1ZBKA

Recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3 like protein 1
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbkA01
1FHDA 2V5CA 2UY3A 1RH9A 4CU8A 4Q7NA 1CECA 3ZSTA 5HXMA 2JFEX 3KL5A 1W3JA 3MU7A 2FGZA 4BQ3A 1J11A 4MDOA 1XGZA 3QHNA 4AD3A 4DUWA 3I3BA 2XYLA 3F5JA 1GJUA 2AMGA 1K6AA 4GZJA 4KGJA 2VRKA 1UD5A 3BSHA 4LX4A 2BXYA 5A6BD 1LWHA 2EQDA 1CXKA 1GOQA 4H7VA 2QV4A 4U33A 1CYGA 4AWEA 4V27A 1UKTA 3VNZA 4M29A 3UEQA 4XV0A 2WVUA 3UG3A 2J25A 4M56A 4HOZA 4D6CA 5M17A 3N12A 1WZMA 1J0IA 1US2A 2F2HA 2J77A 4DWSA 1BFNA 1SFSA 4IISA 1KR1A 1UWTA 2ZIDA 4OOZA 4UCFA 3VTRA 3KL3A 5ABFB 2XVLA 4HTYA 3ALGA 5A6AA 4H04A 1VEOA 5IFTA 2EPNA 1JDDA 2B31A 4UQDA 2J78A 2WMIB 4UNIA 3OZOA 1HIZA 3AMDA 4LXFA 4DWSD 2XVKA 1BQCA 2XWDA 3WDHA 3TTSA 3RDKA 3EDFA 1X6LA 1JG9A 1VFOA 2CBJA 4P7LA 1E1FA 2O9RA 3BGAA 5IDIA 2EXOA 3SCPA 6A3HA 1KB3A 3WKZA 4IPNB 4RE4A 2DH3A 5A3HA 2IUZA 1UH2A 4TUFA 4WLCA 4D6GA 4P7OA 1JI2A 3RPMA 3VNYA 1C8QA 5A6MA 3WL0A 1UR9A 5GQBA 4OBRA 3VD3A 3SIMA 2EPOA 3PZNA 1VFMA 4MB3A 5C70A 1JXKA 1AQ0A 5FCZA 2WC4A 1NH6A 3CZJA 4W85A 3ARUA 2PC8A 1BVZA 1JAEA 3SCUA 1OD0A 3NIYA 4UQ9A 3BAYA 4OUEA 4CGTA 1HL9A 3K8KA 4TTUA 2D23A 4ZXOA 1E6RA 3DYMA 2A3HA 4MJ4A 1VF8A 3AZSA 1G9HA 4MPKA 4PMDA 3AIEA 3ZM8A 4D6JA 5LA1A 2GJXB 2ZX6A 4JAWA 1NP2A 2VVSA 5EMYA 3ZIZA 4D71A 1GQIA 4D1JA 5DMYA 4HZ6A 4CCDA 1XD0A 2BVTA 4GXPA 1WAWA 1W3LA 4GZEA 3AYRA 4F8XA 5LA0A 1NWSA 5HBFA 3MO4A 4GO8A 2ZX5A 2XFYA 1AQHA 1DHKA 3FY1A 3BCDA 8CGTA 3MUY1 3WDQA 3VGGA 3K4DA 5CLTA 4AZCB 1XSJA 1E72M 1W1VA 1V3IA 2ZXAA 4AZ5A 1BHGA 2BHZA 2UY2A 4JFSA 1IZKA 4B9ZA 1J0ZA 4MADA 3JUGA 3KWXA 1GNXA 1ZBVA 5D9OA 4JFVA 1YHTA 3VVGA 1IV8A 3L4WA 4HOXA 1WB0A 5DF0A 2GK1A 6TAAA 2FH6A 3LPGA 3I3EA 4ACZA 1VEMA 4D1IA 1V6UA 3T2OA 1LL6A 3VILA 2ZUNA 3WEMA 2XTKA 1LWJA 1SMDA 3CO4A 1W9XA 1CBGA 3GYCA 1KXTA 4ZXLA 4URIA 3WD1A 3WD3A 1C3FA 4GIAA 2G3JA 1K9TA 1UZ4A 2WPGA 1R8LA 4CD4A 1QW8A 4OJYA 1JZ4A 3CHEA 4TVDA 3MV11 1I1WA 1V0LA 4FLSA 4M8UA 1EA9C 2CIPA 2J4GA 4PMNA 3WL1A 2V3GA 1R7OA 3U7BA 3VMOA 4C7GA 3N9KA 3FNDA 1V0KA 5DT5A 1H49A 4D6DA 3ZQ9A 3UETA 1UR4A 4U2ZA 2PWFA 3VOCA 2CBVA 1ISVA 4ZE5A 5CG0A 1EXPA 3IK2A 3T0DA 1EQCA 2X09A 1LLOA 1TCMA 4UFJA 1U2YA 2YBUA 4GI6A 1QNQA 2V38A 4PUEA 1FHLA 4QP0A 1BAGA 2JEQA 1BSIA 1WO2A 4UQCA 5E6ZA 1AVAA 1CPUA 1BGGA 1UKQA 2DH2A 1E6QM 4HMEA 1C8XA 4JHOA 4OZOA 1GOIA 1J18A 4UOQA 2J7FA 1OINA 2WMHA 3MS8A 4J3WA 1BLIA 1F4HA 3G6MA 1JZ7A 1H0IA 5IFPA 4JHZA 2A3BA 1EGZA 1JFHA 2DT1A 1UWRA 3UR7A 1C7SA 2Z1SA 4S3JA 2BS9A 1JAKA 4ATDA 1OCQA 2XIIA 3GBDA 3VDBA 3BMWA 1VIWA 3W4RA 3AI0A 5A8QA 3CTTA 3SCVA 2PWEA 4JFTA 2BY1A 4ML4A 2W66A 1WNOA 1FFQA 2CXGA 2GJPA 3HJEA 5EB8A 1Q6DA 3VIJA 3WENA 2WCGA 1ISWA 3ZO9A 3WUFA 3CZLA 4FLOA 2VQTA 4BQ4A 5IHRA 1UYQA 4PSPA 2PWHA 1H3GA 3CUJA 2O9PA 3N13A 2G3IA 2WZEA 2ZUWA 3SCWA 5CPQA 2X05A 1TVPA 1UD2A 1V3HA 5CSUA 3B9DA 1CWYA 1E3XA 1B9ZA 4FMVA 1JZ5A 2WZIA 4NZCA 2EPMX 1QHZA 4WKAA 4HZ8A 4CD7A 3MSDA 4BS0A 4Z2HA 5A95A 1VB9A 1VJSA 4BF7A 1OT2A 1J9YA 3AZTA 1NQ6A 4IM4A 3WH9A 1JD7A 3NYDA 4WSKA 3SUTA 2E9LA 1LG2A 4P7QA 4MNJA 4TVUA 4FK9A 1CXEA 3VM5A 1UQYA 3K1DA 3CLWA 1PPIA 1W9PA 5CGTA 5CQ1A 1OGBA 2GK1B 1HT6A 2DQXA 1E70M 2VUYA 2J8GA 2FH8A 3MANA 4NI3A 1WP6A 4PMOA 5I3DA 3S6TA 2WM0A 4W84A 1PEZA 4W7WA 4QLJA 2Z1KA 1TE1A 1KR0A 3TP4A 1LQ0A 1GORA 3AIQA 1QVBA 2CBUA 4LGXA 4J3SA 1CGTA 4TVCA 1QI2A 2CETA 2ZOXA 2OWWA 3WDIA 3CUHA 1GQKA 1US3A 2WVVA 2ZWYA 3D5HA 5A2AA 3RO8A 3W6LA 1KWKA 1GOWA 3GXIA 3EMQA 3CBWA 3DC0A 1OT1A 1WZKA 2YA1A 4BQ2A 3B9AA 1WPCA 3M07A 1E9LA 1O7AA 7TAAA 2JF7A 1HKMA 5ABGA 1ODZA 5DFAA 4U3AA 1BYCA 2CKSA 2VURA 3AIUA 2ZUTA 1MQQA 1ITCA 1EO7A 2VT0A 4WSJA 4DM2A 1W1TA 1V02A 1BYDA 1DWIM 1HP4A 3WF4A 2UY5A 1QNRA 1W1YA 3WNKA 4UFIA 1ZS2A 2A3EA 1E71M 2YL9A 1E0XA 2PBGA 3WF2A 3MV01 3B8SA 2BVYA 1OIFA 5JBEA 3VX1A 3WUBA 1KXHA 3A4AA 2Y8VA 1R86A 3CMGA 1WCGA 4P7RA 4JKLA 1CTNA 2QPUA 4UFHA 2YL5A 2D3LA 4ZEPA 4HZ7A 4X9YA 2NT1A 3VM7A 2WMGA 4AD1A 3WEZA 3L2MA 2BXZA 2C7FA 4U5IA 2XJ7A 1GOOA 1DWHM 5I23A 1OWQA 3W27A 1HVXA 1GONA 5BRQA 4N0RA 2C0HA 3WBEA 1MW3A 3GXMA 5EBAA 2VI0A 2J62A 2XGBA 4KH2A 1ZBCA 1B30A 3AISA 5ECUA 3SUWA 3PZQA 3KE0A 3T2QA 1KQYA 4PTWA 2WSPA 3AS1A 4Z2KA 1B3YA 3ARRA 3WQ6A 2GVYA 4P8WA 2X0YA 2W67A 1JFXA 1VBUA 3VDCA 1OSEA 3U57A 3AIBA 3ARQA 4PMUA 4ZENA 4UQBA 2CESA 1XCXA 1JZ8A 1MWOA 1PZ3A 1KWGA 1H11A 3N18A 1V3MA 4WKHA 3PTQA 1MW2A 2YL8A 3ZOAA 1LL7A 2QPSA 1PX3A 4RL3A 2DSKA 3FN9A 3AZRA 2Y4SA 1CLXA 1G01A 4EKJA 2PWGA 3VGBA 1LL4A 3W6MA 3BAWA 3VDHA 3WDPP 4W5UA 4ATWA 1CGUA 3F5LA 4GKLA 3NJ3A 1CXLA 5D8ZA 2JALA 3BLPX 2MANA 3U5YA 4A3HA 1K9EA 5D9NA 3WQ8A 2EO7A 1QI5A 4UTFA 2YDSA 2VMFA 3WUGA 4HA1A 4CUCA 3WQ4A 4PEEA 2DSUA 1J0HA 3PZ9A 4QFUA 2WC3A 1W2VA 1QBAA 5CPTA 3VD9A 2CHNA 1UWQA 1UWSA 1M53A 2W61A 5BXTA 4PMRA 2QF8A 1B2YA 3GNPA 4M24A 4AZHA 3B9EA 3GH4A 5A6SA 1R85A 4C7FA 1NOFA 1NWTA 2XSBA 3DECA 4IUGA 5I79A 5JBFA 1MYRA 3AMKA 4YPJA 1PX4A 5FOOA 4P8UA 2VZOA 2F61A 1Z32X 3I3DA 3TTQA 2VR4A 2XIBA 4EAMA 1B31A 1JZ6A 4D6FA 2VX7A 4AD2A 5KEZA 3OBAA 3BMVA 4OOUA 2J74A 3K8LA 1CGWA 2VCAA 1RP8A 5JBDA 4J7RA 2J7EA 1WDPA 1JGIA 3TONA 4J3UA 1Q6CA 1A3HA 1RD6A 3PZOA 3HMCA 2ZUSA 2G8ZA 3UR8A 4D6IA 2EPLX 3DHUA 2D3NA 2JF6A 4AY1A 1CLVA 3U5UA 2ZXBA 3BXWA 2OWCA 4E8CA 1VAHA 1E6ZA 3RIKA 1BYBA 3BH4A 1LF1A 3EMCA 3A4WA 3NSNA 4HOWA 3AHYA 1Q6GA 5D4YA 2V3EA 3IJ7A 1JDAA 3T09A 3AIRA 1RPKA 5D8WA 3W25A 2X1IA 1H1NA 3GBEA 2YA0A 4NRSA 2OYKA 7CGTA 2WKLA 1W3HA 3EYPA 4FLQA 2G3NA 1GZJA 1OGSA 3W38A 2FHCA 1CEOA 4MNKA 4A3YA 1EQPA 3A6OA 4W87A 3MUZ1 3WQVA 3DYPA 4YHGA 4P8XA 4MB1A 1ISZA 2XVNA 3AFBA 1NWRA 1QI3A 1JYWA 1VBRA 3UCQA 2VQUA 1G94A 4KRTA 5FL1A 3RCNA 4P8VA 1L8NA 3BAIA 3EDEA 1JL8A 2ZX8A 3WD0A 4AMCA 3VO0A 3VKKA 1H4PA 3L4UA 2WANA 2DGAA 1W1PA 5GNYA 3IAQA 4U2YA 4F9DA 2WHMA 1H2JA 1KFWA 1UWUA 2E4TA 1HKJA 2HVMA 3NDZA 3MUIA 2YKKA 1EHAA 3NSXA 5BWFA 2DIEA 4TX6A 1JZ3A 1IZJA 4Z2LA 4IPLA 2NT0A 1FH7A 1UD6A 2HISA 4NRRA 4B3LA 3AIVA 2IXVA 3IJ9A 5GNZA 5A8NA 2VOTA 2EEXA 2BHUA 1HJUA 3AYSA 4CD8A 3M46A 3ZT5A 3CUFA 3L4ZA 1MFUA 2GDUA 1W2PA 3HU7A 4W89A 3RJXA 2D24A 1B3ZA 3O6AA 1V3KA 3AMLA 1C93A 4W93A 1PJ9A 1KGWA 2CHOA 3WBAA 2YOCA 3PZVA 1V0NA 5GNXA 1BF2A 1QW9A 1E55A 5I6SA 1W9UA 1UR1A 4CN1A 2WHLA 3ARXA 2BV9A 3WF0A 1HKIA 2E8YA 4E4PA 3GZAA 2VO5A 2V5DA 1O6IA 2VR5A 4D72A 2WWDA 4ACZB 2W91A 2VX4A 1WDQA 1JYVA 5A8PA 2VZVA 1CGXA 2VZUA 4PBGA 4WK9A 3AXIA 1CXIA 3SCTA 4H8UA 1UUQA 1HP5A 5A6BA 1MXGA 2NW0A 4N42A 4AZBA 2X8RA 1OM0A 4B16A 4JZ5A 1U30A 4W7UA 3WH6A 1VENA 2J7DA 4C7DA 4KRUA 1F4AA 2VCCA 4AYSA 4D6HA 2DT0A 2GFTA 3TTOA 3UESA 3WN6A 2BHYA 1QBBA 1DWJM 2VCBA 2WMFA 2OLHA 4GQQA 2D0HA 1JDCA 4GZIA 2X0HA 3RMEA 4HMDA 2CBIA 3GM8A 1B1YA 4M1RA 1GQJA 2WMJA 3AS2A 1ZBKA 5DEZA 1J10A 3W29A 9CGTA 2OWXA 3WFLA 1JNEA 2WCSA 2FGLA 2XFFA 3CZKA 5JH8A 4PMQA 4CU7A 4XUYA 1GCYA 2IXUA 3PZIA 3SUSA 1UH3A 2DEPA 2JIEA 2XM1A 4U3CA 3OIHA 1BG9A 4B15A 2DIJA 2YDQA 5HDRA 4E2OA 2YDRA 2WK2A 1DWAM 4CKQA 5BCAA 3W26A 1E15A 4HU0A 4AZCA 3RM9A 4Y7EA 3VX0A 3AROA 4HA3A 1YQ2A 4F9JA 4AEEA 3N15A 1BPLB 3ARPA 5AY7A 8A3HA 3ARYA 3WH7A 4UOZA 3WF3A 2XVPA 2WSKA 4S3KA 5A8OA 1WDSA 3WMBA 2Y8KA 2XFRA 3ZR6A 1E1EA 5I24A 2WC7A 1D2KA 5FL0A 4J3VA 2ZE0A 3EDKA 1UHVA 4A4AA 3LPOA 4PTXA 2CITA 1E0VA 1GHSA 2VRQA 1ISYA 3AHTA 3OZPA 1ZJAA 2PI6A 2VRJA 5LA2A 4J3TA 1FFRA 3SCQA 3O2LA 2Q8XA 4UR9A 3CZGA 1QI4A 4HPHA 3WD2A 5I2UA 1W9BM 2Y24A 2CERA 5M3WA 3VGEA 2VZTA 2VNCA 3NCOA 1JD9A 4PMXA 2PWDA 2OSXA 4XZWA 3CUGA 1EDTA 2FDMA 1EO5A 2WCAA 1OGGA 2G41A 1MVYA 1OB0A 3VIKA 1NP0A 1X1NA 1V3JA 1UH4A 2YLAA 2YIHA 1SR0A 3ZJ6A 3OLGA 3T0BA 3VDAA 1H09A 3PHAA 1J01A 3GXFA 1V0MA 2EBNA 1VRXA 3N17A 5KZ6A 2RGLA 4MB4A 4AIUA 4QLLA 1XHGA 2WZHA 4GI8A 2DSZA 3TA9A 5CPSA 1GQLA 3ZT6A 3L2LA 2ZUUA 1KGUA 3SCNA 4UFKA 3RM4A 2CEQA 1TMQA 1VJZA 1DTUA 3WQWA 4HA4A 1TFVA 1ITXA 2VZSA 4QCEA 3OLIA 1G0CA 2D0GA 4K68A 3M7SA 3CUIA 3QHOA 1NARA 3IAPA 4AD4A 4MJ2A 3NDYA 3VIPA 3UG4A 2ZX9A 1QNPA 2D0FA 4UFMA 5BXSA 1UD3A 4P7NA 1HJVA 1A47A 4LYRA 4XB3A 1KBBA 4PYSA 1LJYA 5ABFA 4Z2IA 1MW1A 4H8VA 1Q6FA 1CZ1A 1FH8A 1E73M 2X2YA 3II1A 2OSYA 4KWUA 1W3KA 3W82A 4CCEA 1JI1A 1DEDA 2BY2A 3BAXA 1E6XM 3WFZA 2DPEA 3AHXA 5AYBA 4FLRA 1QHPA 2JEPA 3GNOA 3PTKA 2WB5A 5AYIA 2BY0A 3GH7A 2WMKA 1GVYA 3VGDA 4L4OA 4AD5A 1JYXA 1HX0A 4XZBA 1B3XA 3ZJKA 1PAMA 4Q22A 3AIWA 1XC6A 4UZSA 2Y2WA 1MQRA 3WH8A 4J3XA 5AC4A 3MMUA 4UZUA 3CHFA 3GXDA 3WD4A 1KXVA 3FHAA 1R7AA 1MFVA 4AEFA 3KL0A 3WF1A 1GPFA 2RGMA 3AS0A 3K46A 4AZ7A 3WNNA 1JYNA 3ZSSA 4F79A 4GO9A 5JUVA 4LQ1A 1W9VA 3APGA 2WVVB 1H41A 4JFUA 2YBTA 2ZICA 1J0KA 5I5RA 3W0KA 1JZ2A 2Y5EA 3PZGA 2YLLA 1KBKA 1B3VA 5A6JA 2W62A 1WKYA 2WW5A 2DDXA 4RE2A 1AQMA 1E4LA 4PMZA 3VPLA 4NF7A 2JIWA 2DSVA 3VIMA 3VIHA 2XVGA 1KGXA 1KCLA 5M5DA 2JE8A 3T08A 1HKKA 3AMCA 3CIVA 4MB5A 4W8AA 3ZR5A 1E6NA 1V6WA 2J7CA 2EPKX 2XSAA 1NOWA 2DT2A 1UD4A 3MMWA 5CLWA 3W53A 1UKPA 2E40A 2V3DA 1WDRA 2CKRA 4MAVA 5E6YA 2YL6A 1I75A 1K9DA 2ZWZA 3VD7A 3BCFA 4GINA 1JNDA 1GW1A 2BNJA 3ZJ7A 2DT3A 4M82A 4JCLA 4F66A 3ZJ8A 1CXFA 3FAXA 1N82A 3VIFA 5A6KA 1V02E 1HN1A 2J79A 3BC9A 4WJXA 3AXHA 2XG9A 3PZTA 4RE3A 5C8BB 4NSBA 2YJQA 4W5ZA 4AC1X 1CGVA 1CXHA 3N11A 4FF5A 2GSJA 2J7GA 1QNSA 4H8HA 3SCSA 3QR3A 3ARZA 5E70A 3MMDA 3IANA 4ATLA 3EBVA 1E4NA 5A2BA 1BTCA 2VX5A 1LG1A 2W92A 1BVNP 3MSGA 4PN2A 1C91A 3CHCA 5ABHA 2GDVA 3AOFA 1ZBWA 2PF0A 2WWCA 5A69A 1HXJA 3UERA 1E0WA 4PTMA 1UZ1A 3SCOA 3THCA 1AMYA 4OIFA 1TR1A 1ZB5A 3OB8A 1ZU8A 4HU8A 5CJ5A 3W28A 1UOKA 5A8MA 3N04A 1BYAA 1P6WA 3OG2A 3M6DA 4YHEA 2OSWA 1ODUA 5FIPA 4HPGA 3ZMRA 3EDDA 4U5KA 3THDA 5M03A 1E40A 5IHSA 4BA0A 1RP9A 5IXEA 4PMYA 3CMJA 1XH1A 1J0YA 4TOQA 3ZT7A 2FHFA 3SUVA 1EDQA 2WBGA 4TXEA 3WDRA 5I0DA 3DYOA 3ALFA 2GJXA 4W7VA 2TAAA 1XSIA 3FHQA 3CH9A 1XYFA 1OD8A 1XSKA 4UQEA 1E43A 5E0CA 3OGSA 4EANA 3L4XA 3AMGA 1SYTA 1VFFA 1WE5A 1HL8A 4AISA 2DSWA 1V3LA 2E8ZA 4JCMA 4B3KA 3AQUA 1PBGA 3WY1A 3L4VA 3F5KA 2QMKA 2A3AA 4GQRA 4EK7A 3L4TA 3GDBA 3J7HA 2F8QA 4H41A 3FW6A 3WH5A 1V08A 3T2PA 3SUUA 4AD0A 3LPPA 1IT0A 4M80A 4JFWA 3WMSA 4CVWA 5A6LA 4QAWA 3WELA 2WAGA 2VJXA 2CNCA 1HJWA 4ACYA 5HNNA 5BRPA 5E0FA 5D9PA 1JXJA 3CZEA 3IJ8A 2G4FA 2EJ1A 5FKYA 1XH2A 3RJYA 3ECQA 5A94A 1HVQA 2AOSA 3EDJA 4PTVA 4PUDA 2XPKA 1HJSA 5I78A 3OLDA 1ZL1A 1KCKA 3NSMA 4OKDA 1HJXA 3QOMA 4D6EA 1GJWA 2O92A 1JF6A 3PBGA 1V03A 2BVDA 1M04A 4W8BA 3VMPA 3D3AA 3VGHA 5DO8A 2PBOA 4W88A 4OBSA 5GPRA 1UA7A 2J8FA 5HPCA 3VD5A 1U33A 1UQZA 1L0PA 1PX8A 3KZSA 1BGAA 3BAKA 4M81A 3VUPA 4X0NA 4GI9A 4QLKA 5BXRA 3AICA 2BFGA 1TG7A 3K4AA 1V6VA 1G1YA 4V2XA 4CD6A 3QHMA 1UD8A 1E6PA 3LMYA 6CGTA 4JL2A 1EOMA 4U31A 3VMNA 2WVSA 2WYSA 4AZGA 1ECEA 1C8YA 3BSGA 3K8MA 4BZYA 4CU6A 3VU2A 1E6SM 5C71A 1EDGA 3WQ5A 1CIUA 4GPNA 2UWFA 2D1ZA 5AC5A 1UKOA 1XH0A 3ARSA 3VINA 3QOKA 2GUYA 4DUVA 3A4XA 3T0AA 1GVIA 1VEPA 1FA2A 2WLZA 1UG6A 4KMQA 3CGTA 1XCWA 1QOXA 3WNPA 3KEHA 4QCFA 3POHA 5BYWA 1Q4NX 2ZUVA 5F7UA 3PZUA 1M03A 4MNLA 3WNMA 5A1AA 2W4XA 1TUXA 5BROA 4WIWA 2A3CA 1W91A 3AJ7A 4L4PA 2OYLA 1J12A 1TA3A 4AW7A 3OA5A 1MXDA 3RILA 3ARTA 1CGYA 1ESWA 3SCRA 4CN4A 2ESCA 3VD4A 4EE9A 1H0GA 3VIOA 4MNMA 1KXQA 4PSRA 1GUVA 2QMJA 3WDJA 1S46A 1PZ2A 5EFFA 3GNRA 1E4MM 3PTMA 1XD1A 1GOMA 2WXDM 2VC9A 3ARWA 7A3HA 4H2CA 1HF6A 4PCTA 4JL1A 2AAAA 3A3HA 4ZFMA 2QHAA 1JIBA 1ISXA 1Q6EA 2J7BA 2W5FA 4PMVA 1XV8A 2UY4A 5A2CA 1FH9A 1OBAA 2OYMA 1NOUA 3VIGA 3L4YA 2ZXDA 3FAWA 2QLYA 1UR2A 2W63A 5D9MA 2J75A 3VIIA 4B9YA 5FD0A 1OIMA 4JKMA 1SMAA 2VX6A 1NWUA 2ZX7A 1DWGM 1TZ7A 4CD5A 1E5JA 2WVTA 1EHNA 4WF7A 1WZLA 1HNYA 2PB1A 3WMCA 1R87A 3ARVA 1VFUA 4R27A 3PZMA 1I1XA 5TD4A 1UR0A 1PIFA 3CPUA 2XUCA 5CZKA 1M7XA 4AXNA 2WHJA 4Z2GA 1EOKA 1KQZA 3WEOA 1MQPA 4TTGA 3W37A 3GH5A 3CHDA 1W32A 1JF5A 1J0JA 1C92A 4KGLA 2O9TA 4AZ6A 1H5VA 3G6LA 4MAZA 1XRVA 3S2CA 5BXPA 4AIOA 4CVUA 2GJRA 4AZIA 3OLEA 3A47A 4PRWA 5LYRA 4HMCA 4R5EA 3AHZA 4TX8A 4WKFA 2CPUA 5JIWA 1E5NA 2D2OA 3U7VA 1BG4A 1FP8A 2ZUMA 4AIEA 4MDPA 4UFLA 3MKKA 3QGVA 1EH9A 4BQ5A 5HPOA 1FP9A 2CYGA 1DWFM 2VL4A 1C7TA 3TOPA 3UG5A 1Y7VA 1G5AA 3W24A 1UWIA 1HJQA 3FXYA 3LPFA 4V28A 4DWSC 1GHRA 2O9OA 2WMIA 3BAJA 4E8DA 4JKKA 1QPKA 2XGIA 2YA2A 5HOSA 3AHVA 5E9AA 2C8NA 1E4IA 2ZXQA 1UKSA 2E9MA 5ABEA 5CGMA 4XX6A 1E56A 3MUAA 4J27A 2BY3A 2V3FA 3SEPA 2J47A 1W9DM 4DUXA 4UOJA 1MW0A 2XWEA 1FOBA 1B90A 1D7FA 3N1AA 3EMZA 4DWSB 1E3ZA 2WNWA 1PIGA 3GTNA 5JIPA 4QDMA 1UA3A 3DHPA 4JIEA 4MTVA 3POCA 3WNLA 4HP5A 3SURA 2G3MA 2VVNA 3VGFA 5DT7A 5I77A 3W81A 2CCRA 2E9BA 5EFDA 4BCEA 3AXXA 1M01A 4LYQA 1K9FA 2D22A 2E3ZA 1ZJBA 1EIBA 1V6YA 2J7HA 1X6NA 2XHYA 2WHKA 5CSYA 4Z2JA 3BLKA 3NUKA 1B0IA 3E1F1 4YN5A 3TTYA 1NM9A 4J28A 2NSXA 1CNVA 1GOKA 2E0PA 2FHBA 3WSUA 3CZ8A 4UQAA 5E09A 3WUEA 4DM1A 4W8LA 3RM8A 1QI0A 2WLYA 4CN6A 4PCSA 3F4VA 4CCCA 4LYPA 1QNOA 5CXPA 1D3CA 1TVNA 2D20A 4LPCA 4X0VA 4W86A 3WIJA 3OGVA 1QHOA 3OGRA 3AS3A 4ZE4A 1TA3B 1XYZA 3O9NA 1C90A 1WZAA 3WNOA 1CENA 2XM2A 1B3WA 1DP0A 3HN3A 1UR8A 2WKGA 2WBKA 1V6XA 3PN8A 1CDGA 2VTFA
chains in the Genus database with same CATH superfamily
2XIQA 2UY3A 1U1UA 4YS1A 3ZSTA 5HXMA 4ZTYA 3G1HA 3KL5A 3W7OA 4U4MA 1N8WA 2FGZA 2V5JA 4PH6A 4BQ3A 3QHNA 4GIEA 2P0OA 3W72A 3I3BA 4S2BA 1U22A 3S5NA 3F5JA 4S3BA 4RDZA 1SZGA 2VRKA 1DJHA 3NQAA 4R88A 3BSHA 3VDGA 1S3HA 1V7AA 3CYJA 2DU2A 5CBJA 3EWZA 4V27A 4NX0A 1RPXA 4XV0A 3UG8A 1A0DA 1EJVC 4JTUA 4D6CA 3I7SA 3ITLA 3N12A 3HGJA 1WZMA 1J0IA 4XD4A 1OFAA 2QCHA 4C6IA 1J6OA 4HTYA 3RRAA 1A5CA 4H04A 2WJEA 1JGMA 2EKGA 5IFTA 3E96A 1PE1A 4AAJA 4O19A 4C1NA 1JUKA 4FX7A 2EAWA 1PHQA 4LXFA 4DWSD 4YCOA 5KTLA 1FKKA 3UT0A 3RDKA 2NX1A 3EDFA 1X6LA 1JG9A 4I5XA 1VFOA 4ZA0A 4C6DA 2TMDA 4FAPA 5DCEA 1TTQA 4QIBA 2C18A 3TLQA 3IK8A 1H7NA 5A3HA 3C2RA 4GYPC 1KM1A 4ZR8A 1C8QA 1RALA 3FFSA 2QCMA 3BSMA 2VFHA 3SN0A 4G7EA 5HNRA 3PZNA 1FWEC 3TW7A 3HG4A 2PC8A 1DKWA 2O7SA 1FDJA 1X6UA 3BPWA 3VFLA 4OUEA 2YXOA 3C2FA 2BDQA 2X1RA 2KAUC 3QMTA 2HROA 1M7PA 3W7MA 2ACSA 4MPKA 4FR6A 3O06A 2RAGA 5LA1A 3B9OA 3KBVA 2R82A 4BWLC 4A6GA 2I5IA 5JU6A 5F2MA 1LT7A 4C91A 1RD5A 4DO5A 4D1JA 1LUCA 3QZEA 1R3QA 1I2PA 3GPKA 4I8YA 4NASA 3UWYA 2DY3A 1H5YA 3GTIA 1XYBA 3HPZA 2C13A 2RFGA 3MUY1 1FKLA 5CJMA 2A21A 3K4DA 5CLTA 4AZCB 1XSJA 1W1VA 1V3IA 4JBRA 5CSRA 4OUIA 2UY2A 1IZKA 3L23A 5DO2A 2GUBA 4NJIA 4B9ZA 5HUPA 4R9XA 3LXCA 1TUFA 1N7KA 5D9OA 4LOCA 3G0UA 3GVRA 3VVGA 2ZE3A 1IV8A 3L4WA 5DF0A 4QQUA 3QMRA 2FH6A 3IJDA 3I3EA 5HQEA 1VHCA 1J5TA 1KFKA 1FWNA 1LWJA 3D46A 1SMDA 2V8ZA 3UP8A 3LMZA 1KXTA 2F84A 3UJEA 1ZNNA 1Y0EA 4QG9A 3S0CA 3WD3A 3UF9A 2X16A 4IF2A 2YBVA 1RY8A 2G3JA 2Y7GA 1UZ4A 2Z1WA 2QDGA 1Z7AA 3MV11 1GVSA 3CO8A 3OBEA 3REQA 2CIPA 1K6WA 1XW8A 3WL1A 2V3GA 2YB4A 4C7GA 3N9KA 3W7GA 1V0KA 1B5TA 1H49A 5HA7A 3VOHA 1FCUA 4PB3A 4MWAB 3DESA 4N9EA 4XAPA 4C65A 3IIVA 4ZE5A 3N2BA 3UPWA 3W2JA 3HQOA 1BQGA 4BEQA 2Z1XA 3IK2A 3V35A 1EQCA 2X09A 5F2GA 4JTKA 3LTSA 5IBXA 4LAKA 1R9HA 1A53A 4C90A 1JPKA 4C6MA 2YBUA 2R1MA 4LCQA 1FHLA 2OGYA 4GGQA 5E6ZA 5AHFA 1BEUA 4MGVA 1JDEA 2A5HA 1TSIA 3VNMA 1WX0A 4DWDA 1FWHC 1XGEA 4OQVA 2P8BA 1C8XA 1U83A 3GHSA 3WLJA 1GOIA 1J18A 1XUZA 4MJMA 2FZ8A 4EAYA 7XIMA 4DAFA 3UWQA 1H0IA 1TZ9A 4JHZA 4PODA 3W23A 4AWSA 2X0SA 3JU2A 1EA0A 1JFHA 2XU2A 1UWRA 2CZEA 2P10A 9RUBA 3G5EA 4WXZA 4NP7A 1X8CA 3GSMA 2P8CA 2BS9A 3KUMA 4PB5A 1OCQA 3BMWA 1VIWA 5C55A 1JCMP 3FV9A 1P0EA 1BKFA 2H8ZA 1R3VA 4OGZA 4GXWA 2BY1A 5H2ZA 1FFQA 3PULA 2GJPA 1FKIA 3WENA 1EJWC 3WLPA 3CPRA 4IP7A 3AO0A 5HAOA 1ISWA 4GX8A 4QT3A 4O0QA 3BTNA 2PWHA 5HATA 2O9PA 4ZQNA 1OFEA 2VFGA 3H24A 1SO3A 5KZDA 1TVPA 1FX6A 4ZODA 4O8RA 5CSUA 1BWVA 4JGDA 1B9ZA 1O60A 1XG4A 3NQ6A 5K3VA 4NZCA 3TA6A 1LP6A 3KBMA 3WMLA 2XIOA 3MSDA 4HCHA 3DG6A 1R9XA 1J9YA 4IJCA 5DXXA 1NQ6A 3IRDA 4GYKA 3C2EA 1R6WA 1OY0A 3FSUA 4E4FA 4PUMA 5GJNA 4MNJA 3MB9A 4B90A 4TVUA 1N8IA 5CKSA 1M7JA 5BW6A 3APTA 1PPIA 1XLBA 5CQ1A 4ZTXA 3TFXA 4O52A 3W1TA 2ACRA 2BODX 3LUOA 2Z4GA 3CXOA 3UGRA 4Q8NA 3MANA 3FA5A 3S6TA 1HQTA 3CB8A 3S6OA 5LNWA 3WLRA 4W7WA 4QLJA 1TE1A 3TQPA 5DIVA 2PV2A 2V2DA 9XIAA 4AF0A 2CBUA 4JD4A 2Y89A 4J3SA 3UQNA 2Y0FA 5T9BG 1J5SA 1QPQA 4PEKA 4LBRA 1US3A 3VOJA 3W6LA 3W2MA 3GXIA 3EMQA 3DC0A 3W00A 3KRSA 1WZKA 1Q4WA 3KAIA 3DI0A 4XVEA 3HPAA 7TAAA 1I2RA 2CLEA 2VURA 3AIUA 1MQQA 4XZHA 1M7OA 1Q85A 4WSJA 2XH2A 2ISDA 4DM2A 1W1TA 1BYDA 2RDWA 4ZCWA 1DWIM 2OT1A 4KR0B 1N2VA 1VRDA 4TX0A 1UR3M 1W1YA 1PZ0A 4CNTA 6XIMA 3VKJA 5EU9A 1HW6A 5D32A 4ODLA 3EXSA 2B7OA 4M1BA 5FJPA 1NF7A 3DKJA 1M68A 5DY2A 4RW3A 1ZCOA 4XO7A 1F3TA 3A4AA 2Y8VA 3CMGA 4P7RA 1CTNA 2QPUA 4WGXA 3BLIA 1SFLA 2NT1A 4JDBA 3KX6A 2F21A 3VKDA 5I3GA 1FVPA 2BXZA 1GYLA 4XKMA 2XJ7A 3NZRA 1K70A 1VPQA 4OTKA 1QPFA 2C0HA 3L67A 2ONEA 1K8CA 1K8XA 2VI0A 3E9AA 2J62A 2XGBA 3IJLA 4C6FA 4GA8A 3UD6A 1B30A 3AISA 4I7WA 3W73A 3NPXA 1FKBA 3KE0A 5L6UA 2Y8UA 2WJDA 3V36A 1W54A 4YVVA 2X0YA 3RCYA 1JFXA 1OSEA 1WAUA 4Z1YA 3VNJA 1TJRA 4K8GA 3KVMA 3UNDA 3RX4A 1JZ8A 2QJGA 2REQB 5DELA 2PDMA 1BKSA 3GTXA 1X1OA 5C7VA 4B2DA 1V3MA 3PTQA 4DRSA 1THFD 2INZA 1MO0A 4R9OA 1UMLA 1NSJA 4QJ5B 3WDPP 2OB3A 1TV5A 4BR1A 3NJ3A 4A3HA 4G2PA 2RURA 1EWDA 1K9EA 4NVTA 4MZ8A 4F0LA 3H23A 2VC6A 3B8IA 2YDSA 2VMFA 3WUGA 1KCZA 4JEJA 4WCJA 1Y5XA 4PEEA 3NFUA 3NXFA 1EGMA 4FAMA 3PZ9A 4QFUA 4EPDC 2GVGA 1W2VA 1QBAA 4EVZA 3QPEA 3BE7A 1FKDA 4JOMA 5BXTA 3PWIA 1KRAC 5A6SA 3ID7A 4C7FA 1NOFA 4HBKA 5JBFA 1MYRA 5FOOA 4P8UA 2QQ6A 2VZOA 4E0CA 2F61A 1I0DA 1Z32X 1UP3A 3S2LA 3TROA 4EAMA 1FCQA 3A22A 4DRQA 2OX1A 5FACA 3C5QA 4OOUA 3K8LA 1JRBA 4ZOAA 3T4CA 2RUDA 1SJCA 3LZ3A 4J7RA 2J7EA 4IL2A 2LJ4A 1JGIA 3G8RA 5HW7A 3TONA 4J3UA 3UU0A 1I8JA 1RD6A 1XLGA 3PZOA 3R8RA 2ZUSA 3O5OA 1MZHA 2EPLX 3S46A 3PM6A 1XQKA 3BXWA 2OWCA 1VAHA 3RIKA 1BYBA 4EIVA 4ZQPA 2NQ9A 3NEVA 4QEHA 2ZRUA 3AHYA 1K1DA 3JW7A 7ENLA 1BKHA 4Z1DA 3AIRA 4Z0SA 1POKA 1O5QA 3LQGA 4JX6A 1UOZA 4ADUA 4NRSA 3R6IA 2WKLA 1BRLB 1FKXA 3TTEA 1TIWA 5B8IC 4A3YA 3CYVA 3CHVA 4HPNA 3M1ZA 3QR0A 3M41A 1PTAA 3W75A 4LC8A 1ZLPA 4YNGA 3P8IA 3EKZA 3WK1A 1NWRA 1QI3A 3KS6A 1JYWA 4XISA 2VQUA 5FL1A 3LGGA 1YDNA 3H21A 3H2MA 2V6AA 3WD0A 1H4PA 4Q4OA 4GHRA 5DMLA 1W1PA 3P5YA 1EJRC 3IAQA 1YPFA 2PTXA 2E4TA 2H3DA 2OLSA 4WDWA 4GGBA 3EAUA 1JCTA 3MUIA 4G7EB 3R89A 3P2VA 3IUHA 3NSXA 5G1YA 2JKAA 1FH7A 4BKNA 3GS6A 1A5KC 3AIVA 1TPFA 4EP8C 4H9ZA 2EEXA 3AYSA 4CD8A 3M46A 3RU6A 3ZT5A 4TQTA 3XISA 3L4ZA 4RNIA 5HR7A 1EGVA 4W89A 3RJXA 2X40A 3G1SA 2PDHA 2QAPA 3AMLA 1C93A 1PJ9A 3E5BA 2YOCA 2PTYA 4C1NB 3L7RA 5L9FA 4LVAA 2DG4A 1QW9A 5EPDA 2HNHA 4K1GA 1UR1A 2QCDA 4XSMA 1W37A 4E4PA 5CAKA 2X30A 1VP5A 2V5DA 6REQA 1O6IA 3A3WA 2QUTA 4EF9A 2WWDA 3TNBA 1QUMA 3W2KA 4HHLA 2W91A 4LUSA 5A8PA 1FRBA 4REQA 3WQDA 1BF6A 4PBGA 4WK9A 3AXIA 3KW3A 5E1QA 2PTDA 4H8UA 5DMMA 5TNVA 2NW0A 1SSGA 3SJNA 2Z28A 1GKPA 2X8RA 4E2VA 2VCCA 5ABTA 2Z1VA 5LNRA 3UPMA 2E09A 1QBBA 1P4CA 3CL6A 4Y96A 2D0HA 3G8EA 1R47A 2QCLA 3QFWA 3ZLFA 1JCXA 1KA9F 3AS2A 5DEZA 1SJDA 1DQUA 1RQHA 2QGHA 3Q94A 4A05A 1TPUA 4XZNX 3NQ2A 2PSNA 2NQJA 2DZPA 4DPQA 2DEPA 2JIEA 1EJ7L 1GEHA 2NLIA 1TMHA 4LF2A 3V5FA 4HGXA 2Z6JA 5HDRA 2RUSA 3ABZA 1P1MA 2WK2A 3BLEA 3MHFA 4ODNA 5TIMA 1E15A 3ELFA 3EOUA 4AZCA 2ABAA 3DU0A 4Y7EA 1YQ2A 3N15A 4O0KA 3UZZA 3HO8A 5A6TC 4Q6JA 3AYTA 8A3HA 4TMCA 4GMEA 2QXWA 1LLZA 2XVPA 2WSKA 4Q8VA 1W26A 1BL4A 3WMBA 2Y8KA 3BLDA 4I9TA 2XP9A 4XAGA 1E1EA 5F4WA 1A50A 2WC7A 2BGQA 4EWJA 5FL0A 3L66A 1VS1A 3MPGA 3MYOA 1LYXA 4GNJA 2Z0IA 1W8GA 2ZFAA 4A4AA 4WJ8A 1XIHA 2VM8A 4AWTA 4DBDA 1ZJAA 4J3TA 3O2LA 2ZZ5A 1QI4A 4ORMA 2A0NA 1JR1A 5I2UA 2CERA 3OHIA 1JNSA 4XZWA 4YYCA 4GUJA 2OKTA 3ICJA 3PNZA 4NHVA 3L5LA 3E2QA 2GWGA 4HBOA 1MVYA 3W2LA 4IP5A 3E0WA 1X1NA 4F2BA 4RXFA 3PF3A 3K1GA 4E4UA 2GGJA 2AWGA 3KRZA 4UTMA 4K7YA 3WLLA 3ZJ6A 3OLGA 3T0BA 4XD5A 4X61A 1DJIA 1J01A 5LIWX 1HKVA 2Y5JA 4BY3A 3CV7A 5HJLA 4DELA 4PCNA 4MB4A 3TN5A 4GI8A 3TA9A 3KVKA 1K8ZA 2PDWA 5CZJA 2IF4A 1P7TA 2ZUUA 3DHDA 2VGBA 4L72B 3I6EA 1FWFC 2CEQA 1TMQA 4HA4A 1F8IA 1P0NA 4LAZA 1TFVA 3B0XA 5D2TA 1RBAA 4K68A 3LV5A 1NARA 4AD4A 1R9ZA 4MJ2A 3EB2A 2P76A 4ICCX 4JHMA 4ADTA 4KKXA 3TSBA 1UD3A 2O56A 1FDZA 3IEBA 1K4HA 1IIHA 4JN6A 3LLFA 4XB3A 1KBBA 1B6CA 5ABFA 4Z2IA 1Q6FA 4IFRA 3C3UA 1HGYA 2YFOA 5AOUA 5BZAA 3CQIA 1ITUA 1DV7A 3EA1A 4CCEA 2YGYA 3PNUA 1JI1A 3NZ1A 2FJKA 3WJZA 3W1LA 5AYBA 2POZA 3GH7A 5BMWA 1GVYA 4L4OA 1JYXA 2L5HA 3BV4A 2A7RA 1DIOA 1LQAA 1KV8A 3HFYA 4DJDC 1XC6A 1R3YA 3KCOA 4J3XA 3RGTA 3GRIA 3S1UA 3BZGA 3PUOA 3K13A 1QPLA 3G1FA 3RR4A 3W84A 3W1NA 4RK8A 1LM1A 3WJWA 3WNNA 4KQNA 3ZSSA 2PRMA 2UZ9A 4F79A 3PRAA 2DW7A 4LQ1A 1UC4A 3W1PA 2EHHA 4M6VA 5I5RA 4S3CA 3W0KA 1KFLA 2Y5EA 1B3VA 5A6JA 3QSRA 2G5WA 3GU2A 4DRPA 5AC7A 4UTLA 1E4LA 4XTDA 4PMZA 1H7WA 1R3SA 2FFIA 2JIWA 4HYRA 1U5JA 2XVGA 3SFKA 3T08A 3STGA 3M5VA 1HKKA 3AMCA 3CIVA 3NXLA 4W8AA 4ZO8A 5RUBA 5T9CE 1I45A 3PRBA 1MNZA 4HARA 1NOWA 1UD4A 5CLWA 3W53A 2ZZ3A 1NFBA 2NX9A 4TV5A 4HJWA 4LVDA 2DV0A 4L65A 2FPVA 4MIMA 1WDRA 2CKRA 1H7XA 4IXHA 5E6YA 4KCUA 1ZUAX 3NNTA 2INEA 4I9MA 1Y8BA 2OMAA 1GTHA 2Q6ZA 1GW1A 2G37A 2CHRA 5CZTA 1F6PA 4I6VA 3ZJ7A 4HA0A 3VIFA 3DBNA 2CZDA 4MM1A 3GHUA 3H4WA 4WJXA 3C8NA 3H2FA 3PZTA 5JH1A 2PP0A 2YJQA 3G0SA 2OCZA 1Q8JA 2CFFA 4DVOA 4FF5A 2ZZ6A 1QNSA 4TW8A 3QR3A 1SZNA 4NNRA 1QPNA 4ATLA 5A2BA 3L0GA 4HKPA 1BTCA 4AFYA 3KADA 5ABHA 4RV3A 3AOFA 3G3MA 3PBUA 4IIEA 4DIAA 3AC0A 3THCA 3W7RA 3A12A 3ZLHA 3RG6A 4BK9A 4MY1A 4UTTC 5CJ5A 4O14A 3V75A 3W28A 1O5RA 3M5YA 3OG2A 4YHEA 3PANA 3ZMRA 1UBSA 4U5KA 4XG1A 1W0MA 3CJPA 4TW6A 4PMYA 3WZ0E 1IXNA 1R46A 2QULA 3DFPA 1ZTVA 2EG8A 4TOQA 4QDWA 1LBLA 2AAMA 2VP8A 1DPMA 2FHFA 5HQLA 1EDQA 5FF0A 1IWPA 4AWUA 1QCWA 1FDYA 3GG7A 3I4EA 4B2DD 3MI6A 1ROUA 3DYOA 3HBLA 1OF6A 3ITCA 1E43A 1O68A 4I8DA 4JTEA 2PV3A 4S2CA 3AMGA 3TAOA 4CNUA 3NYZA 3GC5A 1TPEA 3TYDA 4ITZA 3W76A 2UZ5A 1TREA 3VUSA 1JEZA 2QMKA 3VKBA 3L4TA 4H41A 5FEZA 4PTNA 4QNEA 1Q45A 4JIPA 3WH5A 3CMFA 3B0PA 4M80A 4NAFA 2ZA2A 3WMSA 2XH7A 3IARA 5H6HA 5E0FA 4ONVA 3LERA 1F61A 1O5XA 1Y65A 2VD8A 4Z17A 3CS2A 3LRMA 3IJ8A 1RQEA 2G4FA 3ITGA 3C52A 3URNA 1G4SA 1JQXA 1VFLA 4HK7A 4PTVA 2GYIA 1L6FA 3M0LA 3RX2A 3QOMA 1V03A 1M04A 1XLMA 4MUPA 3D3AA 3VGHA 1OFQA 1DXEA 2PBOA 3NO3A 3NVTA 5DO8A 4BF5A 1PX8A 3TMLA 1CT5A 4XBKA 5AYXA 3VUPA 5H1WA 1YX1A 4QLKA 3NR0A 5BXRA 1YBQA 1TG7A 4HPJA 3IGUA 1V6VA 3GFXA 2R1PA 2PE4A 3QHMA 5I09A 3G1DA 1RK5A 3GVWA 4O1EA 3T40A 2ALRA 2XGZA 3V5OA 4JL2A 1EOMA 3VMNA 2WYSA 2DZUA 4AZGA 4YL2A 1C8YA 3BSGA 4FOKA 3EWCA 3D0CA 3M6YA 4BZYA 1SPQA 3GIQA 4FNSA 4GPNA 4DT4A 2E28A 2NV9A 3CEPA 2Q5AA 4DF0A 3VA8A 4MJZA 2GUYA 5D03A 2GL5A 3EKGA 4DUVA 4A3RA 3T0AA 3N6HA 1VQTA 1TV4A 1GVIA 1VEPA 3CGTA 3KBWA 1M5WA 1Q6RA 3KEHA 3WNPA 5G4WA 1F3EA 2BXVA 1M03A 1EUAA 3WNMA 1TUXA 2FFCA 3RAOA 3AJ7A 5FEWA 1BSLA 1TVLA 2ZRXA 3ARTA 3NPUA 4GK8A 1S2UA 2O4QA 1PZ1A 3M0VA 2BGNE 2Q8ZA 2D9FA 1GG1A 1PWMA 1HUVA 1E4MM 3PTMA 4C1LA 2VC9A 4YU1A 4FHAA 5I07A 1BTMA 3ARWA 3A64A 3AYVA 3RHGA 2F2DA 4N7QA 5I3KA 5HMFA 4PCTA 4C6OA 2W0UA 3TJXA 4FPSA 2AAAA 4ZFMA 5XIAA 1QZ2A 2J9XA 2AL1A 4H4IA 3EWBX 5ENLA 2PWVA 2PMQA 2W5FA 1TPDA 2V30A 4ICNA 2HBXA 3S5YA 1Q65A 1XV8A 2AQOA 2UY4A 3N9RA 4NX5A 3HURA 1OBAA 1G7VA 1H62A 2DG9A 3L4YA 3FAWA 1A0CA 2W63A 3H22A 1EKOA 5D9MA 2J75A 2VFEA 4JKMA 4YWIA 2VX6A 4JTRA 2C91A 4XVDA 1KO0A 3LXAA 4JY9A 1VH7A 4LV4A 1PKNA 4O11A 2C1HA 5G4EA 3CAWA 1EHNA 1RCXB 4JR5A 4RUBA 2ZYFA 2PB1A 3LZ5A 1R38A 1AH3A 2EPHA 4LCSA 3CPUA 5CZKA 3VXGA 4AEOA 1OC6A 2IKJA 3SQMA 3GH5A 4Z08A 1M5YA 1UP0A 2W27A 1P43A 2Z00A 3FJ6A 3OEXA 5U7SA 1H5VA 3O07A 4HCLA 3O6DA 2GOKA 2NSOA 3PB2A 3OHMB 5BXPA 4QR6A 2E1DA 1UPMB 4LB3A 2RDXA 3TW9A 3WX7A 3OLEA 1YPXA 2GGIA 1FWWA 5AHMA 2NQHA 3B40A 4R5EA 1AL7A 4OECA 3KHJA 2AGKA 3E2VA 4AIEA 2PPOA 3MKKA 3CWNA 3L5AA 2GQ8A 5HPOA 5ECVA 1DWFM 1EWEA 2VL4A 4DXXA 3OODA 3LCXA 3M4HA 1G5AA 7REQB 3RF9A 4AC7C 1N8FA 5HWCA 4V28A 3BICA 2WMIA 2ATSA 4J2MA 1XDLA 1LOSA 3BAJA 3A9IA 4QX4A 1IEXA 3AHVA 4QZVB 3CQJA 5G1MA 3C2OA 1YATA 1DVJA 1VCGA 2E9MA 4HT3A 2HCVA 3ABXA 1UIOA 4WSHA 3MUAA 5LSMA 2V3FA 4R7WA 1W9DM 5MKGA 3M5XA 4BJHA 1U79A 3NA8A 1B90A 2FKEA 3QM3A 1D7FA 3EMZA 3WO8A 4O0ZA 3DHPA 4MTVA 3V1HA 4FXFA 3RFWA 4DJFD 5I77A 3W81A 4Y8FA 2P0IA 1M01A 4LYQA 3GR7A 1SO4A 2D22A 3C8FA 4HOXA 2XHYA 4YN5A 2WHKA 5CSYA 3BLKA 4GCAA 1NM9A 1CNVA 1NEYA 3MP3A 5E09A 1IEVA 4MOZA 4DM1A 3O0KA 4C6NA 1WKDA 4US5A 4L80A 2IW0A 1QI0A 2WLYA 3BG5A 4PCSA 2BX7A 3G3DA 4CCCA 3KLKA 1QNOA 5DN1A 1D3CA 1TVNA 3O8AA 5AHNA 1R3TA 4EPEC 2VDGA 3OGRA 3AS3A 2H9AA 1F8AB 4JNYA 1Y5VA 4XIMA 3GHTA 1L2QA 1B3WA 1UR8A 4YTRA 1T7LA 3TWAA 3HG2A 3U0HA 1FHDA 3CWHA 2V5CA 1RH9A 4CU8A 4Q7NA 1CECA 2Z29A 4YMZA 1KFBA 2JFEX 2OT0A 3KP1A 3GX9A 1J11A 4MDOA 4AD3A 4DUWA 3GO2A 4ZQCA 4GKTA 3GTHA 2XYLA 4XZ9A 1SJAA 2AQWA 1A5NC 1K6AA 1KM3A 4GZJA 1ZPTA 4IFKA 4Q4QA 1OYAA 2A2IA 3JS3A 1NDZA 4JTJA 5A6BD 3H26A 2WNZA 2QV4A 1CYGA 3EXTA 4AWEA 1LOQA 3VNZA 1J8VA 2PDYA 3LUTA 3LA4A 1S5TA 4JTFA 3UG3A 3B4YA 1KNWA 3P84A 1QR7A 4DYEA 3W74A 1SFSA 4IISA 1UWTA 2ZIDA 3QXBA 1W56A 2PDXA 5ABFB 5A6AA 4LAUA 4DUOA 3GTYX 2EPNA 3KRBA 1MUCA 1VCVA 1VLIA 2B31A 3OVRA 2NX3A 2J78A 5HK4A 3CU2A 3RR1A 4F40A 1VFHA 3OZOA 3CL8A 1HIZA 4L9XA 2YW3A 3TTSA 3LK6A 4E3TA 4O28A 1KLZA 1G4PA 2HSAA 3ZWSA 3BGAA 1FKRA 5IDIA 4PGLA 1V51A 3KAHA 3MW7A 3TYUA 5MF5A 1DJYA 3EB3A 1IF2A 2IUZA 4TUFA 4WLCA 4P7OA 1JI2A 3RPMA 2HWGA 2QCNA 3WL0A 1UR9A 1A4LA 4M7SA 1NFGA 4MB3A 2M2AA 3UVIA 3AUJA 2V5BA 4KIEA 2WC4A 3GG8A 4FX8A 1E1CB 4JXCA 3SCUA 3S2MA 1OD0A 1W1A1 4F0MA 1TQJA 3E5PA 3LSCA 4DHGA 4P61A 2PLJA 3BAYA 3UXAA 3DG3A 2D23A 3DCPA 4OV9A 3N2OA 2PV1A 4MJ4A 1VF8A 3AZSA 4IQ2A 1PYFA 3AIEA 4Q8WA 3IKGA 3B8UA 4DRMA 3JYMA 4A8NA 3CH0A 4LJ3A 3TUUA 2F6XA 2ZX6A 2XZ7A 3E6EA 2YYTA 2WO5A 5DMYA 3T4WA 3QKEA 4GXPA 4GZEA 1TRIA 4F8XA 1QK0A 2CWXA 1T96A 5LA0A 1NWSA 3CV2A 5HBFA 5FJJA 2ZX5A 1AQHA 1AK5A 1BXBA 2FZ9A 3VGGA 2WZMA 1YNQA 3FA4A 4AZ5A 1ME8A 3EOLA 3R0KA 3VAWA 1BHGA 3ABOA 2OU4A 2ZTJA 4LWWA 1KTCA 3WQFA 1U5HA 3PBYA 3KWXA 4UUIA 3GLCA 4JFVA 1YHTA 3Q45A 3E2RA 3HB9A 5DBTA 4DJFA 3JYJA 4ACZA 4D1IA 4DI8A 2ZUNA 5C2GA 1RAKA 4IQCA 3ZWTA 1W9XA 4JTGA 2VGFA 3LY0A 1CBGA 3GYCA 2RUQA 3MSYA 1GOXA 4UCGA 3WD1A 3CASA 3VFCA 3VCRA 3O5QA 5HKGA 3Q2DA 1K9TA 2I14A 1JZ4A 1L8PA 4A2SA 2VEGA 1I1WA 4F2UA 4FLSA 3WK0A 2PCQA 3P93A 2OG9A 2Q02A 3QBUA 4D6DA 5B7ZA 3ZQ9A 4N9CA 1SW3A 4PE8A 4IT6A 3C0SA 1SQ7A 2BASA 1ISVA 4S38A 3OQEA 6PTDA 2OELA 5LNVA 4NAEA 4UR8A 1QASA 3NZPA 1TCMA 4UFJA 3HGSA 3W83A 3ES8A 4G50A 5H8PA 1QNQA 4GI6A 3HPFA 4QP0A 6ENLA 1BAGA 5CZ0A 2JEQA 2VFFA 3NURA 2H90A 4WY0A 5D38A 2IQTA 1AVAA 1GPWA 2FDSA 4L9YA 4ZPWR 3EOSA 1TX0A 1E6QM 5C9XA 4HMEA 4CQCA 4JHOA 4OZOA 3TIMA 1O12A 3NGJA 4UOQA 4QS6A 2VGIA 3A13A 4D9PA 2A6LA 1OHLA 3MS8A 8TIMA 4Q8TA 4IMEA 2FZDA 1R3WA 3SBFA 1WXZA 4Y9AA 1QU4A 2A3BA 1WOBA 5MHBA 2BWGA 3RITA 2F6UA 4KCWA 4GVGA 1S2TA 1Q6IA 5D33A 3TN3A 1ZENA 1XBXA 1ZALA 3VDBA 3V3WA 3W4RA 2KI3A 5FF7A 1VC4A 3W7PA 3U4AA 4NILA 5D2YA 2CLHA 3TQ0A 1WNOA 1UMYA 2CXGA 1GZ1A 3INPA 2G4JA 4ROQA 1XIJA 2ZR6A 1WKEA 3N3MA 1WV2A 4B4FA 4BQ4A 5IHRA 3NWRA 1M3UA 3GVQA 2FLIA 2ZKMX 3TMQA 2G3IA 4AIBA 3Q4DA 5CPQA 1UD2A 4QG8A 1ZAHA 3I7RA 1XGDA 1V3HA 2H6RA 3UXDA 1CWYA 2CLOA 1GK8A 3W07A 3BANA 2EPMX 3IUIA 1QHZA 4CD7A 1HO1A 1DJQA 4BS0A 5HWMA 1XRFA 4Z2HA 1OT2A 5I98A 2E1WA 4HN8A 3AZTA 3WH9A 3NYDA 4RZBA 3SUTA 4P7QA 4B5TA 4A8LA 5LXXA 1OGBA 3IIPA 1Q3NA 4DB7A 4OHQA 1GT8A 2VUYA 3P74A 2J8GA 3M16A 4NI3A 1HFBA 1F6KA 3W1RA 3B0UX 2ASHA 1PKMA 3B7XA 3A4JA 4HHPA 2Z1KA 1KR0A 1TCDA 4H9UA 2WM1A 3U9IA 1SO6A 3TP4A 1GORA 1GWJA 2DZXA 3O6YX 5K9XA 2ZOXA 1V77A 1A4MA 2WVVA 3WG6A 1KWKA 3OG3A 1J2BA 3GNNA 3CBWA 1OT1A 4BQ2A 1E9LA 1O7AA 4DRKA 5ABGA 4DY1A 2PD9A 4US5D 2ZUTA 5C0QA 2VT0A 1T41A 4L3NA 4YWSA 5LGXA 2CLIA 4Y8EA 2D2JA 4DXKA 1QK2A 2ZZ2A 3GW3A 4HZMA 4JQ1A 4JTSA 4C5ZA 2A3EA 2PP1A 1XI3A 3WF2A 4LBUA 3MP5A 2Z2AA 3P60A 1OIFA 4DJEA 2PF8A 3M64A 2YXGA 4KEUA 2FZBA 3IV3A 1WCGA 4UFHA 2D3LA 3DKLA 3D3FA 4HZ7A 4L5ZA 3VM7A 2WMGA 1WXJA 3L2MA 2QCDB 1RY0A 3DGBA 3P82A 5BRQA 4AYGA 4N0RA 4LUTA 5HNUA 2DP3A 2XDFA 5EMMA 4H01A 4KH2A 2EF9A 1W3TA 4I3GA 5ECUA 3SUWA 3MP4A 3TEVA 1KQYA 2HEJA 4PTWA 2NQ5A 2WSPA 1JPDX 1DJXA 1ML1A 4UTTA 3TZFA 1DTNA 3G2GA 2E5DA 6XIAA 2CESA 4DI9A 3RLGA 1XCXA 6REQB 2FMOA 4JX4A 4ZO6A 3QMSA 4KPLA 3N18A 3O3RA 2BOEX 4WKHA 4DN1A 5AFDA 1PL9A 1QTWA 5CC6A 1IGSA 2Y4SA 3TC3A 4JTIA 1G01A 4NXSA 2PWGA 4H3DA 3S9YA 4GBUA 5EA9A 5J6EA 2PZ0A 4W5UA 2VKZG 1CGUA 1ONXA 4GKLA 2YCKX 3U5YA 4C5YA 4I7VA 3WQ8A 1EIXA 1KFCA 4YXGA 4RNFA 1VKFA 4HA1A 4TO8A 3TOYA 4Q8OA 2DSUA 1J0HA 4UTIA 3ZYZA 2WC3A 3O5EA 1FWJC 4FR1A 1MXSA 4H6KA 1UWQA 2HTMA 3HF3A 5T8GA 3VNIA 2QF8A 5E0KA 4AZHA 4MKSA 1R85A 4F48A 2OQHA 3DECA 4MY9A 4IUGA 2YPIA 3LI1A 3TN4A 3I3DA 3ZZ1A 3H4GA 2HVOA 3OBAA 3BMVA 4JYEA 4ZO9A 3HTWA 2O7QA 3QZ6A 3QTPA 1E9IA 2Q09A 4FF7A 3BJFA 3VNKA 2ZR5A 4WXYA 1VFSA 4MLRA 2JZVA 3DHUA 1RQBA 4GIVA 3HM7A 4AY1A 2GVLA 1OC5A 2ZXBA 4E8CA 3KHDA 4ZVJA 4IFKB 3EMCA 3FVMA 3NSNA 1N1AA 1US0A 3MYPA 1PWLA 5LKYA 3ODKA 4N6EA 5HUAA 4N4PA 3IJ7A 4EXAA 1JDAA 2DZVA 4IX0A 1RPKA 5D8WA 2X1IA 5GJMA 1TWZA 4FLQA 2OJPA 3PJTA 4US6A 1CEOA 1NSGA 1EQPA 2XFWA 1L6YA 3MUZ1 3DYPA 4J4OA 4OVXA 2ISSA 4YHGA 1RVKA 1O1HA 2XVNA 4JFLA 3CEUA 3NVDA 3WK2A 1VBRA 4IWWA 3EDEA 1OQFA 4ODOA 2ZX8A 3HQ1A 2E5BA 4GFSA 4AMCA 1OYCA 3OIXA 4MPQA 2ZQVA 2PDIA 2DGAA 3ZVIA 2PTZA 4ZSTA 1XUUA 1UWUA 2OEKA 3W88A 4PB4A 1HKJA 1YLVA 2HVMA 1FWTA 3SQLA 4L6HA 4QROA 4KERA 4IOTA 1B57A 1I0BA 5BWFA 2DIEA 1IZJA 2NT0A 1UD6A 1VIZA 1ICQA 3S8HA 2PC4A 3QZAA 3H2NA 2HISA 3T8QA 2CLLA 5GNZA 3AWOA 2VOTA 3O05A 2QJJA 4AY8A 1XR2A 3LHUA 2Y7DA 3ITVA 1Q6OA 1W2PA 4PC8A 4WY0F 5C2XA 1FWRA 1T0OA 3TC6A 1B3ZA 3O6AA 3LHYA 2ZA3A 3UWEA 3GR4A 2MPHA 4A8IA 5CG7A 5GNXA 4JFIA 1M41A 2VHLA 1OX6A 3WLHA 1GG0A 4CN1A 2E8YA 3GZAA 3DH7A 3UF8A 2OLAA 2Y6ZA 4AVOA 1RR2A 1IX5A 3EIPA 3EEZA 1JYVA 1EX5A 4FIRA 1QPOA 2ZVIA 3BUVA 3LOTA 4GQBA 3E49A 4PFMA 1XFCA 1MXGA 3L65A 1XINA 4CQ9A 4AZBA 4JX5A 4R34A 1LBMA 1OM0A 2IKIA 4B16A 1U30A 4W7UA 1VENA 2PDBA 3UNTA 4KRUA 1TV7A 4D6HA 3B05A 4A3UA 1K02A 2DT0A 3O5RA 1MUMA 3WN6A 3OYZA 3CT2A 3JZEA 1DWJM 2VCBA 2WMFA 2OLHA 5DITA 2OZ0A 1NY1A 3PSWA 2X0HA 3RMEA 1GW9A 4JTLA 4HYWA 1OX4A 3NOYA 4FXJA 4A3QA 1W31A 9CGTA 1YADA 4JYDA 1JNEA 5AHIA 2PDLA 1AODA 2FGLA 5FJIA 3CZKA 2WQDA 4RV8A 5DLCA 1I60A 4XUYA 3SUSA 2OO0A 3M47A 4GE8A 1KBJA 1OCBA 4MKVA 1V79A 4MG4A 2LPVA 4GD0A 2YDQA 3PG9A 6TIMA 2RKXA 1YXCA 2GZXA 4X9SA 1DWAM 3NDOA 2DZWA 4KS0A 5EMLA 4LU0A 1OZQA 2PDQA 2D73A 4XWUA 3VX0A 1TTPA 4GY7A 3VC6A 1ZZMA 4QISA 4DYKA 5EMJA 1CX9A 4GUGA 1BPLB 1TPC1 2CLFA 1PKLA 1X7IA 3CTLA 4R3UA 3ARYA 1S38A 2WPBA 4ZFCA 3HG3A 3NZQA 5LIKX 3KP0A 2VC7A 1AJZA 2VFDA 3QGAC 3S4TA 1W1IE 2XFRA 1NAL1 4LAVA 3VOFA 3SM0A 5T26A 5HJYA 3PFRA 3TSMA 5I24A 4IGSA 4XAFA 1FWDC 1NJJA 4J3VA 3V1PA 3TJLA 4PZVA 3S2JA 3TR2A 4PTXA 3GR8A 4DAIA 3F4NA 5E5CA 3EB4A 2OXNA 5C2CA 5K9DA 2VRJA 1UP2A 3CM4A 4FXSA 3VC5A 1FFRA 3SCQA 1YIXA 3PR9A 3S6DA 2Q8XA 4UR9A 3VE9A 1UB3A 5K9CA 3KTCA 5CC7A 1JD9A 4PMXA 5D09A 3BLFA 2DIKA 2PWDA 3C0JA 1XLKA 4H6RA 4OU1A 3GVGA 1EDTA 2FDMA 3KBNA 2G41A 2DVXA 2HQAA 1TYGA 1NP0A 1XBVA 1UH4A 1NIUA 2OZ3A 4GUFA 1TTIA 1R30A 4GYFA 3VDAA 3PHAA 1TZZA 2AQVA 3W7QA 3S1WA 2GPTA 3N17A 4GCXA 2RGLA 3QFEA 4F0KA 2YCLB 2VEIA 5TBOA 3TYZA 4K2SA 1LROA 1ZRQA 2WZHA 3H7RA 2DSZA 4XD6A 3LHWA 3SAZA 4IGNA 4DBWA 3KAGA 3L2LA 2WV8A 2INFA 3ISIX 3SCNA 1XC4A 1OCJA 1V8EA 1SZRA 3WQWA 2VZSA 4QCEA 3OLIA 4L7ZA 2C14A 1G0CA 2D0GA 4W4QA 3JRKA 3KVLA 3IAPA 3VIPA 4OT7A 4L4LA 1PCKA 2ZX9A 3OYXA 1PKYA 1QNPA 2D0FA 1YDOA 1M6JA 1FWBC 1H60A 5BXSA 1EZ2A 1YKWA 4PYSA 1LJYA 1MW1A 4QJ1A 2HS8A 3CT7A 3W87A 1E73M 3CPGA 4G1KA 1AD4A 1EJSC 3ANYA 4KWUA 3MKCA 3P5ZA 4KEMA 3W82A 1X38A 5BMXA 4O18A 3HPXA 4W9QA 2BY2A 1E6XM 3AHXA 2ZC8A 3RU8X 5AYIA 2WMKA 3VGDA 3GHRA 3QC3A 1HX0A 4XZBA 4ZZ9A 4UXDA 3ZJKA 1PAMA 4PUJA 2Y2WA 4I7UA 1J4EA 1EP1A 5AC4A 1B4EA 3TN6A 3MMUA 3CHFA 1XYCA 3BW4A 3FHAA 1R7AA 1MFVA 3KXQA 3KDOA 2A7PA 1GPFA 2RGMA 3AALA 2W3ZA 3S1VA 3O5IA 3VZYA 2XP7A 3APGA 2WVVB 4L6DA 1YBQB 3HG5A 4DF2A 1J0KA 4UTJA 1ZY9A 2ZDRA 3PK7A 4YTTA 2WW5A 3PUEA 4IH3A 2DDXA 1Q2RA 3LG3A 4LTSA 3WLKX 3VPLA 4NF7A 3R94A 4HNUA 4YCPA 3QN3A 1NMWA 3VIHA 1RHCA 1RCQA 2HK0A 2JE8A 1I6NA 3GDRA 3GU9A 1Z42A 2QDEA 1XIEA 1WYIA 3ZR5A 3OZYA 1E6NA 2HPIA 2J7CA 1K3UA 1A5AA 3O5KA 4ZQMA 2KGJA 4LS2A 4QE4A 1IZCA 2E40A 2V3DA 2YL6A 2Q3RA 3BCFA 5HWJA 3TJ4A 4CNNA 4V1XA 4ZB5A 3G22A 1JNDA 2BNJA 2DUZA 5CPNA 3FS2A 4F66A 1VBGA 3ZJ8A 3FAXA 5A6KA 1HN1A 1MRQA 4Q6XA 4HU4A 2BP1A 5F2IA 3AXHA 1F6YA 4K39A 3M43A 3ATZA 2I9EA 4NSBA 3KAOA 4JTAA 1CGVA 3APYA 3N11A 1D8WA 4JDYA 2GSJA 2IMRA 1K7XA 4IXXA 4XO6A 1AFSA 1REQB 4R53A 3B03A 5E70A 3FX4A 2F2KA 2P88A 2TSYA 4HIBA 3QPZA 4PN2A 2NZLA 2HNEA 1A5SA 3UW6A 3CHCA 3S5ZA 4FOUA 1PSCA 4RJEA 2PF0A 2WWCA 5A69A 5CC3A 1UZ1A 3SCOA 1TR1A 2PRLA 1ZB5A 4FNUA 4N6FA 1ZU8A 4GLEA 2YZ5A 3R11A 2Y88A 1XQLA 3PS7A 4B92A 3R7MA 1SO5A 5FJOA 3PWAA 1XRTA 3NM3A 4BA0A 3EA2A 5IHSA 5IXEA 1EF2A 4GC3A 3CMJA 1DE6A 1PB0A 4UNLA 4GFIA 4X3ZA 4LC6A 2WBGA 1DHPA 4N19A 4B5SA 4GNVA 1F76A 5AZ1A 4W7VA 3WBXA 2ACQA 3CH9A 1OD8A 3E2SA 1XSKA 4UQEA 3G1VA 1QAPA 3GFYA 5E0CA 3OGSA 4EANA 4DO6A 3L4XA 4L64A 3GUWA 1VFFA 2ATMA 3CQHA 2CZ5A 1WE5A 5EGRA 1OADA 3RXZA 3A23A 3M0ZA 1QMLA 3AQUA 3LTPA 1R5YA 4GQRA 1F9CA 1A5BA 3GDBA 3AJXA 1L6GA 1V08A 4HNCA 2QIWA 7REQA 3SUUA 1HGWA 2ISFA 3H12A 4AD0A 1EYMA 3ZS4A 3LQLA 2Q3OA 4JFWA 5A6LA 2WAGA 2VJXA 1XLEA 2CNCA 1HJWA 4ACYA 5HNNA 5BRPA 1QDSA 1V6TA 4LALA 3PJUA 5D9PA 1JXJA 2IKHA 1TPB1 1YXYA 5FKYA 2PPPA 1UUMA 3ECQA 1HVQA 4XSLA 5MKGB 1A3XA 4R7OA 3OLDA 3K2GA 2E25A 4Y90A 3QV6A 3U48A 5EBUA 3NQMA 2XSXA 3PBGA 3E0FA 2BVDA 4V15A 3HMJG 1FWCC 1F40A 2DJLA 3NG3A 1WUEA 3PBWA 3VMPA 2CU0A 4J35A 4HNVA 4W88A 4OBSA 2J8FA 4JQAA 1U33A 1UQZA 4C60A 3EX1A 1NFPA 3LRLA 3RMJA 4X0NA 1XLAA 3S2NA 3TLLA 3ITYA 3SR7A 1Y5WA 3AICA 3K4AA 5CPLA 2I16A 5D30A 2B0MA 5G2HA 5EMUA 3V7PA 4U31A 2RDUA 4V1YA 4L9ZA 1PDZA 4ZBCA 1XIDA 1E6SM 4RZ5A 5AVHA 4UTUA 3UJSA 1AJ0A 1CIUA 3W1QA 2CLPA 2E6YA 3W7JA 3IGSA 5AC5A 3VINA 3QW3A 2YZRA 4IPIA 1TV3A 2OEMA 1UCWA 5FJUA 3A4XA 4C6LA 3RLHA 4J5NA 1FA2A 3U2EA 5LIYX 2B4GA 1QOXA 3R8HA 3AXMA 2FTWA 1VZWA 5D04C 1BXNA 5REQB 4A21A 3EWDA 3CGMA 5F7UA 1DIEA 5A1AA 2W4XA 5BROA 2RH9A 4AW7A 3OA5A 2QZRA 3N2TA 3RILA 3LYEA 1KC7A 2OOFA 4E2DA 4D8LA 3EKLA 3SCRA 3TE9A 2IQDA 1RA0A 3SY8A 1H0GA 4J4KA 1KXQA 1WBHA 1SW7A 3SRFA 3WDJA 1CW2A 5D02A 5EFFA 2PURA 3KABA 1XD1A 5BU6A 3N6QA 1F3WA 7A3HA 4GUIA 2ISVA 3A3HA 2QHAA 5M2FX 1JIBA 1RV8A 2Z26A 1ISXA 4FNQA 5CZSA 5C9WA 1YW1A 3NTPA 3P0XA 3AU2A 4G9PA 4R0XA 1JPIA 4K38A 4PUWA 1UR2A 4B9YA 1TJPA 3S42A 3DHFA 3MDWA 2VCDA 4PBFA 2Q71A 4LB4A 3GG1A 3EA3A 1WZLA 1HNYA 1ZK6A 1GKRA 3U2CA 1RLDA 1KRMA 4LW7A 4DRIA 3OVGA 3O5PA 1M7XA 4AXNA 3THAA 4Z2GA 3WEOA 1RLCL 1MQPA 1AH0A 4IIDA 4TTGA 3W37A 2ETNA 2Z6IA 4K36A 3CHDA 1J0JA 2BMBA 4KFOA 4A35A 3BO9A 7PTDA 4DRNA 3GNDA 1XLJA 3S2CA 1XRVA 3LNMA 3R58A 2GJRA 3UQAA 1RVGA 3A47A 2XP5A 2CWNA 4TX8A 5JIWA 4RNHA 2OO6A 1FP8A 4MDPA 3QGVA 5HMEA 3I65A 1PUDA 3ITXA 3L12A 1FP9A 4HJFA 2JK2A 1C7TA 4ZOCA 2KE0A 3W24A 1HJQA 2BTMA 1Z3NA 5D2XA 1GHRA 2BG5A 4E8DA 1J4RA 1QPKA 3NQ8A 3GY1A 3GVVA 3UYCA 5E9AA 3G1RA 2R1LA 3F7JA 3R1ZA 1UKSA 1EC9A 4J27A 2DORA 3COTA 4D8ZA 3SEPA 3TK7A 2J47A 3EX4A 1LTDA 2HPMA 3EX6A 1MW0A 4RNJA 1DJZA 3N1AA 1IEIA 4X63A 2IS7A 1PIGA 3GTNA 1ENUA 4JIEA 2DZSA 4B5XA 1Q1CA 4UDMA 4RKAA 1RUSA 2QVNA 4PBEA 2E9BA 5AC6A 4F2TA 4BCEA 1K9FA 2RHGA 1UIPA 3T55A 4LRTA 4Q4MA 4NU7A 4Z2JA 1AZ1A 4O54A 1SFJA 2FHBA 1UW9A 3IJQA 4DZHA 4MFDA 4HVXA 2REQA 3WBYA 2EGZA 1TO3A 1LWIA 2PLKA 4E38A 1J96A 2B7QA 3F4VA 5J5RA 1YNPA 2FTYA 2QCCA 3SJ3A 5F1UA 3WLIA 4LPCA 3LTYA 3ORWA 4X0VA 4Q7BA 1F5ZA 2PDGA 4ZPTR 4S3DA 3WNOA 3HN3A 1YRRA 1YXDA 3S5SA 2BVWA 3FIGA 4O4WA 4MSPA 4I5UA 4Z1CA 5GVJA 1POJA 1P48A 5I3JA 2VC5A 3VKCA 5B7YA 1XGZA 2Y85A 2H8XA 1LRQA 3OOQA 4K6AA 5KMYA 1GJUA 1KRBC 2GVEA 4KGJA 2C0AA 2I56A 3W3OA 1UD5A 4HPXA 4LX4A 1KT0A 2Z7GA 5D2VA 3R25A 1LWHA 2EQDA 1GOQA 4H7VA 1UKTA 4IJRA 4M29A 4LFYA 3UEQA 4EWND 3VI2A 3UZ5A 4LCRA 3UR2A 4HSHA 2J25A 5HQMA 1VPXA 3IS4A 4FOJA 1US2A 1EPXA 3MVIA 2J77A 4DWSA 3CIWA 1KR1A 3B8DA 4OOZA 4WVXA 1KT1A 1TCOC 3E0IA 1T40A 3ALGA 4JFJA 3O63A 3L5MA 1BWLA 3G0XA 3SFWA 2OFJA 3F1QA 3W1MA 3M0HA 1JPMA 3TV8A 3U8GA 3L9CA 4UNIA 1FKWA 4U28A 1BQCA 4JTCA 3WDHA 5KZMA 5TF0A 2ABBA 3USZA 2QNEA 2O9RA 3LU2A 4GH1A 1M65A 1KB3A 1HZYA 3ABSA 4UWMA 4KRZA 3R4IA 4IJBA 4IPNB 4RE4A 2DH3A 1UH2A 4H2HA 2M1IA 2XP4A 1XRSA 2F9RA 1PTDA 4ZMGA 3I6TA 2NQLA 5GQBA 3MI3A 4OBRA 1V93A 2EPOA 1YYAA 2J66A 3W86A 1VFMA 1GVOA 4QHRA 1P0KA 1JXKA 1AQ0A 2TYSA 5FCZA 4V33A 1NH6A 3WBWA 1CLKA 4IUOA 2YXXA 1BVZA 1PHWA 4D2JA 2OODA 1C9DA 4RLIA 4CGTA 3N2CA 4TTUA 3RK8A 4NZ1A 3NOEA 4ZXOA 3DYMA 2WZTA 1G9HA 1FWIC 2ZVRA 2M08A 4D6JA 1NP2A 2VVSA 5EMYA 4IG2A 4D71A 2GQ9A 1EQ3A 1GQIA 4DRJA 2BVTA 4IPPA 3QPYA 1WAWA 4XKYA 4KEVA 3CAQA 4IPXA 1FKSA 3QLDA 4XZMX 3MO4A 1ZHAA 1QWKA 5FSEC 3M0XA 1DHKA 4N9BA 4GYJA 8CGTA 3WDQA 4GI4A 1C9HA 4DF1A 2QT3A 2QAFA 5K2ZA 2ZXAA 4XZLX 1KM5A 2FPTA 2BHZA 1W5MA 4JFSA 3FJNA 4MADA 3S3GA 3UXKA 5K4ZA 3PBMA 3JUGA 1NF0A 1ZBVA 2BOFX 2J6XA 4AX6A 5I06A 2GK1A 4WDXA 1MDRA 3OP2A 4JN8A 1ZCNA 4DZAA 1VEMA 4IGHA 4PL2A 1Q7MA 3SW6A 3IACA 3T2OA 3PVFA 3WEMA 2XTKA 3U6WA 1XLLA 4O10A 4Y9PA 2LKNA 1AG1O 3V0TA 1OX5A 4URIA 1ZJHA 5IOBA 3IV8A 1C3FA 3W7KA 4GIAA 1R8LA 4CD4A 3MVTA 3OBKA 4OJYA 2AKMA 4H9XA 3CLMA 1TE6A 1G4TA 4TVDA 4ICMA 3P61A 3EWWA 4N2YA 1EBHA 4M8UA 4NZ5A 2W79A 3U7BA 3RLVA 3VMOA 1X7FA 5A5WA 1A5LC 2ALDA 1DXFA 4DLMA 1UR4A 1Z48A 4U2ZA 2PWFA 2VN1A 2IPGA 3VOCA 4DXVA 4ZL1A 5CG0A 3DX5A 1OCNA 4UMAA 4QSHA 3ZXWA 5FEXA 3TJIA 3LD5A 4L1WA 1S5NA 4JPGA 1LLOA 1EBGA 4C6JA 4LEQA 3P14A 4WX2A 2FJUB 2PPGA 4PUEA 4DO4A 2MNRA 3DFQA 4INFA 1KTNA 4FEZA 1CPUA 4KWSA 1BGGA 1UKQA 2PDPA 2J8TA 2DH2A 3A5FA 4JIQA 4BI5A 3PBVA 1GTEA 4AF0B 3UA4A 3EPMA 1S1RA 1OINA 4J3WA 3GFZA 3G6MA 4H9YA 3IVUA 4NI8A 3PTDA 1TPVA 1EGZA 4XTIA 2XPBA 1SU5A 2DT1A 1H7PA 1G4EA 2FTPA 5AC8A 2VXNA 2Z1SA 4S3JA 1SZEA 4KT2A 1JAKA 4YLWA 3G18A 3B06A 3F4CA 2XIIA 1VCFA 3KRUA 2Y70A 4BEUA 1FUYA 2IKGA 2V82A 4GQ0A 3PY2A 1QFEA 3AI0A 3W2NA 3MY9A 3CTTA 5A8QA 1IEWA 4XAYA 4JFTA 3SRHA 2W66A 1IT8A 3HQPA 3OVPA 3HJEA 1Q6DA 4GBDA 2V2HA 3LM7A 3VIJA 4W9PA 5J5DA 2VGGA 2OFNA 3WLTA 3LEPA 4GWEA 3CZLA 3EWYA 3WFAA 5AHLA 3BCJA 1UYQA 1H3GA 3BOLA 3CUJA 3I10A 3IJIA 4MLJA 2ZUWA 3SCWA 3IGXA 1ADDA 2VYOA 2OOGA 3B9DA 1GVRA 4POCA 4DBSA 2HRWA 1L9WA 2WZIA 3BJTA 3LLDA 2AKZA 4WKAA 1FTXA 4HZ8A 3DFTA 1VB9A 1VJSA 4IM4A 4WSKA 1P7TB 3JZUA 3WJXA 1LG2A 1D7IA 4GH3A 4FK9A 3WQOA 1CXEA 3UJFA 3CLWA 3W7NA 4G5DA 1W9PA 3LCGA 1G69A 1QT1A 1HT6A 2DQXA 5D2WA 2AL2A 4N02A 1CCWB 1E70M 3TU9A 4IQEA 1UJQA 4Y9NA 4RR4A 4PMOA 5KITA 1XWYA 4OBTA 4FNTA 5I3DA 4M51A 4O17A 5G2IA 4K7VA 3MO7A 1NVMA 1E0TA 4H9TA 4C6BA 1WOAA 1EUNA 3BJSA 2JGYA 1EPVA 3AIQA 4O1DA 1UC5A 1QVBA 1WQ5A 4CQBA 4TVCA 3BQ5A 3B8VA 1QI2A 3HIJA 3C2YA 5HULA 4LUJA 5DIUA 3WDIA 5JH2A 4DNMA 5IRPA 3RO8A 4GZ7A 5A2AA 4DX3A 1EP2A 1GOWA 1Z9AA 3GIYA 3N2MA 5I02A 1K77A 3PAJA 1QJWA 2X42A 3M07A 2JGQA 3IGHX 2DZBA 5KZEA 1HKMA 3Q58A 1ME7A 1S2VA 5DFAA 4L6OA 2CKSA 4FS9A 4JFMA 4IT1A 1V02A 5C9UA 1DIKA 3WF4A 1EEXA 3WNKA 1F3XA 3QQWA 3VABA 2OKOA 2CLKA 1E71M 3I4KA 1E0XA 2PBGA 4NJGA 3MV01 2QJMA 4ORIA 3SO7A 3B8SA 1PXGA 3GE7A 3VX1A 3W01A 3WUBA 4MWAC 1F8MA 1R86A 5CBIA 4JKLA 4QRNA 1O5KA 2HE8A 4HSNA 5C54A 3HQNA 1JUEA 1JCYA 1C29A 3MTWA 4X9YA 4PR4A 3LS9A 1GOOA 1DWHM 3M44A 2CC0A 3KWSA 1JNTA 5FAGA 1GONA 2QV5A 1MW3A 3GXMA 3GXPA 3PRDA 2F38A 4PCPA 1MUWA 4ERAA 3LN3A 4I5RA 3UJ2A 3SN1A 4HTBA 3AS1A 4Z2KA 3GD6A 3ARRA 3HPSA 3WQ6A 2GVYA 2QUNA 3C86A 3EX2A 2W67A 1VBUA 3VDCA 1WDDA 4IICA 2NVDA 2P4VA 3ARQA 4ZENA 4H00A 4NXKA 3D47A 2Z1BA 4PRRA 1MWOA 4TNSA 4LAWA 3TCSA 4ODPA 2J27A 4BI7A 1KBLA 3ZOAA 2J9YA 1LL7A 2QPSA 4RL3A 2OQYA 4IIHA 4WJEA 1X98A 3AZRA 3P81A 3W71A 4DROA 1CLXA 3AUOA 1IYXA 3VGBA 2NV1A 1HKWA 4EACA 4ATWA 5LNSA 1CXLA 3BLPX 2MANA 2KFWA 5LGZA 5D9NA 4QE5A 2EO7A 3SIZA 1QI5A 4KEZA 1ZAIA 1AD1A 4K37A 3M7WA 4LAMA 5F4XA 3H2EA 5CPTA 1S39A 5E9XA 3N19B 1UWSA 1M53A 1RJRA 4PMRA 3JXVA 3ITOA 3GNPA 2ON3A 3GH4A 1NWTA 3AMKA 2OX4A 3WLMA 3TTQA 2VR4A 2XIBA 1JCLA 1JZ6A 1RZMA 7TIMA 1B4KA 1W3IA 3IJ6A 4AD2A 5KEZA 2J74A 4F4RA 2QDHA 3F4WA 4H7ZA 3HA1A 1XFBA 5JBDA 4I90A 4TIMA 1WDPA 1Q6CA 1DOSA 4J1OA 2IPFA 4H1ZA 3HMCA 3UR8A 1DJWA 4D6IA 1TIMA 3DFHA 1YDYA 2D3NA 2JF6A 3U5UA 1AJ2A 3FJLA 1E6ZA 1ELSA 3BH4A 3A4WA 2BZNA 1H61A 3CL7A 1S5WA 2HXTA 2YW4A 5D4YA 2V3EA 2PAJA 1IWBA 4JQ4A 5CJNA 3NQFA 4KF1A 1NDWA 3MBDA 2GSEA 3GBEA 2YA0A 2OYKA 7CGTA 3EYPA 1LRNA 3AAMA 3SADA 1GGOA 1SFTA 3W38A 2FHCA 1OG0A 4MNKA 3UWZA 3AWNA 1PINA 2YSWA 3A6OA 2V2CA 4NZJA 4P8XA 2HBVA 4MB1A 1ISZA 1S2WA 1EJTC 1FCVA 3BGJA 2VR2A 2QUMA 1G94A 1KM4A 3H54A 4P8VA 1L8NA 1PDYA 4JIHA 1NELA 3K5XA 4J3ZA 3VO0A 4QNWA 3MSRA 4CCZA 3L4UA 4M6PA 4IT4A 3H2OA 5GNYA 3O5FA 4U2YA 2V63A 2WHMA 1H2JA 2CLMA 4YVXA 4PUKA 2POTA 4J2PA 3NDZA 2UV8G 3NQGA 1OFDA 3PWGA 5FSDC 3GNXA 2PDJA 2R1KA 1EHAA 4TX6A 3KOWA 1NMVA 4IPLA 3THQA 3TH6A 1V5XA 1SM9A 1LUCB 2ITKA 5A8NA 4KCVA 1HJUA 1IR2A 3UY7A 2J88A 2VD9A 1H7OA 1RBLA 4IIFA 1MFUA 2GDUA 3HU7A 1FKTA 3B04A 4G6CA 4Q8QA 5IDZA 3CV6A 4W93A 4NJKA 1V0NA 4HNOA 4JY8A 5I6SA 1W9UA 1JRCA 2WHLA 2BV9A 4WEVX 1MI3A 4S39A 2V67A 2VO5A 2R6OA