46 O;  3OYI A;  1Q9X A;  2YHW A;  2G8I A;  4FWM A;  2ZJR L;  1IV0 A;  1ATS A;  1RDA A;  4BR0 A;  4BG9 A;  1TKZ A;  4FLY A;  4DV3 K;  3RR8 A;  4EP4 A;  4X66 K;  3FZH A;  4FCY A;  3QFU A;  4BG8 A;  2QKK A;  3I55 N;  2IVO A;  1YNS A;  3C7N A;  1HNV A;  4JK7 A;  5AQN A;  4B9N A;  1UOC A;  3VGL A;  2B6A A;  4IDK A;  5AQS A;  1C0G A;  2HB5 A;  5C12 A;  4HUE A;  1WSI A;  3SUN A;  4O5F A;  4DHY A;  4DTX A;  4AHS A;  3RR7 A;  1YIJ N;  1HYV A;  4JKG A;  1OH8 A;  5FDL A;  2ATQ A;  4JKD A;  1JCG A;  5JMV A;  5JVG L;  2NLX A;  1NK8 A;  2FBX A;  2GX9 A;  4DB3 A;  4BVO A;  2XO7 A;  1NGF A;  2A6A A;  1QSL A;  3CQ8 A;  4JLH A;  1HJO A;  3NGY A;  2O8C A;  1ATR A;  2VGM A;  5HRN A;  4J8F A;  1QQC A;  3K59 A;  3K5O A;  4H0Y B;  3V9X A;  3CYM A;  4KHS A;  1BG3 A;  2PZS A;  1FKO A;  4DTS A;  2QWL A;  3OJU A;  2DFE A;  4OLA A;  2CGK A;  4CGF A;  1GLD G;  1HJR A;  2KLA A;  1VQ4 N;  3HST B;  3WNH A;  4AHU A;  2DTU A;  3OS0 A;  4I6M A;  1KFD A;  4BQZ A;  1ZBL A;  1SQK A;  1NJI O;  4NCB A;  5LY3 A;  4DR1 K;  1NJZ A;  5HRR A;  3KLI A;  3AVI A;  3N4Q A;  4OGE A;  3H1V X;  4XH5 A;  4W5T A;  2FSN A;  2P5G A;  1HPM A;  2P9I B;  2QWN A;  1B92 A;  4CGJ A;  1J5O A;  4C8N A;  2YHY A;  5BR8 K;  1WSF A;  3U6F A;  1CZ9 A;  2FF6 A;  3EE9 A;  1ILY A;  2E2P A;  4Z94 A;  1A8V A;  4X65 K;  5BRD A;  1VQP N;  3L2U A;  4H0X B;  1MU2 A;  4H5T A;  1NOY A;  4A57 A;  4K8Z A;  3P1G A;  4UZW A;  3EE8 A;  5CIU A;  4CVN E;  3IAY A;  3G4S N;  5FRM A;  4KRF A;  3WNE A;  2RKI A;  4JI3 K;  1BQM A;  1REV A;  3ATU A;  4B3O A;  3P31 A;  1DTQ A;  1H9E A;  4KTQ A;  4J2B A;  1A5V A;  4ELV A;  4E7I A;  1S9G A;  4F9O A;  4CIG A;  4ELU A;  1RT3 A;  1YVN A;  1C1A A;  3VOV A;  4CFA A;  4WCE L;  2O4I A;  4CIF A;  4DU4 A;  3AGR A;  5HLF A;  1J5E K;  3L8B A;  4H8K A;  1XHX A;  4ILH A;  2HF4 A;  3K0S A;  2YJE A;  5JLH A;  4K0K K;  2V52 B;  4DR6 K;  2AJQ A;  1BCM A;  4JI1 K;  3AA3 A;  4JRP A;  2Q2R A;  4HHT A;  1WBD A;  3ZLJ A;  2AP1 A;  3O6W A;  2KFN A;  3M6G A;  1X3N A;  2Z1G A;  3HBT A;  4BR5 A;  4DLE A;  1RBT A;  2P51 A;  4DQ8 A;  4YOT A;  3KK7 A;  3T3F A;  4E1M A;  4E1N A;  3HXM A;  3JYT A;  4DFJ A;  1YJN N;  4JNE A;  1RTJ A;  4CEF A;  4FYD A;  3O5B A;  1Z26 A;  1RTI A;  1ZBU A;  2NRR A;  4EZ9 A;  1VSJ A;  1BO5 O;  3N4P A;  4CJF A;  3CJ9 A;  1H1V A;  1NM1 A;  4O0J A;  3C95 A;  3LWL A;  3SPZ A;  2XRI A;  5AQO A;  5KRS A;  1WN7 A;  3MMV A;  4CZG A;  5LMU K;  3GL1 A;  2UUA K;  3O80 A;  3FR0 A;  1QVF M;  1BIU A;  1JCF A;  2HST A;  5JVH L;  2OPR A;  4DQI A;  3NF6 A;  4JI7 K;  3ISN C;  3CI5 A;  5FRN A;  1YIT N;  3FZK A;  4AHC A;  1YJW N;  2YNF A;  3ZEU B;  3K9K A;  1MWK A;  4CJ5 A;  5FPM A;  1NJX A;  2O8F B;  3HOT A;  3OYD A;  2P9N B;  3L3U A;  4BRA A;  4LF5 K;  3DM2 A;  3IG1 A;  4CHQ A;  3AVL A;  1L3U A;  2HBJ A;  2VG5 A;  3ID6 A;  2HHT A;  2W42 A;  4OPH A;  4C8O A;  4LH5 A;  4KI6 A;  3KK3 A;  3SMP A;  4CBU A;  3R1X A;  1SV5 A;  4HUG A;  1RGI A;  3NMU A;  2NRV A;  4DTM A;  4CJS A;  5C25 A;  4FLT A;  3K2P A;  3DLH A;  3J8A A;  1N32 K;  1HYS A;  4JI5 K;  4WFB L;  1KVA A;  1IBK K;  4L3Q A;  4IG3 A;  4CF1 A;  4ILJ A;  2JVW A;  3CCU N;  5LMN K;  3L0O A;  3I0S A;  4YOU A;  4GVE A;  1KXP A;  1LAW A;  4E7K A;  3P5J A;  4DWI A;  3HZ6 A;  1JL2 A;  1SKR A;  4FJM A;  4KHN A;  3M1F A;  4BC3 A;  3S3M A;  4BR7 A;  2E2N A;  1YF5 L;  1VAZ A;  1GL9 B;  5MLC Q;  3PLA A;  3DOL A;  3PSI A;  5FPE A;  5CHI A;  4PUO A;  3ZSZ A;  2YV0 X;  3DLE A;  1S1W A;  3F9K A;  3NDK A;  4LF4 K;  4B9Q A;  3CJB A;  5KPT A;  4HCC A;  2YKM A;  1F21 A;  3EY1 A;  5AQY A;  4B9L A;  1Z25 A;  3D6R A;  2VG7 A;  3MN9 A;  4CJT A;  2G8K A;  1CZA N;  2KFZ A;  3MEC A;  3F9M A;  5ELZ A;  4LF6 K;  3V9S A;  1BIS A;  4YHH K;  3TSU A;  2W41 A;  2F4V K;  1TK0 A;  1S9E A;  4PKG A;  1TL3 A;  4UY8 O;  3NF8 A;  1SS6 A;  3LM9 A;  3S3O A;  1JEI A;  1DLO A;  4O8K A;  5BRE A;  4B9U A;  3CD6 N;  5GAE P;  3SUP A;  2CGJ A;  3VQA A;  3ZSV A;  3SV4 A;  1SKS A;  1HRH A;  3NVK A;  3DXM B;  3E9L A;  2E1Y A;  3BP8 A;  4BVP A;  1VSK A;  3NBP A;  3TAG A;  1IKW A;  3A5M C;  4BR9 A;  1ZBH A;  4KTZ A;  1Q86 O;  4CZF A;  4IOA L;  4CHZ A;  3E01 A;  4ILG B;  2XY7 A;  1C6V A;  4DFM A;  1QS4 A;  1IKV A;  5BPM A;  1JXB A;  2H3G X;  1T44 A;  5TKW A;  5KPR A;  3MXI A;  3VET A;  3L4Q A;  2VQF K;  1K8K B;  2KFV A;  1QZ5 A;  3ZSO A;  1KQS M;  1T8E A;  3O1W A;  4X64 K;  4DV5 K;  1U48 A;  4Z4F A;  1OH7 A;  4B8A B;  5AQF A;  4A2B A;  4DSK A;  4CK1 A;  1FKP A;  1B9D A;  4ISF A;  4DF8 A;  4CD3 A;  4CJ7 A;  3QES A;  3ZYY X;  2NUB A;  3QDK A;  3CJ1 A;  1NJY A;  3FFK B;  5KGW A;  1GKU B;  4JRQ A;  2V7Y A;  4JI6 K;  4KHY A;  1NMD A;  2P9K B;  3OYK A;  2DFF A;  4CZM A;  4E3S A;  2RHK A;  5GAG P;  4LY7 A;  3LAN A;  4W5R A;  4FJH A;  1RNH A;  2X6N A;  1U2V A;  3U8X A;  4FVM A;  3FZL A;  3LZJ A;  4AHV A;  1E4F T;  3HM9 A;  1DGK N;  1SL0 A;  1EET A;  2MPH A;  3ENO A;  4N47 A;  4CFB A;  3UB5 A;  3AVN A;  2Q1N A;  3CMA N;  4J2E A;  2HF3 A;  3LZI A;  2CH6 A;  4CBW A;  1LCU A;  4BRO A;  2G8V A;  2E4L A;  4B1Z A;  3AAQ A;  1D8Y A;  2GWK A;  2Q0R A;  3MDQ A;  2XY5 A;  3H1Q A;  5GIN A;  3CFR A;  4WQ5 C;  1IKY A;  4CW7 B;  2D0C A;  3C6U A;  3J7A P;  4FJX A;  1NGA A;  2QM1 A;  2HBL A;  2OPQ A;  3FZF A;  4FJ9 A;  4QCL A;  3L2R A;  4DQS A;  3D2F A;  1TKT A;  3HVT A;  3KJV A;  1XMQ K;  3V9Z A;  1GLB G;  3EEQ A;  1RTD A;  3ULE B;  1WLJ A;  2Q97 A;  4O5B A;  4FOI A;  2HMP A;  3VQC A;  4HUF A;  1VSE A;  1S22 A;  3B6O A;  1VHX A;  3OTO K;  1QTM A;  4Y1C A;  5I42 A;  4U67 L;  3F2K A;  3RRH A;  2YHX A;  2HHH K;  1HMV A;  2RF2 A;  5IT9 O;  2KZM A;  5AQI A;  4KH5 A;  3R9P A;  4KB0 A;  2OCE A;  4FVU A;  3SUQ A;  3NAE A;  1U04 A;  3CCR N;  2QA4 N;  4YY3 K;  2WBN A;  3V6D A;  4NLB A;  3OYA A;  1LOT B;  4R5P A;  2HMI A;  3UIQ A;  1GLF O;  3OW2 M;  2D4W A;  3QBW A;  3E1Y A;  3ZT0 A;  4Z4C A;  4KHQ A;  4JYA K;  3R8E A;  1NGD A;  3O9R A;  4OKJ A;  1DEJ A;  3DMJ A;  1JCE A;  5E26 A;  3ID8 A;  1RIL A;  3WQU A;  2ZWH A;  2ZE2 A;  4JI4 K;  2AA4 A;  3A5L C;  4PKI A;  4WYB A;  3BUZ B;  1Y97 A;  1HNI A;  1VQ5 N;  1KAZ A;  4CBX A;  5GIP A;  1IBM K;  4C23 A;  2P9K A;  4H4O A;  2R7Y A;  4ELT A;  1VSH A;  2O8E B;  5E41 A;  5KTQ A;  3V81 A;  2IC3 A;  3JXU A;  3QEW A;  5AZI B;  4IZ9 A;  4CEZ A;  4BGB A;  3MN7 A;  3KVG A;  4DSE A;  3AO2 A;  4IJN A;  1RBV A;  2ASP A;  1D9F A;  3EO3 A;  2YJF A;  1ZS9 A;  3MX2 A;  4CEE A;  1NKB A;  3LDP A;  4FLU A;  1I3A A;  4BC2 A;  3RMD A;  3TSP A;  2V51 B;  3CJ7 A;  3TTC A;  3SQ4 A;  1TKD A;  4GKK K;  2EHG A;  4LSN A;  3OYG A;  3OBY A;  3TTF A;  3HPO A;  3QET A;  3TAP A;  5A2Q O;  5HL7 L;  5FRO A;  2VGN A;  4AHR A;  2KW9 A;  3MCP A;  3TR8 A;  3VF4 A;  1MDU B;  3LP2 A;  2PBD A;  3LAL A;  4BRE A;  2A40 A;  4JEP A;  5GAD P;  3CPW M;  4FZZ A;  3M5R A;  2KVU A;  4JKA A;  3AA4 A;  3V9U A;  1LWE A;  3DXK B;  2FSJ A;  3EZ5 A;  3L2Q A;  5J2P A;  1UA0 A;  1J54 A;  3E66 A;  2VQE K;  4BAC A;  2P9L B;  5AQU A;  3B8A X;  4BWJ A;  3TAE A;  2ZGY A;  4O8U A;  3CIP A;  4HVJ A;  2ASO A;  4C8K A;  1TYQ B;  3EKU A;  4H0P A;  1D9D A;  1QSY A;  5EXW A;  3TAB A;  3M3Z A;  3O3F A;  3MEG A;  1BL3 A;  4DR4 K;  1S5J A;  3ATV A;  1NK6 A;  5GIO A;  4WQ4 C;  4N5S A;  3NH0 A;  1RT5 A;  3D2E A;  2OZM A;  4C8M A;  4JI8 K;  5M1P A;  1U45 A;  4KPY A;  2F9T A;  4XH4 A;  1NK7 A;  2HHS A;  1ASV A;  5AZJ B;  4Z4H A;  3TSQ A;  1QVG M;  1IG9 A;  3QBX A;  5C0Y A;  4BR4 A;  1G15 A;  1W0H A;  1TAU A;  4H5R A;  3ZT3 A;  3HPH A;  3PX0 A;  4PWD A;  3CM5 A;  2KTQ A;  3HJF A;  4FWQ A;  2O8E A;  1KAY A;  4QS8 A;  2BH1 A;  2OAN A;  4LFB K;  4M3T A;  2QKB A;  5CE3 A;  1OH5 A;  1JLC A;  2P9N A;  3VQ7 A;  1HYZ A;  4JKE A;  1GLA G;  4JKB A;  1X9W A;  3KWG A;  4Q0B A;  4FPA A;  3IKM A;  2FSK A;  2O8B B;  3BDP A;  4CZJ A;  1ZYQ A;  4IOX A;  1VQ7 N;  4XH1 A;  3QEP A;  3TAQ A;  1VK0 A;  3I33 A;  5DMR A;  1JLF A;  4BDP A;  1X9J A;  1N36 K;  4KB1 A;  1RT1 A;  4B1U B;  3QML A;  4CK3 A;  3CCQ N;  3ZSQ A;  3LPU A;  3F5T A;  4JK9 A;  2O8D A;  4PHT X;  4NO7 A;  3WT0 A;  3VQ6 A;  3DLR A;  3ZEU A;  4QAG A;  4EHU A;  3A0I X;  3THW B;  4BRH A;  4B1W B;  3V1R A;  2A3Z A;  3DI6 A;  1UWB A;  2NRZ A;  3JSM A;  4CHP A;  1LAV A;  3AVA A;  3JS6 A;  1VRT A;  5ADX A;  3CFP A;  3QER A;  4JKH A;  2JWK A;  1OVY A;  1RT2 A;  5M1N A;  1RBS A;  3UE5 A;  3CCM N;  2NRW A;  2IVN A;  3BEX A;  4K25 A;  4Z4I A;  3AVB A;  3THY A;  2Y1I A;  3SAH A;  1W97 L;  1QQN A;  4O4G A;  3THX A;  1KAX A;  3VTH A;  3I0R A;  1C0T A;  3ALY A;  2WTU A;  3HT3 A;  1N5Y A;  3NGZ A;  3SAF A;  3OY9 A;  2YNI A;  3SAG A;  1LV5 A;  4CJP A;  3D2E B;  3G25 A;  2HHU A;  4MDA A;  1T6D A;  4DV4 K;  1FK9 A;  3K58 A;  1GLJ O;  5GAH P;  2DFH A;  1ZBS A;  4LF8 K;  1RDC A;  3WEE A;  2A1S A;  5CYM A;  2E6M A;  3E9O A;  3S3N A;  1S72 N;  3U3Y A;  1O13 A;  4I9L A;  3NCI A;  4G9Z A;  4RWT A;  5C42 A;  4YNQ A;  4CJL A;  1J53 A;  3H3N O;  4DV2 K;  4C8L A;  3K5N A;  1GLE G;  3OS2 A;  4OVL A;  2PY5 A;  3WXK A;  4CFC A;  3RWU A;  3MED A;  3CPE A;  4W5O A;  3R3L A;  4CFD A;  3LDQ A;  3O08 A;  4B1Y B;  5I9E B;  2UXC K;  2HJQ A;  4OPJ A;  1T05 A;  2KZZ A;  1ZBF A;  2G8W A;  2HHX A;  2HNZ A;  4DR2 K;  4PY5 A;  1EX4 A;  1N34 K;  1WNS A;  1NKE A;  2BTF A;  1X9M A;  2Q36 A;  3CCJ N;  4CF8 A;  3EKS A;  1HQU A;  4BGA A;  4DS5 A;  4E19 A;  3KK1 A;  3PIO L;  3AO3 A;  4JKC A;  3CCE N;  2E88 A;  1EXQ A;  4UQG A;  4LD0 A;  5AQH A;  3QEX A;  4FW2 A;  5HBM A;  1IBL K;  2NRT A;  2OTL N;  1Q8I A;  4DUY K;  3SJJ A;  3Q7B A;  2ETJ A;  2P1J A;  2Q0U A;  1E7L A;  2NNW A;  3WNF A;  4W5N A;  4KAZ A;  4CEB A;  5EX5 A;  3ZET A;  3U3G A;  3G71 N;  3K9J A;  3KZB A;  3O9T A;  5LL6 Z;  3OJS A;  3OHR A;  5M1F A;  3I8B A;  4FM2 A;  2FBT A;  4DTP A;  5CY4 A;  3HP9 A;  5DK5 A;  1NK4 A;  3A8Y A;  4Z4E A;  5AQZ A;  1DKG D;  2X78 A;  4OKK A;  5KPZ A;  4LF7 K;  3PX4 A;  3C6A A;  1U49 A;  1NU0 A;  4FJN A;  3IUC A;  4DG1 A;  3B6P A;  4E1J A;  1NGJ A;  3LLR A;  3WEE B;  1V4T A;  1Y02 A;  1T7P A;  5C10 A;  4EZ6 A;  4CJ3 A;  1ZXO A;  2IDO A;  3O4N A;  4K8X A;  2Y1J A;  4M3U A;  3THX B;  1B9F A;  3PSF A;  3LDL A;  3CCS N;  3FE1 A;  4X62 K;  4CF2 A;  5I3U A;  3SI6 A;  4JAX A;  2G80 A;  3QKJ A;  2W6L A;  1LW0 A;  4DTO A;  2E6L A;  3SLC A;  2ITG A;  4DTN A;  2P9S B;  3LM2 A;  4O55 A;  4FLV A;  1CXU A;  3ITH A;  2RN2 A;  2ITM A;  4CGD A;  3NFA A;  4B3M K;  2GV9 A;  4CF0 A;  4OX9 K;  4HCB A;  2P9U A;  1HR0 K;  3HSC A;  3D2F B;  3BZK A;  4IBN A;  3F73 A;  2HW3 A;  4EIA A;  2EX3 A;  4BRP A;  4FWR A;  3VEX A;  4RW7 A;  1HKC A;  3VQD A;  4KHU A;  4CEA A;  3CC4 N;  1J9A A;  5ADX H;  2QWO A;  3VF6 A;  1L3S A;  2YCH A;  4BRN A;  3H6E A;  1OH6 A;  3CHW A;  3SCX A;  4H5N A;  4BC4 A;  3LDN A;  1M90 O;  5F0X A;  3E9P A;  4NCA A;  1TAQ A;  4DSL A;  1NK0 A;  3SJH A;  1GLL O;  1RDW X;  2G8H A;  4IJA A;  4IEE A;  1CZB A;  1XNQ K;  3VEO A;  4IFE A;  1LWF A;  4LSL A;  4RW6 A;  3O3G A;  2A41 A;  4M3W A;  4YOV A;  3CER A;  1E3M A;  2XY6 A;  2IOC A;  2HBM A;  2FC0 A;  2ZJP L;  4XIU A;  4DS4 A;  3PV8 A;  1R0A A;  2QK9 A;  1EO1 A;  2P9P A;  2D0P A;  5JS1 A;  1W7A A;  4OO1 J;  3FLC O;  2IGI A;  1JL1 A;  4FWP A;  1YHQ N;  3QEI A;  3UKU A;  4OLB A;  1SAZ A;  2GUI A;  1ATN A;  4DUZ K;  1OKJ A;  1QQO A;  1ZC6 A;  4PKH A;  3ULD A;  5AFU A;  4Q5V A;  4JI0 K;  3QIN A;  3DWL A;  4DKW A;  4MO5 A;  1HKG A;  1EWR A;  4B8C A;  5J2N A;  3U4L A;  3HVR A;  1WOQ A;  4MDB A;  2A1R A;  1RTH A;  1KLM A;  4AH9 A;  4CZI A;  5H1S Q;  4OGC A;  1U6Z A;  2E1Z A;  3BZC A;  2P5O A;  5FPN A;  1GOA A;  3AVJ A;  1I39 A;  5HP1 A;  4FJL A;  1P90 A;  3WXM B;  1CLQ A;  4BDZ A;  4PL8 A;  4WQ4 A;  4JN4 A;  1WSG A;  4RCH A;  3KD1 E;  1ITG A;  1QE1 A;  3SBT A;  5KQD A;  4FJ7 A;  3DLG A;  3DRS A;  1VQM N;  4CZH A;  1S1X A;  4OPK A;  3W0L A;  2G8U A;  4DF4 A;  3M8Q A;  5SWM A;  3IRX A;  4IWV A;  2BAN A;  4JD2 B;  4CEQ A;  1YI2 N;  2YX6 A;  2I7N A;  3IDH A;  1A5W A;  4AIL C;  1A5X A;  1E4G T;  2LC3 A;  3MWT A;  3SUO A;  1RFQ A;  3I8D A;  1XHZ A;  5AQP A;  3MXM A;  3KD5 E;  4CJV A;  2PFU A;  1BA1 A;  1WSE A;  2I5J A;  2B4J A;  5AQL A;  3GE1 A;  4JD2 A;  3ZT1 A;  3JAM O;  3O8M A;  5AQW A;  4EHT A;  4CZE A;  3L2V A;  4E89 A;  3PY8 A;  2O4G A;  1VSM A;  4DQR A;  1KVC A;  4HTU A;  5D3G A;  3R6M A;  4A61 A;  2E5L K;  3RSE B;  3D7E O;  5DM6 L;  4FM1 A;  2WUS A;  2VG6 A;  2Z1I A;  3QFP A;  5CZ1 A;  4N76 A;  3DOK A;  3MWP A;  3LPT A;  4K41 A;  4M3Z A;  3O9Q A;  3IFR A;  4BQL A;  4YDU C;  2W40 A;  1GLC G;  5TKY A;  4DV6 K;  4DU1 A;  3OYC A;  3KLE A;  4DLG A;  4GMJ B;  4F3O A;  1EP4 A;  2IAJ A;  4DFK A;  2YHB A;  3HI0 A;  3VQ9 A;  3SNN A;  3HTV A;  5J1E A;  3C6T A;  4YOY A;  3VES A;  4A5B A;  4DR7 K;  3IS9 A;  5FPD A;  2KHO A;  4IXC A;  4W5Q A;  3O9U A;  5IWA K;  4B3S K;  1VQO N;  4CJK A;  3UKU B;  4CI6 A;  5AZI A;  1KFS A;  3C0B A;  1P8Z A;  3SK3 A;  2GWJ A;  4BE0 A;  4F3T A;  1JXE A;  4CGG A;  3TWH A;  3DRP A;  3W3D A;  3SQ1 A;  2WFB A;  3V1Q A;  2QTD A;  2PYL A;  5AQM A;  4BRI A;  3VA0 A;  4ZTF A;  1HKB A;  3CCV N;  2QWQ A;  1A63 A;  3TU5 A;  4JK8 A;  3SBG A;  3T19 A;  3PUF A;  2CGL A;  2VWB A;  3VQ5 A;  3AA5 X;  4FJK A;  4IFV A;  2WC9 A;  4KTW A;  3Q7C A;  2YKN A;  4K43 A;  1HUX A;  1QZ6 A;  3KKR A;  4FO0 A;  3OYE A;  1T03 A;  3OVN A;  3ULE A;  4HTL A;  1YTA A;  3CJC A;  4ID1 A;  1ZBI A;  3CC7 N;  1K8A O;  4BDY A;  4K42 A;  4CJ4 A;  2Q31 A;  2D0O A;  3C7N B;  1EKE A;  3A5N C;  5JS2 A;  1HPZ A;  3P4I A;  2WQG A;  1KC8 O;  1T6C A;  2Z1H A;  2PYJ A;  4MQ3 A;  2GEM A;  4DR3 K;  1IG8 A;  1SUQ A;  1IH7 A;  2P9U B;  3AAR A;  4E7L A;  2UXB K;  1TL1 A;  4AM6 A;  1OVQ A;  1TKX A;  3HP6 A;  2D1K A;  4EP5 A;  1RCH A;  1S3X A;  1YAG A;  4FLX A;  3LL3 A;  3AVH A;  3OYF A;  4NB4 A;  1KD1 O;  1BDG A;  3HRG A;  4RW4 A;  1BCO A;  2X74 A;  1QSS A;  1WUA A;  3C94 A;  4FLZ A;  1TUY A;  3U9Z A;  4J2A A;  3T7Z A;  4V19 S;  2OPP A;  2RPI A;  3O3H A;  1I94 K;  2G8F A;  1VSI A;  1L5U A;  5C2D A;  3WXL A;  2VCP A;  1XQS C;  2XHB A;  1WAJ A;  2O8D B;  1DTT A;  3D45 A;  1JLE A;  1MA9 B;  1SZ2 A;  1WAF A;  4LH4 A;  3ASM A;  1XUP O;  4CJR A;  3VQP A;  4CHN A;  2FBV A;  4I2Q A;  3WXJ A;  4CZL A;  2BE2 A;  4FL9 A;  4M63 C;  1C0M A;  3MCA B;  5BN8 A;  4DFP A;  2D0A A;  4GNI A;  2QWM A;  1DT9 A;  4KHP K;  3LP3 A;  4DV1 K;  1HQE A;  3MAQ A;  4DTR A;  4NYN A;  5AJ3 K;  3L2W A;  1W9H A;  2UUB K;  2QWR A;  5C15 A;  3HM8 A;  1E7D A;  3IMX A;  3KKS A;  1HNX K;  3RMB A;  3GBT A;  2E20 A;  2UU9 K;  4RW8 A;  1L3T A;  1ASW A;  4N56 A;  1EN7 A;  2ZF5 O;  4FWK A;  1V4S A;  3LAK A;  1BI4 A;  3AO1 A;  4F4K A;  3A5O C;  4JS4 A;  2KKZ A;  1YVU A;  1QQM A;  1RT7 A;  5JLF A;  3QLH A;  2O8C B;  4B3R K;  1RT6 A;  5AQT A;  3OS1 A;  3DAW A;  5AZJ A;  4GV6 A;  1HNZ K;  3BF3 A;  1VSF A;  3S9H A;  4DSF A;  5C24 A;  4CZK A;  4WE1 A;  3VEN A;  1IKX A;  1LWC A;  2WON A;  1ESV A;  4DCH A;  3OA9 A;  5KRT A;  2EWS A;  2IIR A;  4DSJ A;  1XC3 A;  3T1Y K;  4YOR A;  1U47 A;  3O4Q A;  3VTI A;  4GV9 A;  3QO9 A;  3L0Q A;  3HPG A;  4DV7 K;  3AVG A;  5AQG A;  1R59 O;  3OBW A;  4BC5 A;  3WXI A;  2IS3 A;  2NRX A;  4F2R A;  4FK2 A;  4FJ8 A;  3NE6 A;  4NCG A;  1BWF O;  3VEV A;  3THY B;  4PL7 A;  4FJI A;  4L8R B;  4ICL A;  5LJV A;  3DXK A;  4MLH A;  4EFH A;  4J2D A;  4WF9 L;  2W51 A;  3FZM A;  3VEY A;  3C65 A;  5EOY A;  4YOW A;  2F7T A;  4AHT A;  1K9M O;  2OA8 A;  1MWM A;  4CER A;  3EZW A;  2V7Z A;  4B9V A;  1V66 A;  3TAN A;  4CED A;  3OYN A;  4CCH A;  3KIO A;  5AR0 A;  4I9Q A;  1ASU A;  1XMO K;  3SPY A;  4B1V A;  3CM6 A;  4DQP A;  5CYQ A;  3P83 D;  1IJJ A;  4ISE A;  3LDO A;  4GV3 A;  4I7F A;  4B3T K;  1NLV A;  3P39 A;  3TI0 A;  1JLQ A;  4FSV A;  3H08 A;  4FK4 A;  1BIZ A;  4JI2 K;  4M42 A;  1KTQ A;  2BUP A;  1S6P A;  2FXU A;  1YT3 A;  2O8F A;  1NGB A;  3THW A;  4IDH A;  3ZSW A;  2QEX N;  2OZS A;  2D0B A;  2ZM6 K;  4FZX C;  1T3V A;  3MEE A;  1NGG A;  5F2R A;  1HX1 A;  2HNY A;  5BPN A;  4FW1 A;  4DQQ A;  1XI1 A;  4NYF A;  4Y1D A;  4U7B A;  1S1U A;  4KKO A;  4EAH D;  4H0V B;  1NMN A;  1G99 A;  4H0T B;  1NOZ A;  4C1N K;  1JJ2 M;  3VEW A;  2VWK A;  3BF1 A;  1YTU A;  1K6Y A;  1CXQ A;  3CFO A;  4GW6 A;  4F8R A;  4O0I A;  3H3O B;  5CR4 A;  3VPZ A;  5C2F A;  1Q9Y A;  4YFU A;  4QS9 A;  4FK0 A;  1NBW A;  2YNG A;  3S41 A;  3HOS A;  1XC9 A;  2VWJ A;  1JKH A;  3NVM A;  2NZT A;  3J7Y P;  3CME N;  4LFA K;  3AVC A;  4AQY K;  2P9S A;  1NWK A;  1NGH A;  3ZX3 A;  3ENB A;  4PQU A;  4CGH A;  1HNW K;  1RDD A;  1N8R O;  2A8V A;  4FWO A;  1TUU A;  1GJJ A;  5B8H A;  3ZX0 A;  2QXF A;  4FOE A;  3M8P A;  2HVI A;  1C1B A;  3RSE A;  4BRF A;  1XWL A;  1KRP A;  4FPB A;  3C6H A;  4RG8 A;  3VQB A;  4B1X B;  3SZ2 A;  3KLH A;  1S1T A;  3RMA A;  1JLA A;  3CXC M;  4M7Y A;  3LAM A;  3M8R A;  4CGI A;  4RTF D;  3J81 O;  4CHY A;  4DSI A;  4F2S A;  2CH5 A;  5AQJ A;  1NK9 A;  3GG4 A;  4NLC A;  3U9D A;  1TYQ A;  4H03 B;  2NRH A;  1HLU A;  3L3V A;  4KO0 A;  2E8A A;  5HOO A;  3QIO A;  1SL1 A;  4M7X A;  3AV9 A;  2ODG C;  4OKE A;  3KHY A;  5BPL A;  3OYM A;  4BIT A;  3VQQ A;  2XY8 A;  4DMN A;  1FW6 A;  3BGR A;  3OYH A;  3CQY A;  2F8S A;  1Y64 A;  5AQR A;  2P9L A;  4M45 A;  2UUC K;  3EL2 A;  3V1O A;  3SMS A;  1WBB A;  4TSX A;  3NHG A;  1H1J S;  3SQ0 A;  1SL2 A;  5E84 A;  3CC2 N;  3VQE A;  4DV0 K;  1TV6 A;  1QHA A;  1RBU A;  1WB9 A;  1NK5 A;  4CJQ A;  4DTU A;  1BOT O;  5BRF A;  4FWS A;  4RW9 A;  2HHW A;  1TK8 A;  4B9T A;  3NF9 A;  1VQL N;  4FZY A;  2W6K A;  4Z4G A;  2UYT A;  2D5R A;  3ZX2 A;  3CJA A;  3MXJ A;  1H9F A;  5M1K A;  4QOZ B;  1Q18 A;  3CQX A;  3FGU A;  3HL8 A;  2RNN A;  1KSP A;  5HRP A;  3NH2 A;  1BI4 B;  1C0U A;  1K8K A;  4E7H A;  4JKF A;  2KVD A;  1X3M A;  3ZT4 A;  1Q82 O;  3KLG A;  1X9S A;  1XNR K;  4HWI A;  4A62 A;  2Q3S A;  3AO4 A;  4KV8 A;  3WUH A;  2ASM A;  2IVP A;  4YDU A;  1NJW A;  4IKF A;  2YNH A;  2P9I A;  3TTD A;  3EYZ A;  3T1H K;  2JGU A;  1VQ8 N;  4ID5 A;  1KVB A;  2Z1J A;  2HBK A;  1L3V A;  1N6Q A;  4OPA A;  4BRC A;  1TGO A;  1NGC A;  4ISG A;  4I6M B;  5DM7 L;  5KQ8 A;  3K5L A;  3TAR A;  3PO5 A;  2ZD1 A;  4AM7 A;  3VF2 A;  2UXD K;  4H5W A;  3AY9 A;  1QHT A;  5J2Q A;  2GUP A;  4CJW A;  2OYQ A;  4E0D A;  4LF9 K;  1YJ9 N;  1NNE A;  4H4M A;  2OPS A;  1JLB A;  3ZSY A;  2F8T A;  3H45 C;  3RVC A;  2E2Q A;  2KW4 A;  1BQN A;  4LC9 B;  1YUW A;  2F9W A;  4CF9 A;  3PIP L;  4M3Y A;  1GOB A;  4CEO A;  3SV3 A;  2DK4 A;  2LD7 A;  3PX6 A;  1JLG A;  3THV A;  4CD1 A;  3TAF A;  4G1Q A;  4MFB A;  3CF5 L;  3ZCM A;  3L6Q A;  4H0O A;  5AFU H;  3VMF B;  1WSJ A;  3DLL L;  5EU7 A;  4KI4 A;  2ODC I;  1NKC A;  3UKR B;  2ZGZ A;  3QIC A;  4BWM A;  4BRK A;  3VQ8 A;  3AAP A;  3MX5 A;  3NGI A;  3SYZ A;  5AQX A;  4IG0 A;  1C0F A;  4M3X A;  4BRL A;  4BRM A;  3CCL N;  2HOE A;  4A2A A;  4O44 A;  4FM0 A;  2BDP A;  1UAX A;  4NXM K;  4M41 A;  5KGX A;  1K73 O;  4CE9 A;  1U2V B;  2HND A;  1EQY A;  3RMC A;  4IO9 L;  4FJ5 A;  5M1Q A;  1IO2 A;  2I7P A;  3HYF A;  3VN5 A;  4BY9 C;  1Q81 O;  4CK2 A;  5SZT A;  4GKJ K;  4BR2 A;  1Q7Y O;  5BRH A;  1GOC A;  5JIC A;  1D5A A;  2GEL A;  4JV5 K;  4WFA L;  2KVE A;  5HRO A;  2HVH A;  3GDQ A;  4FJG A;  1BGX T;  3G6E N;  2WOM A;  1RT4 A;  2ZQB A;  4JS5 A;  4FJJ A;  4IO8 A;  2J4R A;  3HK2 A;  3I56 N;  4ZHR A;  3VEZ A;  3HO1 A;  1VSD A;  4KRE A;  2O8B A;  3LP0 A;  5CZ2 A;  4CJU A;  3PO4 A;  3P38 A;  4CIE A;  1BU6 O;  3VA3 A;  4LFC K;  4KH6 A;  3ZET B;  4JHD A;  3RRG A;  2VYP A;  4AF1 A;  3DLK A;  3FFI A;  1JEQ A;  3ZT2 A;  5LJW A;  3LP1 A;  3T69 A;  1UA1 A;  3BY5 A;  3KK2 A;  3QNO A;  3LDS A;  4B08 A;  4CHO A;  2QW9 A;  2QNF A;  4BE2 A;  3AVK A;  3DYA A;  4OJR A;  4BE1 A;  3DXM A;  3QEV A;  3DJC A;  3CG7 A;  1TVR A; 
#chains in the Genus database with same CATH homology
 2D0A A;  3DLE A;  1S1W A;  3F9K A;  3NDK A;  3LP3 A;  4C8L A;  3K5N A;  2HHQ A;  3OS2 A;  1HQE A;  4OVL A;  3MAQ A;  2PY5 A;  4DTR A;  4NYN A;  3L2W A;  1W9H A;  4CFC A;  2YHA A;  2YKM A;  3RWU A;  4HCC A;  1F21 A;  3EY1 A;  3V9W A;  3MED A;  4B9L A;  1Z25 A;  2VG7 A;  5HRS A;  3KKS A;  4CJT A;  2LSN A;  5T7B A;  3RMB A;  2G8K A;  3SQ2 A;  4W5O A;  2KFZ A;  3MEC A;  4CFD A;  4RW8 A;  1L3T A;  1ASW A;  3V9S A;  4N56 A;  1BIS A;  3OYB A;  4OPJ A;  1T05 A;  4DTJ A;  3OYJ A;  3LAK A;  2KZZ A;  1TK0 A;  1BI4 A;  1ZBF A;  2G8W A;  3AO1 A;  4F4K A;  2HHX A;  2HNZ A;  1S9E A;  4JS4 A;  4PY5 A;  1EX4 A;  1TL3 A;  1YVU A;  4N41 A;  3NF8 A;  3DLB A;  1RT7 A;  3S3O A;  1TK5 A;  1WNS A;  1DLO A;  3QLH A;  3QNN A;  4B9U A;  1NKE A;  4GVM A;  1C0M A;  1RT6 A;  3OS1 A;  3SUP A;  4ZTJ A;  1X9M A;  4FXD A;  2HHV A;  4CF8 A;  3SV4 A;  3VQA A;  3ZSV A;  1SKS A;  3A2F A;  1HRH A;  1U4B A;  1HQU A;  3NH1 A;  5KI6 A;  4DS5 A;  4E19 A;  4DU3 A;  2RNO A;  1VSF A;  3S9H A;  3KK1 A;  1S6Q A;  1VSK A;  4DSF A;  4KHW A;  3AO3 A;  3NBP A;  4FLW A;  3TAG A;  1IKW A;  1LW2 A;  5C24 A;  4WE1 A;  1ZBH A;  1IKX A;  1LWC A;  2WON A;  1EXQ A;  4UQG A;  4KTZ A;  4LD0 A;  4CJE A;  4CHZ A;  5KRT A;  3AO5 A;  3QEX A;  3E01 A;  4FW2 A;  4DSJ A;  2XY7 A;  1C6V A;  4DFM A;  1QS4 A;  3DRR A;  5HBM A;  1IKV A;  3LWM A;  1BHL A;  1JXB A;  1U47 A;  1Q8I A;  3O4Q A;  3SJJ A;  2B5J A;  1RBR A;  2ETJ A;  2P1J A;  3QO9 A;  3MXI A;  3WNF A;  4W5N A;  3HPG A;  1VRU A;  4KAZ A;  2KQ2 A;  4CEB A;  3AVG A;  3RTV A;  1O1W A;  3ZSO A;  1T8E A;  3U3G A;  4Z4F A;  1U48 A;  4IFY A;  4B8A B;  3OJS A;  4DSK A;  1C1C A;  4I2P A;  1FKP A;  1B9D A;  4CK1 A;  4DF8 A;  1FXX A;  2IS3 A;  4FM2 A;  2FBT A;  4F2R A;  4M3R A;  4FK2 A;  4FJ8 A;  4DTP A;  3QES A;  3NE6 A;  4NCG A;  1KLN A;  2NUB A;  5CY4 A;  3HP9 A;  5DK5 A;  1NK4 A;  4B9S A;  4ICL A;  4FJI A;  4L8R B;  5K14 A;  4Z4E A;  1NJY A;  2X78 A;  4OKK A;  5KGW A;  4JRQ A;  4CEC A;  4J2D A;  3PX4 A;  4KHY A;  1WSH A;  1U49 A;  3K5M A;  4B9M A;  4FJN A;  3OYK A;  2DFF A;  4DG1 A;  3B6P A;  4E3S A;  5J2M A;  4AHT A;  2OA8 A;  1JJR A;  3AVF A;  4CER A;  3TAM A;  1T7P A;  3KLF A;  4LY7 A;  4E7J A;  3LAN A;  4EZ6 A;  4W5R A;  1S1V A;  4B9V A;  4FJH A;  1RNH A;  2X6N A;  1V66 A;  4CJ3 A;  3K57 A;  4CED A;  3OYN A;  3AA2 A;  3TAN A;  3G10 A;  4PA1 A;  4CCH A;  3KIO A;  2IDO A;  3O4N A;  4I9Q A;  4K8X A;  1ASU A;  2Y1J A;  4M3U A;  4FVM A;  3WNG A;  1B9F A;  4KFB A;  3LZJ A;  3SPY A;  4AHV A;  3CM6 A;  4DQP A;  3HM9 A;  5CYQ A;  3P83 D;  1SL0 A;  1VSL A;  3ZSZ A;  1EET A;  4N47 A;  4CFB A;  2FBY A;  4CF2 A;  4I7F A;  3AVN A;  5I3U A;  4J2E A;  3SI6 A;  2DY4 A;  2GBZ A;  3TI0 A;  3LZI A;  1JLQ A;  3VQ4 A;  3H08 A;  4FK4 A;  1BIZ A;  2G8V A;  4M42 A;  1KTQ A;  1LW0 A;  2E4L A;  2JLE A;  2E6L A;  3D0P A;  4DTO A;  3V4I A;  1D8Y A;  2ITG A;  1S6P A;  2XY5 A;  2BGG A;  4DTN A;  3QIP A;  4O55 A;  1YT3 A;  3KTQ A;  4FLV A;  3CFR A;  1CXU A;  3ITH A;  2RN2 A;  1IKY A;  1X1P A;  4CGD A;  3ZSW A;  3NFA A;  2OZS A;  2GV9 A;  4CF0 A;  2D0C A;  3C6U A;  4FJX A;  2F96 A;  2D0B A;  4HCB A;  4QCL A;  2OPQ A;  4FJ9 A;  3L2R A;  4FZX C;  4DQS A;  3MEE A;  1TKT A;  2X6S A;  3HVT A;  3KJV A;  4IBN A;  2HNY A;  3OYL A;  3F73 A;  3V9Z A;  2HW3 A;  3M8S A;  2EX3 A;  4CES A;  4FW1 A;  4DQQ A;  1XI1 A;  4NYF A;  4Y1D A;  1S1U A;  4RW7 A;  4KKO A;  1RTD A;  1SKW A;  3VQD A;  4KHU A;  4CEA A;  3T1A A;  1J9A A;  1WLJ A;  3NF7 A;  1L3S A;  4O5B A;  3ZSX A;  3AVM A;  3ZSR A;  1NOZ A;  3VQC A;  1KCF A;  1RDB A;  4HUF A;  4Z0U A;  3QEV A;  1VSE A;  1YTU A;  2VWK A;  1K6Y A;  1CXQ A;  3CFO A;  3G0Z A;  3B6O A;  4GW6 A;  4O0I A;  3OYI A;  3SCX A;  1Q9X A;  1QTM A;  4F8R A;  2G8I A;  4Y1C A;  5I42 A;  1RDA A;  1Q9Y A;  3RRH A;  4YFU A;  2RF2 A;  1HMV A;  1TAQ A;  1NK0 A;  4DSL A;  1TKZ A;  4FK0 A;  4FLY A;  4NCA A;  4FYD A;  3RR8 A;  2YNG A;  4EP4 A;  2G8H A;  2KZM A;  1XC9 A;  1CZB A;  4FCY A;  4KB0 A;  2VWJ A;  1JKH A;  2QKK A;  3SUQ A;  3NAE A;  1U04 A;  1LWF A;  1HNV A;  3V6D A;  4LSL A;  4RW6 A;  3AVC A;  3O3G A;  3OYA A;  4M3W A;  4B9N A;  1UOC A;  4R5P A;  2HMI A;  2B6A A;  2IOC A;  2XY6 A;  2FC0 A;  4DS4 A;  4IDK A;  4XIU A;  4CGH A;  3PV8 A;  1R0A A;  3UIQ A;  2QK9 A;  4PQU A;  2HB5 A;  1RDD A;  4HUE A;  1WSI A;  3SUN A;  5JS1 A;  3ZT0 A;  4Z4C A;  4DTX A;  4KHQ A;  4AHS A;  2IGI A;  1JL1 A;  2QXF A;  3RR7 A;  3M8P A;  2HVI A;  1HYV A;  1C1B A;  4OKJ A;  2ATQ A;  5FDL A;  3QEI A;  3DMJ A;  1XWL A;  1KRP A;  4OLB A;  1NK8 A;  2FBX A;  4RG8 A;  2XO7 A;  1RIL A;  3VQB A;  2GUI A;  3ULD A;  1QSL A;  2ZE2 A;  3CQ8 A;  4Q5V A;  3SZ2 A;  4JLH A;  3NGY A;  3QIN A;  3KLH A;  1S1T A;  3RMA A;  1JLA A;  1Y97 A;  3LAM A;  1HNI A;  3M8R A;  5HRN A;  3K59 A;  1QQC A;  4B8C A;  4CGI A;  5J2N A;  3K5O A;  3HVR A;  3V9X A;  2A1R A;  1RTH A;  1KLM A;  4AH9 A;  3CYM A;  4CHY A;  4OGC A;  4KHS A;  4H4O A;  2R7Y A;  2PZS A;  4DSI A;  2P5O A;  4ELT A;  1VSH A;  1FKO A;  4F2S A;  5E41 A;  1NK9 A;  4DTS A;  3OJU A;  1GOA A;  5KTQ A;  2DFE A;  3AVJ A;  3V81 A;  2IC3 A;  4OLA A;  4CGF A;  1I39 A;  5HP1 A;  4FJL A;  3QEW A;  1HJR A;  3L3V A;  4KO0 A;  1SL1 A;  3QIO A;  3HST B;  4CEZ A;  3AV9 A;  4OKE A;  3WNH A;  4BDZ A;  1CLQ A;  4AHU A;  2DTU A;  3OYM A;  4BIT A;  4DSE A;  3AO2 A;  1WSG A;  3OS0 A;  2XY8 A;  1KFD A;  3VQQ A;  1RBV A;  4DMN A;  1D9F A;  1ITG A;  1QE1 A;  1ZBL A;  3KD1 E;  4FJ7 A;  4CEE A;  1NKB A;  4NCB A;  3BGR A;  4FLU A;  1I3A A;  3DLG A;  3DRS A;  3OYH A;  5HRR A;  3KLI A;  3AVI A;  1NJZ A;  4OGE A;  3RMD A;  2F8S A;  3SQ4 A;  1TKD A;  4W5T A;  1S1X A;  2EHG A;  4LSN A;  3OYG A;  3HPO A;  4OPK A;  3QET A;  4M45 A;  3TAP A;  4DF4 A;  2G8U A;  2P5G A;  3M8Q A;  5FRO A;  5SWM A;  3V1O A;  1B92 A;  4AHR A;  2KW9 A;  3IRX A;  2BAN A;  4TSX A;  4CGJ A;  1H1J S;  3NHG A;  1J5O A;  4C8N A;  4CEQ A;  3SQ0 A;  1SL2 A;  1WSF A;  3U6F A;  3TR8 A;  1A5W A;  1CZ9 A;  3VQE A;  4AIL C;  1TV6 A;  3LP2 A;  3LAL A;  1A5X A;  1RBU A;  1NK5 A;  4CJQ A;  3SUO A;  4DTU A;  3I8D A;  1XHZ A;  3L2U A;  3MXM A;  3KD5 E;  4FZZ A;  1MU2 A;  4CJV A;  1WSE A;  2I5J A;  4RW9 A;  2B4J A;  2KVU A;  1NOY A;  2HHW A;  3AA4 A;  3V9U A;  1LWE A;  1TK8 A;  4K8Z A;  3P1G A;  4UZW A;  3EZ5 A;  3L2Q A;  3NF9 A;  5J2P A;  4B9T A;  1UA0 A;  3IAY A;  3ZT1 A;  1J54 A;  4FZY A;  4Z4G A;  4BAC A;  3L2V A;  2D5R A;  5FRM A;  3MXJ A;  4E89 A;  4KRF A;  3WNE A;  2RKI A;  3PY8 A;  2O4G A;  1BQM A;  1REV A;  1KVC A;  1VSM A;  4DQR A;  4B3O A;  4HTU A;  4BWJ A;  3TAE A;  5D3G A;  4HVJ A;  1DTQ A;  4QOZ B;  4C8K A;  4KTQ A;  4J2B A;  4FM1 A;  3HL8 A;  2RNN A;  1KSP A;  1A5V A;  5HRP A;  4ELV A;  3NH2 A;  4E7I A;  1S9G A;  1BI4 B;  2VG6 A;  1C0U A;  2Z1I A;  5CZ1 A;  1QSY A;  1D9D A;  3DOK A;  4N76 A;  3LPT A;  4E7H A;  3TAB A;  4CIG A;  4M3Z A;  4ELU A;  2KVD A;  3O3F A;  3MEG A;  1BL3 A;  1RT3 A;  1C1A A;  4CFA A;  3ZT4 A;  1S5J A;  3KLG A;  1X9S A;  4DU1 A;  3OYC A;  3KLE A;  2O4I A;  4CIF A;  4DLG A;  4DU4 A;  1NK6 A;  5HLF A;  2Q3S A;  3AO4 A;  4KV8 A;  3L8B A;  4GMJ B;  4H8K A;  1XHX A;  1NJW A;  4F3O A;  2YNH A;  4N5S A;  4IKF A;  1EP4 A;  3NH0 A;  3EYZ A;  2IAJ A;  1RT5 A;  2JGU A;  4DFK A;  2OZM A;  4C8M A;  2YHB A;  3VQ9 A;  3SNN A;  1U45 A;  5J1E A;  4KPY A;  3C6T A;  4ID5 A;  1KVB A;  2Z1J A;  1NK7 A;  2HHS A;  1ASV A;  1L3V A;  3IS9 A;  4Z4H A;  1N6Q A;  4DFP A;  1IG9 A;  2AJQ A;  1BCM A;  1TGO A;  3AA3 A;  4JRP A;  1G15 A;  4W5Q A;  4HHT A;  1W0H A;  3K5L A;  2KFN A;  3TAR A;  4CJK A;  3PO5 A;  1TAU A;  1KFS A;  2Z1G A;  3ZT3 A;  2ZD1 A;  3HPH A;  3PX0 A;  4DLE A;  4PWD A;  1RBT A;  3CM5 A;  4BE0 A;  1JXE A;  2P51 A;  4CGG A;  4F3T A;  3TWH A;  3HJF A;  2KTQ A;  1QHT A;  5J2Q A;  3DRP A;  4CJW A;  2OYQ A;  3SQ1 A;  3T3F A;  4E1M A;  4E0D A;  4M3T A;  4E1N A;  4H4M A;  3HXM A;  2QKB A;  2OPS A;  1JLB A;  3V1Q A;  3ZSY A;  2F8T A;  2PYL A;  1JLC A;  2KW4 A;  3JYT A;  3VQ7 A;  1HYZ A;  1BQN A;  1RTJ A;  4CEF A;  3VA0 A;  4DFJ A;  4ZTF A;  1Z26 A;  1RTI A;  4CF9 A;  1ZBU A;  1X9W A;  4EZ9 A;  1VSJ A;  4M3Y A;  1GOB A;  4CEO A;  3SV3 A;  4Q0B A;  3T19 A;  4CJF A;  3PUF A;  3PX6 A;  1JLG A;  3BDP A;  3THV A;  1ZYQ A;  4O0J A;  3VQ5 A;  3AA5 X;  3TAF A;  3C95 A;  4FJK A;  4G1Q A;  4IFV A;  4MFB A;  3LWL A;  3QEP A;  3ZCM A;  3SPZ A;  3TAQ A;  1VK0 A;  4KTW A;  2XRI A;  2YKN A;  5DMR A;  1JLF A;  1WSJ A;  3KKR A;  1T03 A;  4BDP A;  5EU7 A;  5KRS A;  3OYE A;  3OVN A;  1WN7 A;  1NKC A;  4KI4 A;  4KB1 A;  1BIU A;  4BWM A;  1RT1 A;  1YTA A;  3VQ8 A;  4CK3 A;  4DQI A;  2OPR A;  4ID1 A;  3NF6 A;  3ZSQ A;  3NGI A;  3LPU A;  3SYZ A;  3ISN C;  4IG0 A;  1ZBI A;  4M3X A;  4BDY A;  4CJ4 A;  3VQ6 A;  5FRN A;  4O44 A;  1EKE A;  4FM0 A;  5JS2 A;  4AHC A;  2BDP A;  3DLR A;  1UAX A;  4QAG A;  4M41 A;  1HPZ A;  2YNF A;  4CE9 A;  5KGX A;  2HND A;  3RMC A;  4CJ5 A;  4FJ5 A;  1IO2 A;  2WQG A;  3HYF A;  3V1R A;  1NJX A;  3DI6 A;  3VN5 A;  1UWB A;  2Z1H A;  3JSM A;  4MQ3 A;  2PYJ A;  4CK2 A;  5SZT A;  3OYD A;  1SUQ A;  3L3U A;  4CHP A;  3DM2 A;  1LAV A;  3AVA A;  1GOC A;  1IH7 A;  3IG1 A;  3AVL A;  4CHQ A;  1L3U A;  1VRT A;  1D5A A;  3CFP A;  4E7L A;  3QER A;  1TL1 A;  2VG5 A;  2KVE A;  1RT2 A;  2HHT A;  2W42 A;  5HRO A;  4C8O A;  1TKX A;  3HP6 A;  4LH5 A;  4FJG A;  2HVH A;  4EP5 A;  1RBS A;  4KI6 A;  1BGX T;  1RCH A;  3KK3 A;  4FLX A;  2WOM A;  3AVH A;  1SV5 A;  1RT4 A;  2ZQB A;  3OYF A;  4JS5 A;  4HUG A;  3AVB A;  4Z4I A;  4DTM A;  4FJJ A;  4CJS A;  3HK2 A;  2Y1I A;  4O4G A;  4ZHR A;  3HO1 A;  1VSD A;  4RW4 A;  3I0R A;  5C25 A;  4FLT A;  4KRE A;  1BCO A;  3ALY A;  1C0T A;  3LP0 A;  5CZ2 A;  4CJU A;  2X74 A;  1QSS A;  3PO4 A;  3K2P A;  4CIE A;  3DLH A;  3HT3 A;  1N5Y A;  3NGZ A;  3VA3 A;  3C94 A;  4FLZ A;  1HYS A;  1KVA A;  3OY9 A;  2YNI A;  4J2A A;  4IG3 A;  1LV5 A;  2OPP A;  4CJP A;  2RPI A;  4CF1 A;  3RRG A;  2JVW A;  2HHU A;  3O3H A;  3I0S A;  2G8F A;  3DLK A;  1VSI A;  3FFI A;  1JEQ A;  1FK9 A;  3ZT2 A;  3K58 A;  1LAW A;  1L5U A;  4E7K A;  2DFH A;  3P5J A;  3LP1 A;  4DWI A;  2XHB A;  1WAJ A;  1JL2 A;  1UA1 A;  1DTT A;  1SKR A;  4FJM A;  4KHN A;  1RDC A;  3D45 A;  2A1S A;  5CYM A;  3KK2 A;  2E6M A;  1JLE A;  3QNO A;  3S3M A;  1WAF A;  4LH4 A;  3LDS A;  3ASM A;  3S3N A;  4CJR A;  4B08 A;  3U3Y A;  3VQP A;  4I9L A;  4CHO A;  4CHN A;  3NCI A;  2FBV A;  4BE2 A;  5C42 A;  4YNQ A;  3AVK A;  4I2Q A;  3DYA A;  4OJR A;  2BE2 A;  3DOL A;  4CJL A;  4BE1 A;  4PUO A;  1J53 A;  2YV0 X;  3CG7 A;  1TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...