1ZBKA

Recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3 like protein 1
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbkA01
3BAJA 5ECUA 3TOPA 3PZNA 4GO9A 3II1A 3L4ZA 3ZJKA 3VGDA 3GDBA 3VDAA 4FLRA 1E72M 3G6MA 1SR0A 1IZJA 4B3KA 2VMFA 5ABFB 4D6EA 3W25A 1GOMA 5EFFA 2DPEA 3VIGA 4J3SA 1MW0A 1KGXA 4P7RA 5JBEA 5CPSA 3GBDA 1VJZA 2GFTA 2VRKA 1OT2A 1ISWA 1GPFA 3MUY1 4LYRA 4BQ5A 4AD1A 1CEOA 1E3XA 1OSEA 1HX0A 3CUHA 4IM4A 1V3HA 1IT0A 5E09A 4ATDA 1JDAA 1EXPA 4JFVA 4DM1A 1JIBA 3VIMA 2ZUUA 4PMNA 2E8YA 1UHVA 3WD3A 2WVSA 1YHTA 3WQ8A 4P8XA 3BAWA 5BXSA 3AISA 3UR8A 5D4YA 3VPLA 1QI0A 4OBRA 3ARPA 1JZ2A 2V5DA 2Y2WA 3VGHA 3GXIA 3WH9A 2VCBA 2WVTA 1FHDA 4U5IA 1TZ7A 2ZX9A 2HVMA 3PN8A 1K9FA 1NQ6A 2EEXA 1K6AA 3POCA 1J9YA 2WXDM 3WQ6A 2GK1A 2UWFA 4M82A 4XV0A 2PWDA 3WUGA 3ZT7A 3BAKA 1V6UA 2J75A 7A3HA 4Q7NA 1B3VA 4N0RA 4P8WA 4CU8A 4AY1A 3RMEA 2PI6A 4M80A 4AZCA 1DTUA 1L0PA 4NI3A 2BVTA 4UCFA 2W5FA 3KL0A 1ZJBA 5BROA 1UH2A 2YL9A 2BY2A 3S6TA 5FCZA 5IHSA 2CXGA 1CZ1A 1JGIA 3IAPA 3VDCA 1KXTA 2XM2A 1FH8A 2Q8XA 3RDKA 4JFSA 2W63A 1GNXA 3VD3A 1FH9A 4IUGA 1E1FA 5A8NA 1VB9A 4PMVA 5IXEA 4UFIA 4B3LA 4W5ZA 3ZJ6A 1XH1A 4D6HA 1NARA 4A3YA 2W4XA 1OBAA 4CN1A 2DSKA 1KBBA 4AD0A 1Q6CA 3N12A 4HMDA 3MSGA 3K4AA 1LWJA 3SCTA 2YKKA 4J3WA 2WAGA 4W84A 3GNRA 3AHYA 4AZBA 2A3EA 1CLVA 5D9MA 1E3ZA 4B9YA 4BQ4A 1VF8A 2Y5EA 3CPUA 2VOTA 2D0GA 4WF7A 1KXQA 4GI6A 1C93A 4FF5A 5BXPA 5JBDA 3PZVA 1VEMA 3UG4A 4HMCA 3WH7A 3HN3A 1WDPA 2JALA 3WF1A 3M6DA 1UWTA 1NP0A 1QW9A 1OIMA 1CNVA 1UWQA 2VZTA 4H8HA 2VR4A 3PZMA 1KQZA 2EPOA 2TAAA 4ML4A 1JNDA 4WLCA 3W37A 1H0IA 4AIUA 4FK9A 4UZSA 3GBEA 3SCWA 2WHLA 2MANA 3K46A 1HKMA 1E6SM 2GSJA 1V3IA 4OJYA 1BLIA 3WEOA 3CO4A 1W2PA 1J01A 2BHYA 3UETA 2Y24A 3VINA 3VGBA 1WAWA 4UZUA 2QHAA 2IUZA 1V0LA 4OKDA 2XTKA 2E9LA 5D8ZA 4TOQA 2ZXBA 1VFMA 1BTCA 4D6IA 1YQ2A 3W26A 5BXRA 5DMYA 3WNKA 2WCSA 1HL9A 2ZIDA 3L4WA 1LJYA 1UD8A 5DFAA 1QNPA 2J79A 2WHMA 3WQ4A 1CIUA 1VFUA 4TX8A 4W88A 3U5UA 5ABGA 4ZE4A 3BMVA 1B1YA 1B3WA 3WQWA 4MB3A 3L4YA 1E5JA 1JYNA 2EPKX 2VT0A 3M07A 4AWEA 4R5EA 4F79A 2J8GA 2NT0A 5D9PA 4W5UA 7TAAA 1JF5A 1BQCA 2XPKA 4KWUA 3WUFA 1C7TA 4EAMA 1UOKA 3PTKA 2GUYA 4U2ZA 2A3BA 2WBGA 4AC1X 1H1NA 2ZUWA 2NSXA 1I1WA 4E8DA 5HPOA 2J62A 5A2AA 2WW5A 3SIMA 4GZIA 1W1VA 1BYAA 1HVXA 4UOQA 2PWEA 3GH7A 3AHTA 4F9JA 4TVCA 3ARWA 2WMGA 5A6SA 4V28A 4TTUA 1GW1A 5I6SA 3AHXA 1XCXA 3AHVA 3WMCA 2WSKA 1HJQA 1ZB5A 1U33A 3MSDA 4WJXA 2WWDA 1NOUA 3RIKA 3F5KA 3T09A 3VTRA 1K9EA 5CLTA 3SCUA 4P7OA 1C3FA 4ZXLA 3NSNA 1ISZA 1QHOA 4OBSA 2A3AA 5I3DA 1KWGA 4PTWA 2ZX8A 2GJXA 2JEQA 4CCCA 4TVUA 1NWRA 2VVSA 2VURA 4HA3A 4S3KA 4X0NA 5E0FA 2XGBA 4BZYA 3BSGA 4P8VA 2DEPA 4GZJA 3CHDA 3WMSA 1TVPA 1JD7A 1V0KA 4NSBA 2J7EA 1KCKA 2JE8A 2CCRA 2J7BA 4CU7A 3WF3A 1JZ7A 1QNRA 3B9AA 2BXZA 3CZJA 1PBGA 3I3DA 2QMJA 1V3LA 3MS8A 4ATWA 4CVWA 1JZ5A 1HJVA 3ZIZA 4B9ZA 1UKOA 1V02E 4PSRA 4TVDA 4KGLA 4W89A 2OSYA 2CHOA 2OYKA 4FLOA 1XYZA 1H5VA 1E6PA 3BGAA 3VIPA 4OZOA 3CUIA 1M01A 3DC0A 3D3AA 3BMWA 3ARZA 3WDPP 1NWSA 4V27A 2VR5A 1FP9A 3WEMA 1UQYA 4MNKA 1BF2A 1JXJA 1V0MA 4MDPA 2VQUA 1FHLA 1TR1A 2XJ7A 1NWTA 4HZ6A 2GJRA 4W7UA 5HPCA 3GXFA 2XWDA 3VNYA 3UCQA 3OBAA 1DEDA 3VMOA 2CKSA 2UY4A 4D6GA 1D2KA 1BFNA 2DT3A 2V3DA 2DT1A 1U30A 2ZUSA 2XHYA 3WMBA 2XYLA 3K4DA 3NCOA 1PX3A 3S2CA 3VO0A 3GXMA 3IJ9A 4S3JA 3W53A 3KEHA 2CERA 3QHMA 4MAVA 3GM8A 4JL1A 3N13A 1RH9A 4PMUA 3ZT5A 4HOWA 3HMCA 3F5LA 3AS3A 1MXGA 1W9UA 2YLLA 3VIKA 3N9KA 1TUXA 4EANA 2W67A 1CGVA 4MB1A 1KBKA 3AI0A 2C8NA 3BC9A 5HNNA 4AZCB 3LPPA 4RL3A 2EO7A 4UR9A 2VNCA 3LPOA 3ARXA 1SYTA 1EQCA 4P7LA 1ESWA 1QI2A 1K9DA 1HIZA 1C91A 3M46A 1XHGA 4JFWA 4PBGA 2QPUA 4ZFMA 4TXEA 3RO8A 2VX6A 3W6LA 2WCGA 3F5JA 1HJWA 1B3XA 4J28A 1PEZA 3AYRA 4BA0A 5JBFA 1CGYA 1MW2A 3ZR5A 3MMDA 1M7XA 1FA2A 3WNNA 3MV11 2ZX7A 1MFVA 1ZBVA 1CLXA 4D71A 1HP5A 2XFYA 2VRJA 3WH8A 3WD0A 2X8RA 2O92A 2WVVA 3IANA 1WO2A 3POHA 1ODZA 3AIBA 3T0BA 3WD1A 5CGTA 1CBGA 1DWIM 3WN6A 5JIPA 3SCSA 4UQ9A 2X0YA 4CN4A 4QLJA 3SUSA 1EDQA 5IDIA 2WC7A 4C7DA 2O9PA 1E1EA 2PF0A 4MB5A 1AVAA 5LA2A 1GQKA 1VEOA 1BPLB 4PMYA 1DP0A 1HP4A 1HN1A 2V3GA 1GUVA 3W82A 1QI5A 6A3HA 1GVIA 3LMYA 4MPKA 3OGSA 4KMQA 3EDJA 5EB8A 2CEQA 2RGMA 3ARRA 2ZUTA 1LL7A 1H3GA 1PJ9A 3RJYA 4CCDA 2EPMX 3VGFA 5CJ5A 5CQ1A 4PUEA 1CXHA 3WDIA 3OZOA 3FAXA 3ZM8A 1DWGM 2E9MA 2V3EA 3FHAA 4D6CA 5E6YA 2J4GA 1J18A 3L2MA 1NWUA 3RJXA 5CGMA 4JFUA 2Y8KA 4LX4A 4U5KA 1W3JA 1UKSA 4H04A 5EBAA 4M1RA 2VZSA 3PZOA 2EQDA 3TP4A 3VU2A 1V6VA 2XIBA 3E1F1 3AIVA 4CU6A 1W1PA 3CUGA 5F7UA 4NRRA 1C8QA 2G4FA 2WMFA 2ZUMA 1QNSA 1GJUA 1XRVA 1W9DM 1L8NA 3ARSA 9CGTA 2CITA 5A8MA 5DT5A 1EH9A 1O6IA 2XUCA 1UZ4A 2YDQA 2VX5A 5A2CA 2Z1SA 2PB1A 2XWEA 1MWOA 1KGUA 5A6MA 1M04A 1UH4A 3AYSA 4JAWA 1UD6A 4OOZA 3ZMRA 4WKAA 1XH2A 2YL6A 2Y8VA 5DO8A 2DQXA 4D6DA 4JCMA 3WQVA 1JNEA 3QOKA 5HOSA 3VD7A 3ARUA 2XVNA 3IK2A 3TTOA 3WF4A 3TTSA 2YBUA 5I5RA 4QP0A 5BWFA 5CPQA 2YIHA 1UQZA 2OWXA 2VZUA 4ZEPA 4P7NA 2BVDA 2VX4A 4MADA 3O6AA 1LL4A 1XD0A 2ZUVA 2G3NA 2V3FA 2J47A 5KZ6A 3AZRA 2RGLA 3QGVA 4E2OA 1M53A 1UR8A 1J0IA 3QHOA 5FIPA 3PZQA 1H41A 1NOWA 1QW8A 2WZHA 1CGWA 4X0VA 1ITXA 1W3LA 1LG2A 2DIEA 5ABFA 1G9HA 2GJXB 1HL8A 1QPKA 5BCAA 1UWSA 2WC3A 3SCRA 4HU8A 4H41A 2D0FA 1B90A 3VIFA 4J27A 1LWHA 2YOCA 3O2LA 4MNLA 4L4PA 5E0CA 2JF7A 3W24A 3ARYA 1DHKA 1D7FA 2G3IA 3FN9A 2X0HA 3MANA 4JKLA 4UOZA 1XSJA 3VM5A 1GOKA 2VC9A 3MUZ1 1FP8A 2G8ZA 2X1IA 3VGGA 1XGZA 4HZ8A 3DECA 2XFFA 5HDRA 4HOXA 1HKJA 1OWQA 4URIA 3GYCA 3ALFA 2VRQA 1B31A 4UFMA 4LYQA 1UH3A 2ESCA 1VIWA 1AQMA 5LYRA 5GPRA 3BAYA 3AFBA 2G3MA 4KRTA 4PEEA 1V6WA 3NUKA 1RPKA 3U7BA 3WL0A 2BY1A 5CG0A 1J0YA 1E70M 3AXXA 4W7WA 2J74A 1HJSA 3I3EA 3TA9A 2WPGA 3AMDA 1X1NA 2QPSA 4U3AA 2CKRA 3LPGA 4UOJA 5JUVA 2J7DA 4J3VA 1UD5A 1E6XM 5GQBA 1E71M 5BRQA 4PSPA 2ZXAA 1KGWA 4Z2GA 1J12A 1EDTA 1OGSA 3MUIA 5C8BB 3ZJ8A 1EO7A 4HPHA 1E56A 1CTNA 3GH4A 3OLGA 1R86A 4W85A 3T2PA 3WDHA 3DYPA 5CZKA 5FL0A 1J0KA 2VJXA 4XUYA 4JHOA 5FL1A 2BHUA 4Z2IA 2J77A 3WQ5A 4JZ5A 3EDDA 3VD9A 4AISA 1VAHA 2GK1B 1BGAA 5I23A 5A1AA 4AEEA 1MW3A 3AMLA 3ZO9A 4AZ7A 1F4AA 3AMCA 1E4LA 2VQTA 1DWFM 3AOFA 3WL1A 1V3MA 1FOBA 3AMGA 3T0DA 3VOCA 5DT7A 5A2BA 1HJXA 5ABHA 2CHNA 3T2QA 3VDBA 3GTNA 2E0PA 4JHZA 1UZ1A 2J7CA 1DWJM 4CD7A 1E43A 1HT6A 1W1YA 2UY2A 1BSIA 2ZWZA 4M81A 4HA1A 5D9OA 3VD4A 1KXHA 3AICA 4OUEA 4C7GA 4FLQA 1QBBA 1W9BM 1P6WA 1WCGA 3PZ9A 2DSZA 2JIEA 1M03A 2DGAA 2XSBA 1VJSA 4MDOA 2D1ZA 2FHCA 1ODUA 1HJUA 4Z2KA 3PTMA 3VDHA 1ZS2A 3MKKA 1KB3A 5E9AA 3WIJA 1E5NA 1BVNP 3K8LA 1QI3A 5AC4A 2XVGA 2JF6A 4TTGA 4M8UA 2VTFA 3OLEA 1WDRA 1EQPA 4ACZA 1TVNA 4W87A 1R7AA 1B30A 2VCCA 3OIHA 4CN6A 1AQ0A 2D23A 1UR4A 4F9DA 3SCOA 1N82A 1E6RA 1UYQA 3SCVA 3VMNA 1R85A 4Z2JA 4BS0A 3OG2A 3CZGA 4TUFA 3A6OA 3NDZA 2YL5A 1UWRA 4ZE5A 4CKQA 1J0ZA 4YPJA 1E4IA 3M7SA 1C7SA 2PBGA 3KL3A 1RP9A 3ZOAA 2X05A 3AS2A 4C7FA 2YDRA 1MYRA 1KCLA 3CHCA 3VVGA 2CNCA 1B2YA 1LG1A 1SMDA 2W91A 2CBUA 1MXDA 3CMGA 1KWKA 1BG4A 2NT1A 5A6AA 1FH7A 1EGZA 1MQRA 1XV8A 2O9OA 1CGXA 1QVBA 5LA0A 2ZE0A 5JIWA 4GO8A 1CDGA 2VVNA 3VIJA 3AIWA 3O9NA 1UR1A 1NOFA 4AZ5A 2YA0A 2W92A 2F8QA 1EHNA 3AIRA 1G01A 3EMCA 1JFXA 5A6JA 4DUXA 2ZXQA 5E70A 3T2OA 2UY5A 1UD4A 1BAGA 4W8BA 3GH5A 3SURA 1UUQA 2QF8A 1CYGA 1GQIA 4DUWA 3EYPA 5LA1A 3UG5A 4EE9A 2DSVA 3SEPA 3HU7A 3CTTA 2D20A 1J11A 1E6QM 1JI2A 5ABEA 2XSAA 1ISVA 2J7GA 2OYMA 3A4AA 4U2YA 1JYVA 4JL2A 1XSKA 3T08A 3BSHA 3ZJ7A 4DWSB 2VL4A 3WFZA 3UR7A 3F4VA 5A69A 3AZTA 4H8VA 4U3CA 3BAIA 2ZX5A 4GPNA 3K8KA 5CPTA 4KGJA 1HKKA 3WUEA 1CECA 1W3KA 1XYFA 3OA5A 3OB8A 1US2A 4YN5A 4UTFA 2PWFA 3IJ8A 1BYCA 1OCQA 3WF2A 4XZBA 2JFEX 2FH8A 3AXHA 1H2JA 3AIUA 4ATLA 3OZPA 3CMJA 1BVZA 4HTYA 1TA3B 3VX0A 1JDDA 4AZHA 5FD0A 1PX4A 1TMQA 4BQ3A 3N11A 3T0AA 4M56A 1GOWA 4PYSA 2Y4SA 2GDUA 2WMIB 3WELA 5AYBA 4AD5A 1B3ZA 1SMAA 3WDQA 3VILA 4AXNA 4UQBA 4R27A 1WZAA 2QMKA 3ARQA 4Q22A 2NW0A 2F61A 5I2UA 5EFDA 1FFQA 1UD2A 4RE2A 4ZXOA 3WNOA 5HXMA 2YL8A 3L4XA 3AS1A 1C8YA 1V3JA 3DYMA 5GNYA 2J7HA 5D9NA 1UR0A 3WENA 4AD3A 1E4MM 2DH2A 4HA4A 3QOMA 1IZKA 1H49A 3CHFA 1V6XA 3MV01 4QCEA 2V38A 3W27A 4GXPA 4B15A 4HMEA 1MQPA 3DHUA 2WM0A 1U2YA 5DEZA 3B8SA 1UKQA 1RD6A 5KEZA 3PZGA 4AZ6A 2AAAA 2XVKA 4H8UA 1ISYA 1AQHA 2ZXDA 1J0JA 1W9PA 4CD8A 1UG6A 4W8AA 4D1IA 4A3HA 3K1DA 6TAAA 2BNJA 1NH6A 3L4TA 1E6NA 4PMDA 1WDSA 3QHNA 3A4XA 4MAZA 1BHGA 1H11A 4EKJA 1CXFA 5A6BA 1WE5A 1OGGA 2E4TA 4RE3A 1BGGA 2EPLX 2PWHA 3MMWA 3ECQA 5CXPA 1R87A 3OGRA 1GQJA 4W93A 2CETA 4K68A 2J8FA 1G5AA 1CWYA 4H2CA 1NP2A 4NZCA 3PTQA 3NJ3A 1QBAA 2FHFA 1JG9A 1WNOA 3SUWA 3VUPA 2WB5A 1W32A 4UQAA 5A6BD 2WSPA 1UR9A 5IFPA 4UQCA 5EMYA 1ZBWA 5CLWA 3W29A 2WWCA 2BFGA 4QLKA 1OIFA 2CIPA 1V08A 1GVYA 3WKZA 1JL8A 2D24A 4N42A 4XB3A 3BCFA 2DH3A 5A95A 1I75A 3WD2A 1US3A 1A47A 4PMXA 2WKLA 1XC6A 3ZT6A 3RM8A 5AC5A 3PZUA 1J10A 3N17A 4JIEA 2G3JA 4ACZB 5FOOA 3ZSTA 1ZL1A 1CXLA 3PZIA 1JZ4A 1ISXA 1X6LA 4MTVA 3D5HA 3WH5A 8A3HA 3AXIA 1J0HA 4EK7A 4A4AA 1SFSA 1JD9A 1S46A 2WLZA 1CXEA 1MQQA 1E15A 2FH6A 1CXKA 3RM4A 4J3XA 2DDXA 1W1TA 1V6YA 1UA3A 1D3CA 2IXUA 3EMZA 3WD4A 3GNOA 3VIOA 1H09A 2V5CA 1EA9C 4HU0A 4WK9A 2E9BA 3UESA 3AS0A 2BS9A 3GXDA 2WK2A 2ZUNA 3U7VA 2EBNA 1XH0A 3TTQA 1GCYA 1E40A 1WB0A 2WMJA 1XD1A 1LLOA 3G6LA 1IV8A 3KZSA 2Z1KA 1TCMA 1OINA 3W81A 3SCPA 3THCA 2E40A 1FFRA 2VCAA 2VO5A 2WMHA 2OYLA 4PMOA 1QOXA 3MUAA 2BXYA 3OLIA 2YBTA 5A8OA 3W6MA 1Q6FA 3GZAA 3APGA 1JF6A 1PX8A 5A6KA 2O9RA 4E8CA 4W8LA 1JDCA 4HPGA 2CYGA 2OSWA 1JZ8A 4QAWA 2J7FA 3SUVA 2DT2A 4BCEA 1V3KA 3WBEA 2CESA 4QFUA 2WVVB 3EBVA 3VD5A 2OWWA 3CGTA 4GQQA 2CBVA 1Q6GA 1JAEA 3AIQA 3NSMA 3A3HA 3W38A 5AY7A 5IFTA 1PZ2A 3IJ7A 2OLHA 1HXJA 3LPFA 5CSUA 1JYXA 2PWGA 3CUFA 3WEZA 1QNQA 1CGUA 4KH2A 1R7OA 5D8WA 2GVYA 2FHBA 2BV9A 3CIVA 1JZ3A 5BXTA 1OT1A 2E8ZA 4IPLA 1W9VA 1H4PA 2J78A 4AMCA 2AOSA 1JZ6A 5FKYA 4M24A 2WMKA 2F2HA 4LPCA 5BYWA 2BVYA 4KRUA 4WIWA 3J7HA 3ZR6A 4UQEA 2ZICA 4PMRA 4WKHA 4PTXA 3UG3A 1HNYA 3ARVA 2GDVA 4PCSA 4J7RA 1GOIA 2D22A 3KWXA 4OIFA 3L4UA 1MFUA 1I1XA 5IHRA 4P7QA 3AMKA 2PBOA 3DYOA 3JUGA 1E6ZA 2FGLA 1E0XA 2XIIA 2A3CA 4GI9A 3CZEA 2VZOA 4WKFA 1O7AA 2W66A 4DWSA 1EHAA 5A94A 3W4RA 3AJ7A 3RPMA 1WZKA 3BAXA 1C8XA 3EDKA 3N15A 3TTYA 1WKYA 3KL5A 4J3TA 3VIIA 5M17A 4LYPA 1ZBKA 1GOOA 2D3NA 1QI4A 1F4HA 3SUUA 4HOZA 1LL6A 5HBFA 1BYBA 3I3BA 2DSWA 1X6NA 1UR2A 1KR1A 2W62A 1G94A 3CZKA 3CZ8A 3HJEA 1Q6EA 1V03A 2YA2A 4CD5A 4ZENA 4WSKA 3OLDA 3KE0A 1VFOA 1VENA 3WBAA 2XG9A 3UEQA 4CGTA 4GINA 4V2XA 3EDFA 1KQYA 3EMQA 4JFTA 4QLLA 3VX1A 5JH8A 4P8UA 1ECEA 2C0HA 1C92A 3AROA 2YLAA 3SCNA 3AHZA 1EOMA 4GQRA 3THDA 2CBJA 3BH4A 1TFVA 1XSIA 2ZOXA 4UFJA 1JYWA 1H0GA 5DF0A 2X2YA 1KFWA 1BYDA 1ZJAA 4MB4A 3SCQA 1HKIA 2G41A 1UWIA 1JAKA 1TE1A 3ALGA 4U31A 1GZJA 4W86A 1Q6DA 3VIHA 1LQ0A 2WHJA 2DT0A 4DWSC 4HZ7A 3ZQ9A 1CPUA 1ITCA 1PIGA 1VRXA 5E6ZA 4E4PA 5I24A 4B16A 3FAWA 4LQ1A 3NYDA 4GIAA 4CVUA 1CXIA 1JXKA 3NSXA 5M3WA 1EOKA 2WANA 4Y7EA 3N04A 5I0DA 1E4NA 1WZLA 1VFFA 4D1JA 1CENA 1QNOA 1GHSA 2DIJA 1K9TA 3FXYA 1VBRA 1EO5A 1QHPA 3CUJA 1C90A 3WUBA 3BCDA 2WC4A 4DM2A 1VEPA 4AD4A 4PTVA 2VZVA 5C71A 4BF7A 3WNLA 4JCLA 3B9EA 2E3ZA 4CCEA 1GOQA 1G1YA 1PZ3A 2VX7A 1WP6A 1DWAM 3NIYA 4YHGA 4X9YA 3MO4A 2WKGA 3W0KA 4F8XA 1GORA 1UKTA 4D72A 4CUCA 4UFKA 3IAQA 2BY0A 4J3UA 3WDJA 1E55A 2HISA 5TD4A 3WH6A 3VM7A 2WCAA 4PMZA 4PCTA 1WZMA 3OGVA 6CGTA 4GKLA 4CD4A 1PIFA 5A6LA 1GHRA 4LGXA 4MJ4A 3WF0A 4H7VA 2WMIA 2VI0A 1UD3A 4PMQA 5A8QA 2D2OA 4IPNB 1W2VA 2YA1A 1E0WA 2WYSA 1BG9A 2WNWA 4HP5A 1W91A 5A3HA 3N18A 2ZWYA 2EXOA 1LF1A 1UA7A 3N1AA 3VKKA 3A47A 1DWHM 4JKKA 1G0CA 2IXVA 3WFLA 4AD2A 1OD0A 1R8LA 3UERA 2JEPA 2JIWA 2EPNA 3RILA 3WNPA 3AQUA 3MU7A 2A3HA 4PTMA 3BLKA 1UWUA 2BHZA 2ZX6A 2FDMA 1E73M 3AZSA 1CGTA 5C70A 3TONA 2WVUA 3L4VA 3U57A 4IISA 3BXWA 2PC8A 3RCNA 2BY3A 1B0IA 1B9ZA 3RM9A 2W61A 4AZIA 4D6FA 4GZEA 4QCFA 2WHKA 4AIOA 1ZBCA 4RE4A 2J25A 3PHAA 4MNJA 3VGEA 1PPIA 8CGTA 3CHEA 1EIBA 1Y7VA 4QDMA 2XM1A 4L4OA 3A4WA 2QLYA 2YDSA 1V02A 2WLYA 4CD6A 4AZGA 7CGTA 1WPCA 5I78A 2OWCA 3MMUA 2AMGA 4UFLA 1VBUA 4AYSA 3WDRA 4Z2LA 1TG7A 1XCWA 1MW1A 4FLSA 1B3YA 2C7FA 4AIEA 4Z2HA 3FNDA 5I77A 4BQ2A 2UY3A 3FY1A 3AIEA 1MVYA 1GQLA 3ARTA 2CPUA 1KXVA 4XX6A 1OB0A 1RP8A 2GJPA 1GJWA 1Z32X 1PAMA 3GNPA 3FHQA 1QHZA 4FMVA 1A3HA 1KR0A 4TX6A 3L2LA 3SUTA 1W3HA 3CZLA 5M03A 1E0VA 2B31A 3K8MA 3VNZA 5BRPA 5AYIA 4GI8A 4ACYA 4DUVA 2XVPA 4UFHA 2D0HA 1AMYA 1UKPA 4F66A 3EDEA 3PBGA 2X09A 1Q4NX 4YHEA 1OD8A 4PN2A 3ZSSA 2DSUA 5GNZA 5I79A 4AEFA 4XZWA 1EDGA 4DWSD 2CBIA 1OM0A 1WDQA 2O9TA 1TA3A 3BLPX 2D3LA 1E9LA 3CLWA 1ZU8A 4UNIA 1HF6A 1OGBA 3B9DA 5CSYA 1NM9A 4AW7A 4LXFA 3CBWA 1HVQA 4M29A 3WNMA 3PZTA 4UQDA 2FGZA 5A8PA 4PRWA 4OOUA 4D6JA 3WY1A 3DHPA 4NRSA 3FW6A 2WBKA 3WSUA 4W7VA 5M5DA 2OSXA 3W28A 3NDYA 2XFRA 3U5YA 4MNMA 2WZIA 4MJ2A 2EJ1A 1W9XA 3VMPA 5GNXA 1V0NA 2XGIA 2YJQA 2XVLA 3CH9A 1GONA 4WSJA 4NF7A 3QR3A 1JI1A 2WZEA 4U33A 1JFHA 2QV4A 2VUYA 4PUDA 4JKMA
chains in the Genus database with same CATH superfamily
1P7TA 4JIHA 3TOPA 3KM8A 3PZNA 4GO9A 2CWXA 3T4WA 3ZJKA 4GIEA 3O5KA 3B4YA 3P8JA 3KDOA 1E72M 3VZXA 2NUWA 1Z44A 1B4KA 1FWIC 1J4RA 2VMFA 3JU2A 4D6EA 5EFFA 5GPGA 4AWTA 3R79A 3KVJA 1YNQA 2C14A 1ZFJA 3PBWA 1OT2A 1HKWA 3FCPA 4QGCA 3O5PA 3CUZA 4L64A 1TTIA 1EC8A 3VKDA 4AHQA 1UROA 3C4UA 1HX0A 4GJJA 2VC5A 4GC3A 1AH4A 4M51A 5IBXA 1XLAA 2PGEA 2Y78A 1JIBA 1XG4A 1KCXA 1FDJA 1XIJA 2Z24A 2ZUUA 1YHTA 3FA5A 3HFYA 3G1SA 2WZMA 4K7YA 3DZ1A 4WGHA 5I98A 2AQVA 1PKLA 3GXPA 1O5KA 3U4FA 3E0FA 1TKKA 3VGHA 1W5MA 2R1PA 3WH9A 3KP1A 3NURA 2VC6A 3TWAA 5BU9A 1PTAA 2ZX9A 2EEXA 2NQLA 2GK1A 4M82A 2EG6A 4HA0A 4YWSA 3LEPA 3WUGA 4G6CA 4B5TA 1B3VA 4YYFA 2DZXA 3KFTA 1XUUA 3LM3A 4N0RA 5B80A 4CU8A 3RMEA 5F1UA 3E5PA 2PI6A 2PDPA 3NZRA 3TN5A 2VWSA 1L0PA 4NI3A 2QDDA 4HYRA 2NQ5A 4MHBA 2W5FA 3TMLA 3W3OA 2XP9A 5FCZA 1KKRA 5BOFA 3ABRA 4H9UA 1KXTA 3T7VA 5CJMA 3U2CA 2GUBA 1GNXA 3VD3A 2Y0FA 4IUGA 2A79A 3W2KA 3OODA 2J27A 3IIXA 1VB9A 2XINA 5IXEA 3N2XA 4UFIA 1A3XA 1P48A 3VNDA 3ZJ6A 2MUCA 2R1KA 4CN1A 1YADA 1KBBA 3LS9A 3QPYA 2I5QA 1ZRQA 3N12A 4HMDA 3MSGA 4HNUA 2YKKA 2F6KA 3QY7A 4EP8C 4AHOA 3AHYA 4AZBA 1CLVA 4H9TA 3LZ3A 3H2CA 3MCNA 1XDJA 2Y5EA 4EX4A 1TTJA 4YTRA 2D0GA 1IIGA 1KXQA 1TQJA 4GI6A 2BGSA 2DJLA 3PZVA 1V51A 1VEMA 3UG4A 2JALA 1NP0A 3PFRA 4AX7A 3S4TA 4H7ZA 3HIJA 3QXBA 1CNVA 1J2WA 4CNTA 4EXAA 4IMDA 4ML4A 4G7EB 5C9ZA 3R0KA 3M0ZA 3NG3A 2OVLA 2PDUA 2J9XA 2CLPA 1O66A 3BO9A 4DRSA 1RZMA 2MANA 2GSJA 3BW4A 2ITKA 1V3IA 1BLIA 1VLIA 3CO4A 4A6GA 1J01A 2VFDA 4HN8A 3KBJA 3VGBA 1FKXA 1GYLA 4UZUA 3ATZA 1DJWA 1V0LA 4OKDA 2PAJA 5HW6A 1R5YA 5D8ZA 2PC4A 2QCDB 1RA0A 3N2CA 2FZNA 1BTCA 4LYKA 3KABA 1PWMA 5DMYA 3QC0A 2WCSA 2Y5JA 5G2HA 1HL9A 2ZIDA 1LJYA 2PZNA 2FVLA 3W1RA 2J79A 3E74A 3M16A 2JGYA 4W88A 5B7YA 1ENUA 5ABGA 1XIIA 2H9AB 1B1YA 2YB4A 4MB3A 3E12A 4ZO6A 1GVQA 3M07A 2Z1WA 2EF9A 1VIZA 1FQ0A 2BGNE 3OZYA 5HMDA 1LT7A 5D9PA 2GVEA 3NQBA 1E0TA 2R1NA 1PUDA 1FHVA 1ME9A 5G4EA 3H2EA 5H8UA 3SQLA 4ZVJA 3STEA 4EAMA 5JMUA 1UOKA 1XYAA 3PTKA 3RGTA 1KTCA 3C2EA 3VKCA 3N14A 3HV9A 1K03A 3BPWA 4KCVA 1TV3A 2RUSA 3MUCA 5EA9A 2WW5A 5A2AA 2TYSA 3COTA 1BYAA 3ANVA 5EPDA 1PINA 3AHTA 2ZVIA 3KWSA 5A6SA 4V1XA 3AHXA 3WMCA 4E2VA 5TF0A 2WSKA 1HJQA 3BVJA 3MSDA 1AJ0A 1NOUA 3RIKA 3VTRA 4JFJA 4PCPA 2ZDSA 3SCUA 1IWPA 3IARA 1ISZA 1OF6A 5E9XA 4PUWA 1NAL1 2DZUA 3IVSA 1XP3A 2JEQA 4CCCA 5C5YA 4Q32A 3L0KA 4HA3A 4LFYA 4ZQCA 2QGHA 2XGBA 2YW4A 4JEQA 3BSGA 4NQ1A 4P8VA 3S8HA 1UBSA 2EAWA 2PGFA 5DRCA 4NSBA 1KRMA 4O52A 3FSUA 2ABAA 3UQBA 3STPA 2CCRA 2J7BA 3KZPA 4EF9A 1XPYA 3I3DA 2QMJA 1V3LA 2IF4A 3GX9A 5C9XA 1HJVA 2JKEA 2ALDA 4PSRA 4TVDA 3SR7A 1SR9A 1OFQA 3BGAA 1SO4A 3D3AA 3JW7A 3ARZA 6ALDA 1BKSA 2Q09A 7TIMA 1FP9A 4ODMA 2XH2A 4N4QA 3VAVA 3MY9A 1V0MA 1TJRA 1YE4A 4IIFA 4PB3A 4MDPA 1XLCA 4TQTA 2XJ7A 4HZ6A 3FJ4A 3TK7A 3GXFA 1YTEA 3VMOA 5HNRA 4R9OA 4JIPA 3PY2A 2DT1A 2XHYA 1RCOB 3K4DA 5T91A 3WG6A 3S2CA 1RJRA 3VO0A 1EA0A 2V2HA 1D6OA 3W7IA 3W53A 4EXQA 1XKYA 3U2ZA 3N13A 1SJCA 2VM8A 3GTHA 1V7YA 3GE7A 3BDKA 4PMUA 3ZT5A 3AS3A 1W1B1 1FTXA 4C6CA 2OT0A 4LTSA 2C8NA 5HNNA 1TWWA 3LCXA 1IXQA 3H7UA 2YYUA 1Q85A 1X7IA 3W2LA 3GVVA 2GVJA 1NMWA 1C91A 3C61A 3GSMA 1XRTA 4ZB0A 1XHGA 3FDKA 2BG5A 3H12A 4EPKA 3MP5A 4LANA 3R8RA 2VX6A 4F0RA 3NL3A 4YS1A 4HPNA 2AAMA 1RBLA 1Q6UA 1B3XA 4J28A 1V7AA 4L4LA 2J9ZA 3ZR5A 3MMDA 3MV11 1MFVA 1ZBVA 3QRHA 4D71A 2VXNA 4DRMA 1HP5A 3DFQA 1JCYA 1ICQA 2VRJA 2PWUA 3WD0A 4LAUA 3IANA 3MQTA 1WO2A 3G8RA 4HMNA 3T0BA 5CGTA 1YXCA 4HSHA 1W8GA 4AYGA 1XDLA 3SCSA 3SUSA 1HXVA 4E0CA 3R94A 1EDQA 1MUMA 4A8RA 4Z0JA 4S3CA 2PF0A 4MB5A 3U0HA 1K4HA 3M5XA 1NF0A 1VEOA 2V3GA 3UWUA 1KM5A 3SRKA 5J04A 2CEQA 2RGMA 3ARRA 5G2WA 3MWAA 3ORWA 5FACA 3W1MA 1H3GA 3GVQA 4CCDA 3SFKA 1GZGA 3TYUA 2ZC1A 1WXZA 3S9ZA 3E6EA 1CXHA 3OZOA 3RX4A 3I68A 2PDHA 3FAXA 3ZM8A 1FWAC 1DWGM 1YW5A 5HT1A 1K70A 3FHAA 4D6CA 1W26A 2QV5A 4A3RA 1J18A 4AVNA 1I6NA 5DMMA 1AMKA 3QSTA 4J9JA 4LX4A 4CEXC 1UKSA 2DZTA 3CQKA 4LVBA 5MKGA 3PZOA 3OOBA 1AZ1A 1EB3A 3TP4A 3QPEA 4JQ4A 1EKOA 3LQGA 4QX4A 3KOXA 3O7UA 3GLCA 1ZJIA 1TO3A 5CCZA 4ZPWR 1K8YA 1GJUA 1NU5A 1L8NA 1D8CA 3ONCA 3UF8A 2H3DA 9CGTA 4IGNA 5DT5A 5HW8A 3SSZA 3S2JA 1UZ4A 1YXYA 4M5PA 5A2CA 5EGRA 5CAHA 2XWEA 1ICPA 1MWOA 1Q7ZA 3WK0A 1LORA 1P5QA 1M04A 3CU2A 3VCCA 4JAWA 5LHEA 3ZMRA 5LNRA 1QPRA 2Y8VA 4LUJA 1XUZA 3NQ8A 3B3DA 4JCMA 1XJBA 6REQB 3QH2A 3PAJA 3QOKA 5GJMA 4FAMA 3ARUA 4GFSA 3UPMA 3IK2A 1FCQA 3TTOA 2YBUA 5BWFA 5CPQA 3A22A 5EMUA 4L9ZA 3MMTA 2BVDA 4MADA 4P7NA 1Q6RA 4N6EA 5CEWA 1XD0A 2G3NA 3MT1A 4GXWA 4UTMA 3S46A 1OX6A 3QHOA 3I4KA 2WZHA 1DIEA 3LCWA 1QATA 3I7QA 4FNRA 1ITXA 1WDDA 1W3LA 4O16A 1XM3A 4DX3A 3IGSA 4DXKA 2HWGA 2DU2A 4JGDA 1KBJA 1I9CB 3C52A 3VIFA 1LWHA 1SO6A 2X1TA 4RK8A 1N7KA 4NJIA 5RUBA 3O2LA 4R7JA 1VHNA 4WJ8A 1G6CA 3C8NA 2PCEA 4RNFA 3RFWA 2O4QA 1EC7A 3RLHA 3EEGA 5AYXA 4UOZA 1XSJA 3VM5A 1FP8A 1WYIA 2X1IA 3H55A 1XBXA 1XGZA 3DECA 4L1GA 2XFFA 4IQDA 4JTDA 4HOXA 2XH4A 4TV6A 1S3TC 4LYQA 4HPJA 3PUEA 3E49A 3WJSA 3PWAA 4MFEA 1KCZA 3WJZA 4NYYA 4PEEA 3HV8A 4A29A 5IOBA 2F2DA 1BVWA 3U7BA 1K1DA 3EX3A 4Q4QA 4HN4A 3BMXA 4HHMA 1QTWA 2J74A 4WDTA 3I3EA 1R3YA 1T8QA 1KD0A 3ONBA 2J7DA 5CBIA 4FX7A 2OO6A 2VN1A 1E6XM 3GQYA 3DG3A 3DDMA 2ZXAA 1KGWA 1VCVA 2TODA 1OGSA 5C8BB 2GGJA 3N9SA 3N3TA 4UTWA 4NXKA 3B97A 4Z17A 3WDHA 4MY9A 4DNMA 5FL0A 3KCEA 3R10A 3LTPA 3PNZA 4XUYA 3KOZA 2MPHA 5FL1A 2J77A 1KFKA 4PCFA 4L65A 1HG3A 4C6BA 2CLEA 1KM1A 2P4VA 4DUOA 4Q8NA 2GK1B 2E7FA 2PRMA 3ZO9A 3ZVIA 1YLVA 3CWNA 1MNZA 1VJIA 4DLMA 3VZYA 1ZPTA 1KA9F 3AMGA 3CC1A 3T0DA 5DT7A 3UVIA 4S3FA 1ZCNA 5A2BA 1MO0A 3CEPA 4B4FA 3VDBA 1W5QA 3SQMA 1GK8A 2F6XA 1IHIA 4JHZA 3LV6A 2AQOA 1DWJM 4CD7A 1HT6A 1OC7A 3SRHA 1NIUA 5D9OA 4ZA0A 4OUEA 1JCNA 4G2DA 4FLQA 1W9BM 5DIUA 5CPMA 1MI3A 4UUIA 2G95A 4RNIA 1YKWA 4RNHA 4KQZA 3M6YA 4N19A 3WIJA 3NM3A 1B6CA 2JF6A 3D47A 4YXGA 2R91A 3DGBA 4M8UA 2VTFA 3PUGA 4US5A 1WDRA 5E93A 2VCCA 3OIHA 4UB9A 1I2OA 4ODRA 2D23A 5EL1A 3SCOA 3RLVA 1EUNA 3SCVA 3VMNA 5DXYA 7ENLA 4BS0A 4GQ0A 3OG2A 5CC6A 3MKCA 2ALRA 3TYAA 4ERIA 1OQFA 1J0ZA 2WQDA 1C7SA 4XKYB 5DO2A 3VOGA 3H21A 4QT2A 3IGUA 4K1GA 2ACRA 5JU6A 1OZMA 1H63A 2HS8A 5AKQA 3NR0A 1Y5XA 3VVGA 1SMDA 2QDHA 2W91A 4ZR8A 1MXDA 2Z4GA 3UXAA 5KMYA 2O9OA 3A4JA 4L6OA 2HDJA 3AJXA 3C56A 3K2GA 1UR1A 4LU0A 1TPH1 3AIRA 4XUGA 2ZXQA 5E70A 1UUOA 3T2OA 4PUKA 1UD4A 1BKHA 1QK2A 1UUQA 2QF8A 5CG7A 1GQIA 3EA3A 1D7IA 3WLIA 2V8ZA 3SEPA 4NILA 1XPGA 4RE0A 2XU2A 3F1QA 1JI2A 1U5JA 4LCQA 4RV3A 4DJFA 3M0HA 4JL2A 2BSLA 4H00A 2RSEA 3TSMA 4C91A 1OG6A 1E44A 2FFIA 3T08A 3ZJ7A 3UR7A 2OLSA 4KEVA 1H7XA 4GPNA 4UTUA 1OVDA 1KM0A 3LG3A 4KGJA 3RMJA 1R6WA 1HKKA 1Q66A 3S5ZA 3GFZA 4A05A 3GAYA 1KKOA 3OA5A 1WOAA 1F05A 1OK4A 2Y1HA 3G22A 1OCQA 3WF2A 2JFEX 4NXSA 3AIUA 1XYLA 4IF2A 1FXPA 1TA3B 1ROTA 2DVTA 4AZHA 4WDWA 2B7PA 1TMQA 4Y8FA 3N11A 3NWRA 2PU0A 3OVQA 3VXGA 3ZWSA 3A5FA 2GDUA 3WELA 3B7XA 2HROA 1B3ZA 3WDQA 2DG9A 3VILA 2LKNA 1OK6A 1QT1A 1WZAA 3V35A 1DQWA 3ZZ1A 5I2UA 3K13A 1UD2A 5HWNA 4P61A 3FIGA 4QG9A 3L4XA 1FXQA 1XWYA 2AL2A 2J7HA 3NO5A 4PC8A 4B91A 1XBZA 3DAQA 2J8TA 4HA4A 1IZKA 4MKNA 2A3LA 5MHBA 2ZKMX 3O5EA 2POTA 1U5HA 1ZGDA 5FSEC 4HMEA 1KW1A 2IQ0A 4BKNA 3DHUA 6TIMA 2I7GA 5AYYA 2D2GA 3IEBA 5T26A 3PZGA 2AAAA 2XVKA 3GXNA 3GIQA 3V36A 2RQSA 3L5AA 3V1HA 4UXDA 1G4EA 2MF9A 2FTWA 3TJIA 3TC5A 2BNJA 4DELA 5HJLA 3PR2A 1TWIA 2PP0A 3FEQA 2Z1VA 1WDSA 3V3WA 2E5CA 4TYOA 1J4EA 1DJQA 2E4TA 3GR4A 3C5QA 5D04C 3MMWA 1VS1A 1TJ1A 3O5MA 3ECQA 1Y8BA 1R87A 1SM9A 2GOKA 4M6UA 1CWYA 2MLZA 4ERGA 3BLOA 5FJRA 4NZ1A 2GQAA 4FI4A 3PP7A 4IP5A 5AVNA 2PTZA 2DORA 5H1WA 4ODLA 3C6CA 1UR9A 2QEZA 5IFPA 4EPBC 1M6JA 5CLWA 3W29A 2WWCA 4CNSA 2BFGA 1OIFA 2CIPA 2ZR4A 5K2ZA 3WKZA 1JL8A 2H8ZA 1M9HA 3B8TA 3BCFA 4RXFA 5A95A 3WD2A 2I16A 1TZZA 4NX5A 3E0VA 1FD9A 1XLDA 3OYZA 5FJOA 1QCWA 2G3JA 3W7CA 4FXJA 1CXLA 4QISA 2XPAA 2PPGA 1SUXA 3JYMA 4GQBA 3AXIA 4EK7A 4PBFA 1WOBA 3C2OA 1A4MA 1FWGC 4LVGA 1JD9A 4GVFA 3OHIA 5FF0A 1CXEA 3O6DA 1E15A 4IFKB 1M5WA 1TCOC 1XX1A 1IR2A 1V6YA 1D3CA 3ITXA 3WQFA 3EPOA 2IS7A 2ZQ0A 1H09A 3JVAA 1S39A 3ITTA 4GH3A 3U3HA 2FTYA 3R8GA 5CBBA 3GXDA 2YW3A 4BWLC 1EPVA 1F61A 2EBNA 4IIEA 2ZBTA 1WB0A 2DVXA 4ZCWA 1XD1A 3G6LA 1QPOA 3KZSA 2Z1KA 1A7XA 1TCMA 1SZEA 2QJHA 3KW3A 1ZLPA 2FZ9A 1FFRA 1EPXA 2VO5A 3LHYA 4HNNA 3MCMA 3TR2A 4I3GA 1KRBC 3VKAA 1JJKA 1JCLA 2GQ8A 1QOXA 5A8OA 1WUFA 3LBOA 1E1CB 3A24A 3G5EA 2N87A 1PX8A 3FOKA 2P88A 1DJGA 4O2TA 2GL5A 4N7QA 3KCJA 1C8VA 5DLCA 1XYCA 2YXOA 3DIPA 3S2NA 1IF2A 3WBEA 4IT4A 4JTUA 3U2EA 2WVVB 3TC6A 4XISA 4N4PA 3NSMA 3IJ7A 4V15A 2PWGA 1FWEC 3LERA 2VGBA 1ZZMA 4IP4A 4KH2A 3EXTA 3VE9A 5KTLA 3DFNA 2E8ZA 2LGOA 4IPLA 3TYZA 1EYEA 1H4PA 3UI6A 4O0QA 2INEA 5FKYA 3UZZA 4DAFA 4KRUA 1LWIA 3J7HA 3ZR6A 1EGMA 4UQEA 4PMRA 3STGA 1HNYA 4GNJA 1XI3A 2P8CA 3RO6A 1GOIA 1W3TA 1IEVA 1HL2A 1FJDA 4N9EA 1YPFA 1Q2RA 4CNUA 3G77A 1OABA 3LY0A 1E6ZA 4J40A 2XIIA 1OFPA 3PK7A 3MKVA 4H8NA 3M43A 2FQIA 2V68A 4A3QA 4WKFA 4NNCA 3FJNA 4DWSA 1EHAA 5T9CE 3W4RA 3AJ7A 5I03A 1TSIA 3T40A 2DZWA 2OFNA 2ZZ3A 1H61A 5M17A 5HMEA 4DI9A 1W1IE 3F2CA 1XF0A 1HGYA 4HOZA 1LL6A 4AY7A 3QYQA 4LCRA 2CZ5A 4Y9OA 4JY8A 2XISA 1X6NA 4WQ6A 1G94A 2OKTA 3CPRA 7XIMA 1ZAIA 1Q6EA 1V03A 2YA2A 2EG8A 4WSKA 4DJFC 3DKJA 3TQPA 4XZLX 4ZQNA 2C13A 3AO0A 4R88A 3TYBA 5DX7A 3CAVA 5FAJA 3LXCA 1Q13A 4I8DA 1T11A 3FKRA 4X60A 5G4HC 1BXBA 3EMQA 2B4GA 4FO4A 4LEFA 1TVLA 4QLLA 4AG0A 2ZFAA 4JS3A 3AROA 3AHZA 4KR0B 2OJPA 3D3FA 1EOMA 4H4IA 3FX4A 4GQRA 2CBJA 1Q6IA 3BH4A 1XSIA 1DQUA 2QIIA 1UASA 4HHHA 3LHVA 4JR5A 4HCHA 3TEVA 2GGHA 4C6MA 4WDUA 1Q65A 2P76A 4FIRA 4U31A 4QT3A 3T0TA 3C8FA 3O07A 5REQA 2WV8A 3TC3A 1CPUA 1PIGA 4JYDA 3QEZA 1NDZA 4E4PA 5I24A 1EF3A 4B16A 4UTKA 4LQ1A 3NYDA 1CXIA 1R9HA 2QVNA 5I0DA 4ZQRA 4KEZA 3AXMA 1VFFA 2PURA 1EF2A 2DIJA 1K9TA 1VBRA 3DG6A 3CUJA 4CCZA 2WC4A 4AD4A 4PTVA 2CXEA 8XIAA 4UMBA 1DV7A 3WNLA 4JCLA 3VI2A 4LY8A 4ECLA 4IUOA 1KFCA 4DNHA 3C86A 1DWAM 4QM1A 4Z0SA 4IG2B 1GORA 1UKTA 4D72A 3IAQA 4DIAA 2BY0A 4J3UA 2QKFA 5DXXA 3K4WA 1VPYA 4PMZA 3N4FA 4PCTA 3XIMA 6CGTA 4QE5A 3W7KA 4CD4A 2YXGA 4UNKA 1X98A 3WF0A 4H7VA 2GJLA 4F0MA 4QXIA 3S6DA 4ZOBA 3EX4A 2WYSA 4Z08A 2CZVA 3ZLFA 4YTUA 3UYCA 1BWKA 2YFNA 3NZQA 3VNLA 3V1PA 4O10A 3CEUA 3A12A 1DWHM 4XZNX 1G0CA 2IXVA 4AD2A 1OD0A 4FNUA 1OFDA 2JIWA 3WNPA 3E38A 3DG7A 3BLKA 1UWUA 4GGBA 2AQWA 3AZSA 4I8YA 3ZWTA 2RH9A 3L4VA 3BQ6A 1J79A 2IPFA 2VP8A 1B9ZA 2W61A 3B4UA 5HMSA 1TJ0A 1XLBA 4GVIA 4RE4A 4ZQMA 2VEIA 2V30A 3VGEA 4MNJA 1PPIA 4R0XA 4NIRA 1Y7VA 2XM1A 4O18A 1A50A 2IMRA 2YDSA 4AX6A 1L9WA 4CD6A 4YTQA 2DFAA 3DENA 3W7JA 1EUAA 4UR8A 4HHLA 1MW1A 1FKHA 1IIHA 4Z2HA 5I77A 4BQ2A 3E2SA 3AIEA 1KXVA 4XX6A 3W2JA 1XIDA 1OB0A 1RP8A 2HXUA 1GJWA 1Z32X 4DZ3A 3DERA 1NFPA 4FMVA 2PLCA 3L2LA 3MJYA 4C5YA 5BZAA 3WLJA 5M03A 3S5SA 1OX4B 4TW8A 3OQEA 4GYKA 4PUUA 4PULA 3VNZA 3GU0A 2W6RA 5AYIA 4ACYA 4DUVA 2XVPA 1WKDA 4Q3MA 2QJIA 5HNTA 3SQSA 1UKPA 1WXYA 1Q4NX 3CAWA 1R3TA 3OJGA 4MJMA 5GNZA 4UCGA 1F2JA 4A2SA 1L6WA 2CBIA 1OX4A 3UQAA 5HWCA 1UOZA 3MVIA 3CLWA 3URQA 4Z1YA 1HF6A 1UWAA 3OOQA 1OGBA 3NRKA 3O06A 3B9DA 2IKHA 1J6OA 4LXFA 2ISWA 2BVWA 4M29A 5T8GA 2FGZA 2YPIA 1H7RA 4OOUA 3WY1A 3F2BA 3M7WA 1JUEA 1EJXC 1OFEA 3FW6A 2WBKA 3CK5A 4CQ9A 4JQ1A 3WSUA 4W7VA 5M5DA 1RBAA 3M5YA 3UYIA 2Y63A 4J4NA 1DKWA 2B7OA 4HCDA 3NDYA 4IJRA 3U5YA 1H7NA 2PE4A 1A53A 2WZIA 3DFTA 3LGGA 4GX9A 3INPA 3UG8A 2A4AA 4DJDA 3RNDA 2CLOA 1YDYA 4PE8A 2YJQA 2XVLA 4B5VA 3NOYA 3TZNA 1GONA 1XRSA 4HNLA 3P67A 4R9XA 3FA4A 3MTWA 4LV9A 3QR3A 4U33A 4IPXA 2I5GA 2VUYA 1FWDC 4PUDA 2YCLA 3HOJA 4AVOA 2P50A 5I06A 1JPMA 3GIYA 3UCCA 3II1A 3L0GA 3GDBA 3UWWA 2B7QA 4FLRA 4IIDA 5C7VA 5LKYA 2ISVA 3G6MA 3F03K 1SR0A 1IZJA 1OZQA 1FUYA 3S83A 1R3SA 5ABFB 4Y6GA 3W25A 4PL2A 4TNSA 5MF5A 4B5SA 3TX9A 2GPTA 4J3SA 3IK4A 1KGXA 3O8AA 5A6TC 1OJXA 3QV6A 1UB3A 1ISWA 1EX5A 2FKPA 1E3XA 1OSEA 1C29A 3S42A 2A7NA 4O1EA 1RPXA 3ABOA 5C55A 1IT0A 1J8VA 1EXPA 6XIMA 5J6EA 1UHVA 3SECA 4P8XA 3BAWA 4US6A 1Y0EA 5HULA 5D4YA 3UR8A 1BWLA 4OBRA 3ARPA 1JZ2A 3QC3A 1J6YA 2V5DA 2Y2WA 4MF4A 4AF0A 1LRTA 5J5DA 1Y65A 2NXGA 3W7GA 4NAEB 2VCBA 3C2FA 1XYMA 3ENLA 4U5IA 4I5XA 2HVMA 4JX4A 3HG2A 3POCA 1H7PA 1Z42A 4TO8A 3WQCA 1VKFA 1V6UA 1YTDA 3VCNA 7A3HA 4H6RA 3R0DA 4YVXA 4QDPA 1F6KA 4ZSTA 3UZXA 3MI2A 4GUHA 2ZQVA 3G1AA 4Z1CA 1OYCA 4L9XA 5BROA 2YL9A 2X41A 3S6TA 2GOUA 4KFNA 3M5ZA 3M47A 3VDCA 3GDTA 3HO8A 1VLWA 3UPWA 3WLPA 4RCXA 1P1MA 3E0IA 3OO2A 3RDKA 4JFSA 3P6LA 2J88A 4DZIA 2YZ5A 4U10A 4XKYA 5A8NA 1KRAC 3FGCB 3TC7A 3PB0A 3G1XA 2RDTA 3A3WA 1PZ0A 4JIRA 2ATSA 2QCHA 1SZRA 4DF2A 3LD5A 3O63A 2W4XA 2VWTA 2DSKA 4KS0A 4U84A 1Q6CA 1G4TA 1EEXA 4R7OA 3M9YA 2ZE3A 1LWJA 4W84A 5D2TA 2RUQA 2A3EA 4B9YA 1VF8A 3CPUA 3NVDA 4NVTA 3GDRA 3SGUA 5JBDA 1F3WA 3QZ6A 4HMCA 3GR8A 1SU5A 3UD6A 4PB4A 3O6YX 1J4IA 1UWTA 2INZA 3B8WA 4XO6A 5KINA 3H2FA 2QNEA 1AD1A 4MMWA 1KQZA 1CCWB 2PDLA 3W37A 1ZENA 3A21A 4NAFA 4UZSA 3SCWA 2WHLA 4M6VA 4LAYA 4YTTA 3K46A 4JQ3A 3P80A 2AWGA 3FYYA 3WEOA 1W2PA 2NLIA 2X30A 2BHYA 3UETA 2PODA 3PPGA 4GKTA 3GPKA 2EKGA 1WAWA 3RRXA 1XLFA 2C71A 4C6OA 4JD4A 3CL7A 2XTKA 1IXNA 5D75A 3UBPC 1AFSA 2E9LA 4DLFA 5JXQA 4WHBA 1VFMA 1TWDA 1TCDA 5I09A 3W26A 3WNKA 5AVHA 3PF3A 1FKWA 3RF9A 1QNPA 4FNTA 1HO4A 3LCFA 4ZE4A 3BMVA 4YCPA 2QAPA 2RDXA 2QQ6A 1IT7A 1E5JA 1JYNA 2EPKX 4KFPA 2VT0A 2HK1A 4R5EA 4RPQA 2EG7A 1DJZA 1TUFA 5FSDC 2J8GA 4KPLA 7TAAA 3DESA 3HQPA 1JF5A 1BQCA 4PCNA 3O3RA 5HKGA 1PE1A 4QE4A 3QKEA 1LLZA 3KTCA 2ICSA 2WBGA 1H1NA 4QBXA 8XIMA 3V0TA 5KITA 1I1WA 2JKAA 4E8DA 2J62A 4L6DA 3E2VA 4KCUA 1HVXA 3UWQA 4X61A 3UY8A 2HZGA 4U4MA 4F9JA 4GD0A 1HO1A 4TVCA 4LVAA 3ARWA 4Q33A 4TTUA 1BEUA 5I6SA 2WSRA 2C6QA 1WAUA 1XCXA 3AHVA 2H90A 1P1XA 2PDNA 3JYJA 4WJXA 1RALA 2BOEX 4S3DA 4JIQA 2W0UA 4P7OA 3NSNA 4OBSA 1KWGA 4PTWA 3WK3A 1GTHA 1NWRA 3APTA 4HSNA 3QN3A 4S3KA 4IFRA 2IQDA 3UZWA 3BOXA 4S3GA 2X7WA 4GC4A 4PTDA 5FEPA 5KZMA 4LEQA 4GZJA 3LYEA 3CHDA 1JD7A 2BWGA 2J7EA 2NX9A 4JY9A 1QUMA 2CLHA 3WF3A 3MPGA 4I9TA 1JZ7A 2XP5A 1MNSA 4F0LA 3VAWA 2E5DA 2OOFA 3YPIA 3GNDA 2BXZA 2RDUA 1PBGA 3FXGA 3UR5A 3TQVA 1UKOA 1JCXA 4W89A 1S2UA 4LOCA 4JOMA 3A64A 1H5VA 2G97A 2ZTKA 5U4NA 3GTYX 4MYXA 2CLIA 3DC0A 3R5EA 3QYSA 3VYLA 3GHUA 2VR5A 2HNEA 3MC5A 3SGGA 1GYMA 4LAXA 2NQ9A 2H3BA 2HNHA 2V81A 2E28A 3GG1A 3T9PA 1JR1A 2VQUA 2L2SA 5EBUA 1LOQA 4B2DA 1X97A 1PCKA 4ZMGA 1NWTA 3G1VA 1PHWA 4DEFA 2GJRA 4LALA 2PF8A 3NYZA 3JRKA 2XWDA 3AALA 2ZTJA 4LF1A 3UCQA 3VNYA 3OBAA 3CB3A 1RCXB 1DEDA 1R0MA 5FA5A 3DUGA 4IIBA 4D6GA 1BFNA 2V3DA 2HCVA 2ZUSA 3CWHA 4IWWA 3VK5A 5LIKX 3WMBA 2P5NA 3BLEA 3NCOA 4P2VA 1FKIA 1SJAA 3GXMA 1X38A 1R9ZA 3IJ9A 5HW7A 4H9ZA 2W27A 4Z1DA 3QHMA 1KM2A 2OXNA 4MAVA 3KX6A 5BRBA 3W7DA 3R8HA 2JK2A 1REQB 5U7SA 4HOWA 1PB0A 4IQCA 3VIKA 3N9KA 4EANA 5DCBA 1CGVA 3TCEA 1T99A 1JCJA 1KBKA 3AI0A 3BC9A 3KCLA 2EO7A 4UR9A 4WRHA 1SYTA 4WD0A 3CV7A 1ESWA 1K9DA 2HXTA 4F48A 3M0MA 1S1PA 2PPPA 1S5TA 1REQA 5C9UA 4ZOCA 1FKDA 2INFA 2WCGA 3W6LA 3C2YA 3EWDA 1PEZA 3V5CA 4O1FA 3HPSA 3LBMA 3WNNA 2PDKA 2E67A 2ZX7A 4DRHA 2Z25A 1PDYA 4LWWA 4HARA 4C6IA 1L6SA 3PJXA 1QWKA 2VD9A 2WVVA 1W54A 3POHA 1I2NA 2ZYFA 5HWJA 5K4ZA 3RGCA 5DCEA 4GQGA 4MLRA 2V63A 1PZ1A 3H54A 1ONXA 2V82A 3LLDA 2A0NA 3IPWA 4LNYA 4CN4A 3CNYA 1JRCA 5IDIA 1XLKA 2WC7A 1E1EA 4J3ZA 1IZCA 4JXCA 1AVAA 5LA2A 1TPVA 4FNQA 1XICA 1DP0A 1HP4A 4Q7BA 4DN1A 3IIVA 3W82A 4DB7A 2W79A 1GVIA 4MWAB 2VD8A 4F4RA 1TPDA 4MPKA 1Q7QA 3IUDA 3GTIA 2ZUTA 3S2MA 1PV8A 3G0XA 4FP1A 3OHMB 3NXFA 5K7JA 5AC6A 3VGFA 4PTNA 3IJ6A 4AC7C 5CJ5A 5CQ1A 3TA6A 4W9QA 3A5VA 3MB9A 3RR4A 3WDIA 4IL0A 4ADUA 4DYJA 4KWWA 3V5OA 4UTJA 3M41A 4RXGA 3LM7A 3GC4A 3N6JA 2X42A 4IPIA 3PC0A 4NASA 5CGMA 2WJEA 4U5KA 4IICA 4IPPA 2F4EA 2VZSA 3LHUA 3N6HA 3W88A 2OX4A 3GU2A 2EQDA 3VU2A 1V6VA 3TW9A 4DVOA 1Q3NA 2XIBA 3E1F1 5HAOA 4YVPA 4YCOA 3CUGA 4BI6A 4NRRA 1C8QA 1VQTA 2VEFA 3CQHA 3VKJA 2VOMA 4LVFA 5F2IA 2WMFA 4L4MA 3RR1A 3ZFHA 1Q6OA 1BWVA 4MG4A 2BBFA 3QW3A 1W9DM 1RV8A 1THFD 3ABQA 2DW7A 2QULA 2CITA 4UTIA 2ABBA 1VZWA 1EH9A 1GVEA 1LBLA 1MEWA 3AUOA 2YDQA 2F9RA 2VX5A 4ZOEA 2Z1SA 2PB1A 3KAFA 4WOZA 3FV9A 3RCMA 3P0XA 5F4WA 3ELFA 1UD6A 4WKAA 1AW5A 3W86A 2YL6A 5I00A 1ME7A 2XP3A 3NL5A 5ABTA 2D9FA 4D6DA 2NSOA 3GVWA 2DQWA 1MDLA 4DJDC 5HOSA 3VD7A 3OYXA 3TTSA 5I5RA 5I3IA 4C6NA 2YIHA 2VUNA 2XZ7A 3M4HA 4ZEPA 2VZUA 2Z1XA 3EWXA 4LY4A 3W00A 1LL4A 4ROPA 4M6PA 3DCPA 5EU9A 2J47A 4IHCA 5KZ6A 2EKCA 2XP6A 5FAGA 1Z48A 3UZYA 2IKIA 5BNKA 2O4MA 1XGDA 3PZQA 1PKMA 4WY0B 1CGWA 3FVDA 4X0VA 3E02A 5DIVA 4MY8A 2GJXB 2FDSA 1U5VA 2NZLA 2PRLA 4GVHA 1XFCA 4HU8A 2KI3A 4H7CA 2E77A 1TJ2A 4S39A 1TR9A 4DO5A 4NU7A 4MNLA 5E0CA 1M68A 4WY0A 2G3IA 4Q4SA 4JKLA 4W9OA 5D30A 1A5MC 3O16A 4HQVA 2G8ZA 3M44A 3BMBA 2GZXA 2Q8LA 4HTBA 3TQ0A 4DZAA 4URIA 5H8PA 2F23A 2ESCA 3HFTA 1AQMA 5LYRA 5C9RA 4FA3A 5GPRA 3CYVA 3P5ZA 1ONEA 4C6PA 1PWLA 3DEQA 3LB0A 1P0NA 3BW3A 1J0YA 1E70M 2OX1A 3OU8A 5ENLA 2BASA 3KRBA 4JPGA 1W31A 1S3HA 5D37A 5HQLA 2FPTA 2GWNA 3TA9A 2Z2AA 2CKRA 4Z1AA 4LC8A 4UOJA 3NGFA 3Q37A 1YPXA 3KBVA 1UPPA 4M7TA 1PVNA 4MOZA 2QPXA 5GQBA 1TPWA 4PSPA 4FOKA 4HNTA 4Z2GA 1EDTA 1X96A 3DBPA 1CTNA 3FJLA 4NP7A 3N4EA 4I5RA 3CT2A 4W85A 5LNUA 3RXZA 2VJXA 1LRQA 3KRSA 3WQ5A 3VDGA 4NJJA 3EDDA 5HR6A 1W3IA 1VGAA 1M7OA 1PO9A 3IS4A 2RHGA 2H6RA 5M1TA 3SM0A 4INFA 4DRQA 3BSMA 1PTGA 3AMCA 4Q8PA 1AJ2A 1E4LA 1S2TA 4H1ZA 2VQTA 1DWFM 3WL1A 1FOBA 5CZJA 5CZSA 4Y9PA 4PH6A 5ABHA 1JVNA 4XSLA 7ODCA 2XP4A 3A9IA 1PS9A 2E0PA 4RUBA 3WH0A 4HJFA 1AUSL 2V69A 3LCIA 1E43A 1POJA 4KKXA 1KXHA 2OEJA 1GJPA 3AICA 2OZ8A 5FJJA 4KWSA 3SSJA 5I7GA 1WCGA 2JIEA 2IPGA 1M03A 4X2PA 3NPUA 2E5BA 1NELA 2UV8G 3GTXA 1VFSA 3EB4A 4E3VA 4RNJA 1WKEA 3MKKA 1KB3A 1TRDA 5E9AA 3K8LA 3B9OA 4HYVA 1XDMA 3P74A 3EWCA 1OYBA 4W9PA 1R9XA 3OLEA 3U4AA 1XR2A 2HS6A 1D7JA 3GK0A 4H01A 1B30A 4X2RA 4GWEA 3GAKA 1MZRA 5AFDA 1E6RA 2HVNA 2QCMA 1J6PA 3R89A 3WJXA 2PTXA 4Z2JA 3WCZA 1NF7A 3GW0A 4YTSA 3M0XA 2I56A 5L6UA 3CZGA 4PB5A 1LUCB 3NDZA 1UWRA 4ZE5A 4IOTA 1E4IA 3W1UA 1DQXA 1O5QA 2LLEA 1XLLA 4A2RA 2PBGA 3KS6A 3NQGA 4ODNA 1MEHA 4DHGA 3KL3A 1RP9A 2X05A 1EWDA 5F2LA 3QTGA 3AS2A 2D2JA 3G18A 1PKYA 4C6LA 4LB3A 1MYRA 1KCLA 2PU1A 3CHCA 3FK4A 1B2YA 1LG1A 2CBUA 3KLLA 3CMGA 3NZGA 5FF7A 1BG4A 5A6AA 1EGZA 4LAWA 1XV8A 4MZ8A 1CGXA 1CI1A 5LA0A 3T4CA 2ZE0A 3GIPA 3MHFA 2VVNA 3VIJA 3AIWA 2PLJA 4Y90A 2W92A 4N6FA 3PRAA 2F8QA 4JFMA 2OTDA 3RHGA 2PP1A 4GUIA 4DJFD 3BJSA 4O1AA 1CYGA 2C18A 3EYPA 4LAVA 1G7VA 4FF7A 3HU7A 4XIAA 3CTTA 2P8BA 5ABEA 1YIXA 4NJHA 3A4AA 4U2YA 1N8WA 1FWWA 1U79A 3E0WA 4DWSB 4GNVA 4ZOAA 4H8VA 4J2MA 1D8WA 2ZX5A 2DZPA 3JR2A 3MHUA 1XFBA 2DIKA 2OELA 3TXZA 5CC7A 1CECA 4M1BA 1CB2A 4D8ZA 2CLMA 1W3KA 4IP7A 4Q6JA 1BYCA 4WUIA 2ETNA 1U1HA 2FH8A 3AXHA 1WV2A 2Z7KA 4ATLA 3BWWA 1UZHA 3CMJA 4WXZA 1BVZA 1M1BA 3OBKA 4HTYA 1SW3A 5LZLA 3LRMA 3MZNA 2PDIA 2ISDA 3EWBX 4A22A 3P60A 1G4SA 4DY1A 3H23A 1ITQA 4BQ3A 3T0AA 3MSYA 3EPNA 4M56A 3MJMA 1VRDA 3L67A 3PANA 1JQXA 4HBKA 2O7SA 1EBHA 3IRSA 2WMIB 4E6MA 5AYBA 3B04A 4AXNA 2QCNA 1R3RA 3QKZA 3QMTA 4R27A 2K8IA 5JVLA 1O68A 2QMKA 4HZMA 4LRSA 3MP4A 2NW0A 4MUPA 3HQNA 3RPDA 2YCEA 3LTYA 3ZVHA 3VC5A 3KBNA 5HXMA 2YL8A 3PB2A 3AS1A 4ZB5A 5GNYA 4KFOA 3WENA 2E09A 2DH2A 1S1RA 1N55A 3TDBA 1V6XA 2V38A 2P3ZA 2A1YA 2FJKA 4PUJA 1F8MA 2WM0A 4PBEA 1U2YA 3LHTA 5DEZA 3G3MA 2Z6IA 1YW1A 3IWPA 5KEZA 4AZ6A 4H8UA 3W1NA 1ISYA 4J4OA 1DHPA 1BL4A 5C2GA 3LQLA 5CPLA 4FNSA 1J0JA 1TE6A 3W85A 4D1IA 3R6IA 4ICCX 5AHLA 3DU0A 1NH6A 1TPEA 1E6NA 2OB3A 4PMDA 3AWNA 3P8IA 2E68A 4A3UA 1U1JA 4HCLA 1VFLA 4GA8A 3PAOA 3UWYA 4W93A 1CLKA 1GQJA 2A5HA 1KM3A 1LZOA 2CETA 2UZ5A 5G4WA 2AL1A 3PTQA 3NJ3A 1QDSA 3NNTA 1JG9A 3SUWA 3VUPA 2PDWA 2C1GA 1ML1A 4UQAA 1W32A 3TU9A 1Z7AA 1A5SA 1Q6HA 1V79A 2WSPA 4B90A 4E5TA 5EMYA 1KC7A 1ZBWA 2PP3A 3H8AA 4K38A 2FIQA 3W73A 5DN1A 2IPWA 4N42A 5C54A 1ONRA 4KIEA 4N2YA 4Q8QA 5FI8A 1CX9A 2DH3A 4KIRA 5K9CA 4AY8A 2WKLA 2DG3A 4C6KA 3RM8A 3HGSA 5AC5A 4ACZB 3ZSTA 1ZL1A 3C0LA 1B4EA 3PZIA 1JZ4A 4BFAA 3JZEA 2Y85A 3R43A 1XIMA 2I9UA 2M08A 4MTVA 3D5HA 2BMBA 5F2GA 1TELA 2Y89A 4BF9A 3QR0A 1LUCA 1MQQA 4FX8A 2FH6A 1YBQB 4ZO7A 1CXKA 3BLIA 2DDXA 1W1TA 3KTSA 3V18A 2IXUA 3S0CA 3WQPA 3UJ2A 3W1PA 1B5TA 1IQ8A 4QEHA 3VIOA 2V5CA 4HU0A 1EA9C 1K6WA 4WK9A 4PUNA 5AHNA 3UESA 3AS0A 1EP2A 4R34A 1FKLA 4EXBA 2DP3A 3W1TA 2C16A 3N2MA 2WJFA 3QBUA 2WK2A 1PYMA 3S9IA 1W3NA 4O12A 4CNPA 3U7VA 1XH0A 3TTQA 2YFOA 4ALDA 4F0KA 2ZRUA 1IV8A 2CZEA 1VBJA 1OCNA 1OINA 1GKPA 3SCPA 3W81A 1U22A 3THCA 1WQ5A 4E4FA 1CT5A 1LT8A 4XZHA 3TN3A 2EPHA 4L3NA 3RN6A 3BQ5A 3U8GA 2BXYA 4C90A 3ME3A 5MKGB 4FS9A 1Q6FA 3P7YA 5HQMA 1ZTVA 1JF6A 4BEUA 3EPMA 2XP7A 2O9RA 1IXPA 4E8CA 4W8LA 4AFYA 4HPGA 3F4CA 3BGJA 4E2BA 1AODA 1DE6A 1JCMP 1GKQA 2J7FA 2R1MA 3SUVA 2DT2A 3HF3A 3RITA 4BCEA 5DELA 3UA4A 3VD5A 2OWWA 1Q6GA 3TSDA 3W38A 5IFTA 2XN1A 3WQOA 4JFLA 1CGUA 3EA2A 3O6CA 2FHBA 1OT1A 2KE0A 2QT3A 1YX1A 3UGRA 2V5BA 2J78A 3CH0A 4ODKA 2PUZA 2AOSA 4WEVX 2WMKA 4MYAA 3SN4A 2ONEA 2HJPA 4XK2A 1IXOA 1WA3A 5B7ZA 2FFCA 4J7RA 4O54A 3CTLA 1I1XA 3XINA 4XIMA 1Q8AA 1NFBA 4P7QA 3AMKA 3DYOA 3JUGA 1GQNA 2A3CA 3B8UA 3CZEA 4ADSA 1O7AA 3L0NA 3Q94A 5A94A 1A5NC 4L6HA 1WZKA 5LIXX 3VIIA 1P4CA 5CC3A 4LYPA 1RAKA 1ZBKA 2QZRA 1G7UA 4FOJA 3EOSA 1X1ZA 3SUUA 3OG3A 1UMYA 1BYBA 3I3BA 3PUOA 2ZZ7A 3ITLA 4L72B 4X63A 4LS0A 3TCSA 1KR1A 1K77A 4JTEA 1XIEA 3CQ0A 3CZ8A 4DI8A 4ZENA 1Z89A 3ERPA 3C0QA 3OLDA 1VBHA 1VFOA 3VOJA 3URNA 4JX6A 2WNQA 2QXWA 3B8VA 3W74A 4F3HA 3FYPA 3TAKA 1FAPA 1KBIA 5FEXA 3EDFA 1IEWA 3MI6A 4JFTA 2NVDA 1Q63A 1NEYA 3GFYA 3QVQA 4P8UA 1ECEA 2Y70A 1C92A 2YLAA 1IGSA 3TXVA 2PEVA 3HURA 2QUNA 1UW9A 2ZOXA 4UFJA 4WDXA 1JYWA 1QAPA 5DF0A 3R25A 1BYDA 5ECVA 2G41A 1UWIA 1TE1A 1SZNA 3LX9A 4XQ6A 5EMLA 1ONWA 4GY0A 4DRKA 1O1ZA 2NV2A 3VIHA 2WHJA 2X16A 4DWSC 4ORIA 1M7JA 4XAZA 3ZQ9A 1JCHB 3ZLHA 4S3BA 5FJTA 4UR7A 4Z42C 5E6ZA 1D9EA 5CSSA 4GIAA 4NJKA 1D7KA 1JXKA 3TNBA 1HZYA 3DFHA 4Y7EA 2XN2A 4D1JA 4YYCA 1QNOA 1W37A 3HPXA 3WUBA 3BCDA 4ML9A 3IIOA 1PDZA 1VEPA 2VZVA 5C71A 4RW5A 3B9EA 1EC9A 2QCEA 1GOQA 1P0BA 4I6VA 3PJTA 4GJIA 3DHDA 4Z1BA 2DZSA 3ID7A 4X9YA 4KCTA 3W0KA 4F8XA 1W56A 4UFKA 4B5NA 3WDJA 1SJDA 5TD4A 3WH6A 1JGMA 2Z6JA 2X1RA 1WZMA 3L9CA 3OGVA 2UBPC 3EKGA 1GHRA 4MJ4A 1PL9A 2VI0A 1UD3A 5A8QA 2D2OA 4IPNB 1E0WA 1ZUAX 1DJNA 1TPFA 4LVDA 1BG9A 4Q4OA 2WNWA 4HP5A 4B5WA 3N18A 4FPSA 1BQGA 4MY1A 4FN2A 1LF1A 1UA7A 2PA6A 3MVTA 3S2LA 4XWUA 1Z6KA 3A47A 3VNJA 3N3MA 1F5ZA 3WYZA 3GR7A 4B2DD 3HQ1A 2EPNA 4G50A 3AQUA 4G8TA 4HK6A 4PTMA 4RKAA 3N25A 2DVUA 2Y5SA 3FAPA 2BHZA 1XLIA 1XG3A 2PTWA 5C70A 3TONA 4NZ4A 2RUCA 4IISA 3BXWA 3GKFA 2Q8ZA 3N19B 2NV9A 3RM9A 1ZP4A 1J96A 4GZEA 4QCFA 1AG1O 4AIOA 4IMFA 3ANYA 3MBDA 2J25A 8CGTA 3E9AA 3CHEA 3CPGA 3A4WA 1NFGA 4WCJA 2OLAA 2I57A 5EMJA 3W01A 3R7MA 4NKCA 1KFJA 7CGTA 1F6PA 3UI4A 2XZ9A 3KBSA 4DWDA 4AYSA 1E9YB 3W7MA 1B3YA 1NDWA 2C7FA 2ZZ2A 3FNDA 4KEMA 4ITZA 2OGYA 2UY3A 1S5WA 3FY1A 2ON3A 1MVYA 2P1FA 4G56A 4K8EA 3FLUA 4AUBA 3FHQA 1UC4A 2A7PA 2OKOA 1KR0A 1WBJA 1X7FA 4LNCA 3H4XA 4C6EA 3N9RA 3W70A 1DOSA 2PD5A 4GIYA 5GVJA 1FVPA 1TIMA 4IMCA 2FMOA 3PBGA 4O1BA 4MWAA 2X09A 5HK4A 1QZ2A 3ZSSA 2DSUA 4ZSUA 2CZFA 4JTKA 5FJIA 4AEFA 4KESA 2FZDA 2R6OA 3HPZA 4OE7A 1OFRA 2WKJA 1J93A 3UGVA 3PJWA 2C1IA 3SY8A 4M19A 5AN7A 4UNIA 1FWTA 3HGOA 3W7NA 5CSYA 1RA5A 1NM9A 1HVQA 3K30A 3PZTA 3GNNA 3GC2A 2G4JA 3HA1A 1R30A 4QTGA 5H2ZA 2ZRWA 3QM3A 1OADA 1X39A 4NT0A 1OC5A 3GHRA 2OSXA 2XFRA 2ZR6A 2FGBA 3PPHA 3LMZA 5XIMA 2XH0A 3I10A 1OFBA 4XAYA 3G1FA 2EJ1A 3VMPA 1V0NA 3CH9A 2W3ZA 3GKAA 4LJ3A 3HG4A 4NF7A 3B0VC 4IGHA 1JI1A 4JYEA 3BAYA 4L56A 5ECUA 2PGWA 5DMLA 3PPCA 3L4ZA 3VGDA 4NYUA 3HPFA 2Y8UA 2BP1A 1WDWA 3EGJA 3HQOA 2NUXA 4X9SA 1GOMA 2PMQA 3LV5A 3VIGA 5AHEA 3PBVA 5JBEA 3GBDA 4ZGYA 1VJZA 1XBVA 1GPFA 1GKRA 3WBYA 1TV5A 4IT6A 3TLQA 4AD1A 1CEOA 1J2BA 5L9FA 4N9DA 4F2BA 3CUHA 4B5UA 4IM4A 2RKXA 4L5ZA 1V3HA 1XCFA 4OV4A 2OODA 3CHVA 1JDFA 5E09A 3OVGA 4ATDA 2TMDA 3UNTA 3N29A 4JFVA 4DM1A 3KDNA 5E5CA 5BU6A 4PMNA 3WD3A 2WVSA 3AYVA 1L2QA 4K2SA 1H51A 3AISA 1QI0A 4O1CA 3D46A 1G4PA 1QO2A 1XYBA 1LCOA 3KACA 2ZRXA 3WK2A 5G5IA 3V5FA 3DN5A 3Q4DA 1FHDA 3HGRA 1TZ7A 1A4LA 3PN8A 1K9FA 1K6AA 4WY0F 4LAMA 2WXDM 4C6FA 3N73A 2UWFA 4XV0A 2PWDA 4E8GA 3BAKA 1ZNNA 2PDCA 2J75A 3NTYA 2CHRA 2CLFA 4Q7NA 4P8WA 1NQKA 1MZHA 4AY1A 1W17A 3H53A 1DJHA 4M80A 4PGLA 2HE8A 3T8QA 4AZCA 1DTUA 1VYRA 1F8IA 1KTNA 1IWBA 1UMLA 2BY2A 1GRJA 2OGJA 3BARA 5IHSA 2RURA 2CXGA 1CZ1A 4LBUA 5JQ9A 3O5IA 2XM2A 1FH8A 1K8XA 4PL1A 3AU2A 3C0SA 1E1FA 1QPQA 1KNWA 1Q4WA 3H2AA 2PPOA 3ODKA 3H70A 4PMVA 4K7VA 4I9MA 1F3XA 4FR1A 4U86A 4A3YA 3H24A 3O0FA 3DFSA 4IQ2A 1OBAA 3W1LA 1TV2A 2Q3OA 4AD0A 4O13A 3BE7A 4K6AA 4IQJA 4Y8EA 4J1OA 5TBOA 4J3WA 2WAGA 3GNRA 1L1PA 1E3ZA 4BQ4A 3KVLA 3LUOA 3I4EA 4NZ5A 2VOTA 4WF7A 1C93A 2G5WA 3T42A 4FF5A 3KHDA 2RJGA 3OPSA 5FJPA 3WH7A 3HN3A 1RY8A 2Z29A 4C65A 3WF1A 3VFLA 4GUGA 5I3JA 3HZ3A 1QW9A 1OIMA 4XSMA 2PSNA 4DO7A 2VZTA 3PS7A 4IMGA 4H8HA 4L80A 2VR4A 2TAAA 2EPOA 3UWZA 4WLCA 4FZIA 1O1HA 2XP8A 1H0IA 4FK9A 3DI0A 2DV0A 1EWEA 3NQCA 2OG9A 4OJYA 2WPBA 5D02A 1QU4A 2BXVA 3TYEA 3MDYB 3PM6A 3LUTA 1PCWA 4O14A 2X7VA 2V2DA 4DBWA 2IUZA 1FWBC 4TOQA 1QASA 4PUMA 1YQ2A 4ZS6A 5C2XA 4H9VA 5BXRA 4DJDD 3LSCA 3UCDA 4UNLA 4AQLA 3L4WA 4RDYA 3GYEA 4TW6A 1UD8A 1FWCC 2I14A 5DFAA 1K8ZA 3WQ4A 2PPNA 1CIUA 4OU1A 1VFUA 2ZVRA 3RAOA 2ZR5A 2P0IA 3U5UA 4BI7A 4LUTB 4KETA 1OC6A 1B3WA 2NX1A 1G69A 3LK6A 4Q4RA 3TYCA 1Z41A 3EOLA 1M7PA 3KUMA 1LBMA 3WLOA 4AWEA 3KBWA 1DTNA 2NLYA 2VFGA 2NT0A 4JTQA 1Q2SA 1ALDA 2PDMA 2XGZA 3Q65A 2XPKA 5LGXA 4NZJA 4KWUA 3WUFA 4MGVA 3IUHA 3UQNA 4GZ7A 4QS5A 4U2ZA 2A3BA 3UR2A 5I3GA 1XLHA 4AC1X 3EA1A 3B40A 2B81A 3ABSA 4I9JA 4NJGA 2PDGA 5HPOA 5TQLA 4QHRA 2NXIA 3S3GA 1QMLA 1TYGA 1GEQA 3GH7A 1A5OC 3M0JA 1XLEA 4JX5A 1ZAJA 3H7RA 4V28A 2EULA 3RK8A 3EWUA 4EF8A 1JULA 4W4QA 1HKVA 4IGSA 1ZB5A 3IJIA 3F2DA 3ZLGA 4IT1A 3T09A 5CLTA 4IH3A 1C3FA 4ZXLA 3R58A 5I3DA 4JTSA 1XLGA 2GJXA 3R13A 4Q4KA 4TVUA 5HTGA 2VVSA 2VURA 4JTTA 2A2IA 3DH7A 1I2QA 4FEZA 4XD5A 1A0EA 3S5YA 1EJSC 3MYPA 5CKSA 4QS6A 1TVPA 2Q5AA 3KAHA 1R46A 3OVPA 1V0KA 1NSGA 4BI5A 3WLKX 4CQAA 1KCKA 2JE8A 4UTTC 2KX9A 4CU7A 1UBPC 4LW7A 1QNRA 3O5DA 1RJQA 3B9AA 1R3WA 4CVWA 4B9ZA 1YRRA 3E3HA 3O5JA 4OT7A 4KGLA 2OSYA 3P0WA 2CHOA 2OYKA 4FLOA 2KO7A 1Q6LA 4L1XA 1XYZA 1S5NA 3LCHA 4GJ1A 3VIPA 4O0KA 3H6OA 3CUIA 4S3EA 5DQPA 3WDPP 1NWSA 4RR4A 1BF2A 1TREA 4XG1A 1KBLA 4WGXA 2GUUA 3CV1A 3T55A 4NUWA 1TR1A 2L5HA 4GY1A 3HPAA 4W7UA 4DXVA 5HPCA 3H22A 3TLLA 4D8LA 3NZPA 2IQTA 2CKSA 2DT3A 1U30A 2QR6A 4GOAA 2XYLA 3EWWA 1VYSX 2OO0A 2D73A 1PX3A 4LCSA 5I3HA 3JZUA 1GW9A 4YLWA 1Q6QA 1T5AA 3KEHA 4RDVA 2BODX 2I9EA 2FZ8A 1KV8A 4OQVA 5HUPA 3GM8A 4CQDA 1LYXA 4GUJA 3F5LA 1MXGA 2YLLA 1V5XA 4ZODA 4O15A 2Q6ZA 4MB1A 4GFIA 3LPPA 4XAKA 4HYWA 4RL3A 1IGWA 2Y88A 1TWZA 2VNCA 3FDGA 3GNXA 3QZEA 4ZO9A 1HIZA 3PJUA 5BWAA 5EKYA 4ADTA 1A5AA 3P5YA 2QPUA 1M65A 3W6YA 1SFTA 1Z3NA 1FKBA 3AU6A 3F5JA 1HJWA 2OZ0A 3AYRA 5JBFA 3LI1A 2Q71A 1MW2A 4RJEA 1M7XA 1FA2A 2J9YA 3VKBA 2CFFA 3TROA 5GJPA 1IEXA 1CLXA 3OBEA 2XFYA 2YGYA 3WH8A 1S38A 2X8RA 2YDAA 2O92A 2QDGA 1TX2A 2Y62A 3AIBA 1CBGA 1DWIM 3T05A 3WN6A 1R3VA 4UQ9A 4JN7A 2O55A 2BOGX 1TJPA 4IPJA 4C1NB 2Y7GA 4LB4A 4C7DA 2O9PA 2NXHA 3KLKA 4O17A 1GQKA 4PMYA 4A8NA 1HN1A 2ZZ6A 1GUVA 2C3ZA 1QI5A 6A3HA 5FESA 2Q01A 2YR1A 5FF2A 4KMQA 3EDJA 4WVXA 4BF8A 1GG1A 1LL7A 4E4UA 1PJ9A 3RJYA 4GYPC 3G1YA 5E1QA 2FTPA 1Q5MA 2CZDA 1BRLA 4XD6A 2E9MA 2V3EA 4DH0A 3W7QA 3NFUA 2J4GA 3L2MA 1NWUA 1RQEA 1I0BA 1MMFA 5HWMA 4JFUA 1W3JA 4H04A 5BMWA 1HFBA 5DBUA 4M1RA 1EZ2A 3UXIA 4Q6XA 2QCGA 1T8XA 1AW2A 4Q8UA 2FJUB 2R24A 1TRIA 5I07A 3TQKA 1POKA 2G4FA 1Q45A 2ZUMA 2R82A 3RRAA 3KBMA 4QSHA 4GNKB 5AC8A 2A85A 3N34A 4C6JA 1N8FA 3MBFA 3KOYA 2ZQTA 3ARSA 4C1LA 3RYSA 3V75A 4DBSA 3BLLA 5HUOA 4FXRA 1YDOA 1KGUA 3FS2A 1LQ2A 5A6MA 4BR1A 3I6TA 3TWBA 1UH4A 2AGKA 4OOZA 1LRNA 1LROA 3APYA 4OWGA 4UTLA 1EJVC 4ZTYA 3TIMA 1E51A 1DXFA 3WQVA 3FA3A 3UI5A 3GHSA 3QJAA 2VHLA 3TMQA 2YBVA 4QP0A 3LLFA 1KFEA 1QO5A 1UQZA 3LRKA 2QUUA 2OWXA 2VX4A 3O6AA 2HBXA 1BKFA 5AZ0A 2VEKA 4XD4A 1UR3M 5HA7A 4OBTA