1ZBKA

Recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3 like protein 1
publication title Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zbkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zbkA01
3CZGA 2YLLA 2EO7A 5CG0A 1DEDA 4HP5A 1UD4A 3SCWA 2DIJA 1R7OA 2WVTA 1V3KA 4AZIA 2ZX6A 1NWTA 3T2PA 4CN1A 3B9DA 2ZOXA 2OSXA 3K8MA 2VR4A 2CHNA 3KWXA 1G5AA 3WF2A 4WSJA 2J74A 4PRWA 2EPKX 1KQYA 3MANA 2UY2A 5GQBA 1DHKA 1XSKA 3AHYA 1ISZA 1B3YA 3IK2A 1V3LA 3WBEA 1GJUA 5D9OA 5AC4A 5FKYA 2ZUTA 2CIPA 2J7BA 4UFHA 4OIFA 5I77A 4BQ3A 1VB9A 3SUWA 3RO8A 2WMKA 1HIZA 3WMBA 2IUZA 5CJ5A 3AZTA 3UCQA 4BS0A 1W3LA 2DT3A 4E8CA 1IZKA 1VAHA 1HJVA 5BXPA 3VMNA 3ARYA 2ZUSA 3N12A 4ZE5A 3PTQA 1B0IA 4B16A 1UA7A 2PWEA 4AY1A 3U7VA 2E9BA 3ECQA 3ARXA 3ZR5A 1MVYA 1H11A 4GI8A 1US2A 2VNCA 3T09A 3GXFA 3VUPA 2PBOA 2WC4A 3L4ZA 4M24A 1KWKA 1H49A 2ZXBA 1OB0A 5AYBA 3MV01 3CHEA 5EBAA 2CKRA 1EO7A 3K4DA 2OWXA 2X8RA 5CLTA 3ARUA 2C0HA 4DUXA 3DYMA 3WNOA 2BY2A 3G6LA 3WDRA 5A69A 2WSKA 1WB0A 1F4HA 3FY1A 4EE9A 2VX6A 3VIJA 4OBSA 1V3JA 2FHBA 2EPOA 1EQCA 3BLPX 4UR9A 4JCLA 1LJYA 3RJXA 1QNSA 2XFYA 3LPOA 5ABFA 1UKQA 1QPKA 1W3HA 4FLRA 4DWSD 3VGHA 1CYGA 5JH8A 3K8KA 1WPCA 3O6AA 1PBGA 1PZ3A 4RE2A 5A6KA 4ZE4A 4Z2IA 3FHQA 3A6OA 5C8BB 1V3HA 1O7AA 2A3HA 2Q8XA 2EBNA 3WNNA 1B3XA 1NH6A 1JIBA 4B3KA 1KQZA 3WF0A 3AIQA 4OOZA 4H8VA 1QW8A 3WELA 1JZ5A 2ZX8A 1C92A 9CGTA 2GUYA 4JFVA 1GUVA 4JFSA 4PMQA 1R8LA 2GJRA 4FK9A 4N42A 2YBUA 4PUEA 3OLDA 1B90A 1GHSA 4OJYA 4LYRA 2VZVA 4H2CA 3VGFA 4PMZA 2JF7A 1H09A 2YL9A 1UWUA 1BGGA 1V6YA 4C7DA 3K1DA 4TX6A 2YIHA 3WF3A 1JI2A 3BCDA 1VFMA 4AEEA 4UQBA 1Z32X 1V0KA 3WQWA 3ZSTA 4EKJA 4W86A 2WHMA 3J7HA 1TVPA 3AFBA 2X05A 2WZEA 1CXHA 4ZFMA 4UQDA 2O9PA 1C93A 2PWHA 3LPPA 2FH8A 1BTCA 3A4AA 3RCNA 3KEHA 4MNJA 1PZ2A 3TTOA 1OGBA 3IJ9A 1LG2A 3TOPA 2Y2WA 1JZ7A 3WH9A 1TA3B 2ZXDA 3S2CA 5A8OA 2J7CA 4RE4A 2W63A 2F8QA 3UEQA 4CN4A 2WBKA 1BYAA 2J62A 1OGSA 2CPUA 2XWEA 2WYSA 1UWRA 2JEPA 4QDMA 4FMVA 3CZLA 4J3TA 2Y8KA 5ABHA 4JKLA 1BHGA 1B30A 4IISA 3VX1A 5A8PA 2WMIB 1JXKA 1CZ1A 1XH2A 2OYKA 1VF8A 3ZSSA 1ZL1A 3CTTA 3OG2A 1G1YA 3SUSA 3BAXA 1KCKA 1RP8A 3HN3A 4DUVA 1XC6A 1ISYA 1QNPA 3PZOA 5HXMA 3ARWA 4K68A 3L2LA 2E4TA 3AS0A 1UQZA 3BMVA 1VRXA 3WKZA 7A3HA 1EGZA 1DWAM 5CGTA 1GONA 4W8LA 5D9NA 4WSKA 2VCCA 2VQUA 3AMLA 1PIGA 1H2JA 2YL5A 4ZENA 1JYWA 4JZ5A 4UQCA 3WFZA 3GH4A 4HU0A 2YLAA 4P7OA 1AVAA 1Q6CA 2QMKA 2VVNA 1RP9A 1CDGA 2EPNA 3W27A 4ACYA 1NARA 5BXRA 3WY1A 1CGUA 3F5LA 2YL6A 2UY5A 3ZOAA 4EAMA 3ARTA 4AZ5A 2PI6A 2XVKA 4WK9A 3AIVA 3SCUA 1M03A 4PMNA 5A2CA 1C90A 1LL4A 1W9PA 5CPSA 3VIIA 3ZT5A 2HVMA 1BPLB 3NSXA 3CUJA 1NOWA 2G3JA 2UY3A 1HP5A 2WC3A 3AMDA 3T0BA 3VGEA 1V0LA 2WMGA 3W29A 3CZKA 3JUGA 4HU8A 1J0IA 5A6AA 1J10A 1MQRA 1UH2A 2E9LA 3MS8A 1DWHM 2DT1A 3I3EA 4AD0A 3FW6A 5IHSA 5D8WA 2NSXA 2PF0A 1W2PA 4D6EA 1ZB5A 1CIUA 4GI6A 4ACZB 1D2KA 1QNRA 4MJ2A 1VIWA 4JFTA 1UQYA 3I3DA 4HOZA 3WMSA 5CQ1A 4HTYA 1GCYA 2BY0A 3CUGA 1FH9A 2X0HA 4MNKA 3ARSA 1E40A 3WMCA 3AZSA 4AZBA 4AYSA 2J4GA 1CWYA 1HJQA 3A3HA 5I24A 2DSZA 5HDRA 3RM4A 1BSIA 1PX4A 5A8NA 2O9OA 3ZM8A 1MW1A 4M80A 3WF1A 3BSGA 1KR0A 2GK1A 1FH7A 2YL8A 3IAPA 1ZBWA 2FHFA 1H5VA 2Z1SA 2XJ7A 5LA2A 1AQ0A 3VGGA 1UD5A 1G01A 1BAGA 2QPSA 4KH2A 4UQEA 1GNXA 1KR1A 5JBEA 3W6LA 3WUEA 4QLKA 2Y4SA 4TTGA 3EDDA 4A3YA 4BQ5A 1C91A 1FHDA 4U31A 3ZJ7A 5EMYA 4ML4A 1S46A 1UR2A 2E3ZA 4NRRA 4UFKA 2W67A 4QFUA 1JZ8A 4Q22A 5FL1A 1TVNA 3CUHA 1V0MA 1HJSA 3WNKA 3ARZA 3NJ3A 1EH9A 2PWFA 3VDAA 4AIUA 3WH5A 4D1JA 1V02A 1EOKA 1VBRA 2XIIA 5ECUA 1NP2A 3OLEA 1W2VA 2CEQA 1UWQA 2QF8A 1UR0A 3WF4A 1UH4A 2JF6A 3AZRA 2BS9A 3UG3A 1MQPA 4MB3A 1MQQA 1GOWA 2ESCA 3VIGA 1QVBA 3SCPA 2W4XA 3N13A 1J12A 4BF7A 1V02E 4UFMA 1WO2A 2D23A 4DWSC 4TX8A 2BHYA 2D22A 5DO8A 1ITCA 2BY3A 1PEZA 3F4VA 4UQ9A 2FDMA 2EPMX 5BXSA 3FAXA 5I3DA 5LA1A 3FHAA 3WDHA 4R27A 3AICA 2YA2A 4AZGA 5A6SA 3IJ8A 3VDBA 3W4RA 4Q7NA 3WD0A 2D24A 4M56A 1VJZA 1HL9A 3MMDA 2ZWYA 1DWIM 1FA2A 5I6SA 1KWGA 2D1ZA 1I1WA 1UHVA 2WKLA 4FLOA 4U5IA 1LL6A 1RH9A 1BGAA 4W7WA 4UOZA 2YBTA 2QLYA 1E0VA 5A2AA 4AZHA 2W91A 4LPCA 1XGZA 3ZT7A 3QHMA 4PTVA 5HNNA 3SURA 1KXVA 2AOSA 4NRSA 6A3HA 4U33A 2G8ZA 1EOMA 1QI2A 4WF7A 1X6NA 3VMOA 3IAQA 3CZJA 1NP0A 2XM1A 2GSJA 1IT0A 1XH1A 4DWSB 1CLVA 5D4YA 4WKHA 5M3WA 2WVSA 3VDHA 3CPUA 4CGTA 3PZTA 1JYNA 3SCNA 1UWSA 4UFJA 4NZCA 4B9YA 4H7VA 3EMCA 3AJ7A 4E8DA 1Q6DA 3K8LA 1V6VA 4X0NA 3ARPA 4H04A 1E43A 3SCTA 5M17A 1E5JA 2D20A 3L4UA 4D6DA 1BFNA 1KBBA 1XD1A 4V2XA 3ZJKA 3ZJ8A 2O9TA 4JL1A 3WSUA 2G3NA 3SEPA 4H8UA 1PAMA 5E70A 4PCSA 3CHDA 1XSJA 4BZYA 1AMYA 1AQMA 1E6NA 4KWUA 2DSUA 3FAWA 2G41A 2V38A 1R85A 5BRPA 3OLGA 4CCCA 1JNDA 5CZKA 1VFOA 4AD2A 1JZ3A 1GOKA 3CBWA 1OM0A 3GNPA 2JEQA 3QOMA 4OUEA 1OD0A 2E9MA 1G0CA 8A3HA 1KBKA 2WZHA 4U5KA 3GXDA 1E5NA 1VEPA 1CGWA 3OB8A 1MW2A 5HBFA 3B8SA 1OD8A 4TXEA 2XM2A 4M82A 4IPLA 3VMPA 1QBAA 2WXDM 2TAAA 3WQVA 3VDCA 1ODZA 3BAYA 2DDXA 2WWDA 1EIBA 3T2OA 5I78A 3KZSA 4UZUA 2WC7A 1H0GA 3AOFA 4J27A 4TUFA 3VGDA 5C70A 4WIWA 2XVPA 2V3FA 3D3AA 3VM5A 1GVIA 3M07A 2VTFA 2D2OA 4DM1A 4XUYA 3W82A 2EEXA 2V5CA 4CVUA 2C7FA 3WL0A 3BAIA 2XYLA 1UD6A 1FHLA 3B9EA 1EHNA 3CUFA 1MXDA 1FP9A 3MO4A 2WMFA 1HJUA 3TONA 4P7LA 1CENA 2WHLA 3BGAA 4GZIA 1Q4NX 1U30A 4W5UA 2XVLA 1KXQA 3KL5A 1ISXA 2VVSA 4EK7A 1WZMA 2ZX9A 4H41A 1BVNP 1K6AA 1ZBVA 3DHUA 4CD5A 1W9DM 3ARQA 2VO5A 4GI9A 2WHKA 4J3SA 1U33A 3BXWA 1L8NA 2DH3A 3QHOA 3BAWA 1V08A 1E6ZA 4PN2A 1OIMA 1NWSA 3W6MA 1VEMA 1XH0A 3THDA 2WCGA 2BFGA 2QMJA 4CU6A 4BA0A 4H8HA 2YA1A 3N15A 4J3WA 3W81A 1EDTA 2CERA 4J7RA 4M8UA 5E6ZA 5ABEA 3EYPA 1W32A 4GZJA 1LWHA 2VMFA 1MW3A 1C3FA 1E15A 2CXGA 3N17A 3WUBA 2YOCA 3RM8A 1QW9A 1E6QM 1JD7A 1H1NA 3W25A 3AYRA 4L4PA 4ZXLA 3MUIA 1QI3A 3A47A 5M5DA 2VC9A 4D6HA 3A4XA 1GQLA 2OSWA 4CD7A 4QAWA 3SCVA 4HZ7A 4XZBA 4C7FA 5DMYA 3GYCA 4M1RA 2AAAA 1GOQA 3VO0A 2WW5A 1GQJA 4AWEA 3PZVA 3WDQA 3M6DA 3WD1A 3M7SA 2DPEA 3NUKA 5A94A 4P7NA 3WQ6A 1K9EA 1J0YA 1I75A 1CBGA 1QNQA 4YPJA 1TG7A 1V6XA 4PMRA 5IHRA 3O2LA 1UWTA 3ZIZA 1E56A 1VJSA 4DM2A 1G94A 5KEZA 1C8YA 1H4PA 4RL3A 2OSYA 3VNZA 1KFWA 2CBUA 2JALA 1JI1A 2ZIDA 3SCSA 2EQDA 1HF6A 1IV8A 3PZUA 1BF2A 3RM9A 1WKYA 2VRQA 3GM8A 1VFFA 2W92A 3WN6A 4JKKA 3W0KA 3N04A 1JZ2A 1XSIA 1J0KA 4AIEA 1C7SA 4MB5A 1KXHA 3GBEA 3RILA 4KGLA 4P7QA 3UR8A 4D71A 5A8QA 1XCXA 1E6XM 1KGUA 4MDPA 1B1YA 2EPLX 1JDDA 4JL2A 2WCSA 1Q6FA 4QCEA 1OGGA 4KRUA 2G3IA 5E0FA 4AD5A 3BCFA 2ZXQA 4EANA 2ZUNA 1MFVA 1UYQA 4MPKA 2WM0A 3WFLA 3MSGA 1PIFA 3UR7A 2O92A 1J0JA 1DWFM 3EDFA 5HOSA 4HA3A 2VZSA 3OZPA 3LPFA 4HMDA 4W8BA 4WJXA 2Z1KA 3SCRA 3N18A 1TR1A 4HZ6A 2V3GA 1HJWA 1ZBKA 4GKLA 1H41A 1UKOA 5I23A 2DGAA 1UKTA 3GDBA 3MKKA 3MMUA 1GQKA 3TTSA 1CXKA 5CGMA 2ZUWA 2WKGA 2XG9A 2WAGA 1E4LA 4IPNB 4FLSA 4CVWA 1H3GA 1M01A 4HZ8A 1JL8A 1E4MM 1OWQA 1JAEA 4PMVA 1TMQA 3SCQA 1WNOA 3N1AA 3WNMA 4W93A 2JE8A 2GJPA 1TA3A 4PYSA 4X9YA 2VOTA 5E9AA 4AZ6A 4AW7A 5A6JA 2QV4A 5AC5A 3O9NA 2OYLA 1BG4A 3WD2A 2VL4A 4M81A 4BQ2A 5I2UA 4W85A 3ZJ6A 1VEOA 4B9ZA 1FFQA 1QI0A 2WPGA 4W5ZA 1CLXA 1FFRA 3WQ8A 3ZT6A 2WK2A 1EQPA 2CKSA 4AC1X 1LL7A 4JAWA 2ZUMA 3AHXA 2VT0A 3BAKA 1QHZA 4HMCA 1HN1A 3AIWA 3VX0A 4XX6A 3AHZA 1W91A 3ARVA 2WMIA 2ZE0A 5CPQA 1MYRA 3WDPP 1QNOA 1KXTA 1EDQA 5A6BA 2DH2A 2YKKA 3L4VA 4JHOA 1V03A 1HJXA 1B9ZA 4M29A 1UR4A 2YDRA 3NCOA 5BRQA 2VX4A 1JYXA 4L4OA 2AMGA 4PMUA 3RDKA 3VM7A 3G6MA 1XCWA 3MSDA 4PMXA 1TZ7A 1A47A 3W28A 4WKFA 3WIJA 1HL8A 3MV11 2FGZA 2GDUA 1ZU8A 4HOXA 4ZEPA 3IJ7A 2VX5A 5GNXA 2G4FA 1OT2A 5A95A 2VZTA 3F5KA 3F5JA 4CU7A 4AISA 2J7GA 3VTRA 3L4YA 2WWCA 2EJ1A 4URIA 1DWJM 3OIHA 4MAZA 4QP0A 3I3BA 3AIRA 4UOJA 4Z2LA 3VVGA 2CETA 2VCAA 1CXEA 1H0IA 4AD3A 1GJWA 4PTXA 2XHYA 3PZQA 4LYPA 4W87A 1J11A 4J28A 4KRTA 3VIHA 2NT0A 3CGTA 2WMHA 3L4XA 5A2BA 2J7DA 3NSNA 4AEFA 2G3MA 1SFSA 2VURA 3OGVA 1NWRA 1UG6A 2CBIA 4E2OA 1E70M 2WB5A 2PBGA 1SYTA 3CHCA 7TAAA 1NWUA 2EXOA 1OBAA 1W3KA 4XB3A 5ABGA 3WNLA 2VRJA 3CZEA 4LQ1A 1UD3A 3UETA 2BVYA 4FLQA 3CZ8A 1UWIA 5A6BD 2D0FA 4A4AA 2F61A 2ZUVA 2J79A 1PX8A 3EBVA 3T08A 4ZXOA 3RIKA 3TTQA 4PMOA 3WQ5A 1X6LA 3WENA 3AS1A 2OWCA 3PZ9A 1M7XA 1JFHA 1HKKA 3FNDA 2ZICA 2A3AA 1UA3A 3GH7A 5F7UA 1CGTA 1DWGM 2W61A 4KGJA 7CGTA 3THCA 1JNEA 2VZUA 3NSMA 1CGYA 2VUYA 1QI4A 2XUCA 3A4WA 4LXFA 1L0PA 1QOXA 3VD7A 1E72M 1GOIA 1KGXA 4PCTA 1DTUA 3ZQ9A 5FOOA 5CLWA 1WDPA 4W89A 3EMZA 3WL1A 2ZX5A 3WEZA 2YJQA 4S3JA 2WVVA 5FL0A 4PMDA 2XSBA 4J3UA 1RD6A 4HA4A 5FD0A 3LPGA 2CBJA 1G9HA 2J7HA 5FIPA 4TOQA 5GNYA 2CCRA 2GJXA 1E1FA 4UFIA 2MANA 3AS2A 4MB4A 1PPIA 1JG9A 1M04A 2BHUA 3N9KA 3AHVA 5EB8A 4QLJA 5JBDA 1VENA 3T2QA 1BYBA 3GNRA 1W1VA 5GNZA 2CHOA 3AXIA 3MUAA 3EDKA 3NDYA 4UQAA 4D6JA 1TUXA 1BQCA 2E0PA 3VILA 2Y24A 4D6GA 4Z2KA 1R86A 3W53A 1ZS2A 4MNLA 4Z2GA 1E4NA 5JUVA 4UFLA 1J0HA 3BSHA 1J01A 1V6UA 3WEOA 3OZOA 1HKJA 5KZ6A 4GQRA 4GZEA 3PZIA 3SUVA 5IFTA 2UY4A 2WSPA 2PWDA 2GVYA 1ZJBA 1ISWA 1QHPA 2FGLA 1GORA 4OKDA 4OOUA 1D7FA 2X1IA 3PZGA 2J25A 1E0WA 4B3LA 1CXFA 3B9AA 1OIFA 4UTFA 3VOCA 3APGA 1W1PA 3QHNA 1OINA 3KE0A 4X0VA 4BQ4A 2ZX7A 3LMYA 4MTVA 4W88A 1HX0A 2X2YA 5JBFA 2E8ZA 4DWSA 5CPTA 4D6CA 3DECA 1JZ4A 3VD4A 4QLLA 4AD1A 1GW1A 5HPOA 4A3HA 4W84A 8CGTA 5FCZA 3AMGA 2CITA 4D72A 2F2HA 1OCQA 3CIVA 3VIFA 4HA1A 1SMDA 5ABFB 3GZAA 4AZCA 1ISVA 4LYQA 2VQTA 4V28A 1W1TA 1JDCA 2OLHA 4F79A 2B31A 1ECEA 3OBAA 2WLYA 3TP4A 3VIMA 4P8XA 1HKIA 3L2MA 5BCAA 1B3WA 4AXNA 4MADA 2JIEA 3GH5A 3ALGA 2J77A 5IDIA 4GO9A 1UR9A 2WNWA 4LGXA 1WAWA 3AIEA 4UOQA 3RPMA 5BROA 3WUGA 2X0YA 2W62A 3U5UA 3WEMA 3DYOA 2CBVA 5CXPA 5A8MA 3PHAA 3RJYA 4NI3A 5E0CA 4JKMA 3GBDA 1CGVA 3MU7A 1VBUA 2XPKA 4AD4A 2QHAA 1P6WA 4DUWA 4P8VA 1R7AA 1JDAA 3N11A 4Z2JA 1DP0A 1E0XA 1BVZA 2XSAA 3U7BA 1C8XA 1J0ZA 3TTYA 1UZ1A 1AQHA 1UZ4A 3VD5A 4U2YA 1J9YA 2DSVA 1WZLA 4HPHA 1XHGA 4HOWA 2FH6A 5HPCA 3PN8A 3AIBA 3D5HA 4GO8A 1ESWA 1W1YA 2WLZA 4F9JA 3MMWA 4HPGA 4R5EA 2BHZA 3POCA 2D0HA 4UCFA 2W5FA 3BLKA 1UKSA 4CKQA 3MUZ1 3VU2A 4W7UA 1NQ6A 3NDZA 2RGMA 2BY1A 2DSKA 2GDVA 4YHGA 1RPKA 4HMEA 1EDGA 2J8FA 2WZIA 2WCAA 1NOFA 1JAKA 5BXTA 4GXPA 3OGRA 3VKKA 4D1IA 1SR0A 1E3ZA 2Y5EA 2J7EA 6CGTA 4OBRA 4MJ4A 3EMQA 3VNYA 3W24A 2NW0A 5A6MA 5JIPA 2VJXA 3AXHA 3BMWA 4WKAA 4GINA 4Y7EA 4AMCA 2WANA 5E6YA 3ALFA 1UD2A 3DHPA 1GOMA 3GXMA 4E4PA 1Q6EA 1YQ2A 1CGXA 3CMGA 2OYMA 4ATDA 1W9XA 2BXZA 1UR8A 1C7TA 2A3EA 4U2ZA 3VPLA 1UKPA 1E4IA 2V3DA 1HP4A 2QPUA 1WCGA 4OZOA 3AIUA 2PC8A 1K9TA 3WBAA 4D6IA 4AIOA 5IFPA 1E6RA 1BLIA 1E6SM 3WUFA 2O9RA 2BNJA 4CUCA 1K9DA 1BYCA 3ZMRA 4YHEA 2V5DA 1GVYA 3PTKA 2J8GA 3WQ4A 2DSWA 2C8NA 1QHOA 3WH6A 1ODUA 1JFXA 4UZSA 2XGBA 1B31A 4GQQA 5EFFA 4CD6A 4PSPA 1CTNA 3AHTA 1ITXA 1LLOA 3WDJA 2XIBA 3HU7A 3WD4A 5D9PA 1XYFA 1Y7VA 3QOKA 3TA9A 1V3IA 1NOUA 1HXJA 3VIPA 2E8YA 2GFTA 4CD8A 3UERA 1TE1A 1V0NA 5I79A 4JHZA 4YN5A 3CUIA 4MB1A 5I5RA 1SMAA 4PUDA 4WLCA 4GIAA 4TVDA 2X09A 3L4WA 6TAAA 4LX4A 3PZMA 1XV8A 3W38A 2D3NA 5D9MA 3OA5A 1MXGA 5LA0A 5DT7A 1M53A 3SIMA 4KMQA 2VR5A 1W3JA 3WH7A 2ZUUA 1MFUA 2YDQA 4BCEA 1LF1A 3RMEA 5JIWA 4C7GA 3GNOA 1W9BM 1HVQA 2J7FA 1EA9C 1XRVA 3AROA 3M46A 5IXEA 5TD4A 4U3CA 4PTMA 2A3BA 2RGLA 2VX7A 2J78A 3AXXA 2YDSA 3AMCA 4W7VA 3L4TA 3OGSA 2OWWA 2GK1B 1WZKA 1XYZA 2DEPA 1EHAA 3EDJA 4CN6A 2CNCA 1I1XA 1EXPA 1WDRA 4AZ7A 4J3XA 1VFUA 1LQ0A 4W8AA 1BYDA 1GQIA 1D3CA 1OSEA 2IXVA 2VRKA 1CPUA 1XD0A 2FHCA 3AQUA 5CSYA 3HJEA 4CU8A 2XFFA 2ZWZA 1QI5A 2CYGA 3VIKA 1WP6A 3W26A 2BV9A 1JD9A 2BVTA 1WZAA 3NYDA 1ZJAA 3HMCA 2WHJA 3CHFA 1B2YA 3SUUA 3U5YA 5C71A 1HVXA 2ZXAA 1EO5A 4FF5A 5I0DA 1B3VA 3S6TA 1HKMA 1JGIA 1BG9A 1GPFA 1F4AA 3PZNA 4F66A 1E3XA 3CMJA 4MAVA 1CXIA 3POHA 4XV0A 4ATWA 1FP8A 4NSBA 4P7RA 3ZR6A 3IANA 1CXLA 3GXIA 3CO4A 1GOOA 2YA0A 4F9DA 4U3AA 4JFUA 1HT6A 3VIOA 3E1F1 1IZJA 1TCMA 2WVUA 1US3A 4PTWA 3WNPA 2W66A 2J75A 4QCFA 3ARRA 4J3VA 4P8UA 4UNIA 1C8QA 2D0GA 3UG5A 5E09A 3ZO9A 2VI0A 1FH8A 1MW0A 4CCDA 3CH9A 1HNYA 3UESA 2J47A 3OLIA 4TVCA 4PMYA 1U2YA 2WBGA 1MWOA 1OT1A 4F8XA 1CEOA 4ACZA 1V3MA 1QBBA 1N82A 1JZ6A 1UH3A 2XTKA 1E55A 3AS3A 5GPRA 4JFWA 1ZBCA 2IXUA 2WVVB 1GHRA 1JYVA 1JXJA 4IM4A 3PTMA 4IUGA 5DF0A 3K4AA 4GPNA 4JIEA 3T0DA 1JF5A 1E6PA 1PJ9A 1V6WA 4CCEA 1E73M 1KGWA 2NT1A 1YHTA 1R87A 5D8ZA 1W9UA 2XFRA 2GJXB 3W37A 4PEEA 4P8WA 4MNMA 1E71M 2DIEA 2PB1A 1E9LA 1K9FA 1X1NA 2Y8VA 1FOBA 4V27A 5LYRA 1WDSA 3CLWA 1UOKA 2HISA 4TTUA 2V3EA 2DQXA 1NM9A 5A6LA 1W9VA 5DEZA 5AY7A 2E40A 5DT5A 2PWGA 4JCMA 3EDEA 4CD4A 3AI0A 1CECA 3BC9A 4S3KA 1Q6GA 3WDIA 2VZOA 3AYSA 3KL3A 2XVNA 3UG4A 3MUY1 2XGIA 1B3ZA 3FN9A 4B15A 3U57A 3DYPA 3AISA 5A1AA 5BYWA 3VGBA 3SCOA 3KL0A 1J18A 2XWDA 3WH8A 1CNVA 4PSRA 3GTNA 2JFEX 1WDQA 2DT0A 2UWFA 1KB3A 3AMKA 3II1A 1JF6A 3SUTA 1PX3A 3VINA 3VD3A 1UR1A 2BXYA 2DT2A 1WE5A 2A3CA 1KCLA 4MDOA 5CSUA 1E1EA 3T0AA 3QGVA 1LG1A 4PBGA 3NIYA 1O6IA 2XVGA 4XZWA 4Z2HA 5A3HA 4RE3A 3QR3A 1TFVA 3BAJA 4AZCB 4TVUA 3FXYA 2CESA 3BH4A 4NF7A 1UUQA 1LWJA 1UD8A 4N0RA 2BVDA 2WMJA 4D6FA 5AYIA 3WD3A 5EFDA 4ATLA 5BWFA 5M03A 1GZJA 2D3LA 3K46A 3DC0A 2JIWA 5DFAA 3VD9A 3PBGA 1A3HA 2VCBA
chains in the Genus database with same CATH superfamily
4HJFA 2EO7A 1DEDA 3MVTA 4A6GA 3NYZA 3A12A 4HP5A 4B5WA 2XIJA 3SCWA 2YB1A 2DIJA 3GHRA 1NWTA 3T2PA 1MSSA 3TAOA 2OSXA 1EP2A 3IRSA 3KWXA 4IUOA 3H2CA 3T4WA 4QQ3A 4K1WA 3W74A 2XP7A 2J74A 2QCFA 1BWVA 1KQYA 2ZCGA 3L23A 3LHUA 1XSKA 4Q8NA 1ISZA 1GJUA 5AKQA 1VP5A 4UFHA 3WK0A 4RV8A 4IIFA 2BGQA 3SUWA 3UQIA 1OK6A 1A80A 3ANUA 3AWOA 5CJ5A 3L5LA 4BS0A 2XH4A 4NY2A 3PF3A 5DRCA 3BWWA 1IZKA 2ZR6A 3KBWA 1HJVA 2A85A 3GTFA 1TRIA 3ARYA 3HG3A 1B9BA 4ZE5A 3E0WA 4AY7A 1LYXA 1UA7A 3LYEA 4AY1A 1Q6HA 1P0EA 3ECQA 4I8YA 3DN5A 3FLUA 2X40A 3GU9A 1K8CA 3TYDA 3EKGA 2PBOA 1ICPA 4Q4MA 5FF4A 2WC4A 2PLCA 3NQBA 2YR1A 4Y9AA 3RO6A 3W88A 2WQDA 3QW3A 3MV01 1V6TA 3A24A 2ABBA 2CKRA 2HZGA 3Q94A 1JCMP 3K4DA 2OWXA 1KM1A 3TAKA 3W83A 2C0HA 5GVJA 2HNEA 2QPXA 3GKFA 3LTSA 4C1NB 3G6LA 4BI6A 1GVQA 1F4HA 3VIJA 4OBSA 3S4TA 5D75A 3ZYZA 4JCLA 2M1IA 4C6QA 2V2HA 2XFYA 5ABFA 4JX5A 4FLRA 1ONRA 1NIUA 3MSRA 1JRCA 3K8KA 3E5PA 3NQAA 4Q4RA 1OFEA 3NQCA 3LTYA 3GY1A 4LAWA 5D05A 2P0IA 4IQEA 4A3RA 4JYEA 2C6QA 4NJGA 5C8BB 2A3HA 4UMBA 2Q8XA 3C2VA 4RR4A 1W54A 3FOKA 4JTGA 1E0UA 3MPGA 1KQZA 3E49A 4H8VA 1Y8BA 3S0CA 1R9XA 1C92A 3T0TA 4PMQA 4O28A 4N42A 4TV6A 2BOEX 3OLDA 1YXCA 3SADA 2VZVA 2ZRWA 3CH0A 3FYYA 4PMZA 3GVVA 2JF7A 3K2GA 4X60A 1UWUA 5CC5A 1BGGA 3H7VA 4TX6A 1TMHA 3HTWA 3R8HA 4AEEA 1Z32X 1RALA 5JH1A 4F2TA 1TX2A 3G1FA 4ZQNA 3S5NA 2REQB 1LOSA 5B7YA 4ZOAA 3M7WA 4ZFMA 3A4AA 3PWGA 3FS2A 2CU0A 3TTOA 1OGBA 2QUUA 3H2MA 4M6UA 1JZ7A 2OO6A 3UD6A 3EEZA 3WH9A 4OV4A 4IMEA 1Q6IA 4DF1A 3KHDA 4JX6A 5A8OA 2J7CA 4RE4A 1SQ7A 3UEQA 3SBFA 2FZDA 4PR4A 3ERPA 2J13A 1NEYA 4PH6A 3GU0A 1BXCA 2GLKA 4QDMA 3CZLA 4J3TA 2Y8KA 4JKLA 4HGXA 2I57A 4FA3A 4N9BA 4IISA 1KRBC 3Q45A 3R5EA 3SGUA 3NM1A 2WMIB 3B4YA 3TSDA 5H2ZA 2OYKA 1VF8A 2HV5A 3S46A 3ZSSA 5HNUA 4DPQA 3CTTA 4HCHA 2F2KA 1ZZMA 1C9WA 5M2FX 3BAXA 4HA0A 1BRLA 4LVFA 4E8GA 4CQ9A 1ISYA 1QNPA 4C02B 3KBNA 5HXMA 3H2OA 4GUFA 3WJXA 3HBLA 1Q7QA 3WKZA 2BG5A 7A3HA 1DWAM 4I7UA 4ZO9A 5GPGA 4W8LA 3JW7A 4H9UA 1RA5A 1BXNA 1LT7A 1DORA 4BKNA 3WFZA 3CV7A 3QSRA 5BWAA 3GH4A 3PB2A 4P7OA 3HZ3A 1Q6CA 2QMKA 1S2AA 3W27A 2ACQA 2YL6A 3UQNA 4AZ5A 5HINA 1A5BA 4XQ6A 4PMNA 4WSHA 1I60A 2IQDA 2QKFA 4WOQA 1DOSA 2HVMA 1XBYA 3L5MA 4GGQA 3T0BA 3VGEA 1V0LA 4HU8A 3CZKA 3JUGA 1J4EA 1MQRA 1DWHM 4CQBA 3PFMA 4AD0A 4JEQA 5D8WA 2WJZA 2PF0A 1XICA 4E4FA 3PJTA 3HF3A 2CWXA 2Z1XA 5J5RA 4QE5A 4M1BA 2VGBA 4HOZA 2J9ZA 4XAKA 2TPSA 3ISIX 4DJFA 4P5UA 5DIUA 2BY0A 2ZADA 3PB0A 5L6UA 3AO0A 4AYSA 4AZBA 2FMNA 2J4GA 4RPPA 1CWYA 1HJQA 3BK0A 2R91A 4K36A 4XVEA 1F40A 3STEA 1PX4A 3HIJA 4UTJA 2QJNA 3EX3A 1FKFA 1MW1A 4MLJA 4JIIX 2GK1A 2YL8A 4ODPA 2Y62A 1SO6A 5CZSA 3Q58A 1W17A 1UCWA 4Z0JA 4KH2A 3VOIA 4RCXA 5BZAA 1OX4B 1KR1A 4JD4A 4C1KA 3NDOA 5C2XA 2Q01A 4U31A 3ZJ7A 5EYWA 2E3ZA 1IT8A 3ZFHA 4UFKA 2OEMA 2FPVA 1S5WA 1V0MA 1HJSA 3C3UA 3WNKA 1EH9A 2PWFA 3PG8A 1GWJA 3WH5A 2P53A 1K7FA 4D1JA 1N2VA 3OLEA 1XLDA 4IMFA 4F0MA 2DZPA 1JVNA 1XBXA 1UH4A 3NG3A 2QVNA 2J6XA 2E67A 1GTEA 4QEHA 2OEJA 1QVBA 3SCPA 3TMQA 1DL3A 4BF7A 3V1PA 1FXPA 2D23A 4DWSC 1Z7AA 1EXBA 2BHYA 2D22A 1AJ0A 2CLOA 4XAZA 5JMUA 5BXSA 1DJXA 5I3DA 4XKYA 4QZVB 3PBYA 4EF8A 3W7CA 3AICA 4BR1A 2OLAA 3L0GA 2EAWA 1PB0A 4M56A 3MCOA 4HNTA 3D47A 2ZWYA 1DWIM 4INFA 2CLHA 3KVJA 1VQTA 3F7JA 1A5KC 3SN1A 5CC7A 2PWUA 4JTJA 1I1WA 4V15A 1UHVA 2WKLA 3M4HA 4UOZA 4YTRA 2QLYA 5A2AA 4IPIA 4LPCA 1EEPA 3XISA 1P0DA 4XD5A 3S8HA 2AOSA 5BOEA 2XZ9A 1QI2A 1XUZA 4RX0A 5H8PA 1XPYA 3TU9A 4B4HA 4CNPA 3REQA 1X6NA 1MZRA 3ID7A 3TN3A 3IAQA 4UXDA 2XM1A 1XKYA 2QCGA 1KV8A 1EPVA 2HBVA 1IT0A 5TF0A 7PTDA 5T91A 3PC0A 2WVSA 4CGTA 3PZTA 3L67A 4H7VA 5LIKX 3ENLA 4E8DA 4X0NA 3ARPA 3I10A 1K77A 3LV5A 4HNCA 3SCTA 3IJDA 1E5JA 3MKVA 5CKSA 4NG3A 3H21A 4V2XA 3ZWSA 1YW1A 3SEPA 3UF8A 3KTXA 5DRIA 5DXXA 1M41A 1TPDA 1OJXA 5E70A 4KWUA 2DSUA 5XINA 1BXBA 1FVPA 2V38A 2FGBA 3WQGA 4H4IA 1PDZA 1IEXA 1VFOA 4AD2A 1JZ3A 2QCEA 3TR2A 3H53A 1GOKA 3QKZA 1OM0A 3ZVIA 3QOMA 1K8XA 4NXKA 1OD0A 4DH0A 4OUEA 4U4MA 2AKZA 4JFKA 2Z29A 3V0TA 3GXDA 1VEPA 4DF0A 1CGWA 1LRQA 2XP5A 4IGMA 5HBFA 4KQZA 3VMPA 3W1XA 2TAAA 1UPPA 3PP7A 2BBFA 2BX7A 3W1PA 2FPTA 5I78A 1D7HA 2C1GA 4UZUA 3IIVA 1A50A 3TIMA 3R0UA 1FKRA 3FJ4A 3U6WA 2PDUA 1TCOC 2PBCA 2OU4A 4C6MA 4B5XA 2ZZ5A 2LJ4A 3H70A 3STFA 1I45A 2VTFA 3WJWA 4LAUA 3W82A 2EEXA 4BWLC 4BY3A 1EJUC 1JDFA 1VFSA 3BAIA 3HG5A 1VZWA 3URAA 1DQXA 4CQCA 1MXDA 3MO4A 4N6EA 3TONA 2DVTA 2G3FA 3IKDA 2VHLA 5HA7A 3FXGA 1KXQA 2ZRXA 3DI0A 2DVUA 1WZMA 1TJRA 1DKWA 3DHUA 4CD5A 3O6YX 3TN5A 5K3VA 1R30A 3QYQA 2WHKA 1U33A 4I3GA 3BXWA 3B05A 1LDCA 4H3DA 3EA1A 2DH3A 5C9ZA 3GU1A 5AHEA 3BAWA 1E6ZA 1TQXA 4PN2A 1GVEA 1YPXA 1KM4A 1NWSA 3GDRA 3WBWA 4H6KA 4CU6A 4H8HA 4KIRA 4J7RA 1F3EA 1YEYA 1HW6A 2HCVA 2YOCA 3BV4A 3IJLA 1DE5A 3RM8A 3PRBA 4Q8VA 3EOLA 4IIEA 1E6QM 3LU2A 4WR3A 2HRWA 4IPXA 3MUIA 3LHYA 3A47A 4GH3A 5DY3A 4UMCA 1JPKA 2PMQA 3L65A 2OSWA 3SCVA 4ZCWA 4C7FA 3U8GA 5DMYA 4GYJA 3GYCA 2Q8ZA 2NV1A 5HW8A 2WW5A 4XD4A 5CGQA 1DPMA 3KS6A 4QG8A 3D3FA 4AWEA 1RSCA 4PUMA 3EIPA 1FCQA 1J4IA 3M6DA 2VWSA 4XZ9A 1F61A 3QV9A 2XH7A 3NUKA 2NUYA 1Y5VA 3V35A 3NO1A 1K9EA 3PPFA 1PHQA 5L9FA 4FHAA 4YPJA 1TG7A 4JNZA 1RZMA 1V6XA 4C90A 2Y85A 1E56A 1VJSA 5KEZA 2OSYA 1UPMB 2CBUA 5FAGA 3W2MA 1JI1A 3ATYA 1E1CA 1PKYA 4IIGA 3BW3A 3UVIA 3RM9A 1WKYA 2VRQA 3H2FA 1BRLB 4S39A 2ZBTA 3N04A 1K4GA 3IIOA 1AL8A 4YYFA 4MB5A 3OEXA 3U2CA 1KXHA 3GBEA 1HQTA 5CPNA 1XYAA 1XL9A 1XCXA 1H7WA 1FDJA 1TPEA 1DBTA 1SM9A 4YVPA 5CPLA 1KGUA 4MDPA 4RDWA 2RUQA 4TIMA 1EJWC 3GC2A 3SSJA 1JDDA 3APTA 2WCSA 4S3GA 4KRUA 2R6OA 3TLQA 1EUNA 2ZXQA 1QWKA 4EANA 3DFHA 2VM8A 1UYQA 4F48A 4UCGA 2KZHA 3MSGA 3UR7A 2YB4A 4PBFA 3HQNA 2BDQA 2G0WA 1TTPA 2MLXA 4DZ5A 1QZ2A 4W8BA 2W0UA 1PE1A 2Z1KA 3SCRA 3UW6A 4DAFA 1LORA 3F2BA 1KRAC 1LOQA 3THQA 1HJWA 5I23A 4POCA 2DGAA 4XZMX 1MEWA 2V6AA 3W7JA 3LZ5A 3W2JA 4L56A 1FWCC 5CGMA 1XPGA 2Z1WA 2ZUWA 3EWZA 2WKGA 1PTDA 4Q8TA 4N19A 2DUAA 2YGYA 1H3GA 3S47A 3E38A 1JAEA 1KM6A 1I0BA 1QOQA 3P67A 1ENUA 4W93A 3R6IA 2WV8A 5E9AA 4H2HA 1RCQA 3O9NA 3EXSA 2OYLA 2IW0A 2GQ9A 2QCNA 3ZJ6A 3V5CA 1XIIA 1XWYA 2J9YA 3RXZA 3ZT6A 1EQPA 4AC1X 1LL7A 3AHXA 3W00A 4FX6M 4HB7A 3HFTA 2GJLA 1UZDA 1QHZA 1VPQA 4I90A 3H2EA 4ZVJA 3VX0A 1W91A 4NAFA 3M9YA 4NI8A 2PN0A 2HK0A 1EDQA 1QWGA 3OZMA 3RPDA 3GNXA 1HJXA 1B9ZA 1EYEA 1DE6A 2INEA 2YDRA 3F03K 3NCOA 5C5YA 2PDHA 4L4OA 4UWMA 3RDKA 3G6MA 1FCUA 3BLLA 3ANYA 5J04A 4JNMA 1IR2A 1Z89A 5C2GA 2Y89A 3ITLA 1RLCL 1TYGA 4AUBA 3UWYA 2VX5A 3W7GA 3F5JA 3Q2DA 4EWND 1RUSA 1QXLA 4XKYB 1GG1A 4RZ5A 3OIHA 4ZOEA 1G4SA 3B4UA 3E96A 3AIRA 4DRNA 3BO9A 3M5VA 2E1DA 1AG1O 2NV9A 3ZLGA 4ZMGA 2HNHA 3QV8A 4ILSA 3W7RA 3PZQA 4R53A 1C9DA 3TLLA 3C86A 3CGTA 3L4XA 2EULA 5C9XA 1UG6A 2CBIA 2ZKMX 3P5ZA 4WRHA 4NZJA 4E2OA 4NZ5A 3REQB 1VHNA 3LY0A 1NWUA 2EXOA 4NJKA 3DBNA 5ABGA 3GO2A 3WNLA 2VRJA 3CZEA 3KXQA 2BVYA 1DJZA 1FWEC 5AHFA 1NFBA 2YW3A 5D02A 2D0FA 2F61A 2ODOA 4HYWA 2J79A 3EBVA 5HQMA 4ZXOA 3TTQA 4ODKA 1DJIA 4F0HA 3SFWA 1M9HA 4JTKA 4QE1A 2R8WA 1I2QA 4DHGA 2OVLA 1D6OA 1XDMA 3GH7A 5HUAA 3KTSA 1U1HA 4MUZA 4L6OA 1CGYA 4UMAA 2VUYA 3A4JA 1U5HA 3L9CA 2PODA 1AD1A 2OELA 3A4WA 5HUPA 4DBUA 1IT7A 2WOQA 4W89A 4GVIA 2EF9A 3WL1A 4IH3A 1IYXA 2ZX5A 3N9SA 3WEZA 3U9IA 2NLIA 3GWQA 4DBEA 4HD5A 2DU2A 4PMDA 2XSBA 2AKMA 1UW9A 1RD6A 3BARA 1XLEA 4HK6A 5GNYA 1NDZA 2MANA 3V18A 1SR9A 1M04A 2BHUA 3AHVA 3TYCA 2NXGA 5J5DA 2AQWA 3UJSA 5AHNA 1W1VA 1H7XA 3IWPA 3H12A 3NDYA 3QFWA 4FXRA 2Y24A 4RKAA 4KCUA 4DRSA 2NWSA 4MNLA 4Z2GA 4HN8A 5JUVA 2Z2UA 1EGMA 1J0HA 1HKJA 4KCVA 5I3GA 3W07A 3P80A 3SUVA 3G1SA 2WSPA 4EX4A 3BW4A 2PWDA 4YTSA 2FGLA 2QCCA 4OKDA 5EGRA 5T9BG 1B6CA 2WPBA 1Q6RA 4IMDA 4KW2A 4PODA 1CXFA 1YDOA 3B9AA 3P93A 1AK5A 3LXAA 1YXDA 4AU0A 2ZX7A 4MTVA 3TUUA 1HX0A 2X2YA 5DMMA 5CPTA 4RW3A 1B4KA 4O12A 1JZ4A 1GW1A 3FYOA 5HPOA 4CQDA 2BMBA 4LAMA 2OOGA 2PV3A 4AG0A 3AMGA 4ZSTA 1TELA 4H83A 5BW6A 3VIFA 2OPJA 3BMBA 5CPMA 2BLEA 5CAKA 1FWAC 1QCWA 2VQTA 3P60A 5CJNA 2PLKA 1Q6OA 1O1HA 3L2MA 1DXIA 5CBJA 4DI8A 1ICSA 2OKOA 3GH5A 2ZVRA 4H6EA 2J77A 4A21A 2VC5A 1TV7A 2X0YA 1E51A 2E5BA 3MMTA 4D8ZA 1FY6A 3MP5A 3KACA 2YYTA 5A8MA 3PHAA 1H50A 2JBMA 3R10A 3P2VA 1X98A 4AD4A 2KGJA 1O12A 2PDNA 2QHAA 1R7AA 4Z2JA 2VGFA 1DP0A 1E0XA 1S5NA 1TIWA 3SN0A 3JR2A 2JKAA 1C8XA 3U7BA 1J0ZA 1TB3A 2X1TA 1AQHA 1UZ4A 4C6BA 4Y6GA 2Z0IA 4GJIA 1VD6A 2F9RA 4HPHA 3KAGA 4IICA 1XHGA 3NA8A 2FH6A 3AIBA 6XIAA 3D5HA 2Z2AA 4GO8A 4C6LA 3W7NA 2HPMA 1CT5A 3HPFA 2NVCA 3V0SA 1UIPA 2PC4A 4KEVA 2Y7EA 3POCA 2VXNA 1GYLA 1XIDA 3HOJA 3VU2A 3LEPA 2RGMA 4Q4SA 2BY1A 1W0MA 4ZB0A 3M0KA 4WXYA 4UTHA 2J8FA 3B04A 3OHMB 1NF0A 3RGTA 1XDLA 3CL6A 3UZWA 3W9ZA 4DRMA 4LBRA 2Z25A 1E3ZA 3N9RA 4GNJA 3CTLA 1O4UA 1OX6A 4OE7A 3B8VA 6CGTA 1SFJA 3W24A 3RF9A 3STCA 3MVIA 1NMWA 1KM0A 1NQKA 5JIPA 4WKAA 4Y7EA 1KNWA 2WANA 2GGIA 4DJEA 1WKEA 2PDCA 2Y7DA 1UD2A 1GOMA 3GXMA 1Z48A 2B7PA 2HBXA 4IQLA 4Q8OA 1WKDA 2F21A 3RRXA 1CGXA 2OYMA 1W9XA 4QAIA 5HW6A 4NVTA 2O4QA 1C7TA 4U2ZA 2A3EA 3U2OA 1UKPA 1QU4A 3C52A 4H9VA 2O0TA 3UQAA 3KABA 4Q7BA 4YMZA 1BLIA 4GIEA 2O9RA 2BNJA 4M7TA 3LXBA 4H01A 3UNDA 4DJFC 1P0KA 1GVYA 3KVLA 2P4VA 3PTKA 1K4HA 1EF2A 2C79A 3DESA 2C8NA 1QHOA 3GLCA 1ODUA 1ZY9A 4LAOA 2XGBA 4GQQA 1QNVA 4PSPA 4L1XA 5EMUA 3UXIA 1XYFA 1ZUAX 4KRZA 3ABOA 3VI2A 3QPZA 3MJYA 1NOUA 3VIPA 2OGJA 4YVVA 3UERA 1V0NA 2HWGA 1WUEA 4JHZA 3CUIA 2NLYA 3WK3A 5I5RA 3EPNA 3LNMA 4PUDA 3RLVA 2I7GA 3TA6A 4Y90A 4JDBA 4NAFB 1Y0OA 3IGSA 4WLCA 2G97A 2IPGA 1I6NA 1G4EA 4LX4A 5SWUA 1XV8A 4UDMA 1TWWA 5BMXA 5A6TC 1RJPA 1NFGA 4HHHA 4CQAA 2ZUUA 1MFUA 1XFCA 1AODA 5JIWA 4O54A 3W2KA 3QLDA 1VYRA 1ME9A 3L68A 3GHUA 1SVDA 4ODMA 5D33A 5TD4A 3OVGA 4PTMA 4G2PA 2J78A 2Y1HA 4W7VA 1W5MA 1U1UA 1VCGA 3BJTA 1WZKA 3PSVA 4TO8A 1F76A 3KOWA 3EDJA 1YMYA 2CNCA 3N2XA 1SU5A 1F6YA 2OZ8A 1JJKA 4AZ7A 1VFUA 1LQ0A 1BYDA 3BV7A 1L2UA 4L9ZA 3I6CA 3N3TA 3W1TA 1XD0A 4IT1A 2FHCA 4K2SA 3AQUA 4GX8A 2OEKA 3S5YA 1QI5A 4R9XA 4L3NA 1Z44A 2BV9A 3ABSA 3W26A 1JD9A 2HK1A 4ORIA 5MKGA 2BVTA 3W71A 4HKPA 3HFYA 2RKXA 2WNZA 4QX4A 2WHJA 2H3BA 3O5MA 1V5XA 3U5YA 1HVXA 1EO5A 1BSLA 4AVNA 2ASHA 1GPFA 4F66A 3CMJA 4RZ4A 3O1NA 1CXIA 4ROQA 2NXIA 4FAMA 5KSWA 3WLMA 1BWKA 4ATWA 3O0FA 3QYSA 1FP8A 4LBUA 1IR1A 4ONVA 2V5BA 1GOOA 3KWSA 1IEWA 3LBOA 1JCHB 5LHEA 4OVXA 4LNYA 2WVUA 3LG3A 3MSYA 1FWJC 3WNPA 3QC0A 3OQEA 2W66A 3W72A 1ZQ5A 5CAHA 2BOFX 3S3GA 4Q32A 3BZGA 4UNIA 5I3FA 3O5DA 5E09A 4GQGA 4CCDA 5LIWX 4YTUA 3UESA 4US5D 1GQNA 1YNPA 1XYLA 8XIAA 5D2WA 4D8AA 5XIAA 4KCWA 1P4CA 4F8XA 4PC8A 4ACZA 3UR5A 3PVFA 5I3HA 1US0A 3HG2A 3RK8A 1KM2A 6PTDA 2HDJA 5GPRA 3T1GA 1ZBCA 2IXUA 1GHRA 1Q13A 3V16A 1JYVA 2F6XA 3K4AA 4GPNA 4JIEA 1JF5A 1PJ9A 1AD4A 2L5HA 5H6HA 4DI9A 1VKFA 4MZYA 2NT1A 4QRNA 5D8ZA 4GJ1A 2PB1A 4WHBA 1K9FA 1HUVA 4NASA 1V7YA 3NQMA 4NJIA 3RITA 3FA4A 5E9XA 3M64A 2DQXA 1N8IA 3IJQA 5AY7A 2E40A 4G7FA 4ZPWR 1FKXA 1BL4A 5DT5A 1ZLPA 1OFPA 3CO8A 4S3KA 1Q6GA 5TIMA 2VZOA 3KZ7A 2XVNA 2VFGA 3MUY1 3VKAA 4DXVA 2Y70A 4R34A 3SY5A 5G1TA 4OFCA 1RQHA 2PRLA 3UWEA 2PPOA 1JGMA 3U57A 4ZO6A 3AISA 5A1AA 4JTCA 3D6NA 2PDMA 3TJIA 3WH8A 3MP3A 4MWAD 4HSHA 4DT4A 1PDYA 1EBHA 3NM3A 1GVRA 3AMKA 3LCXA 1TTQA 4HCDA 3VD3A 2VENA 4QBXA 2D2GA 1UP3A 1LG1A 4MGGA 2BTMA 1O6IA 4KQNA 3BE7A 2F6UA 3DZ1A 3QR3A 1A5LC 2J24A 1DVJA 4B3ZA 1JPIA 1G4TA 4D6FA 2JKPA 5BWFA 5M03A 1R47A 2D3LA 1R6WA 1DYSA 4W9PA 1D3GA 3KBSA 5CG0A 4QG9A 1UD4A 2ONEA 4TW7A 3EWCA 2WVTA 1V3KA 1TPWA 3K13A 2ZX6A 1OG6A 4EVZA 3B9DA 2ZOXA 3V3WA 4EPDC 2RAGA 2VR4A 2CHNA 1MNSA 3FA5A 1O95A 4PRWA 4NX0A 5D32A 1TV8A 1DHKA 1IWPA 5EKYA 1QW7A 1B3YA 3IK2A 5D9OA 3TJ4A 2FB2A 3AUJA 4O1BA 5EPDA 5FKYA 7TIMA 4QT2A 4OIFA 1VRDA 1VB9A 1MRAA 4ENLA 5MF5A 2ZVIA 4ZB2A 4E8CA 5HULA 1XLFA 1VAHA 4ZTYA 4DRIA 2Q71A 3VMNA 4IPPA 3FK4A 3N12A 4S1FA 3M0JA 4C91A 3TFXA 3ME3A 2W3ZA 3QGKC 1XKJA 3B06A 3G2GA 4KETA 1MVYA 3OO2A 4GI8A 2P76A 3MHFA 3T09A 1P5QA 4GVGA 1RV8A 4O13A 1D9EA 2CC0A 3L4ZA 4M24A 4R7WA 4WQ6A 3TC5A 4O17A 3M0VA 1H49A 2ZXBA 3B03A 3C2EA 3QEZA 4C6OA 3TJXA 5EBAA 3ARUA 1POKA 1F6PA 3WLHA 2BY2A 3WDRA 4TW8A 5A69A 1JCLA 1WB0A 3FY1A 5DO2A 1A5AA 1EQCA 3BLPX 4UR9A 1DQWA 4LCSA 2YDAA 3NQVA 4N4PA 3UPWA 4C5ZA 1QPKA 4DPPA 3QN3A 2E5DA 4KERA 5JH8A 4PZVA 1FXQA 1PBGA 5DIVA 3GB6A 4WEVX 5DELA 4BF5A 1XLLA 3O5GA 1ZFJA 4C6PA 2HXTA 3A6OA 1V3HA 3TNOA 1N8FA 1V93A 3WNNA 4CEUC 1NH6A 3VFCA 1OCJA 3BGGA 3BDKA 4B3KA 1QO5A 3ITOA 3NNTA 3WELA 2X7WA 2GQAA 5KZMA 2ZX8A 4JFVA 1GUVA 3R13A 1OC6A 4FK9A 4O4VA 1JUEA 4PUEA 3LSBA 4GUHA 1GHSA 4OJYA 4LYRA 5KTLA 4H2CA 4BJHA 2YL9A 4IMAA 1V6YA 5AVHA 3VXGA 3G24A 1JI2A 3LGEA 4O1CA 4S3DA 4A8NA 4UQBA 4TU1A 1V0KA 3OIXA 3AC0A 4FNQA 4W86A 3PSWA 2GGGA 2H8XA 1TVPA 4MJMA 2R24A 1CXHA 5KETA 4A35A 3CWHA 1IF2A 4FNRA 2PWHA 3SJNA 3LPPA 4MNJA 3BG5A 3IJ9A 1LG2A 1OFOA 1KC7A 2AQOA 3S2CA 3N34A 4FX8A 1MMFA 1BYAA 2J62A 3ZR4A 1EJRC 3Q67A 2FAPA 2QAFA 1Q1CA 1SO4A 4ML9A 2JEPA 2ZR5A 3U3HA 4E2DA 1JEZA 3N25A 3E0FA 4OU1A 4QROA 3IK8A 4QTGA 1JXKA 3S5ZA 1XH2A 2CLKA 1W5OA 2QV5A 1TPH1 2V8ZA 5MKGB 3KX6A 2QJIA 1G1YA 3SUSA 3WK2A 4DUVA 1XC6A 4UTTA 1Q7MA 3OW1A 4GZ7A 5F1UA 3MP4A 2E4TA 2YCLA 1UQZA 3BMVA 2M2AA 3HO8A 2YXOA 1EQ3A 3O3RA 2VOMA 3C0JA 1SO5A 1W1ZA 1GONA 1WOBA 4UIOA 3PY2A 4WSKA 3M44A 5C7HA 3AMLA 6ALDA 3USZA 4JZ5A 3G1YA 3DG7A 4EIVA 3KFTA 4Z1AA 1O5RA 1SW0A 2VVNA 2DG4A 4KFOA 3GXTA 1CDGA 1PWMA 2EPNA 1NARA 3UVAA 3OVQA 3WLIA 1MO0A 2F6KA 2UY5A 4EAMA 4PEKA 3S9YA 2E6AA 2X42A 4WK9A 3N73A 3Q65A 4DYEA 1M03A 5A2CA 1C90A 2RURA 1S3TC 1LL4A 5CPSA 4MWAB 3VIIA 1BPLB 1NOWA 2WC3A 1RY0A 5KZDA 2IF4A 4G9PA 3W29A 5A6AA 1J0IA 3LUOA 1PINA 4HNUA 3I3EA 3FW6A 2P8BA 4HPJA 3LENA 3P0XA 2NSXA 3I65A 1CIUA 4GI6A 4ACZB 4FNUA 3WMSA 1QPOA 1HL2A 1GCYA 1FH9A 3RUBL 3WJZA 1VGAA 3BOXA 1K7EA 3ARSA 2XDFA 4RXFA 2ACUA 4EXBA 1EB3A 3A3HA 5I24A 3RM4A 5A8NA 5C9RA 1IGSA 1TPFA 4PFMA 4M80A 3WF1A 3BSGA 3IAPA 1ZBWA 3F2DA 2A1YA 1HO4A 2XJ7A 2HMCA 3IACA 3NQGA 1BAGA 2QPSA 1GNXA 4CQ8A 2PPGA 3AWNA 2CZVA 4TTGA 2ZA3A 4O0QA 3I7RA 1S46A 2Y5JA 4WCJA 1NSGA 4C5YA 2PS2A 4QFUA 3M5XA 4HZMA 3A9BA 1S5MA 3NJ3A 4J4KA 3UJRA 2PDJA 4Q4OA 3CK5A 5ECUA 4KFNA 3N2TA 4A2SA 2QF8A 1UR0A 2QULA 1SSGA 3ZVHB 1EZWA 4KS0A 3WF4A 1RK5A 2JF6A 4U85A 3AZRA 4TYOA 1VFTA 3KW3A 3N2MA 3UG3A 4MB3A 3A21A 1GOWA 2ESCA 2MLYA 2W4XA 2ZR4A 3N13A 4RDYA 3PUDA 2NX1A 1KBLA 3KDNA 3COTA 2AGTA 3KCEA 1TZZA 2BY3A 4UQ9A 4Z17A 3KRZA 2YBVA 3VKDA 2YFOA 4O52A 5LA1A 2QDDA 2I1OA 1NDVA 4H9TA 5B80A 3WDHA 1UBSA 3FFSA 4AZGA 3IJ8A 4IQ2A 4O1EA 3FEMA 3IPWA 2D24A 4DEFA 1QTWA 3MMDA 3B0YA 2INZA 1KCZA 1PS9A 1FA2A 3G1VA 1VBGA 4U5IA 3HQPA 3C0QA 4W7WA 3PBWA 1W5QA 1YLVA 1XGEA 2FDSA 1E0VA 1WA3A 2W91A 4LS1A 3BICA 4UBPC 4PB3A 1XGZA 1I4NA 1KFKA 3SURA 1MUWA 4BEUA 4NRSA 6A3HA 2G8ZA 2VP8A 4TV5A 3IGHX 5H8UA 1RCXB 2PU1A 4WF7A 3BLOA 3RAOA 1G67A 4OBTA 3UWQA 1RBAA 1NP0A 3CZJA 1OADA 2XSXA 1XH1A 5D4YA 5M3WA 2ZFAA 3RFWA 3SCNA 1F8IA 2X30A 1F2JA 4JEJA 3AJ7A 5D09A 1Q6DA 3K8LA 4GBUA 3C3NA 3UGRA 4H04A 3TQPA 1DV7A 2DVXA 2RDUA 5KMYA 1KBBA 2O9TA 2G3NA 4NXSA 4C60A 1EJTC 1EJ7L 4DJDA 1H60A 4KKXA 1PAMA 1K3UA 3TDBA 4PCSA 4BZYA 2C1HA 3P82A 1E6NA 3M47A 5LNSA 3DCPA 5CSRA 3FAWA 4PULA 5FJIA 3UCDA 3BCJA 5HWCA 4CCCA 5FJJA 3CAKA 3K30A 3GNPA 3CBWA 3PBMA 1EL3A 1XLAA 4QXIA 4MKNA 6REQB 4UTIA 1H1YA 8A3HA 2PLMA 2WZHA 3MY9A 5DMLA 1AH4A 1Q6LA 3OB8A 1MW2A 5MHBA 2ITKA 1OD8A 2XM2A 3FDKA 4M82A 2WXDM 4XSMA 3WQVA 4GQBA 1B3OA 3BAYA 3LHWA 1EIBA 4DZAA 3PK7A 5CH9A 1YE6A 3M0IA 2WC7A 3AOFA 4J27A 3H22A 3VGDA 2Q3OA 3N6JA 5C70A 2XVPA 2NQZA 4Q4QA 5CZJA 3D3AA 2SFPA 3M07A 1OCBA 2D2OA 2F4EA 2V5CA 1SFLA 3UZXA 4CVUA 3CV2A 3LB0A 1FHLA 1EHNA 1ECQA 1RAKA 1WOAA 1CENA 2WHLA 3BGAA 1IEVA 5E93A 1U30A 3WLRA 4UTUA 1ISXA 2WO5A 1MRQA 2VEFA 2W9MA 1K6AA 2R1PA 4GI9A 1HTIA 3JS3A 4J3SA 1PIIA 3QHOA 3DFYA 4XWUA 4DJDD 1G7VA 1BVWA 2BZNA 4JTUA 5GJNA 3W6MA 2WCGA 2BFGA 2QMJA 1P43A 1A4MA 3N15A 3W81A 1EDTA 2CERA 5ABEA 3OODA 3EYPA 1W32A 5TAOA 1L6FA 5AECA 3U2EA 4QIUA 1SW7A 1E15A 3N17A 2E1WA 4Q6JA 4QDPA 2E6YA 1QW9A 2Y7FA 2FZMA 4Q6XA 3AYRA 1FCBA 4ZXLA 3SDOA 4CNUA 5M5DA 2VGIA 3EPMA 3SSZA 4CD7A 2Z1VA 4HZ7A 3V7PA 1Z9AA 4LVGA 3KAIA 1NELA 4M1RA 2AAAA 2PP1A 2ANUA 3RLGA 3JU2A 4EPKA 4H00A 5C7VA 3PR2A 3UXDA 3WDQA 9XIMA 2PDYA 3QH2A 4J2MA 5LKYA 3SO7A 5A94A 1F8MA 2Y78A 2RUCA 1QNQA 3DGRA 3EAUA 2OXNA 3NWRA 3C8NA 1KLYA 5FEPA 5LZLA 1UWTA 4DM2A 1EP1A 1G94A 4S3EA 3S1XA 4YJ5A 1ZHAA 3C4UA 4ICNA 2WJDA 1RBOB 2A7NA 5FI8A 1QFEA 2I5GA 3W0KA 1J2WA 2EG6A 4ADSA 1JZ2A 1C7SA 2YCLB 3CYJA 2YZRA 4D71A 2BGNE 2C19A 1E6XM 4Y9NA 1C29A 3W7DA 3HJZA 1B1YA 1HXVA 4Z1CA 4QCEA 1OGGA 4ZQOA 4DRHA 5E0FA 4AD5A 4Z1DA 3GVWA 1T5AA 3GRIA 4G1KA 4B2DD 2YPIA 4RDZA 3WZ0E 1TV5A 1PIFA 3UZYA 1DWFM 3R79A 3W7QA 2FYMA 3E2RA 2PV1A 4L4MA 3TEVA 3OZPA 4XK2A 2Q3RA 3DKLA 3LZ3A 4WJXA 3NQFA 1KT0A 1DJQA 1KFEA 4DBSA 5CBBA 3B0VC 1V77A 1TV2A 4MYAA 2XINA 2P8CA 3LA4A 4ODLA 5HQEA 3DHDA 2V3GA 1H41A 3FAPA 1UKOA 1I0DA 1SSDA 2VDHA 3GDBA 1JCJA 3QR1A 2GSHA 3CT2A 2Z2BA 2NWRA 3MWAA 3USBA 4CVWA 3ITCA 1M01A 4HJWA 2ZZ6A 1B5TA 3QTPA 4PMVA 4JIHA 5HKGA 4LC6A 4GK8A 3WNMA 2ZZ4A 2X0SA 2JE8A 3MZ2A 4XBJA 2RJHA 5LXXA 4GY7A 4ZPVR 2VOTA 4PMJA 3GXPA 4AZ6A 4AEOA 4ADUA 2QV4A 3PJWA 5A6JA 1BG4A 3L0KA 1F3TA 3MYOA 3UWVA 1KO0A 2VL4A 3CYVA 4M81A 4BQ2A 4W85A 1VEOA 3NPXA 4NYYA 2QDEA 1FFQA 4Y9PA 1CLXA 2OJPA 1JUBA 2WK2A 2CKSA 5AYZA 1PBKA 2VT0A 1HN1A 4R33A 1U22A 1EX1A 3DOPA 4XX6A 2WMIA 3S2JA 4N9CA 4JR5A 4IPJA 2G4JA 1QNOA 3TTEA 3T42A 3VUSA 1KXTA 2DH2A 2YKKA 4JHOA 3B7XA 4M29A 3B97A 2C16A 3NPVA 5BRQA 2VX4A 1JYXA 2W6RA 2AMGA 4PMUA 3VM7A 1FKGA 3UNTA 1W3NA 3MSDA 4FXSA 2OKTA 3BLFA 1OC5A 1GVFA 4WKFA 3NRKA 3GNDA 3WIJA 3LI1A 4A29A 5DXYA 3GPKA 2QZRA 4NJJA 1WKFA 3TOYA 2IQ0A 3IJ7A 5GNXA 2G4FA 1OT2A 5A95A 2QJJA 3F5KA 4CU7A 1YRRA 4FIRA 2J7GA 1OG0A 3L4YA 2WWCA 1K02A 1VR6A 4URIA 3ONCA 1W5PA 1DJHA 4JTDA 2X1RA 2OQLA 2NUXA 1D8CA 4MF4A 4MAZA 3RGCA 1VC4A 3I3BA 3H9RB 3DFNA 2NX9A 4I6KA 4Z2LA 2CETA 4ODQA 3EB4A 1CXEA 4F2BA 3T4CA 1GJWA 1IWAA 2ISWA 3WCZA 2XHYA 3H26A 1JQVA 4C6CA 1TJ0A 3TYZA 1J11A 2ZYFA 1XRFA 2V5KA 1DQUA 1V8EA 3LRKA 2NT0A 3LQGA 4ZA0A 2J7DA 4AC7C 2FB3A 2G3MA 4NKCA 3CWOX 1V79A 2VURA 3GD6A 3I6EA 3QJAA 4IFOA 3JZUA 7TAAA 1TTJA 3ITTA 1OBAA 4WDTA 2C1IA 4LQ1A 4LJ3A 4IX2A 3CZ8A 1UWIA 1FD9A 4A22A 3PG9A 4IGHA 1DXEA 4A4AA 1XYBA 1J5SA 3VNMA 1PX8A 3QMRA 4DN1A 3RIKA 4I5XA 3WQ5A 4G1NA 1WXZA 4KWVA 2PTXA 4Z1BA 1M7XA 3NXFA 1L9WA 1HKKA 2OQHA 1OX4A 4RUBA 4OWGA 4O1DA 3SAZA 1DWGM 1YE4A 4O10A 2W61A 5FF7A 2QCDA 1JNEA 3NSMA 4F4RA 4Y9MA 1A5SA 1CB7B 4LXFA 1L0PA 3UY8A 1GOIA 2NVAA 1DTUA 1F9CA 5CLWA 3HG4A 3EMZA 3ONBA 3GAKA 3RRAA 3NTPA 2VGGA 2YJQA 4S3JA 2WVVA 4PGLA 2GQ8A 3QW4B 2XISA 1WUFA 1UUOA 1VJIA 3LPGA 2J7HA 4FN2A 5FIPA 3UZZA 3HPZA 1E1FA 4UFIA 3I68A 1EC7A 1NDYA 4MB4A 1ROTA 1JG9A 1TWSA 3TMLA 2GOKA 4QLJA 5I06A 5JBDA 4DBWA 3T2QA 1U1JA 5LHFA 1EA0A 1SJCA 3B9NA 1L1PA 3AXIA 4AYGA 2ZA2A 1TX0A 1N7KA 1O66A 2Z24A 4D6GA 1D7IA 1Q2RA 3G1HA 4KCTA 2I9EA 3NZPA 3BSHA 1V6UA 3BL3A 2V67A 1R2SA 3DUGA 1R3TA 2VKZG 3NTYA 5IFTA 3CMFA 4HU4A 1GKRA 2R1MA 3B8IA 1ZJBA 4V1YA 1ISWA 1QHPA 1GORA 3W86A 2FMOA 3LMZA 3EWBX 1S2WA 4AXKA 3CT7A 3P3BA 3KM8A 2EJAA 3QHNA 3U48A 1AH0A 2FTYA 3KE0A 4X0VA 4BQ4A 2NQ9A 1OFDA 2MUCA 5JBFA 2E8ZA 3TQVA 4HNNA 4WOZA 1O1ZA 4HNLA 4A3HA 4W84A 5CSSA 3M0HA 2LPVA 1XIBA 4IQJA 3TQ0A 4WDUA 4U86A 1ALDA 2RFGA 3CIVA 1E0TA 3HQOA 3QY6A 3BQ5A 4LYQA 3E2VA 3SRHA 3JXVA 3FGCA 4V28A 2XFWA 4HBEA 5F2GA 2OLHA 2B31A 3CPRA 4AVOA 4XG1A 4JXCA 4XZHA 3RX3A 5BCAA 2H3DA 1EF3A 4IZGA 2INFA 2D69A 5LGXA 4HK7A 3GYEA 3R0DA 1UP2A 2W62A 1QPNA 2ZDSA 5LIYX 5CXPA 5C9UA 4NI3A 3GBDA 1CGVA 2QJHA 4HTBA 4DUWA 2Z1BA 5ABTA 1QK0A 4JYDA 5D04C 4E0CA 4ITZA 1BVZA 1XISA 3WLLA 3TTYA 3LXCA 3C5QA 4U2YA 2RDWA 3GHTA 1MI3A 2XU2A 4J35A 2PDIA 1FWTA 4JTRA 1ESWA 1W1YA 4DXXA 3MMWA 2GGEA 4LU0A 1AFSA 3KZPA 4GYPA 4JQ2A 5F2MA 5LNVA 2W5FA 1UKSA 3ABRA 3NXLA 3FSTA 1NQ6A 3NDZA 9XIAA 2HS6A 2VD9A 4BI5A 3TN4A 5AHLA 1NOFA 1YIXA 5BXTA 5TNVA 3OGRA 3VKKA 4D1IA 3L0NA 4NNAA 2Y5EA 1RD5A 3UI6A 4GH1A 1IGWA 1DJWA 3EMQA 3VNYA 5CCZA 1GGOA 2PEVA 3VOFA 4QISA 2VJXA 3BMWA 2V69A 1UASA 1VYPX 2CHRA 5AHMA 4E4PA 1Q6EA 4MHBA 2OT0A 4FALA 3U2ZA 4ATDA 1MNZA 2BXZA 2OT1A 3R11A 3P81A 1UR8A 1XIJA 3TK7A 1E4IA 3RR4A 3UZ5A 3CJPA 3QGAC 2YZ5A 5C0QA 3LCWA 1K9TA 4DAIA 3QV6A 3EWUA 4GIVA 4GGBA 1E6SM 2UZ9A 2RHGA 3WUFA 2ZE3A 3D0CA 1P6BA 4ZB5A 2V5DA 2PFHA 2GOUA 2J8GA 1XX1A 1SPQA 2V2CA 3STGA 3T40A 3WQ4A 2DSWA 3M41A 5I3JA 1QASA 4IWWA 1JFXA 4N4QA 4GRSA 4UZSA 5D2XA 5EFFA 4CD6A 2XIOA 2KE0A 1TPC1 3N2CA 3BUVA 1A5NC 5LSMA 2NXHA 1CTNA 4N9EA 3AHTA 1LLOA 1SZNA 3MCMA 5D9PA 1WBJA 1Y7VA 4TX0A 3QOKA 1V3IA 1Q7ZA 2FTWA 2GFTA 4CD8A 1QATA 1OABA 1LRTA 3EGJA 4LAKA 1TJ2A 2G50A 4MB1A 5CZ0A 5EY5A 1SMAA 2V68A 4O2TA 4JGDA 2Q8LA 3VAVA 1OF6A 3IHZA 3QKEA 5G5IA 4TVDA 2ACSA 2GSEA 3OJGA 1NSJA 3L4WA 2D3NA 5D9MA 1SFTA 4NNRA 3OA5A 1D7JA 3N29A 1TRDA 3LM3A 3LCFA 1LUCB 4KT2A 2YDQA 4BCEA 3GDMA 4I6VA 1TWIA 1AL7A 1TIMA 2PD5A 2J7FA 1EA9C 2CLPA 1XRVA 4K7VA 3AROA 3M46A 3VC6A 1UBPC 1V51A 4DNHA 3ODKA 2YDSA 3O8AA 2OWWA 5I03A 1LZOA 2DZUA 2VFDA 1PVNA 3TCSA 3CGMA 2FZ9A 4S38A 2OTDA 1WDRA 4J3XA 4O1AA 4NQ1A 1GQIA 4I9MA 4O14A 1D3CA 1OSEA 2IXVA 1EGVA 3S5SA 4UTWA 4WVXA 5CSYA 3TYUA 3HJEA 1TPVA 4J5NA 1E9IA 1WZAA 3CV1A 3HMCA 3CHFA 3SECA 1VLWA 2JGQA 2DJLA 4LEFA 3B40A 2IKHA 3WJYA 1HKMA 1AW5A 3MKCA 4LCQA 1F4AA 2V5JA 4Q8PA 2H8ZA 3TSMA 4GJJA 3WMLA 5IOBA 4XV0A 4NSBA 4P7RA 3ITGA 1CXLA 1QDSA 3GXIA 4B4FA 4F9DA 3UY7A 4HBOA 4JFUA 2PPNA 1HT6A 5K7JA 4IP5A 4HSOA 1F73A 3LRLA 3E1F1 1IZJA 1H62A 1LP6A 1LROA 2E09A 2PGRA 4RNIA 4J40A 4KWSA 1QPRA 2IKJA 1OYBA 2J75A 4D8LA 4QCFA 4K8HA 3KCJA 3B8DA 4J3VA 3UG5A 3ZO9A 4L6DA 5K9DA 5AOUA 5ENLA 1FH8A 4W9TA 1NF7A 2ZRZA 3W02A 3SZ8A 3DFQA 2J47A 3OLIA 1ZP3A 4ALDA 5JQ9A 3LNPA 4I5UA 4TVCA 1U2YA 2QCDB 4H9YA 3NO3A 1K8YA 1REQB 5IBXA 1QBBA 1TPB1 2DZBA 2X2GA 2XTKA 3GVQA 2TSYA 1P1XA 1SZEA 3W7KA 2BXVA 4GACA 1H7NA 1I2NA 4YS1A 4DZIA 2WVVB 3CLMA 3LBMA 3NOYA 4ZQPA 1JXJA 4IM4A 1ZSXA 4IUGA 3O15A 3UA4A 1S5TA 1A3WA 3AYVA 1E73M 2QUTA 3O5IA 1KGWA 1H63A 1M7PA 4GBDA 1J79A 3GG7A 2XFRA 4AB4A 4PEEA 4P8WA 2IMRA 2HE5A 1E71M 2DIEA 3EX6A 4AHQA 3UJ2A 1GRJA 3M0XA 3ICJA 4M6VA 4YL2A 1WDSA 5GJMA 2HISA 4TTUA 4RLIA 1S38A 2WZTA 2V0TA 2ZQUA 4NZ3A 1NM9A 1XM3A 1W9VA 5DEZA 1W5NA 2PWGA 4LY4A 4OQVA 1CECA 4JN8A 1PL9A 3W1NA 1TUFA 2ICSA 1GYMA 3AYSA 3KL3A 3UG4A 4E4UA 1OC7A 3GIYA 1SZGA 4KWWA 2ZQSA 3E2SA 3VGBA 3MBDA 3SCOA 3KL0A 4ZGYA 4GC4A 3GTNA 5DMNA 2GVLA 4X2RA 1WDQA 1A0CA 1KB3A 1L6GA 2DZTA 1JF6A 3SUTA 1PX3A 5F2IA 1C9HA 3VE7A 4IT4A 1NU5A 1UR1A 2DT2A 1WE5A 2FJUB 3CWNA 3URBA 1LRNA 4FP1A 4LAZA 4KEUA 2CLFA 4PBGA 3TSBA 3UR2A 2GGJA 4WD0A 4Z2HA 1TR9A 3PPHA 1I8JA 3PBUA 2IPFA 4JHMA 2CESA 5EMLA 3FGCB 2JK2A 2WMJA 2FTPA 3WD3A 4LUSA 3M0LA 4ATLA 4GC3A 4FI4A 3SN4A 1RBLA 3K46A 3DDMA 2JIWA 3VD9A 3PBGA 4RDVA 3SIZA 3CZGA 1LT8A 2Q5AA 2CLEA 1R3SA 4AIBA 1F3WA 1LQAA 1HKWA 3E12A 3QZEA 5H91A 3TZNA 3W3OA 4AZIA 2FLIA 4CN1A 3IK4A 4GCXA 3K8MA 3JZEA 4IG2A 4H8NA 2XPBA 1W8GA 1XF0A 4I9JA 1G5AA 3CQHA 3WF2A 4DO4A 1ADSA 1U5JA 4NNCA 2UY2A 5GQBA 3AHYA 3IGXA 3W7EA 3WBEA 1H7OA 1HGWA 5AC4A 1Z69A 1QT1A 2ZUTA 1XJBA 1NFPA 2CIPA 4M51A 2J7BA 5I77A 1XBVA 1VBHA 4YXGA 4BQ3A 4Z0SA 1PZ0A 1HIZA 3WMBA 2IUZA 3F1QA 2Y61A 4MY8A 4BF8A 4MYXA 2FVKA 3BGJA 1H7RA 5BXPA 2ZUSA 2Z6JA 4KESA 3SRFA 4PUNA 1EUAA 1B0IA 4B16A 3U7VA 4TQTA 2E9BA 4GVHA 1WDWA 3YPIA 3ZR5A 1H11A 2BASA 2Z26A 4QSHA 2WNQA 3T8LA 2BOGX 2VNCA 3VUPA 2Y8UA 3GTIA 3TQKA 3FEQA 5D37A 3UI5A 2BGSA 5AFDA 1X7FA 1OB0A 3LSCA 3O06A 4Y9OA 3SJ3A 3M0ZA 3CHEA 1EO7A 4ZFCA 3QQ1A 3I7SA 4MM1A 5CLTA 3N6QA 4DUXA 4XAPA 3KRBA 3GIPA 5FAJA 2WSKA 2Y5SA 2P10A 1XR2A 2O7QA 1A0EA 1V3JA 2FHBA 4BI7A 2W27A 4GY1A 4DF2A 2OR2A 3RJXA 1QNSA 1UKQA 1O5XA 1WQ5A 3ZXWA 3KOZA 2XP3A 3MHGA 4DWSD 3PANA 1CYGA 1WPCA 4GQ0A 3UXLA 3PJUA 4ZE4A 1AZ1A 1IX5A 5FA5A 3H8AA 3R4IA 4AF0A 1O7AA 2Y7GA 3R25A 2VDIA 3T6CA 4DRJA 1XIFA 4GG9A 1JIBA 2VEMA 2C91A 3UYIA 3WF0A 4OOZA 1FWDC 1QW8A 3WBYA 2Y0FA 4L6HA 4QT3A 9CGTA 2GUYA 4DBDA 4JBRA 4JFSA 2YBUA 4S2CA 1B90A 1UOZA 3EB2A 1KKRA 4C7DA 3K1DA 1S2CA 4G50A 2J8TA 3DXIA 2YIHA 3WF3A 3ORWA 1KD0A 4AHOA 1VFMA 1N8WA 3IV8A 3GTYX 2DW6A 1GTHA 3ZSTA 2WHMA 4LB3A 3H6OA 3HA1A 3IS4A 3ZS4A 3AFBA 1QRQA 4K3ZA 3LV6A 3A5VA 3MYPA 2WZEA 3A13A 2O9PA 3M5YA 4MFEA 3RCNA 1PZ2A 2OG9A 3MO7A 3W7IA 4UNKA 1TA3B 1KLZA 1K70A 1EPXA 3CEPA 2YXXA 2PP0A 2W63A 4ASTA 5J6EA 3OBKA 4U10A 3VE9A 4GUGA 4IP7A 3T55A 4L1WA 1UWRA 1GEQA 1LOLA 5ABHA 4JYFA 4PCNA 3NQDA 3GTHA 3O5QA 3VX1A 2UBPC 4RNJA 3QSTA 3CQ0A 1I2OA 1OFAA 2ZQ0A 1CZ1A 3LCGA 4XO7A 1J6OA 1FTXA 1ZL1A 2PCEA 3LBCA 1KCKA 3HN3A 3PPCA 4GWEA 1ZJHA 4HU3A 5AYYA 2B7QA 3ARWA 4UNLA 4K68A 5HMFA 3OTRA 3G5EA 8XIMA 1VRXA 2VFIA 2HS8A 1EGZA 1ZALA 2XP8A 4JTAA 5DITA 3G1AA 3LLFA 1Q8AA 2VQUA 1PIGA 4UQCA 4HNVA 1DIDA 2DJXA 3G8EA 4HU0A 1YX1A 2YLAA 1S1PA 4ZR8A 2NV2A 3TX9A 4AWSA 1OQFA 1RP9A 5BXRA 3F4DA 1OYCA 2G5WA 3F5LA 3ZOAA 3RMJA 3ARTA 1YDVA 3M43A 3AIVA 4LANA 2P3EA 5K4XA 1ZPTA 4HARA 1VBJA 1W9PA 3NSXA 3CUJA 4FO4A 2G3JA 1HP5A 3GUWA 3L66A 5ECVA 3AMDA 2BSLA 2F2DA 1J10A 2E9LA 2CZDA 2DT1A 3URQA 3LUTA 4LVDA 5IHSA 3MJMA 1Q65A 4ZODA 1W2PA 3IRDA 1D2KA 4LYKA 1QNRA 4MJ2A 5GJPA 3I3DA 1ZJIA 2I17A 4XVDA 5CQ1A 2XP4A 2OZ0A 3H4XA 3CUGA 1R9ZA 2IKGA 1TMLA 2KAUC 3P8JA 4MNKA 4JFJA 2O4MA 3CHVA 3BTNA 3F4NA 3EX4A 2H9AA 1E40A 3WMCA 3A23A 4NILA 2DSZA 3TROA 1BSIA 2PRHA 4K8EA 1T96A 2O9OA 3W73A 1YYAA 4REQB 1KR0A 2AWGA 1FH7A 1FCVA 2VFFA 4PUUA 2FHFA 1S5VA 5LA2A 1AQ0A 3VGGA 1YPFA 1G01A 4HK5A 3DG3A 4LTSA 3EWWA 2AL2A 3W6LA 1FJDA 2JKEA 2X1SA 3WUEA 3EDDA 1TJPA 1C91A 1FHDA 3VNIA 4ML4A 2W67A 5FL1A 1TVNA 4QNWA 3CUHA 2FQIA 4H7ZA 4GISA 3ARZA 4U28A 1R2TA 2XIQA 2POZA 3VDAA 4EAYA 4ZZ9A 4AIUA 1V02A 7XIMA 1VBRA 2XIIA 3GK0A 4DB7A 1LLWA 2CEQA 1UWQA 4NJHA 3NZGA 2DZVA 2BS9A 1MQPA 1MQQA 4AX6A 1A5MC 3VIGA 1S3HA 1J6YA 3WLPA 1J12A 4UR7A 1V02E 1WO2A 2QIWA 2A79A 4TX8A 1GVOA 1ITCA 1PEZA 3F4VA 2ISSA 2FDMA 5AZ1A 5F2LA 2EPMX 1YXYA 2E6DA 2Z4GA 3FHAA 3CXOA 4R27A 3W2NA 2YA2A 3P84A 5EBUA 5A6SA 5JVLA 5DLCA 3B0XA 4O57A 4DO6A 2J9XA 4FZIA 3B8UA 1JPDX 2KI3A 2CLMA 2PDFA 3ES8A 1KWGA 5G4WA 4FLOA 4O11A 4CLMA 1LL6A 1RH9A 1BGAA 4ZQRA 2GQ3A 4PUWA 3LK6A 2YBTA 2XIMA 1T8QA 4Y8EA 4LUSB 3FV9A 2F84A 3QHMA 4LH8A 2QDGA 1RQBA 3OQ8A 2CZFA 3AAMA 4FXFA 3GZ3A 4IFKB 4KF1A 3NPWA 4TW6A 2G95A 1EJVC 2DQWA 3GDKA 2HQAA 2GSJA 4M6PA 1KTNA 4ZS6A 4IG2B 4DWSB 1CLVA 4ORMA 3H4GA 3CPUA 4WY0F 2F23A 4FR1A 3MUXA 5LIUX 1UWSA 3VOJA 2PTDA 4B9YA 3EMCA 1UC4A 1ONXA 4L9XA 2QT3A 1GVSA 3W2UA 4RNFA 1EP3A 1VFHA 3N2BA 1Y5XA 5LXEA 2DG3A 5DCBA 3QV7A 5M17A 1DXFA 1TO3A 3VYLA 1XD1A 3ZJ8A 4JL1A 5I07A 3FSUA 3WSUA 4H8UA 3WLTA 4GYPC 4AQLA 5HMEA 2KO7A 1XSJA 3GDLA 1VCFA 4J4NA 4YTTA 1XP3A 4GY0A 2ZZ7A 4O15A 3LRMA 5E5CA 1R85A 4WJEA 4F2UA 1EEXA 5LNRA 5C2CA 1JNDA 1GK8A 1L6SA 2JEQA 4R7JA 2E9MA 3W23A 4DX3A 1KBKA 1FWSA 1XYMA 2QUMA 2R94A 2J88A 4IPLA 3BZJA 1X97A 1QBAA 3VDCA 1S2UA 2DDXA 1VFLA 2WWDA 3T2OA 4K1GA 3KZSA 1CW2A 1FQ0A 5E1QA 5I3KA 4M6QA 5HJXA 4CCZA 3GDTA 4WIWA 3VM5A 4DM1A 4XUYA 5FEWA 3R8RA 3WL0A 3IUDA 1UD6A 1F6KA 3H7UA 3FJNA 2XPAA 1WAUA 3K5XA 3GVRA 3ZLHA 4YLWA 1BEUA 1Q4NX 2XVLA 3C6CA 4H19A 3KL5A 1ITQA 4S2BA 1XGDA 5EMMA 4AF0B 2VVSA 2YFNA 4EK7A 3RCYA 2ZX9A 2WSRA 1MDRA 4H41A 2ON3A 1F74A 1ZBVA 4V1XA 4UTLA 2DV0A 3VNJA 1X8FA 4BHYA 2GJNA 2GZXA 4R85A 3W84A 1VEMA 1XH0A 4I5RA 1S2VA 5E6ZA 2PDKA 3WQDA 4Q4KA 4L4LA 3Q37A 3VOHA 1P5BA 1MW3A 3WUBA 4AFYA 1U79A 3BSMA 3UPBA 1FWHC 4FIQA 3KRUA 1JD7A 1FKLA 3W25A 2CZEA 3ITYA 3MTWA 4L4PA 3EEGA 3DFOA 1F05A 1XC4A 1K1DA 2DFAA 2VC9A 3V4BA 3A4XA 3G22A 4I9TA 4QAWA 3UP8A 3KAHA 4LVAA 3RN6A 3Q4DA 3QMSA 3S6OA 1GOQA 3KLLA 2VUNA 3GW0A 4Q8UA 1FWWA 3TV8A 3WH0A 1E44A 3VO0A 5AB3A 1SUXA 4JQAA 2FPYA 4XIAA 5F4SA 1Q6UA 4PB4A 5G4HC 5HWJA 3WD1A 4O0ZA 2R82A 3TCEA 4PFHA 3WQ6A 1J0YA 2QNEA 5IDZA 5EU9A 1CBGA 4C6FA 4UTWC 3O2LA 1KRCC 1ZP4A 4EXAA 4ECLA 1PCWA 1C8YA 1FWGC 4GKTA 3E9AA 1KFWA 2JALA 5DN1A 1IV8A 4NZ1A 1JPHA 1BF2A 4AWUA 4FPSA 3NO5A 4JQ4A 1SO3A 3EB3A 4US6A 1MUMA 2H6RA 3DI1A 3ELFA 4JKKA 2ALDA 3LN3A 4LUTB 3SQMA 2J6VA 3HB9A 1XSIA 1J0KA 4AIEA 1VHCA 2Q02A 2R1LA 3KS5A 4JY9A 3U4FA 3RILA 1XUUA 4R88A 4KGLA 4P7QA 3UR8A 1JNSA