1ZBLA

Bacillus halodurans rnase h catalytic domain mutant d192n in complex with 12-mer rna/dna hybrid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
molecule tags Hydrolase/rna/dna
source organism Bacillus halodurans
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zblA00
4DS4A 4CHQA 1DTQA 1XHXA 4DTXA 3A2FA 1VRUA 2A1RA 2IDOA 3AVLA 3HPOA 2Z1IA 2IC3A 4DTSA 2OA8A 3HK2A 1TGOA 4OGEA 4FJIA 3M8SA 1RT1A 5HRPA 1HJRA 3RR8A 2P5GA 2FBVA 3KLHA 4Q0BA 1RILA 1TKXA 2X6SA 4CJLA 4FK0A 1LWEA 1LV5A 4Y1CA 1X9MA 3MEGA 4FJMA 2ZQBA 4JLHA 2WONA 4OPJA 4KFBA 3K5MA 4PUOA 1BQMA 2XY8A 3M8RA 3LAMA 3ZSOA 4NYNA 1GOAA 4BE2A 4E7LA 3QESA 3HO1A 1ASVA 2HHUA 5C25A 4CK3A 4DQIA 3S3MA 4FJLA 3KKSA 4I2QA 3AA4A 1L3SA 3LPUA 2HVHA 3EZ5A 4EZ9A 2FBXA 1KCFA 3AVKA 4C8LA 4FYDA 4HUEA 1S1VA 3LP1A 3T19A 4OLBA 3AO1A 1QHTA 3ZT4A 2ETJA 4HCCA 4JRQA 4F8RA 3L2WA 4FZZA 3TWHA 1FKPA 1EP4A 1RDAA 1GOCA 1WLJA 1YTUA 4PWDA 3TR8A 3C6TA 1DTTA 3RRGA 4CJKA 3V9XA 3PUFA 5HRSA 1T05A 3NBPA 2PYLA 1KLNA 4Z4HA 2I5JA 2O4IA 1QSYA 3P5JA 4IG3A 4BACA 3ZT0A 1TVRA 1IG9A 2G8UA 1C0UA 3NF8A 1RCHA 3HJFA 1B9DA 4FJJA 1VSKA 3V9ZA 3RMBA 1WSIA 2G8VA 1ZBIA 3ZSWA 4IBNA 2F8SA 2DY4A 2ATQA 3S9HA 5KI6A 3CM5A 3SV3A 3LP3A 3KK2A 1SL0A 5J2QA 5E41A 1JLCA 2QXFA 3TANA 2HHTA 2XY5A 3HSTB 4LH4A 1RNHA 5FRNA 1RTJA 4LSNA 3VA3A 5J2PA 1NK4A 4Z4IA 3OYMA 3HPHA 2O4GA 1EXQA 2ZD1A 3OYHA 2B5JA 2YNHA 4UQGA 2NUBA 4DFJA 2P5OA 4M45A 4RW4A 5CZ2A 4DLGA 3OYAA 4DFPA 4DF4A 4O44A 2R7YA 2P51A 2HB5A 2HHVA 1NOYA 4KAZA 4FJ8A 3KLGA 1KLMA 3V9SA 3SQ0A 3MEDA 3QIPA 3DYAA 3WNGA 4CJUA 1NK0A 4KHNA 3SUNA 3HP9A 3I0SA 4DFKA 4CJQA 3ZSRA 2FC0A 1W9HA 4B9TA 3ITHA 4DSIA 3C6UA 2LSNA 4DMNA 3VQPA 2F8TA 4M42A 3NAEA 1I39A 3HYFA 1S1WA 3OYDA 3OYKA 1JLFA 3H08A 4GVMA 3CYMA 4OKJA 3LZIA 1N6QA 1RDCA 4CFCA 4B9MA 1KFDA 1D9DA 1BHLA 3SPZA 5DMRA 4BDYA 3L2UA 4IG0A 5KGWA 4W5NA 3ISNC 1TK0A 2IGIA 3VA0A 4F2SA 3LPTA 3CQ8A 4AHRA 4FLZA 1WAJA 2KW4A 1FK9A 5C24A 3QEXA 4KPYA 1J9AA 3ZSYA 1L3UA 4I9LA 3I8DA 3DLKA 1WSGA 4M3RA 3VQ8A 3AO5A 4CF1A 4YFUA 3KLFA 3KTQA 4FJ5A 4L8RB 5FRMA 1HMVA 4Z4FA 1T03A 4Z0UA 3VQ6A 3SPYA 3SUPA 3TAMA 4I7FA 4Q5VA 1NK9A 3WNFA 1TAUA 3AO4A 4OGCA 4E3SA 4AILC 4RW6A 3OS1A 2G8FA 4KB0A 3VQ4A 1JLBA 3MEEA 3D45A 4QCLA 3PX0A 2X6NA 2HW3A 3L3UA 1LWCA 3QEWA 4H4MA 4B3OA 4Y1DA 1QE1A 4DSKA 2QKBA 3AVMA 3OY9A 3NGIA 4F4KA 3QO9A 3ZSXA 1N5YA 3SV4A 1WN7A 4KHSA 4CF9A 1EKEA 3QLHA 1L5UA 1S1TA 3SUQA 4BWMA 4J2DA 4ZTJA 1EETA 2OPRA 3PX6A 1REVA 1IKWA 4ID1A 1UAXA 3RMCA 4CJSA 4FJXA 4KREA 3IRXA 3RMDA 3WNEA 2G8KA 2OPSA 4M3XA 4J2EA 1U45A 4G1QA 2X74A 4M3WA 2BGGA 4AHTA 3K5NA 3DM2A 4B9LA 4J2AA 3IG1A 2GV9A 1VRTA 4HCBA 1TL3A 1B92A 3SUOA 3DRSA 1VSFA 3TI0A 1UA1A 1X9SA 3VQ7A 1GOBA 3L8BA 4FK4A 4TSXA 3ZSZA 4FLWA 3THVA 2Q3SA 5EU7A 3O3GA 4ELVA 3G0ZA 5KGXA 3VQAA 4QOZB 2EX3A 3KLIA 3AO3A 2PY5A 2G8IA 4CGFA 2YKNA 3VQQA 4FVMA 4DSEA 2D0BA 1D8YA 4KHQA 4KO0A 4FM0A 4QAGA 2DFHA 4B8CA 4MFBA 4C8KA 4IKFA 1SKRA 2DFFA 4AH9A 3TAEA 2HVIA 3K5OA 3ZSQA 1KTQA 3AVIA 3VQ9A 4HUGA 4BDZA 1RT4A 4CK2A 4W5TA 4WE1A 4C8NA 2XRIA 3AA3A 3NH2A 1LAVA 4KTWA 3U3YA 4B9VA 4FK2A 3QINA 2KFNA 3KJVA 1WSFA 5FROA 4DTPA 4M3TA 3AV9A 1T8EA 3CFRA 3HP6A 5K14A 3KD1E 1HQEA 4CFAA 4CEEA 1SUQA 1LAWA 4CFBA 5KRSA 4CGJA 1S9GA 4CIGA 1XC9A 2DFEA 4CJPA 3ZSVA 3NFAA 4LY7A 3HVRA 3E01A 4IDKA 4FM1A 2HHXA 2HMIA 2D0AA 2RF2A 1RBUA 1QS4A 1K6YA 4N47A 1CLQA 3WNHA 3RTVA 1TAQA 4OVLA 4CERA 2E6MA 2Y1JA 3QEPA 4K8XA 1C1AA 4FLUA 2W42A 2QKKA 4E19A 3MAQA 2JGUA 4FM2A 4PQUA 4RW8A 1BI4A 3DLHA 3DOKA 3ZCMA 4KV8A 3S3OA 3HVTA 2VWKA 4NYFA 3NF7A 4CEZA 2GUIA 1ZBFA 4CJRA 1BIUA 4CGHA 4ICLA 2ITGA 4ELUA 1HYSA 4O55A 1ZYQA 3TABA 1UA0A 1J54A 1JKHA 2KQ2A 4FJGA 1EX4A 2XO7A 3V9UA 1NKCA 5DK5A 2KTQA 1Z25A 3LP2A 4AHVA 1BCMA 1HNIA 1SV5A 1FKOA 5HP1A 1VSLA 4DU4A 4O5BA 1X9WA 1S5JA 4EP4A 4CESA 3K58A 1ZBLA 1J5OA 2BDPA 4F2RA 4RG8A 4KTQA 3AA5X 3DLRA 2F96A 4CHNA 2G8HA 2HNZA 2YNIA 4OLAA 4CECA 1QSSA 2IOCA 2B6AA 2VWJA 4HVJA 4DWIA 1HYZA 1LW0A 1S6QA 3LWMA 2A1SA 3PO5A 3MECA 3VQCA 3S3NA 5HLFA 2YHBA 1CXQA 1IKYA 1ITGA 4FJHA 1TKTA 3OYCA 1CXUA 4FXDA 5CZ1A 4HUFA 4OKEA 4W5OA 1KSPA 4E89A 2OZMA 3JYTA 2B4JA 4KHWA 4M3ZA 4CEOA 1TL1A 3QETA 1HPZA 1RT5A 3L2QA 4ELTA 1NK6A 3OYNA 4FZYA 4DFMA 3OS0A 2JLEA 3QEVA 1XWLA 4GMJB 3B6PA 1C0MA 3QIOA 2IAJA 5KRTA 1HNVA 1Y97A 1CZ9A 3C94A 3G10A 3F73A 1BIZA 4N76A 4LH5A 4CEDA 4FLYA 4Z4GA 2D5RA 2KZZA 1A5VA 3HM9A 1IKXA 4FJNA 1WSJA 4DTNA 3VN5A 4DSLA 1SL2A 3DMJA 4CIEA 1C6VA 4HTUA 4DF8A 3AVNA 4KB1A 4OPKA 4Z4EA 4CJ5A 3RMAA 1U49A 2P1JA 4DTMA 3O3HA 1Q9XA 3V81A 2GBZA 1SKSA 2YKMA 1ZBUA 1XI1A 3TAGA 4JRPA 1KVCA 1VSJA 4CJEA 3KK3A 3NCIA 4OKKA 3DLEA 1UOCA 3OS2A 4BE1A 1JLAA 4FLXA 5KTQA 1S9EA 4OJRA 2XY6A 4E7JA 1TK8A 2HNDA 4DQPA 1A5WA 1RBTA 4LSLA 3PY8A 4B9UA 2E4LA 2YNGA 3NGYA 4CJ3A 1C1CA 5FDLA 2XY7A 4CGDA 5J2MA 2Y1IA 1QTMA 4B9SA 1FXXA 1JXEA 3O3FA 3V4IA 5I3UA 4CHYA 5JS1A 1UWBA 3L2VA 4JS4A 4DQSA 4KHYA 3TAQA 4BWJA 1RBSA 3D0PA 5HRNA 4C8MA 1W0HA 3NH1A 1RT3A 4YNQA 3PO4A 1QSLA 4CHPA 4KI6A 4EP5A 1ASUA 3NDKA 4FJKA 3VQBA 3JSMA 1A5XA 5C42A 4M41A 4F3OA 1RTIA 3OYJA 1BL3A 4FW2A 1G15A 4W5QA 1RBRA 4CJ4A 1NJZA 2HHWA 1U4BA 3OYEA 3OYLA 4E0DA 1TV6A 3AO2A 3OYIA 2BE2A 3OVNA 3SYZA 4ZTFA 1X1PA 1ASWA 2WOMA 4ZHRA 3CFOA 3LALA 1VSHA 4PA1A 3I0RA 4CJWA 3RR7A 4M3YA 2AJQA 3P1GA 3CFPA 5CYQA 4KI4A 3NF9A 1YVUA 3LP0A 4Z4CA 4DQQA 1TK5A 3B6OA 1ZBHA 4N56A 2IS3A 5SWMA 3T3FA 3PV8A 4O0IA 1HYVA 1Q9YA 1BQNA 1J53A 3HXMA 2D0CA 1RT2A 1JLEA 1LW2A 2ZE2A 3ALYA 4R5PA 4BDPA 4FZXC 3C95A 4N5SA 3ZT3A 4N41A 3AVBA 4E7IA 1SL1A 3OYBA 5HBMA 3K59A 2G8WA 4KHUA 1WNSA 3IS9A 1KVBA 4RW9A 3M8PA 5SZTA 4HHTA 1HRHA 1KVAA 3ZT1A 1VSDA 1KRPA 1RT6A 1TKZA 3SNNA 3V1QA 1BGXT 2FBYA 4CF0A 3K5LA 3NE6A 1BCOA 1T7PA 3AVAA 1JL1A 3ULDA 4E1MA 4K8ZA 4J2BA 4CJTA 1YTAA 3AVHA 1YT3A 3BGRA 3OJUA 4CJVA 4AHUA 1NKBA 3OJSA 3MXJA 4FLTA 4B9NA 3AVJA 3KKRA 1D9FA 4CFDA 4KKOA 2VG7A 3VQ5A 4AHSA 4MQ3A 1JXBA 1CZBA 1QQCA 1HQUA 1RTHA 1IH7A 2X78A 1JLGA 3CM6A 4FW1A 4CEBA 4CF8A 3U3GA 3KLEA 4H8KA 2BANA 2Z1GA 4E7KA 4DTOA 3AVFA 3TARA 1U47A 3AVGA 4DLEA 4KTZA 1U48A 3FFIA 4CEQA 2YV0X 3QERA 3QNNA 3MXMA 1SKWA 4B8AB 4CF2A 3DI6A 4XIUA 4FLVA 4M3UA 3LDSA 4JS5A 4BE0A 4NCGA 3DRRA 4CJFA 4KRFA 1I3AA 1C1BA 4F3TA 3LANA 3QNOA 2XHBA 2OPPA 4DTRA 3T1AA 3M8QA 1RBVA 5I42A 4CEAA 4AHCA 4FCYA 3BDPA 4NCBA 3KK1A 2HHQA 3CG7A 3RWUA 4CEFA 3EY1A 3QEIA 4PY5A 4FJ7A 5JS2A 4ID5A 4CHZA 5J1EA 3V9WA 4B08A 3SQ2A 1VSMA 1TKDA 2KFZA 4CGGA 3SZ2A 3O4NA 4DU3A 3HT3A 4DSFA 1XHZA 4H4OA 3HPGA 3P83D 4I2PA 3L2RA 2YHAA 3LZJA 3DRPA 3TAPA 3SQ1A 1U04A 2QK9A 5HRRA 2RPIA 4DTJA 1S6PA 1WSHA 1VSIA 4O0JA 1RTDA 1RDDA 5J2NA 3VQEA 3LWLA 3PX4A 3K2PA 1VSEA 4W5RA 3SI6A 3HL8A 4DG1A 2RKIA 1NKEA 1BI4B 3RRHA 3LAKA 3O4QA 3OYGA 3KIOA 2PYJA 4CGIA 4NCAA 2YNFA 1IKVA 3SQ4A 4CE9A 1F21A 5CYMA 3NGZA 2E6LA 1VK0A 3NH0A 1NJXA 3AVCA 3EYZA 1LWFA 1MU2A 1O1WA 1NK7A 2OPQA 4DTUA 4GW6A 4FJ9A 3IAYA 3U6FA 1RT7A 1NOZA 4I9QA 4RW7A 1BISA 3V1OA 3SJJA 1NK5A 4C8OA 3SCXA 4DU1A 4O4GA 3NHGA 3NF6A 5D3GA 1L3VA 4DQRA 3MXIA 2KZMA 1Q8IA 1C0TA 4IFVA 5CY4A 3L3VA 4CIFA 1DLOA 2Z1JA 3V6DA 5T7BA 3ZT2A 4EZ6A 4CHOA 1NJWA 1NJYA 4E1NA 2OZSA 3DLGA 3DLBA 2HHSA 1B9FA 1S1UA 1WSEA 3ASMA 2OYQA 2HNYA 5HROA 4IFYA 4DS5A 3TAFA 4DSJA 1NK8A 1JLQA 2DTUA 2VG5A 3V1RA 3F9KA 1R0AA 3AA2A 1L3TA 3DOLA 1WAFA 2PZSA 2RN2A 1S1XA 1JL2A 1KFSA 3KD5E 3K57A 2FBTA 3UIQA 3VQDA 1D5AA 4LD0A 3OYFA 2EHGA 4E7HA 2VG6A 1Z26A 4CK1A 2Z1HA 4CCHA 1RDBA 1IO2A
chains in the Genus database with same CATH superfamily
1XHXA 3O1BA 3A2FA 2P9UA 4B1ZA 4YDUA 2IDOA 3AVLA 2YJFA 3HPOA 2OA8A 1TGOA 3M8SA 3RR8A 2FBVA 1G99A 1TKXA 4CJLA 3IUCA 2QXLA 4FK0A 1LWEA 4Y1CA 1X9MA 2CGLA 2HSTA 4KFBA 5IWAK 3O9RA 4YOYA 4K42A 3OTOK 3P39A 4NYNA 1GOAA 3WQUA 4BE2A 2CGKA 2HHUA 4CK3A 3L4IA 5LMUK 1L3SA 4PKIA 3LPUA 3U4LA 3KVGA 3AVKA 1BU6O 2WTUA 4HUEA 1QHTA 3R8EA 4HCCA 3WXIA 1WLJA 4PWDA 4JI6K 3C6TA 2P9NA 4CJKA 3RRGA 3PUFA 2QEXN 3SLCA 4H03B 2E2QA 4IG3A 4U67L 1RCHA 1B9DA 4FJJA 1VSKA 1WSIA 4YOXA 2ATQA 1GLJO 5BN9A 4YOWA 3CM5A 1SL0A 3LP3A 1ESVA 2HF3A 4DV6K 2KLAA 4DR6K 3HSTB 4JYAK 4Z4IA 5J2PA 3O9TA 4GV9A 4EAHD 2O4GA 1T6CA 4FWRA 2P5OA 2NUBA 3EE9A 4JI2K 4RW4A 1HKGA 4DLGA 3OYAA 4DFPA 1ZBSA 2P51A 3CJCA 2QWNA 5M1QA 3SQ0A 4KHNA 3DYAA 1NK0A 4BREA 1GLEG 1HLUA 4JHDA 2FC0A 3ITHA 5AQMA 3C6UA 4DMNA 3VQPA 3NAEA 1S1WA 3OYDA 2BH1A 3H08A 2HOEA 4B9MA 1KFDA 1D9DA 1BHLA 4FWNA 3UKRA 1M1KO 1YIJN 3FZLA 5KGWA 3M3ZA 3ISNC 1N8RO 3M5RA 3LPTA 4FLZA 4AHRA 1WAJA 2KW4A 1FK9A 3VF6A 1J9AA 1L3UA 3GL1A 5FPEA 3I8DA 4M3RA 3EKUA 3VQ6A 5M1NA 1NK9A 3WNFA 1YITN 4KB0A 3VQ4A 1Q7YO 1QE1A 4DSKA 4I6MA 3AVMA 3NGIA 3QO9A 3ZSXA 4GV6A 1N5YA 3MWPA 1S1TA 1K8KA 3FZFA 3HTVA 1EETA 2OPRA 3J81O 4ID1A 4L3QA 2ZGYA 4U7BA 2G8KA 2OPSA 4M3XA 1U45A 2ZGZA 2BGGA 3HBTA 3D2EA 1B92A 4NLBA 1BDGA 3O80A 4FK4A 2WUSA 4ELVA 1GLBG 4DV1K 5KGXA 3VQAA 4QOZB 2E2OA 4CGFA 4EHTA 1D8YA 2DFHA 4MFBA 1SKRA 4DV7K 4BRNA 4HUGA 1YJNN 1QZ6A 1RT4A 1KC8O 1BWFO 4C8NA 2O8EB 3AA3A 3OHRA 3NH2A 4FK2A 3QINA 3KJVA 3MDQA 3KD1E 1HQEA 4MLHA 1SUQA 3CJ9A 4CZGA 5KRSA 4CGJA 4GKKK 4FM1A 2HMIA 2RE2A 2GWJA 2RF2A 3LL3A 3D2FA 1CLQA 4KBOA 1K8AO 2Y1JA 1C1AA 3O5BA 1BI4A 1ATSA 3DLHA 3DOKA 4ISEA 3ENHA 3CHWA 4FWMA 4IOCL 3CETA 4EFHA 3UKUA 3CC7N 1ZBFA 4JKDA 1BIUA 3AGKA 3THWA 2VQFK 4ELUA 1HYSA 1UA0A 1P90A 3AY9A 1NJIO 2KTQA 1NKCA 2O8BB 2W6LA 1YUWA 3LP2A 4AHVA 1SV5A 5EX5A 1VSLA 4DU4A 5BPNA 3Q7BA 5JVHL 1VQPN 4CESA 3K58A 2BDPA 1X3NA 3LDOA 5AFUH 1TYQA 4CECA 4OLAA 2VWJA 4CZEA 1LW0A 4E1JA 3LWMA 3HZ6A 1MA9B 3VQCA 5AQSA 1OKJA 3OYCA 5CZ1A 3TTDA 3FFKB 4B3RK 4OKEA 1MWKA 4E89A 2QWMA 2VCPA 5AQOA 1TL1A 2QWQA 3QETA 4M3ZA 1RT5A 5LY3A 3L2QA 4DFMA 4A2BA 3W0LA 3B6PA 3QIOA 2IAJA 1Y97A 1RFQA 4A61A 3C94A 4YOVA 4FLYA 2D5RA 4JI4K 5AQKA 4FJNA 1WSJA 4OPAA 4DSLA 1D4XA 4FWQA 1W7AA 4OPKA 2P1JA 3J80O 1O13A 3O3HA 4DTMA 3V81A 2YKMA 5AQUA 4H5NA 1KVCA 3KK3A 3DLEA 5KTQA 1IBKK 1S9EA 2FF3B 2XY6A 4E7JA 4QS8A 4B9UA 2E4LA 3LM2A 5AR0A 2F7TA 3L4QA 1FXXA 4WFNL 4JV5K 1Q82O 4CHYA 5JS1A 3L2VA 2QW9A 1N32K 2CH6A 2V7YA 3TAQA 1IG8A 3VGLA 3JAMO 4YNQA 1ASUA 3NDKA 4PL8A 5FPMA 4M41A 4F3OA 4RCHA 1NJZA 1BL3A 4W5QA 2HHWA 1YF5L 3O8MA 3OVNA 3SYZA 2WOMA 4ZHRA 3I0RA 3CFPA 2ITMA 5AQQA 4LC9B 3B6OA 3NVMA 5SWMA 3JS6A 1VQ8N 3CJBA 1HYVA 1BQNA 1J53A 3CQXA 4FZXC 3ALYA 4R5PA 4N41A 5M1KA 4H0XB 3K59A 4RW9A 3M8PA 1KVAA 3ZT1A 1VSDA 1KRPA 4ILGB 2FBYA 4B1UB 3AVAA 2VGMA 3ID8A 1NGAA 4CJTA 3PLAA 1YTAA 4B9NA 4BRDA 4FLTA 3MXJA 2WFBA 1D9FA 2AJQA 3VQ5A 4KKOA 1JXBA 1IH7A 2E1YA 4CEBA 3KLEA 4H8KA 2BANA 1U47A 3IAYA 3AVGA 4CEQA 1SKWA 3QNNA 1XMOK 1OH5A 1Z6RA 5AQYA 3DI6A 4IEEA 3LDSA 4NCGA 4CJFA 4KRFA 3VESA 2E20A 3QNOA 5FLXO 4AHCA 2HHQA 3KK1A 3CG7A 3QEIA 4Y0WA 4PY5A 2UXBK 3SQ2A 1TKDA 1VSMA 4FO0A 3VTIA 3DXMB 4DKWA 4CZIA 1M90O 5CE3A 3TAPA 3EL2A 4XEIA 2D4WA 1BA1A 3C7NB 1S6PA 1VSIA 2UUAK 4BY9C 1RTDA 3DXKB 1NGBA 1VSEA 3HL8A 4DG1A 3RRHA 1T6DA 3LAKA 3KIOA 2QWOA 3OA9A 5KPRA 2O8FA 4CE9A 3GG4A 1VK0A 4QS7A 3NH0A 3CXCM 1NJXA 1OH8A 3R3LA 4FL9A 4GW6A 1RT7A 3E66A 1BISA 5LL6Z 3CIPA 3V1OA 1XNQK 1JCGA 3SCXA 4O4GA 3NF6A 4DQRA 3MXIA 1Q8IA 5M1FA 1C0TA 3NMUA 4CIFA 1DLOA 4H0PA 4EZ6A 1U2VA 3A5LC 5JLHA 3ASMA 3WEEA 1K9MO 2HNYA 4FWLA 3RSEB 3TAFA 4DSJA 1JLQA 2VG5A 3V1RA 4IWVA 4BR5A 4QS9A 4NO7A 5LMNK 3AA2A 1FW6A 1S1XA 1JL2A 3KD5E 3G6EN 3K57A 2FBTA 1NMNA 3VQDA 5KPZA 2VG6A 1Z26A 2Z1HA 2A6AA 1RDBA 4CHQA 1DTQA 2GELA 5JICA 1YAGA 2FXUA 1ATRA 3CERA 3FR0A 4OGEA 5M1PA 3CC4N 4FJIA 3QBXA 3MN9A 1VQMN 1RILA 2X6SA 5HOOA 4IFEA 3U9DA 4BC3A 2ZQBA 4JLHA 4OPJA 3K5MA 1BQMA 1ASVA 3KKSA 2FBXA 3LDPA 4C8LA 3A0IX 4FYDA 1S1VA 1EO1A 4OLBA 4XH5A 3ZT4A 4CD3A 1FKPA 1EP4A 1YI2N 1YTUA 2QWLA 4PKGA 3I8BA 3VEVA 5TKWA 2PYLA 3CJ1A 5BR8K 2I5JA 2G8UA 1C0UA 4IO8A 3V9ZA 3RMBA 2G8VA 1VQ6N 1Q18A 4IBNA 4RTFD 1ZBIA 2DY4A 4BC4A 3S9HA 3SV3A 3KK2A 2NLXA 1KAZA 2QXFA 5EXWA 2UUBK 3FE1A 4Z94A 3HPHA 3O9UA 2B5JA 2YNHA 1NGHA 4UQGA 3OYHA 1SQKA 4M45A 3WXMB 5CZ2A 4JN4A 3B8AX 5C0YA 4JI5K 1NOYA 4KAZA 3VEZA 4FJ8A 3KLGA 4DR7K 2P9PA 2P9IB 3I0SA 4CJQA 3ZSRA 4DSIA 3TTFA 3BF3A 1S3XA 5ELZA 3WT0A 1I39A 3KWGA 3OYKA 4OKJA 4GVEA 3QBWA 1N6QA 4LFAK 3J8AA 3HI0A 4B1VA 3CCLN 3SK3A 2NRTA 3SAFA 3VA0A 3QEXA 4IOAL 3S41A 4DV2K 3VQ8A 5AZJA 4Z4FA 4Z0UA 5AQJA 3QICA 4CD1A 4Q5VA 5AQVA 1C0GA 3U9ZA 3GDQA 4E3SA 4RW6A 3OS1A 5KQ8A 2G8FA 2RHKA 1JLBA 3MEEA 3D45A 3PX0A 3L3UA 3QEWA 4LF8K 3OY9A 4H0YB 3THYB 4KHSA 3SUQA 4BWMA 1IBMK 2ZF5O 4GV3A 3VOVA 3RMCA 1IBLK 2E2NA 3CCJN 3M1FA 4G1QA 5AQNA 4M3WA 2GX9A 5BN8A 2ASPA 1VRTA 5MLCQ 1VQ4N 4FWSA 5FPDA 1NGGA 3A5MC 3TI0A 1UA1A 3F5TA 3VQ7A 1GOBA 3L8BA 2UXCK 4TSXA 3KHYA 1V4SA 3G0ZA 1GLLO 2EX3A 2PY5A 2G8IA 3VQQA 4KHQA 2D0BA 4KO0A 4FM0A 2ASMA 4C8KA 1EWRA 5A2QO 3TAEA 2HVIA 3ZSQA 3AVIA 3VQ9A 4LFBK 4B9VA 1LAVA 4KTWA 2FF6A 1WSFA 3AV9A 3CFRA 3C6HA 1LAWA 5GINA 4CFBA 4BROA 2DFEA 2ZJQL 3ZSVA 3NFAA 4LY7A 4DR1K 2HHXA 5CHIA 2FSNA 3E9PA 1YJ9N 1QS4A 1K6YA 1YJWN 4N47A 1R59O 1TAQA 4OVLA 4CERA 1S22A 2QKKA 5AQGA 4FM2A 4KV8A 3HVTA 3QB0A 3SAGA 3NF7A 3VEXA 3FZKA 1KAXA 3UB5A 1J54A 1NU0A 4MO4A 1OVYA 4F2RA 4JKGA 3IMXA 3DLRA 2P9NB 4BC5A 3L6QA 2B6AA 5AZIB 3LM9A 4A5AA 3MECA 3N4PA 5HLFA 1K73O 1TKTA 4ISFA 1OH6A 4NXNK 4HUFA 4DV5K 2OZMA 3J7YP 4JNEA 2P9SA 3HSCA 4DV3K 3OS0A 1H1VA 2JLEA 3QEVA 3F9MA 4GMJB 1C0MA 2OANA 3SMSA 5KRTA 4N76A 4CEDA 2KZZA 1NNEA 1KQSM 4BRPA 3I55N 3ENBA 4HTUA 4Z4EA 1XMQK 1U49A 2UXDK 1ZBUA 4JKHA 1VSJA 4CJEA 4OKKA 1UOCA 4JKAA 4BE1A 4FLXA 2HNDA 1RBTA 3TPQA 1SS6A 3PY8A 4DQ8A 3NGYA 2Y1IA 3UKRB 2E88A 3P4IA 1UWBA 1Q81O 2Q2RA 4ILHA 3CCEN 4FWOA 2NNWA 1W0HA 4C8MA 1KXPA 3PO4A 4CHPA 2BTFA 1NGDA 2D1KA 3JSMA 1QQOA 3OYJA 3VENA 4BRAA 3OYLA 4PA1A 4M3YA 3P1GA 4I6MB 1YVUA 4Z4CA 5AQTA 4N56A 3T3FA 1K8KB 3HXMA 2D0CA 5BPLA 2V51B 1JLEA 4BDPA 4XH1A 4N5SA 4E7IA 1RGIA 2GEMA 4HHTA 1MDUB 4JK9A 1BGXT 3K5LA 1BCOA 3I56N 3PIPL 1JL1A 4E1MA 3D2EB 1QQNA 3MX5A 3OJUA 1S72N 1NKBA 2DTUA 3CCVN 3OJSA 1NGIA 2NRRA 2OCEA 3P38A 1N36K 4CFDA 3EZWA 3E9LA 3CM6A 2I7NA 3KWIA 3ULEB 2Q1NA 4DTOA 3CMEN 1U48A 4BQZA 2YV0X 3MXMA 3KZBA 3J7ZO 3P31A 4FLVA 1OH7A 3DRRA 1C1BA 4MLEA 3WXLA 4F3TA 4WQ5C 2OPPA 4DTRA 2Q36A 3G4SN 3M8QA 5GIPA 3MK6A 4FJ7A 4CHZA 2KFZA 4CGGA 3O4NA 3FZMA 4IO9L 3HT3A 1XHZA 4H4OA 1GLCG 3HPGA 3P83D 4CZMA 4IXCA 3PSFA 2YHAA 3DRPA 4F9OA 1U04A 5LJWA 2VGNA 3WUHA 1WSHA 4K0KK 3TTCA 4EHUA 1RDDA 3CCMN 3LWLA 1NKEA 1BI4B 4BR7A 1IKVA 3SQ4A 1F21A 1ZC6A 5GAHP 1MU2A 3O4WA 4NLCA 3UKUB 4DTUA 3VF2A 3U6FA 3CI5A 3SJJA 4IJAA 1NK5A 3SBGA 4DU1A 1L3VA 2KZMA 4HTLA 2NRZA 3DJCA 2A41A 4O8KA 3V6DA 2Z1JA 5T7BA 3ZT2A 4B9QA 4BRFA 1S1UA 1TYQB 2OYQA 2AA4A 2O8CB 4R79A 1YXQA 1NK8A 3T69A 1EWQA 4K25A 4YOUA 1BO5O 4WQ4C 1R0AA 2W6KA 5AQHA 4JKFA 4A59A 1D5AA 3OYFA 2EHGA 4E7HA 5B8HA 2HBKA 3MN7A 1IV0A 4DS4A 1JJ2M 4DTXA 2A1RA 3FZHA 2FLOA 1VRUA 4CZFA 2J4RA 1SZ2A 3MX2A 2Z1IA 1QHAA 1DT9A 2IC3A 4DTSA 2YHXA 3HK2A 2WC9A 4B3TK 1GLDG 1HJRA 2P5GA 4Q0BA 1T44A 1Y64A 3T7ZA 1HKBA 3MEGA 3VMFB 3LAMA 4K43A 3DWLA 3O08A 3BZKA 3H46O 5C25A 4DB3A 3AA4A 3HOSA 3EZ5A 4EZ9A 1GLAG 3T19A 3QFPA 3K9KA 1VAZA 5AQLA 3MCAB 3TR8A 4X64K 5HRSA 1LCUA 3P5JA 4BACA 3ZT0A 1TVRA 5JMVA 3HJFA 1VQLN 5E41A 2P9KB 2CGJA 2XY5A 3FLCO 4LF7K 1RTJA 3VA3A 4JD2B 1U6ZA 2IVNA 1EXQA 2ZD1A 5C10A 4B3MK 4BG8A 2H3GX 3CCUN 1TUYA 4B1YB 1GLFO 4O44A 5BREA 2R7YA 2HB5A 2HHVA 3VPZA 3O6WA 1KLMA 3V9SA 4CJUA 5BRDA 4WYBA 4BR2A 3SUNA 4A57A 1W9HA 1HJOA 4WCEL 4BR9A 4M42A 2PBDA 3HYFA 5F0XA 3PIOL 1RDUA 2O8DB 4GVMA 3LZIA 4GY2B 5EVZA 3SPZA 5DMRA 1FJGK 3L2UA 4IG0A 3H45C 4W5NA 4F2SA 3CQ8A 4KI4A 5C24A 2YX6A 3ZSYA 4I9LA 3KLFA 3KTQA 3AO5A 4CF1A 4L8RB 4GKJK 1HMVA 3SPYA 5ADXA 3SUPA 3TAMA 4I7FA 1TAUA 3AO4A 4AILC 3D6RA 2QM1A 3NVKA 1LWCA 2ZWHA 4H4MA 3PSIA 4LF4K 4Y1DA 4J8FA 3R6MA 4WQ5A 3SV4A 1VQON 1EKEA 3QLHA 4FWKA 1L5UA 4J2DA 4ZTJA 4BRLA 3PX6A 1REVA 1IKWA 1JCFA 1UAXA 4CJSA 2HHHK 4FJXA 3IRXA 4BC2A 3RMDA 3GBTA 4O5FA 3WNEA 4AM7A 3LDLA 2X74A 1CZAN 4AHTA 2E2PA 4B9LA 4J2AA 4HCBA 3SUOA 3ZETA 2Q0UA 3BF1A 3C65A 1HPMA 1DGKN 1YVNA 3ZSZA 3SAHA 4FLWA 4BQLA 3HRGA 4JI7K 4MDBA 3CPWM 3KLIA 2YKNA 4YHHK 2F9WA 3WEEB 4QAGA 4B8CA 4IKFA 2DFFA 4AH9A 3K5OA 1E4GT 1C0FA 2HBMA 4W5TA 3FGUA 3CPEA 2XRIA 1BUPA 4DTPA 5FROA 4PHTX 4YY3K 1T8EA 1KD1O 5K14A 1VQ5N 4CVNE 1SAZA 3ZX2A 4CJPA 5I9EB 3E01A 3K0SA 2D0AA 1IJJA 4A62A 3D7EO 2YCHA 3RTVA 3E9OA 4WQ4A 3OBWA 4FVUA 3QEPA 4K8XA 4FLUA 3RVCA 1XC3A 2KHOA 5E84A 2YHYA 4X66K 3BP8A 2VWKA 4BRQA 5AQIA 4NYFA 4FPAA 2GUIA 2PAVA 4CJRA 4CGHA 4ICLA 1EQYA 4O55A 3E1YA 3AAPA 1JKHA 2KQ2A 4FPBA 2XO7A 3V9UA 5DK5A 4JK7A 4GNIA 4A2AA 1FKOA 4H0OA 2D0OA 4WFAL 4O5BA 1S5JA 4EP4A 1J5OA 4KTQA 2P9LA 3AA5X 2F96A 2ZJPL 2HNZA 5AQPA 2IOCA 2NZTA 1HX1A 4HVJA 4DWIA 1KAYA 3VEWA 2OTJN 2A1SA 4M7YA 5ADXH 3THXA 3S3NA 4DR4K 2YHBA 1CXQA 4FJHA 1ITGA 4K41A 4C1NI 4JI8K 1CXUA 1HR0K 2QA4N 1KSPA 5BR9A 4KHWA 4CEOA 4YORA 1NK6A 4BRHA 3OYNA 3QFUA 3VETA 1HNVA 1CZ9A 1I94K 3F73A 4JKBA 2W41A 3HM9A 1IKXA 1NGEA 4B1XB 3DLLL 1YHQN 4KH5A 4CIEA 3RMAA 2P9PB 3LDNA 2NRXA 1E4FT 1Q9XA 2BUPA 4IDHA 1XI1A 4LF5K 4JRPA 3NCIA 2YHWA 3OS2A 1HKCA 2Q97A 3L0QA 4OJRA 5KPTA 1A5WA 2WBNA 2YNGA 4CJ3A 2AP1A 5J2MA 5AQWA 1QTMA 1NGFA 4B3SK 3O3FA 1JXEA 4BGAA 3A5OC 4DQSA 4KHYA 4BWJA 1RBSA 3D0PA 5HRNA 5EY4A 3NH1A 1RT3A 2I7PA 4KI6A 1BA0A 4FJKA 5AZJB 1NWKA 4CJ7A 1RTIA 1G15A 5DM6L 4E0DA 1TV6A 5CR4A 2QWPA 3OYIA 2BE2A 4PUOA 3LALA 4CJWA 3RR7A 5CYQA 3NF9A 3LP0A 4JEPA 5IT9O 3ZEUB 4O0IA 1RT2A 3JXUA 3SMPA 1LW2A 2P9UB 3C95A 3ZT3A 3G71N 1SL1A 3OYBA 5HBMA 2G8WA 4KHUA 5SZTA 3IS9A 1KVBA 3MN5A 1HRHA 1VQKN 5GADP 5HL7L 1RT6A 1TKZA 2UUCK 3V1QA 5E26A 4CF0A 3NE6A 1T7PA 1JCEA 3ULDA 4K8ZA 4XH4A 3H1QA 3BGRA 1E3MA 4CW7B 2VG7A 3HP6A 4CFAA 4MQ3A 1QQCA 1XC9A 5AZIA 1JLGA 4M7XA 3U3GA 2Z1GA 1ZBHA 3TARA 3AVFA 4KTZA 4H5RA 4B8AB 4CF2A 2YJEA 4XIUA 2NRVA 4JS5A 2NRWA 3LANA 1QQMA 4DUZK 4OO1J 4H5TA 4EIAA 4CEFA 3RWUA 4ID5A 3O1WA 2ASOA 4DSFA 4AF1A 1NLVA 4I2PA 3L2RA 3T1HK 3WQTA 3ZX0A 2IIRA 4DTJA 1VQ7N 5AQZA 4O0JA 4MDAA 4LF6K 4H5WA 4DHYA 3K2PA 4LFCK 4CBWA 2RKIA 2KKZA 1QZ5A 3O4QA 5GIOA 5CYMA 3NGZA 4KH6A 3AVCA 1O1WA 1NK7A 4FJ9A 3MN6A 4FOIA 1NOZA 4C8OA 2QTDA 5D3GA 3A5NC 5AFUA 3VEOA 3CF5L 1HNXK 4DR2K 5CY4A 5C2FA 4DUYK 3CCSN 3G25A 4JHDB 3DLGA 4JKGB 3DLBA 1WSEA 2F9TA 1TUUA 5HROA 2A3ZA 4DS5A 1J5EK 5AJ3K 2PZSA 3DOLA 1WAFA 4JK8A 2O8EA 1QVFM 3UIQA 3CMAN 2FSJA 4LD0A 3CJAA 1NMDA 4CK1A 4CCHA 1LOTB 3OYEA 1IO2A 2P9SB 2PFUA 1RT1A 5HRPA 1BOTO 3KLHA 3CQYA 1LV5A 3EO3A 4FSVA 4C1NK 2ZM6K 4O8UA 4FJMA 2F4VK 2WONA 2VWBA 3VTHA 2XY8A 2CH5A 3M8RA 3ZSOA 3K9JA 4E7LA 4BR4A 3ULEA 3QESA 3HO1A 4DQIA 3S3MA 4BVOA 4FJLA 5LJVA 4V19S 4I2QA 3ZLJA 3F2KA 2HVHA 1NGCA 1KCFA 2O8BA 4JKEA 3LP1A 3AO1A 2ETJA 4IEIA 4JRQA 4F8RA 3L2WA 4CI6A 3IDHA 4FZZA 3TWHA 1RDAA 1GOCA 5H1SQ 1DTTA 1V4TA 3ATVA 3V9XA 1T05A 3NBPA 3C0BA 1KLNA 3AAQA 4Z4HA 2O4IA 1QSYA 3O9QA 1VHXA 1IG9A 3NF8A 3BUZB 4BVPA 2F8SA 3ZSWA 2GWKA 5FPNA 4DR5K 3LDQA 5KI6A 5J2QA 1P8ZA 1JLCA 3TANA 2HHTA 4C23A 4LH4A 1HNWK 1RNHA 5FRNA 4IOXA 4LSNA 1NK4A 3OYMA 5BRHA 3H1VX 4H5VA 4DFJA 4OPHA 2QWRA 4DF4A 2A40A 2ZJRL 3UE5A 4JI1K 1WUAA 3D2FB 3MEDA 3QIPA 3WNGA 3HP9A 4DFKA 4B9TA 3EKSA 2LSNA 1WBBA 2F8TA 3Q7CA 4CZLA 3CCRN 2O8CA 3WXJA 3EEQA 1JLFA 3CYMA 1RDCA 3BY5A 4CFCA 5GAEP 3THWB 3ATUA 4DR3K 4BDYA 3GE1A 1TK0A 2IGIA 4KPYA 1OVQA 4PKHA 3DLKA 1WSGA 3MCPA 4FJ5A 5FRMA 4YFUA 3ZX3A 3CJ7A 4JI0K 1T03A 4PL7A 1W97L 4H0TB 4OGCA 3R9PA 3M6GA 4BGBA 4KHPK 4JKCA 4QCLA 2HW3A 2X6NA 3H3OB 4B3OA 4AQYK 3H3NO 2QKBA 4F4KA 3VGMA 1WN7A 2A5XA 3DAWA 4CF9A 5C12A 2YI1A 1VQ9N 4BRMA 1ILYA 3O9SA 2V7ZA 5JVGL 4J2EA 2UYTA 3K5NA 3DM2A 1J6ZA 3IG1A 2GV9A 1TL3A 3SJHA 1N33K 3DRSA 1VSFA 3TSPA 1X9SA 1ATNA 3QMLA 3HOTA 3THVA 2Q3SA 5EU7A 3O3GA 2NRHA 4DV4K 5DM7L 2E5LK 3AO3A 5GAGP 4BR0A 4FVMA 4DSEA 2IVOA 2VYPA 5C15A 4YOTA 1KTQA 4BDZA 3EE8A 4CZHA 2P9KA 2HBLA 4CK2A 4WE1A 5M1OA 3U3YA 4JD2A 2Q0RA 2KFNA 4M3TA 3DXMA 4CEEA 1W2BM 1VQNN 1S9GA 4CIGA 3HVRA 4IDKA 3ID6A 1RBUA 2DPNA 3OBYA 1DKGD 3C7NA 3CD6N 3WNHA 3DXKA 2E6MA 2W42A 4E19A 3MAQA 2JGUA 4PQUA 4RW8A 2GUPA 3IFRA 4WF9L 3ZCMA 3ZYYX 3S3OA 4H0VB 5BPMA 5KQDA 2O8DA 4CEZA 2ITGA 1ZYQA 3TABA 4FJGA 1EX4A 1Z25A 1BCMA 1HNIA 5HP1A 2OTLN 4KH4A 5AQFA 3C6AA 4UY8O 1X9WA 1ZBLA 4RG8A 3GOIA 4CHNA 4YDUC 2G8HA 2YNIA 5JLFA 1QSSA 3RSEA 4DV0K 4IZ9A 1WOQA 3OW2M 1HYZA 1S6QA 3PO5A 3IKMA 3T1YK 1BG3A 1IKYA 3R1XA 5BRFA 4FXDA 4W5OA 3ENOA 3JYTA 1X9JA 3TSQA 2B4JA 2EWSA 4IJNA 4CBXA 1HPZA 5AQRA 4ELTA 4FZYA 1XWLA 3G10A 1BIZA 4LH5A 4RWTA 4Z4GA 1A5VA 1NM1A 4DTNA 1WBDA 3VN5A 3MMVA 3U8XA 1SL2A 2W40A 3DMJA 4DF8A 1C6VA 4KB1A 3AVNA 4CJ5A 2GBZA 1SKSA 3KK7A 3TAGA 4FWPA 2O8FB 4BRGA 1JLAA 3AARA 1TK8A 4DQPA 4LSLA 4BRIA 4BG9A 1C1CA 1XUPO 5FDLA 4CGDA 2XY7A 1XNRK 4OX9K 4B9SA 1NGJA 1WB9A 3V4IA 5I3UA 4FOEA 3VF4A 4JS4A 2E1ZA 4CBUA 5F2RA 2E8AA 4NXMK 1QSLA 2FSKA 1U2VB 4CZJA 4EP5A 3W3DA 3VQBA 1A5XA 5C42A 3BEXA 4FW2A 1RBRA 4CJ4A 4B1WB 1Q86O 1U4BA 3AO2A 2V52B 4ZTFA 4MO5A 1X1PA 1ASWA 3CCQN 3CFOA 1VSHA 4X62K 4M63C 1TK5A 4DQQA 1HUXA 2IS3A 4NB4A 3I33A 2QI2A 3PV8A 1Q9YA 4ISGA 1XQSC 3QDKA 2ZE2A 3AVBA 3EN9A 2IVPA 5C2DA 1WNSA 3VGKA 1Z05A 1NG9A 2P9IA 3SNNA 2GTDA 3SBTA 4J2BA 3AVHA 1YT3A 3ZETB 4CJVA 4AHUA 4WFBL 3AVJA 3KKRA 4AHSA 5AQXA 1NBWA 1RTHA 1CZBA 4X65K 1HQUA 2X78A 4FW1A 4CF8A 4E7KA 2PYJA 4DLEA 3FFIA 3QERA 4BRKA 2Q31A 4M3UA 1T3VA 4BE0A 1I3AA 2XHBA 3HM8A 3T1AA 1RBVA 3VERA 4CEAA 5I42A 4FCYA 3BDPA 4JI3K 3EY1A 5JS2A 3V9WA 5J1EA 4B08A 3AGRA 3SZ2A 4DU3A 2HMPA 1ZXOA 3VEYA 3LZJA 3TSUA 1DEJA 3SQ1A 2QK9A 5HRRA 2RPIA 4BRCA 4LF9K 3J7AP 2JWLA 3BZCA 3THYA 5J2NA 4CZKA 2HBJA 3VQEA 3PX4A 4W5RA 4ILJA 2D0PA 3SI6A 4NCBA 4KREA 3OYGA 3WXKA 4NCAA 4CGIA 1MWMA 2YNFA 2A42A 4A5BA 2UU9K 2JWKA 2E6LA 3MWTA 3EYZA 1LWFA 2VQEK 1N34K 3N4QA 1HNZK 4HWIA 2OPQA 2HF4A 1X3MA 4I9QA 4RW7A 3NHGA 4IFVA 3L3VA 4DCHA 4JAXA 5F1XA 4CHOA 1NJWA 1NJYA 4E1NA 2OZSA 2P9LB 2HHSA 1B9FA 5TKYA 4IFYA 4AM6A 3THXB 3F9KA 1QVGM 1L3TA 2RN2A 3H6EA 1KFSA 3ZEUA 3CC2N 1RDWX 5EOYA 4G9ZA 3A8YA 3TU5A
chains in the Genus database with same CATH topology
4DS4A 4CHQA 1DTQA 1XHXA 4DTXA 3A2FA 1VRUA 2A1RA 2IDOA 3AVLA 3HPOA 2Z1IA 2IC3A 4DTSA 2OA8A 3HK2A 1TGOA 4OGEA 4FJIA 3M8SA 1RT1A 5HRPA 1HJRA 3RR8A 2P5GA 2FBVA 3KLHA 4Q0BA 1RILA 1TKXA 2X6SA 4CJLA 4FK0A 1LWEA 1LV5A 4Y1CA 1X9MA 3MEGA 4FJMA 2ZQBA 4JLHA 2WONA 4OPJA 4KFBA 3K5MA 4PUOA 1BQMA 2XY8A 3M8RA 3LAMA 3ZSOA 4NYNA 1GOAA 4BE2A 4E7LA 3QESA 3HO1A 1ASVA 2HHUA 5C25A 4CK3A 4DQIA 3S3MA 4FJLA 3KKSA 4I2QA 3AA4A 1L3SA 3LPUA 2HVHA 3EZ5A 4EZ9A 2FBXA 1KCFA 3AVKA 4C8LA 4FYDA 4HUEA 1S1VA 3LP1A 3T19A 4OLBA 3AO1A 1QHTA 3ZT4A 2ETJA 4HCCA 4JRQA 4F8RA 3L2WA 4FZZA 3TWHA 1FKPA 1EP4A 1RDAA 1GOCA 1WLJA 1YTUA 4PWDA 3TR8A 3C6TA 1DTTA 3RRGA 4CJKA 3V9XA 3PUFA 5HRSA 1T05A 3NBPA 2PYLA 1KLNA 4Z4HA 2I5JA 2O4IA 1QSYA 3P5JA 4IG3A 4BACA 3ZT0A 1TVRA 1IG9A 2G8UA 1C0UA 3NF8A 1RCHA 3HJFA 1B9DA 4FJJA 1VSKA 3V9ZA 3RMBA 1WSIA 2G8VA 1ZBIA 3ZSWA 4IBNA 2F8SA 2DY4A 2ATQA 3S9HA 5KI6A 3CM5A 3SV3A 3LP3A 3KK2A 1SL0A 5J2QA 5E41A 1JLCA 2QXFA 3TANA 2HHTA 2XY5A 3HSTB 4LH4A 1RNHA 5FRNA 1RTJA 4LSNA 3VA3A 5J2PA 1NK4A 4Z4IA 3OYMA 3HPHA 2O4GA 1EXQA 2ZD1A 3OYHA 2B5JA 2YNHA 4UQGA 2NUBA 4DFJA 2P5OA 4M45A 4RW4A 5CZ2A 4DLGA 3OYAA 4DFPA 4DF4A 4O44A 2R7YA 2P51A 2HB5A 2HHVA 1NOYA 4KAZA 4FJ8A 3KLGA 1KLMA 3V9SA 3SQ0A 3MEDA 3QIPA 3DYAA 3WNGA 4CJUA 1NK0A 4KHNA 3SUNA 3HP9A 3I0SA 4DFKA 4CJQA 3ZSRA 2FC0A 1W9HA 4B9TA 3ITHA 4DSIA 3C6UA 2LSNA 4DMNA 3VQPA 2F8TA 4M42A 3NAEA 1I39A 3HYFA 1S1WA 3OYDA 3OYKA 1JLFA 3H08A 4GVMA 3CYMA 4OKJA 3LZIA 1N6QA 1RDCA 4CFCA 4B9MA 1KFDA 1D9DA 1BHLA 3SPZA 5DMRA 4BDYA 3L2UA 4IG0A 5KGWA 4W5NA 3ISNC 1TK0A 2IGIA 3VA0A 4F2SA 3LPTA 3CQ8A 4AHRA 4FLZA 1WAJA 2KW4A 1FK9A 5C24A 3QEXA 4KPYA 1J9AA 3ZSYA 1L3UA 4I9LA 3I8DA 3DLKA 1WSGA 4M3RA 3VQ8A 3AO5A 4CF1A 4YFUA 3KLFA 3KTQA 4FJ5A 4L8RB 5FRMA 1HMVA 4Z4FA 1T03A 4Z0UA 3VQ6A 3SPYA 3SUPA 3TAMA 4I7FA 4Q5VA 1NK9A 3WNFA 1TAUA 3AO4A 4OGCA 4E3SA 4AILC 4RW6A 3OS1A 2G8FA 4KB0A 3VQ4A 1JLBA 3MEEA 3D45A 4QCLA 3PX0A 2X6NA 2HW3A 3L3UA 1LWCA 3QEWA 4H4MA 4B3OA 4Y1DA 1QE1A 4DSKA 2QKBA 3AVMA 3OY9A 3NGIA 4F4KA 3QO9A 3ZSXA 1N5YA 3SV4A 1WN7A 4KHSA 4CF9A 1EKEA 3QLHA 1L5UA 1S1TA 3SUQA 4BWMA 4J2DA 4ZTJA 1EETA 2OPRA 3PX6A 1REVA 1IKWA 4ID1A 1UAXA 3RMCA 4CJSA 4FJXA 4KREA 3IRXA 3RMDA 3WNEA 2G8KA 2OPSA 4M3XA 4J2EA 1U45A 4G1QA 2X74A 4M3WA 2BGGA 4AHTA 3K5NA 3DM2A 4B9LA 4J2AA 3IG1A 2GV9A 1VRTA 4HCBA 1TL3A 1B92A 3SUOA 3DRSA 1VSFA 3TI0A 1UA1A 1X9SA 3VQ7A 1GOBA 3L8BA 4FK4A 4TSXA 3ZSZA 4FLWA 3THVA 2Q3SA 5EU7A 3O3GA 4ELVA 3G0ZA 5KGXA 3VQAA 4QOZB 2EX3A 3KLIA 3AO3A 2PY5A 2G8IA 4CGFA 2YKNA 3VQQA 4FVMA 4DSEA 2D0BA 1D8YA 4KHQA 4KO0A 4FM0A 4QAGA 2DFHA 4B8CA 4MFBA 4C8KA 4IKFA 1SKRA 2DFFA 4AH9A 3TAEA 2HVIA 3K5OA 3ZSQA 1KTQA 3AVIA 3VQ9A 4HUGA 4BDZA 1RT4A 4CK2A 4W5TA 4WE1A 4C8NA 2XRIA 3AA3A 3NH2A 1LAVA 4KTWA 3U3YA 4B9VA 4FK2A 3QINA 2KFNA 3KJVA 1WSFA 5FROA 4DTPA 4M3TA 3AV9A 1T8EA 3CFRA 3HP6A 5K14A 3KD1E 1HQEA 4CFAA 4CEEA 1SUQA 1LAWA 4CFBA 5KRSA 4CGJA 1S9GA 4CIGA 1XC9A 2DFEA 4CJPA 3ZSVA 3NFAA 4LY7A 3HVRA 3E01A 4IDKA 4FM1A 2HHXA 2HMIA 2D0AA 2RF2A 1RBUA 1QS4A 1K6YA 4N47A 1CLQA 3WNHA 3RTVA 1TAQA 4OVLA 4CERA 2E6MA 2Y1JA 3QEPA 4K8XA 1C1AA 4FLUA 2W42A 2QKKA 4E19A 3MAQA 2JGUA 4FM2A 4PQUA 4RW8A 1BI4A 3DLHA 3DOKA 3ZCMA 4KV8A 3S3OA 3HVTA 2VWKA 4NYFA 3NF7A 4CEZA 2GUIA 1ZBFA 4CJRA 1BIUA 4CGHA 4ICLA 2ITGA 4ELUA 1HYSA 4O55A 1ZYQA 3TABA 1UA0A 1J54A 1JKHA 2KQ2A 4FJGA 1EX4A 2XO7A 3V9UA 1NKCA 5DK5A 2KTQA 1Z25A 3LP2A 4AHVA 1BCMA 1HNIA 1SV5A 1FKOA 5HP1A 1VSLA 4DU4A 4O5BA 1X9WA 1S5JA 4EP4A 4CESA 3K58A 1ZBLA 1J5OA 2BDPA 4F2RA 4RG8A 4KTQA 3AA5X 3DLRA 2F96A 4CHNA 2G8HA 2HNZA 2YNIA 4OLAA 4CECA 1QSSA 2IOCA 2B6AA 2VWJA 4HVJA 4DWIA 1HYZA 1LW0A 1S6QA 3LWMA 2A1SA 3PO5A 3MECA 3VQCA 3S3NA 5HLFA 2YHBA 1CXQA 1IKYA 1ITGA 4FJHA 1TKTA 3OYCA 1CXUA 4FXDA 5CZ1A 4HUFA 4OKEA 4W5OA 1KSPA 4E89A 2OZMA 3JYTA 2B4JA 4KHWA 4M3ZA 4CEOA 1TL1A 3QETA 1HPZA 1RT5A 3L2QA 4ELTA 1NK6A 3OYNA 4FZYA 4DFMA 3OS0A 2JLEA 3QEVA 1XWLA 4GMJB 3B6PA 1C0MA 3QIOA 2IAJA 5KRTA 1HNVA 1Y97A 1CZ9A 3C94A 3G10A 3F73A 1BIZA 4N76A 4LH5A 4CEDA 4FLYA 4Z4GA 2D5RA 2KZZA 1A5VA 3HM9A 1IKXA 4FJNA 1WSJA 4DTNA 3VN5A 4DSLA 1SL2A 3DMJA 4CIEA 1C6VA 4HTUA 4DF8A 3AVNA 4KB1A 4OPKA 4Z4EA 4CJ5A 3RMAA 1U49A 2P1JA 4DTMA 3O3HA 1Q9XA 3V81A 2GBZA 1SKSA 2YKMA 1ZBUA 1XI1A 3TAGA 4JRPA 1KVCA 1VSJA 4CJEA 3KK3A 3NCIA 4OKKA 3DLEA 1UOCA 3OS2A 4BE1A 1JLAA 4FLXA 5KTQA 1S9EA 4OJRA 2XY6A 4E7JA 1TK8A 2HNDA 4DQPA 1A5WA 1RBTA 4LSLA 3PY8A 4B9UA 2E4LA 2YNGA 3NGYA 4CJ3A 1C1CA 5FDLA 2XY7A 4CGDA 5J2MA 2Y1IA 1QTMA 4B9SA 1FXXA 1JXEA 3O3FA 3V4IA 5I3UA 4CHYA 5JS1A 1UWBA 3L2VA 4JS4A 4DQSA 4KHYA 3TAQA 4BWJA 1RBSA 3D0PA 5HRNA 4C8MA 1W0HA 3NH1A 1RT3A 4YNQA 3PO4A 1QSLA 4CHPA 4KI6A 4EP5A 1ASUA 3NDKA 4FJKA 3VQBA 3JSMA 1A5XA 5C42A 4M41A 4F3OA 1RTIA 3OYJA 1BL3A 4FW2A 1G15A 4W5QA 1RBRA 4CJ4A 1NJZA 2HHWA 1U4BA 3OYEA 3OYLA 4E0DA 1TV6A 3AO2A 3OYIA 2BE2A 3OVNA 3SYZA 4ZTFA 1X1PA 1ASWA 2WOMA 4ZHRA 3CFOA 3LALA 1VSHA 4PA1A 3I0RA 4CJWA 3RR7A 4M3YA 2AJQA 3P1GA 3CFPA 5CYQA 4KI4A 3NF9A 1YVUA 3LP0A 4Z4CA 4DQQA 1TK5A 3B6OA 1ZBHA 4N56A 2IS3A 5SWMA 3T3FA 3PV8A 4O0IA 1HYVA 1Q9YA 1BQNA 1J53A 3HXMA 2D0CA 1RT2A 1JLEA 1LW2A 2ZE2A 3ALYA 4R5PA 4BDPA 4FZXC 3C95A 4N5SA 3ZT3A 4N41A 3AVBA 4E7IA 1SL1A 3OYBA 5HBMA 3K59A 2G8WA 4KHUA 1WNSA 3IS9A 1KVBA 4RW9A 3M8PA 5SZTA 4HHTA 1HRHA 1KVAA 3ZT1A 1VSDA 1KRPA 1RT6A 1TKZA 3SNNA 3V1QA 1BGXT 2FBYA 4CF0A 3K5LA 3NE6A 1BCOA 1T7PA 3AVAA 1JL1A 3ULDA 4E1MA 4K8ZA 4J2BA 4CJTA 1YTAA 3AVHA 1YT3A 3BGRA 3OJUA 4CJVA 4AHUA 1NKBA 3OJSA 3MXJA 4FLTA 4B9NA 3AVJA 3KKRA 1D9FA 4CFDA 4KKOA 2VG7A 3VQ5A 4AHSA 4MQ3A 1JXBA 1CZBA 1QQCA 1HQUA 1RTHA 1IH7A 2X78A 1JLGA 3CM6A 4FW1A 4CEBA 4CF8A 3U3GA 3KLEA 4H8KA 2BANA 2Z1GA 4E7KA 4DTOA 3AVFA 3TARA 1U47A 3AVGA 4DLEA 4KTZA 1U48A 3FFIA 4CEQA 2YV0X 3QERA 3QNNA 3MXMA 1SKWA 4B8AB 4CF2A 3DI6A 4XIUA 4FLVA 4M3UA 3LDSA 4JS5A 4BE0A 4NCGA 3DRRA 4CJFA 4KRFA 1I3AA 1C1BA 4F3TA 3LANA 3QNOA 2XHBA 2OPPA 4DTRA 3T1AA 3M8QA 1RBVA 5I42A 4CEAA 4AHCA 4FCYA 3BDPA 4NCBA 3KK1A 2HHQA 3CG7A 3RWUA 4CEFA 3EY1A 3QEIA 4PY5A 4FJ7A 5JS2A 4ID5A 4CHZA 5J1EA 3V9WA 4B08A 3SQ2A 1VSMA 1TKDA 2KFZA 4CGGA 3SZ2A 3O4NA 4DU3A 3HT3A 4DSFA 1XHZA 4H4OA 3HPGA 3P83D 4I2PA 3L2RA 2YHAA 3LZJA 3DRPA 3TAPA 3SQ1A 1U04A 2QK9A 5HRRA 2RPIA 4DTJA 1S6PA 1WSHA 1VSIA 4O0JA 1RTDA 1RDDA 5J2NA 3VQEA 3LWLA 3PX4A 3K2PA 1VSEA 4W5RA 3SI6A 3HL8A 4DG1A 2RKIA 1NKEA 1BI4B 3RRHA 3LAKA 3O4QA 3OYGA 3KIOA 2PYJA 4CGIA 4NCAA 2YNFA 1IKVA 3SQ4A 4CE9A 1F21A 5CYMA 3NGZA 2E6LA 1VK0A 3NH0A 1NJXA 3AVCA 3EYZA 1LWFA 1MU2A 1O1WA 1NK7A 2OPQA 4DTUA 4GW6A 4FJ9A 3IAYA 3U6FA 1RT7A 1NOZA 4I9QA 4RW7A 1BISA 3V1OA 3SJJA 1NK5A 4C8OA 3SCXA 4DU1A 4O4GA 3NHGA 3NF6A 5D3GA 1L3VA 4DQRA 3MXIA 2KZMA 1Q8IA 1C0TA 4IFVA 5CY4A 3L3VA 4CIFA 1DLOA 2Z1JA 3V6DA 5T7BA 3ZT2A 4EZ6A 4CHOA 1NJWA 1NJYA 4E1NA 2OZSA 3DLGA 3DLBA 2HHSA 1B9FA 1S1UA 1WSEA 3ASMA 2OYQA 2HNYA 5HROA 4IFYA 4DS5A 3TAFA 4DSJA 1NK8A 1JLQA 2DTUA 2VG5A 3V1RA 3F9KA 1R0AA 3AA2A 1L3TA 3DOLA 1WAFA 2PZSA 2RN2A 1S1XA 1JL2A 1KFSA 3KD5E 3K57A 2FBTA 3UIQA 3VQDA 1D5AA 4LD0A 3OYFA 2EHGA 4E7HA 2VG6A 1Z26A 4CK1A 2Z1HA 4CCHA 1RDBA 1IO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS4 A;  4CHQ A;  1DTQ A;  1XHX A;  4DTX A;  3A2F A;  1VRU A;  2A1R A;  2IDO A;  3AVL A;  3HPO A;  2Z1I A;  2IC3 A;  4DTS A;  2OA8 A;  3HK2 A;  1TGO A;  4OGE A;  4FJI A;  3M8S A;  1RT1 A;  5HRP A;  1HJR A;  3RR8 A;  2P5G A;  2FBV A;  3KLH A;  4Q0B A;  1RIL A;  1TKX A;  2X6S A;  4CJL A;  4FK0 A;  1LWE A;  1LV5 A;  4Y1C A;  1X9M A;  3MEG A;  4FJM A;  2ZQB A;  4JLH A;  2WON A;  4OPJ A;  4KFB A;  3K5M A;  4PUO A;  1BQM A;  2XY8 A;  3M8R A;  3LAM A;  3ZSO A;  4NYN A;  1GOA A;  4BE2 A;  4E7L A;  3QES A;  3HO1 A;  1ASV A;  2HHU A;  5C25 A;  4CK3 A;  4DQI A;  3S3M A;  4FJL A;  3KKS A;  4I2Q A;  3AA4 A;  1L3S A;  3LPU A;  2HVH A;  3EZ5 A;  4EZ9 A;  2FBX A;  1KCF A;  3AVK A;  4C8L A;  4FYD A;  4HUE A;  1S1V A;  3LP1 A;  3T19 A;  4OLB A;  3AO1 A;  1QHT A;  3ZT4 A;  2ETJ A;  4HCC A;  4JRQ A;  4F8R A;  3L2W A;  4FZZ A;  3TWH A;  1FKP A;  1EP4 A;  1RDA A;  1GOC A;  1WLJ A;  1YTU A;  4PWD A;  3TR8 A;  3C6T A;  1DTT A;  3RRG A;  4CJK A;  3V9X A;  3PUF A;  5HRS A;  1T05 A;  3NBP A;  2PYL A;  1KLN A;  4Z4H A;  2I5J A;  2O4I A;  1QSY A;  3P5J A;  4IG3 A;  4BAC A;  3ZT0 A;  1TVR A;  1IG9 A;  2G8U A;  1C0U A;  3NF8 A;  1RCH A;  3HJF A;  1B9D A;  4FJJ A;  1VSK A;  3V9Z A;  3RMB A;  1WSI A;  2G8V A;  1ZBI A;  3ZSW A;  4IBN A;  2F8S A;  2DY4 A;  2ATQ A;  3S9H A;  5KI6 A;  3CM5 A;  3SV3 A;  3LP3 A;  3KK2 A;  1SL0 A;  5J2Q A;  5E41 A;  1JLC A;  2QXF A;  3TAN A;  2HHT A;  2XY5 A;  3HST B;  4LH4 A;  1RNH A;  5FRN A;  1RTJ A;  4LSN A;  3VA3 A;  5J2P A;  1NK4 A;  4Z4I A;  3OYM A;  3HPH A;  2O4G A;  1EXQ A;  2ZD1 A;  3OYH A;  2B5J A;  2YNH A;  4UQG A;  2NUB A;  4DFJ A;  2P5O A;  4M45 A;  4RW4 A;  5CZ2 A;  4DLG A;  3OYA A;  4DFP A;  4DF4 A;  4O44 A;  2R7Y A;  2P51 A;  2HB5 A;  2HHV A;  1NOY A;  4KAZ A;  4FJ8 A;  3KLG A;  1KLM A;  3V9S A;  3SQ0 A;  3MED A;  3QIP A;  3DYA A;  3WNG A;  4CJU A;  1NK0 A;  4KHN A;  3SUN A;  3HP9 A;  3I0S A;  4DFK A;  4CJQ A;  3ZSR A;  2FC0 A;  1W9H A;  4B9T A;  3ITH A;  4DSI A;  3C6U A;  2LSN A;  4DMN A;  3VQP A;  2F8T A;  4M42 A;  3NAE A;  1I39 A;  3HYF A;  1S1W A;  3OYD A;  3OYK A;  1JLF A;  3H08 A;  4GVM A;  3CYM A;  4OKJ A;  3LZI A;  1N6Q A;  1RDC A;  4CFC A;  4B9M A;  1KFD A;  1D9D A;  1BHL A;  3SPZ A;  5DMR A;  4BDY A;  3L2U A;  4IG0 A;  5KGW A;  4W5N A;  3ISN C;  1TK0 A;  2IGI A;  3VA0 A;  4F2S A;  3LPT A;  3CQ8 A;  4AHR A;  4FLZ A;  1WAJ A;  2KW4 A;  1FK9 A;  5C24 A;  3QEX A;  4KPY A;  1J9A A;  3ZSY A;  1L3U A;  4I9L A;  3I8D A;  3DLK A;  1WSG A;  4M3R A;  3VQ8 A;  3AO5 A;  4CF1 A;  4YFU A;  3KLF A;  3KTQ A;  4FJ5 A;  4L8R B;  5FRM A;  1HMV A;  4Z4F A;  1T03 A;  4Z0U A;  3VQ6 A;  3SPY A;  3SUP A;  3TAM A;  4I7F A;  4Q5V A;  1NK9 A;  3WNF A;  1TAU A;  3AO4 A;  4OGC A;  4E3S A;  4AIL C;  4RW6 A;  3OS1 A;  2G8F A;  4KB0 A;  3VQ4 A;  1JLB A;  3MEE A;  3D45 A;  4QCL A;  3PX0 A;  2X6N A;  2HW3 A;  3L3U A;  1LWC A;  3QEW A;  4H4M A;  4B3O A;  4Y1D A;  1QE1 A;  4DSK A;  2QKB A;  3AVM A;  3OY9 A;  3NGI A;  4F4K A;  3QO9 A;  3ZSX A;  1N5Y A;  3SV4 A;  1WN7 A;  4KHS A;  4CF9 A;  1EKE A;  3QLH A;  1L5U A;  1S1T A;  3SUQ A;  4BWM A;  4J2D A;  4ZTJ A;  1EET A;  2OPR A;  3PX6 A;  1REV A;  1IKW A;  4ID1 A;  1UAX A;  3RMC A;  4CJS A;  4FJX A;  4KRE A;  3IRX A;  3RMD A;  3WNE A;  2G8K A;  2OPS A;  4M3X A;  4J2E A;  1U45 A;  4G1Q A;  2X74 A;  4M3W A;  2BGG A;  4AHT A;  3K5N A;  3DM2 A;  4B9L A;  4J2A A;  3IG1 A;  2GV9 A;  1VRT A;  4HCB A;  1TL3 A;  1B92 A;  3SUO A;  3DRS A;  1VSF A;  3TI0 A;  1UA1 A;  1X9S A;  3VQ7 A;  1GOB A;  3L8B A;  4FK4 A;  4TSX A;  3ZSZ A;  4FLW A;  3THV A;  2Q3S A;  5EU7 A;  3O3G A;  4ELV A;  3G0Z A;  5KGX A;  3VQA A;  4QOZ B;  2EX3 A;  3KLI A;  3AO3 A;  2PY5 A;  2G8I A;  4CGF A;  2YKN A;  3VQQ A;  4FVM A;  4DSE A;  2D0B A;  1D8Y A;  4KHQ A;  4KO0 A;  4FM0 A;  4QAG A;  2DFH A;  4B8C A;  4MFB A;  4C8K A;  4IKF A;  1SKR A;  2DFF A;  4AH9 A;  3TAE A;  2HVI A;  3K5O A;  3ZSQ A;  1KTQ A;  3AVI A;  3VQ9 A;  4HUG A;  4BDZ A;  1RT4 A;  4CK2 A;  4W5T A;  4WE1 A;  4C8N A;  2XRI A;  3AA3 A;  3NH2 A;  1LAV A;  4KTW A;  3U3Y A;  4B9V A;  4FK2 A;  3QIN A;  2KFN A;  3KJV A;  1WSF A;  5FRO A;  4DTP A;  4M3T A;  3AV9 A;  1T8E A;  3CFR A;  3HP6 A;  5K14 A;  3KD1 E;  1HQE A;  4CFA A;  4CEE A;  1SUQ A;  1LAW A;  4CFB A;  5KRS A;  4CGJ A;  1S9G A;  4CIG A;  1XC9 A;  2DFE A;  4CJP A;  3ZSV A;  3NFA A;  4LY7 A;  3HVR A;  3E01 A;  4IDK A;  4FM1 A;  2HHX A;  2HMI A;  2D0A A;  2RF2 A;  1RBU A;  1QS4 A;  1K6Y A;  4N47 A;  1CLQ A;  3WNH A;  3RTV A;  1TAQ A;  4OVL A;  4CER A;  2E6M A;  2Y1J A;  3QEP A;  4K8X A;  1C1A A;  4FLU A;  2W42 A;  2QKK A;  4E19 A;  3MAQ A;  2JGU A;  4FM2 A;  4PQU A;  4RW8 A;  1BI4 A;  3DLH A;  3DOK A;  3ZCM A;  4KV8 A;  3S3O A;  3HVT A;  2VWK A;  4NYF A;  3NF7 A;  4CEZ A;  2GUI A;  1ZBF A;  4CJR A;  1BIU A;  4CGH A;  4ICL A;  2ITG A;  4ELU A;  1HYS A;  4O55 A;  1ZYQ A;  3TAB A;  1UA0 A;  1J54 A;  1JKH A;  2KQ2 A;  4FJG A;  1EX4 A;  2XO7 A;  3V9U A;  1NKC A;  5DK5 A;  2KTQ A;  1Z25 A;  3LP2 A;  4AHV A;  1BCM A;  1HNI A;  1SV5 A;  1FKO A;  5HP1 A;  1VSL A;  4DU4 A;  4O5B A;  1X9W A;  1S5J A;  4EP4 A;  4CES A;  3K58 A;  1ZBL A;  1J5O A;  2BDP A;  4F2R A;  4RG8 A;  4KTQ A;  3AA5 X;  3DLR A;  2F96 A;  4CHN A;  2G8H A;  2HNZ A;  2YNI A;  4OLA A;  4CEC A;  1QSS A;  2IOC A;  2B6A A;  2VWJ A;  4HVJ A;  4DWI A;  1HYZ A;  1LW0 A;  1S6Q A;  3LWM A;  2A1S A;  3PO5 A;  3MEC A;  3VQC A;  3S3N A;  5HLF A;  2YHB A;  1CXQ A;  1IKY A;  1ITG A;  4FJH A;  1TKT A;  3OYC A;  1CXU A;  4FXD A;  5CZ1 A;  4HUF A;  4OKE A;  4W5O A;  1KSP A;  4E89 A;  2OZM A;  3JYT A;  2B4J A;  4KHW A;  4M3Z A;  4CEO A;  1TL1 A;  3QET A;  1HPZ A;  1RT5 A;  3L2Q A;  4ELT A;  1NK6 A;  3OYN A;  4FZY A;  4DFM A;  3OS0 A;  2JLE A;  3QEV A;  1XWL A;  4GMJ B;  3B6P A;  1C0M A;  3QIO A;  2IAJ A;  5KRT A;  1HNV A;  1Y97 A;  1CZ9 A;  3C94 A;  3G10 A;  3F73 A;  1BIZ A;  4N76 A;  4LH5 A;  4CED A;  4FLY A;  4Z4G A;  2D5R A;  2KZZ A;  1A5V A;  3HM9 A;  1IKX A;  4FJN A;  1WSJ A;  4DTN A;  3VN5 A;  4DSL A;  1SL2 A;  3DMJ A;  4CIE A;  1C6V A;  4HTU A;  4DF8 A;  3AVN A;  4KB1 A;  4OPK A;  4Z4E A;  4CJ5 A;  3RMA A;  1U49 A;  2P1J A;  4DTM A;  3O3H A;  1Q9X A;  3V81 A;  2GBZ A;  1SKS A;  2YKM A;  1ZBU A;  1XI1 A;  3TAG A;  4JRP A;  1KVC A;  1VSJ A;  4CJE A;  3KK3 A;  3NCI A;  4OKK A;  3DLE A;  1UOC A;  3OS2 A;  4BE1 A;  1JLA A;  4FLX A;  5KTQ A;  1S9E A;  4OJR A;  2XY6 A;  4E7J A;  1TK8 A;  2HND A;  4DQP A;  1A5W A;  1RBT A;  4LSL A;  3PY8 A;  4B9U A;  2E4L A;  2YNG A;  3NGY A;  4CJ3 A;  1C1C A;  5FDL A;  2XY7 A;  4CGD A;  5J2M A;  2Y1I A;  1QTM A;  4B9S A;  1FXX A;  1JXE A;  3O3F A;  3V4I A;  5I3U A;  4CHY A;  5JS1 A;  1UWB A;  3L2V A;  4JS4 A;  4DQS A;  4KHY A;  3TAQ A;  4BWJ A;  1RBS A;  3D0P A;  5HRN A;  4C8M A;  1W0H A;  3NH1 A;  1RT3 A;  4YNQ A;  3PO4 A;  1QSL A;  4CHP A;  4KI6 A;  4EP5 A;  1ASU A;  3NDK A;  4FJK A;  3VQB A;  3JSM A;  1A5X A;  5C42 A;  4M41 A;  4F3O A;  1RTI A;  3OYJ A;  1BL3 A;  4FW2 A;  1G15 A;  4W5Q A;  1RBR A;  4CJ4 A;  1NJZ A;  2HHW A;  1U4B A;  3OYE A;  3OYL A;  4E0D A;  1TV6 A;  3AO2 A;  3OYI A;  2BE2 A;  3OVN A;  3SYZ A;  4ZTF A;  1X1P A;  1ASW A;  2WOM A;  4ZHR A;  3CFO A;  3LAL A;  1VSH A;  4PA1 A;  3I0R A;  4CJW A;  3RR7 A;  4M3Y A;  2AJQ A;  3P1G A;  3CFP A;  5CYQ A;  4KI4 A;  3NF9 A;  1YVU A;  3LP0 A;  4Z4C A;  4DQQ A;  1TK5 A;  3B6O A;  1ZBH A;  4N56 A;  2IS3 A;  5SWM A;  3T3F A;  3PV8 A;  4O0I A;  1HYV A;  1Q9Y A;  1BQN A;  1J53 A;  3HXM A;  2D0C A;  1RT2 A;  1JLE A;  1LW2 A;  2ZE2 A;  3ALY A;  4R5P A;  4BDP A;  4FZX C;  3C95 A;  4N5S A;  3ZT3 A;  4N41 A;  3AVB A;  4E7I A;  1SL1 A;  3OYB A;  5HBM A;  3K59 A;  2G8W A;  4KHU A;  1WNS A;  3IS9 A;  1KVB A;  4RW9 A;  3M8P A;  5SZT A;  4HHT A;  1HRH A;  1KVA A;  3ZT1 A;  1VSD A;  1KRP A;  1RT6 A;  1TKZ A;  3SNN A;  3V1Q A;  1BGX T;  2FBY A;  4CF0 A;  3K5L A;  3NE6 A;  1BCO A;  1T7P A;  3AVA A;  1JL1 A;  3ULD A;  4E1M A;  4K8Z A;  4J2B A;  4CJT A;  1YTA A;  3AVH A;  1YT3 A;  3BGR A;  3OJU A;  4CJV A;  4AHU A;  1NKB A;  3OJS A;  3MXJ A;  4FLT A;  4B9N A;  3AVJ A;  3KKR A;  1D9F A;  4CFD A;  4KKO A;  2VG7 A;  3VQ5 A;  4AHS A;  4MQ3 A;  1JXB A;  1CZB A;  1QQC A;  1HQU A;  1RTH A;  1IH7 A;  2X78 A;  1JLG A;  3CM6 A;  4FW1 A;  4CEB A;  4CF8 A;  3U3G A;  3KLE A;  4H8K A;  2BAN A;  2Z1G A;  4E7K A;  4DTO A;  3AVF A;  3TAR A;  1U47 A;  3AVG A;  4DLE A;  4KTZ A;  1U48 A;  3FFI A;  4CEQ A;  2YV0 X;  3QER A;  3QNN A;  3MXM A;  1SKW A;  4B8A B;  4CF2 A;  3DI6 A;  4XIU A;  4FLV A;  4M3U A;  3LDS A;  4JS5 A;  4BE0 A;  4NCG A;  3DRR A;  4CJF A;  4KRF A;  1I3A A;  1C1B A;  4F3T A;  3LAN A;  3QNO A;  2XHB A;  2OPP A;  4DTR A;  3T1A A;  3M8Q A;  1RBV A;  5I42 A;  4CEA A;  4AHC A;  4FCY A;  3BDP A;  4NCB A;  3KK1 A;  2HHQ A;  3CG7 A;  3RWU A;  4CEF A;  3EY1 A;  3QEI A;  4PY5 A;  4FJ7 A;  5JS2 A;  4ID5 A;  4CHZ A;  5J1E A;  3V9W A;  4B08 A;  3SQ2 A;  1VSM A;  1TKD A;  2KFZ A;  4CGG A;  3SZ2 A;  3O4N A;  4DU3 A;  3HT3 A;  4DSF A;  1XHZ A;  4H4O A;  3HPG A;  3P83 D;  4I2P A;  3L2R A;  2YHA A;  3LZJ A;  3DRP A;  3TAP A;  3SQ1 A;  1U04 A;  2QK9 A;  5HRR A;  2RPI A;  4DTJ A;  1S6P A;  1WSH A;  1VSI A;  4O0J A;  1RTD A;  1RDD A;  5J2N A;  3VQE A;  3LWL A;  3PX4 A;  3K2P A;  1VSE A;  4W5R A;  3SI6 A;  3HL8 A;  4DG1 A;  2RKI A;  1NKE A;  1BI4 B;  3RRH A;  3LAK A;  3O4Q A;  3OYG A;  3KIO A;  2PYJ A;  4CGI A;  4NCA A;  2YNF A;  1IKV A;  3SQ4 A;  4CE9 A;  1F21 A;  5CYM A;  3NGZ A;  2E6L A;  1VK0 A;  3NH0 A;  1NJX A;  3AVC A;  3EYZ A;  1LWF A;  1MU2 A;  1O1W A;  1NK7 A;  2OPQ A;  4DTU A;  4GW6 A;  4FJ9 A;  3IAY A;  3U6F A;  1RT7 A;  1NOZ A;  4I9Q A;  4RW7 A;  1BIS A;  3V1O A;  3SJJ A;  1NK5 A;  4C8O A;  3SCX A;  4DU1 A;  4O4G A;  3NHG A;  3NF6 A;  5D3G A;  1L3V A;  4DQR A;  3MXI A;  2KZM A;  1Q8I A;  1C0T A;  4IFV A;  5CY4 A;  3L3V A;  4CIF A;  1DLO A;  2Z1J A;  3V6D A;  5T7B A;  3ZT2 A;  4EZ6 A;  4CHO A;  1NJW A;  1NJY A;  4E1N A;  2OZS A;  3DLG A;  3DLB A;  2HHS A;  1B9F A;  1S1U A;  1WSE A;  3ASM A;  2OYQ A;  2HNY A;  5HRO A;  4IFY A;  4DS5 A;  3TAF A;  4DSJ A;  1NK8 A;  1JLQ A;  2DTU A;  2VG5 A;  3V1R A;  3F9K A;  1R0A A;  3AA2 A;  1L3T A;  3DOL A;  1WAF A;  2PZS A;  2RN2 A;  1S1X A;  1JL2 A;  1KFS A;  3KD5 E;  3K57 A;  2FBT A;  3UIQ A;  3VQD A;  1D5A A;  4LD0 A;  3OYF A;  2EHG A;  4E7H A;  2VG6 A;  1Z26 A;  4CK1 A;  2Z1H A;  4CCH A;  1RDB A;  1IO2 A; 
#chains in the Genus database with same CATH topology
 1XHX A;  3O1B A;  3A2F A;  2P9U A;  4B1Z A;  4YDU A;  2IDO A;  3AVL A;  2YJF A;  3HPO A;  2OA8 A;  1TGO A;  3M8S A;  3RR8 A;  2FBV A;  1G99 A;  1TKX A;  4CJL A;  3IUC A;  2QXL A;  4FK0 A;  1LWE A;  4Y1C A;  1X9M A;  2CGL A;  2HST A;  4KFB A;  5IWA K;  3O9R A;  4YOY A;  4K42 A;  3OTO K;  3P39 A;  4NYN A;  1GOA A;  3WQU A;  4BE2 A;  2CGK A;  2HHU A;  4CK3 A;  3L4I A;  5LMU K;  1L3S A;  4PKI A;  3LPU A;  3U4L A;  3KVG A;  3AVK A;  1BU6 O;  2WTU A;  4HUE A;  1QHT A;  3R8E A;  4HCC A;  3WXI A;  1WLJ A;  4PWD A;  4JI6 K;  3C6T A;  2P9N A;  4CJK A;  3RRG A;  3PUF A;  2QEX N;  3SLC A;  4H03 B;  2E2Q A;  4IG3 A;  4U67 L;  1RCH A;  1B9D A;  4FJJ A;  1VSK A;  1WSI A;  4YOX A;  2ATQ A;  1GLJ O;  5BN9 A;  4YOW A;  3CM5 A;  1SL0 A;  3LP3 A;  1ESV A;  2HF3 A;  4DV6 K;  2KLA A;  4DR6 K;  3HST B;  4JYA K;  4Z4I A;  5J2P A;  3O9T A;  4GV9 A;  4EAH D;  2O4G A;  1T6C A;  4FWR A;  2P5O A;  2NUB A;  3EE9 A;  4JI2 K;  4RW4 A;  1HKG A;  4DLG A;  3OYA A;  4DFP A;  1ZBS A;  2P51 A;  3CJC A;  2QWN A;  5M1Q A;  3SQ0 A;  4KHN A;  3DYA A;  1NK0 A;  4BRE A;  1GLE G;  1HLU A;  4JHD A;  2FC0 A;  3ITH A;  5AQM A;  3C6U A;  4DMN A;  3VQP A;  3NAE A;  1S1W A;  3OYD A;  2BH1 A;  3H08 A;  2HOE A;  4B9M A;  1KFD A;  1D9D A;  1BHL A;  4FWN A;  3UKR A;  1M1K O;  1YIJ N;  3FZL A;  5KGW A;  3M3Z A;  3ISN C;  1N8R O;  3M5R A;  3LPT A;  4FLZ A;  4AHR A;  1WAJ A;  2KW4 A;  1FK9 A;  3VF6 A;  1J9A A;  1L3U A;  3GL1 A;  5FPE A;  3I8D A;  4M3R A;  3EKU A;  3VQ6 A;  5M1N A;  1NK9 A;  3WNF A;  1YIT N;  4KB0 A;  3VQ4 A;  1Q7Y O;  1QE1 A;  4DSK A;  4I6M A;  3AVM A;  3NGI A;  3QO9 A;  3ZSX A;  4GV6 A;  1N5Y A;  3MWP A;  1S1T A;  1K8K A;  3FZF A;  3HTV A;  1EET A;  2OPR A;  3J81 O;  4ID1 A;  4L3Q A;  2ZGY A;  4U7B A;  2G8K A;  2OPS A;  4M3X A;  1U45 A;  2ZGZ A;  2BGG A;  3HBT A;  3D2E A;  1B92 A;  4NLB A;  1BDG A;  3O80 A;  4FK4 A;  2WUS A;  4ELV A;  1GLB G;  4DV1 K;  5KGX A;  3VQA A;  4QOZ B;  2E2O A;  4CGF A;  4EHT A;  1D8Y A;  2DFH A;  4MFB A;  1SKR A;  4DV7 K;  4BRN A;  4HUG A;  1YJN N;  1QZ6 A;  1RT4 A;  1KC8 O;  1BWF O;  4C8N A;  2O8E B;  3AA3 A;  3OHR A;  3NH2 A;  4FK2 A;  3QIN A;  3KJV A;  3MDQ A;  3KD1 E;  1HQE A;  4MLH A;  1SUQ A;  3CJ9 A;  4CZG A;  5KRS A;  4CGJ A;  4GKK K;  4FM1 A;  2HMI A;  2RE2 A;  2GWJ A;  2RF2 A;  3LL3 A;  3D2F A;  1CLQ A;  4KBO A;  1K8A O;  2Y1J A;  1C1A A;  3O5B A;  1BI4 A;  1ATS A;  3DLH A;  3DOK A;  4ISE A;  3ENH A;  3CHW A;  4FWM A;  4IOC L;  3CET A;  4EFH A;  3UKU A;  3CC7 N;  1ZBF A;  4JKD A;  1BIU A;  3AGK A;  3THW A;  2VQF K;  4ELU A;  1HYS A;  1UA0 A;  1P90 A;  3AY9 A;  1NJI O;  2KTQ A;  1NKC A;  2O8B B;  2W6L A;  1YUW A;  3LP2 A;  4AHV A;  1SV5 A;  5EX5 A;  1VSL A;  4DU4 A;  5BPN A;  3Q7B A;  5JVH L;  1VQP N;  4CES A;  3K58 A;  2BDP A;  1X3N A;  3LDO A;  5AFU H;  1TYQ A;  4CEC A;  4OLA A;  2VWJ A;  4CZE A;  1LW0 A;  4E1J A;  3LWM A;  3HZ6 A;  1MA9 B;  3VQC A;  5AQS A;  1OKJ A;  3OYC A;  5CZ1 A;  3TTD A;  3FFK B;  4B3R K;  4OKE A;  1MWK A;  4E89 A;  2QWM A;  2VCP A;  5AQO A;  1TL1 A;  2QWQ A;  3QET A;  4M3Z A;  1RT5 A;  5LY3 A;  3L2Q A;  4DFM A;  4A2B A;  3W0L A;  3B6P A;  3QIO A;  2IAJ A;  1Y97 A;  1RFQ A;  4A61 A;  3C94 A;  4YOV A;  4FLY A;  2D5R A;  4JI4 K;  5AQK A;  4FJN A;  1WSJ A;  4OPA A;  4DSL A;  1D4X A;  4FWQ A;  1W7A A;  4OPK A;  2P1J A;  3J80 O;  1O13 A;  3O3H A;  4DTM A;  3V81 A;  2YKM A;  5AQU A;  4H5N A;  1KVC A;  3KK3 A;  3DLE A;  5KTQ A;  1IBK K;  1S9E A;  2FF3 B;  2XY6 A;  4E7J A;  4QS8 A;  4B9U A;  2E4L A;  3LM2 A;  5AR0 A;  2F7T A;  3L4Q A;  1FXX A;  4WFN L;  4JV5 K;  1Q82 O;  4CHY A;  5JS1 A;  3L2V A;  2QW9 A;  1N32 K;  2CH6 A;  2V7Y A;  3TAQ A;  1IG8 A;  3VGL A;  3JAM O;  4YNQ A;  1ASU A;  3NDK A;  4PL8 A;  5FPM A;  4M41 A;  4F3O A;  4RCH A;  1NJZ A;  1BL3 A;  4W5Q A;  2HHW A;  1YF5 L;  3O8M A;  3OVN A;  3SYZ A;  2WOM A;  4ZHR A;  3I0R A;  3CFP A;  2ITM A;  5AQQ A;  4LC9 B;  3B6O A;  3NVM A;  5SWM A;  3JS6 A;  1VQ8 N;  3CJB A;  1HYV A;  1BQN A;  1J53 A;  3CQX A;  4FZX C;  3ALY A;  4R5P A;  4N41 A;  5M1K A;  4H0X B;  3K59 A;  4RW9 A;  3M8P A;  1KVA A;  3ZT1 A;  1VSD A;  1KRP A;  4ILG B;  2FBY A;  4B1U B;  3AVA A;  2VGM A;  3ID8 A;  1NGA A;  4CJT A;  3PLA A;  1YTA A;  4B9N A;  4BRD A;  4FLT A;  3MXJ A;  2WFB A;  1D9F A;  2AJQ A;  3VQ5 A;  4KKO A;  1JXB A;  1IH7 A;  2E1Y A;  4CEB A;  3KLE A;  4H8K A;  2BAN A;  1U47 A;  3IAY A;  3AVG A;  4CEQ A;  1SKW A;  3QNN A;  1XMO K;  1OH5 A;  1Z6R A;  5AQY A;  3DI6 A;  4IEE A;  3LDS A;  4NCG A;  4CJF A;  4KRF A;  3VES A;  2E20 A;  3QNO A;  5FLX O;  4AHC A;  2HHQ A;  3KK1 A;  3CG7 A;  3QEI A;  4Y0W A;  4PY5 A;  2UXB K;  3SQ2 A;  1TKD A;  1VSM A;  4FO0 A;  3VTI A;  3DXM B;  4DKW A;  4CZI A;  1M90 O;  5CE3 A;  3TAP A;  3EL2 A;  4XEI A;  2D4W A;  1BA1 A;  3C7N B;  1S6P A;  1VSI A;  2UUA K;  4BY9 C;  1RTD A;  3DXK B;  1NGB A;  1VSE A;  3HL8 A;  4DG1 A;  3RRH A;  1T6D A;  3LAK A;  3KIO A;  2QWO A;  3OA9 A;  5KPR A;  2O8F A;  4CE9 A;  3GG4 A;  1VK0 A;  4QS7 A;  3NH0 A;  3CXC M;  1NJX A;  1OH8 A;  3R3L A;  4FL9 A;  4GW6 A;  1RT7 A;  3E66 A;  1BIS A;  5LL6 Z;  3CIP A;  3V1O A;  1XNQ K;  1JCG A;  3SCX A;  4O4G A;  3NF6 A;  4DQR A;  3MXI A;  1Q8I A;  5M1F A;  1C0T A;  3NMU A;  4CIF A;  1DLO A;  4H0P A;  4EZ6 A;  1U2V A;  3A5L C;  5JLH A;  3ASM A;  3WEE A;  1K9M O;  2HNY A;  4FWL A;  3RSE B;  3TAF A;  4DSJ A;  1JLQ A;  2VG5 A;  3V1R A;  4IWV A;  4BR5 A;  4QS9 A;  4NO7 A;  5LMN K;  3AA2 A;  1FW6 A;  1S1X A;  1JL2 A;  3KD5 E;  3G6E N;  3K57 A;  2FBT A;  1NMN A;  3VQD A;  5KPZ A;  2VG6 A;  1Z26 A;  2Z1H A;  2A6A A;  1RDB A;  4CHQ A;  1DTQ A;  2GEL A;  5JIC A;  1YAG A;  2FXU A;  1ATR A;  3CER A;  3FR0 A;  4OGE A;  5M1P A;  3CC4 N;  4FJI A;  3QBX A;  3MN9 A;  1VQM N;  1RIL A;  2X6S A;  5HOO A;  4IFE A;  3U9D A;  4BC3 A;  2ZQB A;  4JLH A;  4OPJ A;  3K5M A;  1BQM A;  1ASV A;  3KKS A;  2FBX A;  3LDP A;  4C8L A;  3A0I X;  4FYD A;  1S1V A;  1EO1 A;  4OLB A;  4XH5 A;  3ZT4 A;  4CD3 A;  1FKP A;  1EP4 A;  1YI2 N;  1YTU A;  2QWL A;  4PKG A;  3I8B A;  3VEV A;  5TKW A;  2PYL A;  3CJ1 A;  5BR8 K;  2I5J A;  2G8U A;  1C0U A;  4IO8 A;  3V9Z A;  3RMB A;  2G8V A;  1VQ6 N;  1Q18 A;  4IBN A;  4RTF D;  1ZBI A;  2DY4 A;  4BC4 A;  3S9H A;  3SV3 A;  3KK2 A;  2NLX A;  1KAZ A;  2QXF A;  5EXW A;  2UUB K;  3FE1 A;  4Z94 A;  3HPH A;  3O9U A;  2B5J A;  2YNH A;  1NGH A;  4UQG A;  3OYH A;  1SQK A;  4M45 A;  3WXM B;  5CZ2 A;  4JN4 A;  3B8A X;  5C0Y A;  4JI5 K;  1NOY A;  4KAZ A;  3VEZ A;  4FJ8 A;  3KLG A;  4DR7 K;  2P9P A;  2P9I B;  3I0S A;  4CJQ A;  3ZSR A;  4DSI A;  3TTF A;  3BF3 A;  1S3X A;  5ELZ A;  3WT0 A;  1I39 A;  3KWG A;  3OYK A;  4OKJ A;  4GVE A;  3QBW A;  1N6Q A;  4LFA K;  3J8A A;  3HI0 A;  4B1V A;  3CCL N;  3SK3 A;  2NRT A;  3SAF A;  3VA0 A;  3QEX A;  4IOA L;  3S41 A;  4DV2 K;  3VQ8 A;  5AZJ A;  4Z4F A;  4Z0U A;  5AQJ A;  3QIC A;  4CD1 A;  4Q5V A;  5AQV A;  1C0G A;  3U9Z A;  3GDQ A;  4E3S A;  4RW6 A;  3OS1 A;  5KQ8 A;  2G8F A;  2RHK A;  1JLB A;  3MEE A;  3D45 A;  3PX0 A;  3L3U A;  3QEW A;  4LF8 K;  3OY9 A;  4H0Y B;  3THY B;  4KHS A;  3SUQ A;  4BWM A;  1IBM K;  2ZF5 O;  4GV3 A;  3VOV A;  3RMC A;  1IBL K;  2E2N A;  3CCJ N;  3M1F A;  4G1Q A;  5AQN A;  4M3W A;  2GX9 A;  5BN8 A;  2ASP A;  1VRT A;  5MLC Q;  1VQ4 N;  4FWS A;  5FPD A;  1NGG A;  3A5M C;  3TI0 A;  1UA1 A;  3F5T A;  3VQ7 A;  1GOB A;  3L8B A;  2UXC K;  4TSX A;  3KHY A;  1V4S A;  3G0Z A;  1GLL O;  2EX3 A;  2PY5 A;  2G8I A;  3VQQ A;  4KHQ A;  2D0B A;  4KO0 A;  4FM0 A;  2ASM A;  4C8K A;  1EWR A;  5A2Q O;  3TAE A;  2HVI A;  3ZSQ A;  3AVI A;  3VQ9 A;  4LFB K;  4B9V A;  1LAV A;  4KTW A;  2FF6 A;  1WSF A;  3AV9 A;  3CFR A;  3C6H A;  1LAW A;  5GIN A;  4CFB A;  4BRO A;  2DFE A;  2ZJQ L;  3ZSV A;  3NFA A;  4LY7 A;  4DR1 K;  2HHX A;  5CHI A;  2FSN A;  3E9P A;  1YJ9 N;  1QS4 A;  1K6Y A;  1YJW N;  4N47 A;  1R59 O;  1TAQ A;  4OVL A;  4CER A;  1S22 A;  2QKK A;  5AQG A;  4FM2 A;  4KV8 A;  3HVT A;  3QB0 A;  3SAG A;  3NF7 A;  3VEX A;  3FZK A;  1KAX A;  3UB5 A;  1J54 A;  1NU0 A;  4MO4 A;  1OVY A;  4F2R A;  4JKG A;  3IMX A;  3DLR A;  2P9N B;  4BC5 A;  3L6Q A;  2B6A A;  5AZI B;  3LM9 A;  4A5A A;  3MEC A;  3N4P A;  5HLF A;  1K73 O;  1TKT A;  4ISF A;  1OH6 A;  4NXN K;  4HUF A;  4DV5 K;  2OZM A;  3J7Y P;  4JNE A;  2P9S A;  3HSC A;  4DV3 K;  3OS0 A;  1H1V A;  2JLE A;  3QEV A;  3F9M A;  4GMJ B;  1C0M A;  2OAN A;  3SMS A;  5KRT A;  4N76 A;  4CED A;  2KZZ A;  1NNE A;  1KQS M;  4BRP A;  3I55 N;  3ENB A;  4HTU A;  4Z4E A;  1XMQ K;  1U49 A;  2UXD K;  1ZBU A;  4JKH A;  1VSJ A;  4CJE A;  4OKK A;  1UOC A;  4JKA A;  4BE1 A;  4FLX A;  2HND A;  1RBT A;  3TPQ A;  1SS6 A;  3PY8 A;  4DQ8 A;  3NGY A;  2Y1I A;  3UKR B;  2E88 A;  3P4I A;  1UWB A;  1Q81 O;  2Q2R A;  4ILH A;  3CCE N;  4FWO A;  2NNW A;  1W0H A;  4C8M A;  1KXP A;  3PO4 A;  4CHP A;  2BTF A;  1NGD A;  2D1K A;  3JSM A;  1QQO A;  3OYJ A;  3VEN A;  4BRA A;  3OYL A;  4PA1 A;  4M3Y A;  3P1G A;  4I6M B;  1YVU A;  4Z4C A;  5AQT A;  4N56 A;  3T3F A;  1K8K B;  3HXM A;  2D0C A;  5BPL A;  2V51 B;  1JLE A;  4BDP A;  4XH1 A;  4N5S A;  4E7I A;  1RGI A;  2GEM A;  4HHT A;  1MDU B;  4JK9 A;  1BGX T;  3K5L A;  1BCO A;  3I56 N;  3PIP L;  1JL1 A;  4E1M A;  3D2E B;  1QQN A;  3MX5 A;  3OJU A;  1S72 N;  1NKB A;  2DTU A;  3CCV N;  3OJS A;  1NGI A;  2NRR A;  2OCE A;  3P38 A;  1N36 K;  4CFD A;  3EZW A;  3E9L A;  3CM6 A;  2I7N A;  3KWI A;  3ULE B;  2Q1N A;  4DTO A;  3CME N;  1U48 A;  4BQZ A;  2YV0 X;  3MXM A;  3KZB A;  3J7Z O;  3P31 A;  4FLV A;  1OH7 A;  3DRR A;  1C1B A;  4MLE A;  3WXL A;  4F3T A;  4WQ5 C;  2OPP A;  4DTR A;  2Q36 A;  3G4S N;  3M8Q A;  5GIP A;  3MK6 A;  4FJ7 A;  4CHZ A;  2KFZ A;  4CGG A;  3O4N A;  3FZM A;  4IO9 L;  3HT3 A;  1XHZ A;  4H4O A;  1GLC G;  3HPG A;  3P83 D;  4CZM A;  4IXC A;  3PSF A;  2YHA A;  3DRP A;  4F9O A;  1U04 A;  5LJW A;  2VGN A;  3WUH A;  1WSH A;  4K0K K;  3TTC A;  4EHU A;  1RDD A;  3CCM N;  3LWL A;  1NKE A;  1BI4 B;  4BR7 A;  1IKV A;  3SQ4 A;  1F21 A;  1ZC6 A;  5GAH P;  1MU2 A;  3O4W A;  4NLC A;  3UKU B;  4DTU A;  3VF2 A;  3U6F A;  3CI5 A;  3SJJ A;  4IJA A;  1NK5 A;  3SBG A;  4DU1 A;  1L3V A;  2KZM A;  4HTL A;  2NRZ A;  3DJC A;  2A41 A;  4O8K A;  3V6D A;  2Z1J A;  5T7B A;  3ZT2 A;  4B9Q A;  4BRF A;  1S1U A;  1TYQ B;  2OYQ A;  2AA4 A;  2O8C B;  4R79 A;  1YXQ A;  1NK8 A;  3T69 A;  1EWQ A;  4K25 A;  4YOU A;  1BO5 O;  4WQ4 C;  1R0A A;  2W6K A;  5AQH A;  4JKF A;  4A59 A;  1D5A A;  3OYF A;  2EHG A;  4E7H A;  5B8H A;  2HBK A;  3MN7 A;  1IV0 A;  4DS4 A;  1JJ2 M;  4DTX A;  2A1R A;  3FZH A;  2FLO A;  1VRU A;  4CZF A;  2J4R A;  1SZ2 A;  3MX2 A;  2Z1I A;  1QHA A;  1DT9 A;  2IC3 A;  4DTS A;  2YHX A;  3HK2 A;  2WC9 A;  4B3T K;  1GLD G;  1HJR A;  2P5G A;  4Q0B A;  1T44 A;  1Y64 A;  3T7Z A;  1HKB A;  3MEG A;  3VMF B;  3LAM A;  4K43 A;  3DWL A;  3O08 A;  3BZK A;  3H46 O;  5C25 A;  4DB3 A;  3AA4 A;  3HOS A;  3EZ5 A;  4EZ9 A;  1GLA G;  3T19 A;  3QFP A;  3K9K A;  1VAZ A;  5AQL A;  3MCA B;  3TR8 A;  4X64 K;  5HRS A;  1LCU A;  3P5J A;  4BAC A;  3ZT0 A;  1TVR A;  5JMV A;  3HJF A;  1VQL N;  5E41 A;  2P9K B;  2CGJ A;  2XY5 A;  3FLC O;  4LF7 K;  1RTJ A;  3VA3 A;  4JD2 B;  1U6Z A;  2IVN A;  1EXQ A;  2ZD1 A;  5C10 A;  4B3M K;  4BG8 A;  2H3G X;  3CCU N;  1TUY A;  4B1Y B;  1GLF O;  4O44 A;  5BRE A;  2R7Y A;  2HB5 A;  2HHV A;  3VPZ A;  3O6W A;  1KLM A;  3V9S A;  4CJU A;  5BRD A;  4WYB A;  4BR2 A;  3SUN A;  4A57 A;  1W9H A;  1HJO A;  4WCE L;  4BR9 A;  4M42 A;  2PBD A;  3HYF A;  5F0X A;  3PIO L;  1RDU A;  2O8D B;  4GVM A;  3LZI A;  4GY2 B;  5EVZ A;  3SPZ A;  5DMR A;  1FJG K;  3L2U A;  4IG0 A;  3H45 C;  4W5N A;  4F2S A;  3CQ8 A;  4KI4 A;  5C24 A;  2YX6 A;  3ZSY A;  4I9L A;  3KLF A;  3KTQ A;  3AO5 A;  4CF1 A;  4L8R B;  4GKJ K;  1HMV A;  3SPY A;  5ADX A;  3SUP A;  3TAM A;  4I7F A;  1TAU A;  3AO4 A;  4AIL C;  3D6R A;  2QM1 A;  3NVK A;  1LWC A;  2ZWH A;  4H4M A;  3PSI A;  4LF4 K;  4Y1D A;  4J8F A;  3R6M A;  4WQ5 A;  3SV4 A;  1VQO N;  1EKE A;  3QLH A;  4FWK A;  1L5U A;  4J2D A;  4ZTJ A;  4BRL A;  3PX6 A;  1REV A;  1IKW A;  1JCF A;  1UAX A;  4CJS A;  2HHH K;  4FJX A;  3IRX A;  4BC2 A;  3RMD A;  3GBT A;  4O5F A;  3WNE A;  4AM7 A;  3LDL A;  2X74 A;  1CZA N;  4AHT A;  2E2P A;  4B9L A;  4J2A A;  4HCB A;  3SUO A;  3ZET A;  2Q0U A;  3BF1 A;  3C65 A;  1HPM A;  1DGK N;  1YVN A;  3ZSZ A;  3SAH A;  4FLW A;  4BQL A;  3HRG A;  4JI7 K;  4MDB A;  3CPW M;  3KLI A;  2YKN A;  4YHH K;  2F9W A;  3WEE B;  4QAG A;  4B8C A;  4IKF A;  2DFF A;  4AH9 A;  3K5O A;  1E4G T;  1C0F A;  2HBM A;  4W5T A;  3FGU A;  3CPE A;  2XRI A;  1BUP A;  4DTP A;  5FRO A;  4PHT X;  4YY3 K;  1T8E A;  1KD1 O;  5K14 A;  1VQ5 N;  4CVN E;  1SAZ A;  3ZX2 A;  4CJP A;  5I9E B;  3E01 A;  3K0S A;  2D0A A;  1IJJ A;  4A62 A;  3D7E O;  2YCH A;  3RTV A;  3E9O A;  4WQ4 A;  3OBW A;  4FVU A;  3QEP A;  4K8X A;  4FLU A;  3RVC A;  1XC3 A;  2KHO A;  5E84 A;  2YHY A;  4X66 K;  3BP8 A;  2VWK A;  4BRQ A;  5AQI A;  4NYF A;  4FPA A;  2GUI A;  2PAV A;  4CJR A;  4CGH A;  4ICL A;  1EQY A;  4O55 A;  3E1Y A;  3AAP A;  1JKH A;  2KQ2 A;  4FPB A;  2XO7 A;  3V9U A;  5DK5 A;  4JK7 A;  4GNI A;  4A2A A;  1FKO A;  4H0O A;  2D0O A;  4WFA L;  4O5B A;  1S5J A;  4EP4 A;  1J5O A;  4KTQ A;  2P9L A;  3AA5 X;  2F96 A;  2ZJP L;  2HNZ A;  5AQP A;  2IOC A;  2NZT A;  1HX1 A;  4HVJ A;  4DWI A;  1KAY A;  3VEW A;  2OTJ N;  2A1S A;  4M7Y A;  5ADX H;  3THX A;  3S3N A;  4DR4 K;  2YHB A;  1CXQ A;  4FJH A;  1ITG A;  4K41 A;  4C1N I;  4JI8 K;  1CXU A;  1HR0 K;  2QA4 N;  1KSP A;  5BR9 A;  4KHW A;  4CEO A;  4YOR A;  1NK6 A;  4BRH A;  3OYN A;  3QFU A;  3VET A;  1HNV A;  1CZ9 A;  1I94 K;  3F73 A;  4JKB A;  2W41 A;  3HM9 A;  1IKX A;  1NGE A;  4B1X B;  3DLL L;  1YHQ N;  4KH5 A;  4CIE A;  3RMA A;  2P9P B;  3LDN A;  2NRX A;  1E4F T;  1Q9X A;  2BUP A;  4IDH A;  1XI1 A;  4LF5 K;  4JRP A;  3NCI A;  2YHW A;  3OS2 A;  1HKC A;  2Q97 A;  3L0Q A;  4OJR A;  5KPT A;  1A5W A;  2WBN A;  2YNG A;  4CJ3 A;  2AP1 A;  5J2M A;  5AQW A;  1QTM A;  1NGF A;  4B3S K;  3O3F A;  1JXE A;  4BGA A;  3A5O C;  4DQS A;  4KHY A;  4BWJ A;  1RBS A;  3D0P A;  5HRN A;  5EY4 A;  3NH1 A;  1RT3 A;  2I7P A;  4KI6 A;  1BA0 A;  4FJK A;  5AZJ B;  1NWK A;  4CJ7 A;  1RTI A;  1G15 A;  5DM6 L;  4E0D A;  1TV6 A;  5CR4 A;  2QWP A;  3OYI A;  2BE2 A;  4PUO A;  3LAL A;  4CJW A;  3RR7 A;  5CYQ A;  3NF9 A;  3LP0 A;  4JEP A;  5IT9 O;  3ZEU B;  4O0I A;  1RT2 A;  3JXU A;  3SMP A;  1LW2 A;  2P9U B;  3C95 A;  3ZT3 A;  3G71 N;  1SL1 A;  3OYB A;  5HBM A;  2G8W A;  4KHU A;  5SZT A;  3IS9 A;  1KVB A;  3MN5 A;  1HRH A;  1VQK N;  5GAD P;  5HL7 L;  1RT6 A;  1TKZ A;  2UUC K;  3V1Q A;  5E26 A;  4CF0 A;  3NE6 A;  1T7P A;  1JCE A;  3ULD A;  4K8Z A;  4XH4 A;  3H1Q A;  3BGR A;  1E3M A;  4CW7 B;  2VG7 A;  3HP6 A;  4CFA A;  4MQ3 A;  1QQC A;  1XC9 A;  5AZI A;  1JLG A;  4M7X A;  3U3G A;  2Z1G A;  1ZBH A;  3TAR A;  3AVF A;  4KTZ A;  4H5R A;  4B8A B;  4CF2 A;  2YJE A;  4XIU A;  2NRV A;  4JS5 A;  2NRW A;  3LAN A;  1QQM A;  4DUZ K;  4OO1 J;  4H5T A;  4EIA A;  4CEF A;  3RWU A;  4ID5 A;  3O1W A;  2ASO A;  4DSF A;  4AF1 A;  1NLV A;  4I2P A;  3L2R A;  3T1H K;  3WQT A;  3ZX0 A;  2IIR A;  4DTJ A;  1VQ7 N;  5AQZ A;  4O0J A;  4MDA A;  4LF6 K;  4H5W A;  4DHY A;  3K2P A;  4LFC K;  4CBW A;  2RKI A;  2KKZ A;  1QZ5 A;  3O4Q A;  5GIO A;  5CYM A;  3NGZ A;  4KH6 A;  3AVC A;  1O1W A;  1NK7 A;  4FJ9 A;  3MN6 A;  4FOI A;  1NOZ A;  4C8O A;  2QTD A;  5D3G A;  3A5N C;  5AFU A;  3VEO A;  3CF5 L;  1HNX K;  4DR2 K;  5CY4 A;  5C2F A;  4DUY K;  3CCS N;  3G25 A;  4JHD B;  3DLG A;  4JKG B;  3DLB A;  1WSE A;  2F9T A;  1TUU A;  5HRO A;  2A3Z A;  4DS5 A;  1J5E K;  5AJ3 K;  2PZS A;  3DOL A;  1WAF A;  4JK8 A;  2O8E A;  1QVF M;  3UIQ A;  3CMA N;  2FSJ A;  4LD0 A;  3CJA A;  1NMD A;  4CK1 A;  4CCH A;  1LOT B;  3OYE A;  1IO2 A;  2P9S B;  2PFU A;  1RT1 A;  5HRP A;  1BOT O;  3KLH A;  3CQY A;  1LV5 A;  3EO3 A;  4FSV A;  4C1N K;  2ZM6 K;  4O8U A;  4FJM A;  2F4V K;  2WON A;  2VWB A;  3VTH A;  2XY8 A;  2CH5 A;  3M8R A;  3ZSO A;  3K9J A;  4E7L A;  4BR4 A;  3ULE A;  3QES A;  3HO1 A;  4DQI A;  3S3M A;  4BVO A;  4FJL A;  5LJV A;  4V19 S;  4I2Q A;  3ZLJ A;  3F2K A;  2HVH A;  1NGC A;  1KCF A;  2O8B A;  4JKE A;  3LP1 A;  3AO1 A;  2ETJ A;  4IEI A;  4JRQ A;  4F8R A;  3L2W A;  4CI6 A;  3IDH A;  4FZZ A;  3TWH A;  1RDA A;  1GOC A;  5H1S Q;  1DTT A;  1V4T A;  3ATV A;  3V9X A;  1T05 A;  3NBP A;  3C0B A;  1KLN A;  3AAQ A;  4Z4H A;  2O4I A;  1QSY A;  3O9Q A;  1VHX A;  1IG9 A;  3NF8 A;  3BUZ B;  4BVP A;  2F8S A;  3ZSW A;  2GWK A;  5FPN A;  4DR5 K;  3LDQ A;  5KI6 A;  5J2Q A;  1P8Z A;  1JLC A;  3TAN A;  2HHT A;  4C23 A;  4LH4 A;  1HNW K;  1RNH A;  5FRN A;  4IOX A;  4LSN A;  1NK4 A;  3OYM A;  5BRH A;  3H1V X;  4H5V A;  4DFJ A;  4OPH A;  2QWR A;  4DF4 A;  2A40 A;  2ZJR L;  3UE5 A;  4JI1 K;  1WUA A;  3D2F B;  3MED A;  3QIP A;  3WNG A;  3HP9 A;  4DFK A;  4B9T A;  3EKS A;  2LSN A;  1WBB A;  2F8T A;  3Q7C A;  4CZL A;  3CCR N;  2O8C A;  3WXJ A;  3EEQ A;  1JLF A;  3CYM A;  1RDC A;  3BY5 A;  4CFC A;  5GAE P;  3THW B;  3ATU A;  4DR3 K;  4BDY A;  3GE1 A;  1TK0 A;  2IGI A;  4KPY A;  1OVQ A;  4PKH A;  3DLK A;  1WSG A;  3MCP A;  4FJ5 A;  5FRM A;  4YFU A;  3ZX3 A;  3CJ7 A;  4JI0 K;  1T03 A;  4PL7 A;  1W97 L;  4H0T B;  4OGC A;  3R9P A;  3M6G A;  4BGB A;  4KHP K;  4JKC A;  4QCL A;  2HW3 A;  2X6N A;  3H3O B;  4B3O A;  4AQY K;  3H3N O;  2QKB A;  4F4K A;  3VGM A;  1WN7 A;  2A5X A;  3DAW A;  4CF9 A;  5C12 A;  2YI1 A;  1VQ9 N;  4BRM A;  1ILY A;  3O9S A;  2V7Z A;  5JVG L;  4J2E A;  2UYT A;  3K5N A;  3DM2 A;  1J6Z A;  3IG1 A;  2GV9 A;  1TL3 A;  3SJH A;  1N33 K;  3DRS A;  1VSF A;  3TSP A;  1X9S A;  1ATN A;  3QML A;  3HOT A;  3THV A;  2Q3S A;  5EU7 A;  3O3G A;  2NRH A;  4DV4 K;  5DM7 L;  2E5L K;  3AO3 A;  5GAG P;  4BR0 A;  4FVM A;  4DSE A;  2IVO A;  2VYP A;  5C15 A;  4YOT A;  1KTQ A;  4BDZ A;  3EE8 A;  4CZH A;  2P9K A;  2HBL A;  4CK2 A;  4WE1 A;  5M1O A;  3U3Y A;  4JD2 A;  2Q0R A;  2KFN A;  4M3T A;  3DXM A;  4CEE A;  1W2B M;  1VQN N;  1S9G A;  4CIG A;  3HVR A;  4IDK A;  3ID6 A;  1RBU A;  2DPN A;  3OBY A;  1DKG D;  3C7N A;  3CD6 N;  3WNH A;  3DXK A;  2E6M A;  2W42 A;  4E19 A;  3MAQ A;  2JGU A;  4PQU A;  4RW8 A;  2GUP A;  3IFR A;  4WF9 L;  3ZCM A;  3ZYY X;  3S3O A;  4H0V B;  5BPM A;  5KQD A;  2O8D A;  4CEZ A;  2ITG A;  1ZYQ A;  3TAB A;  4FJG A;  1EX4 A;  1Z25 A;  1BCM A;  1HNI A;  5HP1 A;  2OTL N;  4KH4 A;  5AQF A;  3C6A A;  4UY8 O;  1X9W A;  1ZBL A;  4RG8 A;  3GOI A;  4CHN A;  4YDU C;  2G8H A;  2YNI A;  5JLF A;  1QSS A;  3RSE A;  4DV0 K;  4IZ9 A;  1WOQ A;  3OW2 M;  1HYZ A;  1S6Q A;  3PO5 A;  3IKM A;  3T1Y K;  1BG3 A;  1IKY A;  3R1X A;  5BRF A;  4FXD A;  4W5O A;  3ENO A;  3JYT A;  1X9J A;  3TSQ A;  2B4J A;  2EWS A;  4IJN A;  4CBX A;  1HPZ A;  5AQR A;  4ELT A;  4FZY A;  1XWL A;  3G10 A;  1BIZ A;  4LH5 A;  4RWT A;  4Z4G A;  1A5V A;  1NM1 A;  4DTN A;  1WBD A;  3VN5 A;  3MMV A;  3U8X A;  1SL2 A;  2W40 A;  3DMJ A;  4DF8 A;  1C6V A;  4KB1 A;  3AVN A;  4CJ5 A;  2GBZ A;  1SKS A;  3KK7 A;  3TAG A;  4FWP A;  2O8F B;  4BRG A;  1JLA A;  3AAR A;  1TK8 A;  4DQP A;  4LSL A;  4BRI A;  4BG9 A;  1C1C A;  1XUP O;  5FDL A;  4CGD A;  2XY7 A;  1XNR K;  4OX9 K;  4B9S A;  1NGJ A;  1WB9 A;  3V4I A;  5I3U A;  4FOE A;  3VF4 A;  4JS4 A;  2E1Z A;  4CBU A;  5F2R A;  2E8A A;  4NXM K;  1QSL A;  2FSK A;  1U2V B;  4CZJ A;  4EP5 A;  3W3D A;  3VQB A;  1A5X A;  5C42 A;  3BEX A;  4FW2 A;  1RBR A;  4CJ4 A;  4B1W B;  1Q86 O;  1U4B A;  3AO2 A;  2V52 B;  4ZTF A;  4MO5 A;  1X1P A;  1ASW A;  3CCQ N;  3CFO A;  1VSH A;  4X62 K;  4M63 C;  1TK5 A;  4DQQ A;  1HUX A;  2IS3 A;  4NB4 A;  3I33 A;  2QI2 A;  3PV8 A;  1Q9Y A;  4ISG A;  1XQS C;  3QDK A;  2ZE2 A;  3AVB A;  3EN9 A;  2IVP A;  5C2D A;  1WNS A;  3VGK A;  1Z05 A;  1NG9 A;  2P9I A;  3SNN A;  2GTD A;  3SBT A;  4J2B A;  3AVH A;  1YT3 A;  3ZET B;  4CJV A;  4AHU A;  4WFB L;  3AVJ A;  3KKR A;  4AHS A;  5AQX A;  1NBW A;  1RTH A;  1CZB A;  4X65 K;  1HQU A;  2X78 A;  4FW1 A;  4CF8 A;  4E7K A;  2PYJ A;  4DLE A;  3FFI A;  3QER A;  4BRK A;  2Q31 A;  4M3U A;  1T3V A;  4BE0 A;  1I3A A;  2XHB A;  3HM8 A;  3T1A A;  1RBV A;  3VER A;  4CEA A;  5I42 A;  4FCY A;  3BDP A;  4JI3 K;  3EY1 A;  5JS2 A;  3V9W A;  5J1E A;  4B08 A;  3AGR A;  3SZ2 A;  4DU3 A;  2HMP A;  1ZXO A;  3VEY A;  3LZJ A;  3TSU A;  1DEJ A;  3SQ1 A;  2QK9 A;  5HRR A;  2RPI A;  4BRC A;  4LF9 K;  3J7A P;  2JWL A;  3BZC A;  3THY A;  5J2N A;  4CZK A;  2HBJ A;  3VQE A;  3PX4 A;  4W5R A;  4ILJ A;  2D0P A;  3SI6 A;  4NCB A;  4KRE A;  3OYG A;  3WXK A;  4NCA A;  4CGI A;  1MWM A;  2YNF A;  2A42 A;  4A5B A;  2UU9 K;  2JWK A;  2E6L A;  3MWT A;  3EYZ A;  1LWF A;  2VQE K;  1N34 K;  3N4Q A;  1HNZ K;  4HWI A;  2OPQ A;  2HF4 A;  1X3M A;  4I9Q A;  4RW7 A;  3NHG A;  4IFV A;  3L3V A;  4DCH A;  4JAX A;  5F1X A;  4CHO A;  1NJW A;  1NJY A;  4E1N A;  2OZS A;  2P9L B;  2HHS A;  1B9F A;  5TKY A;  4IFY A;  4AM6 A;  3THX B;  3F9K A;  1QVG M;  1L3T A;  2RN2 A;  3H6E A;  1KFS A;  3ZEU A;  3CC2 N;  1RDW X;  5EOY A;  4G9Z A;  3A8Y A;  3TU5 A; 
#chains in the Genus database with same CATH homology
 4DS4 A;  4CHQ A;  1DTQ A;  1XHX A;  4DTX A;  3A2F A;  1VRU A;  2A1R A;  2IDO A;  3AVL A;  3HPO A;  2Z1I A;  2IC3 A;  4DTS A;  2OA8 A;  3HK2 A;  1TGO A;  4OGE A;  4FJI A;  3M8S A;  1RT1 A;  5HRP A;  1HJR A;  3RR8 A;  2P5G A;  2FBV A;  3KLH A;  4Q0B A;  1RIL A;  1TKX A;  2X6S A;  4CJL A;  4FK0 A;  1LWE A;  1LV5 A;  4Y1C A;  1X9M A;  3MEG A;  4FJM A;  2ZQB A;  4JLH A;  2WON A;  4OPJ A;  4KFB A;  3K5M A;  4PUO A;  1BQM A;  2XY8 A;  3M8R A;  3LAM A;  3ZSO A;  4NYN A;  1GOA A;  4BE2 A;  4E7L A;  3QES A;  3HO1 A;  1ASV A;  2HHU A;  5C25 A;  4CK3 A;  4DQI A;  3S3M A;  4FJL A;  3KKS A;  4I2Q A;  3AA4 A;  1L3S A;  3LPU A;  2HVH A;  3EZ5 A;  4EZ9 A;  2FBX A;  1KCF A;  3AVK A;  4C8L A;  4FYD A;  4HUE A;  1S1V A;  3LP1 A;  3T19 A;  4OLB A;  3AO1 A;  1QHT A;  3ZT4 A;  2ETJ A;  4HCC A;  4JRQ A;  4F8R A;  3L2W A;  4FZZ A;  3TWH A;  1FKP A;  1EP4 A;  1RDA A;  1GOC A;  1WLJ A;  1YTU A;  4PWD A;  3TR8 A;  3C6T A;  1DTT A;  3RRG A;  4CJK A;  3V9X A;  3PUF A;  5HRS A;  1T05 A;  3NBP A;  2PYL A;  1KLN A;  4Z4H A;  2I5J A;  2O4I A;  1QSY A;  3P5J A;  4IG3 A;  4BAC A;  3ZT0 A;  1TVR A;  1IG9 A;  2G8U A;  1C0U A;  3NF8 A;  1RCH A;  3HJF A;  1B9D A;  4FJJ A;  1VSK A;  3V9Z A;  3RMB A;  1WSI A;  2G8V A;  1ZBI A;  3ZSW A;  4IBN A;  2F8S A;  2DY4 A;  2ATQ A;  3S9H A;  5KI6 A;  3CM5 A;  3SV3 A;  3LP3 A;  3KK2 A;  1SL0 A;  5J2Q A;  5E41 A;  1JLC A;  2QXF A;  3TAN A;  2HHT A;  2XY5 A;  3HST B;  4LH4 A;  1RNH A;  5FRN A;  1RTJ A;  4LSN A;  3VA3 A;  5J2P A;  1NK4 A;  4Z4I A;  3OYM A;  3HPH A;  2O4G A;  1EXQ A;  2ZD1 A;  3OYH A;  2B5J A;  2YNH A;  4UQG A;  2NUB A;  4DFJ A;  2P5O A;  4M45 A;  4RW4 A;  5CZ2 A;  4DLG A;  3OYA A;  4DFP A;  4DF4 A;  4O44 A;  2R7Y A;  2P51 A;  2HB5 A;  2HHV A;  1NOY A;  4KAZ A;  4FJ8 A;  3KLG A;  1KLM A;  3V9S A;  3SQ0 A;  3MED A;  3QIP A;  3DYA A;  3WNG A;  4CJU A;  1NK0 A;  4KHN A;  3SUN A;  3HP9 A;  3I0S A;  4DFK A;  4CJQ A;  3ZSR A;  2FC0 A;  1W9H A;  4B9T A;  3ITH A;  4DSI A;  3C6U A;  2LSN A;  4DMN A;  3VQP A;  2F8T A;  4M42 A;  3NAE A;  1I39 A;  3HYF A;  1S1W A;  3OYD A;  3OYK A;  1JLF A;  3H08 A;  4GVM A;  3CYM A;  4OKJ A;  3LZI A;  1N6Q A;  1RDC A;  4CFC A;  4B9M A;  1KFD A;  1D9D A;  1BHL A;  3SPZ A;  5DMR A;  4BDY A;  3L2U A;  4IG0 A;  5KGW A;  4W5N A;  3ISN C;  1TK0 A;  2IGI A;  3VA0 A;  4F2S A;  3LPT A;  3CQ8 A;  4AHR A;  4FLZ A;  1WAJ A;  2KW4 A;  1FK9 A;  5C24 A;  3QEX A;  4KPY A;  1J9A A;  3ZSY A;  1L3U A;  4I9L A;  3I8D A;  3DLK A;  1WSG A;  4M3R A;  3VQ8 A;  3AO5 A;  4CF1 A;  4YFU A;  3KLF A;  3KTQ A;  4FJ5 A;  4L8R B;  5FRM A;  1HMV A;  4Z4F A;  1T03 A;  4Z0U A;  3VQ6 A;  3SPY A;  3SUP A;  3TAM A;  4I7F A;  4Q5V A;  1NK9 A;  3WNF A;  1TAU A;  3AO4 A;  4OGC A;  4E3S A;  4AIL C;  4RW6 A;  3OS1 A;  2G8F A;  4KB0 A;  3VQ4 A;  1JLB A;  3MEE A;  3D45 A;  4QCL A;  3PX0 A;  2X6N A;  2HW3 A;  3L3U A;  1LWC A;  3QEW A;  4H4M A;  4B3O A;  4Y1D A;  1QE1 A;  4DSK A;  2QKB A;  3AVM A;  3OY9 A;  3NGI A;  4F4K A;  3QO9 A;  3ZSX A;  1N5Y A;  3SV4 A;  1WN7 A;  4KHS A;  4CF9 A;  1EKE A;  3QLH A;  1L5U A;  1S1T A;  3SUQ A;  4BWM A;  4J2D A;  4ZTJ A;  1EET A;  2OPR A;  3PX6 A;  1REV A;  1IKW A;  4ID1 A;  1UAX A;  3RMC A;  4CJS A;  4FJX A;  4KRE A;  3IRX A;  3RMD A;  3WNE A;  2G8K A;  2OPS A;  4M3X A;  4J2E A;  1U45 A;  4G1Q A;  2X74 A;  4M3W A;  2BGG A;  4AHT A;  3K5N A;  3DM2 A;  4B9L A;  4J2A A;  3IG1 A;  2GV9 A;  1VRT A;  4HCB A;  1TL3 A;  1B92 A;  3SUO A;  3DRS A;  1VSF A;  3TI0 A;  1UA1 A;  1X9S A;  3VQ7 A;  1GOB A;  3L8B A;  4FK4 A;  4TSX A;  3ZSZ A;  4FLW A;  3THV A;  2Q3S A;  5EU7 A;  3O3G A;  4ELV A;  3G0Z A;  5KGX A;  3VQA A;  4QOZ B;  2EX3 A;  3KLI A;  3AO3 A;  2PY5 A;  2G8I A;  4CGF A;  2YKN A;  3VQQ A;  4FVM A;  4DSE A;  2D0B A;  1D8Y A;  4KHQ A;  4KO0 A;  4FM0 A;  4QAG A;  2DFH A;  4B8C A;  4MFB A;  4C8K A;  4IKF A;  1SKR A;  2DFF A;  4AH9 A;  3TAE A;  2HVI A;  3K5O A;  3ZSQ A;  1KTQ A;  3AVI A;  3VQ9 A;  4HUG A;  4BDZ A;  1RT4 A;  4CK2 A;  4W5T A;  4WE1 A;  4C8N A;  2XRI A;  3AA3 A;  3NH2 A;  1LAV A;  4KTW A;  3U3Y A;  4B9V A;  4FK2 A;  3QIN A;  2KFN A;  3KJV A;  1WSF A;  5FRO A;  4DTP A;  4M3T A;  3AV9 A;  1T8E A;  3CFR A;  3HP6 A;  5K14 A;  3KD1 E;  1HQE A;  4CFA A;  4CEE A;  1SUQ A;  1LAW A;  4CFB A;  5KRS A;  4CGJ A;  1S9G A;  4CIG A;  1XC9 A;  2DFE A;  4CJP A;  3ZSV A;  3NFA A;  4LY7 A;  3HVR A;  3E01 A;  4IDK A;  4FM1 A;  2HHX A;  2HMI A;  2D0A A;  2RF2 A;  1RBU A;  1QS4 A;  1K6Y A;  4N47 A;  1CLQ A;  3WNH A;  3RTV A;  1TAQ A;  4OVL A;  4CER A;  2E6M A;  2Y1J A;  3QEP A;  4K8X A;  1C1A A;  4FLU A;  2W42 A;  2QKK A;  4E19 A;  3MAQ A;  2JGU A;  4FM2 A;  4PQU A;  4RW8 A;  1BI4 A;  3DLH A;  3DOK A;  3ZCM A;  4KV8 A;  3S3O A;  3HVT A;  2VWK A;  4NYF A;  3NF7 A;  4CEZ A;  2GUI A;  1ZBF A;  4CJR A;  1BIU A;  4CGH A;  4ICL A;  2ITG A;  4ELU A;  1HYS A;  4O55 A;  1ZYQ A;  3TAB A;  1UA0 A;  1J54 A;  1JKH A;  2KQ2 A;  4FJG A;  1EX4 A;  2XO7 A;  3V9U A;  1NKC A;  5DK5 A;  2KTQ A;  1Z25 A;  3LP2 A;  4AHV A;  1BCM A;  1HNI A;  1SV5 A;  1FKO A;  5HP1 A;  1VSL A;  4DU4 A;  4O5B A;  1X9W A;  1S5J A;  4EP4 A;  4CES A;  3K58 A;  1ZBL A;  1J5O A;  2BDP A;  4F2R A;  4RG8 A;  4KTQ A;  3AA5 X;  3DLR A;  2F96 A;  4CHN A;  2G8H A;  2HNZ A;  2YNI A;  4OLA A;  4CEC A;  1QSS A;  2IOC A;  2B6A A;  2VWJ A;  4HVJ A;  4DWI A;  1HYZ A;  1LW0 A;  1S6Q A;  3LWM A;  2A1S A;  3PO5 A;  3MEC A;  3VQC A;  3S3N A;  5HLF A;  2YHB A;  1CXQ A;  1IKY A;  1ITG A;  4FJH A;  1TKT A;  3OYC A;  1CXU A;  4FXD A;  5CZ1 A;  4HUF A;  4OKE A;  4W5O A;  1KSP A;  4E89 A;  2OZM A;  3JYT A;  2B4J A;  4KHW A;  4M3Z A;  4CEO A;  1TL1 A;  3QET A;  1HPZ A;  1RT5 A;  3L2Q A;  4ELT A;  1NK6 A;  3OYN A;  4FZY A;  4DFM A;  3OS0 A;  2JLE A;  3QEV A;  1XWL A;  4GMJ B;  3B6P A;  1C0M A;  3QIO A;  2IAJ A;  5KRT A;  1HNV A;  1Y97 A;  1CZ9 A;  3C94 A;  3G10 A;  3F73 A;  1BIZ A;  4N76 A;  4LH5 A;  4CED A;  4FLY A;  4Z4G A;  2D5R A;  2KZZ A;  1A5V A;  3HM9 A;  1IKX A;  4FJN A;  1WSJ A;  4DTN A;  3VN5 A;  4DSL A;  1SL2 A;  3DMJ A;  4CIE A;  1C6V A;  4HTU A;  4DF8 A;  3AVN A;  4KB1 A;  4OPK A;  4Z4E A;  4CJ5 A;  3RMA A;  1U49 A;  2P1J A;  4DTM A;  3O3H A;  1Q9X A;  3V81 A;  2GBZ A;  1SKS A;  2YKM A;  1ZBU A;  1XI1 A;  3TAG A;  4JRP A;  1KVC A;  1VSJ A;  4CJE A;  3KK3 A;  3NCI A;  4OKK A;  3DLE A;  1UOC A;  3OS2 A;  4BE1 A;  1JLA A;  4FLX A;  5KTQ A;  1S9E A;  4OJR A;  2XY6 A;  4E7J A;  1TK8 A;  2HND A;  4DQP A;  1A5W A;  1RBT A;  4LSL A;  3PY8 A;  4B9U A;  2E4L A;  2YNG A;  3NGY A;  4CJ3 A;  1C1C A;  5FDL A;  2XY7 A;  4CGD A;  5J2M A;  2Y1I A;  1QTM A;  4B9S A;  1FXX A;  1JXE A;  3O3F A;  3V4I A;  5I3U A;  4CHY A;  5JS1 A;  1UWB A;  3L2V A;  4JS4 A;  4DQS A;  4KHY A;  3TAQ A;  4BWJ A;  1RBS A;  3D0P A;  5HRN A;  4C8M A;  1W0H A;  3NH1 A;  1RT3 A;  4YNQ A;  3PO4 A;  1QSL A;  4CHP A;  4KI6 A;  4EP5 A;  1ASU A;  3NDK A;  4FJK A;  3VQB A;  3JSM A;  1A5X A;  5C42 A;  4M41 A;  4F3O A;  1RTI A;  3OYJ A;  1BL3 A;  4FW2 A;  1G15 A;  4W5Q A;  1RBR A;  4CJ4 A;  1NJZ A;  2HHW A;  1U4B A;  3OYE A;  3OYL A;  4E0D A;  1TV6 A;  3AO2 A;  3OYI A;  2BE2 A;  3OVN A;  3SYZ A;  4ZTF A;  1X1P A;  1ASW A;  2WOM A;  4ZHR A;  3CFO A;  3LAL A;  1VSH A;  4PA1 A;  3I0R A;  4CJW A;  3RR7 A;  4M3Y A;  2AJQ A;  3P1G A;  3CFP A;  5CYQ A;  4KI4 A;  3NF9 A;  1YVU A;  3LP0 A;  4Z4C A;  4DQQ A;  1TK5 A;  3B6O A;  1ZBH A;  4N56 A;  2IS3 A;  5SWM A;  3T3F A;  3PV8 A;  4O0I A;  1HYV A;  1Q9Y A;  1BQN A;  1J53 A;  3HXM A;  2D0C A;  1RT2 A;  1JLE A;  1LW2 A;  2ZE2 A;  3ALY A;  4R5P A;  4BDP A;  4FZX C;  3C95 A;  4N5S A;  3ZT3 A;  4N41 A;  3AVB A;  4E7I A;  1SL1 A;  3OYB A;  5HBM A;  3K59 A;  2G8W A;  4KHU A;  1WNS A;  3IS9 A;  1KVB A;  4RW9 A;  3M8P A;  5SZT A;  4HHT A;  1HRH A;  1KVA A;  3ZT1 A;  1VSD A;  1KRP A;  1RT6 A;  1TKZ A;  3SNN A;  3V1Q A;  1BGX T;  2FBY A;  4CF0 A;  3K5L A;  3NE6 A;  1BCO A;  1T7P A;  3AVA A;  1JL1 A;  3ULD A;  4E1M A;  4K8Z A;  4J2B A;  4CJT A;  1YTA A;  3AVH A;  1YT3 A;  3BGR A;  3OJU A;  4CJV A;  4AHU A;  1NKB A;  3OJS A;  3MXJ A;  4FLT A;  4B9N A;  3AVJ A;  3KKR A;  1D9F A;  4CFD A;  4KKO A;  2VG7 A;  3VQ5 A;  4AHS A;  4MQ3 A;  1JXB A;  1CZB A;  1QQC A;  1HQU A;  1RTH A;  1IH7 A;  2X78 A;  1JLG A;  3CM6 A;  4FW1 A;  4CEB A;  4CF8 A;  3U3G A;  3KLE A;  4H8K A;  2BAN A;  2Z1G A;  4E7K A;  4DTO A;  3AVF A;  3TAR A;  1U47 A;  3AVG A;  4DLE A;  4KTZ A;  1U48 A;  3FFI A;  4CEQ A;  2YV0 X;  3QER A;  3QNN A;  3MXM A;  1SKW A;  4B8A B;  4CF2 A;  3DI6 A;  4XIU A;  4FLV A;  4M3U A;  3LDS A;  4JS5 A;  4BE0 A;  4NCG A;  3DRR A;  4CJF A;  4KRF A;  1I3A A;  1C1B A;  4F3T A;  3LAN A;  3QNO A;  2XHB A;  2OPP A;  4DTR A;  3T1A A;  3M8Q A;  1RBV A;  5I42 A;  4CEA A;  4AHC A;  4FCY A;  3BDP A;  4NCB A;  3KK1 A;  2HHQ A;  3CG7 A;  3RWU A;  4CEF A;  3EY1 A;  3QEI A;  4PY5 A;  4FJ7 A;  5JS2 A;  4ID5 A;  4CHZ A;  5J1E A;  3V9W A;  4B08 A;  3SQ2 A;  1VSM A;  1TKD A;  2KFZ A;  4CGG A;  3SZ2 A;  3O4N A;  4DU3 A;  3HT3 A;  4DSF A;  1XHZ A;  4H4O A;  3HPG A;  3P83 D;  4I2P A;  3L2R A;  2YHA A;  3LZJ A;  3DRP A;  3TAP A;  3SQ1 A;  1U04 A;  2QK9 A;  5HRR A;  2RPI A;  4DTJ A;  1S6P A;  1WSH A;  1VSI A;  4O0J A;  1RTD A;  1RDD A;  5J2N A;  3VQE A;  3LWL A;  3PX4 A;  3K2P A;  1VSE A;  4W5R A;  3SI6 A;  3HL8 A;  4DG1 A;  2RKI A;  1NKE A;  1BI4 B;  3RRH A;  3LAK A;  3O4Q A;  3OYG A;  3KIO A;  2PYJ A;  4CGI A;  4NCA A;  2YNF A;  1IKV A;  3SQ4 A;  4CE9 A;  1F21 A;  5CYM A;  3NGZ A;  2E6L A;  1VK0 A;  3NH0 A;  1NJX A;  3AVC A;  3EYZ A;  1LWF A;  1MU2 A;  1O1W A;  1NK7 A;  2OPQ A;  4DTU A;  4GW6 A;  4FJ9 A;  3IAY A;  3U6F A;  1RT7 A;  1NOZ A;  4I9Q A;  4RW7 A;  1BIS A;  3V1O A;  3SJJ A;  1NK5 A;  4C8O A;  3SCX A;  4DU1 A;  4O4G A;  3NHG A;  3NF6 A;  5D3G A;  1L3V A;  4DQR A;  3MXI A;  2KZM A;  1Q8I A;  1C0T A;  4IFV A;  5CY4 A;  3L3V A;  4CIF A;  1DLO A;  2Z1J A;  3V6D A;  5T7B A;  3ZT2 A;  4EZ6 A;  4CHO A;  1NJW A;  1NJY A;  4E1N A;  2OZS A;  3DLG A;  3DLB A;  2HHS A;  1B9F A;  1S1U A;  1WSE A;  3ASM A;  2OYQ A;  2HNY A;  5HRO A;  4IFY A;  4DS5 A;  3TAF A;  4DSJ A;  1NK8 A;  1JLQ A;  2DTU A;  2VG5 A;  3V1R A;  3F9K A;  1R0A A;  3AA2 A;  1L3T A;  3DOL A;  1WAF A;  2PZS A;  2RN2 A;  1S1X A;  1JL2 A;  1KFS A;  3KD5 E;  3K57 A;  2FBT A;  3UIQ A;  3VQD A;  1D5A A;  4LD0 A;  3OYF A;  2EHG A;  4E7H A;  2VG6 A;  1Z26 A;  4CK1 A;  2Z1H A;  4CCH A;  1RDB A;  1IO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...