1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
4BO0A 4RO0A 2UAGA 5IDWA 4K6FA 1BG6A 1YQDA 2DTDA 4YB8A 2HK8A 1MP0A 3V8BA 3D5QA 3A1NA 1P0CA 1V8BA 3TZ6A 3WOHA 1PX0A 1GL3A 4HP8A 1Y5MA 2AE2A 1G6KA 1UDBA 3JQBA 5BR7A 4MP8A 4H15A 1RM3A 2D0IA 1E6UA 4NJOA 4DTIA 3PDJA 2DC1A 1P77A 1EE9A 3V1YA 1HRDA 1YOVB 2WTBA 2ZB3A 1G0OA 4PN3A 4G5HA 1GQYA 4WPGA 3WB9A 4TRJA 1LDBA 1VSVA 5KJ1A 4CR6A 1JKFA 2EJVA 3EYWA 3DBVO 5G0UA 1DFIA 5A4DA 4U0JA 2IEDA 3H4VA 3KSUA 2IXBA 1CDOA 1O0SA 4J1SA 3FWNA 1R37A 3TL2A 2AA3A 1SO8A 4B7XA 4J7XA 4RORA 3JQAD 4CUZA 3OF2A 3IKTA 1E3LA 3DR3A 3WR5A 4BGIA 1T2CA 1PS9A 1V3VA 5L4SA 3P5SA 1UXJA 3GF4A 4LMPA 1F17A 2NUAA 1W73A 3HDJA 2C82A 4NBUA 3RCBA 2RIRA 1BDBA 3WFJA 3VC7A 3DFUA 5AVOA 4WJZA 4NI5A 1P1IA 5JDCC 1CEQA 1U4OA 1XGKA 3RU9A 4L0QA 1Y81A 4A0SA 4FJ0A 4OOEA 4R69A 3FBGA 2NVUB 4D79A 5ICSA 1XQ6A 1DBVO 1MGOA 2O7QA 4OOFA 2JD2A 1LXCA 2HMVA 3KYCB 1NWHA 3PLRA 1Y8RB 4K1LA 1ISHA 1R0SA 1P1KA 1MG0A 4PLFA 3ZZNA 1V6AA 3HG7A 1UXKA 3NTOA 3VKVA 3PQEA 1BDMA 3FN4A 4BVAA 3ZWBA 2PK3A 2UDPA 1GEGA 2VYVD 5L7WA 4FN4A 1PGOA 1BW9A 1DXYA 1Z7EA 4ALLA 3JCZA 2VOEA 1WAMA 4NIMA 3NV9A 5JAZA 2QRKA 1GUYA 3DO5A 1RYDA 3GFGA 4TRNA 5CEEA 4FFRA 2X0JA 2BI7A 3KSZO 5AQ1A 2D2IA 2WJPA 1RWBA 4Q3NA 4RVDA 1DC6A 2IXAA 1NVGA 4PLCA 2WYWA 2RBEA 3W4IA 3ZNQA 3TOZA 5COQA 4Q39A 1NHGA 4BNZA 3B20A 4B8WA 2E37A 7ADHA 1VLLA 2VZ9A 3AM4A 1DEHA 1IY8A 4LVCA 5CFZA 2FPIA 1ZIDA 2CZCA 4M89A 4NR0A 4FJ2A 3U3XA 1BMDA 1NX6A 4IS3A 4WCDA 4ZHSA 3E5RA 3OIDA 4OL9A 1ZK0A 4EZBA 1E7WA 2JHGA 5A5EA 2ZYDA 3N74A 1GZ6A 1BXGA 4BKUA 4PLYA 4UUNA 4AJ2A 5K0ZA 1N8KA 4WLNA 1I30A 3RFVA 3UCEA 4CM4B 1MFPA 3BMOB 2FSSA 5FI5A 2HRZA 3DL2A 2ZTMA 3AWDA 5F5NA 4BO6A 5THQA 5IZCA 3OJFA 3D4PA 4RPJA 4TZTA 2DLDA 4XD2A 5TT1A 3KEQA 1LDYA 2GN9A 5TX7A 3T7CA 1KYQA 3VH3A 2PD3A 1Z45A 4IS2A 4NFYA 3ZDFA 4BNNA 1YB4A 4GVLA 1PZGA 3ST7A 4LRTB 1H9BA 1W6UA 2P9CA 3PQDA 1U3WA 3QIVA 3CE6A 2AEJA 1TVEA 4N5MA 3JQ6A 4YAEA 3SX2A 5DOVA 2UVDA 3RUDA 1NPDA 4GMFA 1JWBB 1VKOA 3VDQA 4NPCA 1ZMOA 1QORA 4OXYA 1KEUA 3JQEA 1GUFA 1T26A 2OP0A 2WM3A 4RGBA 3IP3A 1OC2A 3QWBA 1GDHA 5DN9A 5ITVA 4MJLA 2J3IA 2ZQYA 5JO9A 3UH1A 3QVTA 1HWYA 1KEPA 5KJCA 1PJLA 1XHLA 2I76A 4AJ4A 2PA3A 3O8QB 4QO8A 3ZH2A 3K30A 1BXZA 2PY6A 4Z9YA 3GZNB 8LDHA 1T2DA 1HE3A 1YL7A 3GUCA 3OJLA 1Q0QA 3IP1A 3V1TC 5CHEA 4CLHA 3E82A 2OP1A 3SLKA 3K92A 3DBLA 2O3TA 3X2FA 2HK9A 3OETA 4IBOA 5BNFA 1XDWA 4AJIA 4J2HA 3Q2IA 4N54A 3WGIA 1VL8A 4LGVA 4XKJA 3O26A 5T8KA 5A02A 2P9GA 3RQSA 4GWGA 3V1UA 3CPSA 4R54A 1YBVA 2RHRA 2FMUA 3G1UA 3MOGA 2P5UA 1C3VA 5EL0A 2PH5A 4PG8A 3DOJA 1ZUD1 4LRSB 1T2FA 3U4CA 1WVGA 4HV4A 1JAYA 4ROSA 3MTGA 4CMIA 1ISGA 5L51A 5A9TA 4OSOA 3WGHA 4BGUA 1YO6A 2VT3A 2NVWA 3H65A 4K26A 2GUGA 1XU9A 5AXBA 2OXIA 3FSRA 2F1KA 4FPXA 1B14A 2NU8A 4KWIA 3BTSA 3RI3A 2Y1CA 4H16A 4MVJM 1LSOA 2C2XA 4DMLA 1K3TA 5I7FA 4Z9FA 3DTYA 4NFHA 1LQUA 5DF1A 5FFFA 1PQUA 4XX0A 4O6VA 4DGSA 4JNKA 3PVZA 4FR5A 4J16A 4D45A 4D42A 1OBFO 4MIEA 5LC1A 4Z0TA 3M1AA 2C0CA 5TJHA 4RLSA 1I33A 1JVBA 1YBAA 1LEHA 5TQVA 2GCGA 2Z5LA 3FRJA 3PZRA 4HNGA 2HK7A 2J5KA 4BNLA 5HM8A 2HJSA 1C1DA 1X7GA 5L4LA 1HKUA 3I9KA 4F3YA 3PFWO 4YJFB 5IF3A 3RASA 3OHSX 3JV7A 3ZNPA 5KIAA 2IYOA 1B0AA 1H6BA 1KY5A 1IE3A 3I6QA 1N1EA 1C1DB 4JBIA 1NQTA 2ZKLA 3PYXA 5CP8A 4UVGA 1MB4A 2WD7B 5JCJD 4XZ3A 1AUPA 1MC4A 1UZMA 2EF1A 4R5MA 4U7WA 1PSDA 1E7RA 3EK2A 4UULA 2X5OA 1QR6A 3RKUA 3WGZA 3AK4A 1LSUA 1LTHR 4CQMA 9LDTA 2GLXA 3ON5A 4KTVE 2OHXA 2Y99A 3DDNA 2E6UX 5JMWA 2EW2A 3OJ0A 3I9NA 1A71A 1Y6JA 2X9VA 2VWPA 4BNUA 2JL1A 3OA0A 3D4OA 1R12A 3V2GA 5JFOA 2VYNA 3EVNA 1HETA 2J3KA 5F1OA 4PZCA 3E03A 3NJ4A 3NEPX 2W90A 3ROPA 4HX5A 2WE7A 3ZCXA 4QSMA 1I01A 3G79A 4J0EA 1AN9A 1H6CA 3EC7A 4PRLA 4W9NC 3U49A 3FHLA 1QYXA 1BSVA 3D3WA 3Q0EA 2H1SA 4IUYA 4BUCA 3NRCA 3GR6A 2CDBA 4B7UA 4HFRA 2A94A 4PLPA 1PQPA 1KBZA 1UUFA 4CM7A 3AOEA 3HHPA 3MJSA 2YFQA 5L3ZA 2I99A 4OM8A 1HF3A 2AQHA 2P2SA 4AJKA 2YV2A 1XWFA 1YB1A 3NT2A 1QRRA 2EW8A 2C59A 4JXKA 2OL4A 2CF6A 3L0DA 1FMCA 5AOVA 1DJQA 4IDBA 1Y8RA 4IQ8A 4C7KA 4EYEA 5K6AC 3HN2A 5EIOA 1LA2A 4ZQBA 3WBBA 3MJCA 1LI4A 4BO8A 4IPTA 4DBVO 4A26A 2PKQO 3BMQA 3R3SA 5LDGA 3VDRA 4BNFA 1XKQA 4ZJUA 4XWYA 4JCOA 2DAPA 1PR9A 4YJGB 5GMOA 5F1KA 1UXIA 4E21A 5BSFA 3D1LA 4UVEA 3ICCA 3LT1A 1WP4A 2JCVA 1E7MA 2Z1NA 1GQ2A 2FZEA 3OBBA 2AHRA 5JC1A 4TWRA 3ASVA 2GNAA 4U6SA 1O5IA 3L6EA 4RDIA 4XRRA 3EZYA 2JD1A 2HRBA 1KY4A 1WDKA 2PZMA 2VHVA 3FBTA 4D0RA 4IDAA 4EITA 3FTNA 2HAEA 2VUSA 1GUZA 4BNGA 2NU7A 4GH5A 2NQTA 3VPGA 1J6UA 3GEDA 4U6QA 2H63A 1U4SA 4D44A 4BO1A 4BQPA 4MO2A 3WBFA 4R1TA 2O23A 2IZZA 1DLIA 1EEHA 1E3WA 2W2LA 2NADA 1MXFA 3ANNA 3UCXA 3H9GA 1GAEO 1H5QA 1ENZA 2NLOA 4ND5A 1EVJA 2Y1DA 2Q46A 1V3UA 1N92A 3K73O 1K0UA 5CG2A 3GNSA 1PJ3A 5IDQA 3BMCA 2CNBA 1C0PA 3R0IA 1NR7A 5GY7A 2GD1O 3GLQA 1CERA 2VHXA 1PZHA 2O3SA 3OICA 2ZATA 3GDGA 1PJSA 3F4BA 4I9HA 3ENKA 1HLDA 4AJLA 3RWBA 4BGEA 3H9JA 4CLDA 5DCWA 2BRUA 2Y1EA 3P19A 3EUWA 3IJPA 4UEOA 4E30A 2LDBA 3OA2A 4KUHA 4YJHA 3DBRA 1X0VA 1U3VA 1B16A 2I67A 2EKLA 4PLHA 4YAKA 4FOSA 2BELA 4R01A 4BKOA 3ZWPA 4ZN6A 4CJXA 4FFNA 5G4KA 3VH2A 3WQRA 1R6DA 4HWKA 1YL6A 4CL3A 3KVOA 1N9GA 3K8ZA 4M49A 4QT0A 5L9AA 1P45A 1JWAB 1XEAA 1B2LA 1SAYA 1D8AA 4OYRA 1CJCA 3GRKA 2C7GA 2BD0A 2Q49A 3ETDA 4PRKA 4AJPA 1NBOA 1FF9A 3OFSA 1EDZA 3LQFA 1AHIA 3E9NA 5T64A 4DQUA 3B70A 3JYQA 3KZVA 1QV6A 3L6OO 1PGNA 1O8CA 4KP7A 5JE8A 3DTTA 3PI7A 4Z9XA 1M67A 3PPIA 4KQXA 3HADA 2PLAA 4MIOA 1HE5A 4XYLA 1PJ2A 1WZIA 1EVYA 2ZB4A 2IE0A 2YHIA 3IQDB 3IDSA 4MVJA 3OIGA 4W82A 4EBFA 5T6BA 3F5QA 3B1JA 4XR4A 2X9NA 1UDAA 4Q9NA 2A92A 3RBVA 2FOIA 4IDFA 3ZN2A 2IDZA 3H3FA 2EEZA 2OZPA 1HDXA 2NWQA 3GG2A 3U9LA 4WECA 2RH8A 4GX1A 1BW9B 1DRUA 5JYDA 4A27A 1OAAA 1E7QA 3D0OA 1PJBA 4DLLA 3O4RA 3FWZA 3PHIA 4O5OA 4DMMA 2IZ0A 2DTXA 2YHIB 5G4KB 3DBHA 2VYVA 4NJMB 1ENYA 3PJDA 1OOEA 4Z3KA 1N2SA 1Y8QB 2C54A 4OO3A 4DREA 5LCXA 3U62A 3PZBA 1F06A 3DBHB 4Y6SA 5HRUA 1DDOA 2BGLA 2HMTA 4TQGA 1E1MA 1FDWA 1JN0A 3QWHA 1NWCA 3I4CA 5A06A 3NT5A 4ILKA 3RC1A 3SBOA 1QXSA 4I5GA 1I5RA 1U9JA 3VZSA 5L53A 4B8ZA 4NU5A 5DCUA 3RIHA 1WNTA 4CUJA 1ONPA 2Y0EA 3VPHA 1DLJA 1JQBA 4I5DA 4EGFA 2JCXA 1ADFA 4NG5A 1BWSA 1V9LA 1NPTO 3ITDA 4DWVA 1GFSA 5H82A 1IHYA 3DHNA 4DC0A 4P4NA 5IG2A 1YB5A 4CUKA 3LT0A 4D3FA 1ZJZA 2WSBA 3ABIA 1SEVA 1XR3A 4FCCA 3LYLA 1LC0A 3ROMA 1N1GA 4QUKA 5TRTA 1BVUA 1EZ4A 2E4AA 2YDYA 3FD8A 3JD4A 4OGWA 4YT4A 1T25A 5G0VA 4GX2A 3LT4A 1ZXBA 3AUUA 1TI7A 3IMFA 4H3VA 4E5MA 3JQFA 4R1NA 2V6MA 4GPD1 2V7PA 3M2PA 1J5PA 4YBZA 3H9UA 4RVSA 2XAAA 3PWSA 3G17A 2Q3EA 1VJ0A 2VRCA 2B5VA 3NUGA 5C7OO 2PD4A 3TQHA 3I83A 1DO8A 2ZTLA 2O48X 3LC2O 4Q3DA 4A7PA 2VNAA 2P5YA 1LBEA 4DBZA 5JBIA 1E1LA 2B69A 2FSVA 4YJGA 3TL3A 4BGVA 2W8ZA 1HXHA 3BMQB 1K6JA 3GOHA 4CQMD 5HWSA 1X7DA 4XYMA 2JFHA 2CMDA 2ET6A 1AGNA 1GZ3A 2V6GA 2ZJ0A 1UXGA 3AU9A 4J7UA 1EVZA 3QQPA 4CMAA 1S7CA 2H6EA 4LW8A 1YS4A 2AXQA 3LC7O 1LDEA 2J5RA 3F46A 3ZU4A 3C1AA 2ZTVA 5ER9A 5A9SA 3F3SA 4UEJA 1I36A 4KWHA 3DZIA 1YXMA 1C0LA 1DRWA 4MP3A 2AE1A 4E6PA 4R1UA 3OP4A 4AG3A 4D3SA 1Z73A 2NVBA 2WYUA 3DAFA 4DPMA 4Z6KA 4NK5A 3UGKA 1ID1A 4CMKA 1R4NA 5I7VA 3FR8A 4CQLA 4LCJA 2JJYA 3K9QO 4E32A 4Z3DA 1MLDA 2FPGA 4YAIA 1YJQA 1R15A 2B0JA 3ZU5A 3D64A 1FXSA 1PS8A 4WLVA 3KM0A 3OM9A 4RZIA 5HS4A 1K6XA 4JGBA 2G82A 4ND4A 4J49A 5JY1A 2Y0CA 4LSWA 3MJVA 4Q3AA 3NDJA 3WSVA 1PS0A 4FW8A 3DZBA 3AW9A 1Q7CA 5KVQA 1DRVA 4UUPA 3TNLA 2WDZA 4WE3A 3GMSA 3ZHXA 4J43A 2WE8A 3ITKA 5KWEA 2X6TA 4XGKA 3HB4X 1SB9A 4RVUA 3U0BA 1NAIA 1VC2A 3G49A 4D46A 2ZJ1A 4BL5A 2BLLA 4YWJA 1DC3A 4MINA 2GN8A 1BXKA 4XGNA 3WWYA 3VVBA 4FGSA 4KQWA 3H7AA 3F6YA 5JW6A 5A04A 2NTNA 4NBTA 1DIGA 4E2ZA 2Y0DA 1SOVA 4DLBA 3TZCA 2WYVA 2R00A 1DHRA 5AXAA 3QVWA 4KTTE 4MDHA 4Z0PA 4B4WA 4K9DA 5IFLA 3I5MA 5HS6A 4IGEA 3JQAB 1ENOA 1EK5A 1X14A 1EVIA 3RUAA 3ZWXA 3WGYA 4PLTA 1UAYA 4JP3A 4R3WA 1LUAA 4CMBA 2PH3A 4M87A 4NBRA 4JX8A 3QY9A 4B4OA 3D3EA 2EKQA 2X5JO 3JQ9A 5JCJA 4E5NA 2UV8A 2CY0A 5IN5A 2ZCUA 4FS3A 5I9NA 3TN7A 4LK3A 3LSYA 1YRLA 1F14A 4R41A 2GN4A 3GAZA 4IDEA 2YUTA 4WCFA 2O3RA 2NNLD 3IJRA 2QYSA 4JROA 4FB5A 1GTMA 4JK3A 4WKGA 4EEXA 5C3MA 2DBZA 1MG5A 5DULA 2GZ1A 1UH5A 3ZW9A 4BV9A 2ZYAA 1LDNA 3WNQA 4DUPA 3DOCA 4Z0HO 4LISA 3HDYA 1PL8A 3IS3A 1M76A 5A1TA 3QWIA 1HSZA 1BTOA 4CPDA 5CDYA 1SZJG 3GA0A 3JYNA 1I3MA 3VTFA 4E33A 4EUFA 3E6AA 5IDXA 1LDMA 3L6DA 5FYDA 4O63O 3KRTA 1VJ1A 1YVEI 3ZV4A 3OMLA 4OXKA 1RPNA 2CD9A 3NDRA 4GLLA 3UICA 3GQVA 3FTPA 1PR3A 5DP2A 3ZHBA 1ZJYA 4E12A 4M54A 1WMBA 4WEQA 3HZZA 2J5QA 3DFZA 5C7IO 1VRWA 3HNPA 4GBJA 3TZHA 2EGGA 3BHIA 1PWZA 1DPGA 4TKLA 5TS3A 2YV3A 5KJEA 2TMDA 2PTGA 1Z75A 3M1LA 5JYEA 4TRRA 2D5AA 3BMNB 2AEMA 4XQEA 4X54A 3PFFA 4AFNA 1NQOA 2FWMX 1IULA 3EHEA 4JP2A 4MVJD 1MV8A 5HBRA 4B3JA 4DVJA 1DB3A 3WIEA 1NFFA 2P68A 3GK3A 3QSGA 5T57A 2EGHA 1GR0A 2AG5A 1QYVA 2J3HA 1E1NA 4J9VA 1T24A 1FDTA 4QX6A 4I08A 4YAJA 4XGIA 1QG6A 3OEYA 3RD5A 4PLWA 1W4ZA 4YRBA 1X0XA 2GZ3A 4XYBA 4E4YA 5FF9A 4CV3A 2Q2QA 1KC1A 3JYPA 1KVQA 4WOKA 4OMUA 3TOXA 3DXFA 4L76A 1UJMA 3PHGA 3PLNA 3IUSA 4CM6A 2C2YA 3KLPX 2EP7A 4ZQGA 2GERA 1T1SA 3E5MA 4CL8A 1SCUA 5H81A 1GU7A 3F1LA 3HSKA 3VZQA 3LC1O 5DBIA 2QZZA 3DOOA 3RC9A 6LDHA 3W1VA 1I3LA 3LLVA 3Q6IA 4GSLA 1D3AA 1ZK1A 1V35A 4JLWA 3B1FA 4PFJA 1A9YA 1HYEA 1RM4A 4QECA 3CH6A 4B7CA 4BMSA 2Y67A 3RAJA 4W6ZA 4EEZA 1Q2XA 2Q45A 1E0DA 3CINA 3WJAA 3IIEA 1TB4A 2DUUA 1FDVA 4R9RA 4GX0A 1VKNA 1ADGA 4GMGA 2DUWA 3JD3A 1WZEA 2HO5A 4NDNE 2GASA 1B26A 3FNEA 2VZ8A 4HKTA 4RF3A 3WMXA 4RCVA 2PZJA 1NAHA 1PQWA 3ZW8A 1WMAA 2DTEA 1E92A 4L4RA 2O7SA 5DDIP 2GO1A 1KIFA 1AXEA 4LSMA 4GX5A 4BB6A 1ZK3A 1M6HA 5A03A 1R66A 3L4BA 3H5NA 3HN7A 3I9MA 4FGWA 5KVCA 1HZJA 2D59A 1ISMA 3A14A 1A7KA 3C7CB 2HQ1A 4EUEA 3D5TA 5J23A 2R00C 3QW2A 2OORA 4N5LA 1HE2A 4AJHA 1YDWA 4CQLB 4BHTA 4ZICA 1ISJA 1ML3A 1I2ZA 3GVHA 1QSGA 4NH4A 1EE2A 1ONNA 2NTJA 1K6IA 3EY4A 5LDHA 4EI2A 1YQXA 2AW5A 2PV7A 2GN6A 2Y68A 3DAGA 3FR7A 1EMDA 3QWFA 4DQXA 2BKAA 3DMTC 1U5AA 4IXWA 3KXDA 3Q2KA 4GGPA 4UEKA 3PWKA 4WLEA 1DHTA 1ORRA 3NTQA 4CR7A 1RYEA 1W8DA 4FFOA 2V65A 3L4SO 3V5NA 1FJHA 3DZFA 3CUKA 1I3NA 1NASA 1EUDA 2Q99A 1PGJA 1DAPA 3STHA 2J3JA 2AG8A 4GL4A 2POQX 4PG6A 5T5QA 3GVPA 3NX4A 1P33A 3A06A 4J1QA 4J1TA 4XQCA 4RQUA 3WX0A 5DBGA 3E1KA 2O4UX 4KUGA 4M8SA 1YDEA 1I8TA 4UVHA 4ND3A 3WYEA 5TIIA 3HQ4O 1YH3A 3U5TA 2DKNA 4BO2A 4QQRA 4NK4A 1OZAA 3GH3A 1HDZA 2Y66A 4BNVA 3QRWA 3Q3CA 2AEFA 1SMKA 4CM9A 1QYCA 3NTRA 3K5PA 5A05A 1XQ1A 1SBYA 4A2CA 1R4MB 2AQ8A 4XCVA 5TT0A 1BGVA 2B5WA 4ID9A 4IY1A 4L4SA 2XOXA 3DZJA 1Y5RA 2GYYA 3BHMA 4GLOA 5DZSA 2E48A 2PD6A 3GN1A 2DPGA 1KERA 1GY8A 4MVJP 1SNYA 3KYBA 3ZV6A 1YQGA 3CSDA 2VHYA 4IJKA 2RH4A 3UF0A 2YDXA 2WD8A 3RUEA 4TRMA 5A9SB 1GPJA 3ADPA 2B36A 3VZRA 4HFMA 5BNIA 1WWKA 2I3GA 3GUYA 1VL0A 2CF5A 4NFSA 4GKBA 2XXJA 1PJTA 3ZHZA 5CDGA 3L77A 1GV0A 1Q0HA 2V6FA 4NQZA 4P4LA 4D3DA 1ZSNA 1C1XB 3ZI0A 1PJCA 3K96A 2BGMA 4M55A 4B79A 4XJSA 3H3JA 5EERA 1VM6A 1EBFA 2RCYA 4YAGA 2V6BA 5DT9A 2I5PO 4W99A 4Q3BA 4TVBA 4IZIA 4OJNA 3W8EA 3GEGA 1EQ2A 3VPXA 3E9QA 2YW9A 1XU7A 2H5LA 2FRDA 3A28A 5IZCC 1RM5A 3C1OA 3P2OA 4BIIA 5MDHA 3L9WA 1TT7A 3RC2A 3EW7A 1FDUA 2YFHA 2X0IA 4IIUA 3MWDB 1Q7GA 3TFOA 1B8VA 5TSDA 4RVHA 2BFMA 3ASUA 5AXCA 2W2LD 1D1TA 3CMCO 4G81A 4NZ9A 5EPOA 2DBRA 3T7EA 3LZ6A 4G2NA 1EBUA 1HZZA 1O6ZA 4I9NA 5HA5A 3C1TA 5KNLA 1AE1A 4RL6A 3GMDA 5B37A 2QRLA 3CXRA 1ZZEA 3MWEB 3Q11A 4KOAA 4BKPA 1TXGA 1E3IA 3G1TA 4NU6A 4YVFA 1L1FA 5JAQA 3EAGA 5ES3A 1HDGO 3JQ9C 5BSHA 3Q1LA 3I9JA 4YT8A 4WEOA 4F6CA 4AJ1A 1P31A 1UZNA 3S1LA 1PGPA 2X0RA 3AU8A 1BRMA 1IOLA 3EDMA 3PGXA 1J0XO 2HKIA 2R6JA 3WNVA 2VUTA 1E5QA 5DBFA 4CM8B 2PR2A 3GEMA 3QJ5A 2DFDA 3BYZA 4E31A 2VNSA 1ZMTA 2JFGA 2PGJA 1UXHA 3KV3O 3OQBA 4II2A 3EVTA 2GPTA 3K31A 1P1RA 1LSJA 3EMKA 2FP4A 4I8XA 1H2BA 3ENNA 3WDSA 2JKVA 2XPCA 5TJ9A 4IDDA 2HCTA 2BI8A 4IQ0A 5JCXA 3VKUA 2EJWA 3GZ4A 4L73A 4N18A 4BO7A 5THKA 1UAGA 2DBVO 3LT2A 3UN1A 5B1YA 3RUHA 2Q2VA 3JQ7B 4BKQA 4D43A 5IJZA 3HUDA 5JDIC 3GGPA 3QA9A 4IJWA 4DA9A 3DONA 4ALNA 3BTUA 4QFDA 3AY6A 4E5YA 3E8XA 4YXFA 5B4VA 1MUUA 1O9BA 2GGSA 3QVXA 4ND1A 5L45A 2HSDA 4L4XA 1UP7A 4CMGA 3CTMA 3U09A 3KTDA 1E3JA 4ESOA 2TMGA 2YHUA 3O03A 3BHJA 4URFA 4YT5A 5DNAA 2XF8A 4IMPA 1IZ9A 1Y9AA 4Y9DA 2B4QA 1ADBA 5BSEA 2WD7A 1VE9A 4YR9A 4S3MA 3IAHA 1U7TA 4BNYA 1ADCA 3CMMA 4QXMA 3AUAA 1DIBA 1LRJA 4MPDA 3GNQA 3NT4A 1ENPA 4ZRMA 3PIIA 3JQFC 1E5LA 4BMVA 3HDHA 3IKVA 3DMYA 1XCBA 3AOEC 4I5FA 3ZGYA 1K2WA 2DM6A 1FK8A 3SLGA 5JDCA 3NKLA 4OQYA 2WWRA 5BSGA 3FNFA 2QZ9A 4EDFA 3TJRA 4ZQHA 3WWZA 4KDFA 3ADOA 2VHWA 4Q3CA 5F5LA 3D4NA 2P4QA 5CG1A 1KS9A 3LF1A 4CLOA 1HDCA 3I52A 3C3XA 4DIBA 3I4FA 4IDCA 4E2WA 4YPOA 3GVIA 3JQBC 4D7AA 4EJ0A 3OJEA 4IIVA 1ZNQO 2B83A 2IODA 1P0FA 5TC4A 3W8DA 1MX3A 1YBMA 3BMCB 3TPCA 4BO3A 1P1FA 4O1MA 1GQQA 1HTBA 3LU1A 4U5QA 3OQ1A 3VOSA 5IZ4A 1CRWG 2FY8A 2O2SA 4BNMA 3I6IA 5ADHA 4J91A 5KVSA 2J6IA 4RPGA 3ZNOA 1U8FO 1T4BA 5CDTA 3BMNA 5C37A 4U8GA 5JMPA 4IJUA 3WMWA 2Y05A 3R1IA 2VT2A 4DRYA 1OFGA 1KETA 2E82A 4BO4A 4XB1A 1NFRA 1NQAO 1UP6A 3F9IA 2YJZA 4CODB 1NVMB 5JLAA 4BNJA 2BMAA 5JY6A 4TMFA 3PYMA 7MDHA 2GZ2A 1K5HA 1XSEA 1YJ8A 1JAXA 3JQ8B 2DT5A 3H8VA 4OAQA 2G76A 3JQCA 1XLTA 1KOLA 4UVDA 2UYYA 3SC6A 5TF4A 4P8RA 2JAHA 4AJJA 1MC5A 3B1KA 4PGFA 2D8AA 5L40A 5A5FA 5MGBA 3DEYX 4BO9A 1EK6A 4PIVA 1X13A 2VQ3A 5G2OA 4QO7A 2CDCA 1T4DA 1GYQA 4WCFB 3H2SA 3ZWWA 2O3JA 3PJGA 2VCYA 3FPCA 4CMCA 3QVOA 1DSSG 1IZ0A 5AYVA 5K6AA 4LCEA 4FQ8A 5C5IA 3ZWOA 2JAPA 3BTOA 4J4TA 4E0BA 4CLOB 3GY0A 2D1YA 3PDUA 3AY7A 4MKXA 4CM4A 5I8ZA 4S1VA 4WLOA 4YEDA 3K2EA 4PVCA 3ZWMA 1JTVA 1NM5A 3UFXA 2D4AA 4DIFA 1Q1NA 1R0KA 1X7HA 3WGGA 4BMNA 3H9QA 4C7JA 1I24A 3WJ7A 2HDHA 4JBHA 4WOJA 2F00A 1LQTA 4WNIA 2O3UA 3OQ6A 1L7EA 5G0SA 2PWZA 3JD1A 2HU2A 4W9NA 1PZEA 3K2BA 1I2BA 2ZCVA 4BS9A 5I9LA 4J2OA 3I23A 3KETA 1PTJA 3M6IA 4BNTA 3WLEA 4IZHA 3GC6A 2WEKA 1DC5A 3DHEA 1LJ8A 3ETEA 5EN4A 3WSWA 4AJOA 3D3WB 4CQMB 1HEUA 2VWQA 3KOUA 4MVJH 3RU7A 1JKJA 4J90A 2HUNA 3RKRA 3BMOA 5I8WA 1TLTA 3GRPA 1E6WA 4E2YA 2Z95A 3KHUA 3GGOA 1X1EA 4FC7A 4B4UA 4BV8A 5EJ2A 4RF2A 2VTDA 2O2YA 4HFJA 4RLHA 1E6EA 2YQ4A 2CVZA 3N7UA 2Y1OA 1MFZA 4BNIA 5U9CA 1NFQA 3QHAA 3BIOA 4N5NA 2ZB7A 3C85A 3PTZA 3RFTA 4XYGA 1JVSA 2O3QA 2PKQP 4B4VA 4YJFA 2ZIZA 4R68A 3ROQA 4GAEA 3GDFA 1SB8A 3QVSA 4CM1A 4WNCA 1QLHA 3W8FA 3H2ZA 1P9LA 5FEUA 3IOYA 4GWKA 2YY7A 4J6FA 4J3FA 4RQTA 2FR8A 4FFLA 1LLDA 4XB2A 1OC4A 3BZUA 3E18A 4KMSA 4CMEC 1T2EA 1UDCA 3C7AA 5CEFA 1JLLA 4QEDA 2NU9A 3GPIA 3B6ZA 5DOZA 4OIMA 1U7HA 1W0CA 4CR8A 2Z1MA 2C5AA 4J9UE 1HSOA 4E5PA 1XIVA 2R2GA 4YYZA 4IMRA 3RUIA 1A5ZA 4L75A 5F1PA 4BQRA 5KOIA 4GGOA 1V0JA 4FSHA 1UZLA 1T1RA 1XG5A 1WDMA 3DB2A 4PG4A 1HT0A 2OFPA 1ZEJA 4HBGA 2CFCA 5GZ1A 2AQKA 1H0KA 4G65A 2X4GA 2W98A 4A73A 1IYZA 1NYTA 5TGDA 1J49A 3RVDA 3AFNA 2UUPA 4A5OA 5JXWA 3FNHA 2A4KA 3JQ8A 3PJEA 4A03A 1QP8A 3FCOA 1B15A 3ZHYA 1GYPA 3FNGA 2P91A 2B4TO 2ZTUA 4Y6RA 2CVQA 4TZKA 4IINA 4UUMA 1IPFA 3ZNNA 1TT5B 4HY3A 1NP3A 1YONA 2IYPA 3H9EO 5AXDA 2IRWA 2JHFA 3ZWAA 2YQ5A 1ISIA 5T8KC 2VOJA 5I9MA 1B3BA 4BNXA 4ONEA 3KO8A 4CM9D 1HDRA 3E9MA 2LDXA 3PHJA 3RFXA 2EWMA 4KUEA 5A3VA 3UAGA 1WW8A 1ZSVA 2BFOA 3INRA 4RPKA 3UXYA 2O4CA 2B4RO 2QG4A 3GVXA 4MKZA 1SEPA 3WYCA 4XR9A 1I2CA 4E2XA 1JW9B 2QYTA 2VWHA 3GG9A 4D41A 1ZBQA 3S8MA 2DFVA 5ICMA 3GZNA 1WLYA 3FF4A 2X86A 4WUVA 3SXPA 3S2FA 2G17A 3HJAA 3PIDA 1DIRA 4NMHA 3BAZA 1PJQA 4BB5A 4I9UA 2AMFA 3CKYA 5ILGA 2B37A 1Z74A 2IZ1A 3AOGA 2A35A 4LN1A 3NYWA 4ND2A 3PYLA 4ZGWA 1YL5A 1EQUA 4NBVA 1HYGA 3QLJA 4NHEA 1VL6A 3ULKA 3NGLA 3PXXA 2AQIA 4I1IA 3A9WA 2W2KA 9LDBA 5JNLA 3DHYA 4DIOA 2UUOA 2C7VA 5TLSA 3WS7A 1R4MA 1M6WA 1GD1O 1D1SA 4IGFA 2Y1GA 1KC3A 2EXXA 4IDGA 1KEVA 1R16A 4E13A 4YJDA 1GCOA 1F8GA 3SEFA 3NGXA 1O94A 4AJNA 2EIHA 1C14A 3VHRA 3Q9NA 2VTEA 3BXXA 1PGQA 1G0NA 4EW6A 4JJIA 3U4IA 3OSUA 5JS6A 3JQDA 3PGJA 1O89A 1Y8QA 1KVRA 3ONFA 4RPLA 1D7OA 1L7DA 1YWGO 3HWRA 4RV9A 1I32A 2HLPA 4CMHA 2ZYGA 5JSFA 2NQ8A 3TDKA 3PWZA 3RC7A 1TEHA 1J4AA 1X15A 2VN8A 1SOWA 2VZ0A 4L8VA 1HLPA 4RVGA 5KKCA 6ADHA 2GF2A 4Y6PA 1NNUA 5B4TA 1ZK2A 4UREA 4RZHA 4HADA 3SJ7A 1OMOA 3UW3A 3SJUA 4UUOA 3WFIA 3RBZA 3GT0A 4N7RA 3F5SA 4CM3A 3WXBA 1H93A 3MOIA 1AXGA 5DCYA 4GKVA 2GR9A 4F6LA 5EESA 3ZWNA 3SC4A 2CVOA 1Y1PA 3W4KA 3NAQA 4AVYA 2G5CA 5L4NA 4EJMA 2XXBA 4WLUA 5EMHA 2OBNA 4NJMA 1U3UA 3AM5A 2FR0A 4YJHB 2SCUA 3WIDA 4YRAA 3HFSA 5FWNA 4DPKA 1JDJA 1EFLA 1QMGA 3JTMA 5C7LO 3BTVA 4UVIA 1QYWA 1ZW1A 2NACA 4U0KA 3CZRA 1Z7BA 1CIVA 3KB6A 3MZ0A 1LRKA 2X9GA 3JYOA 2EP5A 3KBOA 2HJRA 3KYCA 4WCFC 5EQDA 5H83A 5IXSA 2W2KB 2CUKA 2X0NA 4PVDA 4RF5A 2FN7A 2I9PA 4IJVA 1H9AA 4YA6A 5ITWA 1ULUA 2JCYA 4YRDA 5IDYA 1E3WB 1G1AA 4W7IA 1C0KA 4AJEA 2HMWA 3I3OA 4OXNA 3VH4A 2EG9A 4CV2A 3UHAA 1F8FA 4B3IA 3GHYA 4BNKA 1SPXA 4P38A 2I3AA 3ZU2A 3AM3A 4WGGA 1IUKA 4XRGA 3P2YA 2OGUA 3TFQA 1PU2A 3CEAA 3NJ8A 1LRLA 2PGLA 4MIYA 4Y8VA 3WG9A 3O9ZA 4ZQFA 3Q9UA 4ALIA 4BNWA 4L9RA 4BNHA 1BHSA 3WGOA 2ZB8A 4JBGA 3ZV5A 3DZKA 4CM5A 4CMJA 1KVSA 3TRIA 1VPDA 5L95A 2OOSA 1IHXA 3DQPA 4UAGA 4AICA 4CV0A 4PLGA 3TF5A 3DBRB 4H7PA 3C24A 4I5EA 1EUZA 4R5HA 1V3TA 1DAOA 1QKIA 3UUWA 5CEJA 2X5KO 2NSDA 1I3KA 1O95A 2EERA 5IN4A 4IQGA 4BOYA 1Z82A 4ZVVA 1JU9A 1HE4A 2PNFA 2VUUA 1VSUA 4FOOA 3OEWA 1C1XA 4OHUA 1PZFA 2HMUA 3D7LA 3ONDA 1WPQA 4YCAA 3VH1A 4HUJA 3CIFA 4J0FA 5G0TA 2VHZA 1RKXA 1XA0A 1DFGA 2Q1SA 2X23A 4RDHA 1DOHA 3LF2A 3F4LA 4Y98A 1RJWA 2EV9A 3OH8A 1CQJA 2PZLA 3KYDB 3TWOA 3HDQA 2DPHA 3AI1A 3KEOA 2G0TA 1S6YA 3DZHA 2FR1A 4GQAA 1H2HA 4IXTA 1B3RA 2FPPA 1LX6A 5JAIA 4HXYA 3V2HA 2BHLA 4KDEA 2DQ4A 4WLFA 5KVVA 4PCVA 4M1QA 3RBXA 3RJ9A 3WYBA 3GFBA 3UKOA 1PJ4A 3QV1A 3UVEA 1E77A 4QTZA 5KJFA 4Y67A 4PLZA 3MJEA 1ARZA 3UOGA 5ENVA 3C8MA 3ORFA 3JD0A 1CETA 1ZEMA 2QIOA 3ANMA 1P44A 3L9XA 4XDZA 3JD2A 4CLRB 1DIHA 2I66A 2GRAA 5JO0A 5KTKA 1N7GA 3OJOA 3PQFA 1ZVMA 4J1NA 4PZDA 4F46A 5IXYA 1TA4A 3AJRA 4XIJA 3VPFA 4BKRA 3PP8A 3R3JA 4W7HA 2OO5A 1Z6ZA 3LVFO 4RPHA 5B12A 5L7TA 1KVTA 3GAFA 1ZK4A 1H94A 1N5DA 4TVOA 3T4EA 4GSKA 1EFKA 1LC3A 4ZU3A 1P1JA 3AUSA 1M75A 3LDHA 3RJ5A 4CLEA 2NM0A 4E3ZA 1E1KA 1P74A 4M86A 3W6ZA 4L74A 2VYND 1IPEA 4DYVA 2X22A 1T2AA 2FZWA 1ULSA 1A72A 2ILTA 5I7EA 4IM7A 1HDOA 2D3TA 3X2EA 2EKPA 1YGYA 2Q4BA 2PKRA 1N9GB 5U4QA 4CV1A 3JSAA 4FFMA 4O59O 4OH1A 4P4GA 4XDYA 1GZ4A 3ROKA 2GDZA 2QHXA 4D0SA 2PGDA 4R3NA 3KSDO 5G4LA 1RM0A 5GZ6A 3UCFA 1A7AA 1I10A 2X58A 3FI9A 2W4QA 1XELA 1Y7TA 2Y93A 3IUPA 3ZWCA 1ZKMA 1E3EA 3ANLA 3WQQA 4AL4A 4OKIA 4TSKA 1LSSA 2GSDA 5BQFA 3WTCA 3SVTA 1Q0LA 1ISFA 3TSCA 3WGTA 4MVJE 2DVMA 3ICPA 1B8UA 4HFNA 4R1SA 2D5CA 1ZXLA 4FBGA 3G3EA 4CLXA 1CYDA 1P1HA 1PL6A 1LU9A 1E7SA 1ZSYA 3LK7A 2RAFA 1U2DA 1I0ZA 1NTOA 5F21A 3DMTA 3O38A 4ALKA 3N58A 4YQZA 4XJTA 3K6JA 3ONEA 1DC4A 3MJTA 4MKRA 1PEDA 1PIWA 2I6TA 2P9EA 4XQ9A 4LMRA 5I7SA 1QLJA 3BA1A 4XQGA 3PJFA 4EUHA 1F0YA 1Q7BA 2BF7A 2C29D 3DWFA 2Q1UA 2ZK7A 3RROA 1GPDG 3WLFA 3GPDG 4HNHA 4E5KA 4F45A 1HYHA 3COSA 1GADO 4R16A 4XIYA 3V2UA 5A9RA 3DC2A 5A3JA 4ITUA 4R4JA 3F1KA 4RVFA 2A9FA 1LLQA 2PFGA 1U8XX 3RSHA 1LNQA 4CLRA 3MEQA 4O0LA 1NPYA 5JC8A 2O50A 4OSPA 1A9ZA 2Y1FA 4FJ1A 3WICA 3WTBA 3WGQA 1P3DA 2BFAA 4DYDA 2QW8A 4P22A 1TT5A 2Q1TA 1CF2O 4MP6A 5CDUA 1CWUA 4LVUA 3QWAA 4Q3EA 4QFCA 1GEEA 4WASA 4K6CA 4ZD6A 1R4NB 5ER6A 1C0IA 2IEBA 3O8QA 4MOWA 3S2EA 4YQYA 3KUXA 1DFHA 1PL7A 1QV7A 3VTZA 2OBYA 3KYDA 1NVTA 2PZKA 4FD3A 3HB5X 3GDOA 1EUCA 2C07A 5T67A 4DL9A 3JQGB 4ZRNA 1X1TA 2Q50A 2QRJA 3MTJA 3U4HA 1ZCJA 4ALJA 4OKNA 2VRBA 5U1PA 2EHDA 2RHCA 2HMSA 1NQ5A 3W6UA 4FDAA 3JQGA 4JIGA 4J7CA 4YDRA 2NU6A 5L7YA 3PHLA 4PG5A 2QQ5A 3GHHA 3IL2A 3MCVA 5G0WA 4XYEA 1LLCA 1KVUA 4NBWA 4DQVA 1HL3A 1ZH8A 5F3RA 5COAA 3L07A 1PWXA 1ZO8A 3PHHA 3PEFA 1MA0A 3DBLB 5JPIA 3H6KA 4ALMA 4GI2A 1M66A 3F47A 1K89A 2X1HA 2BH9A 1A4IA 4B3HA 4RJTA 2CSUA 3IC5A 1U28A 4FC6A 4GVXA 4ZQEA 4XEHA 5EQFA 3ZU3A 5ENDA 2WMDA 3TZQA 3GN2A 1R0LA 3DAPA 3CZMA 2JD0A 2YZ7A 4YT2A 2YV1A 1D4FA 1NXQA 1U5CA 2VWGA 3FPLA 1H6DA 3AFMA 4PZEA 2BFPA 2X8LA 2X7HA 3M2TA 5CAEA 1SC6A 4WK6A 4PG7A 5GZ3A 3I9LA 3RUFA 2BGKA 4JJGA 4R51A 5CPBA 4PLVA 3A4VA 3VPSA 3HFGA 3INTA 3MJ4A 4KZPA 3AI3A 3ZWVA 4YTEA 1DIAA 4K28A 1B7GO 3VVCA 2G1UA 3RUCA 3VAZA 2FHSA 3AI2A 5JAMA 1E3SA 1MXHA 3H5AA 4OQZA 5ILOA 1E7YA 4NNJA 3JYLA 3ZV3A 3ETGA 3OIFA 2C20A 3OECA 4TKMA 5COBA 4TROA 3LLSA 5TNXA 4YACA 4XA8A 4CM8A 1HDYA 3W4JA 3GGGA 3JQ7A 4CMEA 2OUIA 4DXHA 3U4DA 3VZPA 2P4HX 8ADHA 2DU8A 1Y9EA 3GNTA 1BVRA 4RF4A 3T4XA 3JQAA 3DZGA 5DP1A 1VJTA 5IAAA 1U3TA 3I1JA 1CQIA 1JKIA 3C7DB 3PRJA 1U1IA 3R6DA 2E49A 4J4HA 1GYRA 2NVUA 3I9OA 1KEWA 1N7HA 3INGA 1EDOA 4DC1A 1JA9A 3TZKA 4DPLA 5EINA 2B35A 1M2WA 3P7MA 4MVJG 4JN6B 1OI7A 1FDSA 1BXGB 4JJFA 3GVCA 3QE3A 1UP4A 2Q4EA 3S2IA 5JDIA 3H5RA 3EGOA 3PK0A 4A10A 1LDGA 1YKFA 1U2GA 1XYGA 4ZA2A 3HE3A 2JFFA 1ZFNA 4CMIB 5FI3A 5BNTA 1AHHA 2NTVA 2Q1WA 4FIZA 5KCZA 3QP9A 5K9ZA 4MVJF 1GCUA 3KLMX 3AUTA 5KJ6A 1VI2A 1LLUA 3L4BC 4FFPA 1IB6A 1UR5A 2DBQA 4II3A 5BT9A 1WDLA 1GV1A 4INAA 5HTOA 4JQCA 2C5EA 3E48A 3EZLA 1NR1A 4EJ6A 1IL0A 4W4TA 4C4OA 2H9IA 1F12A 1NHWA 3S55A 5B4UA 1ONOA 3AY3A 1H6AA 3NDIA 4BO5A 1A27A 2ZQZA 2VRCD 1YOVA 5CPFA 4DLAA 2OMEA 5CDSA 3G0OA 4MVJI 1DJNA 1YE3A 2YYYA 4J4BA 1A4UA 2NV6A 2I65A 1WXDA 1B8PA 4R9SA 2J8ZA 1QYDA 3S2GA 2QX7A 2CDAA 5KKAA 3ZWYA 3WQSB 2Q2WA
chains in the Genus database with same CATH superfamily
5DNWA 4BO0A 1B0PA 5HMMA 4K6FA 1KDOA 1C7IA 4X1YB 1BJTA 5CJJA 2DTDA 1JLSA 3OHPA 4YRMA 5CA1F 2EOJA 1E1QD 5JNRA 4V0KA 2AT1A 3PI6A 3U37A 3WOHA 2L19A 3SYNA 1Q21A 3WBKA 2XCLA 3ZKAA 2IQIA 1TKBA 1J70A 1OAKA 5BR7A 2EOEA 2UXDE 4MIKA 1M74A 3AR2A 3B51X 1LJLA 3N76A 3IV7A 4X97A 2YS6A 2D0IA 1E6UA 5DGXA 3N2GB 1E2JA 4DTIA 1JJBA 4BWFB 4ITVA 5D51S 1Z9BA 4G1BA 3THRA 2GPJA 1K7XB 1HRDA 4KYVA 4M83A 2QVYX 2WTBA 4IHQA 4CDNA 3OIUA 1KA9H 1G0OA 4G5HA 4WPGA 3FZQA 1DAEA 1P7WA 1N3BA 2N47A 3ENVA 4TRJA 2EMYA 4Q1FA 1OA0A 3KSMA 1T9GR 3WMGA 4CR6A 5KJ1A 2JR1A 5MF6A 1X19A 3EYWA 3KQHA 3HU2A 2IF2A 2IEDA 2PVPA 3KSUA 5H1YA 3ZZMA 1PFGA 1TGYA 2DYKA 1O0SA 2OZVA 1JHPA 3FWNA 2HQSA 1R37A 4V0ME 1I6MA 4LRWA 3SXUA 1T9BA 4J7XA 3ZVMA 3JQAD 2XECA 3TI7A 2EN6A 2FMIA 3O4JA 1ZONA 2JAWA 4MYUA 2CJFA 3U81A 4DAEA 3UGJA 1EM8A 1UXJA 2YUIA 3NM6B 4GYWA 1F17A 3UUEA 4BRZA 4UOEA 1U7OA 2PXHA 5FOTA 3HDJA 1YFHA 3RARA 1AKQA 2G5TA 3MCTA 1KZ4A 2EX1A 2F7SA 1JE0A 4L5YA 3VC7A 1VRVA 4ARVA 4HUTA 3U39A 4WJZA 2CJXA 3ANXA 1C30B 4NI5A 3O1IC 1R0BA 5JDCC 4TKVA 1RXVA 1WRJA 3FHJA 2CWWA 4A0SA 5B2FA 1RCUA 4UPDA 2WKRA 3OU7A 4R69A 2PGXA 2IP1A 3LQRA 5LKRA 1XD8A 5CM8B 2I78A 3S1SA 5LBIA 2JD2A 3CYFA 1JG2A 1L7NA 1NBEA 1ZW6A 1SD1A 5BSMA 3L01A 4O4LA 4JI3B 4DLWA 1NRXA 4PYKA 4FGKA 4A23A 3OE7D 1R0SA 1YR7A 3WLLA 2WZOA 4O24A 1MG0A 2HBRA 4K40A 4BMDA 3ZDEA 3AIIA 4U2FA 1UXKA 2AMLA 2CVHA 2VA8A 5KMGB 2XTNA 3I6ZA 4H7JA 1BDMA 3FN4A 3FMOB 3KT8A 4FI3F 1W4RA 3D9QX 3VYYA 4OD0A 5HNKA 3OCUA 1V1RA 3QX3A 3JCZA 3RS7A 2VOEA 1WAMA 4EWLA 5HRAA 1DO0A 1GUYA 5CEEA 4O33A 4FFRA 4BECA 1NJ6A 1Z4QA 2X0JA 5JUWA 2D2IA 3T5TA 1HE1C 2ZGVA 1RWBA 5D5PA 4ARSA 3FDZB 5EUMA 3CEJA 4ESEA 3W4IA 2RBEA 1U5BB 1X94A 3VJMA 4EENA 3FOZA 2P2ZA 3MINA 2MINB 4MZXA 4GOMD 1Z35A 4P2BA 4Q39A 2E37A 3A6PC 2A9QA 7ADHA 1V7ZA 2WU8A 2GYWA 3AM4A 4LVCA 2FLKA 1HQDA 1LZLA 4A0RA 1ZIDA 4B0PA 3QKWA 3AH8A 3THOB 1C29B 1XQXA 4YROA 1MJNA 1S4MA 3CV3A 4KDRA 3EGIA 4IS3A 2BI4A 1KPIA 2GZDA 3E5RA 3C43A 3OIDA 4LF8B 2YPNA 4F4FA 1ZK0A 2BW0A 3DKKA 3UNXA 3FAZA 3I62A 1MJFA 2AFIA 3N74A 4FQ5A 4JJ6A 2HA0A 1NXWA 1T15A 3NH6A 3R9KA 2PX8A 4RWZA 3NUZA 1E0SA 3ZXXA 1AO3A 1C50A 1F5NA 4FDLA 1OX5A 2QTLA 2X4IA 1YMVA 4HGOA 1FSZA 1U65A 3FMFA 4HSEA 1O87A 4Y30A 3SBDA 1MFPA 3C5HA 4FSDA 3D4BA 1Z2CA 1L5ZA 2ZTMA 3PC4A 4R2IA 5F5NA 4RGVA 3UJPA 4ICIA 5IZCA 1H05A 3K70D 2PSFA 2Q3BA 1RBMA 3KC2A 5CITA 4TZTA 2VQEE 3LPMA 4XD2A 2PG3A 4F12A 3KEQA 4ZYXA 2SNIE 2P9TA 1H3EA 1OWMA 4IIGA 5TX7A 1WCYA 3T7CA 2GD6A 4X6UA 5ARDA 3JWEA 4J75A 4LE1A 1Z45A 1A98A 4NFYA 4BNNA 4YRTA 5A0VA 3NYRA 1Z07A 3QUQA 1KRHA 5FWAA 5A7FA 3CUSA 2LWIA 3CY6A 4MV5A 5DM1A 3ST7A 1H9BA 2HA2A 1OFUX 1EVEA 1W6UA 2P9CA 1C2YA 2V6JA 3A37A 3AEUA 3AT1A 1Z4JA 4IGKA 5JNWA 3T1TA 1TMOA 2V89A 3I1FA 4FMDB 4U3JA 3F49S 3JQ6A 3UV6A 1IPHA 5JHHB 2UVDA 3L6BA 3RUDA 2EKZA 3OKCA 4WJLA 3DUWA 4B34A 5CFLA 4OL0A 2MKDA 1TLFA 1P9OA 3LPNA 1ZMOA 3U1VA 3NVMB 4WXEA 4HX9A 2NT4A 3OPYB 2WM3A 3COWA 1OC2A 3D6NB 1W8IA 1GDHA 1HK7A 1WSDA 3GJQA 4MJLA 3ZY4A 4ERNA 2ZQYA 3FFWA 3ODPA 5GM1A 3UH1A 4QFBA 2VS1A 3H1GA 4D9KA 5KJCA 1UBLS 1XHLA 4DA6A 2VTKA 4AJ4A 2JGDA 4L5BA 1SHTX 2LR0A 2M1ZA 4UM9D 1R18A 4Z9YA 1FP4B 4ZC1A 3GZNB 2XLCA 5LQKA 4K0KB 1HE3A 1XZDA 2NZJA 3RHTA 1GNRA 3I2IA 4DIEA 1FZQA 1LVHA 2JI7A 3T34A 4DLTA 5FBHA 3MTQA 4E7OA 4DMRA 1GDDA 1S4QA 1ONSA 4HDCA 3UAYA 4PZ9A 4DG9A 1E4EA 1TO6A 2R8OA 1B73A 4AJIA 2YR0A 4N54A 4R6WA 3VYVA 3WGIA 1D4ZA 3EC1A 2GLUA 2P9GA 4PC6A 3V1UA 3ILHA 2O0LA 4MUJA 2ZDQA 1N6IA 3K1AB 2QTZA 3S6JA 2X19A 1SKUA 2GYUA 4M60A 1AKYA 2UZIR 3AHGA 3H1BA 1J7JA 4PG8A 10MHA 4PYMA 1ZUD1 1QAQA 2J9FA 1MR3F 1EI9A 3M3PA 4PYIA 1YACA 5LB2A 3S7TA 1QDLB 3U9TA 4BP1A 3MTGA 4CMIA 5L51A 1YOBA 5A9TA 1Z7YA 3WGHA 1VHQA 1QM5A 2VT3A 3DG9A 3Q7QA 2NVWA 3UGTA 3FYUC 2O6HA 4ZVMA 5AXBA 4QJIA 4NDZA 1VE5A 3IPXA 3PD7A 2NU8A 1P0QA 1SZCA 1I1HA 1NSFA 3BTSA 2VH2A 4IMJB 4ZODA 3RRXA 5DOZA 4HN9A 3QNWA 2ZUTA 3IEMA 4MVJM 4RM3A 1F3OA 5HGXA 4Z9FA 2GARA 1GZVA 3DTYA 4IVNA 4JHXA 4O3FA 5ULLA 4O4IB 3SSOA 1PQUA 1Q74A 1XZNA 5DIFA 4DGSA 4M30A 4NHRA 3VMMA 4Z3OA 4ADSG 4K0RA 3GROA 3PGA1 4LE2A 1UPFA 4OCZA 1HBJA 1OBFO 2D1SA 3ED5A 1QO9A 4Z0TA 5TJHA 3PXUA 1JBQA 4QUDA 1QF7A 3F7MA 3O31A 5IAKA 1XJ0A 1M2OA 3ORYA 1UPTA 4XQ0A 3IAM1 1TMYA 2RHOA 1SR8A 2FX5A 1CB0A 1C1DA 1GPYA 2IXDA 3CF4A 3MWFA 2A67A 4X45A 4GKKB 4OREX 2W42A 2IITA 2YFKA 1QANA 3C6BA 1L4UA 2FG7C 2CJYA 2I2XB 2JFBA 3H19A 3JV7A 3NB0A 3ZNPA 3ZXUB 2OG2A 1IE3A 5GGXA 3KPJA 3SR3A 4RADA 4PV7A 1W25A 1C1DB 1P1CA 1JLLB 1NQTA 1XEFA 2GKSA 1CUZA 2QL6A 3A4TA 3VHQA 5CP8A 5EZYB 3KQQA 4EVRA 3SHWA 4OI1A 2ERXA 1AUPA 4IRUB 4R5MA 4FHGA 3M83A 1GJRA 1PSDA 2NO6A 2FV4B 2QK4A 2HBZA 2X5OA 1ZIOA 2JOXA 2B8JA 2J3MA 3DMFA 3HSYA 3RKUA 3WGZA 1LWOA 1LTHR 5AVQA 3IEIA 1JAIA 2GRJA 2BKXA 4FDTA 2JXPA 4LJ6A 2NX2A 2P30A 2IPOA 3G2PA 1AZSC 2IUSA 1PNTA 4AS1A 1KARA 1H0SA 3A3YA 3HU1A 4OQQA 3BRWD 1Y6JA 2FWIA 5J9FA 4UZFA 1R6XA 1P0PA 4X62B 3JWGA 3LWNA 4MWDA 2QGZA 3EQ7A 4UATA 1QGUA 1ZWLA 4S1NA 4KKVA 3KL2A 4PZCA 3VPAA 2XGJA 4UMDA 1FRNA 2W90A 1REQA 3KJNA 5H02A 1A2BA 2WE7A 4HX5A 3ROPA 2E21A 2O8BB 3G79A 3FYHA 4J0EA 3CVUA 2IYEA 1I7PA 1WSAA 2JGKA 2LXNA 2RGDA 2NZ8A 3LCVB 1T4CA 3FHLA 2EM5A 1GNQA 4HATA 2HFKA 4IHJB 4LYEA 3Q0EA 3M1IA 4BXOA 2J6CA 3EZ9A 2PWYA 3NETA 3QM1A 4MYCA 5DNDA 4F5YA 4DDUA 4BUCA 4IIJB 4Q15A 1FRZA 2JIBA 3UUFA 4LFCE 5AM5A 2NZXA 2IY8A 1TF2A 1YUIA 4CKCB 4FD2A 3N6VA 1VMAA 3QE2A 2YFQA 4RW0A 2I99A 3H17A 2FX3A 2IHUA 1J26A 3OBIA 1ATZA 4NYIR 3RUPA 1QTIA 2WCC3 1UEJA 2A7XA 4L4UA 2YV2A 4KU4A 2UZ0A 2H52A 4JI6B 5J4LA 2R7LA 1NW6A 1Y4ZA 1C7JA 1YB1A 4D9GA 3VR3D 4ACAA 3W5AA 2EW8A 2C59A 3KXIA 4FLEA 5ALIA 2OL4A 2QQGA 3L0DA 3DL0A 1GRNA 2Q5LA 2TECE 3BS4A 3EIXA 3H04A 4GOKA 1DJQA 2FDXA 4KI7A 4IDBA 5FORA 2PA0A 1TQ8A 1R0ZA 3UH0A 2HWWA 1BCRA 4NXME 3WBBA 1LI4A 4Q66C 2V7QD 5FLKA 4DBVO 2B9VA 1QBGA 2V6IA 3AF0A 3BMQA 2QUKA 4WZBA 1XKQA 1Z34A 2DUJA 4LIPD 2JGMA 4YCMA 5GMOA 5C5EA 1UXIA 1Y3IA 1EH5A 3UT0A 4L02A 4E21A 5BURA 3PCXA 1CYEA 5FNVA 4UVEA 1TPYA 2RGEA 1XPUA 4Q1BA 4DQKA 2V1UA 1MH1A 2RAPA 3L04A 3KOMA 3L7IA 2JCVA 5IT5A 1E7MA 2Q6VA 2FZEA 4K9QA 4OB6A 4REQA 5IBQA 2ZDHA 5JS2A 4KHPB 3VO9A 1E1CB 3FUUA 1XVVA 1JYEA 1DUIA 2CFIA 3ASVA 2GNAA 4ZAYA 4U6SA 2F64A 2V0GA 4N8DA 1N7JA 2YZMA 4RDIA 1YCFA 3EZYA 4XRRA 3JATA 4ZXPA 4IZOA 2PZMA 2Z8YM 1UBTS 3IO3A 2VHVA 3K6QA 2QTFA 2ZRPA 3L8GA 3UMCA 1NMXA 2PU7A 1K66A 4YMGA 2K5UA 2WAYA 2XJ4A 4CDRA 3T15A 3AP3A 5DYNA 4A6DA 2Z5FA 1DOZA 2ZRMA 3DDHA 4G5YA 3TSAA 3G8DA 3GEDA 5E1OA 4R83A 2H63A 2PRSA 1UJ4A 3B1YA 1XEXA 4K9SA 1IUNA 3HVKA 2J85A 3D2CA 4MO2A 3WBFA 4R1TA 2HPAA 3QTBA 5A4KA 1YVPA 1QF6A 1T0JB 4OU5A 2IZZA 3DFMA 5LIPA 1EEHA 1V3QE 3L4JA 2NADA 4O1IA 3UCXA 4CDMA 3AVTA 3PPYA 3GLIB 3O9VA 4BE9A 1VA4A 3ASYA 2PV0A 1V3UA 2JH8A 1N92A 3GWGA 4YLEA 5DFAA 5A7GA 4PNPA 5CG2A 3WV5A 3JR3A 1X8JA 2CNBA 3UJDA 4LBVA 5LB4A 1DCFA 4F06A 3GCDA 3L8EA 4ZVPA 2RHHA 1C3JA 2V74B 5GY7A 2C4NA 5C51B 3GLQA 1BGXT 4Z4EA 2VHXA 2WT8A 3EXG1 4DQLA 1JIKA 2C92A 1NLZA 2L3CA 5DW0A 3LO5A 6REQA 3GIDA 4WFQA 5ELMA 1HLDA 2XT6A 2HIHA 4ZMBA 4M98A 1CUBA 3FIUA 4J0GA 4KKXB 5DCWA 4AZ3A 1RFLA 2XRYA 3QEKA 3VKHA 1DG1G 1NG1A 2ICAA 3OA2A 4KUHA 1G17A 4F0JA 3K0AB 2K6GA 1U3VA 3ETHA 5JXHA 2GBFA 5FI0B 2EKLA 2C61A 4FOSA 1LBIA 5LJLA 1IVYA 3A1FA 4FFNA 3WYGA 2FZVA 4R81A 4YJ3F 1VB3A 5CU7A 4KVZA 5E7JA 1DQRA 5E7IA 4N7BA 5FTLA 1UBFA 3TUZC 1QTRA 4X3CA 1YL6A 3NJRA 4UMFA 3QVLA 4Y9SA 1N5OX 3K8ZA 4ZZ0A 5L9AA 1P45A 3TINA 5CB4F 2YIMA 5KUTA 2X0KA 4BHCA 4L4YA 4BZZA 2BD0A 2EL5A 2EM8A 2UUCE 1KJIA 1BH6A 3ZEAA 3LUDA 3NBZC 4FCVA 5CUQA 5JLJA 4RZ2A 3O75A 5T64A 4E07A 4FYHA 4DSZA 1Z4OA 1L5GB 1FBTA 2VQDA 4MEAA 4MA5A 2W00A 4YC7A 4EO9A 3DTTA 2QX6A 2EF0A 5BVGA 4ZDWA 2RPCA 1G6Q1 2QSUA 4R71A 4OHCA 4KQXA 4A6PA 3A9VA 4COOA 2PLAA 5IWAB 1M9NA 1NW8A 3HB1A 1D5WA 1AGPA 1ECGA 1CUDA 2H2AA 3HPSA 2IE0A 2AD5A 2H0QA 2IU6A 2ZB4A 1OX4B 3OIGA 5CLJA 1C81A 1KIAA 3F5QA 4KODA 4G1EB 4XR4A 1IXKA 1UDAA 2BFFB 4Q9NA 1XNHA 4IDFA 3ZN2A 3B7WA 3TVTA 4DJEC 4EJSA 4TKVB 3KELA 3QELA 2ANBA 3K1JA 4ER6A 1QE0A 2IYQA 1MCZA 1ICIA 2X6RA 3U9LA 4X8WA 3C8ZA 5KTKA 4WECA 1X86B 2HV9A 3MFQA 1DRUA 1HOTA 4CFYA 4A27A 1E7QA 2DHDA 2P2LA 1WOMA 3G8YA 5BR1A 1R8SA 1A04A 3K9GA 2JGNA 2RQLA 5EXDA 1Q1ZA 3FWZA 3I5UA 2H7VA 3HC7A 4DMMA 3K4PA 1G19A 2IZ5A 2COKA 2YHIB 5G4KB 4AZTA 1QZUA 1IBLB 4QGGA 1YFKA 4C0QC 4EHIA 4NEGA 5IXJA 3DDUA 3QFHA 5EWJB 2ZSDA 4JI5B 3RSFA 4Z9BA 3L5KA 4OO3A 4DREA 4MRRA 3U62A 5FV4A 1XJWA 2P6UA 2QLJA 3GT3A 2AEEA 5HRUA 3MTIA 3OQNA 1DDOA 1K8QA 2BGLA 2CC2A 3BRQA 1A1SA 4LOHA 4M8KA 4ODIA 3HUEA 4JI0B 3NFYA 1DO2A 5I8PA 3FAKA 1NWCA 3ZE2B 2VFAA 3DVRX 2WHPA 1B6RA 2X14A 4ILKA 2C9CA 4Y2QA 5KOHA 1AN0A 1I5RA 1DTWA 1CUAA 4NU5A 1YK1A 1G9XA 1XRJA 4YECA 4W1PA 4IH1A 4QYTA 5LQRA 1DL5A 2HLDA 4M9RA 4OKSA 1ADFA 4L50A 4LYYA 2DP4E 4NG5A 4TV9A 5GV7A 1VMEA 5DASA 4KQHA 4V0RA 3KQWA 1P18A 1Z0IA 2XOKA 3N0VA 4EECA 4DWVA 5ICMA 3CR8A 3MJRA 3O92A 3RM3A 1AV7A 4NPAA 3AVOA 2IUYA 4JELA 1LK0A 2VZLA 3MJFA 3DHNA 3QU5A 4CE6A 3H11A 5EPUA 1MC1A 4RE5A 2UXCE 3LT0A 2WSYB 2ZSIA 4N0EA 1XR3A 1RJGA 4FCCA 4H6VA 4PBTA 4RH1A 3EA0A 3FETA 1CVIA 1N1GA 1RHQA 1BVUA 5AE2A 4QUKA 4RGYA 2P9BA 3OZIA 5DISB 1O3YA 2E4AA 4LRYA 3HUUA 2ZIFA 2Y71A 4MPTA 1PT9A 4M7WA 5G0VA 3ND5A 2WWVD 2JZCA 3IMFA 4NZOA 4M9XA 1NQVA 3SR0A 4C0BA 2IOQA 1EX9A 1X74A 4QUGA 1F2IG 2Y1XA 3DHWC 3JQFA 3HPZA 2V6MA 3EG9A 1VPLA 3C4QA 4BEVA 5KQRA 4DZTA 4YBZA 3H9UA 3O3CA 4YP5A 1Y3CE 2Q4DA 3FCUB 2X7JA 3PWSA 1BD4A 3G17A 4RVSA 4I3HA 4AMBA 1OGIA 2WM2A 3NTVA 3LDAA 4ETNA 2JGRA 2Q6IA 2PD4A 1TX4B 2B7VA 1DO8A 3PUXA 4K1XA 4F1WA 3DXXA 3RG2A 4Q4HA 1RVV1 2YOFA 3TX2A 4HWTA 4JLBA 2RIPA 2EP8A 3FTQA 1XMIA 1E2MA 1Z0AA 3LFUA 1OPRA 4IXMA 4MLQA 4TKUB 3IUQA 2OVFA 4E5VA 3O1JC 2FSVA 4LHVA 2DFPA 3R7AA 4D0NA 3F67A 1MPTA 5GVSA 3CB2A 3FNIA 1HXHA 1ZVKA 4DQ0A 2BBTA 5KYGA 4CKYA 4L8WB 4JEMA 2R6FA 3KQPA 1XAHA 5HWSA 4DR1B 2H7YA 1Z6QA 4PX5A 2P62A 4TWIA 2CMDA 2ET6A 2H1FA 1AGNA 3ECCA 1QFSA 1KI1A 1XVUA 1SXJC 2ZJ0A 2VPPA 1L5QA 5TF0A 3ZDYB 4BLTA 1E9BA 2QMEA 3QQPA 4WOPA 4OPMA 1S7CA 3K20A 4XIIA 5FT9A 1QB8A 5HPYB 2VRWA 4RV4A 5AM1A 1GUDA 4LW8A 5DYGA 4X6YA 4D02A 1DX6A 4QZVA 1J1UA 3SS8A 3T6KA 3C1AA 4DIMA 1LPNA 3REOA 1K8ZB 5A9SA 3F3SA 1I36A 3HJFA 1GL9B 1DRWA 4LV5B 1AS3A 1BS1A 2H17A 3PFBA 4R1UA 3GI1A 5GONB 5AUQA 4D3SA 3A3NA 4HR7A 1FDOA 5D84A 1O08A 3FDFA 4BKMA 2BGWA 4Q4LA 2OVBA 3BWDD 3VU3A 1R4NA 4IIJF 4M1OA 4RENA 1Z2NX 4CQLA 4ZDJA 5C1BA 3RS5A 5CH3A 1N2ZA 2R76A 5M3BA 3RT9A 3FHTA 3HI4A 3K9QO 2D1RA 4HLDA 3W04A 1YS7A 1SHKA 4K3UA 3FUTA 4Z3DA 3WRYA 2GMWA 3QHPA 2EOSA 3FI0A 3KSBC 1QH0A 1JR2A 1W5TA 2AFHE 2QW0X 1WM1A 5LMNE 4LXIA 3SYLA 4ENVA 4RZIA 5CA0B 4XH9B 3RREA 2O2EA 4N9WA 2FFHA 4MKIA 4RA9B 4N0DA 2G82A 3L5OA 5KBYA 4UOQA 2VDKB 4XVRA 2EKBA 3DE0X 4UXHA 1XNGA 4Z7OB 5HCIA 2IUFA 1OFIA 1PS0A 2ZE5A 3DZBA 3AW9A 4FW8A 5P8WA 2FF7A 3NDBB 1DRVA 2GCIA 4H1TA 4UUPA 3NC0C 1GVNB 1TZKA 2YN0A 3GMSA 3ZHXA 5LUAA 4TSRA 3SN6A 1KI3A 4QNRA 3WJ1A 2X6TA 3AM1A 1L5WA 2D13A 4YONB 1NAIA 3TEJA 2FW0A 3VJKA 2ZTHA 2AF3C 5AWFC 3TLBA 2FEAA 4CF3A 1I2DA 1J23A 4AN0A 5BSUA 4U7GA 2DR3A 4YWJA 3K70B 1CRPA 4EG0A 2H1HA 4AW9A 4GXQA 4RPCA 1M8GA 1JT9A 1XZLA 3UYLA 1D0VA 4JEHA 3LW8A 1FBNA 2Z04A 1D2MA 1W1WA 3CKKA 1M2NA 4FGSA 3VVBA 1ULHA 1YJXA 1IY0A 3F6YA 1ZUNA 3IP8A 4LZLA 4MAMA 1CX9B 2Y0DA 3K9NA 4DLBA 4DT1B 3TZCA 3UWDA 4MQLA 3F98A 4EYQA 1EP1B 5K09A 3EZFA 5TPZD 5ILQA 2BGTA 4P0TA 3QVWA 1JZSA 3DE1X 5IEBA 4MDHA 4B4WA 5DGCA 2EMAA 2QM8A 4G0NA 2OB1A 1Z8FA 4RZXA 3ADCA 2IVZA 2HDOA 3GDWA 3JQAB 2QIPA 4HNQA 1EFPA 1JK2A 3HO1A 1EK5A 1DJMA 3GFVA 2PRJA 3WGYA 4ZT4A 3LKDA 4PLTA 1W4LA 3AG6A 1EAMA 1KXJA 2PH3A 1HFWA 4ZV7A 1KO4A 2HXYA 3QY9A 3MXOA 3UJ9A 3V55A 4QXAA 3T7JA 2N3ZA 2RSLA 3JQ9A 2UV8A 5F77A 3WSTA 1D6MA 2ODEA 4EFKA 4Q48A 2J0QA 3GGCA 4LK3A 1F14A 3MERA 3QG5A 1XD2A 4R41A 1A82A 2QUBA 4M53A 5CJPA 2ZUEA 1IQPA 4P54A 1UJNA 4B6GA 1HNWB 3BIWA 1WXGA 2EM9A 1H9CA 1NDUA 2IQ5A 1JFFA 1RYMA 1FNNA 2AN4A 4FCTA 5AJHA 4FB5A 4G63A 3HCRA 2O8CB 4YCCA 5C81A 3IDZA 1Z5VA 5K0TA 1J9EA 1FOEB 3UB3A 1OV6A 3VUEA 4K9KA 2G9QA 4QDZA 1X9IA 3FDIA 2UZ1A 4QA9A 2H3HA 2CYBA 2ZYAA 1S2DA 3BWXA 4IV8A 3G5UA 3DOCA 4PM4A 4OHZA 1S1MA 2XEXA 3H5TA 1D8TA 1IHDA 5AW1A 3C3YA 3IS3A 1M76A 4D0GA 3QBJA 3QWIA 1TIPA 3DE3X 4YJ2F 3TIXB 3PQ4A 1BTOA 2IBMA 4GS5A 4OBXA 3GA0A 3NBFA 4PXAA 1I3MA 4FFVA 1SC1A 1ZXXA 1KY2A 1LDMA 1FS6A 1UIRA 2VHUA 2W2PA 2XV1A 4H7FA 1GTJ1 2PX0A 3DS8A 2IYLD 4YP9A 4D96A 1DNPA 3LHSA 3RVRA 1ZQ1A 1VJ1A 1YVEI 5E4YA 3IO5A 3OMLA 2VG8A 3ZV4A 1YC5A 4OXKA 3NDRA 1U3DA 4NCNA 2JB9A 3HYLA 2C9MA 3C5VA 5A2QA 1V8ZA 3AJ8A 3PUYA 3GQVA 3TK1A 1A69A 3PPVA 3HK2A 1M5UA 3D7KA 4M54A 3N7TA 1YNSA 4OLFA 3DFZA 3T06B 2A2ZA 1XROA 2H5JA 2BRUC 3TB6A 3LBNA 1KZ7B 2WJVA 4RHXA 3KZYA 3TAUA 3V7FA 4BVJA 1V9SA 5BSVA 2PGOA 4AF8A 4BLOA 1NW9B 3MCWA 3C98A 2E5WA 1CV2A 2KHZA 3QEOA 1S3FA 4CKBA 1PWZA 2NSLA 2WI8A 3WY9A 2KB0A 4AROA 1DRKA 1N34B 4ZYVA 4BCDA 3Q7IA 2C98A 4YASA 3RVQA 5KJEA 5JD4A 2TMDA 2DOKA 1FFBA 1PCXA 2X9QA 4JJ4A 2D5AA 3QFRA 4KNVA 3GBVA 1PQYA 4PRYA 3U61B 5ALLA 4DVJA 5HBRA 4F04A 3B8EA 5AJXA 1DBSA 1UM9B 2QZ4A 1IZ7A 5BUSA 5IVPA 1NFFA 2DPLA 3GK3A 4G25A 4HLQB 5C34B 2PLFA 3LA8A 2WG2A 4TWBA 5B7NA 3QMMA 4MWEA 4LJ9A 5C0OE 4JY7A 3PR3A 5C53B 1T24A 1FDTA 4LGCA 5DHAA 4B6RA 3SD7A 5FTNA 1USUA 2ECOA 2K7ZA 2PBLA 4NTZA 3KT3A 4OAOA 2HCJB 4I6EA 4FTWA 3SJCA 3H5LA 4UCQA 1MPXA 1FUKA 1ELOA 1NNLA 2GO7A 2QX9A 5FWDA 1DQZA 2HDWA 3D8RA 2Q2QA 1DMRA 1KC1A 1OIWA 2QXTA 4WOKA 4BQEA 3BE5A 4QXQA 4V2IA 4IO0A 4XXHA 1P80A 3G89A 3PHGA 3PLNA 5DLPA 3ID6C 4X90A 4DMFA 1JG6A 1VBNA 3KLOA 2HEGA 3NR2A 2XF2A 4BWGA 3KDPA 4HJXA 2P1DA 3NCTA 4EB6B 3VYXA 1MBZA 3HRHA 4Y2PA 5CB8A 2CN1A 5DJ5A 3TCKA 4ZEVA 4L0MA 3KQVA 1QC5B 4MV4A 2OECA 1QQ7A 3X1JA 2JANA 3OVMA 1GOTA 1JLKA 1V16A 5DBIA 2QZZA 1ST3A 3RC9A 5JBNA 2BR3A 3LLVA 3Q6IA 4PE5B 3S2ZA 1D3AA 2XVYA 1V35A 5CH8A 3RF6A 5MFPA 5A7HA 1IMUA 3WADA 5FBVB 3ZD9A 3THYA 4HDNB 4KXFB 1FTYA 3CH6A 1FRVA 1AK2A 4MHSA 4BMSA 4YO8A 3RAJA 4TUIA 1USVA 1DKMA 1WB6A 4BFTA 2FA9A 3IIEA 3TPZA 1TB4A 4V1CI 1Z2PX 4GX0A 4MR7A 5DI3B 1U7ZA 4EG1A 1YS2X 2VXBA 2W6ID 3RHZA 3RADC 3ZZ0A 3R3HA 5LN1A 4LBZA 3TVDA 4DV3E 2DUWA 3JD3A 5HHTA 5M7EA 1KMMA 3H2JA 3HQ1A 2QRNA 2GASA 2ZSHA 2VZ8A 4HKTA 1GKUB 3TRFA 1DI2A 1NVUQ 1WZNA 4W8GA 3TRHA 2JHPA 1NAHA 1P7ZA 2H4XA 3IQXA 1EP3B 2GRUA 1JG7A 5FKJA 4DV2E 3N8GA 5IC5A 4C76A 4L4RA 1BDHA 4J8ZA 3P9SA 3DBOB 4Y1EA 5AKKA 2QTVA 5DDIP 4YXWA 3ZWAA 5J58A 3RYIB 3I45A 4KAXA 2EOFA 5FBWB 4UCFA 4I55F 3ZYZA 5A4FS 5C9ZA 5JU6A 1QZZA 2GFIA 1XPOA 4X95A 3LP6A 1IWPB 4G5FA 1QONA 1TCAA 2Y1KA 3L4BA 4PW0A 4XJXA 3UYKA 3TKYA 4B6FA 2XVMA 2G88A 1NDQA 1Q3TA 1V5IA 2GETA 4N0MA 5JVDA 3A14A 3C7CB 5GV8A 3TCNA 3WAKA 2J3LA 2G1KA 4XVCA 1F7UA 3BGVA 1X38A 3F8TA 2PANA 5AVYA 5TQ0A 2X8AA 4AKEA 1Q22A 1J1ZA 2AYZA 3ICOA 4UUAA 5KWSA 4KXWA 4YLYA 4L22A 3HCPA 3BK1A 4DMIA 4MRVA 4NH4A 1EXWA 3CG4A 5ERXA 1ND5A 1WXEA 3HR7A 2NPFA 2ZBVA 2AJTA 1SKYE 1J0BA 2IELA 4LTMA 5C8XA 4GNRA 4MQEA 3DAGA 2CK3A 4DQXA 2I33A 3QWFA 3WMEA 5LSAA 2OB2A 3IE2A 3WLRA 2QE7A 4TL7A 4GF5A 4XPIA 4ZCTA 3Q2KA 4NNPA 3PNVA 5KZMB 4PQYA 1CE8B 1XZGA 3RTEA 3Q87B 1O6BA 3VR2A 1NR5A 4EKEA 4F9BB 2K2QB 1Y7IA 1OTHA 3W3AA 1XK7A 4FFOA 2MIIA 4DV4E 1J07A 1W88A 4JP1A 2RHMA 3B6IA 1ZH4A 1OX4A 4FYKA 1I3NA 3FROA 1EUDA 1FFXA 2YZGA 4GL4A 2POQX 2XNKA 1T0PA 4TMZA 5IU6A 3KQKA 3WP0A 5GONF 2JEZA 2KX7A 3AV0A 4J1QA 2BFDB 4I7EA 2ZEJA 3HWX1 4J1TA 4CT4B 1U1GA 3O47A 1Z6YA 5LXTF 2OORC 1Z3IX 3LCMA 5AW6A 2FVYA 1JDNA 3O84A 4KUGA 2TSYB 3P0RA 4JT9A 4UVHA 3F8SA 4Y1GA 5ALUA 3V4ZA 4EHLA 4KLZA 5FFNA 1G8GA 3Q9SA 4Q7QA 2WNSA 1JQEA 5EFZA 5I9SA 4BO2A 3ACDA 1XKTA 2F1HA 3CLKA 4RANA 4PINA 4O1HA 1J2YA 2AEFA 3WKCA 1QYCA 4CM9A 5EJEA 1Y80A 1AC5A 5A05A 1D7AA 3K4QA 2QTGA 4P7DA 2AUTA 4FP9A 3D7MA 3OZ7A 2YXBA 1XC7A 1FLVA 4BUZA 3MWLA 2DB3A 3OU2A 1P5JA 3IIMA 4Y9RA 3GN1A 1GU0A 1ODIA 2DPGA 1KERA 1IN5A 2WUGA 3NHPA 5I9BA 1QFMA 3M3DA 5K3OA 2BEVB 2ZRBA 3ZV6A 4F6MA 3CU5A 2VHYA 3VU8A 1YR9A 1J9ZA 1DQSA 1B6SA 3GFFA 4QASA 4A82A 1TUGA 2BJHA 2WD8A 1UMKA 3PC8A 3PEEA 3QPDA 3ZD6A 3N70A 3P94A 4IUBS 3OWOA 3KT0A 2HX1A 3OEHA 4RYDA 3HO8A 3VZRA 4I1VA 2PT6A 1UBDC 4J7AA 4O4LF 4ZI5A 2VBIA 1Z6PA 3T99A 3JASA 3ONWA 3LDUA 4GKBA 3MSWA 2XXJA 3WQBA 5TDHA 4PS1A 5JJCA 1X49A 1D2RA 2HA5A 4KQEA 5CDGA 2H5EA 1RXUA 4NQZA 5AVVA 3GBPA 1G2QA 1N6LA 2ALJA 3H0EA 3R5SA 1KE2A 3PXDA 1L5LA 4L3WA 3WIVA 3N2KA 5I5GA 1XXLA 1KDYA 2Z8XA 2OBXA 5DWDA 3M9LA 5C52B 5BV2P 4DR4B 4XJSA 5B6IA 4LYDA 1H23A 1JFRA 3ZBQA 1EBFA 3RSGA 3PDIA 4WZZA 2E87A 3PGMA 3BIXA 5TS2A 3PNMA 1DEXA 1DKNA 3TRDA 4QOHA 4QUJA 4EW1A 3H9CA 2AKYA 3W8EA 3VPXA 3E9QA 2YW9A 4MV3A 4RY8A 3LWZA 2BEVA 4HAYA 4M9ZA 3K0EA 1CFJA 1MKYA 3HXMA 4W1RA 2FRDA 4O2AF 4XLTA 5M5BA 3ZJTA 1QTQA 5E4FA 1RM5A 3AGPA 1AO0A 3N8DA 3L9WA 3OOYA 3QF7A 2CJWB 5AW3A 1D0IA 1ODSA 2NAFA 4HXEB 4FLMA 3AR6A 3NAMA 2X0IA 2M7QA 2WVJA 4OHOA 1J2JA 2FMTA 3ASUA 2Y9PB 1CEXA 1V43A 4TV9B 2OUKA 1D1TA 2BAGA 1A77A 2CMHA 2P9YA 4IRMA 3GZTB 4G81A 1QCYA 4LJKA 5ICFA 3EUFA 2ACEA 2JFVA 4Z51A 2DBRA 1EBUA 1HZZA 1O6ZA 5HA5A 2C4HA 4D8WA 4RL6A 4WADA 3GMDA 3RT1A 4U9HS 4C0HA 2ZR9A 5B37A 3TCXB 3Q11A 1Q77A 1OVGA 1WTAA 2GQ0A 3GJRA 1YZGA 1SK8A 4OI2A 4R8RA 3DT8A 2OCKA 4JA2A 4DKKA 3Q72A 1L1FA 1NXVA 1D2NA 1Z8HA 4DNPA 3AV0B 3Q7TA 4GL2A 3JQ9C 4X6LA 5IP5A 2R86A 5KOJB 1QRSA 4YT8A 4WEOA 4IVQA 2DGCA 4MAAA 4TLBA 3GQBB 5HIAA 2G9RA 4CJXA 5KAMA 5DNYA 2XT9A 5HILA 1WF3A 1BX1A 1BRMA 4FNMA 5KI6A 4FDUA 5KNDA 3K6SA 3LNTA 2BM8A 3X1WA 5J4VA 5JS7A 1O1YA 5DBFA 5ESRA 4IFBA 2PR2A 1U98A 4XARA 3QJ5A 2RGAA 5ALYA 5C5CA 3ACBA 5CD9A 4XLLA 4PN3A 3OQBA 4ZWNA 4G1MB 4II2A 4Y6QA 2P5TB 3E5HA 1P1RA 1Z0UA 3RYIA 4F9GA 4GKJB 2FP4A 1U9IA 1YJCA 2JH9A 1ZESA 1H2BA 3R5KA 1SHJA 4OLHA 4XI9A 5T41A 2HCTA 1V71A 3K9LA 4IQ0A 4EM6A 3BZWA 5JCXA 1DXOA 4QU0A 3ZY5A 3GZ4A 4R2SA 3H1FA 4L73A 4S24A 4A1FA 2XWBF 1UAGA 3ELUA 2Z3ZA 1NCSA 1EB9A 1OZFA 2YQZA 1A1IA 2ZAIA 5JADA 3AV3A 5JXIA 3V4SA 1GNLA 4MVXA 4EUNA 2OZLB 2V88A 1IXSB 1PFQA 2R8EA 3JWIA 1A4XA 1AK1A 4EG5A 1BKDR 3DONA 3PD0A 1E1QA 2B20A 1GIAA 1DQPA 1UIMA 2QLNA 1VG8A 2QUHA 1G6OA 1ZOOA 2JLCA 4QDKA 4E5YA 5B4VA 1DC7A 3TSYA 2C95A 3WLOA 5IASA 2EOAA 1O9BA 4HJRA 4LVOA 4QL3A 5I51A 4XD7D 1NLMA 4MUFA 4GLJA 4RXUA 2PRKA 5L45A 2VDRB 1JG3A 2YY6A 4MV9A 2NXNA 3MNFA 4YUYA 2ZIGA 3BHJA 2I1QA 3D81A 4YT5A 3GD5A 5TQJA 2ORWA 1LTKA 5I4IA 1OV4A 3OAAA 4P31A 5K3FA 4DA7A 2CXNA 1JEQA 3O2JA 1AAYA 4XFDA 4D74A 2ONJA 2B0CA 3O0TA 6GPBA 3VHTB 2Y2VA 3EJWA 1U7TA 1ADCA 4NENA 3QEBZ 3CUYA 4D3ZA 1DIBA 3HLKA 3CNLA 3GNQA 3EVCA 5K4AA 1ENPA 1EQAA 2PYIA 5K3DA 3PIIA 3TTWA 3C4JA 2QMYA 3VA7A 2J46A 3E3AA 1XCBA 1O6FA 1YB7A 3HVHA 1TJ5A 1M0SA 3DTNA 3CVVA 5HDBB 1TZJA 3ZIAD 3DVSX 4DLSA 4AYTA 2AN5A 3FNFA 1WJGA 2QZ9A 2E4XA 1X47A 5LA6B 2YWEA 2H2IA 5F5LA 3W6PA 4HDQB 1ODTC 3FIJA 1FSGA 1XT6A 3OZBA 4GM4A 4Z2AA 4XWAA 4B32A 2F3SA 3I4FA 4IDCA 1C2TA 3KDAA 4G86A 4N03A 3WV4A 1YGPA 3ZBUA 2IOYA 4JQOA 4D7AA 4EJ0A 3OJEA 1ZNQO 3NDPA 4WGFA 2DE0X 1R64A 3DMDA 3VGJA 2FXVA 2X5NA 3WRWA 2JKYA 1YBMA 1RMTA 1K27A 1TUEA 2IP2A 3BMCB 4X85A 3TPCA 4B46A 1JR3E 4HN4B 1FFDA 4XVHA 4ZU6X 3LU1A 5E4JA 5IBPA 2XGGA 1XMOB 4ZVKA 4I19A 2IZOA 4IOMA 5ADWA 2ZE7A 5IZ4A 3UBMA 2FY8A 1NV8A 2O2SA 1ST2A 3I6IA 3QOFA 3CX3A 1MAUA 4LZWA 4BNMA 3QK7A 3U60B 3HU5A 3IELA 4BRSA 4N0QA 5GOTA 3WYDA 5BUZA 3HEAA 2D5BA 3SZGA 5JMPA 1SC9A 4HAVA 5CDTA 1YIOA 4IHAA 4TXMA 4HL6A 2VT2A 2JCGA 3TSWA 4EGJA 5CFFE 1KETA 3TLGB 4MUNA 1RHKA 4B81A 3A11A 2Q0SA 5AHXA 3PENA 2R11A 1MQAA 2V7VA 3KQOA 1FPQA 2PGIA 2WICA 4LJ7A 4TMFA 1E5DA 3HCEA 2GZ2A 4PZYA 4BNJA 7MDHA 1K5HA 4I4NA 3TW6A 1PO7A 3OZSA 2ZULA 3AIOA 3TLGA 1HA3A 2RHBA 1B4DA 3L7DA 4KPUA 4OAQA 1M5RA 1CNFA