1ZBMA

X-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
HHSHKIRVAHTPDADDAFMFYAMTHGKVDTWLEIEHVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGDGYGPVVVAKSEISLDGKRIAVPGRYTTANLLLKLAVEDFEPVEMPFDRIIQAVLDEEVDAGLLIHEGQITYADYGLKCVLDLWDWWSEQVKLPLPLGLNAIRRDLSVEVQEEFLRAMRESIAFAIENPDEAIEYAMKYSRGLDRERAKRFAMMYVNDYTYNMPESVDAALKKLYEMAEAKGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein AF1704
total genus 86
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02621 VitK2_biosynth Menaquinone biosynthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1zbmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1zbmA02
5HBCA 4JDFA 1Y3NA 4Q8RA 3MPLA 1JEUA 3DP6A 4NF8B 3E4RA 1MQDA 4KR5A 1US5A 1HSLA 1J1NA 2Q2CA 3IORA 1FQAA 1SW1A 3QSLA 1JETA 1B4HA 1MM7A 1MPCA 1XOCA 2F7BA 2W7YA 3LSLA 2NUVA 5CRYA 5FHOA 4NF6B 1LB8A 1FQCA 1MG1A 3T22A 1B3EA 2VP1A 3E9XA 3PGFA 1Y1MA 3HO7A 4QRZA 2VD3A 3QK6A 3UK4A 4UA8A 5ICQA 4YICA 4KD5A 3T93B 1MDP1 1MS7A 5A5XA 3BKIB 5K2XA 5DEXB 4OVJA 3MVXA 1EZOA 1MM6A 3OXNA 2PMSA 1USYE 1MH3A 2A5TA 2CMOA 1LBBA 2AIXA 1Q35A 3K0VA 4ELRA 3RLFE 3K1PA 5DVIA 2NOOA 3IOWA 3SKPA 4F2OA 3IO6A 1SBPA 3CFXA 1YAEA 2OBGA 2ZXTA 4EXKA 3KSJA 3RGYA 4TLMB 5DVJA 3QUFA 2G29A 3H3GA 3TFLA 2HXWA 3Q25A 3IB1A 1N7XA 1HSJA 4IY5A 4IO4A 4FAJA 4QFKA 2ZYNA 1BLFA 2Q89A 1B0LA 4X48A 4ZEBA 1N0TA 1B5IA 1D3KA 3HN0A 4GQOA 1B7ZA 3M3LA 1S7YA 4RA1A 2RC7A 4HCWA 5B7DA 3O66A 2I48A 2PX1A 2DWJA 2XD3A 2XXTA 3BFTA 3K1MA 1QUKA 1ELJA 2DE4A 3SDFA 4E0WA 3O6GA 1ZKBA 1A40A 3GZGA 1LAFE 2H25A 1OVTA 1N3WA 3K1NA 3OO7A 3ZKKA 5CC2A 2DS9A 1IXGA 3FVNA 3L6HA 1LFHA 4QF9A 1SD3A 5AA3A 1NH7A 3SERA 2UVJA 2F7CA 4OETA 2ZNTA 1PC3A 4O3BA 2F97A 5KDTA 3FD3A 2V3QA 4GXAA 4RPNA 1EH3A 2I58A 1R1NA 3KN7A 1FTOA 3FUZA 3K6UA 3O97A 3LSWA 3PMXA 5L9OA 2XXYA 1P1OA 3I6VA 4F22A 5CMBA 3FZVA 3I3VA 3T9XB 3EHSA 5I56B 2DOJA 2XXUA 2I6EA 3GLBA 5F1QA 5CI5A 5I84A 2ZYMA 3PUYE 5H8NB 1II5A 4OEUA 2H99A 4MBPA 4ZZAA 1B5JA 5AA2A 1MY2A 3ONMA 2XHDA 3H7MA 5TP9A 1PBQA 1SI1A 3BBRA 3KOSA 4MLQA 3UP9A 3VLVA 2QS1A 4ISUA 1F9BA 2P2AA 3H6WA 2I0BA 4GIZA 4R6HA 4ELPA 3MVWA 1LGBC 4G68C 1NH8A 4YKJA 2PYYA 5L9MA 2O68A 4EUOA 1UTBA 1XC1A 3IJOB 2QMXA 3O6HA 3EF7A 4ZEKA 1P99A 4RNSA 2B3BA 3I5OA 4QSCA 2GHBA 1HSEA 1YPNA 1JVXA 3MZ1A 4YMAA 4YB7A 4C0RA 4RPOA 3C31A 3PPQA 1FTLA 5AA2B 1GV8A 5L8DA 1FQBA 1O63A 2A5TB 3VLUA 1B40A 5H8NA 1QVSA 3O9PA 4Q0CA 3VXCA 1MXVA 4JWXA 3N6TA 4RY1A 4K3FA 2Z8FA 2RCAA 2ESNA 5EHSA 4EDPA 3FXUA 4RYAA 2XX9A 4M1VA 4R74A 5ELVA 4DXCA 2Y7PA 1JW5A 4KYDA 4IGTA 3S4UA 4BDOA 3S9NC 3CRBA 1Z7ME 2UYEA 4N07A 1LLSA 1VFDA 3RPWA 2RC8A 3UN6A 3UGWA 3OSQA 4U23A 1D9YA 3O2AA 1R9QA 3SESA 3CG1A 2THIA 3FJGA 1QUJA 4NE4A 1FTKA 2F6PA 4AB5A 1UIUA 4YKKA 3PUWE 4THIA 3EN3A 4BDNA 5AA4B 5DT6A 3PD8A 3OOAA 2IA4A 3ZKLA 4BDMA 1MQHA 4BLAA 1JW4A 3OO8A 4OQOA 3IOVA 2HZLA 1MQJA 2O69A 3RN8A 2M8CA 3OELA 1IITA 4POWA 3T9UA 3ECRA 3IL1B 1EU8A 3TTMA 4XKNA 2Y7KA 3UA8A 1EZ9A 5I2NA 4G8MA 1T0KA 2P1SA 3TKDA 3GBBA 4RJZA 1POTA 2O7IA 5LOMA 4EQ7A 2UVHA 4U1OA 3FVKA 1B0HA 1AL3A 2VD2A 2P0SA 3FXRA 4KI0E 5FTIA 1TFAA 3SEXA 1SW4A 3LSXA 1DTGA 1H3DA 5AA1A 2DSFA 4FJPA 3RT6B 2G93A 3KG2A 1B7UA 3KSXA 3W15C 4NWDA 4U1ZA 3OO9A 1FTMA 1LAXA 4FECA 3TODA 2ZNSA 1LSTA 1QUIA 3VVDA 1PEBA 2F36A 3N5LA 3C4MA 4OEVA 1UQWA 3TUSA 2H9BA 1FCKA 1LCFA 2HFBA 4TOZA 1RYOA 3TAJA 2DYXA 1QW0A 4XTCQ 1A8EA 2ONRA 3ILUB 1B6HA 3K6XA 3IAZA 3M3FA 1N3XA 4GL0A 3Q29A 2QS3A 3MQ9A 1OQHA 4H5FA 3U94A 4WEDA 4YKIA 1MY3A 2H98A 4N6PA 4QFOA 3FATA 2V3UA 1POY1 2O1LA 3OSRA 3PU5A 3SETA 1ANFA 1DPEA 1SW5A 3FJ7A 4YU0A 1MY1A 2FYIA 3HHGA 3N94A 4GFRA 1OLAA 5FHMA 1P1QA 1NKXA 2F7AA 2DVZA 1ZTYA 3OMBA 3LUYA 3M3KA 3PV0E 4LQ2A 3QAXA 1R6ZA 1ZU0A 2Z8EA 3B6TA 4PFWA 4RK2A 2Q2AA 2OK2A 5JEIA 5JK4A 1SW2A 3PUVE 3U93A 1O64A 4DXBA 1M5BA 4ZZEA 1QKAA 3KN3A 4X1DA 1IXHA 1H76A 4RK9A 1LFIA 1MPDA 1OVBA 2HAVA 3UORA 5I57A 3IB0A 2R6GE 5H8QB 4F19A 5L9SA 2R9JA 4DZ1A 4ZEIA 4LONB 4KCDA 3CI8A 3B6QA 1LB9A 1M5EA 1N84A 4ND9A 1M5CA 4YKPA 5AA2D 4OHNA 5F7VA 3U8QA 4FEDA 1OLCA 3MUQA 4DXUA 1N04A 3C32A 3TYHA 3B7DA 3HSTA 2H4IA 2HCAA 3H4ZA 5KCJA 2QPQA 3HCQA 1PDAA 4F3BA 4XKPA 2B3FA 4ONYA 4WEPA 3FJMA 3TTKA 1TXFA 2Z8DA 4LA9A 3TCGA 4YMBA 4OESA 3JZJA 1D4NA 3R7XA 1NL5A 2VOZA 4H8JA 4NF5B 4YB5A 1MXWA 1H45A 2YJPA 3MZ9A 3G3JA 1UIVA 4FE8A 4L17A 4F1YA 1YCJA 3G3KA 5HPQA 5IKBA 1FQFA 4MLVA 4P0IA 1NFTA 5TP9B 5CMKA 2F34A 2DP8A 4JB7A 4R73A 2UXAA 5CMMA 2NWJA 3UIFA 5I58A 2YLNA 3QXMA 4YAHX 4OMBA 2AL5A 3CSBA 3E13X 1LAGE 4XXUA 4FATA 4ZE9A 4U21A 5I2NB 3TCFA 3V89B 3VFJA 4F3GA 1FQDA 1JQFA 3CIJA 4QFLA 4HS7A 2QJEA 5H8FA 4U4XA 3KZGA 4LZ8A 4KYEA 1SDXA 3N6UA 4GLIA 3WAEA 1UTHB 3TTLA 4EXLA 1S50A 3T66A 1BKAA 3CFLA 4G4PA 3W9VA 1DOTA 1P1UA 1PB8A 5CMCA 2HEUA 1SYIA 3MVZA 4LVQA 4OYVA 3MVYA 2I4BA 3FV1A 5DTBA 3TZAA 2Q9TA 4H8IA 2F8DA 1Y20A 1MH4A 3CR9A 1LCTA 4HCYA 4ZECA 4ZEDA 1MRPA 4QFPA 4MH5A 4IO2A 1MQGA 2OWTA 3KJ7A 1TFDA 1USYH 2WKYA 2ONKE 2O1MA 4EF1A 2FNCA 2ZYKA 4I1DA 4YB6A 3EHTA 3Q26A 3PD9A 4I62A 3LBSA 2YPNA 3JV9A 3S2VA 2QMWA 4JXIA 1RYXA 3MWBA 4G68B 3K4UA 3PPRA 4OWDA 4PFUA 3KN8A 3QUJA 2I0CA 1JEVA 2O84X 4LATA 4MF3A 5B70A 3FASA 3S9LC 4LUBA 5FTHA 4F1VA 1B4ZA 1NMUA 3H03A 5EHMA 1JW1A 4PE5B 2D21A 4F29A 1AMFA 1VSOA 1M5DA 2B65A 2PT2A 4N13A 4Q30B 1MY0A 3P7IA 1Y9UA 1CB6A 1B05A 3IR1A 4F39A 4Z7EA 2DVCA 4IGRA 3V83A 3RNNA 2DXRA 1A55A 1LBCA 5AE4A 3D4CA 3LR1A 4IO5A 1IUDA 4EQBA 3KEIA 1MDQA 1O7TA 3RUMA 1GGGA 1US4A 4AB6A 4H6DA 1XVYA 3D4GA 2R71A 2ZMBA 4R72A 3F11A 4KFQA 1ZBMA 3MP6A 4ELOA 1DTZA 2LAOA 3PPOA 1TT1A 2D5WA 1URDA 2Y84A 3KOTA 1AOVA 2Y7RA 3T96B 2ZYOA 2VGQA 4OERA 2DWIA 4QFNA 4DE8A 1SYHA 4I9DA 3K02A 4XKRA 2RCBA 3O6IA 4PQJA 3K2DA 1YTVA 4PP0A 5KCJB 3G3GA 1TWYA 1URGA 1Z7NE 3R6UA 4RXLA 1XS5A 2O51A 3KFMA 3TTRA 3TTNA 4BDLA 3IOTA 2AL4A 4H1XA 1M5FA 4TQUQ 4FEBA 4C1UA 4TLLB 3QYTA 5BWJA 3IX1A 3FVOA 2Q8JA 3U72A 5KZTA 1PB7A 4IB2A 4JWOA 3FGSA 3PMWA 4LQ5A 4JSOA 2DQVA 1XHYA 2F35A 4R75A 4U2RA 4DLDA 4GRKA 2DWHA 1PBPA 2V3TA 2Z23A 4R2FA 3HPIA 1Y3PA 4WKMA 3VVFA 1NNTA 5KDTB 4R6YA 2F6GA 3T9VA 4EQ9A 5I2KB 5CM6A 3L6GA 4KQPA 4G8NA 3GXAA 3SEYA 1QJMA 2XXIA 4F18A 1SQYA 4LP2B 2QRYA 1WVJA 1QKBA 2XXXA 5I59A 1IIWA 4POXA 1D9VA 4U4SA 2PBWA 5TPAA 3FV2A 1DSNA 1N76A 3MC2A 2F78A 3V8XB 5ISUA 1IEJA 3H6UA 4NTLA 3RT8A 4E0XA 3MBPA 4M4GA 4JSDA 3OENA 5FHNA 1B3FA 1B52A 1OIBA 3G7WA 2UVIA 1H44A 1B1HA 3KJTA 4KCCA 5H8HB 1LAHE 1BIYA 1I6BA 3VXBA 5DYHA 3Q27A 4U22A 1DMBA 4PFTA 1B32A 3DP4A 3PPNA 4H65A 4IO3A 3H6VA 3USDA 2PT1A 4ZDMA 5JTYA 2XXWA 2GRVA 3PMVA 1IXCA 4G8HA 3IO4A 4ESWA 4F31B 1LFGA 2I49A 4Q5TA 2XX7A 5K2YA 1B58A 1I6QA 4GF8A 1B1XA 3OD7A 3JYRA 1IXIA 3RTFB 4NF4B 2XXVA 4IY6A 4OZ9A 2GH9A 1MXXA 2OZZA 3AXFA 4LZ7A 2ZNUA 5I2KA 5A5XB 3RY3A 3DP8A 1GVCA 1URSA 3KGCA 4KPTA 2ANJA 1MXYA 4KYSA 3K6WA 1BP5A 1Y4TA 4F2QA 5ITPA 3EPEA 5I59B 3MAMA 4FIMA 4F1UA 2REJA 1MPBA 3S9EA 2XXHA 3U92A 2AYSA 1VFEA 4F3SA 2I3VA 1XT8A 1PB9A 1SVXB 2OLBA 4Z0IA 2XXQA 4ZEFA 5BUUA 4BDRA 4NWCA 4GVOA 1UTHA 5TU0A 3LSFB 3PUXE 4GD5A 3VLWA 3IB2A 1Y4CA 2DXYA 3Q28A 2GHAA 2XXPA 2GFEA 2HZKA 1B2HA 2OCUA 3SEUA 4O3AA 1KWHA 4NMYA 3QIMA 2HAUA 4AQ4A 3DM0A 4H5GA 1R9LA 3RQTA 1N7WA 3IOUA 3PPPA 4G77A 4JWYA 4XKQA 4HW8A 2RKMA 4UACA 1GR2A 3S9MC 3TQLA 1VE4A 2HQ0A 1FQEA 1JNFA 2DE2A 2I4CA 2QS2A 3FXQA 3MP1A 2X7PA 5H8FB 1NNKA 1BTJA 5CBSA 5HM4B 4QSEA 1B9JA 4OFLA 3C35A 2NXOA 3O28A 1ATGA 1XVXA 3C34A 4O3CA 3OEKA 2PVUA 1B46A 1UTBB 4P0GA 3FVGA 1JVYA 2UYFA 4NEDA 1B3HA 3B6WA 5I58B 1A54A 1MQIA 3CFZA 4R9GA 1H43A 3C9HA 2Y7WA 3EQ1A 3FIRA 4LZ5A 1Q1KA 5EYFA 3PUZE 1FW0A 4MFIA 2XD2A 1ZIUA 3C33A 4YZZA 1ZMGA 2DE3A 4C1TA 4GOTA 2CZLA 4NF5A 3CG3A 4P11A 3V5AA 3MW0A 4X1BA 5IAIA 4F3PA 1P1NA 2ONSA 4BDQA 4DIGA 4ECFA 1A99A 2Y7IA 3BFUA 1FTJA 1B3LA 3IK6B 1MY4A 4G68A 4R6KA 2A5SA 4DCXA 1DPPA 2E1SA 4GWOA 1Y3QA 1MXUA 1WODA 3KBRA 5DVFA 4KHZE 1NNFA 3VV5A 4DCYA 4EF2A 2QL3A 4PFYA 5I56A 2ABHA 2I3WA 2XXRA 1A8FA 4G2ZA 4ZE8A 3OO6A 2REGA 3SEVA 1OMPA 3CSGA 4H0WA 2ALUA 5H8QA 5H8SA 4R2BA 2DWAA 1ZJLA 4R9FA 3RTWB 2KLFA 3HV1A 1B51A 4QSDA 3TELA 3ZSFA 1B5HA 4NF4A 4ESXA 5ITOA 1AH5A 3ODBA 1I69A 1CE2A 1A7LA 3K6VA 1RKMA 2H5YA 1NNPA 2FA7A 2UVGA 3G3FA 3ILTB 2Q88A 4FORA 4IO7A 3TMGA 3U1OA 3VVEA 3W9WA 5J1DA 3TQWA 4DDDA 1WDNA 2IEEA 3DELB 3SEWA 3H06B 3LC8A 3H6TA 3A09A 3MJNA 1Y1ZA 2O7UA 4QHQA 2NVUB 4IO6A 4OXVA 3TEPA 5M2VA 4PETA 4H67A 3T9HB 5CBRA 1EZPA 3M8UA 1ZLQA 3GBAA 1SI0A 3DLNA 3E3KA 3MPKA 2XX8A 4GXSB 5H8HA 2X7QA 5ICTA 3O29A 3TPAA 3K00A 3VDFA 3THIA 2Z22A 3OEMA 2QS4A 5JTYB 3C36A 4GL8A 3MZBA 1S9TA 2D3IA 3A3CA 3IJXB 4X9TA 5DEXA 2E0SA 3HHFA 4ZS9A 1AIVA 4NF8A 3CVGA 2BJJX 4OTEA 3K01A 2O6AA 1IQ7A 5TPAB 5I57B 1I6AA 2V93A 1B3GA 2VHAA 2OJTA 2OWSA 1QULA 3A3UA 4NF6A 4WXJA 2RC9A 3ZS6A 4OENA 3TCHA 1P1WA 2V84A 3R26A 2RF1A 4HTGA 2F5XA 5AA4A 1GTKA 2RINA 3TDJA 1VR5A 1OQGA 3N26A 1MXZA 4OFOA 1L5TA 2QSXA 4OFJA 3VE1B 3G3HA 4I8CA 4ELQA 4JBZA 2X26A 4XIGQ 2V25A 3EHUA 1B7HA 3WAFA 1IZ1A 3MP8A 3G3IA
chains in the Genus database with same CATH superfamily
4QBAA 1BK4A 3E4RA 1MQDA 2Q2CA 1HSLA 1J1NA 3LSLA 4X8RA 4NF6B 1FQCA 4PBHA 4PCDA 3QK6A 4KD5A 5A5XA 5I5PA 3BKIB 2CMOA 4GX3A 4I3YA 4F2OA 3SKPA 1SBPA 4OVPA 2OBGA 3KSJA 4TLMB 3Q25A 4QFKA 1BLFA 1YZ0A 4X48A 4ZEBA 3HN0A 4GQOA 1B7ZA 1S7YA 5B7DA 3O66A 2DWJA 2XXTA 3BFTA 1QUKA 1KA0A 3SDFA 3GZGA 3ZKKA 1LFHA 4QF9A 2UVJA 2F7CA 4OETA 2DDKA 1PC3A 4G61A 2V3QA 4RPNA 1R1NA 3K6UA 3LSWA 2I6EA 3GLBA 5AA2A 1MY2A 2XHDA 3H7MA 1SI1A 3BBRA 3KOSA 5EYHA 3VLVA 2QS1A 4ISUA 4GIZA 4ELPA 5DW8A 4G68C 2PYYA 2QMXA 1FPKA 4QSCA 4YMAA 2V4CA 5L8DA 3VLUA 5H8NA 4Q0CA 4JWXA 3N6TA 4K3FA 2XX9A 4ZE9A 4R74A 4KYDA 3CRBA 2KR0A 2RC8A 3UGWA 1EYKA 4BDNA 3PUWE 4ZECA 4BDMA 4BLAA 3ZKLA 1MQHA 2O69A 1EU8A 1KZ8A 1T0KA 1POTA 1B0HA 2XWVA 1SW4A 1DTGA 1H3DA 4FJPA 4NF0A 3VVDA 1UQWA 1QW0A 1K9YA 3IAZA 4GL0A 2QS3A 3U94A 2CZKA 2O1LA 3FJ7A 5LTCA 1MY1A 5FHMA 1NKXA 2DVZA 1IMBA 2Z8EA 1SW2A 3U93A 4MHFA 4ZZEA 5I57A 2R6GE 5H8QB 2CEYA 3CI8A 4ND9A 4FEDA 2H4IA 2HCAA 5KCJA 3HCQA 4XKPA 1IMFA 4ONYA 4YMBA 1YXIA 4OESA 3ISPA 1NL5A 2VOZA 4H8JA 4NF5B 1FPDA 4QXDA 3G3KA 5TP9B 2DP8A 3UIFA 4HE1A 2OWZA 4FATA 3V89B 1JQFA 2FVZA 2R8TA 2PFYA 4KYEA 3WAEA 3N6UA 3QMFA 1S50A 3CFLA 3W9VA 5CMCA 2HEUA 1SYIA 3FV1A 4HCYA 1LCTA 4ZEDA 1MRPA 1USYH 4I1DA 3Q26A 3MWBA 4OWDA 3PPRA 3KN8A 5B70A 1JEVA 4MF3A 3H03A 4N91A 1JW1A 4PE5B 1NV2A 1AMFA 1M5DA 1MY0A 4F39A 3IR1A 1B05A 1IUDA 1O7TA 4H6DA 1URDA 2Y84A 4PGPA 2ZYOA 2VGQA 4OERA 4F29A 3T9HB 4PQJA 1TWYA 1Z7NE 4RXLA 3TTNA 5ITPA 1IMAA 2AL4A 4H1XA 5BWJA 4FEBA 3QYTA 4IB2A 1PBPA 2Z23A 4R2FA 4PBQA 3T9VA 3SEYA 4F18A 5I59A 4U4SA 1N76A 4NTLA 4E0XA 1OIBA 2UVIA 3KJTA 1LAHE 3VXBA 1DMBA 1B32A 4O8MA 4H65A 3H6VA 4ZDMA 2GRVA 1IXCA 4ESWA 4GWZA 1FPFA 4Q5TA 5K2YA 3JYRA 1IXIA 3KC1A 1MXXA 2ZNUA 3DP8A 1GVCA 1URSA 1MXYA 1BP5A 1Y4TA 3MAMA 2XXKA 4F1UA 1MPBA 3S9EA 3BIGA 2XXHA 2I3VA 1PB9A 1SVXB 4BDRA 1EYIA 4GVOA 3PUXE 4GD5A 3Q28A 2DXYA 2XXPA 2HZKA 2OCUA 3QIMA 4H5GA 1R9LA 5CBSA 4QSEA 1XVXA 3OEKA 1JVYA 1B3HA 1A54A 4R9GA 3C9HA 2ZZVA 3PUZE 3PTYA 2DE3A 4GOTA 3MW0A 4F3PA 4PC9A 3BFUA 3FXBA 1FPGA 2E1SA 4GWOA 1Y3QA 3KBRA 2QL3A 1NUZA 4G2ZA 5H8QA 1B5HA 4NF4A 5ITOA 4JVIA 1AH5A 2VT5A 2UVGA 2FA7A 3TMGA 5J1DA 4DDDA 3SEWA 4P1LA 3TEPA 2XWKA 3DLNA 2ZZXA 3OEMA 2QS4A 3A3CA 4PAKA 5EYGA 2OX3A 3MYUA 2MKZA 2V93A 1B3GA 3ZS6A 2OWSA 1QULA 2RC9A 2V84A 2RF1A 5AA4A 4NN3A 1GTKA 1VR5A 4I8CA 4ELQA 4JBZA 4O7MA 4XIGQ 1IZ1A 4N8YA 4Q8RA 3DP6A 4NGUA 3IORA 1SW1A 1B4HA 5FHOA 1B3EA 2VP1A 4UA8A 1FPBA 4YICA 4OVJA 3MVXA 1EZOA 3OXNA 1USYE 3K0VA 3IOWA 3RGYA 5DVJA 4PFBA 2G29A 3H3GA 3A29A 3TFLA 1N7XA 1HSJA 1B0LA 2JJKA 1N0TA 1B5IA 1D3KA 5A5LA 4RA1A 2PX1A 2DE4A 3O6GA 1ZKBA 1LAFE 3K1NA 3OO7A 1IXGA 1SD3A 5ET7A 3SERA 1EH3A 2I58A 3KN7A 1FTOA 3O97A 3PMXA 2QVRA 3I6VA 5CMBA 3FZVA 3T9XB 5I56B 5F1QA 3PUYE 2H99A 4ZZAA 1B5JA 1PBQA 3UP9A 4MLQA 3H6WA 1NV6A 1LGBC 4YKJA 1IMCA 1P99A 4RNSA 2B3BA 1JVXA 4YB7A 4C0RA 2HXRA 4X04A 1O63A 2A5TB 1B40A 1MXVA 2Z8FA 5EHSA 4M1VA 3S4UA 4BDOA 3S9NC 3BIHA 4N07A 3UN6A 1D9YA 3O2AA 2QVUA 3SESA 2THIA 1LBWA 4NE4A 4AB5A 5AA4B 3EN3A 3MSTA 1JW4A 1FBDA 3OELA 1IITA 3LV0A 4POWA 3ECRA 3IL1B 3T9UA 1EZ9A 2P1SA 3GBBA 4RJZA 3FVKA 1AL3A 5ESYA 4KI0E 1TFAA 2G93A 3KG2A 3OO9A 1FTMA 4FECA 4P47A 3ROJA 1LSTA 1QUIA 3N5LA 4OEVA 2Y5LA 3TUSA 2HFBA 2DYXA 4XTCQ 1A8EA 2Y5KA 3K6XA 4H5FA 4WEDA 1MY3A 4N6PA 4QFOA 3FATA 1DPEA 1AWBA 4YU0A 3N94A 2F7AA 3M3KA 4PFWA 3QAXA 1R6ZA 3PUVE 1O64A 1QKAA 2HAVA 1OVBA 4DZ1A 3B6QA 1M5CA 3HSTA 3H4ZA 3FJMA 3TTKA 1TXFA 3R7XA 2YJPA 3MZ9A 3G3JA 4F1YA 1YCJA 4MLVA 4DI4B 5I58A 1NV3A 3E13X 4XXUA 4U21A 5I2NB 3TCFA 3VFJA 1FQDA 3CIJA 2QJEA 5H8FA 4U4XA 1SDXA 4GLIA 3TTLA 4EXLA 1FTAA 3T66A 1DOTA 1FJ9A 4LVQA 3TZAA 3MVYA 4AS5A 4GWUA 2WYKA 1MQGA 3KJ7A 3E78A 3PD9A 4JXIA 3QUJA 1NMUA 2FIEA 2D21A 1VSOA 1Y9UA 4N81A 4IGRA 2DXRA 3D4CA 4IO5A 4EQBA 1MDQA 5ET8A 1GGGA 1FPLA 4R72A 3D4GA 2R71A 2ZMBA 1TT1A 4H45A 3KOTA 4GWWA 1SYHA 4I9DA 5KCJB 1YTVA 5EQ7A 5IM2A 4IR8A 3KFMA 5KZTA 3PMWA 2DWHA 1Y3PA 1NNTA 4G8NA 1QJMA 4PTKA 4AS4A 2QRYA 1QKBA 2XXXA 4POXA 1D9VA 2PBWA 5TPAA 3FV2A 3MC2A 3V8XB 3MBPA 4JSDA 4P56A 5FHNA 3G7WA 1B1HA 5DYHA 4U22A 4PFTA 3DP4A 5JTYA 2PT1A 2FHYA 1NUXA 2CZHA 1FBHA 1B1XA 3RTFB 2GH9A 3LUZA 3RY3A 3KGCA 4KPTA 2ANJA 3K6WA 4OVQA 1NV7A 2REJA 3U92A 2AYSA 2VPNA 4PF8A 1DBZA 4NWCA 5TU0A 4OA4A 1FBCA 1RDXA 1QGXA 1B2HA 4MX6A 1KWHA 3IOUA 4G77A 4HE2A 4JWYA 4UACA 1GR2A 1VE4A 1JNFA 3FXQA 3MP1A 5H8FB 1BTJA 3C35A 4P0GA 1B46A 1UTBB 4NEDA 3B6WA 4P9KA 5F24A 1H43A 3FIRA 5EYFA 1IMEA 4MFIA 1ZIUA 3C33A 5EQ9A 1LBVA 2ONSA 2Y7IA 1FBFA 1B3LA 2CZIA 4R6KA 2A5SA 1MXUA 4KHZE 1NNFA 3VV5A 2XXRA 4H0WA 2WEFA 4R9FA 2KLFA 3HV1A 2F3DA 3ODBA 2H5YA 3G3FA 4IO7A 3VVEA 4FORA 4P3LA 3GBAA 1SI0A 3E3KA 3MPKA 4GXSB 2QVVA 3THIA 3VDFA 5JTYB 1RDYA 2D3IA 3IJXB 5DEXA 2E0SA 4NF8A 3CVGA 2BJJX 4OTEA 4XEQA 1XI6A 2PCRA 4WXJA 4PAIA 1LBYA 3TDJA 4N8GA 4OFJA 5IZ1A 3MP8A 3D1RA 3MPLA 1JEUA 4NF8B 4KR5A 1JETA 1XOCA 1MM7A 1MPCA 2F7BA 3UK4A 1LB8A 1MG1A 3PGFA 1NV4A 1Y1MA 1RDZA 4QRZA 2VD3A 1MDP1 5DEXB 2FBPA 1MM6A 1MH3A 2A5TA 1Q35A 3K1PA 2NOOA 3CFXA 4EXKA 4PGNA 3RYDA 3QUFA 4HE0A 4IY5A 4IO4A 2XD3A 3K1MA 1ELJA 1LBZA 2L5VA 2H25A 1OVTA 5CC2A 2DS9A 3L6HA 1NH7A 4O7IA 2ZNTA 2F97A 4P1EA 5L9OA 2XXYA 4F22A 2DOJA 5I84A 4O94A 5CI5A 3ONMA 5ET5A 5TP9A 2P2AA 1KA1A 2I0BA 4R6HA 3MVWA 1NH8A 5L9MA 1XC1A 3IJOB 3O6HA 3I5OA 5FBPA 4RPOA 1FQBA 1QVSA 3O9PA 3VXCA 5JK4A 2RCAA 4RYAA 4DXCA 2Y7PA 1JW5A 4OVTA 4U23A 2FIXA 3FJGA 1QUJA 2F6PA 4THIA 5DT6A 3PD8A 4OQOA 3IOVA 2HZLA 3RN8A 3IFAA 3TTMA 4XKNA 3UA8A 1NV1A 4HXVA 5I2NA 4JVCA 2O7IA 4U1OA 3FXRA 2VD2A 3SEXA 2P0SA 4N4UA 3RT6B 5AA1A 2DSFA 4GWXA 1B7UA 3KSXA 3W15C 3TODA 2ZNSA 4PE3A 4PFIA 2F36A 4TOZA 2ONRA 2PFZA 3M3FA 1N3XA 2F3BA 3Q29A 3MQ9A 4GX4A 2H98A 3SETA 3U65A 2V3UA 3PU5A 1ANFA 1SW5A 3HHGA 1P1QA 2BJIA 4LQ2A 1ZTYA 3OMBA 3TCHA 5JEIA 2Q2AA 2B4MA 3KN3A 1H76A 4RK9A 3UORA 5L9SA 2R9JA 4ZEIA 4LONB 4KCDA 5ET6A 5AA2D 1N84A 3B7DA 1PDAA 4F3BA 4LA9A 1D4NA 4MMPA 1UIVA 5IKBA 1FQFA 4N17A 5CMKA 2F34A 4JB7A 2UXAA 2YLNA 3QXMA 4YAHX 3E79A 4F3GA 4QFLA 3KZGA 1UTHB 1FPJA 2WX9A 4G4PA 3MVZA 2I4BA 5DTBA 2Q9TA 1MH4A 3CR9A 4MEVA 4QFPA 4MH5A 4IO2A 3KBZA 2OWTA 1TFDA 2FNCA 1VDWA 4XFEA 4YB6A 4N15A 4I62A 3LBSA 2YPNA 3S2VA 2QMWA 1RYXA 4PFUA 4G68B 3K4UA 2I0CA 4LATA 4GX6A 3FASA 4LUBA 5FTHA 4F1VA 1B4ZA 2PT2A 4Q30B 3P7IA 1CB6A 2DVCA 3V83A 3RNNA 1LBCA 5AE4A 3LR1A 1CNQA 4AB6A 2LAOA 1AOVA 2D5WA 4MIJA 3T96B 1NUYA 3K02A 3KC0A 4XKRA 3R6UA 2O51A 3RPLA 3TTRA 3IOTA 4C1UA 1FPIA 3IX1A 2Q8JA 3U72A 4I3EA 4LQ5A 4NX1A 4U2RA 4JSOA 2F35A 4GRKA 5IZ3B 2V3TA 3VVFA 4WKMA 4R6YA 2F6GA 4EQ9A 4KQPA 1SQYA 1WVJA 1IIWA 4DI3D 1DSNA 2F78A 1IEJA 3H6UA 3RT8A 1B3FA 1B52A 5H8HB 1H44A 1BIYA 1I6BA 3B50A 3PMVA 4G8HA 3IO4A 1K9ZA 3SZPA 1LFGA 2I49A 2XX7A 4GF8A 4NF4B 2XXVA 4IY6A 4OZ9A 2OZZA 3AXFA 4LZ7A 5I2KA 3EPEA 4FIMA 4F3SA 1XT8A 4Z0IA 1NI9A 5IZZA 3IB2A 1Y4CA 2GHAA 2GFEA 3SEUA 4O3AA 4HW8A 3PPPA 3S9MC 2DE2A 1NNKA 5HM4B 2NXOA 4O3CA 2PVUA 4NG7A 3FVGA 1MQIA 3CFZA 2Y7WA 3EKIA 4LN5A 1FW0A 2XD2A 2CZLA 4NF5A 3CG3A 5IAIA 4X1BA 4PDDA 1SPIA 2P3VA 4DIGA 1A99A 5J16A 3IK6B 1DPPA 4UABA 1WODA 5DVFA 2I3WA 1A8FA 2REGA 3CSGA 5H8SA 4R2BA 2DWAA 1ZJLA 5IZ3A 1B51A 4QSDA 4H46A 4ESXA 1I69A 1CE2A 3K6VA 4I40A 3U1OA 3LC8A 3H6TA 3MJNA 4QHQA 1Y1ZA 4IO6A 5CBRA 4PETA 4H67A 3M8UA 1ZLQA 2XX8A 5H8HA 3TPAA 3CHGA 4GL8A 3HHFA 1IQ7A 5TPAB 2WBDA 1I6AA 2VHAA 1NUWA 2OJTA 4OENA 1P1WA 4HTGA 1OQGA 3N26A 3VE1B 4PF6A 2ZZWA 3WAFA 1DCUA 3O6IA 5HBCA 4JDFA 1FSAA 1Y3NA 2B4LA 2Q74A 4MCOA 1US5A 3QSLA 1FQAA 1FJ6A 4GBVA 4OANA 5CRYA 2W7YA 3T22A 2NUVA 3E9XA 3HO7A 5ICQA 3T93B 1MS7A 5K2XA 2PMSA 1LBBA 2AIXA 4ELRA 3RLFE 5DVIA 1YYZA 3IO6A 1YAEA 2ZXTA 5I7IA 3T0JA 2HXWA 3IB1A 4FAJA 2ZYNA 2Q89A 1G0HA 3M3LA 2RC7A 1FBGA 4HCWA 2I48A 4E0WA 1A40A 1N3WA 3FVNA 5AA3A 1NV0A 4O3BA 5KDTA 3FD3A 4GXAA 3FUZA 4PFRA 1P1OA 3I3VA 3EHSA 2XXUA 1FRPA 2ZYMA 2WYPA 1II5A 4OEUA 5H8NB 4MBPA 3FBPA 5LOMA 1F9BA 2O68A 4EUOA 1UTBA 3EF7A 1G0IA 2HPGA 4ZEKA 2GHBA 1HSEA 1YPNA 3MZ1A 3C31A 3PPQA 1FTLA 5AA2B 1GV8A 3B8BA 4XF5A 3IFCA 4RY1A 1DK4A 4EDPA 2ESNA 3FXUA 5ELVA 4IGTA 1Z7ME 2UYEA 3RPWA 1LLSA 1VFDA 1D9QA 4NHBA 3OSQA 4OVSA 1R9QA 3CG1A 1FTKA 1UIUA 4N6DA 4YKKA 3OOAA 2IA4A 3OO8A 1EYJA 1MQJA 2M8CA 4GBWA 2Y7KA 4G8MA 2CEXA 3TKDA 4EQ7A 2UVHA 5FTIA 3LSXA 2VPOA 4NWDA 4U1ZA 1LAXA 3NOHA 1PEBA 3C4MA 2H9BA 1FCKA 1LCFA 1RYOA 3TAJA 3ILUB 1B6HA 1OQHA 4YKIA 1JP4A 1POY1 3OSRA 1IMDA 5I3SA 4GWYA 2FYIA 4GFRA 1OLAA 4X1DA 3LUYA 3PV0E 4RK2A 3B6TA 1ZU0A 2OK2A 4DXBA 1M5BA 1IXHA 1LFIA 1MPDA 3IB0A 4F19A 1LB9A 1M5EA 4YKPA 4OHNA 5F7VA 3U8QA 1OLCA 4JVDA 3MUQA 4DXUA 1N04A 3C32A 3TYHA 2QPQA 1FBPA 2B3FA 4WEPA 2Z8DA 3TCGA 3JZJA 4YB5A 1MXWA 1H45A 2XWIA 4FE8A 4L17A 1LBXA 4P0IA 1NFTA 5CMMA 4R73A 2NWJA 4OMBA 2AL5A 3CSBA 1LAGE 4PDHA 4HS7A 3T1BA 4LZ8A 1BKAA 1P1UA 1PB8A 4OYVA 4H8IA 2F8DA 4MNPA 1Y20A 2WKYA 4EF1A 2ONKE 2O1MA 2ZYKA 3EHTA 3JV9A 2XA5A 2O84X 3S9LC 4N6KA 5EHMA 1NV5A 4GWSA 2B65A 4N13A 4Z7EA 4P8BA 1A55A 4MNCA 3KEIA 3RUMA 1US4A 1XVYA 3F11A 4KFQA 1ZBMA 3MP6A 4ELOA 1DTZA 3PPOA 1FBEA 1INPA 2Y7RA 4DE8A 4QFNA 2DWIA 2RCBA 3K2DA 4PP0A 3G3GA 1URGA 5HPQA 1XS5A 4BDLA 1FPEA 4TQUQ 1M5FA 4PAFA 4TLLB 3FVOA 5IGAA 3GYYA 1PB7A 4JWOA 3FGSA 4R75A 2DQVA 1XHYA 4DLDA 3HPIA 5KDTB 2XWOA 5I2KB 5CM6A 3L6GA 3GXAA 2XXIA 4LP2B 2KQZA 5ISUA 4MAGA 4M4GA 3OENA 4NAPA 4KCCA 3Q27A 3PPNA 4IO3A 5EQAA 5T3JA 3USDA 2XXWA 4NQ8A 4F31B 1B58A 1I6QA 3OD7A 1LEVA 5A5XB 4KYSA 4KXPA 4F2QA 2GQ1A 5I59B 1VFEA 4ZEFA 2OLBA 5BUUA 2XXQA 1UTHA 3LSFB 3VLWA 5LDZA 4NMYA 2HAUA 4AQ4A 3RQTA 3DM0A 1N7WA 4XKQA 2RKMA 3TQLA 2HQ0A 1FQEA 2I4CA 2QS2A 1Q9DA 2X7PA 1B9JA 4OFLA 3O28A 1ATGA 3C34A 2UYFA 5I58B 3EQ1A 4LZ5A 1Q1KA 4YZZA 1ZMGA 2P3NA 4C1TA 3V5AA 4P11A 3HFUA 1P1NA 4BDQA 2WBBA 4ECFA 1FTJA 4OVRA 4MNIA 1MY4A 4G68A 4DCXA 4FBPA 4DCYA 4EF2A 4PFYA 5I56A 2ABHA 4ZE8A 3OO6A 3SEVA 1OMPA 2ALUA 3RTWB 3ZSFA 3TELA 4MJOA 1A7LA 1RKMA 1NNPA 3ILTB 3W9WA 2Q88A 3TQWA 1WDNA 2IEEA 3DELB 3H06B 3RPLB 3A09A 2O7UA 2NVUB 4OXVA 5M2VA 1EZPA 2X7QA 5ICTA 3O29A 3K00A 2Z22A 3C36A 3MZBA 1S9TA 2HHMA 4X9TA 1AIVA 4ZS9A 3K01A 2Q8MA 2O6AA 5I57B 3A3UA 4NF6A 3R26A 5EQ8A 2F5XA 2RINA 4OFOA 1L5TA 1MXZA 2QSXA 2QFLA 3G3HA 2X26A 2V25A 3EHUA 1B7HA 3G3IA
chains in the Genus database with same CATH topology
5HBCA 4JDFA 1Y3NA 4Q8RA 3MPLA 1JEUA 3DP6A 4NF8B 3E4RA 1MQDA 4KR5A 1US5A 1HSLA 1J1NA 2Q2CA 3IORA 1FQAA 1SW1A 3QSLA 1JETA 1B4HA 1MM7A 1MPCA 1XOCA 2F7BA 2W7YA 3LSLA 2NUVA 5CRYA 5FHOA 4NF6B 1LB8A 1FQCA 1MG1A 3T22A 1B3EA 2VP1A 3E9XA 3PGFA 1Y1MA 3HO7A 4QRZA 2VD3A 3QK6A 3UK4A 4UA8A 5ICQA 4YICA 4KD5A 3T93B 1MDP1 1MS7A 5A5XA 3BKIB 5K2XA 5DEXB 4OVJA 3MVXA 1EZOA 1MM6A 3OXNA 2PMSA 1USYE 1MH3A 2A5TA 2CMOA 1LBBA 2AIXA 1Q35A 3K0VA 4ELRA 3RLFE 3K1PA 5DVIA 2NOOA 3IOWA 3SKPA 4F2OA 3IO6A 1SBPA 3CFXA 1YAEA 2OBGA 2ZXTA 4EXKA 3KSJA 3RGYA 4TLMB 5DVJA 3QUFA 2G29A 3H3GA 3TFLA 2HXWA 3Q25A 3IB1A 1N7XA 1HSJA 4IY5A 4IO4A 4FAJA 4QFKA 2ZYNA 1BLFA 2Q89A 1B0LA 4X48A 4ZEBA 1N0TA 1B5IA 1D3KA 3HN0A 4GQOA 1B7ZA 3M3LA 1S7YA 4RA1A 2RC7A 4HCWA 5B7DA 3O66A 2I48A 2PX1A 2DWJA 2XD3A 2XXTA 3BFTA 3K1MA 1QUKA 1ELJA 2DE4A 3SDFA 4E0WA 3O6GA 1ZKBA 1A40A 3GZGA 1LAFE 2H25A 1OVTA 1N3WA 3K1NA 3OO7A 3ZKKA 5CC2A 2DS9A 1IXGA 3FVNA 3L6HA 1LFHA 4QF9A 1SD3A 5AA3A 1NH7A 3SERA 2UVJA 2F7CA 4OETA 2ZNTA 1PC3A 4O3BA 2F97A 5KDTA 3FD3A 2V3QA 4GXAA 4RPNA 1EH3A 2I58A 1R1NA 3KN7A 1FTOA 3FUZA 3K6UA 3O97A 3LSWA 3PMXA 5L9OA 2XXYA 1P1OA 3I6VA 4F22A 5CMBA 3FZVA 3I3VA 3T9XB 3EHSA 5I56B 2DOJA 2XXUA 2I6EA 3GLBA 5F1QA 5CI5A 5I84A 2ZYMA 3PUYE 5H8NB 1II5A 4OEUA 2H99A 4MBPA 4ZZAA 1B5JA 5AA2A 1MY2A 3ONMA 2XHDA 3H7MA 5TP9A 1PBQA 1SI1A 3BBRA 3KOSA 4MLQA 3UP9A 3VLVA 2QS1A 4ISUA 1F9BA 2P2AA 3H6WA 2I0BA 4GIZA 4R6HA 4ELPA 3MVWA 1LGBC 4G68C 1NH8A 4YKJA 2PYYA 5L9MA 2O68A 4EUOA 1UTBA 1XC1A 3IJOB 2QMXA 3O6HA 3EF7A 4ZEKA 1P99A 4RNSA 2B3BA 3I5OA 4QSCA 2GHBA 1HSEA 1YPNA 1JVXA 3MZ1A 4YMAA 4YB7A 4C0RA 4RPOA 3C31A 3PPQA 1FTLA 5AA2B 1GV8A 5L8DA 1FQBA 1O63A 2A5TB 3VLUA 1B40A 5H8NA 1QVSA 3O9PA 4Q0CA 3VXCA 1MXVA 4JWXA 3N6TA 4RY1A 4K3FA 2Z8FA 2RCAA 2ESNA 5EHSA 4EDPA 3FXUA 4RYAA 2XX9A 4M1VA 4R74A 5ELVA 4DXCA 2Y7PA 1JW5A 4KYDA 4IGTA 3S4UA 4BDOA 3S9NC 3CRBA 1Z7ME 2UYEA 4N07A 1LLSA 1VFDA 3RPWA 2RC8A 3UN6A 3UGWA 3OSQA 4U23A 1D9YA 3O2AA 1R9QA 3SESA 3CG1A 2THIA 3FJGA 1QUJA 4NE4A 1FTKA 2F6PA 4AB5A 1UIUA 4YKKA 3PUWE 4THIA 3EN3A 4BDNA 5AA4B 5DT6A 3PD8A 3OOAA 2IA4A 3ZKLA 4BDMA 1MQHA 4BLAA 1JW4A 3OO8A 4OQOA 3IOVA 2HZLA 1MQJA 2O69A 3RN8A 2M8CA 3OELA 1IITA 4POWA 3T9UA 3ECRA 3IL1B 1EU8A 3TTMA 4XKNA 2Y7KA 3UA8A 1EZ9A 5I2NA 4G8MA 1T0KA 2P1SA 3TKDA 3GBBA 4RJZA 1POTA 2O7IA 5LOMA 4EQ7A 2UVHA 4U1OA 3FVKA 1B0HA 1AL3A 2VD2A 2P0SA 3FXRA 4KI0E 5FTIA 1TFAA 3SEXA 1SW4A 3LSXA 1DTGA 1H3DA 5AA1A 2DSFA 4FJPA 3RT6B 2G93A 3KG2A 1B7UA 3KSXA 3W15C 4NWDA 4U1ZA 3OO9A 1FTMA 1LAXA 4FECA 3TODA 2ZNSA 1LSTA 1QUIA 3VVDA 1PEBA 2F36A 3N5LA 3C4MA 4OEVA 1UQWA 3TUSA 2H9BA 1FCKA 1LCFA 2HFBA 4TOZA 1RYOA 3TAJA 2DYXA 1QW0A 4XTCQ 1A8EA 2ONRA 3ILUB 1B6HA 3K6XA 3IAZA 3M3FA 1N3XA 4GL0A 3Q29A 2QS3A 3MQ9A 1OQHA 4H5FA 3U94A 4WEDA 4YKIA 1MY3A 2H98A 4N6PA 4QFOA 3FATA 2V3UA 1POY1 2O1LA 3OSRA 3PU5A 3SETA 1ANFA 1DPEA 1SW5A 3FJ7A 4YU0A 1MY1A 2FYIA 3HHGA 3N94A 4GFRA 1OLAA 5FHMA 1P1QA 1NKXA 2F7AA 2DVZA 1ZTYA 3OMBA 3LUYA 3M3KA 3PV0E 4LQ2A 3QAXA 1R6ZA 1ZU0A 2Z8EA 3B6TA 4PFWA 4RK2A 2Q2AA 2OK2A 5JEIA 5JK4A 1SW2A 3PUVE 3U93A 1O64A 4DXBA 1M5BA 4ZZEA 1QKAA 3KN3A 4X1DA 1IXHA 1H76A 4RK9A 1LFIA 1MPDA 1OVBA 2HAVA 3UORA 5I57A 3IB0A 2R6GE 5H8QB 4F19A 5L9SA 2R9JA 4DZ1A 4ZEIA 4LONB 4KCDA 3CI8A 3B6QA 1LB9A 1M5EA 1N84A 4ND9A 1M5CA 4YKPA 5AA2D 4OHNA 5F7VA 3U8QA 4FEDA 1OLCA 3MUQA 4DXUA 1N04A 3C32A 3TYHA 3B7DA 3HSTA 2H4IA 2HCAA 3H4ZA 5KCJA 2QPQA 3HCQA 1PDAA 4F3BA 4XKPA 2B3FA 4ONYA 4WEPA 3FJMA 3TTKA 1TXFA 2Z8DA 4LA9A 3TCGA 4YMBA 4OESA 3JZJA 1D4NA 3R7XA 1NL5A 2VOZA 4H8JA 4NF5B 4YB5A 1MXWA 1H45A 2YJPA 3MZ9A 3G3JA 1UIVA 4FE8A 4L17A 4F1YA 1YCJA 3G3KA 5HPQA 5IKBA 1FQFA 4MLVA 4P0IA 1NFTA 5TP9B 5CMKA 2F34A 2DP8A 4JB7A 4R73A 2UXAA 5CMMA 2NWJA 3UIFA 5I58A 2YLNA 3QXMA 4YAHX 4OMBA 2AL5A 3CSBA 3E13X 1LAGE 4XXUA 4FATA 4ZE9A 4U21A 5I2NB 3TCFA 3V89B 3VFJA 4F3GA 1FQDA 1JQFA 3CIJA 4QFLA 4HS7A 2QJEA 5H8FA 4U4XA 3KZGA 4LZ8A 4KYEA 1SDXA 3N6UA 4GLIA 3WAEA 1UTHB 3TTLA 4EXLA 1S50A 3T66A 1BKAA 3CFLA 4G4PA 3W9VA 1DOTA 1P1UA 1PB8A 5CMCA 2HEUA 1SYIA 3MVZA 4LVQA 4OYVA 3MVYA 2I4BA 3FV1A 5DTBA 3TZAA 2Q9TA 4H8IA 2F8DA 1Y20A 1MH4A 3CR9A 1LCTA 4HCYA 4ZECA 4ZEDA 1MRPA 4QFPA 4MH5A 4IO2A 1MQGA 2OWTA 3KJ7A 1TFDA 1USYH 2WKYA 2ONKE 2O1MA 4EF1A 2FNCA 2ZYKA 4I1DA 4YB6A 3EHTA 3Q26A 3PD9A 4I62A 3LBSA 2YPNA 3JV9A 3S2VA 2QMWA 4JXIA 1RYXA 3MWBA 4G68B 3K4UA 3PPRA 4OWDA 4PFUA 3KN8A 3QUJA 2I0CA 1JEVA 2O84X 4LATA 4MF3A 5B70A 3FASA 3S9LC 4LUBA 5FTHA 4F1VA 1B4ZA 1NMUA 3H03A 5EHMA 1JW1A 4PE5B 2D21A 4F29A 1AMFA 1VSOA 1M5DA 2B65A 2PT2A 4N13A 4Q30B 1MY0A 3P7IA 1Y9UA 1CB6A 1B05A 3IR1A 4F39A 4Z7EA 2DVCA 4IGRA 3V83A 3RNNA 2DXRA 1A55A 1LBCA 5AE4A 3D4CA 3LR1A 4IO5A 1IUDA 4EQBA 3KEIA 1MDQA 1O7TA 3RUMA 1GGGA 1US4A 4AB6A 4H6DA 1XVYA 3D4GA 2R71A 2ZMBA 4R72A 3F11A 4KFQA 1ZBMA 3MP6A 4ELOA 1DTZA 2LAOA 3PPOA 1TT1A 2D5WA 1URDA 2Y84A 3KOTA 1AOVA 2Y7RA 3T96B 2ZYOA 2VGQA 4OERA 2DWIA 4QFNA 4DE8A 1SYHA 4I9DA 3K02A 4XKRA 2RCBA 3O6IA 4PQJA 3K2DA 1YTVA 4PP0A 5KCJB 3G3GA 1TWYA 1URGA 1Z7NE 3R6UA 4RXLA 1XS5A 2O51A 3KFMA 3TTRA 3TTNA 4BDLA 3IOTA 2AL4A 4H1XA 1M5FA 4TQUQ 4FEBA 4C1UA 4TLLB 3QYTA 5BWJA 3IX1A 3FVOA 2Q8JA 3U72A 5KZTA 1PB7A 4IB2A 4JWOA 3FGSA 3PMWA 4LQ5A 4JSOA 2DQVA 1XHYA 2F35A 4R75A 4U2RA 4DLDA 4GRKA 2DWHA 1PBPA 2V3TA 2Z23A 4R2FA 3HPIA 1Y3PA 4WKMA 3VVFA 1NNTA 5KDTB 4R6YA 2F6GA 3T9VA 4EQ9A 5I2KB 5CM6A 3L6GA 4KQPA 4G8NA 3GXAA 3SEYA 1QJMA 2XXIA 4F18A 1SQYA 4LP2B 2QRYA 1WVJA 1QKBA 2XXXA 5I59A 1IIWA 4POXA 1D9VA 4U4SA 2PBWA 5TPAA 3FV2A 1DSNA 1N76A 3MC2A 2F78A 3V8XB 5ISUA 1IEJA 3H6UA 4NTLA 3RT8A 4E0XA 3MBPA 4M4GA 4JSDA 3OENA 5FHNA 1B3FA 1B52A 1OIBA 3G7WA 2UVIA 1H44A 1B1HA 3KJTA 4KCCA 5H8HB 1LAHE 1BIYA 1I6BA 3VXBA 5DYHA 3Q27A 4U22A 1DMBA 4PFTA 1B32A 3DP4A 3PPNA 4H65A 4IO3A 3H6VA 3USDA 2PT1A 4ZDMA 5JTYA 2XXWA 2GRVA 3PMVA 1IXCA 4G8HA 3IO4A 4ESWA 4F31B 1LFGA 2I49A 4Q5TA 2XX7A 5K2YA 1B58A 1I6QA 4GF8A 1B1XA 3OD7A 3JYRA 1IXIA 3RTFB 4NF4B 2XXVA 4IY6A 4OZ9A 2GH9A 1MXXA 2OZZA 3AXFA 4LZ7A 2ZNUA 5I2KA 5A5XB 3RY3A 3DP8A 1GVCA 1URSA 3KGCA 4KPTA 2ANJA 1MXYA 4KYSA 3K6WA 1BP5A 1Y4TA 4F2QA 5ITPA 3EPEA 5I59B 3MAMA 4FIMA 4F1UA 2REJA 1MPBA 3S9EA 2XXHA 3U92A 2AYSA 1VFEA 4F3SA 2I3VA 1XT8A 1PB9A 1SVXB 2OLBA 4Z0IA 2XXQA 4ZEFA 5BUUA 4BDRA 4NWCA 4GVOA 1UTHA 5TU0A 3LSFB 3PUXE 4GD5A 3VLWA 3IB2A 1Y4CA 2DXYA 3Q28A 2GHAA 2XXPA 2GFEA 2HZKA 1B2HA 2OCUA 3SEUA 4O3AA 1KWHA 4NMYA 3QIMA 2HAUA 4AQ4A 3DM0A 4H5GA 1R9LA 3RQTA 1N7WA 3IOUA 3PPPA 4G77A 4JWYA 4XKQA 4HW8A 2RKMA 4UACA 1GR2A 3S9MC 3TQLA 1VE4A 2HQ0A 1FQEA 1JNFA 2DE2A 2I4CA 2QS2A 3FXQA 3MP1A 2X7PA 5H8FB 1NNKA 1BTJA 5CBSA 5HM4B 4QSEA 1B9JA 4OFLA 3C35A 2NXOA 3O28A 1ATGA 1XVXA 3C34A 4O3CA 3OEKA 2PVUA 1B46A 1UTBB 4P0GA 3FVGA 1JVYA 2UYFA 4NEDA 1B3HA 3B6WA 5I58B 1A54A 1MQIA 3CFZA 4R9GA 1H43A 3C9HA 2Y7WA 3EQ1A 3FIRA 4LZ5A 1Q1KA 5EYFA 3PUZE 1FW0A 4MFIA 2XD2A 1ZIUA 3C33A 4YZZA 1ZMGA 2DE3A 4C1TA 4GOTA 2CZLA 4NF5A 3CG3A 4P11A 3V5AA 3MW0A 4X1BA 5IAIA 4F3PA 1P1NA 2ONSA 4BDQA 4DIGA 4ECFA 1A99A 2Y7IA 3BFUA 1FTJA 1B3LA 3IK6B 1MY4A 4G68A 4R6KA 2A5SA 4DCXA 1DPPA 2E1SA 4GWOA 1Y3QA 1MXUA 1WODA 3KBRA 5DVFA 4KHZE 1NNFA 3VV5A 4DCYA 4EF2A 2QL3A 4PFYA 5I56A 2ABHA 2I3WA 2XXRA 1A8FA 4G2ZA 4ZE8A 3OO6A 2REGA 3SEVA 1OMPA 3CSGA 4H0WA 2ALUA 5H8QA 5H8SA 4R2BA 2DWAA 1ZJLA 4R9FA 3RTWB 2KLFA 3HV1A 1B51A 4QSDA 3TELA 3ZSFA 1B5HA 4NF4A 4ESXA 5ITOA 1AH5A 3ODBA 1I69A 1CE2A 1A7LA 3K6VA 1RKMA 2H5YA 1NNPA 2FA7A 2UVGA 3G3FA 3ILTB 2Q88A 4FORA 4IO7A 3TMGA 3U1OA 3VVEA 3W9WA 5J1DA 3TQWA 4DDDA 1WDNA 2IEEA 3DELB 3SEWA 3H06B 3LC8A 3H6TA 3A09A 3MJNA 1Y1ZA 2O7UA 4QHQA 2NVUB 4IO6A 4OXVA 3TEPA 5M2VA 4PETA 4H67A 3T9HB 5CBRA 1EZPA 3M8UA 1ZLQA 3GBAA 1SI0A 3DLNA 3E3KA 3MPKA 2XX8A 4GXSB 5H8HA 2X7QA 5ICTA 3O29A 3TPAA 3K00A 3VDFA 3THIA 2Z22A 3OEMA 2QS4A 5JTYB 3C36A 4GL8A 3MZBA 1S9TA 2D3IA 3A3CA 3IJXB 4X9TA 5DEXA 2E0SA 3HHFA 4ZS9A 1AIVA 4NF8A 3CVGA 2BJJX 4OTEA 3K01A 2O6AA 1IQ7A 5TPAB 5I57B 1I6AA 2V93A 1B3GA 2VHAA 2OJTA 2OWSA 1QULA 3A3UA 4NF6A 4WXJA 2RC9A 3ZS6A 4OENA 3TCHA 1P1WA 2V84A 3R26A 2RF1A 4HTGA 2F5XA 5AA4A 1GTKA 2RINA 3TDJA 1VR5A 1OQGA 3N26A 1MXZA 4OFOA 1L5TA 2QSXA 4OFJA 3VE1B 3G3HA 4I8CA 4ELQA 4JBZA 2X26A 4XIGQ 2V25A 3EHUA 1B7HA 3WAFA 1IZ1A 3MP8A 3G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBC A;  4JDF A;  1Y3N A;  4Q8R A;  3MPL A;  1JEU A;  3DP6 A;  4NF8 B;  3E4R A;  1MQD A;  4KR5 A;  1US5 A;  1HSL A;  1J1N A;  2Q2C A;  3IOR A;  1FQA A;  1SW1 A;  3QSL A;  1JET A;  1B4H A;  1MM7 A;  1MPC A;  1XOC A;  2F7B A;  2W7Y A;  3LSL A;  2NUV A;  5CRY A;  5FHO A;  4NF6 B;  1LB8 A;  1FQC A;  1MG1 A;  3T22 A;  1B3E A;  2VP1 A;  3E9X A;  3PGF A;  1Y1M A;  3HO7 A;  4QRZ A;  2VD3 A;  3QK6 A;  3UK4 A;  4UA8 A;  5ICQ A;  4YIC A;  4KD5 A;  3T93 B;  1MDP 1;  1MS7 A;  5A5X A;  3BKI B;  5K2X A;  5DEX B;  4OVJ A;  3MVX A;  1EZO A;  1MM6 A;  3OXN A;  2PMS A;  1USY E;  1MH3 A;  2A5T A;  2CMO A;  1LBB A;  2AIX A;  1Q35 A;  3K0V A;  4ELR A;  3RLF E;  3K1P A;  5DVI A;  2NOO A;  3IOW A;  3SKP A;  4F2O A;  3IO6 A;  1SBP A;  3CFX A;  1YAE A;  2OBG A;  2ZXT A;  4EXK A;  3KSJ A;  3RGY A;  4TLM B;  5DVJ A;  3QUF A;  2G29 A;  3H3G A;  3TFL A;  2HXW A;  3Q25 A;  3IB1 A;  1N7X A;  1HSJ A;  4IY5 A;  4IO4 A;  4FAJ A;  4QFK A;  2ZYN A;  1BLF A;  2Q89 A;  1B0L A;  4X48 A;  4ZEB A;  1N0T A;  1B5I A;  1D3K A;  3HN0 A;  4GQO A;  1B7Z A;  3M3L A;  1S7Y A;  4RA1 A;  2RC7 A;  4HCW A;  5B7D A;  3O66 A;  2I48 A;  2PX1 A;  2DWJ A;  2XD3 A;  2XXT A;  3BFT A;  3K1M A;  1QUK A;  1ELJ A;  2DE4 A;  3SDF A;  4E0W A;  3O6G A;  1ZKB A;  1A40 A;  3GZG A;  1LAF E;  2H25 A;  1OVT A;  1N3W A;  3K1N A;  3OO7 A;  3ZKK A;  5CC2 A;  2DS9 A;  1IXG A;  3FVN A;  3L6H A;  1LFH A;  4QF9 A;  1SD3 A;  5AA3 A;  1NH7 A;  3SER A;  2UVJ A;  2F7C A;  4OET A;  2ZNT A;  1PC3 A;  4O3B A;  2F97 A;  5KDT A;  3FD3 A;  2V3Q A;  4GXA A;  4RPN A;  1EH3 A;  2I58 A;  1R1N A;  3KN7 A;  1FTO A;  3FUZ A;  3K6U A;  3O97 A;  3LSW A;  3PMX A;  5L9O A;  2XXY A;  1P1O A;  3I6V A;  4F22 A;  5CMB A;  3FZV A;  3I3V A;  3T9X B;  3EHS A;  5I56 B;  2DOJ A;  2XXU A;  2I6E A;  3GLB A;  5F1Q A;  5CI5 A;  5I84 A;  2ZYM A;  3PUY E;  5H8N B;  1II5 A;  4OEU A;  2H99 A;  4MBP A;  4ZZA A;  1B5J A;  5AA2 A;  1MY2 A;  3ONM A;  2XHD A;  3H7M A;  5TP9 A;  1PBQ A;  1SI1 A;  3BBR A;  3KOS A;  4MLQ A;  3UP9 A;  3VLV A;  2QS1 A;  4ISU A;  1F9B A;  2P2A A;  3H6W A;  2I0B A;  4GIZ A;  4R6H A;  4ELP A;  3MVW A;  1LGB C;  4G68 C;  1NH8 A;  4YKJ A;  2PYY A;  5L9M A;  2O68 A;  4EUO A;  1UTB A;  1XC1 A;  3IJO B;  2QMX A;  3O6H A;  3EF7 A;  4ZEK A;  1P99 A;  4RNS A;  2B3B A;  3I5O A;  4QSC A;  2GHB A;  1HSE A;  1YPN A;  1JVX A;  3MZ1 A;  4YMA A;  4YB7 A;  4C0R A;  4RPO A;  3C31 A;  3PPQ A;  1FTL A;  5AA2 B;  1GV8 A;  5L8D A;  1FQB A;  1O63 A;  2A5T B;  3VLU A;  1B40 A;  5H8N A;  1QVS A;  3O9P A;  4Q0C A;  3VXC A;  1MXV A;  4JWX A;  3N6T A;  4RY1 A;  4K3F A;  2Z8F A;  2RCA A;  2ESN A;  5EHS A;  4EDP A;  3FXU A;  4RYA A;  2XX9 A;  4M1V A;  4R74 A;  5ELV A;  4DXC A;  2Y7P A;  1JW5 A;  4KYD A;  4IGT A;  3S4U A;  4BDO A;  3S9N C;  3CRB A;  1Z7M E;  2UYE A;  4N07 A;  1LLS A;  1VFD A;  3RPW A;  2RC8 A;  3UN6 A;  3UGW A;  3OSQ A;  4U23 A;  1D9Y A;  3O2A A;  1R9Q A;  3SES A;  3CG1 A;  2THI A;  3FJG A;  1QUJ A;  4NE4 A;  1FTK A;  2F6P A;  4AB5 A;  1UIU A;  4YKK A;  3PUW E;  4THI A;  3EN3 A;  4BDN A;  5AA4 B;  5DT6 A;  3PD8 A;  3OOA A;  2IA4 A;  3ZKL A;  4BDM A;  1MQH A;  4BLA A;  1JW4 A;  3OO8 A;  4OQO A;  3IOV A;  2HZL A;  1MQJ A;  2O69 A;  3RN8 A;  2M8C A;  3OEL A;  1IIT A;  4POW A;  3T9U A;  3ECR A;  3IL1 B;  1EU8 A;  3TTM A;  4XKN A;  2Y7K A;  3UA8 A;  1EZ9 A;  5I2N A;  4G8M A;  1T0K A;  2P1S A;  3TKD A;  3GBB A;  4RJZ A;  1POT A;  2O7I A;  5LOM A;  4EQ7 A;  2UVH A;  4U1O A;  3FVK A;  1B0H A;  1AL3 A;  2VD2 A;  2P0S A;  3FXR A;  4KI0 E;  5FTI A;  1TFA A;  3SEX A;  1SW4 A;  3LSX A;  1DTG A;  1H3D A;  5AA1 A;  2DSF A;  4FJP A;  3RT6 B;  2G93 A;  3KG2 A;  1B7U A;  3KSX A;  3W15 C;  4NWD A;  4U1Z A;  3OO9 A;  1FTM A;  1LAX A;  4FEC A;  3TOD A;  2ZNS A;  1LST A;  1QUI A;  3VVD A;  1PEB A;  2F36 A;  3N5L A;  3C4M A;  4OEV A;  1UQW A;  3TUS A;  2H9B A;  1FCK A;  1LCF A;  2HFB A;  4TOZ A;  1RYO A;  3TAJ A;  2DYX A;  1QW0 A;  4XTC Q;  1A8E A;  2ONR A;  3ILU B;  1B6H A;  3K6X A;  3IAZ A;  3M3F A;  1N3X A;  4GL0 A;  3Q29 A;  2QS3 A;  3MQ9 A;  1OQH A;  4H5F A;  3U94 A;  4WED A;  4YKI A;  1MY3 A;  2H98 A;  4N6P A;  4QFO A;  3FAT A;  2V3U A;  1POY 1;  2O1L A;  3OSR A;  3PU5 A;  3SET A;  1ANF A;  1DPE A;  1SW5 A;  3FJ7 A;  4YU0 A;  1MY1 A;  2FYI A;  3HHG A;  3N94 A;  4GFR A;  1OLA A;  5FHM A;  1P1Q A;  1NKX A;  2F7A A;  2DVZ A;  1ZTY A;  3OMB A;  3LUY A;  3M3K A;  3PV0 E;  4LQ2 A;  3QAX A;  1R6Z A;  1ZU0 A;  2Z8E A;  3B6T A;  4PFW A;  4RK2 A;  2Q2A A;  2OK2 A;  5JEI A;  5JK4 A;  1SW2 A;  3PUV E;  3U93 A;  1O64 A;  4DXB A;  1M5B A;  4ZZE A;  1QKA A;  3KN3 A;  4X1D A;  1IXH A;  1H76 A;  4RK9 A;  1LFI A;  1MPD A;  1OVB A;  2HAV A;  3UOR A;  5I57 A;  3IB0 A;  2R6G E;  5H8Q B;  4F19 A;  5L9S A;  2R9J A;  4DZ1 A;  4ZEI A;  4LON B;  4KCD A;  3CI8 A;  3B6Q A;  1LB9 A;  1M5E A;  1N84 A;  4ND9 A;  1M5C A;  4YKP A;  5AA2 D;  4OHN A;  5F7V A;  3U8Q A;  4FED A;  1OLC A;  3MUQ A;  4DXU A;  1N04 A;  3C32 A;  3TYH A;  3B7D A;  3HST A;  2H4I A;  2HCA A;  3H4Z A;  5KCJ A;  2QPQ A;  3HCQ A;  1PDA A;  4F3B A;  4XKP A;  2B3F A;  4ONY A;  4WEP A;  3FJM A;  3TTK A;  1TXF A;  2Z8D A;  4LA9 A;  3TCG A;  4YMB A;  4OES A;  3JZJ A;  1D4N A;  3R7X A;  1NL5 A;  2VOZ A;  4H8J A;  4NF5 B;  4YB5 A;  1MXW A;  1H45 A;  2YJP A;  3MZ9 A;  3G3J A;  1UIV A;  4FE8 A;  4L17 A;  4F1Y A;  1YCJ A;  3G3K A;  5HPQ A;  5IKB A;  1FQF A;  4MLV A;  4P0I A;  1NFT A;  5TP9 B;  5CMK A;  2F34 A;  2DP8 A;  4JB7 A;  4R73 A;  2UXA A;  5CMM A;  2NWJ A;  3UIF A;  5I58 A;  2YLN A;  3QXM A;  4YAH X;  4OMB A;  2AL5 A;  3CSB A;  3E13 X;  1LAG E;  4XXU A;  4FAT A;  4ZE9 A;  4U21 A;  5I2N B;  3TCF A;  3V89 B;  3VFJ A;  4F3G A;  1FQD A;  1JQF A;  3CIJ A;  4QFL A;  4HS7 A;  2QJE A;  5H8F A;  4U4X A;  3KZG A;  4LZ8 A;  4KYE A;  1SDX A;  3N6U A;  4GLI A;  3WAE A;  1UTH B;  3TTL A;  4EXL A;  1S50 A;  3T66 A;  1BKA A;  3CFL A;  4G4P A;  3W9V A;  1DOT A;  1P1U A;  1PB8 A;  5CMC A;  2HEU A;  1SYI A;  3MVZ A;  4LVQ A;  4OYV A;  3MVY A;  2I4B A;  3FV1 A;  5DTB A;  3TZA A;  2Q9T A;  4H8I A;  2F8D A;  1Y20 A;  1MH4 A;  3CR9 A;  1LCT A;  4HCY A;  4ZEC A;  4ZED A;  1MRP A;  4QFP A;  4MH5 A;  4IO2 A;  1MQG A;  2OWT A;  3KJ7 A;  1TFD A;  1USY H;  2WKY A;  2ONK E;  2O1M A;  4EF1 A;  2FNC A;  2ZYK A;  4I1D A;  4YB6 A;  3EHT A;  3Q26 A;  3PD9 A;  4I62 A;  3LBS A;  2YPN A;  3JV9 A;  3S2V A;  2QMW A;  4JXI A;  1RYX A;  3MWB A;  4G68 B;  3K4U A;  3PPR A;  4OWD A;  4PFU A;  3KN8 A;  3QUJ A;  2I0C A;  1JEV A;  2O84 X;  4LAT A;  4MF3 A;  5B70 A;  3FAS A;  3S9L C;  4LUB A;  5FTH A;  4F1V A;  1B4Z A;  1NMU A;  3H03 A;  5EHM A;  1JW1 A;  4PE5 B;  2D21 A;  4F29 A;  1AMF A;  1VSO A;  1M5D A;  2B65 A;  2PT2 A;  4N13 A;  4Q30 B;  1MY0 A;  3P7I A;  1Y9U A;  1CB6 A;  1B05 A;  3IR1 A;  4F39 A;  4Z7E A;  2DVC A;  4IGR A;  3V83 A;  3RNN A;  2DXR A;  1A55 A;  1LBC A;  5AE4 A;  3D4C A;  3LR1 A;  4IO5 A;  1IUD A;  4EQB A;  3KEI A;  1MDQ A;  1O7T A;  3RUM A;  1GGG A;  1US4 A;  4AB6 A;  4H6D A;  1XVY A;  3D4G A;  2R71 A;  2ZMB A;  4R72 A;  3F11 A;  4KFQ A;  1ZBM A;  3MP6 A;  4ELO A;  1DTZ A;  2LAO A;  3PPO A;  1TT1 A;  2D5W A;  1URD A;  2Y84 A;  3KOT A;  1AOV A;  2Y7R A;  3T96 B;  2ZYO A;  2VGQ A;  4OER A;  2DWI A;  4QFN A;  4DE8 A;  1SYH A;  4I9D A;  3K02 A;  4XKR A;  2RCB A;  3O6I A;  4PQJ A;  3K2D A;  1YTV A;  4PP0 A;  5KCJ B;  3G3G A;  1TWY A;  1URG A;  1Z7N E;  3R6U A;  4RXL A;  1XS5 A;  2O51 A;  3KFM A;  3TTR A;  3TTN A;  4BDL A;  3IOT A;  2AL4 A;  4H1X A;  1M5F A;  4TQU Q;  4FEB A;  4C1U A;  4TLL B;  3QYT A;  5BWJ A;  3IX1 A;  3FVO A;  2Q8J A;  3U72 A;  5KZT A;  1PB7 A;  4IB2 A;  4JWO A;  3FGS A;  3PMW A;  4LQ5 A;  4JSO A;  2DQV A;  1XHY A;  2F35 A;  4R75 A;  4U2R A;  4DLD A;  4GRK A;  2DWH A;  1PBP A;  2V3T A;  2Z23 A;  4R2F A;  3HPI A;  1Y3P A;  4WKM A;  3VVF A;  1NNT A;  5KDT B;  4R6Y A;  2F6G A;  3T9V A;  4EQ9 A;  5I2K B;  5CM6 A;  3L6G A;  4KQP A;  4G8N A;  3GXA A;  3SEY A;  1QJM A;  2XXI A;  4F18 A;  1SQY A;  4LP2 B;  2QRY A;  1WVJ A;  1QKB A;  2XXX A;  5I59 A;  1IIW A;  4POX A;  1D9V A;  4U4S A;  2PBW A;  5TPA A;  3FV2 A;  1DSN A;  1N76 A;  3MC2 A;  2F78 A;  3V8X B;  5ISU A;  1IEJ A;  3H6U A;  4NTL A;  3RT8 A;  4E0X A;  3MBP A;  4M4G A;  4JSD A;  3OEN A;  5FHN A;  1B3F A;  1B52 A;  1OIB A;  3G7W A;  2UVI A;  1H44 A;  1B1H A;  3KJT A;  4KCC A;  5H8H B;  1LAH E;  1BIY A;  1I6B A;  3VXB A;  5DYH A;  3Q27 A;  4U22 A;  1DMB A;  4PFT A;  1B32 A;  3DP4 A;  3PPN A;  4H65 A;  4IO3 A;  3H6V A;  3USD A;  2PT1 A;  4ZDM A;  5JTY A;  2XXW A;  2GRV A;  3PMV A;  1IXC A;  4G8H A;  3IO4 A;  4ESW A;  4F31 B;  1LFG A;  2I49 A;  4Q5T A;  2XX7 A;  5K2Y A;  1B58 A;  1I6Q A;  4GF8 A;  1B1X A;  3OD7 A;  3JYR A;  1IXI A;  3RTF B;  4NF4 B;  2XXV A;  4IY6 A;  4OZ9 A;  2GH9 A;  1MXX A;  2OZZ A;  3AXF A;  4LZ7 A;  2ZNU A;  5I2K A;  5A5X B;  3RY3 A;  3DP8 A;  1GVC A;  1URS A;  3KGC A;  4KPT A;  2ANJ A;  1MXY A;  4KYS A;  3K6W A;  1BP5 A;  1Y4T A;  4F2Q A;  5ITP A;  3EPE A;  5I59 B;  3MAM A;  4FIM A;  4F1U A;  2REJ A;  1MPB A;  3S9E A;  2XXH A;  3U92 A;  2AYS A;  1VFE A;  4F3S A;  2I3V A;  1XT8 A;  1PB9 A;  1SVX B;  2OLB A;  4Z0I A;  2XXQ A;  4ZEF A;  5BUU A;  4BDR A;  4NWC A;  4GVO A;  1UTH A;  5TU0 A;  3LSF B;  3PUX E;  4GD5 A;  3VLW A;  3IB2 A;  1Y4C A;  2DXY A;  3Q28 A;  2GHA A;  2XXP A;  2GFE A;  2HZK A;  1B2H A;  2OCU A;  3SEU A;  4O3A A;  1KWH A;  4NMY A;  3QIM A;  2HAU A;  4AQ4 A;  3DM0 A;  4H5G A;  1R9L A;  3RQT A;  1N7W A;  3IOU A;  3PPP A;  4G77 A;  4JWY A;  4XKQ A;  4HW8 A;  2RKM A;  4UAC A;  1GR2 A;  3S9M C;  3TQL A;  1VE4 A;  2HQ0 A;  1FQE A;  1JNF A;  2DE2 A;  2I4C A;  2QS2 A;  3FXQ A;  3MP1 A;  2X7P A;  5H8F B;  1NNK A;  1BTJ A;  5CBS A;  5HM4 B;  4QSE A;  1B9J A;  4OFL A;  3C35 A;  2NXO A;  3O28 A;  1ATG A;  1XVX A;  3C34 A;  4O3C A;  3OEK A;  2PVU A;  1B46 A;  1UTB B;  4P0G A;  3FVG A;  1JVY A;  2UYF A;  4NED A;  1B3H A;  3B6W A;  5I58 B;  1A54 A;  1MQI A;  3CFZ A;  4R9G A;  1H43 A;  3C9H A;  2Y7W A;  3EQ1 A;  3FIR A;  4LZ5 A;  1Q1K A;  5EYF A;  3PUZ E;  1FW0 A;  4MFI A;  2XD2 A;  1ZIU A;  3C33 A;  4YZZ A;  1ZMG A;  2DE3 A;  4C1T A;  4GOT A;  2CZL A;  4NF5 A;  3CG3 A;  4P11 A;  3V5A A;  3MW0 A;  4X1B A;  5IAI A;  4F3P A;  1P1N A;  2ONS A;  4BDQ A;  4DIG A;  4ECF A;  1A99 A;  2Y7I A;  3BFU A;  1FTJ A;  1B3L A;  3IK6 B;  1MY4 A;  4G68 A;  4R6K A;  2A5S A;  4DCX A;  1DPP A;  2E1S A;  4GWO A;  1Y3Q A;  1MXU A;  1WOD A;  3KBR A;  5DVF A;  4KHZ E;  1NNF A;  3VV5 A;  4DCY A;  4EF2 A;  2QL3 A;  4PFY A;  5I56 A;  2ABH A;  2I3W A;  2XXR A;  1A8F A;  4G2Z A;  4ZE8 A;  3OO6 A;  2REG A;  3SEV A;  1OMP A;  3CSG A;  4H0W A;  2ALU A;  5H8Q A;  5H8S A;  4R2B A;  2DWA A;  1ZJL A;  4R9F A;  3RTW B;  2KLF A;  3HV1 A;  1B51 A;  4QSD A;  3TEL A;  3ZSF A;  1B5H A;  4NF4 A;  4ESX A;  5ITO A;  1AH5 A;  3ODB A;  1I69 A;  1CE2 A;  1A7L A;  3K6V A;  1RKM A;  2H5Y A;  1NNP A;  2FA7 A;  2UVG A;  3G3F A;  3ILT B;  2Q88 A;  4FOR A;  4IO7 A;  3TMG A;  3U1O A;  3VVE A;  3W9W A;  5J1D A;  3TQW A;  4DDD A;  1WDN A;  2IEE A;  3DEL B;  3SEW A;  3H06 B;  3LC8 A;  3H6T A;  3A09 A;  3MJN A;  1Y1Z A;  2O7U A;  4QHQ A;  2NVU B;  4IO6 A;  4OXV A;  3TEP A;  5M2V A;  4PET A;  4H67 A;  3T9H B;  5CBR A;  1EZP A;  3M8U A;  1ZLQ A;  3GBA A;  1SI0 A;  3DLN A;  3E3K A;  3MPK A;  2XX8 A;  4GXS B;  5H8H A;  2X7Q A;  5ICT A;  3O29 A;  3TPA A;  3K00 A;  3VDF A;  3THI A;  2Z22 A;  3OEM A;  2QS4 A;  5JTY B;  3C36 A;  4GL8 A;  3MZB A;  1S9T A;  2D3I A;  3A3C A;  3IJX B;  4X9T A;  5DEX A;  2E0S A;  3HHF A;  4ZS9 A;  1AIV A;  4NF8 A;  3CVG A;  2BJJ X;  4OTE A;  3K01 A;  2O6A A;  1IQ7 A;  5TPA B;  5I57 B;  1I6A A;  2V93 A;  1B3G A;  2VHA A;  2OJT A;  2OWS A;  1QUL A;  3A3U A;  4NF6 A;  4WXJ A;  2RC9 A;  3ZS6 A;  4OEN A;  3TCH A;  1P1W A;  2V84 A;  3R26 A;  2RF1 A;  4HTG A;  2F5X A;  5AA4 A;  1GTK A;  2RIN A;  3TDJ A;  1VR5 A;  1OQG A;  3N26 A;  1MXZ A;  4OFO A;  1L5T A;  2QSX A;  4OFJ A;  3VE1 B;  3G3H A;  4I8C A;  4ELQ A;  4JBZ A;  2X26 A;  4XIG Q;  2V25 A;  3EHU A;  1B7H A;  3WAF A;  1IZ1 A;  3MP8 A;  3G3I A; 
#chains in the Genus database with same CATH topology
 4QBA A;  1BK4 A;  3E4R A;  1MQD A;  2Q2C A;  1HSL A;  1J1N A;  3LSL A;  4X8R A;  4NF6 B;  1FQC A;  4PBH A;  4PCD A;  3QK6 A;  4KD5 A;  5A5X A;  5I5P A;  3BKI B;  2CMO A;  4GX3 A;  4I3Y A;  4F2O A;  3SKP A;  1SBP A;  4OVP A;  2OBG A;  3KSJ A;  4TLM B;  3Q25 A;  4QFK A;  1BLF A;  1YZ0 A;  4X48 A;  4ZEB A;  3HN0 A;  4GQO A;  1B7Z A;  1S7Y A;  5B7D A;  3O66 A;  2DWJ A;  2XXT A;  3BFT A;  1QUK A;  1KA0 A;  3SDF A;  3GZG A;  3ZKK A;  1LFH A;  4QF9 A;  2UVJ A;  2F7C A;  4OET A;  2DDK A;  1PC3 A;  4G61 A;  2V3Q A;  4RPN A;  1R1N A;  3K6U A;  3LSW A;  2I6E A;  3GLB A;  5AA2 A;  1MY2 A;  2XHD A;  3H7M A;  1SI1 A;  3BBR A;  3KOS A;  5EYH A;  3VLV A;  2QS1 A;  4ISU A;  4GIZ A;  4ELP A;  5DW8 A;  4G68 C;  2PYY A;  2QMX A;  1FPK A;  4QSC A;  4YMA A;  2V4C A;  5L8D A;  3VLU A;  5H8N A;  4Q0C A;  4JWX A;  3N6T A;  4K3F A;  2XX9 A;  4ZE9 A;  4R74 A;  4KYD A;  3CRB A;  2KR0 A;  2RC8 A;  3UGW A;  1EYK A;  4BDN A;  3PUW E;  4ZEC A;  4BDM A;  4BLA A;  3ZKL A;  1MQH A;  2O69 A;  1EU8 A;  1KZ8 A;  1T0K A;  1POT A;  1B0H A;  2XWV A;  1SW4 A;  1DTG A;  1H3D A;  4FJP A;  4NF0 A;  3VVD A;  1UQW A;  1QW0 A;  1K9Y A;  3IAZ A;  4GL0 A;  2QS3 A;  3U94 A;  2CZK A;  2O1L A;  3FJ7 A;  5LTC A;  1MY1 A;  5FHM A;  1NKX A;  2DVZ A;  1IMB A;  2Z8E A;  1SW2 A;  3U93 A;  4MHF A;  4ZZE A;  5I57 A;  2R6G E;  5H8Q B;  2CEY A;  3CI8 A;  4ND9 A;  4FED A;  2H4I A;  2HCA A;  5KCJ A;  3HCQ A;  4XKP A;  1IMF A;  4ONY A;  4YMB A;  1YXI A;  4OES A;  3ISP A;  1NL5 A;  2VOZ A;  4H8J A;  4NF5 B;  1FPD A;  4QXD A;  3G3K A;  5TP9 B;  2DP8 A;  3UIF A;  4HE1 A;  2OWZ A;  4FAT A;  3V89 B;  1JQF A;  2FVZ A;  2R8T A;  2PFY A;  4KYE A;  3WAE A;  3N6U A;  3QMF A;  1S50 A;  3CFL A;  3W9V A;  5CMC A;  2HEU A;  1SYI A;  3FV1 A;  4HCY A;  1LCT A;  4ZED A;  1MRP A;  1USY H;  4I1D A;  3Q26 A;  3MWB A;  4OWD A;  3PPR A;  3KN8 A;  5B70 A;  1JEV A;  4MF3 A;  3H03 A;  4N91 A;  1JW1 A;  4PE5 B;  1NV2 A;  1AMF A;  1M5D A;  1MY0 A;  4F39 A;  3IR1 A;  1B05 A;  1IUD A;  1O7T A;  4H6D A;  1URD A;  2Y84 A;  4PGP A;  2ZYO A;  2VGQ A;  4OER A;  4F29 A;  3T9H B;  4PQJ A;  1TWY A;  1Z7N E;  4RXL A;  3TTN A;  5ITP A;  1IMA A;  2AL4 A;  4H1X A;  5BWJ A;  4FEB A;  3QYT A;  4IB2 A;  1PBP A;  2Z23 A;  4R2F A;  4PBQ A;  3T9V A;  3SEY A;  4F18 A;  5I59 A;  4U4S A;  1N76 A;  4NTL A;  4E0X A;  1OIB A;  2UVI A;  3KJT A;  1LAH E;  3VXB A;  1DMB A;  1B32 A;  4O8M A;  4H65 A;  3H6V A;  4ZDM A;  2GRV A;  1IXC A;  4ESW A;  4GWZ A;  1FPF A;  4Q5T A;  5K2Y A;  3JYR A;  1IXI A;  3KC1 A;  1MXX A;  2ZNU A;  3DP8 A;  1GVC A;  1URS A;  1MXY A;  1BP5 A;  1Y4T A;  3MAM A;  2XXK A;  4F1U A;  1MPB A;  3S9E A;  3BIG A;  2XXH A;  2I3V A;  1PB9 A;  1SVX B;  4BDR A;  1EYI A;  4GVO A;  3PUX E;  4GD5 A;  3Q28 A;  2DXY A;  2XXP A;  2HZK A;  2OCU A;  3QIM A;  4H5G A;  1R9L A;  5CBS A;  4QSE A;  1XVX A;  3OEK A;  1JVY A;  1B3H A;  1A54 A;  4R9G A;  3C9H A;  2ZZV A;  3PUZ E;  3PTY A;  2DE3 A;  4GOT A;  3MW0 A;  4F3P A;  4PC9 A;  3BFU A;  3FXB A;  1FPG A;  2E1S A;  4GWO A;  1Y3Q A;  3KBR A;  2QL3 A;  1NUZ A;  4G2Z A;  5H8Q A;  1B5H A;  4NF4 A;  5ITO A;  4JVI A;  1AH5 A;  2VT5 A;  2UVG A;  2FA7 A;  3TMG A;  5J1D A;  4DDD A;  3SEW A;  4P1L A;  3TEP A;  2XWK A;  3DLN A;  2ZZX A;  3OEM A;  2QS4 A;  3A3C A;  4PAK A;  5EYG A;  2OX3 A;  3MYU A;  2MKZ A;  2V93 A;  1B3G A;  3ZS6 A;  2OWS A;  1QUL A;  2RC9 A;  2V84 A;  2RF1 A;  5AA4 A;  4NN3 A;  1GTK A;  1VR5 A;  4I8C A;  4ELQ A;  4JBZ A;  4O7M A;  4XIG Q;  1IZ1 A;  4N8Y A;  4Q8R A;  3DP6 A;  4NGU A;  3IOR A;  1SW1 A;  1B4H A;  5FHO A;  1B3E A;  2VP1 A;  4UA8 A;  1FPB A;  4YIC A;  4OVJ A;  3MVX A;  1EZO A;  3OXN A;  1USY E;  3K0V A;  3IOW A;  3RGY A;  5DVJ A;  4PFB A;  2G29 A;  3H3G A;  3A29 A;  3TFL A;  1N7X A;  1HSJ A;  1B0L A;  2JJK A;  1N0T A;  1B5I A;  1D3K A;  5A5L A;  4RA1 A;  2PX1 A;  2DE4 A;  3O6G A;  1ZKB A;  1LAF E;  3K1N A;  3OO7 A;  1IXG A;  1SD3 A;  5ET7 A;  3SER A;  1EH3 A;  2I58 A;  3KN7 A;  1FTO A;  3O97 A;  3PMX A;  2QVR A;  3I6V A;  5CMB A;  3FZV A;  3T9X B;  5I56 B;  5F1Q A;  3PUY E;  2H99 A;  4ZZA A;  1B5J A;  1PBQ A;  3UP9 A;  4MLQ A;  3H6W A;  1NV6 A;  1LGB C;  4YKJ A;  1IMC A;  1P99 A;  4RNS A;  2B3B A;  1JVX A;  4YB7 A;  4C0R A;  2HXR A;  4X04 A;  1O63 A;  2A5T B;  1B40 A;  1MXV A;  2Z8F A;  5EHS A;  4M1V A;  3S4U A;  4BDO A;  3S9N C;  3BIH A;  4N07 A;  3UN6 A;  1D9Y A;  3O2A A;  2QVU A;  3SES A;  2THI A;  1LBW A;  4NE4 A;  4AB5 A;  5AA4 B;  3EN3 A;  3MST A;  1JW4 A;  1FBD A;  3OEL A;  1IIT A;  3LV0 A;  4POW A;  3ECR A;  3IL1 B;  3T9U A;  1EZ9 A;  2P1S A;  3GBB A;  4RJZ A;  3FVK A;  1AL3 A;  5ESY A;  4KI0 E;  1TFA A;  2G93 A;  3KG2 A;  3OO9 A;  1FTM A;  4FEC A;  4P47 A;  3ROJ A;  1LST A;  1QUI A;  3N5L A;  4OEV A;  2Y5L A;  3TUS A;  2HFB A;  2DYX A;  4XTC Q;  1A8E A;  2Y5K A;  3K6X A;  4H5F A;  4WED A;  1MY3 A;  4N6P A;  4QFO A;  3FAT A;  1DPE A;  1AWB A;  4YU0 A;  3N94 A;  2F7A A;  3M3K A;  4PFW A;  3QAX A;  1R6Z A;  3PUV E;  1O64 A;  1QKA A;  2HAV A;  1OVB A;  4DZ1 A;  3B6Q A;  1M5C A;  3HST A;  3H4Z A;  3FJM A;  3TTK A;  1TXF A;  3R7X A;  2YJP A;  3MZ9 A;  3G3J A;  4F1Y A;  1YCJ A;  4MLV A;  4DI4 B;  5I58 A;  1NV3 A;  3E13 X;  4XXU A;  4U21 A;  5I2N B;  3TCF A;  3VFJ A;  1FQD A;  3CIJ A;  2QJE A;  5H8F A;  4U4X A;  1SDX A;  4GLI A;  3TTL A;  4EXL A;  1FTA A;  3T66 A;  1DOT A;  1FJ9 A;  4LVQ A;  3TZA A;  3MVY A;  4AS5 A;  4GWU A;  2WYK A;  1MQG A;  3KJ7 A;  3E78 A;  3PD9 A;  4JXI A;  3QUJ A;  1NMU A;  2FIE A;  2D21 A;  1VSO A;  1Y9U A;  4N81 A;  4IGR A;  2DXR A;  3D4C A;  4IO5 A;  4EQB A;  1MDQ A;  5ET8 A;  1GGG A;  1FPL A;  4R72 A;  3D4G A;  2R71 A;  2ZMB A;  1TT1 A;  4H45 A;  3KOT A;  4GWW A;  1SYH A;  4I9D A;  5KCJ B;  1YTV A;  5EQ7 A;  5IM2 A;  4IR8 A;  3KFM A;  5KZT A;  3PMW A;  2DWH A;  1Y3P A;  1NNT A;  4G8N A;  1QJM A;  4PTK A;  4AS4 A;  2QRY A;  1QKB A;  2XXX A;  4POX A;  1D9V A;  2PBW A;  5TPA A;  3FV2 A;  3MC2 A;  3V8X B;  3MBP A;  4JSD A;  4P56 A;  5FHN A;  3G7W A;  1B1H A;  5DYH A;  4U22 A;  4PFT A;  3DP4 A;  5JTY A;  2PT1 A;  2FHY A;  1NUX A;  2CZH A;  1FBH A;  1B1X A;  3RTF B;  2GH9 A;  3LUZ A;  3RY3 A;  3KGC A;  4KPT A;  2ANJ A;  3K6W A;  4OVQ A;  1NV7 A;  2REJ A;  3U92 A;  2AYS A;  2VPN A;  4PF8 A;  1DBZ A;  4NWC A;  5TU0 A;  4OA4 A;  1FBC A;  1RDX A;  1QGX A;  1B2H A;  4MX6 A;  1KWH A;  3IOU A;  4G77 A;  4HE2 A;  4JWY A;  4UAC A;  1GR2 A;  1VE4 A;  1JNF A;  3FXQ A;  3MP1 A;  5H8F B;  1BTJ A;  3C35 A;  4P0G A;  1B46 A;  1UTB B;  4NED A;  3B6W A;  4P9K A;  5F24 A;  1H43 A;  3FIR A;  5EYF A;  1IME A;  4MFI A;  1ZIU A;  3C33 A;  5EQ9 A;  1LBV A;  2ONS A;  2Y7I A;  1FBF A;  1B3L A;  2CZI A;  4R6K A;  2A5S A;  1MXU A;  4KHZ E;  1NNF A;  3VV5 A;  2XXR A;  4H0W A;  2WEF A;  4R9F A;  2KLF A;  3HV1 A;  2F3D A;  3ODB A;  2H5Y A;  3G3F A;  4IO7 A;  3VVE A;  4FOR A;  4P3L A;  3GBA A;  1SI0 A;  3E3K A;  3MPK A;  4GXS B;  2QVV A;  3THI A;  3VDF A;  5JTY B;  1RDY A;  2D3I A;  3IJX B;  5DEX A;  2E0S A;  4NF8 A;  3CVG A;  2BJJ X;  4OTE A;  4XEQ A;  1XI6 A;  2PCR A;  4WXJ A;  4PAI A;  1LBY A;  3TDJ A;  4N8G A;  4OFJ A;  5IZ1 A;  3MP8 A;  3D1R A;  3MPL A;  1JEU A;  4NF8 B;  4KR5 A;  1JET A;  1XOC A;  1MM7 A;  1MPC A;  2F7B A;  3UK4 A;  1LB8 A;  1MG1 A;  3PGF A;  1NV4 A;  1Y1M A;  1RDZ A;  4QRZ A;  2VD3 A;  1MDP 1;  5DEX B;  2FBP A;  1MM6 A;  1MH3 A;  2A5T A;  1Q35 A;  3K1P A;  2NOO A;  3CFX A;  4EXK A;  4PGN A;  3RYD A;  3QUF A;  4HE0 A;  4IY5 A;  4IO4 A;  2XD3 A;  3K1M A;  1ELJ A;  1LBZ A;  2L5V A;  2H25 A;  1OVT A;  5CC2 A;  2DS9 A;  3L6H A;  1NH7 A;  4O7I A;  2ZNT A;  2F97 A;  4P1E A;  5L9O A;  2XXY A;  4F22 A;  2DOJ A;  5I84 A;  4O94 A;  5CI5 A;  3ONM A;  5ET5 A;  5TP9 A;  2P2A A;  1KA1 A;  2I0B A;  4R6H A;  3MVW A;  1NH8 A;  5L9M A;  1XC1 A;  3IJO B;  3O6H A;  3I5O A;  5FBP A;  4RPO A;  1FQB A;  1QVS A;  3O9P A;  3VXC A;  5JK4 A;  2RCA A;  4RYA A;  4DXC A;  2Y7P A;  1JW5 A;  4OVT A;  4U23 A;  2FIX A;  3FJG A;  1QUJ A;  2F6P A;  4THI A;  5DT6 A;  3PD8 A;  4OQO A;  3IOV A;  2HZL A;  3RN8 A;  3IFA A;  3TTM A;  4XKN A;  3UA8 A;  1NV1 A;  4HXV A;  5I2N A;  4JVC A;  2O7I A;  4U1O A;  3FXR A;  2VD2 A;  3SEX A;  2P0S A;  4N4U A;  3RT6 B;  5AA1 A;  2DSF A;  4GWX A;  1B7U A;  3KSX A;  3W15 C;  3TOD A;  2ZNS A;  4PE3 A;  4PFI A;  2F36 A;  4TOZ A;  2ONR A;  2PFZ A;  3M3F A;  1N3X A;  2F3B A;  3Q29 A;  3MQ9 A;  4GX4 A;  2H98 A;  3SET A;  3U65 A;  2V3U A;  3PU5 A;  1ANF A;  1SW5 A;  3HHG A;  1P1Q A;  2BJI A;  4LQ2 A;  1ZTY A;  3OMB A;  3TCH A;  5JEI A;  2Q2A A;  2B4M A;  3KN3 A;  1H76 A;  4RK9 A;  3UOR A;  5L9S A;  2R9J A;  4ZEI A;  4LON B;  4KCD A;  5ET6 A;  5AA2 D;  1N84 A;  3B7D A;  1PDA A;  4F3B A;  4LA9 A;  1D4N A;  4MMP A;  1UIV A;  5IKB A;  1FQF A;  4N17 A;  5CMK A;  2F34 A;  4JB7 A;  2UXA A;  2YLN A;  3QXM A;  4YAH X;  3E79 A;  4F3G A;  4QFL A;  3KZG A;  1UTH B;  1FPJ A;  2WX9 A;  4G4P A;  3MVZ A;  2I4B A;  5DTB A;  2Q9T A;  1MH4 A;  3CR9 A;  4MEV A;  4QFP A;  4MH5 A;  4IO2 A;  3KBZ A;  2OWT A;  1TFD A;  2FNC A;  1VDW A;  4XFE A;  4YB6 A;  4N15 A;  4I62 A;  3LBS A;  2YPN A;  3S2V A;  2QMW A;  1RYX A;  4PFU A;  4G68 B;  3K4U A;  2I0C A;  4LAT A;  4GX6 A;  3FAS A;  4LUB A;  5FTH A;  4F1V A;  1B4Z A;  2PT2 A;  4Q30 B;  3P7I A;  1CB6 A;  2DVC A;  3V83 A;  3RNN A;  1LBC A;  5AE4 A;  3LR1 A;  1CNQ A;  4AB6 A;  2LAO A;  1AOV A;  2D5W A;  4MIJ A;  3T96 B;  1NUY A;  3K02 A;  3KC0 A;  4XKR A;  3R6U A;  2O51 A;  3RPL A;  3TTR A;  3IOT A;  4C1U A;  1FPI A;  3IX1 A;  2Q8J A;  3U72 A;  4I3E A;  4LQ5 A;  4NX1 A;  4U2R A;  4JSO A;  2F35 A;  4GRK A;  5IZ3 B;  2V3T A;  3VVF A;  4WKM A;  4R6Y A;  2F6G A;  4EQ9 A;  4KQP A;  1SQY A;  1WVJ A;  1IIW A;  4DI3 D;  1DSN A;  2F78 A;  1IEJ A;  3H6U A;  3RT8 A;  1B3F A;  1B52 A;  5H8H B;  1H44 A;  1BIY A;  1I6B A;  3B50 A;  3PMV A;  4G8H A;  3IO4 A;  1K9Z A;  3SZP A;  1LFG A;  2I49 A;  2XX7 A;  4GF8 A;  4NF4 B;  2XXV A;  4IY6 A;  4OZ9 A;  2OZZ A;  3AXF A;  4LZ7 A;  5I2K A;  3EPE A;  4FIM A;  4F3S A;  1XT8 A;  4Z0I A;  1NI9 A;  5IZZ A;  3IB2 A;  1Y4C A;  2GHA A;  2GFE A;  3SEU A;  4O3A A;  4HW8 A;  3PPP A;  3S9M C;  2DE2 A;  1NNK A;  5HM4 B;  2NXO A;  4O3C A;  2PVU A;  4NG7 A;  3FVG A;  1MQI A;  3CFZ A;  2Y7W A;  3EKI A;  4LN5 A;  1FW0 A;  2XD2 A;  2CZL A;  4NF5 A;  3CG3 A;  5IAI A;  4X1B A;  4PDD A;  1SPI A;  2P3V A;  4DIG A;  1A99 A;  5J16 A;  3IK6 B;  1DPP A;  4UAB A;  1WOD A;  5DVF A;  2I3W A;  1A8F A;  2REG A;  3CSG A;  5H8S A;  4R2B A;  2DWA A;  1ZJL A;  5IZ3 A;  1B51 A;  4QSD A;  4H46 A;  4ESX A;  1I69 A;  1CE2 A;  3K6V A;  4I40 A;  3U1O A;  3LC8 A;  3H6T A;  3MJN A;  4QHQ A;  1Y1Z A;  4IO6 A;  5CBR A;  4PET A;  4H67 A;  3M8U A;  1ZLQ A;  2XX8 A;  5H8H A;  3TPA A;  3CHG A;  4GL8 A;  3HHF A;  1IQ7 A;  5TPA B;  2WBD A;  1I6A A;  2VHA A;  1NUW A;  2OJT A;  4OEN A;  1P1W A;  4HTG A;  1OQG A;  3N26 A;  3VE1 B;  4PF6 A;  2ZZW A;  3WAF A;  1DCU A;  3O6I A;  5HBC A;  4JDF A;  1FSA A;  1Y3N A;  2B4L A;  2Q74 A;  4MCO A;  1US5 A;  3QSL A;  1FQA A;  1FJ6 A;  4GBV A;  4OAN A;  5CRY A;  2W7Y A;  3T22 A;  2NUV A;  3E9X A;  3HO7 A;  5ICQ A;  3T93 B;  1MS7 A;  5K2X A;  2PMS A;  1LBB A;  2AIX A;  4ELR A;  3RLF E;  5DVI A;  1YYZ A;  3IO6 A;  1YAE A;  2ZXT A;  5I7I A;  3T0J A;  2HXW A;  3IB1 A;  4FAJ A;  2ZYN A;  2Q89 A;  1G0H A;  3M3L A;  2RC7 A;  1FBG A;  4HCW A;  2I48 A;  4E0W A;  1A40 A;  1N3W A;  3FVN A;  5AA3 A;  1NV0 A;  4O3B A;  5KDT A;  3FD3 A;  4GXA A;  3FUZ A;  4PFR A;  1P1O A;  3I3V A;  3EHS A;  2XXU A;  1FRP A;  2ZYM A;  2WYP A;  1II5 A;  4OEU A;  5H8N B;  4MBP A;  3FBP A;  5LOM A;  1F9B A;  2O68 A;  4EUO A;  1UTB A;  3EF7 A;  1G0I A;  2HPG A;  4ZEK A;  2GHB A;  1HSE A;  1YPN A;  3MZ1 A;  3C31 A;  3PPQ A;  1FTL A;  5AA2 B;  1GV8 A;  3B8B A;  4XF5 A;  3IFC A;  4RY1 A;  1DK4 A;  4EDP A;  2ESN A;  3FXU A;  5ELV A;  4IGT A;  1Z7M E;  2UYE A;  3RPW A;  1LLS A;  1VFD A;  1D9Q A;  4NHB A;  3OSQ A;  4OVS A;  1R9Q A;  3CG1 A;  1FTK A;  1UIU A;  4N6D A;  4YKK A;  3OOA A;  2IA4 A;  3OO8 A;  1EYJ A;  1MQJ A;  2M8C A;  4GBW A;  2Y7K A;  4G8M A;  2CEX A;  3TKD A;  4EQ7 A;  2UVH A;  5FTI A;  3LSX A;  2VPO A;  4NWD A;  4U1Z A;  1LAX A;  3NOH A;  1PEB A;  3C4M A;  2H9B A;  1FCK A;  1LCF A;  1RYO A;  3TAJ A;  3ILU B;  1B6H A;  1OQH A;  4YKI A;  1JP4 A;  1POY 1;  3OSR A;  1IMD A;  5I3S A;  4GWY A;  2FYI A;  4GFR A;  1OLA A;  4X1D A;  3LUY A;  3PV0 E;  4RK2 A;  3B6T A;  1ZU0 A;  2OK2 A;  4DXB A;  1M5B A;  1IXH A;  1LFI A;  1MPD A;  3IB0 A;  4F19 A;  1LB9 A;  1M5E A;  4YKP A;  4OHN A;  5F7V A;  3U8Q A;  1OLC A;  4JVD A;  3MUQ A;  4DXU A;  1N04 A;  3C32 A;  3TYH A;  2QPQ A;  1FBP A;  2B3F A;  4WEP A;  2Z8D A;  3TCG A;  3JZJ A;  4YB5 A;  1MXW A;  1H45 A;  2XWI A;  4FE8 A;  4L17 A;  1LBX A;  4P0I A;  1NFT A;  5CMM A;  4R73 A;  2NWJ A;  4OMB A;  2AL5 A;  3CSB A;  1LAG E;  4PDH A;  4HS7 A;  3T1B A;  4LZ8 A;  1BKA A;  1P1U A;  1PB8 A;  4OYV A;  4H8I A;  2F8D A;  4MNP A;  1Y20 A;  2WKY A;  4EF1 A;  2ONK E;  2O1M A;  2ZYK A;  3EHT A;  3JV9 A;  2XA5 A;  2O84 X;  3S9L C;  4N6K A;  5EHM A;  1NV5 A;  4GWS A;  2B65 A;  4N13 A;  4Z7E A;  4P8B A;  1A55 A;  4MNC A;  3KEI A;  3RUM A;  1US4 A;  1XVY A;  3F11 A;  4KFQ A;  1ZBM A;  3MP6 A;  4ELO A;  1DTZ A;  3PPO A;  1FBE A;  1INP A;  2Y7R A;  4DE8 A;  4QFN A;  2DWI A;  2RCB A;  3K2D A;  4PP0 A;  3G3G A;  1URG A;  5HPQ A;  1XS5 A;  4BDL A;  1FPE A;  4TQU Q;  1M5F A;  4PAF A;  4TLL B;  3FVO A;  5IGA A;  3GYY A;  1PB7 A;  4JWO A;  3FGS A;  4R75 A;  2DQV A;  1XHY A;  4DLD A;  3HPI A;  5KDT B;  2XWO A;  5I2K B;  5CM6 A;  3L6G A;  3GXA A;  2XXI A;  4LP2 B;  2KQZ A;  5ISU A;  4MAG A;  4M4G A;  3OEN A;  4NAP A;  4KCC A;  3Q27 A;  3PPN A;  4IO3 A;  5EQA A;  5T3J A;  3USD A;  2XXW A;  4NQ8 A;  4F31 B;  1B58 A;  1I6Q A;  3OD7 A;  1LEV A;  5A5X B;  4KYS A;  4KXP A;  4F2Q A;  2GQ1 A;  5I59 B;  1VFE A;  4ZEF A;  2OLB A;  5BUU A;  2XXQ A;  1UTH A;  3LSF B;  3VLW A;  5LDZ A;  4NMY A;  2HAU A;  4AQ4 A;  3RQT A;  3DM0 A;  1N7W A;  4XKQ A;  2RKM A;  3TQL A;  2HQ0 A;  1FQE A;  2I4C A;  2QS2 A;  1Q9D A;  2X7P A;  1B9J A;  4OFL A;  3O28 A;  1ATG A;  3C34 A;  2UYF A;  5I58 B;  3EQ1 A;  4LZ5 A;  1Q1K A;  4YZZ A;  1ZMG A;  2P3N A;  4C1T A;  3V5A A;  4P11 A;  3HFU A;  1P1N A;  4BDQ A;  2WBB A;  4ECF A;  1FTJ A;  4OVR A;  4MNI A;  1MY4 A;  4G68 A;  4DCX A;  4FBP A;  4DCY A;  4EF2 A;  4PFY A;  5I56 A;  2ABH A;  4ZE8 A;  3OO6 A;  3SEV A;  1OMP A;  2ALU A;  3RTW B;  3ZSF A;  3TEL A;  4MJO A;  1A7L A;  1RKM A;  1NNP A;  3ILT B;  3W9W A;  2Q88 A;  3TQW A;  1WDN A;  2IEE A;  3DEL B;  3H06 B;  3RPL B;  3A09 A;  2O7U A;  2NVU B;  4OXV A;  5M2V A;  1EZP A;  2X7Q A;  5ICT A;  3O29 A;  3K00 A;  2Z22 A;  3C36 A;  3MZB A;  1S9T A;  2HHM A;  4X9T A;  1AIV A;  4ZS9 A;  3K01 A;  2Q8M A;  2O6A A;  5I57 B;  3A3U A;  4NF6 A;  3R26 A;  5EQ8 A;  2F5X A;  2RIN A;  4OFO A;  1L5T A;  1MXZ A;  2QSX A;  2QFL A;  3G3H A;  2X26 A;  2V25 A;  3EHU A;  1B7H A;  3G3I A; 
#chains in the Genus database with same CATH homology
 5HBC A;  4JDF A;  1Y3N A;  4Q8R A;  3MPL A;  1JEU A;  3DP6 A;  4NF8 B;  3E4R A;  1MQD A;  4KR5 A;  1US5 A;  1HSL A;  1J1N A;  2Q2C A;  3IOR A;  1FQA A;  1SW1 A;  3QSL A;  1JET A;  1B4H A;  1MM7 A;  1MPC A;  1XOC A;  2F7B A;  2W7Y A;  3LSL A;  2NUV A;  5CRY A;  5FHO A;  4NF6 B;  1LB8 A;  1FQC A;  1MG1 A;  3T22 A;  1B3E A;  2VP1 A;  3E9X A;  3PGF A;  1Y1M A;  3HO7 A;  4QRZ A;  2VD3 A;  3QK6 A;  3UK4 A;  4UA8 A;  5ICQ A;  4YIC A;  4KD5 A;  3T93 B;  1MDP 1;  1MS7 A;  5A5X A;  3BKI B;  5K2X A;  5DEX B;  4OVJ A;  3MVX A;  1EZO A;  1MM6 A;  3OXN A;  2PMS A;  1USY E;  1MH3 A;  2A5T A;  2CMO A;  1LBB A;  2AIX A;  1Q35 A;  3K0V A;  4ELR A;  3RLF E;  3K1P A;  5DVI A;  2NOO A;  3IOW A;  3SKP A;  4F2O A;  3IO6 A;  1SBP A;  3CFX A;  1YAE A;  2OBG A;  2ZXT A;  4EXK A;  3KSJ A;  3RGY A;  4TLM B;  5DVJ A;  3QUF A;  2G29 A;  3H3G A;  3TFL A;  2HXW A;  3Q25 A;  3IB1 A;  1N7X A;  1HSJ A;  4IY5 A;  4IO4 A;  4FAJ A;  4QFK A;  2ZYN A;  1BLF A;  2Q89 A;  1B0L A;  4X48 A;  4ZEB A;  1N0T A;  1B5I A;  1D3K A;  3HN0 A;  4GQO A;  1B7Z A;  3M3L A;  1S7Y A;  4RA1 A;  2RC7 A;  4HCW A;  5B7D A;  3O66 A;  2I48 A;  2PX1 A;  2DWJ A;  2XD3 A;  2XXT A;  3BFT A;  3K1M A;  1QUK A;  1ELJ A;  2DE4 A;  3SDF A;  4E0W A;  3O6G A;  1ZKB A;  1A40 A;  3GZG A;  1LAF E;  2H25 A;  1OVT A;  1N3W A;  3K1N A;  3OO7 A;  3ZKK A;  5CC2 A;  2DS9 A;  1IXG A;  3FVN A;  3L6H A;  1LFH A;  4QF9 A;  1SD3 A;  5AA3 A;  1NH7 A;  3SER A;  2UVJ A;  2F7C A;  4OET A;  2ZNT A;  1PC3 A;  4O3B A;  2F97 A;  5KDT A;  3FD3 A;  2V3Q A;  4GXA A;  4RPN A;  1EH3 A;  2I58 A;  1R1N A;  3KN7 A;  1FTO A;  3FUZ A;  3K6U A;  3O97 A;  3LSW A;  3PMX A;  5L9O A;  2XXY A;  1P1O A;  3I6V A;  4F22 A;  5CMB A;  3FZV A;  3I3V A;  3T9X B;  3EHS A;  5I56 B;  2DOJ A;  2XXU A;  2I6E A;  3GLB A;  5F1Q A;  5CI5 A;  5I84 A;  2ZYM A;  3PUY E;  5H8N B;  1II5 A;  4OEU A;  2H99 A;  4MBP A;  4ZZA A;  1B5J A;  5AA2 A;  1MY2 A;  3ONM A;  2XHD A;  3H7M A;  5TP9 A;  1PBQ A;  1SI1 A;  3BBR A;  3KOS A;  4MLQ A;  3UP9 A;  3VLV A;  2QS1 A;  4ISU A;  1F9B A;  2P2A A;  3H6W A;  2I0B A;  4GIZ A;  4R6H A;  4ELP A;  3MVW A;  1LGB C;  4G68 C;  1NH8 A;  4YKJ A;  2PYY A;  5L9M A;  2O68 A;  4EUO A;  1UTB A;  1XC1 A;  3IJO B;  2QMX A;  3O6H A;  3EF7 A;  4ZEK A;  1P99 A;  4RNS A;  2B3B A;  3I5O A;  4QSC A;  2GHB A;  1HSE A;  1YPN A;  1JVX A;  3MZ1 A;  4YMA A;  4YB7 A;  4C0R A;  4RPO A;  3C31 A;  3PPQ A;  1FTL A;  5AA2 B;  1GV8 A;  5L8D A;  1FQB A;  1O63 A;  2A5T B;  3VLU A;  1B40 A;  5H8N A;  1QVS A;  3O9P A;  4Q0C A;  3VXC A;  1MXV A;  4JWX A;  3N6T A;  4RY1 A;  4K3F A;  2Z8F A;  2RCA A;  2ESN A;  5EHS A;  4EDP A;  3FXU A;  4RYA A;  2XX9 A;  4M1V A;  4R74 A;  5ELV A;  4DXC A;  2Y7P A;  1JW5 A;  4KYD A;  4IGT A;  3S4U A;  4BDO A;  3S9N C;  3CRB A;  1Z7M E;  2UYE A;  4N07 A;  1LLS A;  1VFD A;  3RPW A;  2RC8 A;  3UN6 A;  3UGW A;  3OSQ A;  4U23 A;  1D9Y A;  3O2A A;  1R9Q A;  3SES A;  3CG1 A;  2THI A;  3FJG A;  1QUJ A;  4NE4 A;  1FTK A;  2F6P A;  4AB5 A;  1UIU A;  4YKK A;  3PUW E;  4THI A;  3EN3 A;  4BDN A;  5AA4 B;  5DT6 A;  3PD8 A;  3OOA A;  2IA4 A;  3ZKL A;  4BDM A;  1MQH A;  4BLA A;  1JW4 A;  3OO8 A;  4OQO A;  3IOV A;  2HZL A;  1MQJ A;  2O69 A;  3RN8 A;  2M8C A;  3OEL A;  1IIT A;  4POW A;  3T9U A;  3ECR A;  3IL1 B;  1EU8 A;  3TTM A;  4XKN A;  2Y7K A;  3UA8 A;  1EZ9 A;  5I2N A;  4G8M A;  1T0K A;  2P1S A;  3TKD A;  3GBB A;  4RJZ A;  1POT A;  2O7I A;  5LOM A;  4EQ7 A;  2UVH A;  4U1O A;  3FVK A;  1B0H A;  1AL3 A;  2VD2 A;  2P0S A;  3FXR A;  4KI0 E;  5FTI A;  1TFA A;  3SEX A;  1SW4 A;  3LSX A;  1DTG A;  1H3D A;  5AA1 A;  2DSF A;  4FJP A;  3RT6 B;  2G93 A;  3KG2 A;  1B7U A;  3KSX A;  3W15 C;  4NWD A;  4U1Z A;  3OO9 A;  1FTM A;  1LAX A;  4FEC A;  3TOD A;  2ZNS A;  1LST A;  1QUI A;  3VVD A;  1PEB A;  2F36 A;  3N5L A;  3C4M A;  4OEV A;  1UQW A;  3TUS A;  2H9B A;  1FCK A;  1LCF A;  2HFB A;  4TOZ A;  1RYO A;  3TAJ A;  2DYX A;  1QW0 A;  4XTC Q;  1A8E A;  2ONR A;  3ILU B;  1B6H A;  3K6X A;  3IAZ A;  3M3F A;  1N3X A;  4GL0 A;  3Q29 A;  2QS3 A;  3MQ9 A;  1OQH A;  4H5F A;  3U94 A;  4WED A;  4YKI A;  1MY3 A;  2H98 A;  4N6P A;  4QFO A;  3FAT A;  2V3U A;  1POY 1;  2O1L A;  3OSR A;  3PU5 A;  3SET A;  1ANF A;  1DPE A;  1SW5 A;  3FJ7 A;  4YU0 A;  1MY1 A;  2FYI A;  3HHG A;  3N94 A;  4GFR A;  1OLA A;  5FHM A;  1P1Q A;  1NKX A;  2F7A A;  2DVZ A;  1ZTY A;  3OMB A;  3LUY A;  3M3K A;  3PV0 E;  4LQ2 A;  3QAX A;  1R6Z A;  1ZU0 A;  2Z8E A;  3B6T A;  4PFW A;  4RK2 A;  2Q2A A;  2OK2 A;  5JEI A;  5JK4 A;  1SW2 A;  3PUV E;  3U93 A;  1O64 A;  4DXB A;  1M5B A;  4ZZE A;  1QKA A;  3KN3 A;  4X1D A;  1IXH A;  1H76 A;  4RK9 A;  1LFI A;  1MPD A;  1OVB A;  2HAV A;  3UOR A;  5I57 A;  3IB0 A;  2R6G E;  5H8Q B;  4F19 A;  5L9S A;  2R9J A;  4DZ1 A;  4ZEI A;  4LON B;  4KCD A;  3CI8 A;  3B6Q A;  1LB9 A;  1M5E A;  1N84 A;  4ND9 A;  1M5C A;  4YKP A;  5AA2 D;  4OHN A;  5F7V A;  3U8Q A;  4FED A;  1OLC A;  3MUQ A;  4DXU A;  1N04 A;  3C32 A;  3TYH A;  3B7D A;  3HST A;  2H4I A;  2HCA A;  3H4Z A;  5KCJ A;  2QPQ A;  3HCQ A;  1PDA A;  4F3B A;  4XKP A;  2B3F A;  4ONY A;  4WEP A;  3FJM A;  3TTK A;  1TXF A;  2Z8D A;  4LA9 A;  3TCG A;  4YMB A;  4OES A;  3JZJ A;  1D4N A;  3R7X A;  1NL5 A;  2VOZ A;  4H8J A;  4NF5 B;  4YB5 A;  1MXW A;  1H45 A;  2YJP A;  3MZ9 A;  3G3J A;  1UIV A;  4FE8 A;  4L17 A;  4F1Y A;  1YCJ A;  3G3K A;  5HPQ A;  5IKB A;  1FQF A;  4MLV A;  4P0I A;  1NFT A;  5TP9 B;  5CMK A;  2F34 A;  2DP8 A;  4JB7 A;  4R73 A;  2UXA A;  5CMM A;  2NWJ A;  3UIF A;  5I58 A;  2YLN A;  3QXM A;  4YAH X;  4OMB A;  2AL5 A;  3CSB A;  3E13 X;  1LAG E;  4XXU A;  4FAT A;  4ZE9 A;  4U21 A;  5I2N B;  3TCF A;  3V89 B;  3VFJ A;  4F3G A;  1FQD A;  1JQF A;  3CIJ A;  4QFL A;  4HS7 A;  2QJE A;  5H8F A;  4U4X A;  3KZG A;  4LZ8 A;  4KYE A;  1SDX A;  3N6U A;  4GLI A;  3WAE A;  1UTH B;  3TTL A;  4EXL A;  1S50 A;  3T66 A;  1BKA A;  3CFL A;  4G4P A;  3W9V A;  1DOT A;  1P1U A;  1PB8 A;  5CMC A;  2HEU A;  1SYI A;  3MVZ A;  4LVQ A;  4OYV A;  3MVY A;  2I4B A;  3FV1 A;  5DTB A;  3TZA A;  2Q9T A;  4H8I A;  2F8D A;  1Y20 A;  1MH4 A;  3CR9 A;  1LCT A;  4HCY A;  4ZEC A;  4ZED A;  1MRP A;  4QFP A;  4MH5 A;  4IO2 A;  1MQG A;  2OWT A;  3KJ7 A;  1TFD A;  1USY H;  2WKY A;  2ONK E;  2O1M A;  4EF1 A;  2FNC A;  2ZYK A;  4I1D A;  4YB6 A;  3EHT A;  3Q26 A;  3PD9 A;  4I62 A;  3LBS A;  2YPN A;  3JV9 A;  3S2V A;  2QMW A;  4JXI A;  1RYX A;  3MWB A;  4G68 B;  3K4U A;  3PPR A;  4OWD A;  4PFU A;  3KN8 A;  3QUJ A;  2I0C A;  1JEV A;  2O84 X;  4LAT A;  4MF3 A;  5B70 A;  3FAS A;  3S9L C;  4LUB A;  5FTH A;  4F1V A;  1B4Z A;  1NMU A;  3H03 A;  5EHM A;  1JW1 A;  4PE5 B;  2D21 A;  4F29 A;  1AMF A;  1VSO A;  1M5D A;  2B65 A;  2PT2 A;  4N13 A;  4Q30 B;  1MY0 A;  3P7I A;  1Y9U A;  1CB6 A;  1B05 A;  3IR1 A;  4F39 A;  4Z7E A;  2DVC A;  4IGR A;  3V83 A;  3RNN A;  2DXR A;  1A55 A;  1LBC A;  5AE4 A;  3D4C A;  3LR1 A;  4IO5 A;  1IUD A;  4EQB A;  3KEI A;  1MDQ A;  1O7T A;  3RUM A;  1GGG A;  1US4 A;  4AB6 A;  4H6D A;  1XVY A;  3D4G A;  2R71 A;  2ZMB A;  4R72 A;  3F11 A;  4KFQ A;  1ZBM A;  3MP6 A;  4ELO A;  1DTZ A;  2LAO A;  3PPO A;  1TT1 A;  2D5W A;  1URD A;  2Y84 A;  3KOT A;  1AOV A;  2Y7R A;  3T96 B;  2ZYO A;  2VGQ A;  4OER A;  2DWI A;  4QFN A;  4DE8 A;  1SYH A;  4I9D A;  3K02 A;  4XKR A;  2RCB A;  3O6I A;  4PQJ A;  3K2D A;  1YTV A;  4PP0 A;  5KCJ B;  3G3G A;  1TWY A;  1URG A;  1Z7N E;  3R6U A;  4RXL A;  1XS5 A;  2O51 A;  3KFM A;  3TTR A;  3TTN A;  4BDL A;  3IOT A;  2AL4 A;  4H1X A;  1M5F A;  4TQU Q;  4FEB A;  4C1U A;  4TLL B;  3QYT A;  5BWJ A;  3IX1 A;  3FVO A;  2Q8J A;  3U72 A;  5KZT A;  1PB7 A;  4IB2 A;  4JWO A;  3FGS A;  3PMW A;  4LQ5 A;  4JSO A;  2DQV A;  1XHY A;  2F35 A;  4R75 A;  4U2R A;  4DLD A;  4GRK A;  2DWH A;  1PBP A;  2V3T A;  2Z23 A;  4R2F A;  3HPI A;  1Y3P A;  4WKM A;  3VVF A;  1NNT A;  5KDT B;  4R6Y A;  2F6G A;  3T9V A;  4EQ9 A;  5I2K B;  5CM6 A;  3L6G A;  4KQP A;  4G8N A;  3GXA A;  3SEY A;  1QJM A;  2XXI A;  4F18 A;  1SQY A;  4LP2 B;  2QRY A;  1WVJ A;  1QKB A;  2XXX A;  5I59 A;  1IIW A;  4POX A;  1D9V A;  4U4S A;  2PBW A;  5TPA A;  3FV2 A;  1DSN A;  1N76 A;  3MC2 A;  2F78 A;  3V8X B;  5ISU A;  1IEJ A;  3H6U A;  4NTL A;  3RT8 A;  4E0X A;  3MBP A;  4M4G A;  4JSD A;  3OEN A;  5FHN A;  1B3F A;  1B52 A;  1OIB A;  3G7W A;  2UVI A;  1H44 A;  1B1H A;  3KJT A;  4KCC A;  5H8H B;  1LAH E;  1BIY A;  1I6B A;  3VXB A;  5DYH A;  3Q27 A;  4U22 A;  1DMB A;  4PFT A;  1B32 A;  3DP4 A;  3PPN A;  4H65 A;  4IO3 A;  3H6V A;  3USD A;  2PT1 A;  4ZDM A;  5JTY A;  2XXW A;  2GRV A;  3PMV A;  1IXC A;  4G8H A;  3IO4 A;  4ESW A;  4F31 B;  1LFG A;  2I49 A;  4Q5T A;  2XX7 A;  5K2Y A;  1B58 A;  1I6Q A;  4GF8 A;  1B1X A;  3OD7 A;  3JYR A;  1IXI A;  3RTF B;  4NF4 B;  2XXV A;  4IY6 A;  4OZ9 A;  2GH9 A;  1MXX A;  2OZZ A;  3AXF A;  4LZ7 A;  2ZNU A;  5I2K A;  5A5X B;  3RY3 A;  3DP8 A;  1GVC A;  1URS A;  3KGC A;  4KPT A;  2ANJ A;  1MXY A;  4KYS A;  3K6W A;  1BP5 A;  1Y4T A;  4F2Q A;  5ITP A;  3EPE A;  5I59 B;  3MAM A;  4FIM A;  4F1U A;  2REJ A;  1MPB A;  3S9E A;  2XXH A;  3U92 A;  2AYS A;  1VFE A;  4F3S A;  2I3V A;  1XT8 A;  1PB9 A;  1SVX B;  2OLB A;  4Z0I A;  2XXQ A;  4ZEF A;  5BUU A;  4BDR A;  4NWC A;  4GVO A;  1UTH A;  5TU0 A;  3LSF B;  3PUX E;  4GD5 A;  3VLW A;  3IB2 A;  1Y4C A;  2DXY A;  3Q28 A;  2GHA A;  2XXP A;  2GFE A;  2HZK A;  1B2H A;  2OCU A;  3SEU A;  4O3A A;  1KWH A;  4NMY A;  3QIM A;  2HAU A;  4AQ4 A;  3DM0 A;  4H5G A;  1R9L A;  3RQT A;  1N7W A;  3IOU A;  3PPP A;  4G77 A;  4JWY A;  4XKQ A;  4HW8 A;  2RKM A;  4UAC A;  1GR2 A;  3S9M C;  3TQL A;  1VE4 A;  2HQ0 A;  1FQE A;  1JNF A;  2DE2 A;  2I4C A;  2QS2 A;  3FXQ A;  3MP1 A;  2X7P A;  5H8F B;  1NNK A;  1BTJ A;  5CBS A;  5HM4 B;  4QSE A;  1B9J A;  4OFL A;  3C35 A;  2NXO A;  3O28 A;  1ATG A;  1XVX A;  3C34 A;  4O3C A;  3OEK A;  2PVU A;  1B46 A;  1UTB B;  4P0G A;  3FVG A;  1JVY A;  2UYF A;  4NED A;  1B3H A;  3B6W A;  5I58 B;  1A54 A;  1MQI A;  3CFZ A;  4R9G A;  1H43 A;  3C9H A;  2Y7W A;  3EQ1 A;  3FIR A;  4LZ5 A;  1Q1K A;  5EYF A;  3PUZ E;  1FW0 A;  4MFI A;  2XD2 A;  1ZIU A;  3C33 A;  4YZZ A;  1ZMG A;  2DE3 A;  4C1T A;  4GOT A;  2CZL A;  4NF5 A;  3CG3 A;  4P11 A;  3V5A A;  3MW0 A;  4X1B A;  5IAI A;  4F3P A;  1P1N A;  2ONS A;  4BDQ A;  4DIG A;  4ECF A;  1A99 A;  2Y7I A;  3BFU A;  1FTJ A;  1B3L A;  3IK6 B;  1MY4 A;  4G68 A;  4R6K A;  2A5S A;  4DCX A;  1DPP A;  2E1S A;  4GWO A;  1Y3Q A;  1MXU A;  1WOD A;  3KBR A;  5DVF A;  4KHZ E;  1NNF A;  3VV5 A;  4DCY A;  4EF2 A;  2QL3 A;  4PFY A;  5I56 A;  2ABH A;  2I3W A;  2XXR A;  1A8F A;  4G2Z A;  4ZE8 A;  3OO6 A;  2REG A;  3SEV A;  1OMP A;  3CSG A;  4H0W A;  2ALU A;  5H8Q A;  5H8S A;  4R2B A;  2DWA A;  1ZJL A;  4R9F A;  3RTW B;  2KLF A;  3HV1 A;  1B51 A;  4QSD A;  3TEL A;  3ZSF A;  1B5H A;  4NF4 A;  4ESX A;  5ITO A;  1AH5 A;  3ODB A;  1I69 A;  1CE2 A;  1A7L A;  3K6V A;  1RKM A;  2H5Y A;  1NNP A;  2FA7 A;  2UVG A;  3G3F A;  3ILT B;  2Q88 A;  4FOR A;  4IO7 A;  3TMG A;  3U1O A;  3VVE A;  3W9W A;  5J1D A;  3TQW A;  4DDD A;  1WDN A;  2IEE A;  3DEL B;  3SEW A;  3H06 B;  3LC8 A;  3H6T A;  3A09 A;  3MJN A;  1Y1Z A;  2O7U A;  4QHQ A;  2NVU B;  4IO6 A;  4OXV A;  3TEP A;  5M2V A;  4PET A;  4H67 A;  3T9H B;  5CBR A;  1EZP A;  3M8U A;  1ZLQ A;  3GBA A;  1SI0 A;  3DLN A;  3E3K A;  3MPK A;  2XX8 A;  4GXS B;  5H8H A;  2X7Q A;  5ICT A;  3O29 A;  3TPA A;  3K00 A;  3VDF A;  3THI A;  2Z22 A;  3OEM A;  2QS4 A;  5JTY B;  3C36 A;  4GL8 A;  3MZB A;  1S9T A;  2D3I A;  3A3C A;  3IJX B;  4X9T A;  5DEX A;  2E0S A;  3HHF A;  4ZS9 A;  1AIV A;  4NF8 A;  3CVG A;  2BJJ X;  4OTE A;  3K01 A;  2O6A A;  1IQ7 A;  5TPA B;  5I57 B;  1I6A A;  2V93 A;  1B3G A;  2VHA A;  2OJT A;  2OWS A;  1QUL A;  3A3U A;  4NF6 A;  4WXJ A;  2RC9 A;  3ZS6 A;  4OEN A;  3TCH A;  1P1W A;  2V84 A;  3R26 A;  2RF1 A;  4HTG A;  2F5X A;  5AA4 A;  1GTK A;  2RIN A;  3TDJ A;  1VR5 A;  1OQG A;  3N26 A;  1MXZ A;  4OFO A;  1L5T A;  2QSX A;  4OFJ A;  3VE1 B;  3G3H A;  4I8C A;  4ELQ A;  4JBZ A;  2X26 A;  4XIG Q;  2V25 A;  3EHU A;  1B7H A;  3WAF A;  1IZ1 A;  3MP8 A;  3G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...