1ZBLA

Bacillus halodurans rnase h catalytic domain mutant d192n in complex with 12-mer rna/dna hybrid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zblA00
4JS5A 4FJ9A 1NJXA 5JS2A 2BDPA 5KTQA 3S3OA 4Y1CA 5FRMA 4J2AA 3TAMA 1TAUA 1WAJA 4DQSA 1NK4A 4ELTA 4W5QA 4KHWA 1U45A 3SV4A 4W5TA 3NF8A 1KVBA 2NUBA 3QO9A 3TAGA 3C95A 2G8HA 3PO4A 4Z4EA 4FYDA 3SUPA 1MU2A 4QAGA 3F73A 4M3ZA 3AVIA 1TKZA 4DQIA 3KJVA 4FLUA 3EY1A 2HVIA 4HHTA 1RT5A 4CJTA 1RTIA 3HPOA 3V9UA 2JGUA 1BIUA 1TK5A 1JLEA 2OA8A 4FZZA 2B6AA 4B9MA 3NAEA 4OJRA 1Q8IA 3U6FA 4CEFA 1RTDA 3ZSXA 2X6SA 2F96A 3AVAA 1JLBA 3AO1A 1HYVA 3RRHA 2PZSA 2OZMA 1LAVA 4FLZA 4M3TA 4Z4GA 4TSXA 1KSPA 3VQ7A 4LY7A 2IS3A 1IO2A 2D0AA 2ITGA 3SPZA 4B9SA 1KLMA 4DQQA 4B9VA 1WSEA 3OS2A 1LWFA 1IKWA 3QETA 1D9FA 4CJRA 3OYMA 1CXQA 1J5OA 3V1QA 2JLEA 4CJ3A 4H4MA 3RMCA 2G8UA 1YT3A 4HUGA 3KLEA 5J1EA 4AHUA 3IRXA 5CYQA 3VQ8A 3ZSQA 1KVCA 3CFPA 4W5NA 4GVMA 4YFUA 2R7YA 1QQCA 2VG6A 4DTPA 2GBZA 4KFBA 4CGIA 2HHVA 1TK8A 3SI6A 3OYDA 1XHZA 3ZSYA 4AHVA 3NHGA 1QSLA 2RPIA 3K59A 1O1WA 3L2WA 3VA3A 4CEZA 2XRIA 3HVRA 4NYFA 4CJEA 1QHTA 1HYZA 3SUNA 4F3OA 3WNGA 4IBNA 3DLKA 3IG1A 4CJKA 4R5PA 4IFVA 5CZ2A 1WN7A 5J2PA 1IG9A 3AVMA 3O3GA 3MXMA 3S3MA 2D0BA 1U47A 1RILA 1JLFA 4JS4A 4CFCA 1QSYA 3G0ZA 3RTVA 4KTQA 4E89A 3QEXA 1U49A 3TANA 4HVJA 4DTNA 5HRSA 4Q5VA 4DFPA 3L3VA 3RWUA 4E7JA 2W42A 1KLNA 1NJYA 5K14A 3B6OA 2VG7A 4M42A 2G8IA 1L3UA 5J2MA 1JXEA 4ZTFA 5HRRA 3ZSRA 4CJUA 1RT6A 3CFOA 3OJUA 5CYMA 1SL2A 3DM2A 3TAFA 4NCGA 3K2PA 4BDYA 3CM5A 3TI0A 1I39A 5KRTA 4FCYA 4KI6A 2YV0X 1VSKA 3OVNA 3TARA 1NK8A 1BL3A 2QKBA 4M3XA 4I9LA 3TWHA 1SKSA 4MQ3A 3HXMA 4EP5A 3AA5X 1HQUA 1QS4A 3LANA 1D8YA 4K8ZA 1U48A 1LW0A 5E41A 1REVA 3QIPA 2OZSA 4HUFA 5KGWA 2VG5A 1RNHA 3VQAA 4E7KA 3MXIA 3ZT4A 5D3GA 3QNNA 3V4IA 4DMNA 3THVA 4CHPA 5CZ1A 3SCXA 3NGYA 2FC0A 1SV5A 2RF2A 4FW1A 4IDKA 3OYFA 2G8FA 4NCAA 1G15A 3EZ5A 3TAEA 1WSHA 2YHAA 1T7PA 2KZZA 5C42A 3SPYA 2G8WA 3LAMA 5HBMA 4DSEA 3VA0A 3QIOA 3C6UA 3DMJA 4CJWA 3NCIA 3RRGA 4HTUA 4PQUA 1RBUA 3L2RA 1KVAA 3MEGA 1DLOA 1S5JA 1VSIA 3AO4A 5DMRA 4J2BA 4CHQA 4FJMA 4CK1A 4DSIA 2PYJA 2Z1GA 3AV9A 2P5OA 3QINA 3WNHA 4CJLA 4FJHA 3AA3A 4OGCA 3PUFA 3LP2A 3DLRA 4CHYA 2DFHA 1C1CA 4XIUA 3KLFA 4FLXA 3L8BA 3VQBA 1TL3A 1W9HA 4FJ7A 1TAQA 3DI6A 4FK2A 2HHSA 4FM1A 4N5SA 1EP4A 4E3SA 4CJ4A 3AA4A 4Z0UA 4KTWA 2XY7A 1IKVA 1JL1A 1HQEA 2E6MA 1NK5A 4RW8A 5CY4A 3T1AA 2HB5A 4E19A 3V9WA 4DTXA 3QEPA 4LSNA 4EP4A 3MXJA 4CFDA 1HJRA 3AVNA 1YVUA 4W5RA 4BDZA 3QERA 3UIQA 3M8PA 3QEVA 1UA0A 1WSIA 1RT4A 4DSLA 3VQ5A 3SQ2A 3HK2A 4FXDA 4DTUA 1R0AA 2HHUA 4DTMA 3BDPA 2QK9A 3KIOA 5SZTA 2AJQA 1RCHA 1A5VA 1XWLA 3LZJA 2HHXA 1RDAA 1JXBA 4IFYA 3U3YA 1RTJA 4OLAA 2FBTA 4RW9A 3C6TA 3VQEA 5HLFA 4CEOA 4CK2A 2RKIA 3KK3A 1NOYA 3OYHA 4O44A 4KB1A 2O4GA 1S1XA 2YNHA 3KLHA 3TAPA 4AHCA 4BE2A 2A1RA 3ULDA 3CG7A 4ELUA 1JL2A 4H4OA 3KTQA 4B9LA 3KD5E 4FK0A 1QTMA 4Z4HA 4O0JA 4BE0A 3SNNA 3ALYA 3DLHA 1RBRA 4RW7A 1Q9YA 2IC3A 2RN2A 4N76A 4OPKA 3OY9A 1RTHA 1EKEA 3AO5A 2E4LA 1ITGA 3D45A 1SUQA 3DLEA 3VQ6A 4CEAA 4CJSA 3O3FA 4KAZA 4FZXC 4E1NA 4CHZA 1SL0A 4DSJA 2HNYA 2Z1HA 4KREA 5HRPA 2WONA 1HYSA 3I0RA 3LALA 3O4QA 4DLGA 4AH9A 3MAQA 4DTJA 3SUQA 1NK0A 3L3UA 4CHNA 4C8LA 4DFJA 4LH4A 3NH0A 2G8VA 1BIZA 1VSEA 1VSHA 2EX3A 2Y1JA 1QE1A 3IS9A 3DOKA 3OYLA 1C6VA 3EYZA 3ZSZA 4CCHA 3HPGA 1CZBA 1GOCA 4RG8A 1ZBHA 4PA1A 4KHQA 2FBYA 4LH5A 1KTQA 1DTQA 1BISA 1FXXA 3T19A 4CEQA 2HHQA 3HO1A 4CJVA 2Q3SA 3KLGA 3AVGA 3HP9A 4E7LA 1S1UA 1N6QA 1ZBFA 4E7IA 1TK0A 3CYMA 5FRNA 1NJZA 3VN5A 1NKEA 2E6LA 2KFNA 3DRPA 2Z1JA 3QNOA 4CGDA 5HRNA 3OYAA 3S9HA 4B9NA 1KRPA 1RT7A 2KQ2A 3OYEA 3ZT3A 1BGXT 4L8RB 3LP0A 3L2QA 4JRPA 3T3FA 3HYFA 2ATQA 3QESA 4Q0BA 2KW4A 3LPUA 3NGIA 3TR8A 3HP6A 2ETJA 4KB0A 4DWIA 4FLTA 2I5JA 4DTRA 3MECA 5FROA 4YNQA 3NH2A 1BI4B 4FJ5A 3F9KA 2FBXA 3AVCA 4C8NA 3LWLA 1X9MA 3K5MA 4RW6A 1BQMA 3D0PA 4DU1A 1VRUA 3CM6A 4CERA 4DFKA 2YNIA 4CGHA 3LAKA 3OYBA 1X9SA 2LSNA 4FJKA 4DS5A 4IG0A 4C8MA 4DSFA 1RT1A 1LV5A 3SZ2A 5I3UA 4NCBA 3RMDA 5KGXA 3AVHA 3PX4A 3OS0A 3L2VA 1NKBA 1NK6A 1JLAA 4FLYA 4KI4A 1RT3A 1XI1A 4DG1A 4B8AB 1T03A 4BE1A 4CK3A 3VQCA 4ID5A 2EHGA 3KK2A 4F2SA 4CF1A 4AHRA 3ZT1A 1RT2A 4KRFA 2IDOA 3NF7A 4B08A 1C1AA 3K5NA 4DLEA 3V1RA 4IKFA 2WOMA 2XO7A 1XHXA 1YTUA 1EETA 4DS4A 1A5XA 4ELVA 4FJNA 3NF6A 4CE9A 3AVFA 4LD0A 5I42A 1EXQA 1JLQA 3DOLA 3RR7A 4B9TA 4CFBA 1TL1A 2Z1IA 2BGGA 1JKHA 4MFBA 4CIFA 1VSLA 3HJFA 2XHBA 3NF9A 1C0TA 4KHNA 3DYAA 3HVTA 4CGJA 3MEEA 4H8KA 1IH7A 3VQ4A 2HHWA 3SYZA 4HCCA 1X9WA 4DTSA 4W5OA 4ID1A 3HM9A 2PY5A 4OPJA 5C25A 2B4JA 2DY4A 3VQQA 3LPTA 2FBVA 3B6PA 4DF8A 2XY6A 1CLQA 3LDSA 5HROA 4N47A 3VQDA 4E7HA 2ZQBA 3KLIA 4FVMA 3OS1A 4F2RA 5SWMA 4O5BA 3QEIA 2YNFA 4NYNA 4I7FA 2KTQA 3SQ1A 3I0SA 1S9GA 1TV6A 4AHTA 1ZBLA 1UOCA 2QKKA 4C8KA 1NK7A 2DFEA 4CEDA 2O4IA 3P1GA 1ZBIA 2HW3A 4BWMA 2IAJA 1S9EA 4M3WA 3AO3A 3OJSA 1ASVA 2GUIA 2F8SA 1VSMA 2YNGA 1HRHA 3OYKA 5C24A 3SJJA 4I9QA 3NFAA 4CF9A 4N41A 4FJ8A 3HL8A 1D5AA 3JYTA 3OYGA 3K5LA 2Y1IA 2X78A 4J2EA 4BDPA 4ZHRA 1XC9A 4KHUA 1ASWA 3SQ4A 1LAWA 4WE1A 1FKPA 4DF4A 1L3TA 2OPPA 2KZMA 3IAYA 1WAFA 1BCMA 1Z25A 3SUOA 4FJIA 2VWJA 4FJGA 4Z4CA 4FM2A 4KHYA 4EZ9A 4FW2A 3C94A 3RMAA 2OPRA 4CEBA 4B8CA 3DRSA 1NJWA 4FLWA 4CF8A 2YKMA 4KO0A 5FDLA 3KK1A 1L3VA 1RBVA 4CF0A 5KI6A 4ICLA 1RDCA 4CJ5A 1TKDA 1RBTA 3WNFA 3RR8A 4DQRA 2DFFA 3ZSVA 2P5GA 4PUOA 4CJPA 1VSJA 3QLHA 3A2FA 3NBPA 1JLGA 4OKKA 4CECA 4E1MA 2YKNA 1SKWA 2BE2A 3HPHA 4DSKA 3V81A 3PO5A 4EZ6A 4Y1DA 1L5UA 2ZD1A 4G1QA 3AO2A 1GOBA 3PV8A 1Z26A 1S1WA 1ASUA 3DRRA 4ZTJA 3ZSWA 4F8RA 4FK4A 5DK5A 4M3RA 4CEEA 1S6QA 1I3AA 4KTZA 3CQ8A 3K58A 1IKYA 3G10A 4K8XA 1K6YA 1S1TA 2PYLA 2HNDA 1BI4A 1VK0A 3PY8A 3NGZA 1X1PA 4AILC 3OYJA 3NDKA 1UWBA 2OPQA 2G8KA 2ZE2A 4HCBA 3AVLA 3LZIA 3AVBA 3V9XA 5J2NA 2QXFA 4O0IA 3ISNC 4CIGA 3SV3A 3V9SA 1D9DA 1C0MA 4N56A 4DQPA 4F4KA 3HT3A 4GMJB 1RDBA 4DFMA 1J9AA 4AHSA 1HMVA 4JLHA 4CJQA 4O55A 3HSTB 3JSMA 1CZ9A 1L3SA 1B92A 1KFDA 1S6PA 3ZCMA 3OYNA 3KKRA 4DU4A 4C8OA 2F8TA 1LW2A 1HNIA 1TKXA 1NKCA 3BGRA 3PX6A 1S1VA 4OGEA 1EX4A 1LWCA 2KFZA 2IOCA 2X74A 4QCLA 1KCFA 4FM0A 1B9DA 1SL1A 4B3OA 4CHOA 4M41A 2D5RA 3KD1E 1WSJA 1U4BA 2XY5A 1B9FA 4Z4IA 4I2QA 4KKOA 4CGFA 4E0DA 1RDDA 1WSGA 4QOZB 3TAQA 2XY8A 3L2UA 2P51A 1LWEA 1SKRA 3ZT2A 3I8DA 3H08A 1Q9XA 2B5JA 4IG3A 4FJJA 4KHSA 4LSLA 1T05A 4PY5A 2IGIA 4KV8A 5EU7A 3OYIA 4DTOA 1A5WA 3U3GA 1BQNA 1VRTA 4CFAA 3O3HA 2HNZA 4HUEA 3AVJA 4OVLA 4FJXA 4PWDA 5KRSA 2HMIA 1NK9A 3KKSA 4JRQA 1UA1A 1NOZA 3OYCA 2X6NA 4UQGA 4GW6A 3K57A 3CFRA 2VWKA 3AVKA 1BCOA 3ZT0A 3P83D 1W0HA 5J2QA 4I2PA 4FJLA 3M8SA 1DTTA 3M8RA 1C1BA 5T7BA 2OPSA 4BACA 3S3NA 2HHTA 4BWJA 4CF2A 5JS1A 3VQPA 4RW4A 3FFIA 3ITHA 3DLBA 4B9UA 4M3YA 1U04A 4FZYA 2P1JA 3WNEA 1GOAA 3VQ9A 2DTUA 3LP1A 3NE6A 3TABA 3V1OA 4CIEA 1VSFA 4Z4FA 1Y97A 1J54A 1HNVA 4CJFA 1RBSA 1IKXA 2OYQA 1YTAA 3ASMA 4M45A 3V6DA 3V9ZA 1HPZA 3O4NA 1FKOA 4F3TA 1N5YA 4M3UA 1WSFA 3NH1A 1TKTA 3PX0A 3ZSOA 2GV9A 4CGGA 1TGOA 1UAXA 3LP3A 4OKJA 3RMBA 3QEWA 5HP1A 1CXUA 1C0UA 1TVRA 3M8QA 3P5JA 2D0CA 3MEDA 3E01A 4O4GA 4OLBA 1J53A 1QSSA 2HVHA 1WLJA 1JLCA 4CESA 3AA2A 4DU3A 1BHLA 1VSDA 2A1SA 1F21A 3LWMA 3SQ0A 1T8EA 4J2DA 1FK9A 1ZYQA 3DLGA 4FLVA 2BANA 2YHBA 3K5OA 1WNSA 4OKEA 1KFSA 4KPYA 1ZBUA
chains in the Genus database with same CATH superfamily
4JS5A 4FJ9A 2RE2A 4Y1CA 3CMEN 4ELTA 2E8AA 3OA9A 1KVBA 2NUBA 1W2BM 4QAGA 4M3ZA 4JI4K 5E26A 3O6WA 3W3DA 1J6ZA 1TK5A 4IXCA 1E3MA 3CJ7A 3AVAA 1BG3A 4JKAA 1HYVA 4M3TA 4OX9K 4Z4GA 1KSPA 4B1ZA 4B9SA 1KLMA 4JI7K 4B1UB 3ENBA 5F1XA 3THYA 4H4MA 4HUGA 4FWSA 4BRGA 3ZSQA 5FLXO 4GVMA 2R7YA 1MDUB 3F5TA 4DTPA 4DR7K 3K59A 1O1WA 3L2WA 4UY8O 3FZLA 5E84A 3DLKA 3J7YP 4R5PA 4CJKA 4YORA 2YI1A 4IFVA 1Q82O 3AVMA 3O3GA 3THWA 3MXMA 1RILA 1JLFA 4FPAA 3VGMA 4JS4A 5JICA 3ZETA 3G4SN 1QSYA 4H0PA 3QEXA 4DTNA 4Q5VA 4CZJA 3PLAA 4K25A 3RWUA 4JKDA 2W42A 3ENOA 1KLNA 5K14A 1L3UA 4ZTFA 3CFOA 1S3XA 5AFUH 3TAFA 2A6AA 3CM5A 4BDYA 4WF9L 4FCYA 5AQPA 3CC4N 4X66K 4XH1A 2QKBA 4I9LA 1SKSA 5AR0A 3ZX2A 4EP5A 3CETA 1HQUA 1QS4A 4K8ZA 1U48A 5E41A 4GV3A 2OZSA 5KGWA 3J8AA 2NRXA 5AQXA 3ZT4A 2HF3A 3V4IA 1JCGA 3THVA 3VEXA 4JD2B 4PKIA 3HI0A 2P9LA 4YOTA 3Q7CA 2ZGZA 1T7PA 1N32K 1YXQA 1OH6A 5C42A 2G8WA 3LAMA 4PKHA 3QIOA 1YIJN 3SMSA 1RBUA 3VTHA 3RSEA 1S5JA 3AO4A 4J2BA 2P5OA 3QINA 3WNHA 3AA3A 1NLVA 3JS6A 4CHYA 1VQON 4FLXA 3VTIA 3VQBA 5F2RA 2CGLA 4CBXA 3AA4A 4KTWA 2QI2A 1VQMN 3N4QA 2Q31A 4B1VA 3O8MA 4DTXA 3VF2A 4CFDA 1YVUA 2V52B 4BC3A 3M8PA 3QEVA 1RT4A 3R6MA 3VQ5A 1R0AA 5BPLA 4BR5A 1NGBA 3KIOA 5SZTA 4FVUA 1XWLA 1JXBA 4IFYA 1IBMK 3CJBA 2WBNA 4QS8A 3SAFA 1RTJA 4YOUA 2Q2RA 4A5AA 3CXCM 4RCHA 4CK2A 2RKIA 3C6AA 1Q86O 2UU9K 3QBXA 5H1SQ 4FWLA 4YDUC 1S1XA 2A1RA 1ATSA 3ULDA 3CG7A 3DXMA 1JL2A 1HX1A 1NJWA 4FK0A 1QTMA 2UUAK 4BE0A 3SNNA 4RW7A 4CEAA 4FZXC 4E1NA 2E2QA 4CHZA 2FF6A 2Z1HA 1HYSA 4NLBA 4DTJA 4AM7A 3DJCA 1NK0A 3L3UA 3M5RA 3D2EB 2H3GX 1QE1A 3OYLA 4CCHA 3HPGA 3HOTA 4PA1A 1QVFM 2FBYA 4CD1A 1KTQA 4H5TA 1BISA 3T19A 4CEQA 2HHQA 2Q36A 1RDWX 4CJVA 2I7PA 3KLGA 5AQZA 2FSNA 3TU5A 1ZBFA 4E7IA 1BDGA 3QNOA 1NM1A 5HRNA 3S9HA 4WYBA 3VERA 1KRPA 1VQ7N 3OYEA 4JKCA 3LP0A 3L2QA 5BRFA 3HYFA 3QESA 2KW4A 2QWLA 1NWKA 1IBLK 4DTRA 4FJ5A 3MECA 3NH2A 4JYAK 5AQLA 3VEZA 3AVCA 5LJWA 5KPRA 1BQMA 3D0PA 2Q1NA 4CERA 4CGHA 4DS5A 4C8MA 4DSFA 4JI6K 3A0IX 5I3UA 5EXWA 2F9TA 1NK6A 3EE9A 3CCLN 4GY2B 4DG1A 4B8AB 3KK2A 1ZC6A 4B9QA 3R8EA 4CF1A 5LMNK 1K8AO 3ATUA 1RT2A 3NF7A 2O8BB 2VGMA 5EX5A 2YCHA 4DS4A 4HTLA 1NGCA 3AVFA 3DAWA 2UXCK 1JLQA 3DOLA 1TL1A 1MWKA 1JKHA 4CIFA 2BGGA 2O8EB 5AQQA 3HJFA 3NF9A 4KHNA 3WT0A 4LF7K 1IH7A 2ZJQL 3VQ4A 3SYZA 4HCCA 4DTSA 2PY5A 4OPJA 5EY4A 1BA0A 2B4JA 1YI2N 3LDSA 1ZBSA 1OVYA 2ASOA 1KQSM 2ZQBA 1GLEG 5SWMA 3QEIA 2HBMA 4AHTA 3MCAB 4C8KA 2DFEA 1ZBIA 2HW3A 2IAJA 4M3WA 1ASVA 2YNGA 3SJJA 4I9QA 2ZWHA 1K8KB 3OYGA 3K5LA 2X78A 3G71N 1LAWA 2CH6A 1HNZK 1WBDA 5LJVA 1L3TA 2OPPA 5AFUA 3IAYA 1BCMA 3SUOA 1IBKK 2VWJA 1VQKN 4FJGA 3BEXA 4BQLA 1ESVA 3K0SA 1OKJA 3O9UA 3O9TA 4B8CA 3DRSA 4QS9A 4CEBA 4CF8A 2YKMA 2AP1A 4KO0A 5FDLA 1L3VA 4CF0A 4ICLA 1RBTA 3A2FA 4CECA 1N36K 3HPHA 3MX5A 1MWMA 1QQNA 2ZD1A 5JLHA 1S1TA 3PY8A 1BI4A 3OYJA 3VEVA 3NDKA 1UWBA 2E1YA 1M90O 3L0QA 4CIGA 4IO9L 3SV3A 4OO1J 1QZ5A 1GLCG 1J9AA 4JLHA 4DV4K 1CZ9A 3EN9A 3ZCMA 2F8TA 3F2KA 1LW2A 4IOAL 1NKCA 1GLFO 3BGRA 1W97L 3I56N 4H0OA 3AAQA 3J7AP 1EX4A 3L4QA 1LWCA 2IOCA 4FM0A 2D5RA 3MX2A 4B3MK 3O80A 2XY5A 1HR0K 1X3MA 4I2QA 4KKOA 3WXMB 1RDDA 3TAQA 1DGKN 3H08A 4KHSA 2NLXA 4FJJA 2IGIA 4KV8A 4DTOA 1BQNA 4FJXA 5C2FA 4CZLA 5KRSA 3KKSA 3P39A 4JRQA 3O1WA 1NOZA 5GAEP 4UQGA 4GW6A 2V7ZA 3K57A 3EEQA 4JKGB 1JCEA 1BCOA 2O8DB 5J2QA 1DTTA 3TTCA 2OPSA 2YX6A 3KWGA 5JS1A 3DLBA 3H1QA 4FZYA 4MO4A 2P1JA 3CC2N 3M3ZA 4H0XB 4JKFA 1KAYA 3CERA 3V1OA 1J54A 3EE8A 4DV7K 1IKXA 4DR4K 4V19S 3ASMA 2QWMA 1HPZA 3Q7BA 4F3TA 1XQSC 3CPEA 3JXUA 2ITMA 3RMBA 4PHTX 1QQMA 3P4IA 2P9PB 3IMXA 2HVHA 5GADP 1JLCA 3QFPA 1NJIO 3A5NC 2A1SA 3LWMA 5IWAK 1T8EA 4BRAA 1FK9A 2QXLA 3MDQA 2OTJN 1KFSA 3BZKA 3VPZA 1O13A 1U2VA 1NK4A 2EWSA 4W5TA 5AQWA 1HPMA 3TSQA 3ZYYX 4YHHK 3PO4A 3H3NO 4E1JA 3AVIA 3FGUA 3EY1A 4A57A 2HVIA 2JGUA 4O8UA 4FZZA 1WUAA 4WCEL 3NAEA 3SLCA 3U6FA 5AQVA 2X6SA 3SAGA 1JLBA 1KXPA 2OTLN 4TSXA 1Z6RA 3VQ7A 4DQ8A 2D0AA 3SPZA 3KHYA 1WSEA 3M6GA 1LWFA 2ASPA 2NRWA 1IKWA 5BPNA 1TYQA 2WUSA 3OYMA 3V1QA 2JLEA 1YT3A 3IRXA 5CYQA 3J7ZO 4YFUA 1ATRA 4BVOA 4BG9A 2YHYA 2GBZA 2I7NA 3CI5A 3SI6A 1XHZA 1QSLA 2RPIA 3AY9A 4CEZA 3THXA 4CJEA 4IBNA 3A5LC 1HKGA 3IG1A 4FOEA 1WN7A 4BR7A 4ISEA 2IVPA 3QBWA 4CFCA 3RTVA 4E89A 1SAZA 1Q81O 1Q7YO 1XNQK 2UUBK 2UXDK 4DR5K 1KAZA 4M42A 5J2MA 3A8YA 3ZSRA 4CJUA 5M1OA 3OJUA 4FWOA 4NCGA 3TI0A 3TSPA 4KI6A 1VSKA 3OVNA 1BL3A 1E4FT 4M3XA 3TWHA 3ZEUB 2KHOA 3AAPA 3JAMO 1VQ9N 1REVA 4LF9K 3U9DA 1XUPO 3VQAA 4E7KA 3MXIA 4DMNA 5KQDA 1SV5A 4FW1A 4IDKA 3OYFA 3WXJA 4LFAK 3FZFA 5AZIB 1YUWA 2NZTA 4DSEA 4CJWA 4HTUA 1OH7A 3UKRB 3SAHA 1KVAA 5DMRA 4CW7B 3BF1A 4CVNE 2A41A 2Z1GA 2PFUA 5AQIA 4OGCA 3PUFA 3DLRA 2DFHA 3ID8A 3SBGA 1TL3A 1W9HA 2HHSA 3D2FA 4FPBA 3ULEA 4CJ4A 4Z0UA 4NXMK 2XY7A 3TTDA 4DV5K 2D4WA 1NK5A 3QEPA 4DUYK 4LSNA 4JNEA 1HJRA 4BY9C 3UIQA 1WSIA 3OTOK 4C23A 4DTUA 4DTMA 2QK9A 3C65A 3MN6A 3LDQA 5F0XA 4OLAA 1P8ZA 3C6TA 3CJ9A 2QEXN 3OYHA 2Q0UA 4KB1A 4CZFA 4IJAA 3LDPA 3TAPA 4AHCA 2P9SA 3O5BA 4K0KK 4H4OA 3KTQA 4B9LA 3OBYA 4Z4HA 4O0JA 3MN9A 3ALYA 3DLHA 2ASMA 2QWRA 3GOIA 2IC3A 4N76A 3FZMA 2E4LA 1ITGA 2F9WA 4WFBL 4EFHA 1K9MO 3I55N 1OH5A 1DEJA 3DLLL 5KPZA 2A3ZA 3O4QA 3MAQA 5AQGA 4CHNA 4C8LA 2G8VA 4GKKK 5M1KA 1VSEA 2Y1JA 5BREA 3EYZA 1GOCA 1ZBHA 5JVHL 4MLHA 1T6DA 4LH5A 3SJHA 3GG4A 4YOWA 4B3SK 3ZLJA 3HO1A 4BR9A 4JD2A 2P9IB 1NBWA 1R59O 2VGNA 2Z1JA 3OYAA 3CMAN 1VQ5N 2KQ2A 3T69A 1E4GT 4L8RB 5AQNA 3THYB 3HP6A 5BN9A 4DWIA 4FLTA 2I5JA 4YNQA 5FROA 1J5EK 3F9KA 1X9MA 2NNWA 4IOCL 4BG8A 1VRUA 3CM6A 4K43A 2YNIA 1X9SA 3LAKA 4FJKA 2LSNA 3VF4A 5CE3A 4A2BA 1NG9A 2WC9A 5C15A 1LCUA 3RMDA 4H5RA 3TSUA 4XEIA 4FLYA 1RT3A 3THWB 4BE1A 4CK3A 2EHGA 3A5MC 1XMQK 3ZETB 4IKFA 2WOMA 2XO7A 1XHXA 1YTUA 4FJNA 1YITN 2O8FA 3M1FA 4LD0A 5FPEA 3ATVA 1VSLA 2HHWA 1X9WA 2HMPA 1YHQN 4ID1A 5C25A 4JHDB 4BRDA 3LPTA 3B6PA 1CLQA 3G25A 3SK3A 4DHYA 3VQDA 3OS1A 3H6EA 4F2RA 4O5BA 2JWKA 5AQMA 2KTQA 4WQ5C 1HLUA 4YOYA 1ZBLA 2QWNA 4BGAA 2E20A 3AO3A 2GUIA 3CJCA 3OJSA 2P9LB 1HRHA 4CF9A 2VQFK 4BDPA 5AZJB 4JAXA 2QA4N 2KZMA 1WAFA 1Z25A 3RSEB 4Z4CA 4FM2A 1OVQA 1BA1A 4FLWA 5MLCQ 3KK1A 2E2OA 1RBVA 1NU0A 5KI6A 1TKDA 3RR8A 3ZSVA 1GLAG 1VSJA 3QLHA 4AF1A 1IG8A 1YAGA 3S41A 1HJOA 4IEEA 1GLBG 1GOBA 2W41A 1Z26A 3C7NA 1ASUA 4FWNA 5DK5A 4KTZA 1I3AA 4FWQA 3UE5A 1IKYA 3G10A 2E2PA 2PYLA 1X1PA 1NGHA 4HCBA 4K41A 2RHKA 3LZIA 1Q18A 3AVBA 3VETA 4MDAA 3V9XA 5J2NA 2QXFA 4B1YB 1D9DA 4DQPA 1C0MA 3HT3A 4DFMA 1NGJA 4JK7A 2CH5A 4FWMA 4CJQA 3JSMA 1L3SA 1B92A 4C8OA 3HOSA 3KKRA 1P90A 2VWBA 1HNIA 1TKXA 4IDHA 1DT9A 4GNIA 1S1VA 3LL3A 4GV6A 1SL1A 4CHOA 1WSJA 2PAVA 3SBTA 4JK8A 3G6EN 2UYTA 1EO1A 2HBJA 3FZKA 5HOOA 4CBWA 4CI6A 2XY8A 3I8DA 4PY5A 1GLLO 5TKWA 4CFAA 3O3HA 3AVJA 1HNXK 2WFBA 3ZX3A 2J4RA 4IOXA 1NK9A 2HMIA 3LDNA 2KLAA 3CFRA 4DR6K 4BRQA 4YDUA 3M8SA 1C1BA 4BACA 2PBDA 3VQPA 4AM6A 1XNRK 4RW4A 2NRRA 4M3YA 3IUCA 3NVKA 2DTUA 3VQ9A 1FJGK 4CIEA 1VSFA 5LMUK 5GIPA 2WTUA 4K42A 1YTAA 4M45A 5JMVA 1VAZA 1WSFA 3NH1A 3OBWA 4CGGA 1TGOA 1UAXA 2V7YA 1CXUA 1YVNA 4I6MB 1TVRA 3M8QA 3P5JA 2D0CA 3E01A 1J53A 4NB4A 1QSSA 1WLJA 1NGAA 4EAHD 1BHLA 4DU3A 1VSDA 1F21A 3WXIA 4J2DA 2ZJPL 1IJJA 2BANA 2YJEA 1NJXA 5JS2A 2BDPA 5KTQA 3S3OA 3MN7A 5AQKA 1NGFA 4J2AA 1WAJA 3VGLA 4BVPA 4DQSA 4W5QA 3SV4A 3QO9A 3C95A 1X9JA 4FYDA 3SUPA 3F73A 1V4SA 1TKZA 2NRTA 5M1PA 4LC9B 1RT5A 4CJTA 2ZGYA 3V9UA 1JLEA 2B6AA 1Q8IA 3VEOA 4CEFA 2F96A 2OZMA 3AO1A 5AQFA 1LOTB 5BRHA 4FLZA 4LY7A 2ITGA 4DQQA 3WEEB 2IIRA 3OS2A 1RFQA 4ISGA 4BRIA 1HNWK 4CJRA 1BU6O 5EOYA 5AQTA 4CJ3A 4B1XB 3RMCA 2G8UA 2QW9A 1S72N 1TUYA 1SS6A 3R9PA 3VQ8A 4W5NA 3CFPA 1QQCA 4CGIA 2HHVA 3OYDA 1GLDG 4XH5A 4AHVA 3NHGA 3O1BA 4B3TK 2GELA 1QHTA 1HYZA 3SUNA 1QVGM 5J2PA 4BGBA 3CPWM 4KTQA 2O8DA 3BP8A 3IKMA 5HRSA 3L3VA 4E7JA 1NJYA 2G8IA 5FPDA 1JXEA 3UKUB 3L4IA 5CYMA 1SL2A 1SQKA 2D0PA 1M1KO 1I39A 5KRTA 2YV0X 3TARA 4JI3K 4MQ3A 4DV3K 4C1NI 3AA5X 1D8YA 3LANA 2P9KB 1S22A 1LW0A 4H0VB 5ADXH 3QIPA 4LF8K 4HUFA 1VQLN 2VG5A 1RNHA 2O8CA 3MK6A 3LM9A 4ILJA 3QDKA 3QNNA 5LY3A 2FSJA 5CZ1A 3SCXA 2FC0A 2G8FA 2NRHA 4NCAA 2KZZA 3SPYA 5HBMA 3FZHA 3VA0A 4U67L 4L3QA 2P9UB 3NCIA 1NNEA 1OH8A 3L2RA 3MEGA 2A40A 1U6ZA 4CK1A 2P9NB 4FJHA 4CJLA 3LP2A 5IT9O 3KLFA 3DXKA 4FWKA 3EKSA 3L8BA 4FK2A 3DI6A 4BRKA 1D4XA 4FM1A 2ZF5O 4E3SA 3OW2M 5I9EB 3K9KA 1IKVA 4JEPA 4RW8A 5CY4A 3T1AA 2HB5A 5AQHA 2GEMA 4E19A 3CCQN 3V9WA 1X3NA 4EP4A 3MXJA 5AQUA 4B1WB 1XC3A 3J80O 1UA0A 3LDLA 4FXDA 3SQ2A 2HHUA 5ELZA 1BUPA 3CCSN 4MO5A 1RCHA 1A5VA 3GBTA 3U3YA 2HBLA 3VQEA 5HLFA 4CEOA 4FOIA 4O44A 2OCEA 3ENHA 4DV1K 1HKBA 3KLHA 4BE2A 4CZGA 4KBOA 4CZEA 4ELUA 3O08A 3KD5E 3PIPL 4EIAA 1RBRA 3WUHA 4LFCK 1Q9YA 2RN2A 4OPAA 4OPKA 3OY9A 1EKEA 1NGDA 3AO5A 5EVZA 4KAZA 3O9SA 1SUQA 3VQ6A 2W6LA 4CJSA 3CC7N 5DM6L 4DSJA 1SL0A 3GDQA 4KREA 1VQ4N 4H5WA 1BO5O 3I0RA 4JI8K 1U2VB 3H46O 4XH4A 3KWIA 4LH4A 3NH0A 2QWOA 2D1KA 3ZSZA 3CQXA 1CZBA 3EL2A 4RG8A 3OHRA 4BRHA 3HTVA 2GTDA 1DTQA 3ZX0A 5B8HA 1KAXA 1RDUA 3CCRN 2Q3SA 4R79A 4E7LA 1S1UA 1G99A 3CYMA 1NJZA 3VN5A 3CIPA 2KFNA 3DRPA 3FLCO 4NO7A 4EHUA 1XMOK 1HKCA 4M63C 4NXNK 1RT7A 2D0OA 3U8XA 1BGXT 3T3FA 4JRPA 4Q0BA 1TYQB 3VEWA 3D6RA 4WFNL 4FSVA 4KB0A 2BUPA 2FBXA 3LWLA 3K5MA 4IEIA 4RW6A 3CJ1A 3VMFB 4A5BA 4YOVA 4DFKA 5C0YA 1TUUA 2FXUA 1LV5A 4FWRA 3SZ2A 5KGXA 5BR9A 3OS0A 3THXB 1NKBA 1JLAA 4KI4A 1XI1A 4DV2K 1T03A 3QMLA 4ID5A 1MA9B 5M1FA 2IDOA 4A61A 4LFBK 3K5NA 4DLEA 3V1RA 3MMVA 1YF5L 3AGRA 4ELVA 1WOQA 3NF6A 1NMNA 4CE9A 5I42A 3E9LA 1EXQA 3RR7A 5C12A 4MFBA 2XHBA 1C0TA 3DYAA 4HWIA 3T1HK 3HVTA 4H0TB 3MEEA 4H8KA 4H03B 3R1XA 2W6KA 4W5OA 2GUPA 3VQQA 5GAGP 2FBVA 2XY6A 5HROA 3W0LA 4E7HA 4FVMA 3KLIA 2YNFA 3D7EO 2QKKA 1UOCA 3P1GA 4BRLA 4F9OA 4BWMA 2F8SA 2BTFA 3O9RA 3OYKA 4FJ8A 3NFAA 1D5AA 2CGJA 3FR0A 4J2EA 4ZHRA 4PL7A 4KHUA 3SQ4A 4WE1A 4DF4A 4AQYK 3PSIA 5CHIA 3C0BA 2IVOA 4FW2A 3C94A 2OPRA 5HL7L 1RDCA 3WNFA 5ADXA 2P9IA 3PSFA 2DFFA 4DQRA 2P5GA 4GVEA 3D2FB 4PUOA 2IVNA 4CJPA 3NBPA 1JLGA 4OKKA 3ULEB 3HM8A 2BE2A 3PO5A 3VENA 4Y1DA 4G1QA 3AO2A 4ZTJA 1S1WA 3DRRA 4F8RA 3ZSWA 4CEEA 3CQ8A 3P31A 4CBUA 3K58A 1NGGA 3CCVN 3CQYA 3NGZA 1VQNN 3ID6A 4H5NA 2G8KA 2ZE2A 3E9PA 3WXKA 3TTFA 3NVMA 4O0IA 4F4KA 3MCPA 4N56A 4GMJB 1RDBA 1QZ6A 4AHSA 1HMVA 3HSTB 2HF4A 3WQUA 4DU4A 3EKUA 4WFAL 4QS7A 2P9SB 2FF3B 4OGEA 3VESA 2KFZA 2X74A 4B3OA 4M41A 3H1VX 1U4BA 4RWTA 5LL6Z 1QHAA 1B9FA 3R3LA 1NGIA 4E0DA 4QOZB 3J81O 2P51A 1LWEA 3ZT2A 4IG3A 4H5VA 3OYIA 3DWLA 1A5WA 1VRTA 3MN5A 2YHXA 4JK9A 4BROA 4HUEA 4PWDA 4IFEA 4JHDA 4JKEA 3HZ6A 1UA1A 2X6NA 3AVKA 3ZT0A 2ZJRL 4MLEA 3S3NA 5T7BA 3L6QA 4BWJA 3FFIA 1U04A 4BR4A 3WNEA 1GOAA 1NMDA 5KPTA 3NE6A 3FE1A 4Z4FA 4FWPA 1RBSA 4CJFA 5AZJA 3FFKB 3V9ZA 2VCPA 1N5YA 4M3UA 1BOTO 4ILGB 4BR2A 4OKJA 3IFRA 1C0UA 4O4GA 4OLBA 3MEDA 4IO8A 4H0YB 4CESA 2A42A 4G9ZA 1Z05A 4M7YA 1ZYQA 3U9ZA 3E66A 4ILHA 2YHBA 4OKEA 3AGKA 2DPNA 1C0GA 5FRMA 3D2EA 3TAMA 1TAUA 4KHWA 4YY3K 1U45A 3WXLA 4A59A 3NF8A 4CZIA 3TAGA 4Z4EA 2G8HA 1MU2A 2HOEA 4DQIA 3KJVA 4WQ4C 4FLUA 2O8FB 4HHTA 1RTIA 3HPOA 3O9QA 4DV6K 1BIUA 2OA8A 2OANA 4B9MA 3BF3A 4OJRA 4RTFD 1RTDA 3ZSXA 2PZSA 3RRHA 1CZAN 3AARA 1LAVA 5BPMA 4OPHA 2IS3A 1IO2A 3U4LA 4B9VA 5GIOA 3QETA 1D9FA 1CXQA 1EWRA 1J5OA 1VQ8N 1JJ2M 3KLEA 4BRNA 5J1EA 4AHUA 1K73O 1KVCA 5C10A 2VG6A 4KFBA 4PL8A 1TK8A 4X62K 3ZSYA 2FLOA 3VA3A 3HVRA 2XRIA 4NYFA 3KK7A 3CD6N 3PIOL 4F3OA 3WNGA 3CCJN 5CZ2A 3DXMB 1IG9A 4Z94A 3S3MA 2D0BA 4GKJK 1U47A 2ZM6K 3BY5A 3KZBA 2W40A 2O8BA 1WB9A 3G0ZA 1U49A 3TANA 4HVJA 4DFPA 1VHXA 1BWFO 2QM1A 5GINA 3B6OA 2VG7A 2O8EA 3QB0A 5HRRA 4J8FA 1RT6A 3DM2A 4WQ5A 3K2PA 5KQ8A 4DCHA 3C7NB 2Q0RA 1NK8A 3HRGA 3HXMA 2E88A 1YJNN 4I6MA 2GWJA 2VQEK 2FSKA 4KHPK 5D3GA 4CHPA 4M7XA 3NGYA 2RF2A 4WQ4A 3MWTA 1K8KA 1G15A 4O8KA 3T7ZA 1WSHA 2YHAA 3EZ5A 3TAEA 3EZWA 1VQPN 4CD3A 3C6UA 3DMJA 4BC5A 3RRGA 1YJWN 1W7AA 4PQUA 4DR2K 1DLOA 1VSIA 4FJMA 2F4VK 4CHQA 4DSIA 2PYJA 3AV9A 1DKGD 1C1CA 4XIUA 5C2DA 4FJ7A 1TAQA 4N5SA 1EP4A 5BN8A 1FW6A 1JL1A 5CR4A 1HQEA 2E6MA 4YOXA 3WEEA 3AVNA 4W5RA 4BDZA 3QERA 2BH1A 4DSLA 3HK2A 3BDPA 4DUZK 2AJQA 3LZJA 4GV9A 2HHXA 1RDAA 2FBTA 4RW9A 5FPMA 2E2NA 3KK3A 1NOYA 2O4GA 3I33A 2YNHA 2YHWA 4FO0A 4DKWA 1RGIA 4CZMA 2GX9A 1HUXA 3WQTA 4U7BA 1RTHA 1N34K 3D45A 3DLEA 3O3FA 2GWKA 4BRMA 4O5FA 2HNYA 5HRPA 2WONA 3UKUA 4DB3A 2HSTA 3EO3A 3LALA 3MWPA 4DLGA 4AH9A 3SUQA 3SMPA 4DFJA 1V4TA 4NLCA 1BIZA 1VSHA 2EX3A 3HSCA 3IS9A 3IDHA 3DOKA 1C6VA 3C6HA 2VYPA 3O4WA 3VEYA 3K9JA 4KHQA 2P9KA 3TPQA 4JI2K 4JKGA 1KD1O 4KH6A 4A62A 4BRCA 1FXXA 1T44A 4IJNA 4JKHA 4JI5K 1YJ9N 3AVGA 3HP9A 1N6QA 1TK0A 1C0FA 5FRNA 1NKEA 2E6LA 3CCEN 4CGDA 4B9NA 4JI1K 3NMUA 1EWQA 3CCMN 3ZT3A 2P9UA 3UB5A 3N4PA 2ATQA 3LPUA 3NGIA 3TR8A 2ETJA 2UXBK 3HBTA 1BI4B 2P9PA 2P9NA 4C8NA 4BC4A 2F7TA 4DU1A 5AQOA 4LF6K 1SZ2A 2QTDA 3CF5L 3OYBA 4IG0A 1RT1A 4NCBA 3AVHA 3QICA 3PX4A 3L2VA 1T6CA 4X64K 4KH5A 3VQCA 4F2SA 4AHRA 3ZT1A 1VQ6N 4KRFA 3P38A 4B08A 1C1AA 4CZHA 3CHWA 5A2QO 2V51B 1I94K 1EETA 1A5XA 5BR8K 3BZCA 3E1YA 4B9TA 5FPNA 4CFBA 2Z1IA 1ILYA 4PKGA 3VF6A 1WBBA 4KPYA 4CGJA 4LF5K 3E9OA 3HM9A 1N8RO 5AQRA 4BRPA 1NGEA 2DY4A 4DF8A 5AQJA 3F9MA 4N47A 3KVGA 1T3VA 5M1NA 4NYNA 4I7FA 3SQ1A 3I0SA 2O8CB 5JLFA 1S9GA 1TV6A 1NK7A 3H45C 4CEDA 2O4IA 1S9EA 3VGKA 1VSMA 4BR0A 4BREA 5C24A 4N41A 1Y64A 3HL8A 3JYTA 2Y1IA 1EQYA 1XC9A 1ASWA 5AJ3K 2UUCK 4CJ7A 1FKPA 2QWQA 4FJIA 4KHYA 4EZ9A 3H3OB 3RMAA 4JN4A 2JWLA 4BRFA 5BRDA 4CJ5A 3DXKB 3B8AX 5DM7L 5M1QA 4E1MA 2YKNA 1SKWA 4FL9A 4DSKA 3V81A 4EZ6A 1L5UA 4DV0K 3PV8A 4FK4A 4M3RA 1S6QA 3LM2A 3ZEUA 4K8XA 1K6YA 4CZKA 1KC8O 2HNDA 3BUZB 1VK0A 5GAHP 5JVGL 2A5XA 4AILC 1QQOA 4KH4A 2OPQA 3AVLA 1ZXOA 2KKZA 3ISNC 2Q97A 4BC2A 3V9SA 4IWVA 3A5OC 4B3RK 4BQZA 4O55A 3VOVA 5AZIA 1KFDA 1S6PA 3OYNA 3PX6A 4MDBA 4JI0K 3UKRA 2NRZA 4C1NK 4QCLA 1KCFA 1B9DA 3RVCA 3QFUA 3KD1E 3LDOA 4Z4IA 3I8BA 4CGFA 1WSGA 3L2UA 4LF4K 5AQYA 1SKRA 1Q9XA 1N33K 2B5JA 4LSLA 1T05A 3T1YK 5EU7A 1JCFA 2E1ZA 3U3GA 4EHTA 2AA4A 2HNZA 4OVLA 2E5LK 2HBKA 3OYCA 4DR1K 2VWKA 3P83D 1W0HA 4FJLA 4I2PA 3GL1A 3M8RA 3GE1A 2HHTA 4CF2A 4A2AA 3ITHA 4B9UA 2HHHK 1H1VA 3CCUN 4JKBA 2CGKA 3LP1A 3TABA 5TKYA 1GLJO 1Y97A 1HNVA 2OYQA 4Y0WA 3V6DA 3CJAA 1FKOA 3O4NA 1TKTA 3PX0A 3ZSOA 2GV9A 1ATNA 3LP3A 3QEWA 2YJFA 5HP1A 5AQSA 4ISFA 4JV5K 3AA2A 4X65K 3SQ0A 2QWPA 1IV0A 2NRVA 3DLGA 4DR3K 4FLVA 3K5OA 1WNSA 4IZ9A 1ZBUA
chains in the Genus database with same CATH topology
4JS5A 4FJ9A 1NJXA 5JS2A 2BDPA 5KTQA 3S3OA 4Y1CA 5FRMA 4J2AA 3TAMA 1TAUA 1WAJA 4DQSA 1NK4A 4ELTA 4W5QA 4KHWA 1U45A 3SV4A 4W5TA 3NF8A 1KVBA 2NUBA 3QO9A 3TAGA 3C95A 2G8HA 3PO4A 4Z4EA 4FYDA 3SUPA 1MU2A 4QAGA 3F73A 4M3ZA 3AVIA 1TKZA 4DQIA 3KJVA 4FLUA 3EY1A 2HVIA 4HHTA 1RT5A 4CJTA 1RTIA 3HPOA 3V9UA 2JGUA 1BIUA 1TK5A 1JLEA 2OA8A 4FZZA 2B6AA 4B9MA 3NAEA 4OJRA 1Q8IA 3U6FA 4CEFA 1RTDA 3ZSXA 2X6SA 2F96A 3AVAA 1JLBA 3AO1A 1HYVA 3RRHA 2PZSA 2OZMA 1LAVA 4FLZA 4M3TA 4Z4GA 4TSXA 1KSPA 3VQ7A 4LY7A 2IS3A 1IO2A 2D0AA 2ITGA 3SPZA 4B9SA 1KLMA 4DQQA 4B9VA 1WSEA 3OS2A 1LWFA 1IKWA 3QETA 1D9FA 4CJRA 3OYMA 1CXQA 1J5OA 3V1QA 2JLEA 4CJ3A 4H4MA 3RMCA 2G8UA 1YT3A 4HUGA 3KLEA 5J1EA 4AHUA 3IRXA 5CYQA 3VQ8A 3ZSQA 1KVCA 3CFPA 4W5NA 4GVMA 4YFUA 2R7YA 1QQCA 2VG6A 4DTPA 2GBZA 4KFBA 4CGIA 2HHVA 1TK8A 3SI6A 3OYDA 1XHZA 3ZSYA 4AHVA 3NHGA 1QSLA 2RPIA 3K59A 1O1WA 3L2WA 3VA3A 4CEZA 2XRIA 3HVRA 4NYFA 4CJEA 1QHTA 1HYZA 3SUNA 4F3OA 3WNGA 4IBNA 3DLKA 3IG1A 4CJKA 4R5PA 4IFVA 5CZ2A 1WN7A 5J2PA 1IG9A 3AVMA 3O3GA 3MXMA 3S3MA 2D0BA 1U47A 1RILA 1JLFA 4JS4A 4CFCA 1QSYA 3G0ZA 3RTVA 4KTQA 4E89A 3QEXA 1U49A 3TANA 4HVJA 4DTNA 5HRSA 4Q5VA 4DFPA 3L3VA 3RWUA 4E7JA 2W42A 1KLNA 1NJYA 5K14A 3B6OA 2VG7A 4M42A 2G8IA 1L3UA 5J2MA 1JXEA 4ZTFA 5HRRA 3ZSRA 4CJUA 1RT6A 3CFOA 3OJUA 5CYMA 1SL2A 3DM2A 3TAFA 4NCGA 3K2PA 4BDYA 3CM5A 3TI0A 1I39A 5KRTA 4FCYA 4KI6A 2YV0X 1VSKA 3OVNA 3TARA 1NK8A 1BL3A 2QKBA 4M3XA 4I9LA 3TWHA 1SKSA 4MQ3A 3HXMA 4EP5A 3AA5X 1HQUA 1QS4A 3LANA 1D8YA 4K8ZA 1U48A 1LW0A 5E41A 1REVA 3QIPA 2OZSA 4HUFA 5KGWA 2VG5A 1RNHA 3VQAA 4E7KA 3MXIA 3ZT4A 5D3GA 3QNNA 3V4IA 4DMNA 3THVA 4CHPA 5CZ1A 3SCXA 3NGYA 2FC0A 1SV5A 2RF2A 4FW1A 4IDKA 3OYFA 2G8FA 4NCAA 1G15A 3EZ5A 3TAEA 1WSHA 2YHAA 1T7PA 2KZZA 5C42A 3SPYA 2G8WA 3LAMA 5HBMA 4DSEA 3VA0A 3QIOA 3C6UA 3DMJA 4CJWA 3NCIA 3RRGA 4HTUA 4PQUA 1RBUA 3L2RA 1KVAA 3MEGA 1DLOA 1S5JA 1VSIA 3AO4A 5DMRA 4J2BA 4CHQA 4FJMA 4CK1A 4DSIA 2PYJA 2Z1GA 3AV9A 2P5OA 3QINA 3WNHA 4CJLA 4FJHA 3AA3A 4OGCA 3PUFA 3LP2A 3DLRA 4CHYA 2DFHA 1C1CA 4XIUA 3KLFA 4FLXA 3L8BA 3VQBA 1TL3A 1W9HA 4FJ7A 1TAQA 3DI6A 4FK2A 2HHSA 4FM1A 4N5SA 1EP4A 4E3SA 4CJ4A 3AA4A 4Z0UA 4KTWA 2XY7A 1IKVA 1JL1A 1HQEA 2E6MA 1NK5A 4RW8A 5CY4A 3T1AA 2HB5A 4E19A 3V9WA 4DTXA 3QEPA 4LSNA 4EP4A 3MXJA 4CFDA 1HJRA 3AVNA 1YVUA 4W5RA 4BDZA 3QERA 3UIQA 3M8PA 3QEVA 1UA0A 1WSIA 1RT4A 4DSLA 3VQ5A 3SQ2A 3HK2A 4FXDA 4DTUA 1R0AA 2HHUA 4DTMA 3BDPA 2QK9A 3KIOA 5SZTA 2AJQA 1RCHA 1A5VA 1XWLA 3LZJA 2HHXA 1RDAA 1JXBA 4IFYA 3U3YA 1RTJA 4OLAA 2FBTA 4RW9A 3C6TA 3VQEA 5HLFA 4CEOA 4CK2A 2RKIA 3KK3A 1NOYA 3OYHA 4O44A 4KB1A 2O4GA 1S1XA 2YNHA 3KLHA 3TAPA 4AHCA 4BE2A 2A1RA 3ULDA 3CG7A 4ELUA 1JL2A 4H4OA 3KTQA 4B9LA 3KD5E 4FK0A 1QTMA 4Z4HA 4O0JA 4BE0A 3SNNA 3ALYA 3DLHA 1RBRA 4RW7A 1Q9YA 2IC3A 2RN2A 4N76A 4OPKA 3OY9A 1RTHA 1EKEA 3AO5A 2E4LA 1ITGA 3D45A 1SUQA 3DLEA 3VQ6A 4CEAA 4CJSA 3O3FA 4KAZA 4FZXC 4E1NA 4CHZA 1SL0A 4DSJA 2HNYA 2Z1HA 4KREA 5HRPA 2WONA 1HYSA 3I0RA 3LALA 3O4QA 4DLGA 4AH9A 3MAQA 4DTJA 3SUQA 1NK0A 3L3UA 4CHNA 4C8LA 4DFJA 4LH4A 3NH0A 2G8VA 1BIZA 1VSEA 1VSHA 2EX3A 2Y1JA 1QE1A 3IS9A 3DOKA 3OYLA 1C6VA 3EYZA 3ZSZA 4CCHA 3HPGA 1CZBA 1GOCA 4RG8A 1ZBHA 4PA1A 4KHQA 2FBYA 4LH5A 1KTQA 1DTQA 1BISA 1FXXA 3T19A 4CEQA 2HHQA 3HO1A 4CJVA 2Q3SA 3KLGA 3AVGA 3HP9A 4E7LA 1S1UA 1N6QA 1ZBFA 4E7IA 1TK0A 3CYMA 5FRNA 1NJZA 3VN5A 1NKEA 2E6LA 2KFNA 3DRPA 2Z1JA 3QNOA 4CGDA 5HRNA 3OYAA 3S9HA 4B9NA 1KRPA 1RT7A 2KQ2A 3OYEA 3ZT3A 1BGXT 4L8RB 3LP0A 3L2QA 4JRPA 3T3FA 3HYFA 2ATQA 3QESA 4Q0BA 2KW4A 3LPUA 3NGIA 3TR8A 3HP6A 2ETJA 4KB0A 4DWIA 4FLTA 2I5JA 4DTRA 3MECA 5FROA 4YNQA 3NH2A 1BI4B 4FJ5A 3F9KA 2FBXA 3AVCA 4C8NA 3LWLA 1X9MA 3K5MA 4RW6A 1BQMA 3D0PA 4DU1A 1VRUA 3CM6A 4CERA 4DFKA 2YNIA 4CGHA 3LAKA 3OYBA 1X9SA 2LSNA 4FJKA 4DS5A 4IG0A 4C8MA 4DSFA 1RT1A 1LV5A 3SZ2A 5I3UA 4NCBA 3RMDA 5KGXA 3AVHA 3PX4A 3OS0A 3L2VA 1NKBA 1NK6A 1JLAA 4FLYA 4KI4A 1RT3A 1XI1A 4DG1A 4B8AB 1T03A 4BE1A 4CK3A 3VQCA 4ID5A 2EHGA 3KK2A 4F2SA 4CF1A 4AHRA 3ZT1A 1RT2A 4KRFA 2IDOA 3NF7A 4B08A 1C1AA 3K5NA 4DLEA 3V1RA 4IKFA 2WOMA 2XO7A 1XHXA 1YTUA 1EETA 4DS4A 1A5XA 4ELVA 4FJNA 3NF6A 4CE9A 3AVFA 4LD0A 5I42A 1EXQA 1JLQA 3DOLA 3RR7A 4B9TA 4CFBA 1TL1A 2Z1IA 2BGGA 1JKHA 4MFBA 4CIFA 1VSLA 3HJFA 2XHBA 3NF9A 1C0TA 4KHNA 3DYAA 3HVTA 4CGJA 3MEEA 4H8KA 1IH7A 3VQ4A 2HHWA 3SYZA 4HCCA 1X9WA 4DTSA 4W5OA 4ID1A 3HM9A 2PY5A 4OPJA 5C25A 2B4JA 2DY4A 3VQQA 3LPTA 2FBVA 3B6PA 4DF8A 2XY6A 1CLQA 3LDSA 5HROA 4N47A 3VQDA 4E7HA 2ZQBA 3KLIA 4FVMA 3OS1A 4F2RA 5SWMA 4O5BA 3QEIA 2YNFA 4NYNA 4I7FA 2KTQA 3SQ1A 3I0SA 1S9GA 1TV6A 4AHTA 1ZBLA 1UOCA 2QKKA 4C8KA 1NK7A 2DFEA 4CEDA 2O4IA 3P1GA 1ZBIA 2HW3A 4BWMA 2IAJA 1S9EA 4M3WA 3AO3A 3OJSA 1ASVA 2GUIA 2F8SA 1VSMA 2YNGA 1HRHA 3OYKA 5C24A 3SJJA 4I9QA 3NFAA 4CF9A 4N41A 4FJ8A 3HL8A 1D5AA 3JYTA 3OYGA 3K5LA 2Y1IA 2X78A 4J2EA 4BDPA 4ZHRA 1XC9A 4KHUA 1ASWA 3SQ4A 1LAWA 4WE1A 1FKPA 4DF4A 1L3TA 2OPPA 2KZMA 3IAYA 1WAFA 1BCMA 1Z25A 3SUOA 4FJIA 2VWJA 4FJGA 4Z4CA 4FM2A 4KHYA 4EZ9A 4FW2A 3C94A 3RMAA 2OPRA 4CEBA 4B8CA 3DRSA 1NJWA 4FLWA 4CF8A 2YKMA 4KO0A 5FDLA 3KK1A 1L3VA 1RBVA 4CF0A 5KI6A 4ICLA 1RDCA 4CJ5A 1TKDA 1RBTA 3WNFA 3RR8A 4DQRA 2DFFA 3ZSVA 2P5GA 4PUOA 4CJPA 1VSJA 3QLHA 3A2FA 3NBPA 1JLGA 4OKKA 4CECA 4E1MA 2YKNA 1SKWA 2BE2A 3HPHA 4DSKA 3V81A 3PO5A 4EZ6A 4Y1DA 1L5UA 2ZD1A 4G1QA 3AO2A 1GOBA 3PV8A 1Z26A 1S1WA 1ASUA 3DRRA 4ZTJA 3ZSWA 4F8RA 4FK4A 5DK5A 4M3RA 4CEEA 1S6QA 1I3AA 4KTZA 3CQ8A 3K58A 1IKYA 3G10A 4K8XA 1K6YA 1S1TA 2PYLA 2HNDA 1BI4A 1VK0A 3PY8A 3NGZA 1X1PA 4AILC 3OYJA 3NDKA 1UWBA 2OPQA 2G8KA 2ZE2A 4HCBA 3AVLA 3LZIA 3AVBA 3V9XA 5J2NA 2QXFA 4O0IA 3ISNC 4CIGA 3SV3A 3V9SA 1D9DA 1C0MA 4N56A 4DQPA 4F4KA 3HT3A 4GMJB 1RDBA 4DFMA 1J9AA 4AHSA 1HMVA 4JLHA 4CJQA 4O55A 3HSTB 3JSMA 1CZ9A 1L3SA 1B92A 1KFDA 1S6PA 3ZCMA 3OYNA 3KKRA 4DU4A 4C8OA 2F8TA 1LW2A 1HNIA 1TKXA 1NKCA 3BGRA 3PX6A 1S1VA 4OGEA 1EX4A 1LWCA 2KFZA 2IOCA 2X74A 4QCLA 1KCFA 4FM0A 1B9DA 1SL1A 4B3OA 4CHOA 4M41A 2D5RA 3KD1E 1WSJA 1U4BA 2XY5A 1B9FA 4Z4IA 4I2QA 4KKOA 4CGFA 4E0DA 1RDDA 1WSGA 4QOZB 3TAQA 2XY8A 3L2UA 2P51A 1LWEA 1SKRA 3ZT2A 3I8DA 3H08A 1Q9XA 2B5JA 4IG3A 4FJJA 4KHSA 4LSLA 1T05A 4PY5A 2IGIA 4KV8A 5EU7A 3OYIA 4DTOA 1A5WA 3U3GA 1BQNA 1VRTA 4CFAA 3O3HA 2HNZA 4HUEA 3AVJA 4OVLA 4FJXA 4PWDA 5KRSA 2HMIA 1NK9A 3KKSA 4JRQA 1UA1A 1NOZA 3OYCA 2X6NA 4UQGA 4GW6A 3K57A 3CFRA 2VWKA 3AVKA 1BCOA 3ZT0A 3P83D 1W0HA 5J2QA 4I2PA 4FJLA 3M8SA 1DTTA 3M8RA 1C1BA 5T7BA 2OPSA 4BACA 3S3NA 2HHTA 4BWJA 4CF2A 5JS1A 3VQPA 4RW4A 3FFIA 3ITHA 3DLBA 4B9UA 4M3YA 1U04A 4FZYA 2P1JA 3WNEA 1GOAA 3VQ9A 2DTUA 3LP1A 3NE6A 3TABA 3V1OA 4CIEA 1VSFA 4Z4FA 1Y97A 1J54A 1HNVA 4CJFA 1RBSA 1IKXA 2OYQA 1YTAA 3ASMA 4M45A 3V6DA 3V9ZA 1HPZA 3O4NA 1FKOA 4F3TA 1N5YA 4M3UA 1WSFA 3NH1A 1TKTA 3PX0A 3ZSOA 2GV9A 4CGGA 1TGOA 1UAXA 3LP3A 4OKJA 3RMBA 3QEWA 5HP1A 1CXUA 1C0UA 1TVRA 3M8QA 3P5JA 2D0CA 3MEDA 3E01A 4O4GA 4OLBA 1J53A 1QSSA 2HVHA 1WLJA 1JLCA 4CESA 3AA2A 4DU3A 1BHLA 1VSDA 2A1SA 1F21A 3LWMA 3SQ0A 1T8EA 4J2DA 1FK9A 1ZYQA 3DLGA 4FLVA 2BANA 2YHBA 3K5OA 1WNSA 4OKEA 1KFSA 4KPYA 1ZBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JS5 A;  4FJ9 A;  1NJX A;  5JS2 A;  2BDP A;  5KTQ A;  3S3O A;  4Y1C A;  5FRM A;  4J2A A;  3TAM A;  1TAU A;  1WAJ A;  4DQS A;  1NK4 A;  4ELT A;  4W5Q A;  4KHW A;  1U45 A;  3SV4 A;  4W5T A;  3NF8 A;  1KVB A;  2NUB A;  3QO9 A;  3TAG A;  3C95 A;  2G8H A;  3PO4 A;  4Z4E A;  4FYD A;  3SUP A;  1MU2 A;  4QAG A;  3F73 A;  4M3Z A;  3AVI A;  1TKZ A;  4DQI A;  3KJV A;  4FLU A;  3EY1 A;  2HVI A;  4HHT A;  1RT5 A;  4CJT A;  1RTI A;  3HPO A;  3V9U A;  2JGU A;  1BIU A;  1TK5 A;  1JLE A;  2OA8 A;  4FZZ A;  2B6A A;  4B9M A;  3NAE A;  4OJR A;  1Q8I A;  3U6F A;  4CEF A;  1RTD A;  3ZSX A;  2X6S A;  2F96 A;  3AVA A;  1JLB A;  3AO1 A;  1HYV A;  3RRH A;  2PZS A;  2OZM A;  1LAV A;  4FLZ A;  4M3T A;  4Z4G A;  4TSX A;  1KSP A;  3VQ7 A;  4LY7 A;  2IS3 A;  1IO2 A;  2D0A A;  2ITG A;  3SPZ A;  4B9S A;  1KLM A;  4DQQ A;  4B9V A;  1WSE A;  3OS2 A;  1LWF A;  1IKW A;  3QET A;  1D9F A;  4CJR A;  3OYM A;  1CXQ A;  1J5O A;  3V1Q A;  2JLE A;  4CJ3 A;  4H4M A;  3RMC A;  2G8U A;  1YT3 A;  4HUG A;  3KLE A;  5J1E A;  4AHU A;  3IRX A;  5CYQ A;  3VQ8 A;  3ZSQ A;  1KVC A;  3CFP A;  4W5N A;  4GVM A;  4YFU A;  2R7Y A;  1QQC A;  2VG6 A;  4DTP A;  2GBZ A;  4KFB A;  4CGI A;  2HHV A;  1TK8 A;  3SI6 A;  3OYD A;  1XHZ A;  3ZSY A;  4AHV A;  3NHG A;  1QSL A;  2RPI A;  3K59 A;  1O1W A;  3L2W A;  3VA3 A;  4CEZ A;  2XRI A;  3HVR A;  4NYF A;  4CJE A;  1QHT A;  1HYZ A;  3SUN A;  4F3O A;  3WNG A;  4IBN A;  3DLK A;  3IG1 A;  4CJK A;  4R5P A;  4IFV A;  5CZ2 A;  1WN7 A;  5J2P A;  1IG9 A;  3AVM A;  3O3G A;  3MXM A;  3S3M A;  2D0B A;  1U47 A;  1RIL A;  1JLF A;  4JS4 A;  4CFC A;  1QSY A;  3G0Z A;  3RTV A;  4KTQ A;  4E89 A;  3QEX A;  1U49 A;  3TAN A;  4HVJ A;  4DTN A;  5HRS A;  4Q5V A;  4DFP A;  3L3V A;  3RWU A;  4E7J A;  2W42 A;  1KLN A;  1NJY A;  5K14 A;  3B6O A;  2VG7 A;  4M42 A;  2G8I A;  1L3U A;  5J2M A;  1JXE A;  4ZTF A;  5HRR A;  3ZSR A;  4CJU A;  1RT6 A;  3CFO A;  3OJU A;  5CYM A;  1SL2 A;  3DM2 A;  3TAF A;  4NCG A;  3K2P A;  4BDY A;  3CM5 A;  3TI0 A;  1I39 A;  5KRT A;  4FCY A;  4KI6 A;  2YV0 X;  1VSK A;  3OVN A;  3TAR A;  1NK8 A;  1BL3 A;  2QKB A;  4M3X A;  4I9L A;  3TWH A;  1SKS A;  4MQ3 A;  3HXM A;  4EP5 A;  3AA5 X;  1HQU A;  1QS4 A;  3LAN A;  1D8Y A;  4K8Z A;  1U48 A;  1LW0 A;  5E41 A;  1REV A;  3QIP A;  2OZS A;  4HUF A;  5KGW A;  2VG5 A;  1RNH A;  3VQA A;  4E7K A;  3MXI A;  3ZT4 A;  5D3G A;  3QNN A;  3V4I A;  4DMN A;  3THV A;  4CHP A;  5CZ1 A;  3SCX A;  3NGY A;  2FC0 A;  1SV5 A;  2RF2 A;  4FW1 A;  4IDK A;  3OYF A;  2G8F A;  4NCA A;  1G15 A;  3EZ5 A;  3TAE A;  1WSH A;  2YHA A;  1T7P A;  2KZZ A;  5C42 A;  3SPY A;  2G8W A;  3LAM A;  5HBM A;  4DSE A;  3VA0 A;  3QIO A;  3C6U A;  3DMJ A;  4CJW A;  3NCI A;  3RRG A;  4HTU A;  4PQU A;  1RBU A;  3L2R A;  1KVA A;  3MEG A;  1DLO A;  1S5J A;  1VSI A;  3AO4 A;  5DMR A;  4J2B A;  4CHQ A;  4FJM A;  4CK1 A;  4DSI A;  2PYJ A;  2Z1G A;  3AV9 A;  2P5O A;  3QIN A;  3WNH A;  4CJL A;  4FJH A;  3AA3 A;  4OGC A;  3PUF A;  3LP2 A;  3DLR A;  4CHY A;  2DFH A;  1C1C A;  4XIU A;  3KLF A;  4FLX A;  3L8B A;  3VQB A;  1TL3 A;  1W9H A;  4FJ7 A;  1TAQ A;  3DI6 A;  4FK2 A;  2HHS A;  4FM1 A;  4N5S A;  1EP4 A;  4E3S A;  4CJ4 A;  3AA4 A;  4Z0U A;  4KTW A;  2XY7 A;  1IKV A;  1JL1 A;  1HQE A;  2E6M A;  1NK5 A;  4RW8 A;  5CY4 A;  3T1A A;  2HB5 A;  4E19 A;  3V9W A;  4DTX A;  3QEP A;  4LSN A;  4EP4 A;  3MXJ A;  4CFD A;  1HJR A;  3AVN A;  1YVU A;  4W5R A;  4BDZ A;  3QER A;  3UIQ A;  3M8P A;  3QEV A;  1UA0 A;  1WSI A;  1RT4 A;  4DSL A;  3VQ5 A;  3SQ2 A;  3HK2 A;  4FXD A;  4DTU A;  1R0A A;  2HHU A;  4DTM A;  3BDP A;  2QK9 A;  3KIO A;  5SZT A;  2AJQ A;  1RCH A;  1A5V A;  1XWL A;  3LZJ A;  2HHX A;  1RDA A;  1JXB A;  4IFY A;  3U3Y A;  1RTJ A;  4OLA A;  2FBT A;  4RW9 A;  3C6T A;  3VQE A;  5HLF A;  4CEO A;  4CK2 A;  2RKI A;  3KK3 A;  1NOY A;  3OYH A;  4O44 A;  4KB1 A;  2O4G A;  1S1X A;  2YNH A;  3KLH A;  3TAP A;  4AHC A;  4BE2 A;  2A1R A;  3ULD A;  3CG7 A;  4ELU A;  1JL2 A;  4H4O A;  3KTQ A;  4B9L A;  3KD5 E;  4FK0 A;  1QTM A;  4Z4H A;  4O0J A;  4BE0 A;  3SNN A;  3ALY A;  3DLH A;  1RBR A;  4RW7 A;  1Q9Y A;  2IC3 A;  2RN2 A;  4N76 A;  4OPK A;  3OY9 A;  1RTH A;  1EKE A;  3AO5 A;  2E4L A;  1ITG A;  3D45 A;  1SUQ A;  3DLE A;  3VQ6 A;  4CEA A;  4CJS A;  3O3F A;  4KAZ A;  4FZX C;  4E1N A;  4CHZ A;  1SL0 A;  4DSJ A;  2HNY A;  2Z1H A;  4KRE A;  5HRP A;  2WON A;  1HYS A;  3I0R A;  3LAL A;  3O4Q A;  4DLG A;  4AH9 A;  3MAQ A;  4DTJ A;  3SUQ A;  1NK0 A;  3L3U A;  4CHN A;  4C8L A;  4DFJ A;  4LH4 A;  3NH0 A;  2G8V A;  1BIZ A;  1VSE A;  1VSH A;  2EX3 A;  2Y1J A;  1QE1 A;  3IS9 A;  3DOK A;  3OYL A;  1C6V A;  3EYZ A;  3ZSZ A;  4CCH A;  3HPG A;  1CZB A;  1GOC A;  4RG8 A;  1ZBH A;  4PA1 A;  4KHQ A;  2FBY A;  4LH5 A;  1KTQ A;  1DTQ A;  1BIS A;  1FXX A;  3T19 A;  4CEQ A;  2HHQ A;  3HO1 A;  4CJV A;  2Q3S A;  3KLG A;  3AVG A;  3HP9 A;  4E7L A;  1S1U A;  1N6Q A;  1ZBF A;  4E7I A;  1TK0 A;  3CYM A;  5FRN A;  1NJZ A;  3VN5 A;  1NKE A;  2E6L A;  2KFN A;  3DRP A;  2Z1J A;  3QNO A;  4CGD A;  5HRN A;  3OYA A;  3S9H A;  4B9N A;  1KRP A;  1RT7 A;  2KQ2 A;  3OYE A;  3ZT3 A;  1BGX T;  4L8R B;  3LP0 A;  3L2Q A;  4JRP A;  3T3F A;  3HYF A;  2ATQ A;  3QES A;  4Q0B A;  2KW4 A;  3LPU A;  3NGI A;  3TR8 A;  3HP6 A;  2ETJ A;  4KB0 A;  4DWI A;  4FLT A;  2I5J A;  4DTR A;  3MEC A;  5FRO A;  4YNQ A;  3NH2 A;  1BI4 B;  4FJ5 A;  3F9K A;  2FBX A;  3AVC A;  4C8N A;  3LWL A;  1X9M A;  3K5M A;  4RW6 A;  1BQM A;  3D0P A;  4DU1 A;  1VRU A;  3CM6 A;  4CER A;  4DFK A;  2YNI A;  4CGH A;  3LAK A;  3OYB A;  1X9S A;  2LSN A;  4FJK A;  4DS5 A;  4IG0 A;  4C8M A;  4DSF A;  1RT1 A;  1LV5 A;  3SZ2 A;  5I3U A;  4NCB A;  3RMD A;  5KGX A;  3AVH A;  3PX4 A;  3OS0 A;  3L2V A;  1NKB A;  1NK6 A;  1JLA A;  4FLY A;  4KI4 A;  1RT3 A;  1XI1 A;  4DG1 A;  4B8A B;  1T03 A;  4BE1 A;  4CK3 A;  3VQC A;  4ID5 A;  2EHG A;  3KK2 A;  4F2S A;  4CF1 A;  4AHR A;  3ZT1 A;  1RT2 A;  4KRF A;  2IDO A;  3NF7 A;  4B08 A;  1C1A A;  3K5N A;  4DLE A;  3V1R A;  4IKF A;  2WOM A;  2XO7 A;  1XHX A;  1YTU A;  1EET A;  4DS4 A;  1A5X A;  4ELV A;  4FJN A;  3NF6 A;  4CE9 A;  3AVF A;  4LD0 A;  5I42 A;  1EXQ A;  1JLQ A;  3DOL A;  3RR7 A;  4B9T A;  4CFB A;  1TL1 A;  2Z1I A;  2BGG A;  1JKH A;  4MFB A;  4CIF A;  1VSL A;  3HJF A;  2XHB A;  3NF9 A;  1C0T A;  4KHN A;  3DYA A;  3HVT A;  4CGJ A;  3MEE A;  4H8K A;  1IH7 A;  3VQ4 A;  2HHW A;  3SYZ A;  4HCC A;  1X9W A;  4DTS A;  4W5O A;  4ID1 A;  3HM9 A;  2PY5 A;  4OPJ A;  5C25 A;  2B4J A;  2DY4 A;  3VQQ A;  3LPT A;  2FBV A;  3B6P A;  4DF8 A;  2XY6 A;  1CLQ A;  3LDS A;  5HRO A;  4N47 A;  3VQD A;  4E7H A;  2ZQB A;  3KLI A;  4FVM A;  3OS1 A;  4F2R A;  5SWM A;  4O5B A;  3QEI A;  2YNF A;  4NYN A;  4I7F A;  2KTQ A;  3SQ1 A;  3I0S A;  1S9G A;  1TV6 A;  4AHT A;  1ZBL A;  1UOC A;  2QKK A;  4C8K A;  1NK7 A;  2DFE A;  4CED A;  2O4I A;  3P1G A;  1ZBI A;  2HW3 A;  4BWM A;  2IAJ A;  1S9E A;  4M3W A;  3AO3 A;  3OJS A;  1ASV A;  2GUI A;  2F8S A;  1VSM A;  2YNG A;  1HRH A;  3OYK A;  5C24 A;  3SJJ A;  4I9Q A;  3NFA A;  4CF9 A;  4N41 A;  4FJ8 A;  3HL8 A;  1D5A A;  3JYT A;  3OYG A;  3K5L A;  2Y1I A;  2X78 A;  4J2E A;  4BDP A;  4ZHR A;  1XC9 A;  4KHU A;  1ASW A;  3SQ4 A;  1LAW A;  4WE1 A;  1FKP A;  4DF4 A;  1L3T A;  2OPP A;  2KZM A;  3IAY A;  1WAF A;  1BCM A;  1Z25 A;  3SUO A;  4FJI A;  2VWJ A;  4FJG A;  4Z4C A;  4FM2 A;  4KHY A;  4EZ9 A;  4FW2 A;  3C94 A;  3RMA A;  2OPR A;  4CEB A;  4B8C A;  3DRS A;  1NJW A;  4FLW A;  4CF8 A;  2YKM A;  4KO0 A;  5FDL A;  3KK1 A;  1L3V A;  1RBV A;  4CF0 A;  5KI6 A;  4ICL A;  1RDC A;  4CJ5 A;  1TKD A;  1RBT A;  3WNF A;  3RR8 A;  4DQR A;  2DFF A;  3ZSV A;  2P5G A;  4PUO A;  4CJP A;  1VSJ A;  3QLH A;  3A2F A;  3NBP A;  1JLG A;  4OKK A;  4CEC A;  4E1M A;  2YKN A;  1SKW A;  2BE2 A;  3HPH A;  4DSK A;  3V81 A;  3PO5 A;  4EZ6 A;  4Y1D A;  1L5U A;  2ZD1 A;  4G1Q A;  3AO2 A;  1GOB A;  3PV8 A;  1Z26 A;  1S1W A;  1ASU A;  3DRR A;  4ZTJ A;  3ZSW A;  4F8R A;  4FK4 A;  5DK5 A;  4M3R A;  4CEE A;  1S6Q A;  1I3A A;  4KTZ A;  3CQ8 A;  3K58 A;  1IKY A;  3G10 A;  4K8X A;  1K6Y A;  1S1T A;  2PYL A;  2HND A;  1BI4 A;  1VK0 A;  3PY8 A;  3NGZ A;  1X1P A;  4AIL C;  3OYJ A;  3NDK A;  1UWB A;  2OPQ A;  2G8K A;  2ZE2 A;  4HCB A;  3AVL A;  3LZI A;  3AVB A;  3V9X A;  5J2N A;  2QXF A;  4O0I A;  3ISN C;  4CIG A;  3SV3 A;  3V9S A;  1D9D A;  1C0M A;  4N56 A;  4DQP A;  4F4K A;  3HT3 A;  4GMJ B;  1RDB A;  4DFM A;  1J9A A;  4AHS A;  1HMV A;  4JLH A;  4CJQ A;  4O55 A;  3HST B;  3JSM A;  1CZ9 A;  1L3S A;  1B92 A;  1KFD A;  1S6P A;  3ZCM A;  3OYN A;  3KKR A;  4DU4 A;  4C8O A;  2F8T A;  1LW2 A;  1HNI A;  1TKX A;  1NKC A;  3BGR A;  3PX6 A;  1S1V A;  4OGE A;  1EX4 A;  1LWC A;  2KFZ A;  2IOC A;  2X74 A;  4QCL A;  1KCF A;  4FM0 A;  1B9D A;  1SL1 A;  4B3O A;  4CHO A;  4M41 A;  2D5R A;  3KD1 E;  1WSJ A;  1U4B A;  2XY5 A;  1B9F A;  4Z4I A;  4I2Q A;  4KKO A;  4CGF A;  4E0D A;  1RDD A;  1WSG A;  4QOZ B;  3TAQ A;  2XY8 A;  3L2U A;  2P51 A;  1LWE A;  1SKR A;  3ZT2 A;  3I8D A;  3H08 A;  1Q9X A;  2B5J A;  4IG3 A;  4FJJ A;  4KHS A;  4LSL A;  1T05 A;  4PY5 A;  2IGI A;  4KV8 A;  5EU7 A;  3OYI A;  4DTO A;  1A5W A;  3U3G A;  1BQN A;  1VRT A;  4CFA A;  3O3H A;  2HNZ A;  4HUE A;  3AVJ A;  4OVL A;  4FJX A;  4PWD A;  5KRS A;  2HMI A;  1NK9 A;  3KKS A;  4JRQ A;  1UA1 A;  1NOZ A;  3OYC A;  2X6N A;  4UQG A;  4GW6 A;  3K57 A;  3CFR A;  2VWK A;  3AVK A;  1BCO A;  3ZT0 A;  3P83 D;  1W0H A;  5J2Q A;  4I2P A;  4FJL A;  3M8S A;  1DTT A;  3M8R A;  1C1B A;  5T7B A;  2OPS A;  4BAC A;  3S3N A;  2HHT A;  4BWJ A;  4CF2 A;  5JS1 A;  3VQP A;  4RW4 A;  3FFI A;  3ITH A;  3DLB A;  4B9U A;  4M3Y A;  1U04 A;  4FZY A;  2P1J A;  3WNE A;  1GOA A;  3VQ9 A;  2DTU A;  3LP1 A;  3NE6 A;  3TAB A;  3V1O A;  4CIE A;  1VSF A;  4Z4F A;  1Y97 A;  1J54 A;  1HNV A;  4CJF A;  1RBS A;  1IKX A;  2OYQ A;  1YTA A;  3ASM A;  4M45 A;  3V6D A;  3V9Z A;  1HPZ A;  3O4N A;  1FKO A;  4F3T A;  1N5Y A;  4M3U A;  1WSF A;  3NH1 A;  1TKT A;  3PX0 A;  3ZSO A;  2GV9 A;  4CGG A;  1TGO A;  1UAX A;  3LP3 A;  4OKJ A;  3RMB A;  3QEW A;  5HP1 A;  1CXU A;  1C0U A;  1TVR A;  3M8Q A;  3P5J A;  2D0C A;  3MED A;  3E01 A;  4O4G A;  4OLB A;  1J53 A;  1QSS A;  2HVH A;  1WLJ A;  1JLC A;  4CES A;  3AA2 A;  4DU3 A;  1BHL A;  1VSD A;  2A1S A;  1F21 A;  3LWM A;  3SQ0 A;  1T8E A;  4J2D A;  1FK9 A;  1ZYQ A;  3DLG A;  4FLV A;  2BAN A;  2YHB A;  3K5O A;  1WNS A;  4OKE A;  1KFS A;  4KPY A;  1ZBU A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  4FJ9 A;  2RE2 A;  4Y1C A;  3CME N;  4ELT A;  2E8A A;  3OA9 A;  1KVB A;  2NUB A;  1W2B M;  4QAG A;  4M3Z A;  4JI4 K;  5E26 A;  3O6W A;  3W3D A;  1J6Z A;  1TK5 A;  4IXC A;  1E3M A;  3CJ7 A;  3AVA A;  1BG3 A;  4JKA A;  1HYV A;  4M3T A;  4OX9 K;  4Z4G A;  1KSP A;  4B1Z A;  4B9S A;  1KLM A;  4JI7 K;  4B1U B;  3ENB A;  5F1X A;  3THY A;  4H4M A;  4HUG A;  4FWS A;  4BRG A;  3ZSQ A;  5FLX O;  4GVM A;  2R7Y A;  1MDU B;  3F5T A;  4DTP A;  4DR7 K;  3K59 A;  1O1W A;  3L2W A;  4UY8 O;  3FZL A;  5E84 A;  3DLK A;  3J7Y P;  4R5P A;  4CJK A;  4YOR A;  2YI1 A;  4IFV A;  1Q82 O;  3AVM A;  3O3G A;  3THW A;  3MXM A;  1RIL A;  1JLF A;  4FPA A;  3VGM A;  4JS4 A;  5JIC A;  3ZET A;  3G4S N;  1QSY A;  4H0P A;  3QEX A;  4DTN A;  4Q5V A;  4CZJ A;  3PLA A;  4K25 A;  3RWU A;  4JKD A;  2W42 A;  3ENO A;  1KLN A;  5K14 A;  1L3U A;  4ZTF A;  3CFO A;  1S3X A;  5AFU H;  3TAF A;  2A6A A;  3CM5 A;  4BDY A;  4WF9 L;  4FCY A;  5AQP A;  3CC4 N;  4X66 K;  4XH1 A;  2QKB A;  4I9L A;  1SKS A;  5AR0 A;  3ZX2 A;  4EP5 A;  3CET A;  1HQU A;  1QS4 A;  4K8Z A;  1U48 A;  5E41 A;  4GV3 A;  2OZS A;  5KGW A;  3J8A A;  2NRX A;  5AQX A;  3ZT4 A;  2HF3 A;  3V4I A;  1JCG A;  3THV A;  3VEX A;  4JD2 B;  4PKI A;  3HI0 A;  2P9L A;  4YOT A;  3Q7C A;  2ZGZ A;  1T7P A;  1N32 K;  1YXQ A;  1OH6 A;  5C42 A;  2G8W A;  3LAM A;  4PKH A;  3QIO A;  1YIJ N;  3SMS A;  1RBU A;  3VTH A;  3RSE A;  1S5J A;  3AO4 A;  4J2B A;  2P5O A;  3QIN A;  3WNH A;  3AA3 A;  1NLV A;  3JS6 A;  4CHY A;  1VQO N;  4FLX A;  3VTI A;  3VQB A;  5F2R A;  2CGL A;  4CBX A;  3AA4 A;  4KTW A;  2QI2 A;  1VQM N;  3N4Q A;  2Q31 A;  4B1V A;  3O8M A;  4DTX A;  3VF2 A;  4CFD A;  1YVU A;  2V52 B;  4BC3 A;  3M8P A;  3QEV A;  1RT4 A;  3R6M A;  3VQ5 A;  1R0A A;  5BPL A;  4BR5 A;  1NGB A;  3KIO A;  5SZT A;  4FVU A;  1XWL A;  1JXB A;  4IFY A;  1IBM K;  3CJB A;  2WBN A;  4QS8 A;  3SAF A;  1RTJ A;  4YOU A;  2Q2R A;  4A5A A;  3CXC M;  4RCH A;  4CK2 A;  2RKI A;  3C6A A;  1Q86 O;  2UU9 K;  3QBX A;  5H1S Q;  4FWL A;  4YDU C;  1S1X A;  2A1R A;  1ATS A;  3ULD A;  3CG7 A;  3DXM A;  1JL2 A;  1HX1 A;  1NJW A;  4FK0 A;  1QTM A;  2UUA K;  4BE0 A;  3SNN A;  4RW7 A;  4CEA A;  4FZX C;  4E1N A;  2E2Q A;  4CHZ A;  2FF6 A;  2Z1H A;  1HYS A;  4NLB A;  4DTJ A;  4AM7 A;  3DJC A;  1NK0 A;  3L3U A;  3M5R A;  3D2E B;  2H3G X;  1QE1 A;  3OYL A;  4CCH A;  3HPG A;  3HOT A;  4PA1 A;  1QVF M;  2FBY A;  4CD1 A;  1KTQ A;  4H5T A;  1BIS A;  3T19 A;  4CEQ A;  2HHQ A;  2Q36 A;  1RDW X;  4CJV A;  2I7P A;  3KLG A;  5AQZ A;  2FSN A;  3TU5 A;  1ZBF A;  4E7I A;  1BDG A;  3QNO A;  1NM1 A;  5HRN A;  3S9H A;  4WYB A;  3VER A;  1KRP A;  1VQ7 N;  3OYE A;  4JKC A;  3LP0 A;  3L2Q A;  5BRF A;  3HYF A;  3QES A;  2KW4 A;  2QWL A;  1NWK A;  1IBL K;  4DTR A;  4FJ5 A;  3MEC A;  3NH2 A;  4JYA K;  5AQL A;  3VEZ A;  3AVC A;  5LJW A;  5KPR A;  1BQM A;  3D0P A;  2Q1N A;  4CER A;  4CGH A;  4DS5 A;  4C8M A;  4DSF A;  4JI6 K;  3A0I X;  5I3U A;  5EXW A;  2F9T A;  1NK6 A;  3EE9 A;  3CCL N;  4GY2 B;  4DG1 A;  4B8A B;  3KK2 A;  1ZC6 A;  4B9Q A;  3R8E A;  4CF1 A;  5LMN K;  1K8A O;  3ATU A;  1RT2 A;  3NF7 A;  2O8B B;  2VGM A;  5EX5 A;  2YCH A;  4DS4 A;  4HTL A;  1NGC A;  3AVF A;  3DAW A;  2UXC K;  1JLQ A;  3DOL A;  1TL1 A;  1MWK A;  1JKH A;  4CIF A;  2BGG A;  2O8E B;  5AQQ A;  3HJF A;  3NF9 A;  4KHN A;  3WT0 A;  4LF7 K;  1IH7 A;  2ZJQ L;  3VQ4 A;  3SYZ A;  4HCC A;  4DTS A;  2PY5 A;  4OPJ A;  5EY4 A;  1BA0 A;  2B4J A;  1YI2 N;  3LDS A;  1ZBS A;  1OVY A;  2ASO A;  1KQS M;  2ZQB A;  1GLE G;  5SWM A;  3QEI A;  2HBM A;  4AHT A;  3MCA B;  4C8K A;  2DFE A;  1ZBI A;  2HW3 A;  2IAJ A;  4M3W A;  1ASV A;  2YNG A;  3SJJ A;  4I9Q A;  2ZWH A;  1K8K B;  3OYG A;  3K5L A;  2X78 A;  3G71 N;  1LAW A;  2CH6 A;  1HNZ K;  1WBD A;  5LJV A;  1L3T A;  2OPP A;  5AFU A;  3IAY A;  1BCM A;  3SUO A;  1IBK K;  2VWJ A;  1VQK N;  4FJG A;  3BEX A;  4BQL A;  1ESV A;  3K0S A;  1OKJ A;  3O9U A;  3O9T A;  4B8C A;  3DRS A;  4QS9 A;  4CEB A;  4CF8 A;  2YKM A;  2AP1 A;  4KO0 A;  5FDL A;  1L3V A;  4CF0 A;  4ICL A;  1RBT A;  3A2F A;  4CEC A;  1N36 K;  3HPH A;  3MX5 A;  1MWM A;  1QQN A;  2ZD1 A;  5JLH A;  1S1T A;  3PY8 A;  1BI4 A;  3OYJ A;  3VEV A;  3NDK A;  1UWB A;  2E1Y A;  1M90 O;  3L0Q A;  4CIG A;  4IO9 L;  3SV3 A;  4OO1 J;  1QZ5 A;  1GLC G;  1J9A A;  4JLH A;  4DV4 K;  1CZ9 A;  3EN9 A;  3ZCM A;  2F8T A;  3F2K A;  1LW2 A;  4IOA L;  1NKC A;  1GLF O;  3BGR A;  1W97 L;  3I56 N;  4H0O A;  3AAQ A;  3J7A P;  1EX4 A;  3L4Q A;  1LWC A;  2IOC A;  4FM0 A;  2D5R A;  3MX2 A;  4B3M K;  3O80 A;  2XY5 A;  1HR0 K;  1X3M A;  4I2Q A;  4KKO A;  3WXM B;  1RDD A;  3TAQ A;  1DGK N;  3H08 A;  4KHS A;  2NLX A;  4FJJ A;  2IGI A;  4KV8 A;  4DTO A;  1BQN A;  4FJX A;  5C2F A;  4CZL A;  5KRS A;  3KKS A;  3P39 A;  4JRQ A;  3O1W A;  1NOZ A;  5GAE P;  4UQG A;  4GW6 A;  2V7Z A;  3K57 A;  3EEQ A;  4JKG B;  1JCE A;  1BCO A;  2O8D B;  5J2Q A;  1DTT A;  3TTC A;  2OPS A;  2YX6 A;  3KWG A;  5JS1 A;  3DLB A;  3H1Q A;  4FZY A;  4MO4 A;  2P1J A;  3CC2 N;  3M3Z A;  4H0X B;  4JKF A;  1KAY A;  3CER A;  3V1O A;  1J54 A;  3EE8 A;  4DV7 K;  1IKX A;  4DR4 K;  4V19 S;  3ASM A;  2QWM A;  1HPZ A;  3Q7B A;  4F3T A;  1XQS C;  3CPE A;  3JXU A;  2ITM A;  3RMB A;  4PHT X;  1QQM A;  3P4I A;  2P9P B;  3IMX A;  2HVH A;  5GAD P;  1JLC A;  3QFP A;  1NJI O;  3A5N C;  2A1S A;  3LWM A;  5IWA K;  1T8E A;  4BRA A;  1FK9 A;  2QXL A;  3MDQ A;  2OTJ N;  1KFS A;  3BZK A;  3VPZ A;  1O13 A;  1U2V A;  1NK4 A;  2EWS A;  4W5T A;  5AQW A;  1HPM A;  3TSQ A;  3ZYY X;  4YHH K;  3PO4 A;  3H3N O;  4E1J A;  3AVI A;  3FGU A;  3EY1 A;  4A57 A;  2HVI A;  2JGU A;  4O8U A;  4FZZ A;  1WUA A;  4WCE L;  3NAE A;  3SLC A;  3U6F A;  5AQV A;  2X6S A;  3SAG A;  1JLB A;  1KXP A;  2OTL N;  4TSX A;  1Z6R A;  3VQ7 A;  4DQ8 A;  2D0A A;  3SPZ A;  3KHY A;  1WSE A;  3M6G A;  1LWF A;  2ASP A;  2NRW A;  1IKW A;  5BPN A;  1TYQ A;  2WUS A;  3OYM A;  3V1Q A;  2JLE A;  1YT3 A;  3IRX A;  5CYQ A;  3J7Z O;  4YFU A;  1ATR A;  4BVO A;  4BG9 A;  2YHY A;  2GBZ A;  2I7N A;  3CI5 A;  3SI6 A;  1XHZ A;  1QSL A;  2RPI A;  3AY9 A;  4CEZ A;  3THX A;  4CJE A;  4IBN A;  3A5L C;  1HKG A;  3IG1 A;  4FOE A;  1WN7 A;  4BR7 A;  4ISE A;  2IVP A;  3QBW A;  4CFC A;  3RTV A;  4E89 A;  1SAZ A;  1Q81 O;  1Q7Y O;  1XNQ K;  2UUB K;  2UXD K;  4DR5 K;  1KAZ A;  4M42 A;  5J2M A;  3A8Y A;  3ZSR A;  4CJU A;  5M1O A;  3OJU A;  4FWO A;  4NCG A;  3TI0 A;  3TSP A;  4KI6 A;  1VSK A;  3OVN A;  1BL3 A;  1E4F T;  4M3X A;  3TWH A;  3ZEU B;  2KHO A;  3AAP A;  3JAM O;  1VQ9 N;  1REV A;  4LF9 K;  3U9D A;  1XUP O;  3VQA A;  4E7K A;  3MXI A;  4DMN A;  5KQD A;  1SV5 A;  4FW1 A;  4IDK A;  3OYF A;  3WXJ A;  4LFA K;  3FZF A;  5AZI B;  1YUW A;  2NZT A;  4DSE A;  4CJW A;  4HTU A;  1OH7 A;  3UKR B;  3SAH A;  1KVA A;  5DMR A;  4CW7 B;  3BF1 A;  4CVN E;  2A41 A;  2Z1G A;  2PFU A;  5AQI A;  4OGC A;  3PUF A;  3DLR A;  2DFH A;  3ID8 A;  3SBG A;  1TL3 A;  1W9H A;  2HHS A;  3D2F A;  4FPB A;  3ULE A;  4CJ4 A;  4Z0U A;  4NXM K;  2XY7 A;  3TTD A;  4DV5 K;  2D4W A;  1NK5 A;  3QEP A;  4DUY K;  4LSN A;  4JNE A;  1HJR A;  4BY9 C;  3UIQ A;  1WSI A;  3OTO K;  4C23 A;  4DTU A;  4DTM A;  2QK9 A;  3C65 A;  3MN6 A;  3LDQ A;  5F0X A;  4OLA A;  1P8Z A;  3C6T A;  3CJ9 A;  2QEX N;  3OYH A;  2Q0U A;  4KB1 A;  4CZF A;  4IJA A;  3LDP A;  3TAP A;  4AHC A;  2P9S A;  3O5B A;  4K0K K;  4H4O A;  3KTQ A;  4B9L A;  3OBY A;  4Z4H A;  4O0J A;  3MN9 A;  3ALY A;  3DLH A;  2ASM A;  2QWR A;  3GOI A;  2IC3 A;  4N76 A;  3FZM A;  2E4L A;  1ITG A;  2F9W A;  4WFB L;  4EFH A;  1K9M O;  3I55 N;  1OH5 A;  1DEJ A;  3DLL L;  5KPZ A;  2A3Z A;  3O4Q A;  3MAQ A;  5AQG A;  4CHN A;  4C8L A;  2G8V A;  4GKK K;  5M1K A;  1VSE A;  2Y1J A;  5BRE A;  3EYZ A;  1GOC A;  1ZBH A;  5JVH L;  4MLH A;  1T6D A;  4LH5 A;  3SJH A;  3GG4 A;  4YOW A;  4B3S K;  3ZLJ A;  3HO1 A;  4BR9 A;  4JD2 A;  2P9I B;  1NBW A;  1R59 O;  2VGN A;  2Z1J A;  3OYA A;  3CMA N;  1VQ5 N;  2KQ2 A;  3T69 A;  1E4G T;  4L8R B;  5AQN A;  3THY B;  3HP6 A;  5BN9 A;  4DWI A;  4FLT A;  2I5J A;  4YNQ A;  5FRO A;  1J5E K;  3F9K A;  1X9M A;  2NNW A;  4IOC L;  4BG8 A;  1VRU A;  3CM6 A;  4K43 A;  2YNI A;  1X9S A;  3LAK A;  4FJK A;  2LSN A;  3VF4 A;  5CE3 A;  4A2B A;  1NG9 A;  2WC9 A;  5C15 A;  1LCU A;  3RMD A;  4H5R A;  3TSU A;  4XEI A;  4FLY A;  1RT3 A;  3THW B;  4BE1 A;  4CK3 A;  2EHG A;  3A5M C;  1XMQ K;  3ZET B;  4IKF A;  2WOM A;  2XO7 A;  1XHX A;  1YTU A;  4FJN A;  1YIT N;  2O8F A;  3M1F A;  4LD0 A;  5FPE A;  3ATV A;  1VSL A;  2HHW A;  1X9W A;  2HMP A;  1YHQ N;  4ID1 A;  5C25 A;  4JHD B;  4BRD A;  3LPT A;  3B6P A;  1CLQ A;  3G25 A;  3SK3 A;  4DHY A;  3VQD A;  3OS1 A;  3H6E A;  4F2R A;  4O5B A;  2JWK A;  5AQM A;  2KTQ A;  4WQ5 C;  1HLU A;  4YOY A;  1ZBL A;  2QWN A;  4BGA A;  2E20 A;  3AO3 A;  2GUI A;  3CJC A;  3OJS A;  2P9L B;  1HRH A;  4CF9 A;  2VQF K;  4BDP A;  5AZJ B;  4JAX A;  2QA4 N;  2KZM A;  1WAF A;  1Z25 A;  3RSE B;  4Z4C A;  4FM2 A;  1OVQ A;  1BA1 A;  4FLW A;  5MLC Q;  3KK1 A;  2E2O A;  1RBV A;  1NU0 A;  5KI6 A;  1TKD A;  3RR8 A;  3ZSV A;  1GLA G;  1VSJ A;  3QLH A;  4AF1 A;  1IG8 A;  1YAG A;  3S41 A;  1HJO A;  4IEE A;  1GLB G;  1GOB A;  2W41 A;  1Z26 A;  3C7N A;  1ASU A;  4FWN A;  5DK5 A;  4KTZ A;  1I3A A;  4FWQ A;  3UE5 A;  1IKY A;  3G10 A;  2E2P A;  2PYL A;  1X1P A;  1NGH A;  4HCB A;  4K41 A;  2RHK A;  3LZI A;  1Q18 A;  3AVB A;  3VET A;  4MDA A;  3V9X A;  5J2N A;  2QXF A;  4B1Y B;  1D9D A;  4DQP A;  1C0M A;  3HT3 A;  4DFM A;  1NGJ A;  4JK7 A;  2CH5 A;  4FWM A;  4CJQ A;  3JSM A;  1L3S A;  1B92 A;  4C8O A;  3HOS A;  3KKR A;  1P90 A;  2VWB A;  1HNI A;  1TKX A;  4IDH A;  1DT9 A;  4GNI A;  1S1V A;  3LL3 A;  4GV6 A;  1SL1 A;  4CHO A;  1WSJ A;  2PAV A;  3SBT A;  4JK8 A;  3G6E N;  2UYT A;  1EO1 A;  2HBJ A;  3FZK A;  5HOO A;  4CBW A;  4CI6 A;  2XY8 A;  3I8D A;  4PY5 A;  1GLL O;  5TKW A;  4CFA A;  3O3H A;  3AVJ A;  1HNX K;  2WFB A;  3ZX3 A;  2J4R A;  4IOX A;  1NK9 A;  2HMI A;  3LDN A;  2KLA A;  3CFR A;  4DR6 K;  4BRQ A;  4YDU A;  3M8S A;  1C1B A;  4BAC A;  2PBD A;  3VQP A;  4AM6 A;  1XNR K;  4RW4 A;  2NRR A;  4M3Y A;  3IUC A;  3NVK A;  2DTU A;  3VQ9 A;  1FJG K;  4CIE A;  1VSF A;  5LMU K;  5GIP A;  2WTU A;  4K42 A;  1YTA A;  4M45 A;  5JMV A;  1VAZ A;  1WSF A;  3NH1 A;  3OBW A;  4CGG A;  1TGO A;  1UAX A;  2V7Y A;  1CXU A;  1YVN A;  4I6M B;  1TVR A;  3M8Q A;  3P5J A;  2D0C A;  3E01 A;  1J53 A;  4NB4 A;  1QSS A;  1WLJ A;  1NGA A;  4EAH D;  1BHL A;  4DU3 A;  1VSD A;  1F21 A;  3WXI A;  4J2D A;  2ZJP L;  1IJJ A;  2BAN A;  2YJE A;  1NJX A;  5JS2 A;  2BDP A;  5KTQ A;  3S3O A;  3MN7 A;  5AQK A;  1NGF A;  4J2A A;  1WAJ A;  3VGL A;  4BVP A;  4DQS A;  4W5Q A;  3SV4 A;  3QO9 A;  3C95 A;  1X9J A;  4FYD A;  3SUP A;  3F73 A;  1V4S A;  1TKZ A;  2NRT A;  5M1P A;  4LC9 B;  1RT5 A;  4CJT A;  2ZGY A;  3V9U A;  1JLE A;  2B6A A;  1Q8I A;  3VEO A;  4CEF A;  2F96 A;  2OZM A;  3AO1 A;  5AQF A;  1LOT B;  5BRH A;  4FLZ A;  4LY7 A;  2ITG A;  4DQQ A;  3WEE B;  2IIR A;  3OS2 A;  1RFQ A;  4ISG A;  4BRI A;  1HNW K;  4CJR A;  1BU6 O;  5EOY A;  5AQT A;  4CJ3 A;  4B1X B;  3RMC A;  2G8U A;  2QW9 A;  1S72 N;  1TUY A;  1SS6 A;  3R9P A;  3VQ8 A;  4W5N A;  3CFP A;  1QQC A;  4CGI A;  2HHV A;  3OYD A;  1GLD G;  4XH5 A;  4AHV A;  3NHG A;  3O1B A;  4B3T K;  2GEL A;  1QHT A;  1HYZ A;  3SUN A;  1QVG M;  5J2P A;  4BGB A;  3CPW M;  4KTQ A;  2O8D A;  3BP8 A;  3IKM A;  5HRS A;  3L3V A;  4E7J A;  1NJY A;  2G8I A;  5FPD A;  1JXE A;  3UKU B;  3L4I A;  5CYM A;  1SL2 A;  1SQK A;  2D0P A;  1M1K O;  1I39 A;  5KRT A;  2YV0 X;  3TAR A;  4JI3 K;  4MQ3 A;  4DV3 K;  4C1N I;  3AA5 X;  1D8Y A;  3LAN A;  2P9K B;  1S22 A;  1LW0 A;  4H0V B;  5ADX H;  3QIP A;  4LF8 K;  4HUF A;  1VQL N;  2VG5 A;  1RNH A;  2O8C A;  3MK6 A;  3LM9 A;  4ILJ A;  3QDK A;  3QNN A;  5LY3 A;  2FSJ A;  5CZ1 A;  3SCX A;  2FC0 A;  2G8F A;  2NRH A;  4NCA A;  2KZZ A;  3SPY A;  5HBM A;  3FZH A;  3VA0 A;  4U67 L;  4L3Q A;  2P9U B;  3NCI A;  1NNE A;  1OH8 A;  3L2R A;  3MEG A;  2A40 A;  1U6Z A;  4CK1 A;  2P9N B;  4FJH A;  4CJL A;  3LP2 A;  5IT9 O;  3KLF A;  3DXK A;  4FWK A;  3EKS A;  3L8B A;  4FK2 A;  3DI6 A;  4BRK A;  1D4X A;  4FM1 A;  2ZF5 O;  4E3S A;  3OW2 M;  5I9E B;  3K9K A;  1IKV A;  4JEP A;  4RW8 A;  5CY4 A;  3T1A A;  2HB5 A;  5AQH A;  2GEM A;  4E19 A;  3CCQ N;  3V9W A;  1X3N A;  4EP4 A;  3MXJ A;  5AQU A;  4B1W B;  1XC3 A;  3J80 O;  1UA0 A;  3LDL A;  4FXD A;  3SQ2 A;  2HHU A;  5ELZ A;  1BUP A;  3CCS N;  4MO5 A;  1RCH A;  1A5V A;  3GBT A;  3U3Y A;  2HBL A;  3VQE A;  5HLF A;  4CEO A;  4FOI A;  4O44 A;  2OCE A;  3ENH A;  4DV1 K;  1HKB A;  3KLH A;  4BE2 A;  4CZG A;  4KBO A;  4CZE A;  4ELU A;  3O08 A;  3KD5 E;  3PIP L;  4EIA A;  1RBR A;  3WUH A;  4LFC K;  1Q9Y A;  2RN2 A;  4OPA A;  4OPK A;  3OY9 A;  1EKE A;  1NGD A;  3AO5 A;  5EVZ A;  4KAZ A;  3O9S A;  1SUQ A;  3VQ6 A;  2W6L A;  4CJS A;  3CC7 N;  5DM6 L;  4DSJ A;  1SL0 A;  3GDQ A;  4KRE A;  1VQ4 N;  4H5W A;  1BO5 O;  3I0R A;  4JI8 K;  1U2V B;  3H46 O;  4XH4 A;  3KWI A;  4LH4 A;  3NH0 A;  2QWO A;  2D1K A;  3ZSZ A;  3CQX A;  1CZB A;  3EL2 A;  4RG8 A;  3OHR A;  4BRH A;  3HTV A;  2GTD A;  1DTQ A;  3ZX0 A;  5B8H A;  1KAX A;  1RDU A;  3CCR N;  2Q3S A;  4R79 A;  4E7L A;  1S1U A;  1G99 A;  3CYM A;  1NJZ A;  3VN5 A;  3CIP A;  2KFN A;  3DRP A;  3FLC O;  4NO7 A;  4EHU A;  1XMO K;  1HKC A;  4M63 C;  4NXN K;  1RT7 A;  2D0O A;  3U8X A;  1BGX T;  3T3F A;  4JRP A;  4Q0B A;  1TYQ B;  3VEW A;  3D6R A;  4WFN L;  4FSV A;  4KB0 A;  2BUP A;  2FBX A;  3LWL A;  3K5M A;  4IEI A;  4RW6 A;  3CJ1 A;  3VMF B;  4A5B A;  4YOV A;  4DFK A;  5C0Y A;  1TUU A;  2FXU A;  1LV5 A;  4FWR A;  3SZ2 A;  5KGX A;  5BR9 A;  3OS0 A;  3THX B;  1NKB A;  1JLA A;  4KI4 A;  1XI1 A;  4DV2 K;  1T03 A;  3QML A;  4ID5 A;  1MA9 B;  5M1F A;  2IDO A;  4A61 A;  4LFB K;  3K5N A;  4DLE A;  3V1R A;  3MMV A;  1YF5 L;  3AGR A;  4ELV A;  1WOQ A;  3NF6 A;  1NMN A;  4CE9 A;  5I42 A;  3E9L A;  1EXQ A;  3RR7 A;  5C12 A;  4MFB A;  2XHB A;  1C0T A;  3DYA A;  4HWI A;  3T1H K;  3HVT A;  4H0T B;  3MEE A;  4H8K A;  4H03 B;  3R1X A;  2W6K A;  4W5O A;  2GUP A;  3VQQ A;  5GAG P;  2FBV A;  2XY6 A;  5HRO A;  3W0L A;  4E7H A;  4FVM A;  3KLI A;  2YNF A;  3D7E O;  2QKK A;  1UOC A;  3P1G A;  4BRL A;  4F9O A;  4BWM A;  2F8S A;  2BTF A;  3O9R A;  3OYK A;  4FJ8 A;  3NFA A;  1D5A A;  2CGJ A;  3FR0 A;  4J2E A;  4ZHR A;  4PL7 A;  4KHU A;  3SQ4 A;  4WE1 A;  4DF4 A;  4AQY K;  3PSI A;  5CHI A;  3C0B A;  2IVO A;  4FW2 A;  3C94 A;  2OPR A;  5HL7 L;  1RDC A;  3WNF A;  5ADX A;  2P9I A;  3PSF A;  2DFF A;  4DQR A;  2P5G A;  4GVE A;  3D2F B;  4PUO A;  2IVN A;  4CJP A;  3NBP A;  1JLG A;  4OKK A;  3ULE B;  3HM8 A;  2BE2 A;  3PO5 A;  3VEN A;  4Y1D A;  4G1Q A;  3AO2 A;  4ZTJ A;  1S1W A;  3DRR A;  4F8R A;  3ZSW A;  4CEE A;  3CQ8 A;  3P31 A;  4CBU A;  3K58 A;  1NGG A;  3CCV N;  3CQY A;  3NGZ A;  1VQN N;  3ID6 A;  4H5N A;  2G8K A;  2ZE2 A;  3E9P A;  3WXK A;  3TTF A;  3NVM A;  4O0I A;  4F4K A;  3MCP A;  4N56 A;  4GMJ B;  1RDB A;  1QZ6 A;  4AHS A;  1HMV A;  3HST B;  2HF4 A;  3WQU A;  4DU4 A;  3EKU A;  4WFA L;  4QS7 A;  2P9S B;  2FF3 B;  4OGE A;  3VES A;  2KFZ A;  2X74 A;  4B3O A;  4M41 A;  3H1V X;  1U4B A;  4RWT A;  5LL6 Z;  1QHA A;  1B9F A;  3R3L A;  1NGI A;  4E0D A;  4QOZ B;  3J81 O;  2P51 A;  1LWE A;  3ZT2 A;  4IG3 A;  4H5V A;  3OYI A;  3DWL A;  1A5W A;  1VRT A;  3MN5 A;  2YHX A;  4JK9 A;  4BRO A;  4HUE A;  4PWD A;  4IFE A;  4JHD A;  4JKE A;  3HZ6 A;  1UA1 A;  2X6N A;  3AVK A;  3ZT0 A;  2ZJR L;  4MLE A;  3S3N A;  5T7B A;  3L6Q A;  4BWJ A;  3FFI A;  1U04 A;  4BR4 A;  3WNE A;  1GOA A;  1NMD A;  5KPT A;  3NE6 A;  3FE1 A;  4Z4F A;  4FWP A;  1RBS A;  4CJF A;  5AZJ A;  3FFK B;  3V9Z A;  2VCP A;  1N5Y A;  4M3U A;  1BOT O;  4ILG B;  4BR2 A;  4OKJ A;  3IFR A;  1C0U A;  4O4G A;  4OLB A;  3MED A;  4IO8 A;  4H0Y B;  4CES A;  2A42 A;  4G9Z A;  1Z05 A;  4M7Y A;  1ZYQ A;  3U9Z A;  3E66 A;  4ILH A;  2YHB A;  4OKE A;  3AGK A;  2DPN A;  1C0G A;  5FRM A;  3D2E A;  3TAM A;  1TAU A;  4KHW A;  4YY3 K;  1U45 A;  3WXL A;  4A59 A;  3NF8 A;  4CZI A;  3TAG A;  4Z4E A;  2G8H A;  1MU2 A;  2HOE A;  4DQI A;  3KJV A;  4WQ4 C;  4FLU A;  2O8F B;  4HHT A;  1RTI A;  3HPO A;  3O9Q A;  4DV6 K;  1BIU A;  2OA8 A;  2OAN A;  4B9M A;  3BF3 A;  4OJR A;  4RTF D;  1RTD A;  3ZSX A;  2PZS A;  3RRH A;  1CZA N;  3AAR A;  1LAV A;  5BPM A;  4OPH A;  2IS3 A;  1IO2 A;  3U4L A;  4B9V A;  5GIO A;  3QET A;  1D9F A;  1CXQ A;  1EWR A;  1J5O A;  1VQ8 N;  1JJ2 M;  3KLE A;  4BRN A;  5J1E A;  4AHU A;  1K73 O;  1KVC A;  5C10 A;  2VG6 A;  4KFB A;  4PL8 A;  1TK8 A;  4X62 K;  3ZSY A;  2FLO A;  3VA3 A;  3HVR A;  2XRI A;  4NYF A;  3KK7 A;  3CD6 N;  3PIO L;  4F3O A;  3WNG A;  3CCJ N;  5CZ2 A;  3DXM B;  1IG9 A;  4Z94 A;  3S3M A;  2D0B A;  4GKJ K;  1U47 A;  2ZM6 K;  3BY5 A;  3KZB A;  2W40 A;  2O8B A;  1WB9 A;  3G0Z A;  1U49 A;  3TAN A;  4HVJ A;  4DFP A;  1VHX A;  1BWF O;  2QM1 A;  5GIN A;  3B6O A;  2VG7 A;  2O8E A;  3QB0 A;  5HRR A;  4J8F A;  1RT6 A;  3DM2 A;  4WQ5 A;  3K2P A;  5KQ8 A;  4DCH A;  3C7N B;  2Q0R A;  1NK8 A;  3HRG A;  3HXM A;  2E88 A;  1YJN N;  4I6M A;  2GWJ A;  2VQE K;  2FSK A;  4KHP K;  5D3G A;  4CHP A;  4M7X A;  3NGY A;  2RF2 A;  4WQ4 A;  3MWT A;  1K8K A;  1G15 A;  4O8K A;  3T7Z A;  1WSH A;  2YHA A;  3EZ5 A;  3TAE A;  3EZW A;  1VQP N;  4CD3 A;  3C6U A;  3DMJ A;  4BC5 A;  3RRG A;  1YJW N;  1W7A A;  4PQU A;  4DR2 K;  1DLO A;  1VSI A;  4FJM A;  2F4V K;  4CHQ A;  4DSI A;  2PYJ A;  3AV9 A;  1DKG D;  1C1C A;  4XIU A;  5C2D A;  4FJ7 A;  1TAQ A;  4N5S A;  1EP4 A;  5BN8 A;  1FW6 A;  1JL1 A;  5CR4 A;  1HQE A;  2E6M A;  4YOX A;  3WEE A;  3AVN A;  4W5R A;  4BDZ A;  3QER A;  2BH1 A;  4DSL A;  3HK2 A;  3BDP A;  4DUZ K;  2AJQ A;  3LZJ A;  4GV9 A;  2HHX A;  1RDA A;  2FBT A;  4RW9 A;  5FPM A;  2E2N A;  3KK3 A;  1NOY A;  2O4G A;  3I33 A;  2YNH A;  2YHW A;  4FO0 A;  4DKW A;  1RGI A;  4CZM A;  2GX9 A;  1HUX A;  3WQT A;  4U7B A;  1RTH A;  1N34 K;  3D45 A;  3DLE A;  3O3F A;  2GWK A;  4BRM A;  4O5F A;  2HNY A;  5HRP A;  2WON A;  3UKU A;  4DB3 A;  2HST A;  3EO3 A;  3LAL A;  3MWP A;  4DLG A;  4AH9 A;  3SUQ A;  3SMP A;  4DFJ A;  1V4T A;  4NLC A;  1BIZ A;  1VSH A;  2EX3 A;  3HSC A;  3IS9 A;  3IDH A;  3DOK A;  1C6V A;  3C6H A;  2VYP A;  3O4W A;  3VEY A;  3K9J A;  4KHQ A;  2P9K A;  3TPQ A;  4JI2 K;  4JKG A;  1KD1 O;  4KH6 A;  4A62 A;  4BRC A;  1FXX A;  1T44 A;  4IJN A;  4JKH A;  4JI5 K;  1YJ9 N;  3AVG A;  3HP9 A;  1N6Q A;  1TK0 A;  1C0F A;  5FRN A;  1NKE A;  2E6L A;  3CCE N;  4CGD A;  4B9N A;  4JI1 K;  3NMU A;  1EWQ A;  3CCM N;  3ZT3 A;  2P9U A;  3UB5 A;  3N4P A;  2ATQ A;  3LPU A;  3NGI A;  3TR8 A;  2ETJ A;  2UXB K;  3HBT A;  1BI4 B;  2P9P A;  2P9N A;  4C8N A;  4BC4 A;  2F7T A;  4DU1 A;  5AQO A;  4LF6 K;  1SZ2 A;  2QTD A;  3CF5 L;  3OYB A;  4IG0 A;  1RT1 A;  4NCB A;  3AVH A;  3QIC A;  3PX4 A;  3L2V A;  1T6C A;  4X64 K;  4KH5 A;  3VQC A;  4F2S A;  4AHR A;  3ZT1 A;  1VQ6 N;  4KRF A;  3P38 A;  4B08 A;  1C1A A;  4CZH A;  3CHW A;  5A2Q O;  2V51 B;  1I94 K;  1EET A;  1A5X A;  5BR8 K;  3BZC A;  3E1Y A;  4B9T A;  5FPN A;  4CFB A;  2Z1I A;  1ILY A;  4PKG A;  3VF6 A;  1WBB A;  4KPY A;  4CGJ A;  4LF5 K;  3E9O A;  3HM9 A;  1N8R O;  5AQR A;  4BRP A;  1NGE A;  2DY4 A;  4DF8 A;  5AQJ A;  3F9M A;  4N47 A;  3KVG A;  1T3V A;  5M1N A;  4NYN A;  4I7F A;  3SQ1 A;  3I0S A;  2O8C B;  5JLF A;  1S9G A;  1TV6 A;  1NK7 A;  3H45 C;  4CED A;  2O4I A;  1S9E A;  3VGK A;  1VSM A;  4BR0 A;  4BRE A;  5C24 A;  4N41 A;  1Y64 A;  3HL8 A;  3JYT A;  2Y1I A;  1EQY A;  1XC9 A;  1ASW A;  5AJ3 K;  2UUC K;  4CJ7 A;  1FKP A;  2QWQ A;  4FJI A;  4KHY A;  4EZ9 A;  3H3O B;  3RMA A;  4JN4 A;  2JWL A;  4BRF A;  5BRD A;  4CJ5 A;  3DXK B;  3B8A X;  5DM7 L;  5M1Q A;  4E1M A;  2YKN A;  1SKW A;  4FL9 A;  4DSK A;  3V81 A;  4EZ6 A;  1L5U A;  4DV0 K;  3PV8 A;  4FK4 A;  4M3R A;  1S6Q A;  3LM2 A;  3ZEU A;  4K8X A;  1K6Y A;  4CZK A;  1KC8 O;  2HND A;  3BUZ B;  1VK0 A;  5GAH P;  5JVG L;  2A5X A;  4AIL C;  1QQO A;  4KH4 A;  2OPQ A;  3AVL A;  1ZXO A;  2KKZ A;  3ISN C;  2Q97 A;  4BC2 A;  3V9S A;  4IWV A;  3A5O C;  4B3R K;  4BQZ A;  4O55 A;  3VOV A;  5AZI A;  1KFD A;  1S6P A;  3OYN A;  3PX6 A;  4MDB A;  4JI0 K;  3UKR A;  2NRZ A;  4C1N K;  4QCL A;  1KCF A;  1B9D A;  3RVC A;  3QFU A;  3KD1 E;  3LDO A;  4Z4I A;  3I8B A;  4CGF A;  1WSG A;  3L2U A;  4LF4 K;  5AQY A;  1SKR A;  1Q9X A;  1N33 K;  2B5J A;  4LSL A;  1T05 A;  3T1Y K;  5EU7 A;  1JCF A;  2E1Z A;  3U3G A;  4EHT A;  2AA4 A;  2HNZ A;  4OVL A;  2E5L K;  2HBK A;  3OYC A;  4DR1 K;  2VWK A;  3P83 D;  1W0H A;  4FJL A;  4I2P A;  3GL1 A;  3M8R A;  3GE1 A;  2HHT A;  4CF2 A;  4A2A A;  3ITH A;  4B9U A;  2HHH K;  1H1V A;  3CCU N;  4JKB A;  2CGK A;  3LP1 A;  3TAB A;  5TKY A;  1GLJ O;  1Y97 A;  1HNV A;  2OYQ A;  4Y0W A;  3V6D A;  3CJA A;  1FKO A;  3O4N A;  1TKT A;  3PX0 A;  3ZSO A;  2GV9 A;  1ATN A;  3LP3 A;  3QEW A;  2YJF A;  5HP1 A;  5AQS A;  4ISF A;  4JV5 K;  3AA2 A;  4X65 K;  3SQ0 A;  2QWP A;  1IV0 A;  2NRV A;  3DLG A;  4DR3 K;  4FLV A;  3K5O A;  1WNS A;  4IZ9 A;  1ZBU A; 
#chains in the Genus database with same CATH homology
 4JS5 A;  4FJ9 A;  1NJX A;  5JS2 A;  2BDP A;  5KTQ A;  3S3O A;  4Y1C A;  5FRM A;  4J2A A;  3TAM A;  1TAU A;  1WAJ A;  4DQS A;  1NK4 A;  4ELT A;  4W5Q A;  4KHW A;  1U45 A;  3SV4 A;  4W5T A;  3NF8 A;  1KVB A;  2NUB A;  3QO9 A;  3TAG A;  3C95 A;  2G8H A;  3PO4 A;  4Z4E A;  4FYD A;  3SUP A;  1MU2 A;  4QAG A;  3F73 A;  4M3Z A;  3AVI A;  1TKZ A;  4DQI A;  3KJV A;  4FLU A;  3EY1 A;  2HVI A;  4HHT A;  1RT5 A;  4CJT A;  1RTI A;  3HPO A;  3V9U A;  2JGU A;  1BIU A;  1TK5 A;  1JLE A;  2OA8 A;  4FZZ A;  2B6A A;  4B9M A;  3NAE A;  4OJR A;  1Q8I A;  3U6F A;  4CEF A;  1RTD A;  3ZSX A;  2X6S A;  2F96 A;  3AVA A;  1JLB A;  3AO1 A;  1HYV A;  3RRH A;  2PZS A;  2OZM A;  1LAV A;  4FLZ A;  4M3T A;  4Z4G A;  4TSX A;  1KSP A;  3VQ7 A;  4LY7 A;  2IS3 A;  1IO2 A;  2D0A A;  2ITG A;  3SPZ A;  4B9S A;  1KLM A;  4DQQ A;  4B9V A;  1WSE A;  3OS2 A;  1LWF A;  1IKW A;  3QET A;  1D9F A;  4CJR A;  3OYM A;  1CXQ A;  1J5O A;  3V1Q A;  2JLE A;  4CJ3 A;  4H4M A;  3RMC A;  2G8U A;  1YT3 A;  4HUG A;  3KLE A;  5J1E A;  4AHU A;  3IRX A;  5CYQ A;  3VQ8 A;  3ZSQ A;  1KVC A;  3CFP A;  4W5N A;  4GVM A;  4YFU A;  2R7Y A;  1QQC A;  2VG6 A;  4DTP A;  2GBZ A;  4KFB A;  4CGI A;  2HHV A;  1TK8 A;  3SI6 A;  3OYD A;  1XHZ A;  3ZSY A;  4AHV A;  3NHG A;  1QSL A;  2RPI A;  3K59 A;  1O1W A;  3L2W A;  3VA3 A;  4CEZ A;  2XRI A;  3HVR A;  4NYF A;  4CJE A;  1QHT A;  1HYZ A;  3SUN A;  4F3O A;  3WNG A;  4IBN A;  3DLK A;  3IG1 A;  4CJK A;  4R5P A;  4IFV A;  5CZ2 A;  1WN7 A;  5J2P A;  1IG9 A;  3AVM A;  3O3G A;  3MXM A;  3S3M A;  2D0B A;  1U47 A;  1RIL A;  1JLF A;  4JS4 A;  4CFC A;  1QSY A;  3G0Z A;  3RTV A;  4KTQ A;  4E89 A;  3QEX A;  1U49 A;  3TAN A;  4HVJ A;  4DTN A;  5HRS A;  4Q5V A;  4DFP A;  3L3V A;  3RWU A;  4E7J A;  2W42 A;  1KLN A;  1NJY A;  5K14 A;  3B6O A;  2VG7 A;  4M42 A;  2G8I A;  1L3U A;  5J2M A;  1JXE A;  4ZTF A;  5HRR A;  3ZSR A;  4CJU A;  1RT6 A;  3CFO A;  3OJU A;  5CYM A;  1SL2 A;  3DM2 A;  3TAF A;  4NCG A;  3K2P A;  4BDY A;  3CM5 A;  3TI0 A;  1I39 A;  5KRT A;  4FCY A;  4KI6 A;  2YV0 X;  1VSK A;  3OVN A;  3TAR A;  1NK8 A;  1BL3 A;  2QKB A;  4M3X A;  4I9L A;  3TWH A;  1SKS A;  4MQ3 A;  3HXM A;  4EP5 A;  3AA5 X;  1HQU A;  1QS4 A;  3LAN A;  1D8Y A;  4K8Z A;  1U48 A;  1LW0 A;  5E41 A;  1REV A;  3QIP A;  2OZS A;  4HUF A;  5KGW A;  2VG5 A;  1RNH A;  3VQA A;  4E7K A;  3MXI A;  3ZT4 A;  5D3G A;  3QNN A;  3V4I A;  4DMN A;  3THV A;  4CHP A;  5CZ1 A;  3SCX A;  3NGY A;  2FC0 A;  1SV5 A;  2RF2 A;  4FW1 A;  4IDK A;  3OYF A;  2G8F A;  4NCA A;  1G15 A;  3EZ5 A;  3TAE A;  1WSH A;  2YHA A;  1T7P A;  2KZZ A;  5C42 A;  3SPY A;  2G8W A;  3LAM A;  5HBM A;  4DSE A;  3VA0 A;  3QIO A;  3C6U A;  3DMJ A;  4CJW A;  3NCI A;  3RRG A;  4HTU A;  4PQU A;  1RBU A;  3L2R A;  1KVA A;  3MEG A;  1DLO A;  1S5J A;  1VSI A;  3AO4 A;  5DMR A;  4J2B A;  4CHQ A;  4FJM A;  4CK1 A;  4DSI A;  2PYJ A;  2Z1G A;  3AV9 A;  2P5O A;  3QIN A;  3WNH A;  4CJL A;  4FJH A;  3AA3 A;  4OGC A;  3PUF A;  3LP2 A;  3DLR A;  4CHY A;  2DFH A;  1C1C A;  4XIU A;  3KLF A;  4FLX A;  3L8B A;  3VQB A;  1TL3 A;  1W9H A;  4FJ7 A;  1TAQ A;  3DI6 A;  4FK2 A;  2HHS A;  4FM1 A;  4N5S A;  1EP4 A;  4E3S A;  4CJ4 A;  3AA4 A;  4Z0U A;  4KTW A;  2XY7 A;  1IKV A;  1JL1 A;  1HQE A;  2E6M A;  1NK5 A;  4RW8 A;  5CY4 A;  3T1A A;  2HB5 A;  4E19 A;  3V9W A;  4DTX A;  3QEP A;  4LSN A;  4EP4 A;  3MXJ A;  4CFD A;  1HJR A;  3AVN A;  1YVU A;  4W5R A;  4BDZ A;  3QER A;  3UIQ A;  3M8P A;  3QEV A;  1UA0 A;  1WSI A;  1RT4 A;  4DSL A;  3VQ5 A;  3SQ2 A;  3HK2 A;  4FXD A;  4DTU A;  1R0A A;  2HHU A;  4DTM A;  3BDP A;  2QK9 A;  3KIO A;  5SZT A;  2AJQ A;  1RCH A;  1A5V A;  1XWL A;  3LZJ A;  2HHX A;  1RDA A;  1JXB A;  4IFY A;  3U3Y A;  1RTJ A;  4OLA A;  2FBT A;  4RW9 A;  3C6T A;  3VQE A;  5HLF A;  4CEO A;  4CK2 A;  2RKI A;  3KK3 A;  1NOY A;  3OYH A;  4O44 A;  4KB1 A;  2O4G A;  1S1X A;  2YNH A;  3KLH A;  3TAP A;  4AHC A;  4BE2 A;  2A1R A;  3ULD A;  3CG7 A;  4ELU A;  1JL2 A;  4H4O A;  3KTQ A;  4B9L A;  3KD5 E;  4FK0 A;  1QTM A;  4Z4H A;  4O0J A;  4BE0 A;  3SNN A;  3ALY A;  3DLH A;  1RBR A;  4RW7 A;  1Q9Y A;  2IC3 A;  2RN2 A;  4N76 A;  4OPK A;  3OY9 A;  1RTH A;  1EKE A;  3AO5 A;  2E4L A;  1ITG A;  3D45 A;  1SUQ A;  3DLE A;  3VQ6 A;  4CEA A;  4CJS A;  3O3F A;  4KAZ A;  4FZX C;  4E1N A;  4CHZ A;  1SL0 A;  4DSJ A;  2HNY A;  2Z1H A;  4KRE A;  5HRP A;  2WON A;  1HYS A;  3I0R A;  3LAL A;  3O4Q A;  4DLG A;  4AH9 A;  3MAQ A;  4DTJ A;  3SUQ A;  1NK0 A;  3L3U A;  4CHN A;  4C8L A;  4DFJ A;  4LH4 A;  3NH0 A;  2G8V A;  1BIZ A;  1VSE A;  1VSH A;  2EX3 A;  2Y1J A;  1QE1 A;  3IS9 A;  3DOK A;  3OYL A;  1C6V A;  3EYZ A;  3ZSZ A;  4CCH A;  3HPG A;  1CZB A;  1GOC A;  4RG8 A;  1ZBH A;  4PA1 A;  4KHQ A;  2FBY A;  4LH5 A;  1KTQ A;  1DTQ A;  1BIS A;  1FXX A;  3T19 A;  4CEQ A;  2HHQ A;  3HO1 A;  4CJV A;  2Q3S A;  3KLG A;  3AVG A;  3HP9 A;  4E7L A;  1S1U A;  1N6Q A;  1ZBF A;  4E7I A;  1TK0 A;  3CYM A;  5FRN A;  1NJZ A;  3VN5 A;  1NKE A;  2E6L A;  2KFN A;  3DRP A;  2Z1J A;  3QNO A;  4CGD A;  5HRN A;  3OYA A;  3S9H A;  4B9N A;  1KRP A;  1RT7 A;  2KQ2 A;  3OYE A;  3ZT3 A;  1BGX T;  4L8R B;  3LP0 A;  3L2Q A;  4JRP A;  3T3F A;  3HYF A;  2ATQ A;  3QES A;  4Q0B A;  2KW4 A;  3LPU A;  3NGI A;  3TR8 A;  3HP6 A;  2ETJ A;  4KB0 A;  4DWI A;  4FLT A;  2I5J A;  4DTR A;  3MEC A;  5FRO A;  4YNQ A;  3NH2 A;  1BI4 B;  4FJ5 A;  3F9K A;  2FBX A;  3AVC A;  4C8N A;  3LWL A;  1X9M A;  3K5M A;  4RW6 A;  1BQM A;  3D0P A;  4DU1 A;  1VRU A;  3CM6 A;  4CER A;  4DFK A;  2YNI A;  4CGH A;  3LAK A;  3OYB A;  1X9S A;  2LSN A;  4FJK A;  4DS5 A;  4IG0 A;  4C8M A;  4DSF A;  1RT1 A;  1LV5 A;  3SZ2 A;  5I3U A;  4NCB A;  3RMD A;  5KGX A;  3AVH A;  3PX4 A;  3OS0 A;  3L2V A;  1NKB A;  1NK6 A;  1JLA A;  4FLY A;  4KI4 A;  1RT3 A;  1XI1 A;  4DG1 A;  4B8A B;  1T03 A;  4BE1 A;  4CK3 A;  3VQC A;  4ID5 A;  2EHG A;  3KK2 A;  4F2S A;  4CF1 A;  4AHR A;  3ZT1 A;  1RT2 A;  4KRF A;  2IDO A;  3NF7 A;  4B08 A;  1C1A A;  3K5N A;  4DLE A;  3V1R A;  4IKF A;  2WOM A;  2XO7 A;  1XHX A;  1YTU A;  1EET A;  4DS4 A;  1A5X A;  4ELV A;  4FJN A;  3NF6 A;  4CE9 A;  3AVF A;  4LD0 A;  5I42 A;  1EXQ A;  1JLQ A;  3DOL A;  3RR7 A;  4B9T A;  4CFB A;  1TL1 A;  2Z1I A;  2BGG A;  1JKH A;  4MFB A;  4CIF A;  1VSL A;  3HJF A;  2XHB A;  3NF9 A;  1C0T A;  4KHN A;  3DYA A;  3HVT A;  4CGJ A;  3MEE A;  4H8K A;  1IH7 A;  3VQ4 A;  2HHW A;  3SYZ A;  4HCC A;  1X9W A;  4DTS A;  4W5O A;  4ID1 A;  3HM9 A;  2PY5 A;  4OPJ A;  5C25 A;  2B4J A;  2DY4 A;  3VQQ A;  3LPT A;  2FBV A;  3B6P A;  4DF8 A;  2XY6 A;  1CLQ A;  3LDS A;  5HRO A;  4N47 A;  3VQD A;  4E7H A;  2ZQB A;  3KLI A;  4FVM A;  3OS1 A;  4F2R A;  5SWM A;  4O5B A;  3QEI A;  2YNF A;  4NYN A;  4I7F A;  2KTQ A;  3SQ1 A;  3I0S A;  1S9G A;  1TV6 A;  4AHT A;  1ZBL A;  1UOC A;  2QKK A;  4C8K A;  1NK7 A;  2DFE A;  4CED A;  2O4I A;  3P1G A;  1ZBI A;  2HW3 A;  4BWM A;  2IAJ A;  1S9E A;  4M3W A;  3AO3 A;  3OJS A;  1ASV A;  2GUI A;  2F8S A;  1VSM A;  2YNG A;  1HRH A;  3OYK A;  5C24 A;  3SJJ A;  4I9Q A;  3NFA A;  4CF9 A;  4N41 A;  4FJ8 A;  3HL8 A;  1D5A A;  3JYT A;  3OYG A;  3K5L A;  2Y1I A;  2X78 A;  4J2E A;  4BDP A;  4ZHR A;  1XC9 A;  4KHU A;  1ASW A;  3SQ4 A;  1LAW A;  4WE1 A;  1FKP A;  4DF4 A;  1L3T A;  2OPP A;  2KZM A;  3IAY A;  1WAF A;  1BCM A;  1Z25 A;  3SUO A;  4FJI A;  2VWJ A;  4FJG A;  4Z4C A;  4FM2 A;  4KHY A;  4EZ9 A;  4FW2 A;  3C94 A;  3RMA A;  2OPR A;  4CEB A;  4B8C A;  3DRS A;  1NJW A;  4FLW A;  4CF8 A;  2YKM A;  4KO0 A;  5FDL A;  3KK1 A;  1L3V A;  1RBV A;  4CF0 A;  5KI6 A;  4ICL A;  1RDC A;  4CJ5 A;  1TKD A;  1RBT A;  3WNF A;  3RR8 A;  4DQR A;  2DFF A;  3ZSV A;  2P5G A;  4PUO A;  4CJP A;  1VSJ A;  3QLH A;  3A2F A;  3NBP A;  1JLG A;  4OKK A;  4CEC A;  4E1M A;  2YKN A;  1SKW A;  2BE2 A;  3HPH A;  4DSK A;  3V81 A;  3PO5 A;  4EZ6 A;  4Y1D A;  1L5U A;  2ZD1 A;  4G1Q A;  3AO2 A;  1GOB A;  3PV8 A;  1Z26 A;  1S1W A;  1ASU A;  3DRR A;  4ZTJ A;  3ZSW A;  4F8R A;  4FK4 A;  5DK5 A;  4M3R A;  4CEE A;  1S6Q A;  1I3A A;  4KTZ A;  3CQ8 A;  3K58 A;  1IKY A;  3G10 A;  4K8X A;  1K6Y A;  1S1T A;  2PYL A;  2HND A;  1BI4 A;  1VK0 A;  3PY8 A;  3NGZ A;  1X1P A;  4AIL C;  3OYJ A;  3NDK A;  1UWB A;  2OPQ A;  2G8K A;  2ZE2 A;  4HCB A;  3AVL A;  3LZI A;  3AVB A;  3V9X A;  5J2N A;  2QXF A;  4O0I A;  3ISN C;  4CIG A;  3SV3 A;  3V9S A;  1D9D A;  1C0M A;  4N56 A;  4DQP A;  4F4K A;  3HT3 A;  4GMJ B;  1RDB A;  4DFM A;  1J9A A;  4AHS A;  1HMV A;  4JLH A;  4CJQ A;  4O55 A;  3HST B;  3JSM A;  1CZ9 A;  1L3S A;  1B92 A;  1KFD A;  1S6P A;  3ZCM A;  3OYN A;  3KKR A;  4DU4 A;  4C8O A;  2F8T A;  1LW2 A;  1HNI A;  1TKX A;  1NKC A;  3BGR A;  3PX6 A;  1S1V A;  4OGE A;  1EX4 A;  1LWC A;  2KFZ A;  2IOC A;  2X74 A;  4QCL A;  1KCF A;  4FM0 A;  1B9D A;  1SL1 A;  4B3O A;  4CHO A;  4M41 A;  2D5R A;  3KD1 E;  1WSJ A;  1U4B A;  2XY5 A;  1B9F A;  4Z4I A;  4I2Q A;  4KKO A;  4CGF A;  4E0D A;  1RDD A;  1WSG A;  4QOZ B;  3TAQ A;  2XY8 A;  3L2U A;  2P51 A;  1LWE A;  1SKR A;  3ZT2 A;  3I8D A;  3H08 A;  1Q9X A;  2B5J A;  4IG3 A;  4FJJ A;  4KHS A;  4LSL A;  1T05 A;  4PY5 A;  2IGI A;  4KV8 A;  5EU7 A;  3OYI A;  4DTO A;  1A5W A;  3U3G A;  1BQN A;  1VRT A;  4CFA A;  3O3H A;  2HNZ A;  4HUE A;  3AVJ A;  4OVL A;  4FJX A;  4PWD A;  5KRS A;  2HMI A;  1NK9 A;  3KKS A;  4JRQ A;  1UA1 A;  1NOZ A;  3OYC A;  2X6N A;  4UQG A;  4GW6 A;  3K57 A;  3CFR A;  2VWK A;  3AVK A;  1BCO A;  3ZT0 A;  3P83 D;  1W0H A;  5J2Q A;  4I2P A;  4FJL A;  3M8S A;  1DTT A;  3M8R A;  1C1B A;  5T7B A;  2OPS A;  4BAC A;  3S3N A;  2HHT A;  4BWJ A;  4CF2 A;  5JS1 A;  3VQP A;  4RW4 A;  3FFI A;  3ITH A;  3DLB A;  4B9U A;  4M3Y A;  1U04 A;  4FZY A;  2P1J A;  3WNE A;  1GOA A;  3VQ9 A;  2DTU A;  3LP1 A;  3NE6 A;  3TAB A;  3V1O A;  4CIE A;  1VSF A;  4Z4F A;  1Y97 A;  1J54 A;  1HNV A;  4CJF A;  1RBS A;  1IKX A;  2OYQ A;  1YTA A;  3ASM A;  4M45 A;  3V6D A;  3V9Z A;  1HPZ A;  3O4N A;  1FKO A;  4F3T A;  1N5Y A;  4M3U A;  1WSF A;  3NH1 A;  1TKT A;  3PX0 A;  3ZSO A;  2GV9 A;  4CGG A;  1TGO A;  1UAX A;  3LP3 A;  4OKJ A;  3RMB A;  3QEW A;  5HP1 A;  1CXU A;  1C0U A;  1TVR A;  3M8Q A;  3P5J A;  2D0C A;  3MED A;  3E01 A;  4O4G A;  4OLB A;  1J53 A;  1QSS A;  2HVH A;  1WLJ A;  1JLC A;  4CES A;  3AA2 A;  4DU3 A;  1BHL A;  1VSD A;  2A1S A;  1F21 A;  3LWM A;  3SQ0 A;  1T8E A;  4J2D A;  1FK9 A;  1ZYQ A;  3DLG A;  4FLV A;  2BAN A;  2YHB A;  3K5O A;  1WNS A;  4OKE A;  1KFS A;  4KPY A;  1ZBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...