1ZBLA

Bacillus halodurans rnase h catalytic domain mutant d192n in complex with 12-mer rna/dna hybrid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zblA00
2XO7A 3EY1A 2HNDA 3QERA 5J2MA 4I2QA 1D5AA 4BE2A 3TANA 3AVMA 2DY4A 2IC3A 4E89A 1YTAA 4BACA 2PZSA 3SCXA 1WAJA 2B5JA 2P1JA 1CZBA 1HQEA 3U6FA 4FJ7A 4KREA 3QNOA 2KFNA 2GV9A 1UAXA 3IRXA 4UQGA 3NGZA 4I9QA 4FM0A 1C0TA 1WNSA 4KO0A 2VG7A 3WNGA 3OYNA 4LH5A 1L5UA 4EZ6A 1WSJA 2YKMA 4NCAA 3K2PA 3NH0A 1T05A 4BDPA 3SPYA 3PO4A 1KFDA 1VSKA 1W9HA 3NAEA 5J2PA 4ELUA 4KTWA 4RW6A 1Q8IA 4CFDA 1RBUA 1KLNA 1KVCA 3DI6A 3VQ4A 2HVIA 1BCMA 3ISNC 4YNQA 1SL1A 1S1XA 2YNIA 4GVMA 4N5SA 4B9NA 3ASMA 1D8YA 3DOLA 3PO5A 2FC0A 3L3VA 1X1PA 4Q5VA 4DQQA 3HXMA 4F3TA 2IDOA 3ZSZA 2JGUA 2OPRA 1T03A 3P83D 2YNFA 4DTXA 5KTQA 4CEAA 2IS3A 3C94A 4DTMA 4JS4A 3KD1E 4RW7A 3OYBA 4M3WA 4CFAA 1ZYQA 3HYFA 3CM5A 4CGJA 1ITGA 3V6DA 4J2AA 4DSFA 2ATQA 4B9MA 1TK0A 1RT7A 1QE1A 3NF8A 5KI6A 3TWHA 2DTUA 3AVGA 4I9LA 3HVRA 3DLEA 3L8BA 4DS4A 3V81A 4DS5A 4RG8A 1TKDA 3O4NA 1B9DA 4FJKA 3KLFA 3L2VA 1S6QA 1HPZA 4HVJA 3AVKA 4JLHA 5HRPA 4H8KA 1BGXT 2KZZA 4CGDA 3T19A 4B8AB 3PY8A 4LSNA 1SL2A 3OYKA 4CJPA 4IKFA 3QNNA 1IKXA 4PUOA 2B6AA 4FXDA 3RMBA 1B9FA 2Z1GA 1G15A 1RDCA 1MU2A 3C95A 4EZ9A 5I3UA 3M8PA 1HRHA 3DOKA 3QLHA 4FJHA 4KRFA 4N47A 2YHBA 5FDLA 2EHGA 4CESA 1A5WA 1BI4A 1B92A 3UIQA 4HCBA 4B9UA 1L3UA 1TKTA 4J2DA 4OPJA 2YV0X 2A1SA 3VQCA 4AHVA 3SQ2A 4DTJA 5HP1A 4CCHA 1U4BA 1BIZA 3L2WA 3T3FA 4IFYA 4FLVA 3NF7A 3VN5A 3WNEA 2JLEA 4CHNA 1T7PA 3AVHA 5SWMA 1WSHA 4C8KA 1CZ9A 4ELVA 3OYGA 1QTMA 4FJGA 3VA3A 3SNNA 3SUQA 1VSLA 3K5OA 3ZCMA 1C0MA 3U3YA 3LZJA 3TAQA 2G8HA 5KGWA 3OJSA 3KKSA 1VK0A 4FCYA 1SKWA 1KSPA 4AHCA 1IKVA 1RDAA 5CZ1A 1TKXA 3SUPA 3KJVA 1LW0A 2P51A 4KI6A 4E1MA 2KTQA 1TV6A 4DWIA 4DQPA 3KK3A 2PYLA 4FZXC 1JXBA 4NCGA 1BHLA 4Z4CA 4PA1A 3CYMA 1HNIA 2G8KA 4E7IA 4AHUA 3HP9A 1YVUA 5FRNA 1LWEA 4AHTA 2HHSA 1JLCA 3ZSXA 4DQIA 4W5TA 4CF0A 3AV9A 4ZHRA 3I8DA 3OYFA 3JYTA 3HPHA 1F21A 4CF9A 4XIUA 4Z4GA 3S9HA 2GUIA 4GMJB 3OYJA 1HYVA 4I2PA 3VQBA 3LWMA 3MEGA 1LWFA 3VQ9A 1D9FA 3SUOA 2ZE2A 5HRNA 3CFPA 3AA2A 1RT5A 3AA5X 5I42A 3AVIA 3LAKA 1BL3A 3RRHA 2Y1JA 4L8RB 4AHRA 4FVMA 4EP4A 4B3OA 1RNHA 4ZTJA 4OVLA 4FLUA 1ASVA 3AVLA 4K8ZA 3DRRA 2R7YA 3RR7A 1FKOA 1S6PA 4OGCA 4CE9A 4CHOA 3MAQA 5J1EA 3TABA 5K14A 4NCBA 2HNZA 2FBTA 3HJFA 4CJFA 1IKWA 3LALA 4H4OA 1KVBA 2FBYA 4CK1A 1LWCA 2F96A 4DTNA 1U49A 4M3XA 1RBRA 1S9GA 1JKHA 1SV5A 2ETJA 2RPIA 4CF1A 4B9VA 3WNFA 3OYMA 4M3ZA 1IO2A 3OYCA 1U04A 3HM9A 3LANA 2E4LA 4Z4FA 4OKEA 3PX4A 2VWKA 1QSYA 4BDYA 2Q3SA 1ZBUA 4JRPA 1L3SA 4CHPA 3M8SA 3L2RA 4Y1CA 3QEWA 2KZMA 4MQ3A 4E7JA 5SZTA 1JL1A 3CFOA 4AHSA 4CJVA 3L3UA 3S3NA 2O4IA 5FRMA 2QKKA 4OKJA 1NKEA 2I5JA 3RMAA 5CYQA 1RT2A 1RBVA 3HL8A 2BANA 5J2NA 3QEXA 4FJLA 4CEZA 5HRRA 2VWJA 3AO4A 1NJYA 3K5NA 2HB5A 3MXJA 3V9SA 4CECA 1C6VA 3BDPA 2F8SA 1KLMA 3OY9A 4O0JA 1EX4A 4E0DA 4GW6A 3AVAA 1BISA 4CJQA 3P5JA 3LPUA 1JLEA 5JS2A 4CIFA 4YFUA 3ZT2A 3O3HA 4O0IA 1XC9A 1TK8A 3U3GA 1NK0A 4KHWA 4CJUA 1HJRA 5C42A 4IG0A 3SUNA 4KB0A 4W5QA 1TAUA 1SUQA 3DRSA 1UOCA 1RTJA 3AA4A 4KFBA 4CGFA 1XHZA 1C1CA 1TAQA 4AILC 1JLAA 4QCLA 3KK2A 3PX6A 4ID5A 1NK7A 1CLQA 3DYAA 3NGYA 3KLIA 4FJIA 4N76A 3ZSOA 4HUFA 3HK2A 1WN7A 4N41A 1ASWA 4CGHA 3ZT1A 3LPTA 2QK9A 1TVRA 3O3FA 3NH1A 3H08A 3BGRA 4CEEA 5KRSA 3SQ0A 3THVA 1ZBIA 2HW3A 2D0CA 2HHWA 4E1NA 3D0PA 1U45A 3KLHA 1HQUA 3VQ5A 4DLGA 4FJ5A 1RDBA 2NUBA 2RKIA 3AO5A 1IKYA 3I0SA 2KFZA 2G8FA 3QIPA 3HVTA 2A1RA 3T1AA 3V1QA 1NK6A 5CY4A 4O5BA 3G0ZA 3DLRA 4DTSA 4C8MA 1KCFA 1NKCA 3D45A 3O4QA 2IOCA 3KIOA 4FJ8A 3LP0A 3NFAA 4CGGA 4R5PA 1VSEA 4LD0A 2FBXA 3I0RA 4MFBA 3SI6A 2QKBA 4CIEA 4OPKA 4OLAA 4DSIA 1BQNA 2Y1IA 2WOMA 1A5XA 4KHQA 2G8IA 4RW9A 3VQ6A 4HTUA 4FYDA 2KW4A 1SKRA 3FFIA 4ICLA 2EX3A 1HYSA 3QIOA 3SV4A 4CJWA 1D9DA 3KTQA 4W5OA 3DLBA 3HT3A 3CM6A 3JSMA 1XWLA 1CXUA 2XY7A 4KHSA 1JLFA 4CJKA 3ULDA 1KTQA 4CJRA 4KHUA 4TSXA 4DQSA 1LAWA 1LV5A 4CJ5A 2D5RA 3KK1A 4PWDA 4KI4A 3NF9A 4IG3A 1XI1A 5KGXA 1J53A 2FBVA 4CJ3A 1WAFA 1EXQA 1O1WA 5C25A 1NK4A 4FK0A 2X6SA 4FZZA 1YTUA 4CIGA 3PV8A 4Z4IA 2DFFA 5DK5A 2X6NA 4NYFA 3VQAA 1FXXA 4HUEA 3KLGA 3TAFA 1TKZA 4KHYA 1NKBA 4M45A 4B08A 4E7HA 4C8LA 3LZIA 4LH4A 2O4GA 4DMNA 1FKPA 4FJMA 1UWBA 3OVNA 3SQ4A 1X9WA 3S3OA 1RBSA 2D0AA 3M8QA 1NK9A 3C6TA 2XY8A 1ZBLA 3QEPA 1RBTA 2W42A 5E41A 2GBZA 4O44A 1DLOA 3NCIA 2DFEA 3K59A 4FM2A 4DQRA 1RILA 4BWJA 1S5JA 4WE1A 2HHXA 4QAGA 4F2SA 1WSGA 1HYZA 1VSFA 1WSFA 4DFJA 4KB1A 3ZSVA 3OYHA 3ZT3A 3NH2A 2F8TA 3SZ2A 2D0BA 3V9ZA 2XY5A 1S1WA 1KVAA 3K58A 1RCHA 3QEIA 1BI4B 4M3UA 3PX0A 5JS1A 4CK3A 3NDKA 2PY5A 4H4MA 3TAEA 4KAZA 3F9KA 4E3SA 1R0AA 1C1AA 4KV8A 1L3VA 1DTTA 1U47A 4FK4A 1VSIA 2OZSA 3CG7A 4C8NA 4N56A 4ELTA 1SKSA 3VQ8A 4F2RA 4RW4A 4J2EA 1RT1A 2LSNA 2HHTA 2VG5A 3AA3A 3HO1A 4CEFA 3NE6A 1DTQA 1VRUA 3AO3A 3TR8A 3LP2A 1NOYA 4E7LA 4LY7A 3IS9A 3VQEA 4OLBA 1NOZA 4G1QA 4CEOA 1XHXA 3MECA 1VSJA 4CGIA 1LAVA 3AVCA 4EP5A 4DFPA 5HLFA 3E01A 4FJNA 1ZBFA 3RR8A 3SV3A 4F3OA 3CFRA 4JRQA 4DTUA 1J5OA 1QSSA 2P5GA 1NJZA 4CJLA 4M3YA 4FJXA 4I7FA 1X9MA 4PY5A 2OPSA 3HP6A 2ITGA 4M42A 5CYMA 5C24A 3KLEA 1I39A 3A2FA 3ZSWA 4CHYA 2HHUA 1JL2A 1W0HA 2BDPA 3WNHA 3OS2A 4FLZA 4FZYA 1TL3A 4FK2A 3TAGA 4DSEA 4FJJA 4BWMA 1WSIA 5D3GA 3OYLA 3L2QA 3VQ7A 4B9TA 1L3TA 4O55A 5T7BA 1C0UA 3IG1A 3V9WA 3SJJA 2G8VA 4CJSA 3S3MA 3DM2A 1BIUA 3OYDA 4FLXA 3ITHA 2B4JA 3CQ8A 3SYZA 4CFCA 3QESA 4QOZB 4CEDA 4FJ9A 1GOCA 1RTIA 4AH9A 5CZ2A 1RTDA 4F4KA 3VQPA 3B6OA 4CF2A 2KQ2A 3LWLA 3LDSA 4IDKA 4DU4A 2VG6A 2BE2A 4OJRA 3EYZA 3PUFA 4DTPA 4M41A 2DFHA 5FROA 4DF8A 1X9SA 2WONA 2AJQA 4KPYA 1JLQA 2HMIA 1GOAA 3V9XA 2HHQA 5KRTA 3LP3A 1FK9A 4BE1A 4DTRA 3TI0A 4PQUA 1IH7A 3ALYA 3K5LA 4KTQA 2G8UA 3DLGA 4HUGA 4DSKA 4K8XA 4ID1A 3AVFA 3F73A 4O4GA 3M8RA 4W5NA 1GOBA 1HMVA 2ZD1A 3NGIA 2Z1JA 4E7KA 2OYQA 3KD5E 3NF6A 1UA0A 4CEBA 1U48A 4NYNA 3NHGA 4BDZA 3HPOA 3LAMA 4FLWA 4FW1A 3OS0A 3RRGA 1RTHA 3V4IA 2X74A 3LP1A 4FW2A 4FM1A 3DMJA 4Y1DA 1N6QA 2G8WA 4F8RA 1HNVA 4KHNA 1UA1A 1VSHA 3SPZA 3AVBA 2XHBA 4IBNA 2RF2A 4OKKA 1S1TA 4CK2A 3ZSYA 3K57A 4Z4EA 1LW2A 2YKNA 3OS1A 1BCOA 4C8OA 1CXQA 2ZQBA 3MXIA 3G10A 4CJTA 5HROA 1RT3A 3OYAA 3TARA 2Z1HA 2YNHA 2OPQA 4CHZA 4Q0BA 3RMDA 1JLBA 3RWUA 1WSEA 1VSDA 1REVA 2E6MA 4OGEA 1VRTA 2OA8A 1J54A 3QEVA 4DSLA 1QSLA 2QXFA 2HNYA 3VQDA 1TK5A 3SQ1A 1IG9A 1EETA 3HSTB 4CERA 3MEDA 3EZ5A 1BQMA 4JS5A 5J2QA 2E6LA 3TAMA 3TAPA 4FLTA 4B9SA 4CHQA 1Q9XA 1QQCA 4DU1A 1TL1A 2XRIA 2Z1IA 2HHVA 2YHAA 3AO1A 1Z26A 3AVNA 3VQQA 4DTOA 1RDDA 1C1BA 2XY6A 3IAYA 1JXEA 5DMRA 1RT6A 3DLKA 4CF8A 1WLJA 1JLGA 4Z0UA 3KKRA 1S9EA 2IAJA 3HPGA 5EU7A 3V9UA 1EKEA 3RTVA 4CEQA 1ZBHA 1EP4A 3V1OA 4B8CA 4KTZA 2P5OA 3QINA 1K6YA 1Z25A 4DG1A 4HHTA 4HCCA 1I3AA 4J2BA 4KKOA 3RMCA 3V1RA 1A5VA 2PYJA 5HBMA 4CJ4A 3OJUA 4DFKA 1N5YA 3ZT4A 4M3TA 3AVJA 3OYIA 1T8EA 3VA0A 5HRSA 3OYEA 2X78A 3DRPA 1YT3A 3ZSRA 3QETA 3MXMA 1TGOA 1QHTA 1S1VA 1NJXA 1SL0A 3MEEA 1J9AA 1QS4A 3DLHA 4W5RA 4M3RA 1NK5A 1S1UA 2BGGA 1KFSA 2RN2A 1NJWA 4DSJA 3C6UA 3K5MA 1VSMA 2YNGA 1Y97A 2OZMA 2HVHA 1ASUA 3ZT0A 4E19A 4IFVA 4BE0A 4B9LA 3ZSQA 3QO9A 1Q9YA 3O3GA 4RW8A 3NBPA 4CJEA 4FLYA 4DF4A 2IGIA 3L2UA 4Z4HA 4DFMA 1RT4A 4DLEA 4CFBA 1NK8A 4LSLA 3B6PA 1KRPA 4DU3A 3AO2A 4ZTFA 3P1GA 2OPPA
chains in the Genus database with same CATH superfamily
4BR9A 1M90O 2HNDA 3AVMA 3O6WA 3MN9A 3SCXA 4BR7A 4FJ7A 3QNOA 4UQGA 3NGZA 1C0TA 1WNSA 3QBWA 3RSEA 3A5MC 4BDPA 1KFDA 1W9HA 3F5TA 2IVPA 5J2PA 4RW6A 4CFDA 4YNQA 3ISNC 5C2FA 4KHPK 1SL1A 4WQ4A 3ASMA 1KQSM 1D8YA 3K9KA 3CERA 4Q5VA 1X1PA 4CW7B 3HXMA 1HKGA 2QWRA 3BZCA 3VGKA 2IS3A 2QW9A 3C94A 2ZGZA 4NLCA 4CI6A 4RW7A 3OYBA 4JS4A 3KD1E 1ZYQA 3HYFA 3CM5A 4CGJA 4A2BA 2Q97A 1RT7A 1QE1A 3TWHA 3AVGA 4EIAA 1T44A 4CZEA 1W2BM 4DS4A 3I33A 4B1WB 3TTDA 4FO0A 1B9DA 4FJKA 1HPZA 2O8CA 3BUZB 1BGXT 4B8AB 4JI5K 2ZJRL 3OYKA 2YHYA 1IKXA 2B6AA 2Z1GA 3CJ9A 4DQ8A 5I3UA 1U6ZA 3MX2A 3M8PA 4N47A 5FDLA 4BQZA 4HCBA 3B8AX 4OX9K 3ZEUA 2PAVA 2UXDK 4DV3K 5F2RA 1U4BA 1BIZA 4IFYA 3NF7A 3RSEB 3WQTA 3WNEA 1WSHA 4YOXA 1CZ9A 4C8KA 3SUQA 3U3YA 3ZCMA 3LZJA 3KKSA 1VK0A 4KH4A 1IKVA 5CZ1A 4DWIA 3WXLA 3KK3A 4NCGA 3UE5A 5F0XA 2ZGYA 3CYMA 3D6RA 1YVUA 2P9KA 3AY9A 5FRNA 3AAQA 1D4XA 4CF0A 3AV9A 3I8DA 2WC9A 1YITN 1BDGA 3S9HA 4GMJB 2GX9A 3LWMA 4DR6K 4B3MK 3K9JA 4JN4A 4NO7A 5BREA 4LF6K 2O8CB 1HJOA 4YOYA 5BRFA 1HLUA 4FLUA 1N32K 3SMPA 4JKBA 4XH1A 4CHOA 3T7ZA 5J1EA 3MAQA 2VYPA 2HNZA 1X9JA 4IDHA 2J4RA 2F96A 4M3XA 1EO1A 4H0OA 4QS8A 1S9GA 1JKHA 1Z05A 3R6MA 3WNFA 4M3ZA 4M7YA 5BN8A 3LANA 4DV1K 1L3SA 3HOTA 3L2RA 3QEWA 2NRTA 1YJNN 1OVQA 3HSCA 3U4LA 2HBJA 1JL1A 4AHSA 2IVOA 2I5JA 1RBVA 4FJLA 3H45C 3CETA 1YI2N 2HB5A 5AQUA 4KH6A 3HM8A 5AQXA 4FWRA 2CH6A 1EX4A 4O0JA 5AQSA 3AVAA 1BA0A 3P5JA 5JS2A 3O3HA 3PSIA 1NK0A 1OKJA 4PKGA 1TK8A 4CJUA 5C42A 1P8ZA 3UKRA 3SLCA 1SUQA 3DRSA 1NWKA 2VQEK 1TAQA 3WXJA 4CZKA 5LJVA 3PX6A 4QS7A 2OTLN 3KLIA 4N76A 3HK2A 3ZSOA 1WN7A 1KAZA 2F4VK 1MWKA 3I56N 1MA9B 3SAHA 4UY8O 4H5RA 3CJ7A 4E1NA 3QMLA 3KLHA 3VQ5A 4PKIA 4JK8A 2QWNA 2HF3A 3AO5A 1IKYA 2KFZA 2QWMA 1KAYA 3L4IA 3G0ZA 4DTSA 4C8MA 3KZBA 3LM9A 3VESA 3D45A 3FFKB 3O4QA 5LJWA 3VGMA 4U67L 2P9UB 4PL8A 1GLJO 4H5NA 3SI6A 4OLAA 4DR7K 4DSIA 1S22A 2G8IA 3VQ6A 1QHAA 2FF3B 4DV0K 3THYB 3SV4A 3O9RA 4CJWA 2NZTA 2AP1A 3JSMA 3A5OC 1XWLA 4ISFA 1NGFA 4KHUA 2HBLA 1LV5A 4CJ5A 1ZC6A 4K25A 4PWDA 3VENA 5KGXA 4FJ8A 4CJ3A 4FK0A 3UKRB 2X6SA 3MCPA 3M5RA 2DFFA 3GDQA 5DK5A 2QA4N 3TAFA 3KLGA 1E4GT 1TKZA 2W41A 4B08A 2ASOA 4C8LA 5C2DA 4LH4A 5AFUH 1SZ2A 4CBWA 3GL1A 1NK9A 3C6TA 2GBZA 3QEXA 4WE1A 1HYZA 3R1XA 1TUUA 3NH2A 3SZ2A 3V9ZA 3THXA 3E9OA 2NRVA 5AQHA 1BI4B 3LDQA 3PX0A 3NDKA 2PY5A 4H0VB 5BRHA 1WUAA 4KV8A 1U47A 1SQKA 3WT0A 4C8NA 4F2RA 3Q7CA 5LL6Z 2LSNA 1NOYA 3TR8A 4YY3K 1NGGA 5BPNA 1SAZA 4JEPA 3RR8A 4DR4K 4JI1K 1J5OA 1TUYA 3FE1A 1HKCA 4BRIA 3HP6A 4I6MA 3CI5A 4M42A 5CYMA 1HNWK 4FWOA 3ZSWA 4CHYA 4BROA 3OA9A 1W0HA 2F7TA 2BDPA 4FLZA 1TL3A 3VEVA 2GTDA 4BWMA 1WSIA 4JK7A 3VQ7A 4B9TA 1X3NA 2HBMA 1BOTO 3S3MA 3ITHA 4E1JA 1ATRA 2BH1A 4CEDA 1XMQK 5AZJB 3ZX3A 1RTDA 4IEEA 2VG6A 4OJRA 1IG8A 2HW3A 1K8AO 2AJQA 5FROA 4BVPA 4M63C 5CR4A 2YX6A 3LP3A 3TI0A 4PQUA 3ALYA 3K5LA 4A62A 4CBUA 3DLGA 3BEXA 4M7XA 3F73A 4E7KA 4EHUA 5EX5A 3NF6A 3HOSA 1UA0A 1U48A 4C23A 1Q82O 3OS0A 3RRGA 2X74A 4FW2A 1GLCG 4BRCA 4CZIA 2E2NA 2VQFK 4FM1A 4KHNA 1VSHA 2XHBA 4OKKA 3K57A 4C8OA 2ZQBA 4H5TA 3G10A 1VQON 4AQYK 4I6MB 3RMDA 1REVA 2E6MA 5M1KA 4DSLA 1J54A 3QEVA 2QXFA 3VQDA 5CHIA 1IG9A 4CD3A 4CERA 1S3XA 2QWPA 3TAPA 4FLTA 3R8EA 1QQCA 1TL1A 1ATNA 1YHQN 3CPEA 1C1BA 2XY6A 3IAYA 4JI7K 2RE2A 3QB0A 1WLJA 1S9EA 3HPGA 5EU7A 4B9QA 3RTVA 1EP4A 1VQ6N 4NLBA 3C6HA 2P5OA 4DG1A 1DT9A 4KKOA 3RMCA 4BR2A 1QZ5A 1JCGA 3QFPA 4CJ4A 3OJUA 1N8RO 3ZT4A 1JJ2M 3OYIA 2P9SA 1E3MA 1S72N 4W5RA 2A5XA 1KFSA 2RN2A 2UXBK 1MDUB 3SBTA 1ZXOA 4JD2A 4FLYA 2CGKA 1RT4A 1Q81O 1KRPA 1Y64A 3P1GA 3MN7A 5BRDA 2BTFA 3T69A 4BRAA 3EY1A 3QERA 4F9OA 4BE2A 2IC3A 1YTAA 3WEEA 4BACA 3JS6A 5MLCQ 1ESVA 2KFNA 1HQEA 2GV9A 1UAXA 4I9QA 2NNWA 2VG7A 4KO0A 4EZ6A 2A41A 3NH0A 5AFUA 1QVGM 3VEOA 3CC7N 4IXCA 2HVIA 3DI6A 3F9MA 1BCMA 2HMPA 5GADP 4FOIA 1S1XA 4GVMA 4B9NA 1NBWA 4LFAK 3DOLA 3PO5A 2IDOA 4O5FA 3J7ZO 1N36K 2JGUA 2OPRA 1DEJA 3P83D 2P9SB 5IT9O 4DTXA 3R3LA 3HBTA 3FZLA 3J8AA 1G99A 2O8BA 2ZWHA 4M3WA 4FWKA 4X64K 3V6DA 4BGAA 4BRMA 1VQ4N 4B9MA 2DTUA 3HVRA 5FPMA 3W0LA 3H3OB 4JD2B 5TKWA 3CPWM 5HRPA 3CJBA 4CGDA 3QNNA 3C95A 4FWMA 2QWOA 3CMAN 3FZMA 3WEEB 3UIQA 1A5WA 1TKTA 3EKSA 4AHVA 3OBYA 3DLLL 3T3FA 4O8KA 3VN5A 1T7PA 2ZM6K 2IVNA 2QKBA 3SNNA 1C0MA 1KC8O 5KGWA 3OJSA 4FCYA 2O8DA 3CCRN 1W7AA 3BF3A 2P51A 2KTQA 4H0XB 1NMNA 4E1MA 4DQPA 1WB9A 1HNIA 2G8KA 4X65K 5LMUK 4AHTA 1JLCA 1IBLK 4DQIA 2QTDA 3OYFA 2GEMA 3HPHA 5JICA 4IFEA 4CF9A 5M1QA 2HSTA 3MEGA 4YORA 2JWKA 3SUOA 3G71N 3RRHA 4K43A 3ATUA 5AQTA 1BA1A 2VWBA 3LDNA 3IMXA 1RNHA 4JNEA 4DKWA 1XNRK 4OGCA 4JKDA 4NXMK 3HJFA 4CJFA 3LALA 4CK1A 1KVBA 2FBYA 4DTNA 3N4PA 3Q7BA 1RBRA 5LMNK 3OYMA 1IO2A 1U04A 2NRXA 4OKEA 3PX4A 1QSYA 4BDYA 3D7EO 2Q3SA 2QXLA 1Q18A 3ZLJA 3M8SA 1ILYA 3CFOA 1NGDA 3CIPA 3S3NA 2CGJA 4U7BA 2YHWA 2O8DB 3RMAA 5CYQA 1DGKN 4V19S 1NJYA 3K5NA 3MXJA 3O5BA 2F8SA 4BRLA 1XC3A 4E0DA 1NGEA 5AQJA 3VTIA 1N34K 1VQLN 3ZT2A 5TKYA 3D2EA 2ZJQL 4NB4A 5C12A 4QCLA 3E66A 4ID5A 4EHTA 3DYAA 4BC4A 4BG8A 2QWLA 4N41A 1ASWA 1O13A 1J5EK 2QK9A 3O3FA 3BGRA 4CEEA 5KRSA 3SQ0A 3THVA 2D0CA 3D0PA 3WUHA 3R9PA 1EQYA 4DLGA 1RDBA 2NUBA 4YOWA 1EWQA 3EKUA 5DM7L 4BRKA 4PHTX 3KIOA 3NFAA 4CGGA 2NRHA 4IJAA 2FBXA 3D2FA 2E1YA 3A0IX 4OPKA 4LFCK 2Y1IA 4KHQA 4RW9A 2FF6A 4HTUA 2FXUA 2KW4A 5B8HA 1SKRA 1HYSA 1D9DA 3KTQA 4W5OA 3HT3A 5KQ8A 5KPRA 4KBOA 1JLFA 5H1SQ 4BRQA 4R79A 4CJRA 4DQSA 1LAWA 4LF7K 4ILGB 4BREA 3MWTA 3D2EB 1J53A 2FBVA 4FWQA 3L6QA 1YTUA 4C1NI 3U9ZA 4Z4IA 5BR8K 2X6NA 1FXXA 4KHYA 3E1YA 2DPNA 4FPBA 2ASPA 3LZIA 2Q1NA 2D1KA 3OVNA 1X9WA 3S3OA 1RBSA 2XY8A 5E41A 4FM2A 3I8BA 4DQRA 2D0PA 4BWJA 1S5JA 1OH6A 4QAGA 1WSGA 3QFUA 1VSFA 1WSFA 4DFJA 2HBKA 3ZT3A 2D0BA 2XY5A 5M1NA 3K58A 3QEIA 4M3UA 3DAWA 3ZEUB 4E3SA 3D2FB 1L3VA 1DTTA 4JI3K 5BPMA 4FK4A 4A59A 1VSIA 3J80O 2OZSA 2OCEA 1KXPA 4LC9B 4GNIA 2VG5A 3AA3A 4CEFA 2VGMA 4O8UA 4JKEA 4E7LA 4LY7A 3IS9A 1NOZA 2QM1A 1XHXA 4EP5A 3AVCA 4DFPA 4FJNA 3CFRA 5AQMA 4JRQA 2P5GA 4IO8A 1NJZA 2P9PA 2PBDA 4I7FA 1X9MA 1YJ9N 2OPSA 2P9KB 4ISEA 1RDWX 3KLEA 4DCHA 3C0BA 2E20A 5CE3A 3U8XA 2HHUA 4CD1A 4EFHA 5ADXH 2W6LA 3EEQA 3TAGA 3L2QA 1L3TA 4O55A 5T7BA 4H5WA 4GV6A 3SYZA 4CFCA 1GOCA 1RTIA 3VETA 4Z94A 2KQ2A 4IDKA 4BRPA 3EYZA 4DF8A 1X9SA 2YI1A 2FSJA 4YOUA 2IIRA 4DUYK 3V9XA 3GE1A 1FK9A 2AA4A 1Z6RA 2A40A 2E8AA 1GOBA 2ZD1A 3VEXA 3KD5E 3TTCA 1HKBA 3NHGA 1WOQA 3LAMA 4FLWA 4IZ9A 3LP1A 4H0YB 1UA1A 1HUXA 4IBNA 2RF2A 4CZLA 3ZSYA 5FPEA 1LW2A 2O8EA 1BCOA 3F2KA 2P9PB 1BWFO 5HROA 3TARA 2Z1HA 2YNHA 2OPQA 3DWLA 1JLBA 3AARA 3LDOA 3RWUA 1VRTA 4BC2A 2HNYA 3SQ1A 3EZ5A 4K0KK 2E6LA 4GVEA 3TAMA 5AQNA 4CHQA 2XRIA 5GAEP 2NRWA 3IKMA 3AVNA 4DB3A 3P4IA 4DR3K 5E84A 1RT6A 3DLKA 4CF8A 2P9IA 5M1OA 1ZBHA 3VEWA 4KTZA 4CZHA 5HOOA 4HHTA 2OTJN 4HCCA 3V1RA 1A5VA 5HBMA 2FSKA 5E26A 4CVNE 1N5YA 3L4QA 4M3TA 3AVJA 4LF9K 4H03B 3OYEA 3CF5L 2X78A 2D4WA 3ZSRA 3CC4N 2A3ZA 4HTLA 3MXMA 1TGOA 1NJXA 4BRHA 3MEEA 1SS6A 3T1HK 2E2PA 3DLHA 1S1UA 2E2OA 1NJWA 4RTFD 5I9EB 3C6UA 3K5MA 1VSMA 3QICA 2O8EB 4E19A 3G6EN 4B9LA 4RW8A 3NBPA 4CJEA 4CZMA 2IGIA 1R59O 4Z4HA 4DFMA 4MDAA 5GIOA 4BRFA 4LSLA 1T05A 2OANA 2XO7A 3EO3A 4I2QA 1D5AA 3TANA 1WAJA 2P1JA 3SK3A 1CZBA 4KREA 3U6FA 3BZKA 5IWAK 4NXNK 4BR4A 4FM0A 3OYNA 1L5UA 4LH5A 2UXCK 2YKMA 4NCAA 3K2PA 4K42A 3SPYA 3PO4A 1VSKA 4WQ5A 2P9IB 3H1QA 4KTWA 4ELUA 1RBUA 1KLNA 1KVCA 4LF8K 3T1YK 4JYAK 2YNIA 4N5SA 3ZX2A 4BRGA 2FC0A 3L3VA 1BO5O 4BVOA 4HWIA 3THXB 1QQNA 5DM6L 3TSQA 2EWSA 3BP8A 5AZIA 2YNFA 3NMUA 5KTQA 1NNEA 3HRGA 4LF5K 1TK0A 2VGNA 3NF8A 5KI6A 4IOXA 4I9LA 3L8BA 3V81A 1TKDA 2NRRA 3O4NA 3L2VA 1S6QA 5F1XA 4LSNA 2E2QA 1SL2A 4CJPA 4IKFA 4FXDA 3RMBA 1RDCA 3HTVA 4PKHA 1YIJN 1HRHA 1HX1A 3QLHA 4KRFA 4B1UB 3ENOA 2YHBA 4CESA 2EHGA 4B1ZA 3SAFA 5ADXA 4OPJA 2YV0X 3VQCA 4DTJA 5HP1A 3L2WA 3ID6A 4FLVA 4CHNA 1XMOK 3AAPA 5SWMA 3VA3A 3TAQA 1VSLA 2G8HA 3O08A 3WQUA 1SKWA 1QVFM 1GLEG 3KJVA 3GG4A 1JXBA 4Z4CA 1BHLA 4PA1A 4E7IA 4DV5K 5AZIB 1LWEA 3RVCA 1C0FA 1KAXA 4W5TA 2FLOA 4ZHRA 3JYTA 3J81O 5AQGA 4XIUA 4Z4GA 2GUIA 3OYJA 1LWFA 3O9TA 4OPHA 4IEIA 1RT5A 1RGIA 4JKGA 5EXWA 1BL3A 4L8RB 4AHRA 4FVMA 4EP4A 4B3OA 4OVLA 3AVLA 4K8ZA 3CJCA 2R7YA 3RR7A 1FKOA 1S6PA 3A5LC 3CD6N 2Q2RA 4XH4A 3TABA 2FBTA 1IBKK 4DV2K 1H1VA 4JKFA 5LY3A 4H4OA 1LWCA 1NGBA 3LDPA 1U49A 4GV3A 1SV5A 2ETJA 4B9VA 4CF1A 2CGLA 3OYCA 4FL9A 1ZBUA 4CHPA 1Q86O 4Y1CA 5AR0A 4MQ3A 1ATSA 4E7JA 5SZTA 1VAZA 3CCQN 3FZKA 3KWGA 3L3UA 2A6AA 2O4IA 5FRMA 1I94K 2QKKA 4OKJA 1NKEA 2WUSA 1N33K 2P9NA 1RT2A 2GELA 3CMEN 5J2NA 4CEZA 4FSVA 3CHWA 5HRRA 4JI6K 1T6CA 2VWJA 3J7YP 2E88A 4CECA 3BDPA 1KLMA 3OY9A 3OBWA 4FWPA 3MN6A 3LPUA 4CIFA 4YFUA 1IV0A 1XC9A 4O0IA 4KHWA 4KB0A 4W5QA 4X66K 1RTJA 3AA4A 4CGFA 1XHZA 1NU0A 3ENBA 1C1CA 1WBBA 4AILC 1JLAA 1VQMN 2NLXA 4BC3A 4JKGB 3KK2A 1NK7A 1CLQA 3NGYA 3I55N 4FJIA 3M1FA 3O1BA 3H46O 1LOTB 4CGHA 5AQRA 3NH1A 1NJIO 3H08A 5KPTA 4A2AA 4MO5A 2WFBA 1HQUA 5JLFA 4FJ5A 2GUPA 2RKIA 3I0SA 3C6AA 3HVTA 5AQFA 1NK6A 3O9SA 1YJWN 5CY4A 4O5BA 5EY4A 3DLRA 1KCFA 1ZBSA 1NKCA 2IOCA 1DKGD 1VSEA 4LD0A 3I0RA 4CIEA 3IUCA 4JKCA 3SJHA 4YDUC 3EE9A 2P9NB 4ICLA 3LL3A 1GLFO 3TSUA 3DXMA 4BQLA 3CM6A 2XY7A 4KHSA 1V4SA 4CJKA 3ULDA 4TSXA 3ULEA 3LDLA 3KK1A 1OVYA 3NF9A 4IG3A 1XI1A 5C25A 1NK4A 1EXQA 2JWLA 4CIGA 1RFQA 4PL7A 1U2VA 3PV8A 3O9QA 4NYFA 4X62K 2O8BB 1NM1A 1KD1O 4HUEA 3C65A 1NKBA 4M45A 4E7HA 3VF4A 5BPLA 4DMNA 2UU9K 3MWPA 4FJMA 4CZGA 1ZBLA 2W42A 4JI8K 3NCIA 4GY2B 4O44A 4RWTA 2DFEA 3WXIA 1RILA 3PIPL 4KB1A 3ZSVA 3OYHA 1YUWA 2F8TA 3VERA 2RHKA 1KVAA 3G4SN 1RCHA 4BY9C 3MX5A 1WBDA 3O1WA 4CK3A 4KAZA 3TAEA 3F9KA 1VQ8N 2QI2A 4BG9A 2ZJPL 4ELTA 1SKSA 4RW4A 4J2EA 3HO1A 3NE6A 3LP2A 4G1QA 3DXMB 3MECA 1BU6O 4CGIA 5HLFA 3J7AP 3SV3A 4ILHA 4G9ZA 4F3OA 5AQZA 3ULEB 5AQYA 1QQOA 4CJLA 4M3YA 4FJXA 3PLAA 1JCEA 3MK6A 3CCJN 2ITGA 1QZ6A 1U2VB 1I39A 3A2FA 4H0TB 1JL2A 4DUZK 4LF4K 3WNHA 3OS2A 3NVKA 2HHHK 4FK2A 3WXMB 1EWRA 5D3GA 1X3MA 1VQPN 3OYLA 1OH8A 3IG1A 1NG9A 4FLXA 2B4JA 2Q0UA 4B3RK 3N4QA 4FJ9A 3CCLN 4YDUA 4BRNA 3B6OA 3LDSA 3E9LA 4DU4A 2I7NA 3PUFA 4M41A 1JLQA 4FWSA 2HHQA 3ID8A 5KRTA 4BE1A 4WYBA 2G8UA 2BUPA 3TSPA 3ZETA 4HUGA 4DSKA 4K8XA 3PSFA 1NGJA 1HNXK 3M6GA 3HI0A 4NYNA 4BDZA 4FW1A 5EOYA 1NGAA 1N6QA 4F8RA 1HNVA 3SPZA 3AVBA 1XQSC 1S1TA 2KKZA 1HR0K 4FPAA 5JLHA 3MXIA 3DJCA 4CJTA 5BN9A 1TYQA 4CZJA 1NLVA 1VSDA 4OGEA 1QSLA 4FWLA 1LCUA 1IJJA 2YHXA 4GV9A 3HSTB 4A57A 3MEDA 1BQMA 5J2QA 1K8KA 3VF2A 1GLAG 2ASMA 4B9SA 1C0GA 1NGIA 2FSNA 4DU1A 2Z1IA 4WFNL 5JVGL 2YHAA 3AO1A 1Z26A 3ZX0A 4A61A 1RDDA 1FW6A 3KKRA 4XH5A 2YCHA 4A5BA 4CEQA 3V1OA 3QINA 1Z25A 2I7PA 2W40A 3GOIA 2PYJA 3ZETB 4DFKA 2V7YA 1T8EA 3VA0A 5HRSA 3QETA 2QEXN 3AGKA 1S1VA 1SL0A 4MLHA 3L0QA 2BGGA 2O8FA 5AQPA 2YNGA 1Y97A 4JKAA 2OZMA 4IFVA 4BE0A 3MCAB 3O3GA 4C1NK 4B1VA 1TYQB 3B6PA 4DU3A 4ZTFA 4JV5K 3MN5A 3KK7A 5J2MA 2DY4A 4E89A 1K8KB 3E9PA 5JMVA 1Q7YO 2PZSA 5M1FA 2B5JA 3TTFA 2P9UA 3IRXA 2V52B 1V4TA 3CQYA 3WNGA 4B1YB 1WSJA 3OW2M 2P9LA 5GAHP 1YVNA 3HZ6A 3THYA 4H5VA 4K41A 3NAEA 1IBMK 1Q8IA 3VQ4A 3A8YA 3VMFB 3O8MA 2HOEA 5FLXO 4DQQA 4F3TA 4ILJA 3ZSZA 2H3GX 1T03A 4ISGA 4AM7A 4JHDA 4CEAA 4DTMA 3JXUA 3A5NC 4CFAA 1ITGA 1VQ7N 4J2AA 2O8FB 1VHXA 4DSFA 2NRZA 2ATQA 3TPQA 2QWQA 5AJ3K 3VPZA 4WF9L 4WQ5C 5AQIA 2UUCK 3DLEA 1BUPA 4IWVA 4DS5A 4RG8A 3CQXA 4FOEA 3KLFA 3THWA 4HVJA 3AVKA 4JLHA 4H8KA 4OPAA 2KZZA 3FR0A 3T19A 3PY8A 1XNQK 2KLAA 4PUOA 3SMSA 1B9FA 1G15A 3FZFA 1MU2A 3O80A 4EZ9A 4DV6K 4B3SK 3DOKA 4FJHA 2E5LK 1BI4A 1B92A 5FPDA 4B9UA 1L3UA 3MMVA 4J2DA 5BR9A 3CCEN 3SQ2A 2A1SA 4CCHA 4RCHA 1HNZK 4OO1J 2P9LB 2JLEA 3K0SA 3AVHA 4DR2K 3OTOK 4ELVA 4FJGA 3OYGA 1QTMA 3K5OA 5AQLA 5HL7L 1KSPA 4AHCA 1RDAA 1VQKN 1TKXA 1HPMA 3IFRA 3SUPA 1LW0A 4KI6A 1TV6A 4YHHK 2PYLA 4FZXC 1K73O 4AHUA 4IOCL 3HP9A 2HHSA 4J8FA 3ZSXA 4JHDB 4YOVA 5AQVA 1F21A 1HYVA 4I2PA 3VQBA 3VQ9A 1D9FA 2ZE2A 5HRNA 3CFPA 2GWJA 3AA2A 3AA5X 3AGRA 5I42A 3AVIA 3LAKA 2Y1JA 3THWB 3UB5A 5AZJA 4ZTJA 1ASVA 4FWNA 3DRRA 4CE9A 4NCBA 5K14A 1IKWA 5FPNA 3GBTA 3VGLA 2RPIA 4BRDA 4BR0A 3HM9A 4Z4FA 2E4LA 4B1XB 2VWKA 4QS9A 4JRPA 2KZMA 2Q0RA 1JCFA 3KHYA 3M3ZA 4WFAL 4KH5A 4YOTA 4CJVA 4B3TK 3C7NA 3H3NO 3HL8A 2BANA 3AO4A 3V9SA 5KQDA 4XEIA 1C6VA 1VQNN 3QBXA 4GW6A 3EZWA 1BISA 4CJQA 1JLEA 3P39A 3U3GA 1HJRA 4IG0A 3SUNA 1TAUA 1UOCA 3EN9A 4KFBA 3OHRA 4MDBA 5GIPA 5C10A 4HUFA 1T6DA 2UYTA 3P38A 3ZT1A 3LPTA 1TVRA 1VQ9N 1ZBIA 1MWMA 2HHWA 3KWIA 1U45A 1J6ZA 1NMDA 1M1KO 2WTUA 4CBXA 5M1PA 2G8FA 3QIPA 2A1RA 3T1AA 3V1QA 3SBGA 2PFUA 3VTHA 3CJAA 3LP0A 4R5PA 4FVUA 1XUPO 4MFBA 4DR5K 1BQNA 3C7NB 1A5XA 2WOMA 4AM6A 2YJFA 4BR5A 4WCEL 4Y0WA 4FYDA 4DHYA 3S41A 5C15A 3FFIA 3VEZA 2EX3A 2KHOA 3QIOA 5AQKA 1GLDG 1K9MO 3CXCM 2HF4A 3DLBA 4GKJK 1CXUA 1KTQA 4JKHA 2D5RA 3VOVA 4KI4A 4LFBK 1YAGA 1WAFA 1O1WA 2ITMA 4FZZA 5AQWA 3UKUA 3VQAA 1T3VA 2O4GA 1FKPA 1UWBA 3SQ4A 3M8QA 2D0AA 1P90A 3QEPA 1RBTA 3K59A 3DXKA 1DLOA 4MLEA 2HHXA 4F2SA 2WBNA 2E1ZA 4JK9A 3TU5A 1S1WA 1FJGK 3CCUN 4CZFA 5JS1A 3EE8A 4H4MA 1R0AA 1C1AA 5AQQA 3PIOL 3P31A 2Q36A 3ENHA 3CG7A 4N56A 2D0OA 3VQ8A 1RT1A 2HHTA 2F9TA 5AQOA 3VEYA 1DTQA 1VRUA 2V51B 3AO3A 3MDQA 3VQEA 4OLBA 4CEOA 1VSJA 1LAVA 3E01A 1ZBFA 2A42A 4DTUA 1QSSA 5GAGP 4PY5A 4BC5A 3BF1A 5C24A 4DR1K 4BGBA 3NVMA 3CC2N 3UKUB 4FZYA 4AF1A 1NGCA 1W97L 4DSEA 4FJJA 3G25A 1C0UA 3V9WA 3SJJA 1YF5L 5JVHL 3O9UA 4CJSA 2G8VA 3DM2A 1BIUA 3OYDA 2W6KA 4IO9L 3CQ8A 3SAGA 4JI4K 3QESA 2UUAK 2ZF5O 3DXKB 4QOZB 5A2QO 4AH9A 5CZ2A 4F4KA 3CJ1A 1CZAN 3FLCO 3VQPA 4CF2A 3LWLA 2YJEA 5EVZA 2BE2A 4L3QA 4DTPA 2DFHA 2WONA 4KPYA 2HMIA 1GOAA 3FZHA 4DTRA 1IH7A 1NGHA 4KTQA 4ID1A 3AVFA 4O4GA 1GLLO 3M8RA 4W5NA 1HMVA 3NGIA 2Z1JA 2OYQA 4CEBA 1VQ5N 3HPOA 3U9DA 3CCSN 4DV4K 4IJNA 1RTHA 1BG3A 3V4IA 4A5AA 3DMJA 4Y1DA 2G8WA 4WQ4C 1OH7A 4CK2A 4Z4EA 4EAHD 2YKNA 3OS1A 4GKKK 3ZYYX 1CXQA 2F9WA 4CJ7A 1RT3A 1OH5A 3OYAA 3EL2A 4CHZA 4DV7K 4Q0BA 1WSEA 4IOAL 3O4WA 2OA8A 1TK5A 3IDHA 1EETA 3H1VX 4MO4A 4JS5A 3CCVN 3VF6A 4JI2K 3W3DA 1Q9XA 3CCMN 4WFBL 3ATVA 2HHVA 5ELZA 3LM2A 3VQQA 5GINA 4DTOA 3KVGA 2V7ZA 1JXEA 5DMRA 1JLGA 4Z0UA 2IAJA 2GWKA 5C0YA 1RDUA 3V9UA 1EKEA 4B8CA 1K6YA 1I3AA 4J2BA 1GLBG 1E4FT 3WXKA 4JAXA 3DRPA 1YT3A 4JI0K 1QHTA 1J9AA 1QS4A 4M3RA 1NK5A 2Q31A 5KPZA 4DSJA 2UUBK 2HVHA 1ASUA 3JAMO 3ZT0A 3QDKA 2VCPA 3BY5A 3ZSQA 3QO9A 1YXQA 1Q9YA 2CH5A 4DF4A 3L2UA 4H0PA 4DLEA 4CFBA 1NK8A 3H6EA 1QQMA 3FGUA 3AO2A 2OPPA
chains in the Genus database with same CATH topology
2XO7A 3EY1A 2HNDA 3QERA 5J2MA 4I2QA 1D5AA 4BE2A 3TANA 3AVMA 2DY4A 2IC3A 4E89A 1YTAA 4BACA 2PZSA 3SCXA 1WAJA 2B5JA 2P1JA 1CZBA 1HQEA 3U6FA 4FJ7A 4KREA 3QNOA 2KFNA 2GV9A 1UAXA 3IRXA 4UQGA 3NGZA 4I9QA 4FM0A 1C0TA 1WNSA 4KO0A 2VG7A 3WNGA 3OYNA 4LH5A 1L5UA 4EZ6A 1WSJA 2YKMA 4NCAA 3K2PA 3NH0A 1T05A 4BDPA 3SPYA 3PO4A 1KFDA 1VSKA 1W9HA 3NAEA 5J2PA 4ELUA 4KTWA 4RW6A 1Q8IA 4CFDA 1RBUA 1KLNA 1KVCA 3DI6A 3VQ4A 2HVIA 1BCMA 3ISNC 4YNQA 1SL1A 1S1XA 2YNIA 4GVMA 4N5SA 4B9NA 3ASMA 1D8YA 3DOLA 3PO5A 2FC0A 3L3VA 1X1PA 4Q5VA 4DQQA 3HXMA 4F3TA 2IDOA 3ZSZA 2JGUA 2OPRA 1T03A 3P83D 2YNFA 4DTXA 5KTQA 4CEAA 2IS3A 3C94A 4DTMA 4JS4A 3KD1E 4RW7A 3OYBA 4M3WA 4CFAA 1ZYQA 3HYFA 3CM5A 4CGJA 1ITGA 3V6DA 4J2AA 4DSFA 2ATQA 4B9MA 1TK0A 1RT7A 1QE1A 3NF8A 5KI6A 3TWHA 2DTUA 3AVGA 4I9LA 3HVRA 3DLEA 3L8BA 4DS4A 3V81A 4DS5A 4RG8A 1TKDA 3O4NA 1B9DA 4FJKA 3KLFA 3L2VA 1S6QA 1HPZA 4HVJA 3AVKA 4JLHA 5HRPA 4H8KA 1BGXT 2KZZA 4CGDA 3T19A 4B8AB 3PY8A 4LSNA 1SL2A 3OYKA 4CJPA 4IKFA 3QNNA 1IKXA 4PUOA 2B6AA 4FXDA 3RMBA 1B9FA 2Z1GA 1G15A 1RDCA 1MU2A 3C95A 4EZ9A 5I3UA 3M8PA 1HRHA 3DOKA 3QLHA 4FJHA 4KRFA 4N47A 2YHBA 5FDLA 2EHGA 4CESA 1A5WA 1BI4A 1B92A 3UIQA 4HCBA 4B9UA 1L3UA 1TKTA 4J2DA 4OPJA 2YV0X 2A1SA 3VQCA 4AHVA 3SQ2A 4DTJA 5HP1A 4CCHA 1U4BA 1BIZA 3L2WA 3T3FA 4IFYA 4FLVA 3NF7A 3VN5A 3WNEA 2JLEA 4CHNA 1T7PA 3AVHA 5SWMA 1WSHA 4C8KA 1CZ9A 4ELVA 3OYGA 1QTMA 4FJGA 3VA3A 3SNNA 3SUQA 1VSLA 3K5OA 3ZCMA 1C0MA 3U3YA 3LZJA 3TAQA 2G8HA 5KGWA 3OJSA 3KKSA 1VK0A 4FCYA 1SKWA 1KSPA 4AHCA 1IKVA 1RDAA 5CZ1A 1TKXA 3SUPA 3KJVA 1LW0A 2P51A 4KI6A 4E1MA 2KTQA 1TV6A 4DWIA 4DQPA 3KK3A 2PYLA 4FZXC 1JXBA 4NCGA 1BHLA 4Z4CA 4PA1A 3CYMA 1HNIA 2G8KA 4E7IA 4AHUA 3HP9A 1YVUA 5FRNA 1LWEA 4AHTA 2HHSA 1JLCA 3ZSXA 4DQIA 4W5TA 4CF0A 3AV9A 4ZHRA 3I8DA 3OYFA 3JYTA 3HPHA 1F21A 4CF9A 4XIUA 4Z4GA 3S9HA 2GUIA 4GMJB 3OYJA 1HYVA 4I2PA 3VQBA 3LWMA 3MEGA 1LWFA 3VQ9A 1D9FA 3SUOA 2ZE2A 5HRNA 3CFPA 3AA2A 1RT5A 3AA5X 5I42A 3AVIA 3LAKA 1BL3A 3RRHA 2Y1JA 4L8RB 4AHRA 4FVMA 4EP4A 4B3OA 1RNHA 4ZTJA 4OVLA 4FLUA 1ASVA 3AVLA 4K8ZA 3DRRA 2R7YA 3RR7A 1FKOA 1S6PA 4OGCA 4CE9A 4CHOA 3MAQA 5J1EA 3TABA 5K14A 4NCBA 2HNZA 2FBTA 3HJFA 4CJFA 1IKWA 3LALA 4H4OA 1KVBA 2FBYA 4CK1A 1LWCA 2F96A 4DTNA 1U49A 4M3XA 1RBRA 1S9GA 1JKHA 1SV5A 2ETJA 2RPIA 4CF1A 4B9VA 3WNFA 3OYMA 4M3ZA 1IO2A 3OYCA 1U04A 3HM9A 3LANA 2E4LA 4Z4FA 4OKEA 3PX4A 2VWKA 1QSYA 4BDYA 2Q3SA 1ZBUA 4JRPA 1L3SA 4CHPA 3M8SA 3L2RA 4Y1CA 3QEWA 2KZMA 4MQ3A 4E7JA 5SZTA 1JL1A 3CFOA 4AHSA 4CJVA 3L3UA 3S3NA 2O4IA 5FRMA 2QKKA 4OKJA 1NKEA 2I5JA 3RMAA 5CYQA 1RT2A 1RBVA 3HL8A 2BANA 5J2NA 3QEXA 4FJLA 4CEZA 5HRRA 2VWJA 3AO4A 1NJYA 3K5NA 2HB5A 3MXJA 3V9SA 4CECA 1C6VA 3BDPA 2F8SA 1KLMA 3OY9A 4O0JA 1EX4A 4E0DA 4GW6A 3AVAA 1BISA 4CJQA 3P5JA 3LPUA 1JLEA 5JS2A 4CIFA 4YFUA 3ZT2A 3O3HA 4O0IA 1XC9A 1TK8A 3U3GA 1NK0A 4KHWA 4CJUA 1HJRA 5C42A 4IG0A 3SUNA 4KB0A 4W5QA 1TAUA 1SUQA 3DRSA 1UOCA 1RTJA 3AA4A 4KFBA 4CGFA 1XHZA 1C1CA 1TAQA 4AILC 1JLAA 4QCLA 3KK2A 3PX6A 4ID5A 1NK7A 1CLQA 3DYAA 3NGYA 3KLIA 4FJIA 4N76A 3ZSOA 4HUFA 3HK2A 1WN7A 4N41A 1ASWA 4CGHA 3ZT1A 3LPTA 2QK9A 1TVRA 3O3FA 3NH1A 3H08A 3BGRA 4CEEA 5KRSA 3SQ0A 3THVA 1ZBIA 2HW3A 2D0CA 2HHWA 4E1NA 3D0PA 1U45A 3KLHA 1HQUA 3VQ5A 4DLGA 4FJ5A 1RDBA 2NUBA 2RKIA 3AO5A 1IKYA 3I0SA 2KFZA 2G8FA 3QIPA 3HVTA 2A1RA 3T1AA 3V1QA 1NK6A 5CY4A 4O5BA 3G0ZA 3DLRA 4DTSA 4C8MA 1KCFA 1NKCA 3D45A 3O4QA 2IOCA 3KIOA 4FJ8A 3LP0A 3NFAA 4CGGA 4R5PA 1VSEA 4LD0A 2FBXA 3I0RA 4MFBA 3SI6A 2QKBA 4CIEA 4OPKA 4OLAA 4DSIA 1BQNA 2Y1IA 2WOMA 1A5XA 4KHQA 2G8IA 4RW9A 3VQ6A 4HTUA 4FYDA 2KW4A 1SKRA 3FFIA 4ICLA 2EX3A 1HYSA 3QIOA 3SV4A 4CJWA 1D9DA 3KTQA 4W5OA 3DLBA 3HT3A 3CM6A 3JSMA 1XWLA 1CXUA 2XY7A 4KHSA 1JLFA 4CJKA 3ULDA 1KTQA 4CJRA 4KHUA 4TSXA 4DQSA 1LAWA 1LV5A 4CJ5A 2D5RA 3KK1A 4PWDA 4KI4A 3NF9A 4IG3A 1XI1A 5KGXA 1J53A 2FBVA 4CJ3A 1WAFA 1EXQA 1O1WA 5C25A 1NK4A 4FK0A 2X6SA 4FZZA 1YTUA 4CIGA 3PV8A 4Z4IA 2DFFA 5DK5A 2X6NA 4NYFA 3VQAA 1FXXA 4HUEA 3KLGA 3TAFA 1TKZA 4KHYA 1NKBA 4M45A 4B08A 4E7HA 4C8LA 3LZIA 4LH4A 2O4GA 4DMNA 1FKPA 4FJMA 1UWBA 3OVNA 3SQ4A 1X9WA 3S3OA 1RBSA 2D0AA 3M8QA 1NK9A 3C6TA 2XY8A 1ZBLA 3QEPA 1RBTA 2W42A 5E41A 2GBZA 4O44A 1DLOA 3NCIA 2DFEA 3K59A 4FM2A 4DQRA 1RILA 4BWJA 1S5JA 4WE1A 2HHXA 4QAGA 4F2SA 1WSGA 1HYZA 1VSFA 1WSFA 4DFJA 4KB1A 3ZSVA 3OYHA 3ZT3A 3NH2A 2F8TA 3SZ2A 2D0BA 3V9ZA 2XY5A 1S1WA 1KVAA 3K58A 1RCHA 3QEIA 1BI4B 4M3UA 3PX0A 5JS1A 4CK3A 3NDKA 2PY5A 4H4MA 3TAEA 4KAZA 3F9KA 4E3SA 1R0AA 1C1AA 4KV8A 1L3VA 1DTTA 1U47A 4FK4A 1VSIA 2OZSA 3CG7A 4C8NA 4N56A 4ELTA 1SKSA 3VQ8A 4F2RA 4RW4A 4J2EA 1RT1A 2LSNA 2HHTA 2VG5A 3AA3A 3HO1A 4CEFA 3NE6A 1DTQA 1VRUA 3AO3A 3TR8A 3LP2A 1NOYA 4E7LA 4LY7A 3IS9A 3VQEA 4OLBA 1NOZA 4G1QA 4CEOA 1XHXA 3MECA 1VSJA 4CGIA 1LAVA 3AVCA 4EP5A 4DFPA 5HLFA 3E01A 4FJNA 1ZBFA 3RR8A 3SV3A 4F3OA 3CFRA 4JRQA 4DTUA 1J5OA 1QSSA 2P5GA 1NJZA 4CJLA 4M3YA 4FJXA 4I7FA 1X9MA 4PY5A 2OPSA 3HP6A 2ITGA 4M42A 5CYMA 5C24A 3KLEA 1I39A 3A2FA 3ZSWA 4CHYA 2HHUA 1JL2A 1W0HA 2BDPA 3WNHA 3OS2A 4FLZA 4FZYA 1TL3A 4FK2A 3TAGA 4DSEA 4FJJA 4BWMA 1WSIA 5D3GA 3OYLA 3L2QA 3VQ7A 4B9TA 1L3TA 4O55A 5T7BA 1C0UA 3IG1A 3V9WA 3SJJA 2G8VA 4CJSA 3S3MA 3DM2A 1BIUA 3OYDA 4FLXA 3ITHA 2B4JA 3CQ8A 3SYZA 4CFCA 3QESA 4QOZB 4CEDA 4FJ9A 1GOCA 1RTIA 4AH9A 5CZ2A 1RTDA 4F4KA 3VQPA 3B6OA 4CF2A 2KQ2A 3LWLA 3LDSA 4IDKA 4DU4A 2VG6A 2BE2A 4OJRA 3EYZA 3PUFA 4DTPA 4M41A 2DFHA 5FROA 4DF8A 1X9SA 2WONA 2AJQA 4KPYA 1JLQA 2HMIA 1GOAA 3V9XA 2HHQA 5KRTA 3LP3A 1FK9A 4BE1A 4DTRA 3TI0A 4PQUA 1IH7A 3ALYA 3K5LA 4KTQA 2G8UA 3DLGA 4HUGA 4DSKA 4K8XA 4ID1A 3AVFA 3F73A 4O4GA 3M8RA 4W5NA 1GOBA 1HMVA 2ZD1A 3NGIA 2Z1JA 4E7KA 2OYQA 3KD5E 3NF6A 1UA0A 4CEBA 1U48A 4NYNA 3NHGA 4BDZA 3HPOA 3LAMA 4FLWA 4FW1A 3OS0A 3RRGA 1RTHA 3V4IA 2X74A 3LP1A 4FW2A 4FM1A 3DMJA 4Y1DA 1N6QA 2G8WA 4F8RA 1HNVA 4KHNA 1UA1A 1VSHA 3SPZA 3AVBA 2XHBA 4IBNA 2RF2A 4OKKA 1S1TA 4CK2A 3ZSYA 3K57A 4Z4EA 1LW2A 2YKNA 3OS1A 1BCOA 4C8OA 1CXQA 2ZQBA 3MXIA 3G10A 4CJTA 5HROA 1RT3A 3OYAA 3TARA 2Z1HA 2YNHA 2OPQA 4CHZA 4Q0BA 3RMDA 1JLBA 3RWUA 1WSEA 1VSDA 1REVA 2E6MA 4OGEA 1VRTA 2OA8A 1J54A 3QEVA 4DSLA 1QSLA 2QXFA 2HNYA 3VQDA 1TK5A 3SQ1A 1IG9A 1EETA 3HSTB 4CERA 3MEDA 3EZ5A 1BQMA 4JS5A 5J2QA 2E6LA 3TAMA 3TAPA 4FLTA 4B9SA 4CHQA 1Q9XA 1QQCA 4DU1A 1TL1A 2XRIA 2Z1IA 2HHVA 2YHAA 3AO1A 1Z26A 3AVNA 3VQQA 4DTOA 1RDDA 1C1BA 2XY6A 3IAYA 1JXEA 5DMRA 1RT6A 3DLKA 4CF8A 1WLJA 1JLGA 4Z0UA 3KKRA 1S9EA 2IAJA 3HPGA 5EU7A 3V9UA 1EKEA 3RTVA 4CEQA 1ZBHA 1EP4A 3V1OA 4B8CA 4KTZA 2P5OA 3QINA 1K6YA 1Z25A 4DG1A 4HHTA 4HCCA 1I3AA 4J2BA 4KKOA 3RMCA 3V1RA 1A5VA 2PYJA 5HBMA 4CJ4A 3OJUA 4DFKA 1N5YA 3ZT4A 4M3TA 3AVJA 3OYIA 1T8EA 3VA0A 5HRSA 3OYEA 2X78A 3DRPA 1YT3A 3ZSRA 3QETA 3MXMA 1TGOA 1QHTA 1S1VA 1NJXA 1SL0A 3MEEA 1J9AA 1QS4A 3DLHA 4W5RA 4M3RA 1NK5A 1S1UA 2BGGA 1KFSA 2RN2A 1NJWA 4DSJA 3C6UA 3K5MA 1VSMA 2YNGA 1Y97A 2OZMA 2HVHA 1ASUA 3ZT0A 4E19A 4IFVA 4BE0A 4B9LA 3ZSQA 3QO9A 1Q9YA 3O3GA 4RW8A 3NBPA 4CJEA 4FLYA 4DF4A 2IGIA 3L2UA 4Z4HA 4DFMA 1RT4A 4DLEA 4CFBA 1NK8A 4LSLA 3B6PA 1KRPA 4DU3A 3AO2A 4ZTFA 3P1GA 2OPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XO7 A;  3EY1 A;  2HND A;  3QER A;  5J2M A;  4I2Q A;  1D5A A;  4BE2 A;  3TAN A;  3AVM A;  2DY4 A;  2IC3 A;  4E89 A;  1YTA A;  4BAC A;  2PZS A;  3SCX A;  1WAJ A;  2B5J A;  2P1J A;  1CZB A;  1HQE A;  3U6F A;  4FJ7 A;  4KRE A;  3QNO A;  2KFN A;  2GV9 A;  1UAX A;  3IRX A;  4UQG A;  3NGZ A;  4I9Q A;  4FM0 A;  1C0T A;  1WNS A;  4KO0 A;  2VG7 A;  3WNG A;  3OYN A;  4LH5 A;  1L5U A;  4EZ6 A;  1WSJ A;  2YKM A;  4NCA A;  3K2P A;  3NH0 A;  1T05 A;  4BDP A;  3SPY A;  3PO4 A;  1KFD A;  1VSK A;  1W9H A;  3NAE A;  5J2P A;  4ELU A;  4KTW A;  4RW6 A;  1Q8I A;  4CFD A;  1RBU A;  1KLN A;  1KVC A;  3DI6 A;  3VQ4 A;  2HVI A;  1BCM A;  3ISN C;  4YNQ A;  1SL1 A;  1S1X A;  2YNI A;  4GVM A;  4N5S A;  4B9N A;  3ASM A;  1D8Y A;  3DOL A;  3PO5 A;  2FC0 A;  3L3V A;  1X1P A;  4Q5V A;  4DQQ A;  3HXM A;  4F3T A;  2IDO A;  3ZSZ A;  2JGU A;  2OPR A;  1T03 A;  3P83 D;  2YNF A;  4DTX A;  5KTQ A;  4CEA A;  2IS3 A;  3C94 A;  4DTM A;  4JS4 A;  3KD1 E;  4RW7 A;  3OYB A;  4M3W A;  4CFA A;  1ZYQ A;  3HYF A;  3CM5 A;  4CGJ A;  1ITG A;  3V6D A;  4J2A A;  4DSF A;  2ATQ A;  4B9M A;  1TK0 A;  1RT7 A;  1QE1 A;  3NF8 A;  5KI6 A;  3TWH A;  2DTU A;  3AVG A;  4I9L A;  3HVR A;  3DLE A;  3L8B A;  4DS4 A;  3V81 A;  4DS5 A;  4RG8 A;  1TKD A;  3O4N A;  1B9D A;  4FJK A;  3KLF A;  3L2V A;  1S6Q A;  1HPZ A;  4HVJ A;  3AVK A;  4JLH A;  5HRP A;  4H8K A;  1BGX T;  2KZZ A;  4CGD A;  3T19 A;  4B8A B;  3PY8 A;  4LSN A;  1SL2 A;  3OYK A;  4CJP A;  4IKF A;  3QNN A;  1IKX A;  4PUO A;  2B6A A;  4FXD A;  3RMB A;  1B9F A;  2Z1G A;  1G15 A;  1RDC A;  1MU2 A;  3C95 A;  4EZ9 A;  5I3U A;  3M8P A;  1HRH A;  3DOK A;  3QLH A;  4FJH A;  4KRF A;  4N47 A;  2YHB A;  5FDL A;  2EHG A;  4CES A;  1A5W A;  1BI4 A;  1B92 A;  3UIQ A;  4HCB A;  4B9U A;  1L3U A;  1TKT A;  4J2D A;  4OPJ A;  2YV0 X;  2A1S A;  3VQC A;  4AHV A;  3SQ2 A;  4DTJ A;  5HP1 A;  4CCH A;  1U4B A;  1BIZ A;  3L2W A;  3T3F A;  4IFY A;  4FLV A;  3NF7 A;  3VN5 A;  3WNE A;  2JLE A;  4CHN A;  1T7P A;  3AVH A;  5SWM A;  1WSH A;  4C8K A;  1CZ9 A;  4ELV A;  3OYG A;  1QTM A;  4FJG A;  3VA3 A;  3SNN A;  3SUQ A;  1VSL A;  3K5O A;  3ZCM A;  1C0M A;  3U3Y A;  3LZJ A;  3TAQ A;  2G8H A;  5KGW A;  3OJS A;  3KKS A;  1VK0 A;  4FCY A;  1SKW A;  1KSP A;  4AHC A;  1IKV A;  1RDA A;  5CZ1 A;  1TKX A;  3SUP A;  3KJV A;  1LW0 A;  2P51 A;  4KI6 A;  4E1M A;  2KTQ A;  1TV6 A;  4DWI A;  4DQP A;  3KK3 A;  2PYL A;  4FZX C;  1JXB A;  4NCG A;  1BHL A;  4Z4C A;  4PA1 A;  3CYM A;  1HNI A;  2G8K A;  4E7I A;  4AHU A;  3HP9 A;  1YVU A;  5FRN A;  1LWE A;  4AHT A;  2HHS A;  1JLC A;  3ZSX A;  4DQI A;  4W5T A;  4CF0 A;  3AV9 A;  4ZHR A;  3I8D A;  3OYF A;  3JYT A;  3HPH A;  1F21 A;  4CF9 A;  4XIU A;  4Z4G A;  3S9H A;  2GUI A;  4GMJ B;  3OYJ A;  1HYV A;  4I2P A;  3VQB A;  3LWM A;  3MEG A;  1LWF A;  3VQ9 A;  1D9F A;  3SUO A;  2ZE2 A;  5HRN A;  3CFP A;  3AA2 A;  1RT5 A;  3AA5 X;  5I42 A;  3AVI A;  3LAK A;  1BL3 A;  3RRH A;  2Y1J A;  4L8R B;  4AHR A;  4FVM A;  4EP4 A;  4B3O A;  1RNH A;  4ZTJ A;  4OVL A;  4FLU A;  1ASV A;  3AVL A;  4K8Z A;  3DRR A;  2R7Y A;  3RR7 A;  1FKO A;  1S6P A;  4OGC A;  4CE9 A;  4CHO A;  3MAQ A;  5J1E A;  3TAB A;  5K14 A;  4NCB A;  2HNZ A;  2FBT A;  3HJF A;  4CJF A;  1IKW A;  3LAL A;  4H4O A;  1KVB A;  2FBY A;  4CK1 A;  1LWC A;  2F96 A;  4DTN A;  1U49 A;  4M3X A;  1RBR A;  1S9G A;  1JKH A;  1SV5 A;  2ETJ A;  2RPI A;  4CF1 A;  4B9V A;  3WNF A;  3OYM A;  4M3Z A;  1IO2 A;  3OYC A;  1U04 A;  3HM9 A;  3LAN A;  2E4L A;  4Z4F A;  4OKE A;  3PX4 A;  2VWK A;  1QSY A;  4BDY A;  2Q3S A;  1ZBU A;  4JRP A;  1L3S A;  4CHP A;  3M8S A;  3L2R A;  4Y1C A;  3QEW A;  2KZM A;  4MQ3 A;  4E7J A;  5SZT A;  1JL1 A;  3CFO A;  4AHS A;  4CJV A;  3L3U A;  3S3N A;  2O4I A;  5FRM A;  2QKK A;  4OKJ A;  1NKE A;  2I5J A;  3RMA A;  5CYQ A;  1RT2 A;  1RBV A;  3HL8 A;  2BAN A;  5J2N A;  3QEX A;  4FJL A;  4CEZ A;  5HRR A;  2VWJ A;  3AO4 A;  1NJY A;  3K5N A;  2HB5 A;  3MXJ A;  3V9S A;  4CEC A;  1C6V A;  3BDP A;  2F8S A;  1KLM A;  3OY9 A;  4O0J A;  1EX4 A;  4E0D A;  4GW6 A;  3AVA A;  1BIS A;  4CJQ A;  3P5J A;  3LPU A;  1JLE A;  5JS2 A;  4CIF A;  4YFU A;  3ZT2 A;  3O3H A;  4O0I A;  1XC9 A;  1TK8 A;  3U3G A;  1NK0 A;  4KHW A;  4CJU A;  1HJR A;  5C42 A;  4IG0 A;  3SUN A;  4KB0 A;  4W5Q A;  1TAU A;  1SUQ A;  3DRS A;  1UOC A;  1RTJ A;  3AA4 A;  4KFB A;  4CGF A;  1XHZ A;  1C1C A;  1TAQ A;  4AIL C;  1JLA A;  4QCL A;  3KK2 A;  3PX6 A;  4ID5 A;  1NK7 A;  1CLQ A;  3DYA A;  3NGY A;  3KLI A;  4FJI A;  4N76 A;  3ZSO A;  4HUF A;  3HK2 A;  1WN7 A;  4N41 A;  1ASW A;  4CGH A;  3ZT1 A;  3LPT A;  2QK9 A;  1TVR A;  3O3F A;  3NH1 A;  3H08 A;  3BGR A;  4CEE A;  5KRS A;  3SQ0 A;  3THV A;  1ZBI A;  2HW3 A;  2D0C A;  2HHW A;  4E1N A;  3D0P A;  1U45 A;  3KLH A;  1HQU A;  3VQ5 A;  4DLG A;  4FJ5 A;  1RDB A;  2NUB A;  2RKI A;  3AO5 A;  1IKY A;  3I0S A;  2KFZ A;  2G8F A;  3QIP A;  3HVT A;  2A1R A;  3T1A A;  3V1Q A;  1NK6 A;  5CY4 A;  4O5B A;  3G0Z A;  3DLR A;  4DTS A;  4C8M A;  1KCF A;  1NKC A;  3D45 A;  3O4Q A;  2IOC A;  3KIO A;  4FJ8 A;  3LP0 A;  3NFA A;  4CGG A;  4R5P A;  1VSE A;  4LD0 A;  2FBX A;  3I0R A;  4MFB A;  3SI6 A;  2QKB A;  4CIE A;  4OPK A;  4OLA A;  4DSI A;  1BQN A;  2Y1I A;  2WOM A;  1A5X A;  4KHQ A;  2G8I A;  4RW9 A;  3VQ6 A;  4HTU A;  4FYD A;  2KW4 A;  1SKR A;  3FFI A;  4ICL A;  2EX3 A;  1HYS A;  3QIO A;  3SV4 A;  4CJW A;  1D9D A;  3KTQ A;  4W5O A;  3DLB A;  3HT3 A;  3CM6 A;  3JSM A;  1XWL A;  1CXU A;  2XY7 A;  4KHS A;  1JLF A;  4CJK A;  3ULD A;  1KTQ A;  4CJR A;  4KHU A;  4TSX A;  4DQS A;  1LAW A;  1LV5 A;  4CJ5 A;  2D5R A;  3KK1 A;  4PWD A;  4KI4 A;  3NF9 A;  4IG3 A;  1XI1 A;  5KGX A;  1J53 A;  2FBV A;  4CJ3 A;  1WAF A;  1EXQ A;  1O1W A;  5C25 A;  1NK4 A;  4FK0 A;  2X6S A;  4FZZ A;  1YTU A;  4CIG A;  3PV8 A;  4Z4I A;  2DFF A;  5DK5 A;  2X6N A;  4NYF A;  3VQA A;  1FXX A;  4HUE A;  3KLG A;  3TAF A;  1TKZ A;  4KHY A;  1NKB A;  4M45 A;  4B08 A;  4E7H A;  4C8L A;  3LZI A;  4LH4 A;  2O4G A;  4DMN A;  1FKP A;  4FJM A;  1UWB A;  3OVN A;  3SQ4 A;  1X9W A;  3S3O A;  1RBS A;  2D0A A;  3M8Q A;  1NK9 A;  3C6T A;  2XY8 A;  1ZBL A;  3QEP A;  1RBT A;  2W42 A;  5E41 A;  2GBZ A;  4O44 A;  1DLO A;  3NCI A;  2DFE A;  3K59 A;  4FM2 A;  4DQR A;  1RIL A;  4BWJ A;  1S5J A;  4WE1 A;  2HHX A;  4QAG A;  4F2S A;  1WSG A;  1HYZ A;  1VSF A;  1WSF A;  4DFJ A;  4KB1 A;  3ZSV A;  3OYH A;  3ZT3 A;  3NH2 A;  2F8T A;  3SZ2 A;  2D0B A;  3V9Z A;  2XY5 A;  1S1W A;  1KVA A;  3K58 A;  1RCH A;  3QEI A;  1BI4 B;  4M3U A;  3PX0 A;  5JS1 A;  4CK3 A;  3NDK A;  2PY5 A;  4H4M A;  3TAE A;  4KAZ A;  3F9K A;  4E3S A;  1R0A A;  1C1A A;  4KV8 A;  1L3V A;  1DTT A;  1U47 A;  4FK4 A;  1VSI A;  2OZS A;  3CG7 A;  4C8N A;  4N56 A;  4ELT A;  1SKS A;  3VQ8 A;  4F2R A;  4RW4 A;  4J2E A;  1RT1 A;  2LSN A;  2HHT A;  2VG5 A;  3AA3 A;  3HO1 A;  4CEF A;  3NE6 A;  1DTQ A;  1VRU A;  3AO3 A;  3TR8 A;  3LP2 A;  1NOY A;  4E7L A;  4LY7 A;  3IS9 A;  3VQE A;  4OLB A;  1NOZ A;  4G1Q A;  4CEO A;  1XHX A;  3MEC A;  1VSJ A;  4CGI A;  1LAV A;  3AVC A;  4EP5 A;  4DFP A;  5HLF A;  3E01 A;  4FJN A;  1ZBF A;  3RR8 A;  3SV3 A;  4F3O A;  3CFR A;  4JRQ A;  4DTU A;  1J5O A;  1QSS A;  2P5G A;  1NJZ A;  4CJL A;  4M3Y A;  4FJX A;  4I7F A;  1X9M A;  4PY5 A;  2OPS A;  3HP6 A;  2ITG A;  4M42 A;  5CYM A;  5C24 A;  3KLE A;  1I39 A;  3A2F A;  3ZSW A;  4CHY A;  2HHU A;  1JL2 A;  1W0H A;  2BDP A;  3WNH A;  3OS2 A;  4FLZ A;  4FZY A;  1TL3 A;  4FK2 A;  3TAG A;  4DSE A;  4FJJ A;  4BWM A;  1WSI A;  5D3G A;  3OYL A;  3L2Q A;  3VQ7 A;  4B9T A;  1L3T A;  4O55 A;  5T7B A;  1C0U A;  3IG1 A;  3V9W A;  3SJJ A;  2G8V A;  4CJS A;  3S3M A;  3DM2 A;  1BIU A;  3OYD A;  4FLX A;  3ITH A;  2B4J A;  3CQ8 A;  3SYZ A;  4CFC A;  3QES A;  4QOZ B;  4CED A;  4FJ9 A;  1GOC A;  1RTI A;  4AH9 A;  5CZ2 A;  1RTD A;  4F4K A;  3VQP A;  3B6O A;  4CF2 A;  2KQ2 A;  3LWL A;  3LDS A;  4IDK A;  4DU4 A;  2VG6 A;  2BE2 A;  4OJR A;  3EYZ A;  3PUF A;  4DTP A;  4M41 A;  2DFH A;  5FRO A;  4DF8 A;  1X9S A;  2WON A;  2AJQ A;  4KPY A;  1JLQ A;  2HMI A;  1GOA A;  3V9X A;  2HHQ A;  5KRT A;  3LP3 A;  1FK9 A;  4BE1 A;  4DTR A;  3TI0 A;  4PQU A;  1IH7 A;  3ALY A;  3K5L A;  4KTQ A;  2G8U A;  3DLG A;  4HUG A;  4DSK A;  4K8X A;  4ID1 A;  3AVF A;  3F73 A;  4O4G A;  3M8R A;  4W5N A;  1GOB A;  1HMV A;  2ZD1 A;  3NGI A;  2Z1J A;  4E7K A;  2OYQ A;  3KD5 E;  3NF6 A;  1UA0 A;  4CEB A;  1U48 A;  4NYN A;  3NHG A;  4BDZ A;  3HPO A;  3LAM A;  4FLW A;  4FW1 A;  3OS0 A;  3RRG A;  1RTH A;  3V4I A;  2X74 A;  3LP1 A;  4FW2 A;  4FM1 A;  3DMJ A;  4Y1D A;  1N6Q A;  2G8W A;  4F8R A;  1HNV A;  4KHN A;  1UA1 A;  1VSH A;  3SPZ A;  3AVB A;  2XHB A;  4IBN A;  2RF2 A;  4OKK A;  1S1T A;  4CK2 A;  3ZSY A;  3K57 A;  4Z4E A;  1LW2 A;  2YKN A;  3OS1 A;  1BCO A;  4C8O A;  1CXQ A;  2ZQB A;  3MXI A;  3G10 A;  4CJT A;  5HRO A;  1RT3 A;  3OYA A;  3TAR A;  2Z1H A;  2YNH A;  2OPQ A;  4CHZ A;  4Q0B A;  3RMD A;  1JLB A;  3RWU A;  1WSE A;  1VSD A;  1REV A;  2E6M A;  4OGE A;  1VRT A;  2OA8 A;  1J54 A;  3QEV A;  4DSL A;  1QSL A;  2QXF A;  2HNY A;  3VQD A;  1TK5 A;  3SQ1 A;  1IG9 A;  1EET A;  3HST B;  4CER A;  3MED A;  3EZ5 A;  1BQM A;  4JS5 A;  5J2Q A;  2E6L A;  3TAM A;  3TAP A;  4FLT A;  4B9S A;  4CHQ A;  1Q9X A;  1QQC A;  4DU1 A;  1TL1 A;  2XRI A;  2Z1I A;  2HHV A;  2YHA A;  3AO1 A;  1Z26 A;  3AVN A;  3VQQ A;  4DTO A;  1RDD A;  1C1B A;  2XY6 A;  3IAY A;  1JXE A;  5DMR A;  1RT6 A;  3DLK A;  4CF8 A;  1WLJ A;  1JLG A;  4Z0U A;  3KKR A;  1S9E A;  2IAJ A;  3HPG A;  5EU7 A;  3V9U A;  1EKE A;  3RTV A;  4CEQ A;  1ZBH A;  1EP4 A;  3V1O A;  4B8C A;  4KTZ A;  2P5O A;  3QIN A;  1K6Y A;  1Z25 A;  4DG1 A;  4HHT A;  4HCC A;  1I3A A;  4J2B A;  4KKO A;  3RMC A;  3V1R A;  1A5V A;  2PYJ A;  5HBM A;  4CJ4 A;  3OJU A;  4DFK A;  1N5Y A;  3ZT4 A;  4M3T A;  3AVJ A;  3OYI A;  1T8E A;  3VA0 A;  5HRS A;  3OYE A;  2X78 A;  3DRP A;  1YT3 A;  3ZSR A;  3QET A;  3MXM A;  1TGO A;  1QHT A;  1S1V A;  1NJX A;  1SL0 A;  3MEE A;  1J9A A;  1QS4 A;  3DLH A;  4W5R A;  4M3R A;  1NK5 A;  1S1U A;  2BGG A;  1KFS A;  2RN2 A;  1NJW A;  4DSJ A;  3C6U A;  3K5M A;  1VSM A;  2YNG A;  1Y97 A;  2OZM A;  2HVH A;  1ASU A;  3ZT0 A;  4E19 A;  4IFV A;  4BE0 A;  4B9L A;  3ZSQ A;  3QO9 A;  1Q9Y A;  3O3G A;  4RW8 A;  3NBP A;  4CJE A;  4FLY A;  4DF4 A;  2IGI A;  3L2U A;  4Z4H A;  4DFM A;  1RT4 A;  4DLE A;  4CFB A;  1NK8 A;  4LSL A;  3B6P A;  1KRP A;  4DU3 A;  3AO2 A;  4ZTF A;  3P1G A;  2OPP A; 
#chains in the Genus database with same CATH topology
 4BR9 A;  1M90 O;  2HND A;  3AVM A;  3O6W A;  3MN9 A;  3SCX A;  4BR7 A;  4FJ7 A;  3QNO A;  4UQG A;  3NGZ A;  1C0T A;  1WNS A;  3QBW A;  3RSE A;  3A5M C;  4BDP A;  1KFD A;  1W9H A;  3F5T A;  2IVP A;  5J2P A;  4RW6 A;  4CFD A;  4YNQ A;  3ISN C;  5C2F A;  4KHP K;  1SL1 A;  4WQ4 A;  3ASM A;  1KQS M;  1D8Y A;  3K9K A;  3CER A;  4Q5V A;  1X1P A;  4CW7 B;  3HXM A;  1HKG A;  2QWR A;  3BZC A;  3VGK A;  2IS3 A;  2QW9 A;  3C94 A;  2ZGZ A;  4NLC A;  4CI6 A;  4RW7 A;  3OYB A;  4JS4 A;  3KD1 E;  1ZYQ A;  3HYF A;  3CM5 A;  4CGJ A;  4A2B A;  2Q97 A;  1RT7 A;  1QE1 A;  3TWH A;  3AVG A;  4EIA A;  1T44 A;  4CZE A;  1W2B M;  4DS4 A;  3I33 A;  4B1W B;  3TTD A;  4FO0 A;  1B9D A;  4FJK A;  1HPZ A;  2O8C A;  3BUZ B;  1BGX T;  4B8A B;  4JI5 K;  2ZJR L;  3OYK A;  2YHY A;  1IKX A;  2B6A A;  2Z1G A;  3CJ9 A;  4DQ8 A;  5I3U A;  1U6Z A;  3MX2 A;  3M8P A;  4N47 A;  5FDL A;  4BQZ A;  4HCB A;  3B8A X;  4OX9 K;  3ZEU A;  2PAV A;  2UXD K;  4DV3 K;  5F2R A;  1U4B A;  1BIZ A;  4IFY A;  3NF7 A;  3RSE B;  3WQT A;  3WNE A;  1WSH A;  4YOX A;  1CZ9 A;  4C8K A;  3SUQ A;  3U3Y A;  3ZCM A;  3LZJ A;  3KKS A;  1VK0 A;  4KH4 A;  1IKV A;  5CZ1 A;  4DWI A;  3WXL A;  3KK3 A;  4NCG A;  3UE5 A;  5F0X A;  2ZGY A;  3CYM A;  3D6R A;  1YVU A;  2P9K A;  3AY9 A;  5FRN A;  3AAQ A;  1D4X A;  4CF0 A;  3AV9 A;  3I8D A;  2WC9 A;  1YIT N;  1BDG A;  3S9H A;  4GMJ B;  2GX9 A;  3LWM A;  4DR6 K;  4B3M K;  3K9J A;  4JN4 A;  4NO7 A;  5BRE A;  4LF6 K;  2O8C B;  1HJO A;  4YOY A;  5BRF A;  1HLU A;  4FLU A;  1N32 K;  3SMP A;  4JKB A;  4XH1 A;  4CHO A;  3T7Z A;  5J1E A;  3MAQ A;  2VYP A;  2HNZ A;  1X9J A;  4IDH A;  2J4R A;  2F96 A;  4M3X A;  1EO1 A;  4H0O A;  4QS8 A;  1S9G A;  1JKH A;  1Z05 A;  3R6M A;  3WNF A;  4M3Z A;  4M7Y A;  5BN8 A;  3LAN A;  4DV1 K;  1L3S A;  3HOT A;  3L2R A;  3QEW A;  2NRT A;  1YJN N;  1OVQ A;  3HSC A;  3U4L A;  2HBJ A;  1JL1 A;  4AHS A;  2IVO A;  2I5J A;  1RBV A;  4FJL A;  3H45 C;  3CET A;  1YI2 N;  2HB5 A;  5AQU A;  4KH6 A;  3HM8 A;  5AQX A;  4FWR A;  2CH6 A;  1EX4 A;  4O0J A;  5AQS A;  3AVA A;  1BA0 A;  3P5J A;  5JS2 A;  3O3H A;  3PSI A;  1NK0 A;  1OKJ A;  4PKG A;  1TK8 A;  4CJU A;  5C42 A;  1P8Z A;  3UKR A;  3SLC A;  1SUQ A;  3DRS A;  1NWK A;  2VQE K;  1TAQ A;  3WXJ A;  4CZK A;  5LJV A;  3PX6 A;  4QS7 A;  2OTL N;  3KLI A;  4N76 A;  3HK2 A;  3ZSO A;  1WN7 A;  1KAZ A;  2F4V K;  1MWK A;  3I56 N;  1MA9 B;  3SAH A;  4UY8 O;  4H5R A;  3CJ7 A;  4E1N A;  3QML A;  3KLH A;  3VQ5 A;  4PKI A;  4JK8 A;  2QWN A;  2HF3 A;  3AO5 A;  1IKY A;  2KFZ A;  2QWM A;  1KAY A;  3L4I A;  3G0Z A;  4DTS A;  4C8M A;  3KZB A;  3LM9 A;  3VES A;  3D45 A;  3FFK B;  3O4Q A;  5LJW A;  3VGM A;  4U67 L;  2P9U B;  4PL8 A;  1GLJ O;  4H5N A;  3SI6 A;  4OLA A;  4DR7 K;  4DSI A;  1S22 A;  2G8I A;  3VQ6 A;  1QHA A;  2FF3 B;  4DV0 K;  3THY B;  3SV4 A;  3O9R A;  4CJW A;  2NZT A;  2AP1 A;  3JSM A;  3A5O C;  1XWL A;  4ISF A;  1NGF A;  4KHU A;  2HBL A;  1LV5 A;  4CJ5 A;  1ZC6 A;  4K25 A;  4PWD A;  3VEN A;  5KGX A;  4FJ8 A;  4CJ3 A;  4FK0 A;  3UKR B;  2X6S A;  3MCP A;  3M5R A;  2DFF A;  3GDQ A;  5DK5 A;  2QA4 N;  3TAF A;  3KLG A;  1E4G T;  1TKZ A;  2W41 A;  4B08 A;  2ASO A;  4C8L A;  5C2D A;  4LH4 A;  5AFU H;  1SZ2 A;  4CBW A;  3GL1 A;  1NK9 A;  3C6T A;  2GBZ A;  3QEX A;  4WE1 A;  1HYZ A;  3R1X A;  1TUU A;  3NH2 A;  3SZ2 A;  3V9Z A;  3THX A;  3E9O A;  2NRV A;  5AQH A;  1BI4 B;  3LDQ A;  3PX0 A;  3NDK A;  2PY5 A;  4H0V B;  5BRH A;  1WUA A;  4KV8 A;  1U47 A;  1SQK A;  3WT0 A;  4C8N A;  4F2R A;  3Q7C A;  5LL6 Z;  2LSN A;  1NOY A;  3TR8 A;  4YY3 K;  1NGG A;  5BPN A;  1SAZ A;  4JEP A;  3RR8 A;  4DR4 K;  4JI1 K;  1J5O A;  1TUY A;  3FE1 A;  1HKC A;  4BRI A;  3HP6 A;  4I6M A;  3CI5 A;  4M42 A;  5CYM A;  1HNW K;  4FWO A;  3ZSW A;  4CHY A;  4BRO A;  3OA9 A;  1W0H A;  2F7T A;  2BDP A;  4FLZ A;  1TL3 A;  3VEV A;  2GTD A;  4BWM A;  1WSI A;  4JK7 A;  3VQ7 A;  4B9T A;  1X3N A;  2HBM A;  1BOT O;  3S3M A;  3ITH A;  4E1J A;  1ATR A;  2BH1 A;  4CED A;  1XMQ K;  5AZJ B;  3ZX3 A;  1RTD A;  4IEE A;  2VG6 A;  4OJR A;  1IG8 A;  2HW3 A;  1K8A O;  2AJQ A;  5FRO A;  4BVP A;  4M63 C;  5CR4 A;  2YX6 A;  3LP3 A;  3TI0 A;  4PQU A;  3ALY A;  3K5L A;  4A62 A;  4CBU A;  3DLG A;  3BEX A;  4M7X A;  3F73 A;  4E7K A;  4EHU A;  5EX5 A;  3NF6 A;  3HOS A;  1UA0 A;  1U48 A;  4C23 A;  1Q82 O;  3OS0 A;  3RRG A;  2X74 A;  4FW2 A;  1GLC G;  4BRC A;  4CZI A;  2E2N A;  2VQF K;  4FM1 A;  4KHN A;  1VSH A;  2XHB A;  4OKK A;  3K57 A;  4C8O A;  2ZQB A;  4H5T A;  3G10 A;  1VQO N;  4AQY K;  4I6M B;  3RMD A;  1REV A;  2E6M A;  5M1K A;  4DSL A;  1J54 A;  3QEV A;  2QXF A;  3VQD A;  5CHI A;  1IG9 A;  4CD3 A;  4CER A;  1S3X A;  2QWP A;  3TAP A;  4FLT A;  3R8E A;  1QQC A;  1TL1 A;  1ATN A;  1YHQ N;  3CPE A;  1C1B A;  2XY6 A;  3IAY A;  4JI7 K;  2RE2 A;  3QB0 A;  1WLJ A;  1S9E A;  3HPG A;  5EU7 A;  4B9Q A;  3RTV A;  1EP4 A;  1VQ6 N;  4NLB A;  3C6H A;  2P5O A;  4DG1 A;  1DT9 A;  4KKO A;  3RMC A;  4BR2 A;  1QZ5 A;  1JCG A;  3QFP A;  4CJ4 A;  3OJU A;  1N8R O;  3ZT4 A;  1JJ2 M;  3OYI A;  2P9S A;  1E3M A;  1S72 N;  4W5R A;  2A5X A;  1KFS A;  2RN2 A;  2UXB K;  1MDU B;  3SBT A;  1ZXO A;  4JD2 A;  4FLY A;  2CGK A;  1RT4 A;  1Q81 O;  1KRP A;  1Y64 A;  3P1G A;  3MN7 A;  5BRD A;  2BTF A;  3T69 A;  4BRA A;  3EY1 A;  3QER A;  4F9O A;  4BE2 A;  2IC3 A;  1YTA A;  3WEE A;  4BAC A;  3JS6 A;  5MLC Q;  1ESV A;  2KFN A;  1HQE A;  2GV9 A;  1UAX A;  4I9Q A;  2NNW A;  2VG7 A;  4KO0 A;  4EZ6 A;  2A41 A;  3NH0 A;  5AFU A;  1QVG M;  3VEO A;  3CC7 N;  4IXC A;  2HVI A;  3DI6 A;  3F9M A;  1BCM A;  2HMP A;  5GAD P;  4FOI A;  1S1X A;  4GVM A;  4B9N A;  1NBW A;  4LFA K;  3DOL A;  3PO5 A;  2IDO A;  4O5F A;  3J7Z O;  1N36 K;  2JGU A;  2OPR A;  1DEJ A;  3P83 D;  2P9S B;  5IT9 O;  4DTX A;  3R3L A;  3HBT A;  3FZL A;  3J8A A;  1G99 A;  2O8B A;  2ZWH A;  4M3W A;  4FWK A;  4X64 K;  3V6D A;  4BGA A;  4BRM A;  1VQ4 N;  4B9M A;  2DTU A;  3HVR A;  5FPM A;  3W0L A;  3H3O B;  4JD2 B;  5TKW A;  3CPW M;  5HRP A;  3CJB A;  4CGD A;  3QNN A;  3C95 A;  4FWM A;  2QWO A;  3CMA N;  3FZM A;  3WEE B;  3UIQ A;  1A5W A;  1TKT A;  3EKS A;  4AHV A;  3OBY A;  3DLL L;  3T3F A;  4O8K A;  3VN5 A;  1T7P A;  2ZM6 K;  2IVN A;  2QKB A;  3SNN A;  1C0M A;  1KC8 O;  5KGW A;  3OJS A;  4FCY A;  2O8D A;  3CCR N;  1W7A A;  3BF3 A;  2P51 A;  2KTQ A;  4H0X B;  1NMN A;  4E1M A;  4DQP A;  1WB9 A;  1HNI A;  2G8K A;  4X65 K;  5LMU K;  4AHT A;  1JLC A;  1IBL K;  4DQI A;  2QTD A;  3OYF A;  2GEM A;  3HPH A;  5JIC A;  4IFE A;  4CF9 A;  5M1Q A;  2HST A;  3MEG A;  4YOR A;  2JWK A;  3SUO A;  3G71 N;  3RRH A;  4K43 A;  3ATU A;  5AQT A;  1BA1 A;  2VWB A;  3LDN A;  3IMX A;  1RNH A;  4JNE A;  4DKW A;  1XNR K;  4OGC A;  4JKD A;  4NXM K;  3HJF A;  4CJF A;  3LAL A;  4CK1 A;  1KVB A;  2FBY A;  4DTN A;  3N4P A;  3Q7B A;  1RBR A;  5LMN K;  3OYM A;  1IO2 A;  1U04 A;  2NRX A;  4OKE A;  3PX4 A;  1QSY A;  4BDY A;  3D7E O;  2Q3S A;  2QXL A;  1Q18 A;  3ZLJ A;  3M8S A;  1ILY A;  3CFO A;  1NGD A;  3CIP A;  3S3N A;  2CGJ A;  4U7B A;  2YHW A;  2O8D B;  3RMA A;  5CYQ A;  1DGK N;  4V19 S;  1NJY A;  3K5N A;  3MXJ A;  3O5B A;  2F8S A;  4BRL A;  1XC3 A;  4E0D A;  1NGE A;  5AQJ A;  3VTI A;  1N34 K;  1VQL N;  3ZT2 A;  5TKY A;  3D2E A;  2ZJQ L;  4NB4 A;  5C12 A;  4QCL A;  3E66 A;  4ID5 A;  4EHT A;  3DYA A;  4BC4 A;  4BG8 A;  2QWL A;  4N41 A;  1ASW A;  1O13 A;  1J5E K;  2QK9 A;  3O3F A;  3BGR A;  4CEE A;  5KRS A;  3SQ0 A;  3THV A;  2D0C A;  3D0P A;  3WUH A;  3R9P A;  1EQY A;  4DLG A;  1RDB A;  2NUB A;  4YOW A;  1EWQ A;  3EKU A;  5DM7 L;  4BRK A;  4PHT X;  3KIO A;  3NFA A;  4CGG A;  2NRH A;  4IJA A;  2FBX A;  3D2F A;  2E1Y A;  3A0I X;  4OPK A;  4LFC K;  2Y1I A;  4KHQ A;  4RW9 A;  2FF6 A;  4HTU A;  2FXU A;  2KW4 A;  5B8H A;  1SKR A;  1HYS A;  1D9D A;  3KTQ A;  4W5O A;  3HT3 A;  5KQ8 A;  5KPR A;  4KBO A;  1JLF A;  5H1S Q;  4BRQ A;  4R79 A;  4CJR A;  4DQS A;  1LAW A;  4LF7 K;  4ILG B;  4BRE A;  3MWT A;  3D2E B;  1J53 A;  2FBV A;  4FWQ A;  3L6Q A;  1YTU A;  4C1N I;  3U9Z A;  4Z4I A;  5BR8 K;  2X6N A;  1FXX A;  4KHY A;  3E1Y A;  2DPN A;  4FPB A;  2ASP A;  3LZI A;  2Q1N A;  2D1K A;  3OVN A;  1X9W A;  3S3O A;  1RBS A;  2XY8 A;  5E41 A;  4FM2 A;  3I8B A;  4DQR A;  2D0P A;  4BWJ A;  1S5J A;  1OH6 A;  4QAG A;  1WSG A;  3QFU A;  1VSF A;  1WSF A;  4DFJ A;  2HBK A;  3ZT3 A;  2D0B A;  2XY5 A;  5M1N A;  3K58 A;  3QEI A;  4M3U A;  3DAW A;  3ZEU B;  4E3S A;  3D2F B;  1L3V A;  1DTT A;  4JI3 K;  5BPM A;  4FK4 A;  4A59 A;  1VSI A;  3J80 O;  2OZS A;  2OCE A;  1KXP A;  4LC9 B;  4GNI A;  2VG5 A;  3AA3 A;  4CEF A;  2VGM A;  4O8U A;  4JKE A;  4E7L A;  4LY7 A;  3IS9 A;  1NOZ A;  2QM1 A;  1XHX A;  4EP5 A;  3AVC A;  4DFP A;  4FJN A;  3CFR A;  5AQM A;  4JRQ A;  2P5G A;  4IO8 A;  1NJZ A;  2P9P A;  2PBD A;  4I7F A;  1X9M A;  1YJ9 N;  2OPS A;  2P9K B;  4ISE A;  1RDW X;  3KLE A;  4DCH A;  3C0B A;  2E20 A;  5CE3 A;  3U8X A;  2HHU A;  4CD1 A;  4EFH A;  5ADX H;  2W6L A;  3EEQ A;  3TAG A;  3L2Q A;  1L3T A;  4O55 A;  5T7B A;  4H5W A;  4GV6 A;  3SYZ A;  4CFC A;  1GOC A;  1RTI A;  3VET A;  4Z94 A;  2KQ2 A;  4IDK A;  4BRP A;  3EYZ A;  4DF8 A;  1X9S A;  2YI1 A;  2FSJ A;  4YOU A;  2IIR A;  4DUY K;  3V9X A;  3GE1 A;  1FK9 A;  2AA4 A;  1Z6R A;  2A40 A;  2E8A A;  1GOB A;  2ZD1 A;  3VEX A;  3KD5 E;  3TTC A;  1HKB A;  3NHG A;  1WOQ A;  3LAM A;  4FLW A;  4IZ9 A;  3LP1 A;  4H0Y B;  1UA1 A;  1HUX A;  4IBN A;  2RF2 A;  4CZL A;  3ZSY A;  5FPE A;  1LW2 A;  2O8E A;  1BCO A;  3F2K A;  2P9P B;  1BWF O;  5HRO A;  3TAR A;  2Z1H A;  2YNH A;  2OPQ A;  3DWL A;  1JLB A;  3AAR A;  3LDO A;  3RWU A;  1VRT A;  4BC2 A;  2HNY A;  3SQ1 A;  3EZ5 A;  4K0K K;  2E6L A;  4GVE A;  3TAM A;  5AQN A;  4CHQ A;  2XRI A;  5GAE P;  2NRW A;  3IKM A;  3AVN A;  4DB3 A;  3P4I A;  4DR3 K;  5E84 A;  1RT6 A;  3DLK A;  4CF8 A;  2P9I A;  5M1O A;  1ZBH A;  3VEW A;  4KTZ A;  4CZH A;  5HOO A;  4HHT A;  2OTJ N;  4HCC A;  3V1R A;  1A5V A;  5HBM A;  2FSK A;  5E26 A;  4CVN E;  1N5Y A;  3L4Q A;  4M3T A;  3AVJ A;  4LF9 K;  4H03 B;  3OYE A;  3CF5 L;  2X78 A;  2D4W A;  3ZSR A;  3CC4 N;  2A3Z A;  4HTL A;  3MXM A;  1TGO A;  1NJX A;  4BRH A;  3MEE A;  1SS6 A;  3T1H K;  2E2P A;  3DLH A;  1S1U A;  2E2O A;  1NJW A;  4RTF D;  5I9E B;  3C6U A;  3K5M A;  1VSM A;  3QIC A;  2O8E B;  4E19 A;  3G6E N;  4B9L A;  4RW8 A;  3NBP A;  4CJE A;  4CZM A;  2IGI A;  1R59 O;  4Z4H A;  4DFM A;  4MDA A;  5GIO A;  4BRF A;  4LSL A;  1T05 A;  2OAN A;  2XO7 A;  3EO3 A;  4I2Q A;  1D5A A;  3TAN A;  1WAJ A;  2P1J A;  3SK3 A;  1CZB A;  4KRE A;  3U6F A;  3BZK A;  5IWA K;  4NXN K;  4BR4 A;  4FM0 A;  3OYN A;  1L5U A;  4LH5 A;  2UXC K;  2YKM A;  4NCA A;  3K2P A;  4K42 A;  3SPY A;  3PO4 A;  1VSK A;  4WQ5 A;  2P9I B;  3H1Q A;  4KTW A;  4ELU A;  1RBU A;  1KLN A;  1KVC A;  4LF8 K;  3T1Y K;  4JYA K;  2YNI A;  4N5S A;  3ZX2 A;  4BRG A;  2FC0 A;  3L3V A;  1BO5 O;  4BVO A;  4HWI A;  3THX B;  1QQN A;  5DM6 L;  3TSQ A;  2EWS A;  3BP8 A;  5AZI A;  2YNF A;  3NMU A;  5KTQ A;  1NNE A;  3HRG A;  4LF5 K;  1TK0 A;  2VGN A;  3NF8 A;  5KI6 A;  4IOX A;  4I9L A;  3L8B A;  3V81 A;  1TKD A;  2NRR A;  3O4N A;  3L2V A;  1S6Q A;  5F1X A;  4LSN A;  2E2Q A;  1SL2 A;  4CJP A;  4IKF A;  4FXD A;  3RMB A;  1RDC A;  3HTV A;  4PKH A;  1YIJ N;  1HRH A;  1HX1 A;  3QLH A;  4KRF A;  4B1U B;  3ENO A;  2YHB A;  4CES A;  2EHG A;  4B1Z A;  3SAF A;  5ADX A;  4OPJ A;  2YV0 X;  3VQC A;  4DTJ A;  5HP1 A;  3L2W A;  3ID6 A;  4FLV A;  4CHN A;  1XMO K;  3AAP A;  5SWM A;  3VA3 A;  3TAQ A;  1VSL A;  2G8H A;  3O08 A;  3WQU A;  1SKW A;  1QVF M;  1GLE G;  3KJV A;  3GG4 A;  1JXB A;  4Z4C A;  1BHL A;  4PA1 A;  4E7I A;  4DV5 K;  5AZI B;  1LWE A;  3RVC A;  1C0F A;  1KAX A;  4W5T A;  2FLO A;  4ZHR A;  3JYT A;  3J81 O;  5AQG A;  4XIU A;  4Z4G A;  2GUI A;  3OYJ A;  1LWF A;  3O9T A;  4OPH A;  4IEI A;  1RT5 A;  1RGI A;  4JKG A;  5EXW A;  1BL3 A;  4L8R B;  4AHR A;  4FVM A;  4EP4 A;  4B3O A;  4OVL A;  3AVL A;  4K8Z A;  3CJC A;  2R7Y A;  3RR7 A;  1FKO A;  1S6P A;  3A5L C;  3CD6 N;  2Q2R A;  4XH4 A;  3TAB A;  2FBT A;  1IBK K;  4DV2 K;  1H1V A;  4JKF A;  5LY3 A;  4H4O A;  1LWC A;  1NGB A;  3LDP A;  1U49 A;  4GV3 A;  1SV5 A;  2ETJ A;  4B9V A;  4CF1 A;  2CGL A;  3OYC A;  4FL9 A;  1ZBU A;  4CHP A;  1Q86 O;  4Y1C A;  5AR0 A;  4MQ3 A;  1ATS A;  4E7J A;  5SZT A;  1VAZ A;  3CCQ N;  3FZK A;  3KWG A;  3L3U A;  2A6A A;  2O4I A;  5FRM A;  1I94 K;  2QKK A;  4OKJ A;  1NKE A;  2WUS A;  1N33 K;  2P9N A;  1RT2 A;  2GEL A;  3CME N;  5J2N A;  4CEZ A;  4FSV A;  3CHW A;  5HRR A;  4JI6 K;  1T6C A;  2VWJ A;  3J7Y P;  2E88 A;  4CEC A;  3BDP A;  1KLM A;  3OY9 A;  3OBW A;  4FWP A;  3MN6 A;  3LPU A;  4CIF A;  4YFU A;  1IV0 A;  1XC9 A;  4O0I A;  4KHW A;  4KB0 A;  4W5Q A;  4X66 K;  1RTJ A;  3AA4 A;  4CGF A;  1XHZ A;  1NU0 A;  3ENB A;  1C1C A;  1WBB A;  4AIL C;  1JLA A;  1VQM N;  2NLX A;  4BC3 A;  4JKG B;  3KK2 A;  1NK7 A;  1CLQ A;  3NGY A;  3I55 N;  4FJI A;  3M1F A;  3O1B A;  3H46 O;  1LOT B;  4CGH A;  5AQR A;  3NH1 A;  1NJI O;  3H08 A;  5KPT A;  4A2A A;  4MO5 A;  2WFB A;  1HQU A;  5JLF A;  4FJ5 A;  2GUP A;  2RKI A;  3I0S A;  3C6A A;  3HVT A;  5AQF A;  1NK6 A;  3O9S A;  1YJW N;  5CY4 A;  4O5B A;  5EY4 A;  3DLR A;  1KCF A;  1ZBS A;  1NKC A;  2IOC A;  1DKG D;  1VSE A;  4LD0 A;  3I0R A;  4CIE A;  3IUC A;  4JKC A;  3SJH A;  4YDU C;  3EE9 A;  2P9N B;  4ICL A;  3LL3 A;  1GLF O;  3TSU A;  3DXM A;  4BQL A;  3CM6 A;  2XY7 A;  4KHS A;  1V4S A;  4CJK A;  3ULD A;  4TSX A;  3ULE A;  3LDL A;  3KK1 A;  1OVY A;  3NF9 A;  4IG3 A;  1XI1 A;  5C25 A;  1NK4 A;  1EXQ A;  2JWL A;  4CIG A;  1RFQ A;  4PL7 A;  1U2V A;  3PV8 A;  3O9Q A;  4NYF A;  4X62 K;  2O8B B;  1NM1 A;  1KD1 O;  4HUE A;  3C65 A;  1NKB A;  4M45 A;  4E7H A;  3VF4 A;  5BPL A;  4DMN A;  2UU9 K;  3MWP A;  4FJM A;  4CZG A;  1ZBL A;  2W42 A;  4JI8 K;  3NCI A;  4GY2 B;  4O44 A;  4RWT A;  2DFE A;  3WXI A;  1RIL A;  3PIP L;  4KB1 A;  3ZSV A;  3OYH A;  1YUW A;  2F8T A;  3VER A;  2RHK A;  1KVA A;  3G4S N;  1RCH A;  4BY9 C;  3MX5 A;  1WBD A;  3O1W A;  4CK3 A;  4KAZ A;  3TAE A;  3F9K A;  1VQ8 N;  2QI2 A;  4BG9 A;  2ZJP L;  4ELT A;  1SKS A;  4RW4 A;  4J2E A;  3HO1 A;  3NE6 A;  3LP2 A;  4G1Q A;  3DXM B;  3MEC A;  1BU6 O;  4CGI A;  5HLF A;  3J7A P;  3SV3 A;  4ILH A;  4G9Z A;  4F3O A;  5AQZ A;  3ULE B;  5AQY A;  1QQO A;  4CJL A;  4M3Y A;  4FJX A;  3PLA A;  1JCE A;  3MK6 A;  3CCJ N;  2ITG A;  1QZ6 A;  1U2V B;  1I39 A;  3A2F A;  4H0T B;  1JL2 A;  4DUZ K;  4LF4 K;  3WNH A;  3OS2 A;  3NVK A;  2HHH K;  4FK2 A;  3WXM B;  1EWR A;  5D3G A;  1X3M A;  1VQP N;  3OYL A;  1OH8 A;  3IG1 A;  1NG9 A;  4FLX A;  2B4J A;  2Q0U A;  4B3R K;  3N4Q A;  4FJ9 A;  3CCL N;  4YDU A;  4BRN A;  3B6O A;  3LDS A;  3E9L A;  4DU4 A;  2I7N A;  3PUF A;  4M41 A;  1JLQ A;  4FWS A;  2HHQ A;  3ID8 A;  5KRT A;  4BE1 A;  4WYB A;  2G8U A;  2BUP A;  3TSP A;  3ZET A;  4HUG A;  4DSK A;  4K8X A;  3PSF A;  1NGJ A;  1HNX K;  3M6G A;  3HI0 A;  4NYN A;  4BDZ A;  4FW1 A;  5EOY A;  1NGA A;  1N6Q A;  4F8R A;  1HNV A;  3SPZ A;  3AVB A;  1XQS C;  1S1T A;  2KKZ A;  1HR0 K;  4FPA A;  5JLH A;  3MXI A;  3DJC A;  4CJT A;  5BN9 A;  1TYQ A;  4CZJ A;  1NLV A;  1VSD A;  4OGE A;  1QSL A;  4FWL A;  1LCU A;  1IJJ A;  2YHX A;  4GV9 A;  3HST B;  4A57 A;  3MED A;  1BQM A;  5J2Q A;  1K8K A;  3VF2 A;  1GLA G;  2ASM A;  4B9S A;  1C0G A;  1NGI A;  2FSN A;  4DU1 A;  2Z1I A;  4WFN L;  5JVG L;  2YHA A;  3AO1 A;  1Z26 A;  3ZX0 A;  4A61 A;  1RDD A;  1FW6 A;  3KKR A;  4XH5 A;  2YCH A;  4A5B A;  4CEQ A;  3V1O A;  3QIN A;  1Z25 A;  2I7P A;  2W40 A;  3GOI A;  2PYJ A;  3ZET B;  4DFK A;  2V7Y A;  1T8E A;  3VA0 A;  5HRS A;  3QET A;  2QEX N;  3AGK A;  1S1V A;  1SL0 A;  4MLH A;  3L0Q A;  2BGG A;  2O8F A;  5AQP A;  2YNG A;  1Y97 A;  4JKA A;  2OZM A;  4IFV A;  4BE0 A;  3MCA B;  3O3G A;  4C1N K;  4B1V A;  1TYQ B;  3B6P A;  4DU3 A;  4ZTF A;  4JV5 K;  3MN5 A;  3KK7 A;  5J2M A;  2DY4 A;  4E89 A;  1K8K B;  3E9P A;  5JMV A;  1Q7Y O;  2PZS A;  5M1F A;  2B5J A;  3TTF A;  2P9U A;  3IRX A;  2V52 B;  1V4T A;  3CQY A;  3WNG A;  4B1Y B;  1WSJ A;  3OW2 M;  2P9L A;  5GAH P;  1YVN A;  3HZ6 A;  3THY A;  4H5V A;  4K41 A;  3NAE A;  1IBM K;  1Q8I A;  3VQ4 A;  3A8Y A;  3VMF B;  3O8M A;  2HOE A;  5FLX O;  4DQQ A;  4F3T A;  4ILJ A;  3ZSZ A;  2H3G X;  1T03 A;  4ISG A;  4AM7 A;  4JHD A;  4CEA A;  4DTM A;  3JXU A;  3A5N C;  4CFA A;  1ITG A;  1VQ7 N;  4J2A A;  2O8F B;  1VHX A;  4DSF A;  2NRZ A;  2ATQ A;  3TPQ A;  2QWQ A;  5AJ3 K;  3VPZ A;  4WF9 L;  4WQ5 C;  5AQI A;  2UUC K;  3DLE A;  1BUP A;  4IWV A;  4DS5 A;  4RG8 A;  3CQX A;  4FOE A;  3KLF A;  3THW A;  4HVJ A;  3AVK A;  4JLH A;  4H8K A;  4OPA A;  2KZZ A;  3FR0 A;  3T19 A;  3PY8 A;  1XNQ K;  2KLA A;  4PUO A;  3SMS A;  1B9F A;  1G15 A;  3FZF A;  1MU2 A;  3O80 A;  4EZ9 A;  4DV6 K;  4B3S K;  3DOK A;  4FJH A;  2E5L K;  1BI4 A;  1B92 A;  5FPD A;  4B9U A;  1L3U A;  3MMV A;  4J2D A;  5BR9 A;  3CCE N;  3SQ2 A;  2A1S A;  4CCH A;  4RCH A;  1HNZ K;  4OO1 J;  2P9L B;  2JLE A;  3K0S A;  3AVH A;  4DR2 K;  3OTO K;  4ELV A;  4FJG A;  3OYG A;  1QTM A;  3K5O A;  5AQL A;  5HL7 L;  1KSP A;  4AHC A;  1RDA A;  1VQK N;  1TKX A;  1HPM A;  3IFR A;  3SUP A;  1LW0 A;  4KI6 A;  1TV6 A;  4YHH K;  2PYL A;  4FZX C;  1K73 O;  4AHU A;  4IOC L;  3HP9 A;  2HHS A;  4J8F A;  3ZSX A;  4JHD B;  4YOV A;  5AQV A;  1F21 A;  1HYV A;  4I2P A;  3VQB A;  3VQ9 A;  1D9F A;  2ZE2 A;  5HRN A;  3CFP A;  2GWJ A;  3AA2 A;  3AA5 X;  3AGR A;  5I42 A;  3AVI A;  3LAK A;  2Y1J A;  3THW B;  3UB5 A;  5AZJ A;  4ZTJ A;  1ASV A;  4FWN A;  3DRR A;  4CE9 A;  4NCB A;  5K14 A;  1IKW A;  5FPN A;  3GBT A;  3VGL A;  2RPI A;  4BRD A;  4BR0 A;  3HM9 A;  4Z4F A;  2E4L A;  4B1X B;  2VWK A;  4QS9 A;  4JRP A;  2KZM A;  2Q0R A;  1JCF A;  3KHY A;  3M3Z A;  4WFA L;  4KH5 A;  4YOT A;  4CJV A;  4B3T K;  3C7N A;  3H3N O;  3HL8 A;  2BAN A;  3AO4 A;  3V9S A;  5KQD A;  4XEI A;  1C6V A;  1VQN N;  3QBX A;  4GW6 A;  3EZW A;  1BIS A;  4CJQ A;  1JLE A;  3P39 A;  3U3G A;  1HJR A;  4IG0 A;  3SUN A;  1TAU A;  1UOC A;  3EN9 A;  4KFB A;  3OHR A;  4MDB A;  5GIP A;  5C10 A;  4HUF A;  1T6D A;  2UYT A;  3P38 A;  3ZT1 A;  3LPT A;  1TVR A;  1VQ9 N;  1ZBI A;  1MWM A;  2HHW A;  3KWI A;  1U45 A;  1J6Z A;  1NMD A;  1M1K O;  2WTU A;  4CBX A;  5M1P A;  2G8F A;  3QIP A;  2A1R A;  3T1A A;  3V1Q A;  3SBG A;  2PFU A;  3VTH A;  3CJA A;  3LP0 A;  4R5P A;  4FVU A;  1XUP O;  4MFB A;  4DR5 K;  1BQN A;  3C7N B;  1A5X A;  2WOM A;  4AM6 A;  2YJF A;  4BR5 A;  4WCE L;  4Y0W A;  4FYD A;  4DHY A;  3S41 A;  5C15 A;  3FFI A;  3VEZ A;  2EX3 A;  2KHO A;  3QIO A;  5AQK A;  1GLD G;  1K9M O;  3CXC M;  2HF4 A;  3DLB A;  4GKJ K;  1CXU A;  1KTQ A;  4JKH A;  2D5R A;  3VOV A;  4KI4 A;  4LFB K;  1YAG A;  1WAF A;  1O1W A;  2ITM A;  4FZZ A;  5AQW A;  3UKU A;  3VQA A;  1T3V A;  2O4G A;  1FKP A;  1UWB A;  3SQ4 A;  3M8Q A;  2D0A A;  1P90 A;  3QEP A;  1RBT A;  3K59 A;  3DXK A;  1DLO A;  4MLE A;  2HHX A;  4F2S A;  2WBN A;  2E1Z A;  4JK9 A;  3TU5 A;  1S1W A;  1FJG K;  3CCU N;  4CZF A;  5JS1 A;  3EE8 A;  4H4M A;  1R0A A;  1C1A A;  5AQQ A;  3PIO L;  3P31 A;  2Q36 A;  3ENH A;  3CG7 A;  4N56 A;  2D0O A;  3VQ8 A;  1RT1 A;  2HHT A;  2F9T A;  5AQO A;  3VEY A;  1DTQ A;  1VRU A;  2V51 B;  3AO3 A;  3MDQ A;  3VQE A;  4OLB A;  4CEO A;  1VSJ A;  1LAV A;  3E01 A;  1ZBF A;  2A42 A;  4DTU A;  1QSS A;  5GAG P;  4PY5 A;  4BC5 A;  3BF1 A;  5C24 A;  4DR1 K;  4BGB A;  3NVM A;  3CC2 N;  3UKU B;  4FZY A;  4AF1 A;  1NGC A;  1W97 L;  4DSE A;  4FJJ A;  3G25 A;  1C0U A;  3V9W A;  3SJJ A;  1YF5 L;  5JVH L;  3O9U A;  4CJS A;  2G8V A;  3DM2 A;  1BIU A;  3OYD A;  2W6K A;  4IO9 L;  3CQ8 A;  3SAG A;  4JI4 K;  3QES A;  2UUA K;  2ZF5 O;  3DXK B;  4QOZ B;  5A2Q O;  4AH9 A;  5CZ2 A;  4F4K A;  3CJ1 A;  1CZA N;  3FLC O;  3VQP A;  4CF2 A;  3LWL A;  2YJE A;  5EVZ A;  2BE2 A;  4L3Q A;  4DTP A;  2DFH A;  2WON A;  4KPY A;  2HMI A;  1GOA A;  3FZH A;  4DTR A;  1IH7 A;  1NGH A;  4KTQ A;  4ID1 A;  3AVF A;  4O4G A;  1GLL O;  3M8R A;  4W5N A;  1HMV A;  3NGI A;  2Z1J A;  2OYQ A;  4CEB A;  1VQ5 N;  3HPO A;  3U9D A;  3CCS N;  4DV4 K;  4IJN A;  1RTH A;  1BG3 A;  3V4I A;  4A5A A;  3DMJ A;  4Y1D A;  2G8W A;  4WQ4 C;  1OH7 A;  4CK2 A;  4Z4E A;  4EAH D;  2YKN A;  3OS1 A;  4GKK K;  3ZYY X;  1CXQ A;  2F9W A;  4CJ7 A;  1RT3 A;  1OH5 A;  3OYA A;  3EL2 A;  4CHZ A;  4DV7 K;  4Q0B A;  1WSE A;  4IOA L;  3O4W A;  2OA8 A;  1TK5 A;  3IDH A;  1EET A;  3H1V X;  4MO4 A;  4JS5 A;  3CCV N;  3VF6 A;  4JI2 K;  3W3D A;  1Q9X A;  3CCM N;  4WFB L;  3ATV A;  2HHV A;  5ELZ A;  3LM2 A;  3VQQ A;  5GIN A;  4DTO A;  3KVG A;  2V7Z A;  1JXE A;  5DMR A;  1JLG A;  4Z0U A;  2IAJ A;  2GWK A;  5C0Y A;  1RDU A;  3V9U A;  1EKE A;  4B8C A;  1K6Y A;  1I3A A;  4J2B A;  1GLB G;  1E4F T;  3WXK A;  4JAX A;  3DRP A;  1YT3 A;  4JI0 K;  1QHT A;  1J9A A;  1QS4 A;  4M3R A;  1NK5 A;  2Q31 A;  5KPZ A;  4DSJ A;  2UUB K;  2HVH A;  1ASU A;  3JAM O;  3ZT0 A;  3QDK A;  2VCP A;  3BY5 A;  3ZSQ A;  3QO9 A;  1YXQ A;  1Q9Y A;  2CH5 A;  4DF4 A;  3L2U A;  4H0P A;  4DLE A;  4CFB A;  1NK8 A;  3H6E A;  1QQM A;  3FGU A;  3AO2 A;  2OPP A; 
#chains in the Genus database with same CATH homology
 2XO7 A;  3EY1 A;  2HND A;  3QER A;  5J2M A;  4I2Q A;  1D5A A;  4BE2 A;  3TAN A;  3AVM A;  2DY4 A;  2IC3 A;  4E89 A;  1YTA A;  4BAC A;  2PZS A;  3SCX A;  1WAJ A;  2B5J A;  2P1J A;  1CZB A;  1HQE A;  3U6F A;  4FJ7 A;  4KRE A;  3QNO A;  2KFN A;  2GV9 A;  1UAX A;  3IRX A;  4UQG A;  3NGZ A;  4I9Q A;  4FM0 A;  1C0T A;  1WNS A;  4KO0 A;  2VG7 A;  3WNG A;  3OYN A;  4LH5 A;  1L5U A;  4EZ6 A;  1WSJ A;  2YKM A;  4NCA A;  3K2P A;  3NH0 A;  1T05 A;  4BDP A;  3SPY A;  3PO4 A;  1KFD A;  1VSK A;  1W9H A;  3NAE A;  5J2P A;  4ELU A;  4KTW A;  4RW6 A;  1Q8I A;  4CFD A;  1RBU A;  1KLN A;  1KVC A;  3DI6 A;  3VQ4 A;  2HVI A;  1BCM A;  3ISN C;  4YNQ A;  1SL1 A;  1S1X A;  2YNI A;  4GVM A;  4N5S A;  4B9N A;  3ASM A;  1D8Y A;  3DOL A;  3PO5 A;  2FC0 A;  3L3V A;  1X1P A;  4Q5V A;  4DQQ A;  3HXM A;  4F3T A;  2IDO A;  3ZSZ A;  2JGU A;  2OPR A;  1T03 A;  3P83 D;  2YNF A;  4DTX A;  5KTQ A;  4CEA A;  2IS3 A;  3C94 A;  4DTM A;  4JS4 A;  3KD1 E;  4RW7 A;  3OYB A;  4M3W A;  4CFA A;  1ZYQ A;  3HYF A;  3CM5 A;  4CGJ A;  1ITG A;  3V6D A;  4J2A A;  4DSF A;  2ATQ A;  4B9M A;  1TK0 A;  1RT7 A;  1QE1 A;  3NF8 A;  5KI6 A;  3TWH A;  2DTU A;  3AVG A;  4I9L A;  3HVR A;  3DLE A;  3L8B A;  4DS4 A;  3V81 A;  4DS5 A;  4RG8 A;  1TKD A;  3O4N A;  1B9D A;  4FJK A;  3KLF A;  3L2V A;  1S6Q A;  1HPZ A;  4HVJ A;  3AVK A;  4JLH A;  5HRP A;  4H8K A;  1BGX T;  2KZZ A;  4CGD A;  3T19 A;  4B8A B;  3PY8 A;  4LSN A;  1SL2 A;  3OYK A;  4CJP A;  4IKF A;  3QNN A;  1IKX A;  4PUO A;  2B6A A;  4FXD A;  3RMB A;  1B9F A;  2Z1G A;  1G15 A;  1RDC A;  1MU2 A;  3C95 A;  4EZ9 A;  5I3U A;  3M8P A;  1HRH A;  3DOK A;  3QLH A;  4FJH A;  4KRF A;  4N47 A;  2YHB A;  5FDL A;  2EHG A;  4CES A;  1A5W A;  1BI4 A;  1B92 A;  3UIQ A;  4HCB A;  4B9U A;  1L3U A;  1TKT A;  4J2D A;  4OPJ A;  2YV0 X;  2A1S A;  3VQC A;  4AHV A;  3SQ2 A;  4DTJ A;  5HP1 A;  4CCH A;  1U4B A;  1BIZ A;  3L2W A;  3T3F A;  4IFY A;  4FLV A;  3NF7 A;  3VN5 A;  3WNE A;  2JLE A;  4CHN A;  1T7P A;  3AVH A;  5SWM A;  1WSH A;  4C8K A;  1CZ9 A;  4ELV A;  3OYG A;  1QTM A;  4FJG A;  3VA3 A;  3SNN A;  3SUQ A;  1VSL A;  3K5O A;  3ZCM A;  1C0M A;  3U3Y A;  3LZJ A;  3TAQ A;  2G8H A;  5KGW A;  3OJS A;  3KKS A;  1VK0 A;  4FCY A;  1SKW A;  1KSP A;  4AHC A;  1IKV A;  1RDA A;  5CZ1 A;  1TKX A;  3SUP A;  3KJV A;  1LW0 A;  2P51 A;  4KI6 A;  4E1M A;  2KTQ A;  1TV6 A;  4DWI A;  4DQP A;  3KK3 A;  2PYL A;  4FZX C;  1JXB A;  4NCG A;  1BHL A;  4Z4C A;  4PA1 A;  3CYM A;  1HNI A;  2G8K A;  4E7I A;  4AHU A;  3HP9 A;  1YVU A;  5FRN A;  1LWE A;  4AHT A;  2HHS A;  1JLC A;  3ZSX A;  4DQI A;  4W5T A;  4CF0 A;  3AV9 A;  4ZHR A;  3I8D A;  3OYF A;  3JYT A;  3HPH A;  1F21 A;  4CF9 A;  4XIU A;  4Z4G A;  3S9H A;  2GUI A;  4GMJ B;  3OYJ A;  1HYV A;  4I2P A;  3VQB A;  3LWM A;  3MEG A;  1LWF A;  3VQ9 A;  1D9F A;  3SUO A;  2ZE2 A;  5HRN A;  3CFP A;  3AA2 A;  1RT5 A;  3AA5 X;  5I42 A;  3AVI A;  3LAK A;  1BL3 A;  3RRH A;  2Y1J A;  4L8R B;  4AHR A;  4FVM A;  4EP4 A;  4B3O A;  1RNH A;  4ZTJ A;  4OVL A;  4FLU A;  1ASV A;  3AVL A;  4K8Z A;  3DRR A;  2R7Y A;  3RR7 A;  1FKO A;  1S6P A;  4OGC A;  4CE9 A;  4CHO A;  3MAQ A;  5J1E A;  3TAB A;  5K14 A;  4NCB A;  2HNZ A;  2FBT A;  3HJF A;  4CJF A;  1IKW A;  3LAL A;  4H4O A;  1KVB A;  2FBY A;  4CK1 A;  1LWC A;  2F96 A;  4DTN A;  1U49 A;  4M3X A;  1RBR A;  1S9G A;  1JKH A;  1SV5 A;  2ETJ A;  2RPI A;  4CF1 A;  4B9V A;  3WNF A;  3OYM A;  4M3Z A;  1IO2 A;  3OYC A;  1U04 A;  3HM9 A;  3LAN A;  2E4L A;  4Z4F A;  4OKE A;  3PX4 A;  2VWK A;  1QSY A;  4BDY A;  2Q3S A;  1ZBU A;  4JRP A;  1L3S A;  4CHP A;  3M8S A;  3L2R A;  4Y1C A;  3QEW A;  2KZM A;  4MQ3 A;  4E7J A;  5SZT A;  1JL1 A;  3CFO A;  4AHS A;  4CJV A;  3L3U A;  3S3N A;  2O4I A;  5FRM A;  2QKK A;  4OKJ A;  1NKE A;  2I5J A;  3RMA A;  5CYQ A;  1RT2 A;  1RBV A;  3HL8 A;  2BAN A;  5J2N A;  3QEX A;  4FJL A;  4CEZ A;  5HRR A;  2VWJ A;  3AO4 A;  1NJY A;  3K5N A;  2HB5 A;  3MXJ A;  3V9S A;  4CEC A;  1C6V A;  3BDP A;  2F8S A;  1KLM A;  3OY9 A;  4O0J A;  1EX4 A;  4E0D A;  4GW6 A;  3AVA A;  1BIS A;  4CJQ A;  3P5J A;  3LPU A;  1JLE A;  5JS2 A;  4CIF A;  4YFU A;  3ZT2 A;  3O3H A;  4O0I A;  1XC9 A;  1TK8 A;  3U3G A;  1NK0 A;  4KHW A;  4CJU A;  1HJR A;  5C42 A;  4IG0 A;  3SUN A;  4KB0 A;  4W5Q A;  1TAU A;  1SUQ A;  3DRS A;  1UOC A;  1RTJ A;  3AA4 A;  4KFB A;  4CGF A;  1XHZ A;  1C1C A;  1TAQ A;  4AIL C;  1JLA A;  4QCL A;  3KK2 A;  3PX6 A;  4ID5 A;  1NK7 A;  1CLQ A;  3DYA A;  3NGY A;  3KLI A;  4FJI A;  4N76 A;  3ZSO A;  4HUF A;  3HK2 A;  1WN7 A;  4N41 A;  1ASW A;  4CGH A;  3ZT1 A;  3LPT A;  2QK9 A;  1TVR A;  3O3F A;  3NH1 A;  3H08 A;  3BGR A;  4CEE A;  5KRS A;  3SQ0 A;  3THV A;  1ZBI A;  2HW3 A;  2D0C A;  2HHW A;  4E1N A;  3D0P A;  1U45 A;  3KLH A;  1HQU A;  3VQ5 A;  4DLG A;  4FJ5 A;  1RDB A;  2NUB A;  2RKI A;  3AO5 A;  1IKY A;  3I0S A;  2KFZ A;  2G8F A;  3QIP A;  3HVT A;  2A1R A;  3T1A A;  3V1Q A;  1NK6 A;  5CY4 A;  4O5B A;  3G0Z A;  3DLR A;  4DTS A;  4C8M A;  1KCF A;  1NKC A;  3D45 A;  3O4Q A;  2IOC A;  3KIO A;  4FJ8 A;  3LP0 A;  3NFA A;  4CGG A;  4R5P A;  1VSE A;  4LD0 A;  2FBX A;  3I0R A;  4MFB A;  3SI6 A;  2QKB A;  4CIE A;  4OPK A;  4OLA A;  4DSI A;  1BQN A;  2Y1I A;  2WOM A;  1A5X A;  4KHQ A;  2G8I A;  4RW9 A;  3VQ6 A;  4HTU A;  4FYD A;  2KW4 A;  1SKR A;  3FFI A;  4ICL A;  2EX3 A;  1HYS A;  3QIO A;  3SV4 A;  4CJW A;  1D9D A;  3KTQ A;  4W5O A;  3DLB A;  3HT3 A;  3CM6 A;  3JSM A;  1XWL A;  1CXU A;  2XY7 A;  4KHS A;  1JLF A;  4CJK A;  3ULD A;  1KTQ A;  4CJR A;  4KHU A;  4TSX A;  4DQS A;  1LAW A;  1LV5 A;  4CJ5 A;  2D5R A;  3KK1 A;  4PWD A;  4KI4 A;  3NF9 A;  4IG3 A;  1XI1 A;  5KGX A;  1J53 A;  2FBV A;  4CJ3 A;  1WAF A;  1EXQ A;  1O1W A;  5C25 A;  1NK4 A;  4FK0 A;  2X6S A;  4FZZ A;  1YTU A;  4CIG A;  3PV8 A;  4Z4I A;  2DFF A;  5DK5 A;  2X6N A;  4NYF A;  3VQA A;  1FXX A;  4HUE A;  3KLG A;  3TAF A;  1TKZ A;  4KHY A;  1NKB A;  4M45 A;  4B08 A;  4E7H A;  4C8L A;  3LZI A;  4LH4 A;  2O4G A;  4DMN A;  1FKP A;  4FJM A;  1UWB A;  3OVN A;  3SQ4 A;  1X9W A;  3S3O A;  1RBS A;  2D0A A;  3M8Q A;  1NK9 A;  3C6T A;  2XY8 A;  1ZBL A;  3QEP A;  1RBT A;  2W42 A;  5E41 A;  2GBZ A;  4O44 A;  1DLO A;  3NCI A;  2DFE A;  3K59 A;  4FM2 A;  4DQR A;  1RIL A;  4BWJ A;  1S5J A;  4WE1 A;  2HHX A;  4QAG A;  4F2S A;  1WSG A;  1HYZ A;  1VSF A;  1WSF A;  4DFJ A;  4KB1 A;  3ZSV A;  3OYH A;  3ZT3 A;  3NH2 A;  2F8T A;  3SZ2 A;  2D0B A;  3V9Z A;  2XY5 A;  1S1W A;  1KVA A;  3K58 A;  1RCH A;  3QEI A;  1BI4 B;  4M3U A;  3PX0 A;  5JS1 A;  4CK3 A;  3NDK A;  2PY5 A;  4H4M A;  3TAE A;  4KAZ A;  3F9K A;  4E3S A;  1R0A A;  1C1A A;  4KV8 A;  1L3V A;  1DTT A;  1U47 A;  4FK4 A;  1VSI A;  2OZS A;  3CG7 A;  4C8N A;  4N56 A;  4ELT A;  1SKS A;  3VQ8 A;  4F2R A;  4RW4 A;  4J2E A;  1RT1 A;  2LSN A;  2HHT A;  2VG5 A;  3AA3 A;  3HO1 A;  4CEF A;  3NE6 A;  1DTQ A;  1VRU A;  3AO3 A;  3TR8 A;  3LP2 A;  1NOY A;  4E7L A;  4LY7 A;  3IS9 A;  3VQE A;  4OLB A;  1NOZ A;  4G1Q A;  4CEO A;  1XHX A;  3MEC A;  1VSJ A;  4CGI A;  1LAV A;  3AVC A;  4EP5 A;  4DFP A;  5HLF A;  3E01 A;  4FJN A;  1ZBF A;  3RR8 A;  3SV3 A;  4F3O A;  3CFR A;  4JRQ A;  4DTU A;  1J5O A;  1QSS A;  2P5G A;  1NJZ A;  4CJL A;  4M3Y A;  4FJX A;  4I7F A;  1X9M A;  4PY5 A;  2OPS A;  3HP6 A;  2ITG A;  4M42 A;  5CYM A;  5C24 A;  3KLE A;  1I39 A;  3A2F A;  3ZSW A;  4CHY A;  2HHU A;  1JL2 A;  1W0H A;  2BDP A;  3WNH A;  3OS2 A;  4FLZ A;  4FZY A;  1TL3 A;  4FK2 A;  3TAG A;  4DSE A;  4FJJ A;  4BWM A;  1WSI A;  5D3G A;  3OYL A;  3L2Q A;  3VQ7 A;  4B9T A;  1L3T A;  4O55 A;  5T7B A;  1C0U A;  3IG1 A;  3V9W A;  3SJJ A;  2G8V A;  4CJS A;  3S3M A;  3DM2 A;  1BIU A;  3OYD A;  4FLX A;  3ITH A;  2B4J A;  3CQ8 A;  3SYZ A;  4CFC A;  3QES A;  4QOZ B;  4CED A;  4FJ9 A;  1GOC A;  1RTI A;  4AH9 A;  5CZ2 A;  1RTD A;  4F4K A;  3VQP A;  3B6O A;  4CF2 A;  2KQ2 A;  3LWL A;  3LDS A;  4IDK A;  4DU4 A;  2VG6 A;  2BE2 A;  4OJR A;  3EYZ A;  3PUF A;  4DTP A;  4M41 A;  2DFH A;  5FRO A;  4DF8 A;  1X9S A;  2WON A;  2AJQ A;  4KPY A;  1JLQ A;  2HMI A;  1GOA A;  3V9X A;  2HHQ A;  5KRT A;  3LP3 A;  1FK9 A;  4BE1 A;  4DTR A;  3TI0 A;  4PQU A;  1IH7 A;  3ALY A;  3K5L A;  4KTQ A;  2G8U A;  3DLG A;  4HUG A;  4DSK A;  4K8X A;  4ID1 A;  3AVF A;  3F73 A;  4O4G A;  3M8R A;  4W5N A;  1GOB A;  1HMV A;  2ZD1 A;  3NGI A;  2Z1J A;  4E7K A;  2OYQ A;  3KD5 E;  3NF6 A;  1UA0 A;  4CEB A;  1U48 A;  4NYN A;  3NHG A;  4BDZ A;  3HPO A;  3LAM A;  4FLW A;  4FW1 A;  3OS0 A;  3RRG A;  1RTH A;  3V4I A;  2X74 A;  3LP1 A;  4FW2 A;  4FM1 A;  3DMJ A;  4Y1D A;  1N6Q A;  2G8W A;  4F8R A;  1HNV A;  4KHN A;  1UA1 A;  1VSH A;  3SPZ A;  3AVB A;  2XHB A;  4IBN A;  2RF2 A;  4OKK A;  1S1T A;  4CK2 A;  3ZSY A;  3K57 A;  4Z4E A;  1LW2 A;  2YKN A;  3OS1 A;  1BCO A;  4C8O A;  1CXQ A;  2ZQB A;  3MXI A;  3G10 A;  4CJT A;  5HRO A;  1RT3 A;  3OYA A;  3TAR A;  2Z1H A;  2YNH A;  2OPQ A;  4CHZ A;  4Q0B A;  3RMD A;  1JLB A;  3RWU A;  1WSE A;  1VSD A;  1REV A;  2E6M A;  4OGE A;  1VRT A;  2OA8 A;  1J54 A;  3QEV A;  4DSL A;  1QSL A;  2QXF A;  2HNY A;  3VQD A;  1TK5 A;  3SQ1 A;  1IG9 A;  1EET A;  3HST B;  4CER A;  3MED A;  3EZ5 A;  1BQM A;  4JS5 A;  5J2Q A;  2E6L A;  3TAM A;  3TAP A;  4FLT A;  4B9S A;  4CHQ A;  1Q9X A;  1QQC A;  4DU1 A;  1TL1 A;  2XRI A;  2Z1I A;  2HHV A;  2YHA A;  3AO1 A;  1Z26 A;  3AVN A;  3VQQ A;  4DTO A;  1RDD A;  1C1B A;  2XY6 A;  3IAY A;  1JXE A;  5DMR A;  1RT6 A;  3DLK A;  4CF8 A;  1WLJ A;  1JLG A;  4Z0U A;  3KKR A;  1S9E A;  2IAJ A;  3HPG A;  5EU7 A;  3V9U A;  1EKE A;  3RTV A;  4CEQ A;  1ZBH A;  1EP4 A;  3V1O A;  4B8C A;  4KTZ A;  2P5O A;  3QIN A;  1K6Y A;  1Z25 A;  4DG1 A;  4HHT A;  4HCC A;  1I3A A;  4J2B A;  4KKO A;  3RMC A;  3V1R A;  1A5V A;  2PYJ A;  5HBM A;  4CJ4 A;  3OJU A;  4DFK A;  1N5Y A;  3ZT4 A;  4M3T A;  3AVJ A;  3OYI A;  1T8E A;  3VA0 A;  5HRS A;  3OYE A;  2X78 A;  3DRP A;  1YT3 A;  3ZSR A;  3QET A;  3MXM A;  1TGO A;  1QHT A;  1S1V A;  1NJX A;  1SL0 A;  3MEE A;  1J9A A;  1QS4 A;  3DLH A;  4W5R A;  4M3R A;  1NK5 A;  1S1U A;  2BGG A;  1KFS A;  2RN2 A;  1NJW A;  4DSJ A;  3C6U A;  3K5M A;  1VSM A;  2YNG A;  1Y97 A;  2OZM A;  2HVH A;  1ASU A;  3ZT0 A;  4E19 A;  4IFV A;  4BE0 A;  4B9L A;  3ZSQ A;  3QO9 A;  1Q9Y A;  3O3G A;  4RW8 A;  3NBP A;  4CJE A;  4FLY A;  4DF4 A;  2IGI A;  3L2U A;  4Z4H A;  4DFM A;  1RT4 A;  4DLE A;  4CFB A;  1NK8 A;  4LSL A;  3B6P A;  1KRP A;  4DU3 A;  3AO2 A;  4ZTF A;  3P1G A;  2OPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...