1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
4IDFA 1PIWA 5AXAA 5LCXA 1I30A 4EEXA 4CM9D 5JS6A 1GDHA 3WIEA 1PJSA 2GO1A 3IUSA 4CMIB 3JQ8A 1QYDA 1F12A 3SJ7A 1DPGA 2HO5A 1UJMA 2Q46A 3DEYX 2XOXA 2H1SA 1EE9A 1IY8A 4II3A 2OXIA 4J2OA 4I1IA 3G0OA 2P4QA 3I9KA 1E7MA 5KKAA 3KLPX 3IKTA 2NUAA 4MP3A 3LQFA 3D64A 4IXWA 3EVTA 1I3MA 4A26A 3E5RA 4J0FA 4N7RA 1I36A 1LEHA 2DPGA 2BMAA 2EW8A 4CQMA 4M55A 3ORFA 3K8ZA 2CDCA 4F3YA 2NTVA 3O9ZA 3ZNNA 4XYMA 4RPGA 4DQXA 4AJOA 3WSVA 5B4UA 2LDBA 3OIGA 3WBBA 1JVBA 3K30A 4NNJA 4MOWA 3QW2A 4IIVA 1GZ4A 4AJKA 3MWDB 1S6YA 1XELA 4CUJA 2ZB4A 8ADHA 5L4SA 4E3ZA 3ONEA 2P9GA 2J5QA 4DA9A 6ADHA 1YQXA 3OICA 5F21A 5KTKA 3CH6A 3RUFA 1UP6A 1NX6A 1VSUA 1I33A 1PJBA 3KXDA 4FOSA 4I5GA 1K3TA 1Y8QB 2DLDA 3Q0EA 2PGJA 3AU9A 3KBOA 4YT5A 1I0ZA 3O26A 4CLRA 2B4QA 1F8FA 3I9MA 5A06A 1PJ2A 5JDIC 1EUZA 2GR9A 2ZK7A 5FI5A 1CQIA 4U8GA 3TNLA 3UOGA 4EYEA 3P2OA 4AJLA 3JQ9C 1PJCA 4B7XA 5LC1A 2F1KA 3F46A 4HFNA 3UCFA 3QVSA 1ISJA 4IZIA 4W7IA 4DXHA 1CETA 1TT5A 4UAGA 3UW3A 3R3JA 4L4SA 4J1SA 1NPYA 3I52A 2ZB8A 4RDIA 3WNVA 2DKNA 3ZU3A 4K26A 1EFLA 3R0IA 5L7TA 1Q1NA 4GX2A 2J6IA 2CF6A 3AUUA 4D45A 3TZKA 2X5JO 4WCFB 3DBVO 2IYPA 1LBEA 2CD9A 3LT4A 4D43A 1D3AA 1D7OA 3WQQA 4BGIA 3KSUA 5IN4A 3QSGA 2GNAA 3I9LA 1H5QA 4ZQFA 4DMLA 3ZWOA 1TA4A 2NLOA 4NJOA 5TQVA 2RH8A 2HMTA 4AJ2A 3GZNB 1KIFA 2ILTA 3UXYA 2PY6A 3NRCA 4PLFA 1HYGA 3ZH2A 2B0JA 2E37A 2ZTUA 4BNUA 3LF1A 1O8CA 3SJUA 3AWDA 5IFLA 3QWHA 2WM3A 5ADHA 1BTOA 4A27A 4YQZA 4YJHA 3NDJA 1DRVA 5I7EA 1P1IA 2WTBA 3QVTA 3UHAA 3UF0A 2BFPA 4E33A 5JMWA 3RC7A 1GQ2A 3M1AA 5H83A 4DBVO 1DO8A 1LXCA 4ALJA 3F5SA 3HDHA 3QIVA 2IRWA 4JCOA 2WWRA 4R4JA 2BRUA 3GGOA 3ADOA 1X13A 3QLJA 1ISGA 1P1FA 3RC1A 4CMCA 4P8RA 3PWZA 3RKUA 2VYND 3SX2A 3ULKA 3ZI0A 1W6UA 5DDIP 4BKRA 1FJHA 3ZU5A 2CUKA 4ZRMA 4ND5A 5G0SA 5IJZA 3GN1A 1X7HA 3HADA 4E6PA 1QLJA 4NHEA 4RLHA 1HLDA 4DREA 4XYEA 1WZIA 2DQ4A 1Z7EA 1X7DA 3VPGA 2CVZA 1XSEA 3OFSA 1UXGA 4LCJA 4WEOA 2CVQA 3PRJA 1RM4A 3FTPA 2SCUA 4O6VA 1NWHA 4TZTA 1LC3A 4YBZA 4CM6A 5LDGA 3VDRA 4WLVA 3KSDO 4Y67A 1T4DA 1NVMB 4NFYA 4YQYA 3RUIA 5IAAA 5U9CA 1B14A 3VH1A 2PK3A 4IQ8A 3O38A 1FK8A 5TRTA 3KRTA 4J90A 5G0TA 3FNGA 5FEUA 3NV9A 3JQ6A 1SO8A 1EK5A 3OQBA 1MB4A 1NR7A 5U4QA 1ISHA 1P9LA 4CLOB 4D42A 4QECA 1P31A 4O5OA 4YYZA 3H9EO 4BNIA 4LW8A 1L1FA 3WS7A 4CV3A 1P3DA 2RHCA 3JQFA 3RUEA 2TMDA 5DBGA 4CR7A 3LT1A 2X5KO 3NDIA 5CDYA 3LC2O 2ZKLA 5T64A 4FIZA 4ND2A 2HDHA 2GN9A 3ZWAA 3GOHA 3EAGA 6LDHA 4Z0TA 2QZ9A 4BO1A 1ZK2A 1Q7BA 4YT4A 1W4ZA 1A71A 3ADPA 4CM8A 4FB5A 4YCAA 3C85A 4YTEA 3TFQA 4TRMA 1R15A 2VHZA 3PJDA 4CV1A 4F6LA 1JKIA 3GN2A 3PYMA 3MOIA 3ZGYA 3M2PA 4XRGA 5TF4A 1Z73A 5KJFA 4MP6A 2VUSA 5DP1A 4MKZA 5G2OA 1Z7BA 2Q50A 4CMEA 2FPIA 2VRBA 4N5LA 3C7DB 2VHWA 1H6AA 2YHUA 1FF9A 4WNIA 4BKUA 3L6EA 1EMDA 4K28A 4CJXA 1GV1A 1HE5A 2PZMA 1JQBA 4F46A 2C59A 3V1YA 3EUWA 4DVJA 3N7UA 1DLIA 3ROPA 5A9TA 4BO5A 3CTMA 3ASVA 4BV9A 3VVCA 3DHNA 4TKMA 1TVEA 1A7AA 3AJRA 5ICMA 1IUKA 3ZV5A 1GCOA 3PYLA 2B83A 4HADA 2PKQP 3MTJA 5ER6A 2FRDA 2NVUA 1YOVA 1P45A 2OBYA 1WDKA 3B1FA 3QJ5A 3DZHA 3ZNOA 3BTOA 1DOHA 5BSEA 2FZWA 2FWMX 1ID1A 3L6OO 4S1VA 1CF2O 3PIDA 1C1DA 5DCUA 2VZ0A 3LU1A 5FI3A 4MO2A 1HDCA 1O9BA 4FFLA 3HUDA 2QHXA 3BTVA 3NEPX 4YJFB 3ZCXA 4L73A 1UDCA 1TXGA 4IJVA 4YAEA 1T1SA 4CR8A 4J1TA 4YPOA 4NR0A 1EQ2A 5I7FA 3C1AA 4WECA 1Y5RA 3SEFA 1T2FA 4L75A 3TFOA 4IJWA 3S2FA 1ZBQA 2DT5A 1N92A 3QQPA 4XIYA 1OBFO 1U28A 1T2DA 2VRCD 1HETA 3FNHA 3O8QB 3G3EA 3DBRB 3K5PA 4B4VA 4N5MA 3D4NA 4DC1A 1BMDA 1LSOA 1PZEA 2YV2A 1WPQA 4OXNA 3K9QO 2OP1A 3MJSA 1PWXA 4Q3CA 2OP0A 4HBGA 1M6HA 2EV9A 3CPSA 2X7HA 5IDQA 1YXMA 1LQUA 4S3MA 2BKAA 4Y9DA 3WJ7A 1N5DA 3PWSA 3X2FA 3ZHYA 5BQFA 4B4OA 3HQ4O 1CQJA 3BMCA 1EDOA 3PHLA 4KTTE 4RV9A 3VPXA 3WLEA 4OKIA 5TGDA 1E7RA 5HS4A 1AUPA 3SLGA 4CQMD 1JLLA 3AI3A 2FP4A 1GUYA 2X23A 3MWEB 4KUGA 2HMSA 1GYPA 3WYBA 1Y8RA 3PHHA 2FSSA 1VL0A 1R4MA 1UZNA 5JAQA 2BI7A 4BOYA 2JCVA 1GFSA 2WDZA 4TKLA 1IULA 1V3VA 1BW9B 1RYEA 2QYTA 3IAHA 2OL4A 3STHA 3QP9A 1LDEA 4NI5A 2C7VA 1PJTA 4Q3EA 4LGVA 2DBVO 1MC4A 3DBLB 2EJWA 5C7OO 3DO5A 4BNFA 1M67A 3IIEA 1R4MB 2X86A 2HCTA 4NMHA 5KWEA 1QYVA 2JJYA 3GH3A 4BNVA 3GF4A 4CV0A 4ZN6A 4IJKA 3BIOA 1E1MA 4WLEA 3HZZA 3ZZNA 1W8DA 4DLLA 3LLVA 3TDKA 3JD4A 2AG8A 1H94A 1E0DA 2FMUA 3QVWA 3VPFA 4TSKA 3GHYA 3WGIA 3V5NA 4ALMA 1IHYA 1R4NB 3DBHA 4J4HA 4BB5A 3UICA 5EINA 1BRMA 4GVLA 4AL4A 3MJCA 4AJJA 4CMAA 4RVGA 4I9HA 4RCVA 1KETA 2P9CA 5EMHA 1FDSA 4IMPA 3JTMA 3S55A 3T7EA 1VL8A 1I24A 4LSMA 4DQVA 1XQ6A 4E13A 4Z3KA 1H93A 1XGKA 4J7XA 1P1JA 1UP7A 3TZQA 4BO4A 4DIFA 4JP2A 1I3KA 4R1UA 1AGNA 1ZKMA 1LA2A 4WPGA 3VOSA 3ABIA 3ZNPA 5CG1A 1R12A 4EITA 3IJPA 4GPD1 4I08A 4OHUA 1XWFA 1PL7A 3LT0A 3EZLA 3DZKA 4RQUA 3ZU4A 4ALIA 4P4LA 4XEHA 1LDYA 3I3OA 4WCFA 4DPLA 3WSWA 1W0CA 3KO8A 2JD2A 1X0VA 4R5HA 5KVVA 1UP4A 2VHVA 1H9AA 1HLPA 3QVOA 2ZJ1A 5BT9A 5JNLA 2CSUA 2CZCA 2BFOA 3RBXA 5JXWA 1R37A 2O50A 4ZD6A 3VH3A 5I7VA 4IMRA 3JQ8B 1BXKA 3H8VA 5EL0A 1T4BA 3B20A 3I9JA 1GTMA 1EQUA 1ULUA 3JQEA 4ILKA 3SC4A 4E2YA 3DC2A 1U5CA 2Y99A 1I10A 4WLFA 5K0ZA 2PZKA 5I9NA 4R1TA 5KVCA 5GY7A 1LRJA 3MTGA 5L4NA 2IODA 5TNXA 1OOEA 3B6ZA 1LRLA 2VUUA 4PLCA 1W73A 4KUHA 2X22A 3ZV6A 4DYDA 5HS6A 2ZIZA 4NK5A 2PD4A 1DIAA 5TS3A 3BMQA 3RKRA 3UAGA 1PJQA 4E32A 1DBVO 4CM3A 4CQMB 3L6DA 3VPHA 2FR1A 2H63A 3AI2A 4ZQGA 4URFA 4E2XA 3PJEA 3RUDA 1K6IA 1DEHA 1D1SA 2PLAA 3AK4A 3WR5A 3GDOA 3PZRA 4GMFA 3QWBA 3KLMX 1MUUA 2Y0CA 1V35A 5GZ3A 3UCEA 5LDHA 4MVJF 4M86A 4O59O 2Y05A 4ALNA 2EP5A 4E30A 2NM0A 1U3WA 1SAYA 4IZHA 2P4HX 1A27A 2W2KB 5A9RA 1MX3A 4PZEA 3A9WA 2FN7A 2EGGA 4BO7A 1JW9B 1H6DA 1YQDA 2O3QA 4EJ0A 3MJ4A 2I67A 2IE0A 4JNKA 5JMPA 4ALLA 1DFHA 4QSMA 5THQA 1EUCA 4Z3DA 3LT2A 1WMAA 1ONNA 2AA3A 2R2GA 2GERA 4TQGA 3ZHXA 3W6ZA 1J5PA 5ITVA 1OI7A 4GSKA 4GX5A 4IQGA 2ZB3A 4KP7A 1ZMOA 5CP8A 4EUFA 3RFVA 1OC2A 1T1RA 3OETA 4AJ4A 2NU6A 1M2WA 1O0SA 4GH5A 2FSVA 3JCZA 2D59A 3ZWYA 1IL0A 1HT0A 1TB4A 3O03A 2CDBA 4JROA 1E92A 4XJTA 4WE3A 3ONFA 3NGLA 4D3SA 3DDNA 4RORA 3INTA 4L76A 1ISIA 1K5HA 1KY5A 1LDNA 1LI4A 2D1YA 2P2SA 1ISFA 4M87A 3WNQA 5JSFA 5GZ6A 4ID9A 1U2GA 2AQHA 4MIOA 3WWYA 4FR5A 1QYXA 1H2BA 3LLSA 2AHRA 1C14A 1BHSA 1GZ3A 5AOVA 3GGGA 4PG4A 3ZHZA 1ZVMA 5BSGA 2J8ZA 4XQGA 1NP3A 5J23A 5JYEA 5TIIA 2JCYA 1QRRA 4B3JA 4PG7A 5IDYA 5TT0A 4BKPA 3ZV4A 2HLPA 2GZ2A 2D0IA 2I3AA 1ZXLA 2VWGA 4BQRA 5IDXA 3PHIA 4DIBA 2B4RO 3ANMA 3W4JA 2QZZA 1CIVA 3C8MA 4NH4A 3RFTA 2G82A 2PGDA 1I01A 3WMXA 1KS9A 4IGEA 1HDGO 2UYYA 4JBGA 4ESOA 3BMNA 4L4RA 5JY1A 4HFRA 1YRLA 5I9LA 3GPIA 3RFXA 2BELA 2JD1A 1GEEA 4CMGA 1AHHA 4Q3BA 4CM7A 4LVCA 3EGOA 1MFZA 1IOLA 1QYWA 3KYDA 5F5LA 2Q2QA 4XKJA 4K9DA 5BNTA 4TZKA 1XR3A 3IQDB 1LQTA 4BKQA 3L4BC 1LUAA 4R54A 2HJRA 4IJUA 1EBUA 2B4TO 1PX0A 3WMWA 3U4IA 3S1LA 1X0XA 1KEPA 2O3SA 1E3WB 3DONA 3P7MA 3I5MA 1D1TA 2W90A 4IDGA 4NFHA 3UUWA 3MCVA 4PLHA 5CEEA 5BSHA 2FOIA 3QWIA 1B7GO 4MIYA 1M66A 1HE2A 4CUZA 1YB1A 4RGBA 1V3TA 4RPLA 4GSLA 4Z9FA 4MVJG 1SC6A 3FR7A 5KNLA 1LJ8A 3CXRA 1ADBA 3CMMA 2FPGA 2O23A 1E5LA 3I83A 4OM8A 4P4NA 5T67A 3G1UA 1LX6A 1UXKA 1E7WA 3JYNA 2QRJA 3UH1A 5HBRA 3KSZO 4UULA 3A1NA 4ZA2A 2AMFA 2VYNA 4GWGA 3H65A 2PD6A 4RVHA 3GUYA 3PIIA 4EUHA 2QW8A 2BGKA 3DAFA 3GK3A 4WNCA 3GVIA 2NQ8A 2I5PO 4FC6A 3GNTA 2NNLD 4GL4A 2PNFA 1N2SA 2P68A 4R68A 3E1KA 5KVQA 2A94A 4W7HA 1P74A 3IP3A 1VM6A 4W99A 5HRUA 1P1KA 4IS3A 1X1TA 1CJCA 1AXEA 3ETEA 1HDZA 4UEOA 3LC7O 2NACA 4Y98A 4GX1A 1DJNA 2X5OA 3NJ4A 4RF4A 2DTDA 3KYBA 3RI3A 4R01A 1NXQA 1ZCJA 1RM3A 3VTFA 4NJMB 3U9LA 1YE3A 4LMRA 2X0RA 3ETGA 2ET6A 2H6EA 4U6QA 5COBA 3WBFA 1XQ1A 4HFJA 1Q0HA 4HKTA 2VNAA 4Q9NA 4BNTA 4CM4A 1N9GA 4ND1A 1EVYA 1EE2A 1NHWA 1DC6A 3I23A 4B3IA 5IXSA 2D8AA 1Z75A 5AVOA 1T2CA 2PD3A 3M2TA 3IS3A 1WMBA 5CPBA 5G4LA 1F06A 2VRCA 4UUPA 1K6JA 1SEPA 3V2UA 4GQAA 4OO3A 2AQ8A 3I4CA 1YDEA 3AFNA 4RF5A 1AN9A 2O3TA 5AXDA 1GL3A 3ZN2A 3QRWA 3RC2A 1NVTA 1YBAA 3TSCA 1MG0A 5L95A 2Q1UA 4UVEA 3GVCA 4IDBA 1VJ0A 3I1JA 2PZJA 2X9NA 4UVIA 4B7CA 3FWZA 4XYGA 4F6CA 4WLNA 1NAIA 3T7CA 4R9RA 1PJ4A 3I6IA 4MDHA 1I5RA 3GRKA 4R3NA 4CM4B 5JY6A 1PZGA 3BMQB 1CDOA 3GG2A 2CNBA 3OJLA 4FN4A 3X2EA 4WLUA 1DIRA 2G1UA 4A5OA 1SEVA 2W2LA 4BNMA 3PJFA 4KQWA 4IBOA 1ZFNA 4RQTA 4ZHSA 2GYYA 1HEUA 2DFDA 3U4HA 3FBGA 3KEOA 2BGMA 3TOZA 3KETA 3JD3A 3AOEA 4GGPA 3O8QA 1O89A 1YL6A 3EYWA 4OAQA 4PG6A 1NR1A 4YRBA 4NU6A 4Y6RA 2AEMA 4D41A 1LLCA 1I32A 2EWMA 4LK3A 5AQ1A 1JWBB 3INRA 2QX7A 2NVUB 1Y6JA 5T8KA 3ON5A 3QWFA 3PHJA 4MVJP 5A3VA 3C7AA 4NG5A 1WXDA 3NDRA 4CQLA 3HN7A 3H9UA 2ZCVA 3TN7A 5KCZA 1VJ1A 3ENKA 5CDGA 3H9JA 4MVJD 4LRTB 1DFIA 2NSDA 4TRNA 2Y1CA 4I5EA 3W8FA 1DHRA 1BXGB 1O5IA 4W4TA 2PGLA 1VJTA 1PGPA 3Q2IA 2C5EA 4UUOA 3AM4A 3HG7A 3U5TA 2G76A 1GD1O 2C07A 1KVUA 4OH1A 2QG4A 4OKNA 3PK0A 4K6FA 3FHLA 4BGEA 4J0EA 4MVJM 1MGOA 1QORA 2AEJA 3F1LA 3BHMA 3KYCA 2VWHA 3SVTA 1KC1A 1XU7A 4RVSA 2YYYA 4MVJI 4XQEA 4BHTA 3RU9A 1GADO 4JGBA 4PZCA 3TPCA 2GZ1A 3AY6A 4CL3A 2UV8A 4BL5A 1EDZA 1DIGA 1Y7TA 2TMGA 4ITUA 4B8WA 1E3SA 5BSFA 5ICSA 5I9MA 5H81A 2PV7A 2B5WA 3OBBA 3P2YA 1IPFA 2UUOA 4XB2A 5L9AA 1GY8A 3RROA 3A4VA 2C2YA 4IM7A 2V6BA 1JA9A 1SB9A 2J3IA 1PJ3A 2GGSA 1SOWA 5KJ6A 2I9PA 2G5CA 2E49A 3K96A 3H2SA 4LISA 3H9QA 3V8BA 4CLXA 1E7SA 4E5YA 1X7GA 1PS9A 4WGGA 3D4PA 5AXCA 3H5AA 4BMVA 3H4VA 3EC7A 3PQEA 4MJLA 4CMBA 1KVQA 4BNXA 1NFQA 1NYTA 4QO7A 2C7GA 4R1NA 1QYCA 1Y9AA 3VHRA 4P22A 2GASA 3JQAD 3PLNA 2PFGA 4MVJA 3WFIA 1YO6A 2EERA 3FRJA 2ZATA 4R5MA 5A3JA 1I2ZA 1V6AA 3GVHA 1LLUA 5DCYA 4HX5A 4B4WA 1DHTA 3RWBA 1B0AA 1ARZA 2HMVA 4FC7A 3PQDA 3HN2A 4AG3A 1E6WA 3FF4A 3UGKA 4C7JA 2RH4A 4N54A 4GWKA 2Y1EA 1XIVA 1KVTA 5B1YA 2LDXA 4DRYA 4ZQBA 1DC4A 4IPTA 5FWNA 3DAGA 3GUCA 5DBIA 2OZPA 2JFGA 2F00A 4D3DA 1U3TA 3E9MA 1V9LA 3WYEA 1DFGA 4AJHA 4XRRA 2O4CA 1A4UA 3NJ8A 4IDCA 4OQYA 3OEYA 3C1OA 1E3EA 1PL8A 1T24A 4IDAA 1UXHA 4MKXA 1XDWA 2X1HA 1A7KA 3CE6A 3FPLA 3F6YA 1LNQA 1DIBA 4B3HA 2JAPA 1U3VA 2GSDA 4Z6KA 4UUMA 1GPDG 4R51A 5JDCC 4PLGA 3OP4A 3TRIA 3ICPA 3LDHA 4NBRA 4AJ1A 3CMCO 4O1MA 1RJWA 4HP8A 5ER9A 4DMMA 1MG5A 3DBRA 4XDZA 3S8MA 1TI7A 5DZSA 4AICA 4L8VA 2HQ1A 3IL2A 5I8WA 1C0LA 2OGUA 3MZ0A 4FD3A 4RZIA 4YAIA 1GEGA 4NDNE 1ZW1A 4PGFA 3CUKA 3F4BA 4DC0A 2DBRA 5T5QA 1F17A 4NBTA 4RVDA 1NWCA 4B7UA 1N7HA 3WTBA 4ND3A 1UZMA 3P19A 4XWYA 3H6KA 4CM1A 3NGXA 4UVDA 1U9JA 2WEKA 4WLOA 4EDFA 3F5QA 1XU9A 1WAMA 2E82A 1P0FA 3ZWNA 1E5QA 5JC1A 1ADCA 7MDHA 1LC0A 3U4CA 3E03A 3WB9A 3HDQA 4FGSA 1V0JA 3GAZA 4QFCA 4MIEA 3KYCB 4GLLA 3KV3O 5KJ1A 2NVBA 4A10A 1ENOA 4NU5A 1HF3A 2JFHA 3OIDA 1WNTA 1XCBA 3DOJA 4M1QA 3O4RA 2EW2A 4PZDA 2VYVA 3L77A 2Q45A 3FI9A 5JC8A 4J43A 3ANLA 3OA0A 1WLYA 1ZXBA 4L9RA 3JD1A 4NIMA 5TJHA 4L74A 4DPKA 5DBFA 1QP8A 3RQSA 3UVEA 3ZWCA 3Q3CA 1RM5A 3AU8A 3CZMA 4I5FA 3DMTC 1B16A 1ORRA 2ZYDA 3GVXA 3JYQA 4EGFA 1A5ZA 2VHYA 5CPFA 2FR0A 2ZTMA 1U5AA 5FF9A 1YJQA 1YS4A 5A03A 3VZPA 3WGZA 1LSUA 2Q99A 3HHPA 1DC3A 1P44A 3PYXA 2ZTVA 1NQ5A 2PH5A 4WUVA 4YJGB 3OSUA 1K6XA 3GG9A 1QLHA 3NTOA 3LSYA 1PQPA 3H2ZA 4BNJA 2ZYAA 2V6GA 4QXMA 2V65A 3T4EA 1ZK3A 3DHEA 1V3UA 3Q11A 3EDMA 4JIGA 5DCWA 5JAIA 3ANNA 2HAEA 3RCBA 1QV7A 3OF2A 1NTOA 4B4UA 1DSSG 4BO6A 3D0OA 1EVJA 4FFPA 4BNNA 1JAYA 1J0XO 1B8VA 3A14A 3GNQA 2JKVA 5C7LO 4UEJA 2J3JA 2E6UX 3R3SA 4J49A 1YGYA 2HRZA 3GPDG 1F14A 3WGHA 4OIMA 3CZRA 1U4OA 3WGOA 4M89A 1R6DA 4YJGA 3F47A 3S2IA 4RVFA 5EIOA 3AY7A 2POQX 2O3JA 1SOVA 5K6AA 1U4SA 4W82A 4CLHA 1FDUA 2D2IA 1GPJA 1UDAA 3ROMA 2EF1A 4JJFA 4IGFA 4XYLA 2X4GA 3MJEA 2QIOA 4R9SA 3RU7A 3G17A 1YKFA 2AG5A 1B8PA 1UUFA 1ML3A 1C0KA 1QSGA 1UR5A 2YV1A 3F4LA 3I9OA 3IMFA 5JYDA 3K2BA 4DWVA 4LSWA 5L3ZA 4HY3A 1G6KA 3LF2A 1OZAA 3RASA 3VZSA 2WD8A 5A9SA 5A05A 3HE3A 2FHSA 2G17A 4Y8VA 4BV8A 1ENYA 1SNYA 2JCXA 2Q49A 4KTVE 3NT2A 4QO8A 1T26A 4RF3A 5JPIA 1ZZEA 4NBUA 4LVUA 3ROKA 3UFXA 1GYRA 1MV8A 2D4AA 2O48X 5G4KB 4YRAA 4OQZA 1HXHA 4Z9XA 5JE8A 2IEDA 1T2EA 4X54A 4J1QA 3QWAA 3IJRA 3ITKA 4FGWA 5EJ2A 2Z95A 3RC9A 3ZW8A 3FNFA 4Z0HO 4XJSA 1I3LA 1NQTA 3KVOA 2VZ9A 1KBZA 1Q7GA 4JX8A 3W8EA 3BZUA 3KTDA 4ROSA 4JJGA 4BNGA 2NADA 2Y0DA 4U5QA 3FCOA 5C37A 4E12A 1V8BA 4LRSB 1HL3A 3EMKA 4QX6A 1CYDA 1U7HA 5JO9A 3E48A 4CV2A 4HUJA 2D5AA 3SXPA 1ADGA 4AJIA 4KWHA 4CMKA 4Q3AA 1Y1PA 2E48A 1JKJA 3AUTA 3B1KA 4O0LA 3L4BA 5TX7A 4CM8B 3KZVA 4EBFA 3SLKA 4TRRA 4RZHA 1VSVA 2W2KA 4C7KA 1AE1A 5COQA 1XHLA 1ZIDA 1SPXA 3DZIA 3MOGA 4H15A 3NAQA 5B4VA 1VC2A 2Y1OA 4J9UE 4I9UA 1BDBA 1HWYA 1A72A 2EKPA 3KOUA 3QA9A 2CF5A 3ZWMA 5CDSA 1KC3A 4Y6PA 5MGBA 5IZCC 5JDCA 1KEVA 1JAXA 5THKA 4YVFA 1FXSA 4QFDA 4WOJA 3C7CB 1O6ZA 1ZK0A 2AE2A 3IC5A 1NNUA 2J5KA 1PZFA 3HFSA 4FPXA 4XIJA 1F8GA 3COSA 1QG6A 3JQFC 4JXKA 3RUAA 3E9QA 1Q2XA 5GMOA 3HNPA 1GUFA 4OGWA 4A73A 2GPTA 2AW5A 1GUZA 1JTVA 1PU2A 3OMLA 3FR8A 3RUHA 1D8AA 4AJNA 2B37A 2JAHA 4Q3DA 1RPNA 3PPIA 4BNZA 5G0UA 2RBEA 1T25A 1ZJZA 1PZHA 3NX4A 2DFVA 4PLWA 4KWIA 3L4SO 1RKXA 3DFZA 4WK6A 3D4OA 3DZGA 5ES3A 1YOVB 4YRDA 4ZQEA 4NBVA 5BNFA 2ZJ0A 1L7DA 3WGYA 1DRUA 2H9IA 1ONOA 2QQ5A 3ZDFA 1UXJA 5EN4A 5ENVA 1GV0A 2EHDA 1E3IA 1GCUA 4YACA 2IXAA 3ENNA 1EBFA 1LDGA 2XAAA 3OJEA 9LDTA 5MDHA 1Z74A 2XF8A 3U0BA 4CMJA 1HE4A 3OJFA 3SC6A 4TWRA 2AQIA 2I3GA 1FDTA 4YJFA 1FDVA 1E7YA 1NFRA 3OHSX 4P38A 5KVSA 4IDDA 3KB6A 3CIFA 4DL9A 3B70A 3GZNA 1NPDA 1R66A 2DU8A 1BG6A 2NU7A 3G79A 2ZCUA 3JD0A 4RL6A 3WDSA 4TVBA 1C0IA 2HSDA 3JYOA 2Q1WA 5L40A 1G1AA 4GMGA 3JYLA 4K6CA 4GI2A 3ETDA 1EK6A 3DMTA 3JQ7B 4QEDA 3WGTA 3R1IA 1ZK4A 5ILGA 4NPCA 3UKOA 5JBIA 5A4DA 1UAGA 5DT9A 4B79A 4W9NC 5G0VA 2NWQA 2ZQYA 5EESA 3DZJA 4ND4A 3AUSA 3RAJA 2O7SA 2VOJA 2FR8A 4JBHA 5K9ZA 4CODB 4D0SA 2RAFA 1F0YA 1YDWA 1I8TA 1E6EA 5EQDA 1P1HA 4IS2A 2R6JA 1ONPA 2JHFA 5IF3A 4HV4A 4E5PA 3PFWO 2BFAA 4XCVA 4FJ2A 4BGUA 3AI1A 4BNLA 4PLZA 4HNHA 2PKRA 3VVBA 5EPOA 3H5NA 3OEWA 4D0RA 2FY8A 3PP8A 4PLPA 4DPMA 1DB3A 1VL6A 2EG9A 1ZO8A 5C7IO 3DTTA 1NQAO 4JK3A 1B26A 4XYBA 2ZTLA 1OAAA 2WYWA 3N74A 1HYEA 1Q7CA 3L9WA 3BHJA 5L7WA 1GYQA 2JFFA 5TC4A 3AM3A 4U7WA 3QE3A 1R16A 4AVYA 2NU9A 5DN9A 1WVGA 1Q0QA 3AOEC 1YONA 3NT4A 2V6MA 3C3XA 1P77A 2DM6A 2CDAA 2HUNA 1SZJG 2VZ8A 1FMCA 1X15A 5FFFA 4EJMA 4PRKA 5TT1A 4ZICA 1X14A 5C3MA 4D79A 4XR9A 2OMEA 1LSSA 2PTGA 1PEDA 4E0BA 4NQZA 1DLJA 2BGLA 1WZEA 3C1TA 4XGKA 4INAA 4WJZA 3AY3A 1VPDA 3KYDB 5IDWA 1DAOA 1E3JA 2AQKA 2X0IA 3WX0A 4OXYA 1R4NA 3DBHB 3U4DA 5CHEA 4CPDA 1N1GA 3DZBA 4QT0A 2QRLA 4YAJA 3EW7A 4ONEA 4DQUA 1BXGA 3AFMA 2O3RA 2PR2A 2WE7A 1QKIA 4YJDA 4YT8A 2YHIB 4UVGA 3MJVA 4M8SA 4TROA 4CLEA 1JVSA 4QUKA 1VKNA 4FJ1A 3RJ9A 1HZZA 4YAKA 3GR6A 5CG2A 3JQBC 2Y93A 3Q2KA 1DJQA 3V1TC 1M75A 2E4AA 5G0WA 2YV3A 4H16A 2G0TA 4F45A 3PDUA 2NVWA 1DRWA 2Q4BA 3JQAB 4E4YA 3KHUA 2NTJA 1Z82A 3DTYA 1HTBA 4EZBA 3GZ4A 4G81A 2AEFA 3WLFA 1ENPA 3EZYA 3GMDA 3GLQA 3S2EA 2GD1O 4K1LA 4TMFA 4HXYA 1PR9A 4N18A 2OHXA 4G65A 4D44A 4JN6B 1B3RA 5CAEA 5CEFA 1NPTO 4GAEA 1OFGA 3DB2A 3FNEA 3BAZA 3HSKA 3VZRA 3UN1A 4J7CA 4Z0PA 1RM0A 5IZCA 3JQCA 3ZHBA 3GFBA 4KZPA 9LDBA 4CM9A 3JYPA 2O2YA 2NQTA 1UH5A 4LCEA 2GUGA 2GZ3A 1U8XX 2V7PA 3QVXA 4LN1A 3NT5A 1ISMA 4WCFC 1ZEJA 1TT7A 4QTZA 1EVZA 2DUUA 4EI2A 1C3VA 1RWBA 3G1TA 4FSHA 3ZWWA 3F3SA 2B36A 2GF2A 3CKYA 3RSHA 4IY1A 3L0DA 4CUKA 8LDHA 2VWQA 3OIFA 1B15A 3HJAA 2Y67A 1AXGA 2XXJA 1VKOA 4HWKA 2DBZA 3WJAA 2YUTA 1U7TA 4AJEA 2Z1MA 1L7EA 4A7PA 1ZSNA 4Z9YA 3OECA 4XR4A 5JLAA 3W1VA 5HTOA 3NUGA 5G4KA 5B37A 4FJ0A 3VZQA 2AE1A 4L4XA 2J5RA 5ITWA 1R0KA 3D1LA 4UEKA 1SBYA 4NFSA 3Q6IA 1H9BA 4WKGA 3TF5A 4BNHA 4R69A 3PWKA 2RIRA 3I4FA 2DBQA 4RPJA 3ROQA 5L45A 1MXHA 1K89A 3I9NA 1HZJA 3PHGA 2VT2A 2Y68A 1LLQA 3BMNB 4IQ0A 1PS8A 1QXSA 3OQ6A 3EHEA 3SBOA 1Y8QA 3VC7A 2EJVA 4OJNA 2X6TA 3AM5A 4FDAA 1GZ6A 3E8XA 4J6FA 1PQWA 2FPPA 3RJ5A 4Q3NA 4WEQA 2DUWA 2ZQZA 1HDXA 4J16A 4FOOA 4E21A 1E3LA 3H7AA 3EVNA 3BTUA 4HNGA 2Q2VA 4IXTA 4OL9A 1N7GA 5A1TA 1QR6A 1PTJA 4CR6A 1Q0LA 1A9ZA 4BO8A 2HJSA 2WMDA 1EVIA 4OSPA 1PS0A 1C0PA 3VKUA 3ZWVA 3B1JA 4MVJE 4KQXA 2VQ3A 1RYDA 1C1DB 2OBNA 3FSRA 3TZ6A 2YHIA 1GU7A 2C5AA 4GLOA 1UXIA 1IZ0A 4WOKA 2QRKA 5CEJA 1PGJA 4J9VA 3M1LA 1VE9A 5TJ9A 5I7SA 3H9GA 1J49A 5ENDA 3FPCA 3GDFA 4J2HA 3PDJA 2X58A 2B5VA 4W6ZA 2C20A 4RF2A 1BDMA 3OH8A 4FCCA 4A0SA 4BMSA 1C1XB 1K2WA 3GNSA 4YJHB 1IPEA 1P1RA 5I8ZA 2W2LD 3WQRA 1OC4A 3FN4A 2Y66A 1MLDA 4BGVA 1JDJA 3K6JA 3I6QA 2C2XA 3FBTA 3Q9UA 2R00A 4R3WA 3W4IA 4YXFA 1YVEI 4PFJA 4XA8A 2VCYA 3PJGA 3EY4A 3WGQA 1GQYA 3GRPA 4MP8A 5JAZA 1PJLA 1A4IA 2JHGA 2WYUA 3FWNA 1B3BA 3AW9A 1SCUA 1XG5A 2I99A 3GAFA 2P91A 1E6UA 5JDIA 3E82A 1PGNA 1H6CA 4BKOA 1NVGA 1PGOA 4A2CA 4U0KA 1I3NA 1BSVA 4JBIA 1QV6A 3AUAA 2IXBA 4J7UA 2WJPA 3A06A 4J91A 1H0KA 3TWOA 1EFKA 2WSBA 2Q1SA 2CMDA 4ZJUA 3BMOB 4E2WA 3DZFA 4FBGA 5DOZA 4M54A 3CINA 4E2ZA 3WQSB 3DQPA 3ZV3A 4DTIA 3K92A 2O4UX 1GAEO 2OOSA 2YFHA 2HK8A 1WWKA 1HKUA 1WDMA 1MC5A 2I66A 2IEBA 4XD2A 1VI2A 2Q2WA 3GC6A 1EUDA 5DP2A 3PGXA 3DOCA 4CLOA 1ZH8A 1E7QA 2NTNA 1GR0A 1LDBA 4E5NA 4D7AA 5BNIA 1UDBA 5L7YA 3V2GA 3N58A 2WD7B 2GRAA 3D5QA 3ICCA 3DR3A 4BQPA 4BVAA 1MFPA 3ZU2A 5HA5A 4R16A 1ZMTA 4QQRA 2O2SA 3E6AA 2OUIA 2Q1TA 2DTEA 3JSAA 2CY0A 4BO2A 3IKVA 2C0CA 3HDJA 5CDUA 1H2HA 3KEQA 1EEHA 1QMGA 5DF1A 1LRKA 3UCXA 3MJTA 3WGGA 1KERA 1T2AA 4D3FA 3OJ0A 4G2NA 4KUEA 4YB8A 5AYVA 4NZ9A 4PLYA 5T6BA 1JWAB 2A9FA 1LTHR 4PLTA 1I2CA 3D7LA 1HSOA 3GMSA 1HSZA 4FQ8A 2BFMA 4E5MA 3PZBA 3QV1A 4AJPA 2O7QA 2Q4EA 3PQFA 2XXBA 1BWSA 5T8KC 1MP0A 2P5YA 2GN4A 5ILOA 4IIUA 3VH4A 3GA0A 1YQGA 2YQ4A 4BMNA 1YL5A 5B12A 1C1XA 1P33A 4YR9A 2D3TA 4XQCA 4GVXA 4MVJH 4J3FA 5C5IA 4NBWA 1KYQA 1E1KA 2VUTA 1N9GB 3HFGA 3CEAA 5HWSA 3HDYA 3E9NA 1P0CA 2EXXA 3QHAA 1BVRA 4RO0A 4EUEA 3D3WB 3WYCA 3IP1A 2O3UA 3RIHA 2BF7A 3GT0A 3DMYA 5F1KA 1CWUA 1U3UA 1KVSA 5EERA 2GN8A 4LMPA 2PWZA 1YBMA 5A5FA 3PFFA 3PTZA 3V2HA 1IB6A 2EIHA 4IUYA 5IN5A 3WWZA 4XZ3A 3H3FA 3ZWXA 5DOVA 4EW6A 4A03A 1Y5MA 3TZHA 4EJ6A 1ZSVA 2PA3A 4W9NA 3T4XA 3LVFO 3JQAA 5IZ4A 4FS3A 3V1UA 4YAGA 2YJZA 2HMUA 3E5MA 1XYGA 4DLBA 2VHXA 4CLDA 3DL2A 2D5CA 3R6DA 1R0SA 5A04A 4JQCA 4YA6A 1WDLA 2OORA 1Y8RB 3WG9A 4DLAA 3DAPA 3OA2A 2YDYA 3PXXA 2I65A 5H82A 5JW6A 3DHYA 3H5RA 4FFNA 4GBJA 5KKCA 4CMHA 4PCVA 4CQLB 4MKRA 1O95A 2X0NA 3FD8A 3G49A 2OFPA 5CDTA 3PGJA 3QY9A 4JLWA 3RBZA 1Y9EA 5GZ1A 3OM9A 4PG8A 1PQUA 2Y1GA 3MEQA 2X8LA 2P5UA 4TVOA 4H7PA 1YWGO 4GX0A 1VRWA 1I2BA 3U62A 3GEGA 3LYLA 3H3JA 4I5DA 1ZEMA 3LZ6A 3LC1O 4YDRA 4FFRA 1NAHA 5F3RA 2DPHA 3PEFA 4YEDA 1OMOA 3K2EA 2GLXA 5IXYA 3JQGB 3WXBA 4DIOA 1LSJA 4BS9A 1MXFA 5CFZA 1NQOA 1WW8A 2HK9A 5BR7A 2DTXA 1ADFA 2YFQA 1S7CA 1IHXA 3DOOA 3GQVA 2HKIA 5IG2A 2GN6A 4MINA 1JKFA 2A4KA 2BLLA 2Y1DA 5L51A 1X1EA 4Q39A 3VTZA 2C82A 2C54A 3JQ9A 2VNSA 3BYZA 3A28A 1TT5B 2VN8A 3TL2A 1Z6ZA 3DXFA 1U8FO 2EEZA 5KJCA 3E18A 3VPSA 2J3KA 2H5LA 2NV6A 3BXXA 3IOYA 1KEUA 2WD7A 3F1KA 2BI8A 2VT3A 4N5NA 1J4AA 4OOFA 1NASA 4WASA 4YT2A 2XPCA 4J4BA 3W8DA 5F1OA 1BVUA 4EEZA 2EKQA 4ZVVA 1YL7A 1E77A 3D5TA 3WICA 5DULA 2I76A 3WFJA 5KJEA 3U3XA 4GKBA 5JCXA 3RBVA 3INGA 3TJRA 3ZNQA 5JAMA 3NKLA 1CRWG 3JQBA 3WTCA 1NM5A 1E1NA 1HYHA 4U0JA 3GFGA 4FFMA 1YH3A 4B8ZA 3EK2A 1IE3A 2I6TA 2CVOA 5A9SB 1D4FA 3HWRA 3KM0A 1PR3A 1NFFA 2VWPA 3Q1LA 2HMWA 3HB4X 1DDOA 3BMOA 3OQ1A 3ST7A 3ASUA 4P4GA 7ADHA 2FZEA 3RD5A 1ZNQO 2PH3A 1B2LA 2YZ7A 4TRJA 1Y81A 3VKVA 1HDYA 3DWFA 2Z1NA 4KDFA 1WP4A 2IDZA 2QYSA 4ZGWA 1H6BA 2AXQA 4ZU3A 5JCJA 4RPHA 2EGHA 4OOEA 2UUPA 1PSDA 4KOAA 1UAYA 2OO5A 3HB5X 2UDPA 1DXYA 4H3VA 1CEQA 2EP7A 4PN3A 1M6WA 4Y6SA 4GGOA 1XA0A 1M76A 4BNWA 4PG5A 2YQ5A 1UZLA 1A9YA 4OXKA 2J3HA 3BMCB 3NYWA 3L07A 1IZ9A 1BXZA 2Q3EA 4J1NA 1HDOA 2HK7A 1K0UA 2VTDA 4CLRB 1PGQA 4DUPA 4JP3A 1CERA 3KUXA 4BNYA 2WE8A 3ITDA 2JL1A 4FW8A 2EKLA 1KVRA 4XX0A 4C4OA 3BHIA 1DIHA 1HDRA 2IZ0A 4O63O 4UUNA 4CMIA 3PVZA 3P5SA 3CSDA 4RLSA 5JCJD 1G0NA 5F1PA 2Y0EA 2GCGA 1YBVA 4PIVA 1LDMA 4UREA 1NHGA 3JQDA 3K73O 3ONDA 2VTEA 2WYVA 3GEMA 4XGIA 1BGVA 1Z45A 1VLLA 3BA1A 2A35A 4ALKA 4ZRNA 2YDXA 2PKQO 2YY7A 4L0QA 2BHLA 3W4KA 4NK4A 3ZWPA 4BNKA 5KIAA 4D46A 4CM5A 1B8UA 4RPKA 2JD0A 3RUCA 4PVCA 1YB4A 4HFMA 3L9XA 2BD0A 4KMSA 3GGPA 2X9VA 3U09A 1SMKA 3M6IA 1BW9A 5F5NA 3RVDA 4PLVA 1YB5A 2W4QA 5U1PA 3GY0A 3JQGA 1XLTA 4KDEA 3C24A 4E31A 3F9IA 1SB8A 3DFUA 5AXBA 2ZYGA 5A5EA 1HRDA 3U49A 4BUCA 2X9GA 1XKQA 4OSOA 4U6SA 1TLTA 5A02A 5HM8A 4WCDA 4BIIA 2IZ1A 5B4TA 1N1EA 5K6AC 1GQQA 3D3WA 4XB1A 3IDSA 2ZB7A 4XGNA 2HRBA 3LK7A 3PLRA 1FDWA 3JQ7A 5COAA 2PZLA 4M49A 1O94A 2VOEA 1NBOA 3BTSA 3NTQA 3JD2A 4BO3A 4DGSA 4ZQHA 2BH9A 4GKVA 3K31A 4J4TA 4PRLA 4R41A 4OMUA 4R1SA 1LLDA 3ZW9A 1AHIA 4FFOA 1KEWA 2NU8A 1MA0A 4RVUA 4IDEA 4E5KA 2UVDA 2VYVD 3GDGA 1R0LA 2RCYA 3WIDA 3W6UA 3ZWBA 1YJ8A 1U2DA 1ENZA 1PL6A 2W8ZA 3VH2A 4PVDA 2W98A 1JU9A 2B69A 4JJIA 1TEHA 2GDZA 4RDHA 2DAPA 2R00C 4DBZA 3Q9NA 3TQHA 5T57A 5TSDA 1DC5A 5L53A 1J6UA 2DC1A 3GHHA 3D3EA 3GEDA 1G0OA 2HU2A 3OJOA 1LU9A 1IYZA 2B35A 2Z5LA 2X0JA 5JFOA 1ULSA 3IUPA 3TOXA 1DAPA 2IYOA 2Y1FA 1N8KA 5EQFA 4I9NA 3DBLA 4CL8A 3GVPA 1EZ4A 1JN0A 4DYVA 3S2GA 4BO0A 4XQ9A 4NJMA 2A92A 2RHRA 2CFCA 3VAZA 5TLSA 4CMEC 3TZCA 4AFNA 4G5HA 1HE3A 5JO0A 3AOGA 4MPDA 1U1IA 5FYDA 5L4LA 4I8XA 1KOLA 2P9EA 3FTNA 4IINA 3NTRA 4UVHA 5DNAA 1ZUD1 2DVMA 3TL3A 3WOHA 2YW9A 1ZK1A 2V6FA 1E1LA 3JV7A 1PWZA 3VDQA 4RJTA 2IZZA 4BB6A 4YWJA 2UAGA 4OYRA 4XDYA 5KOIA 1ZSYA 2C29D 1E3WA 1KY4A 4II2A 3PI7A 1XEAA 4BO9A 1ZJYA
chains in the Genus database with same CATH superfamily
2P5TB 2H8KA 2XTNA 2IU4A 5LCXA 4CIAA 3IEMA 3UB2A 4AIIA 3N6VA 1R6BX 4I4TF 5CXXA 1TZJA 5FA6A 4D6PA 4GZ5A 4YMUA 4A36A 1FYXA 2ZPTX 4IG9A 1SWWA 2P3SA 2GO1A 4RA6A 3VPAA 4BFCA 1E4EA 3WA7A 1E2LA 2OXRA 5LLTA 3EXHA 3PUKA 3PQ8A 1E6KA 5GJWC 4BQOA 5GADl 4DVGA 3H1TA 5B5SA 2DHQA 2WA2A 1AKUA 3PUIA 3TUJC 3EQ2A 4J0HA 4WNYA 5CVUA 1UEIA 1WHSA 2YCLA 1IY8A 4A4DA 5KWIA 1IUPA 2R751 2OXIA 1RWWA 4J2OA 4D4MA 4DCGA 1RP7A 1JDBC 3WWOA 2YOHA 5HE8A 3BJZA 1FLAA 3GGDA 4EG8A 2YC4C 5JI3E 3EZ9A 1UJBA 4IXWA 2CXNA 4ICIA 4CN8A 3HUUA 2B3TB 1MGTA 3CNBA 3I5XA 3D8RA 3EVTA 1I3MA 4N7RA 1FUKA 4IQFA 4Q19A 1LEHA 2DPGA 3ABSB 1VJGA 3TLYA 2EW8A 4CQMA 4M55A 4ZOLB 3L8HA 2VRNA 3HEAA 3MC1A 1OA0A 2CDCA 1YHZA 4X97A 4LKOA 2AZMA 1WV0A 3O9ZA 2G6TA 3SNHA 4R2RA 2JPAA 3FUUA 4HTGA 4N6GA 4GUDA 4QFMA 4AJOA 3OO1A 4GEQB 4LTMA 5B4UA 4FE7A 2LDBA 1A8IA 4BAGA 3FM9A 5IASA 5CXUA 3AF3A 3QW2A 1GZ4A 4PWYA 3OEHD 1P0QA 1S6YA 1ECJA 1RWKA 4X60A 5TPWA 1U0TA 4WBNA 5FPPA 4E3ZA 3FMOB 3ONEA 2RK3A 3PCTA 1M0EA 1QK4A 3IRVA 4PX3A 5A0VA 1YQXA 4X1YB 1M34B 3K20A 1YFLA 2YRMA 3FLEA 3LMKA 4I1OA 2ZSJA 1GTJ1 5ICEA 4WL0A 1PJBA 3KXDA 4FOSA 5B30A 3NU1A 1A5AB 2D9HA 1K3TA 2BRUC 2DYKA 2WMYA 3DL7A 4H08A 4JLSA 5A0FA 1QTQA 5JADA 3Q0EA 4RV4A 2DERA 1T5LA 3AU9A 3AGPA 4FFWA 3ZK9A 2VPPA 3F7TA 4BN4A 1C8BA 1SVLA 4ZQIA 3QOYA 5JDIC 1EUZA 2ZK7A 3NM4A 4QRHA 2NP6A 1RLJA 1E1YA 1LKZA 3UOGA 3CR7A 2VK1A 5DT2A 3JQ9C 1PJCA 3QE9Y 2JIZD 1Z5ZA 4RIIA 1XDSA 3UCFA 4BP8A 3QVSA 3GBSA 1ISJA 1EK2A 4W7IA 5GONA 1TT5A 4TTRA 4DXHA 5I4KA 1BOFA 3DLBA 4LOHA 3UW3A 1Z83A 2KWIA 4K9LA 4BBPA 4RDIA 2R3SA 3NP9A 4H2DA 2DKNA 2V3CC 4HWSA 3NASA 3AV3A 3Q40A 4LRXA 3V4OA 3CB4A 4AS3A 4DANA 2HJHA 3NBMA 1QRAA 5FULA 2DWQA 1PD0A 1Q1NA 3NONA 3AUUA 4D45A 3TZKA 4ZYEA 3TI7A 3N59A 5IN4A 3ZZ1A 3WQQA 1TCCA 3GL9A 1JDNA 3QSGA 3I9LA 2XCRB 2NLOA 1S02A 1A9QA 1YQUA 3GFVA 1JSLA 1J0EA 2EMXA 1CQPA 1JU3A 2ODNA 3AXTA 1YCDA 2CFSA 2PY6A 4UPVA 5REQB 1W4BA 4LF8B 1G38A 3JWGA 4MS1B 1O4WA 3TE7A 4B45A 2ZTUA 3G5MA 3CNOA 1V8PA 2P2ZA 4B7ZA 1FPQA 2CJYA 1EUQA 4X6YA 1CNFA 1GU1A 1UBHS 3GLVA 2BZSA 4LZWA 4S2UA 2CLHB 3RIXA 3TLAA 1MCZA 5DI9A 2BE7A 2WTBA 4F9AB 2Z2KA 3RSOA 3D7KA 4JELA 2WYHA 3CRZA 3RVSA 4E33A 5JMWA 4I4LA 1GQ2A 2Z30A 1F8XA 2ZJZA 5LQJA 4B75A 2YVAA 2JXPA 3K53A 3LYUA 1K86A 3UQZA 1BEZA 1FQWA 1RYZA 3EF1A 3F5SA 1XKTA 2QTBA 3HDHA 1F7UA 1S9HA 2CFOA 2WKSA 3OKAA 4CMCA 3OKPA 4UFPA 1ISGA 1P1FA 2OKCA 4ZKDA 2W0SA 4ESVA 4DV0B 1HOTA 4HL6A 5AO9A 1WABA 4XI9A 1PR4A 2OXFA 1R6AA 3ZU5A 4B6QA 4YNBA 5GPBA 1YVDA 5IC5A 2L6MA 5EFOA 1T9KA 1D9XA 3A32A 3EGDA 2QGFA 4UCWA 4UZEA 1GDTA 3OT1A 3Q7QA 1YU9A 5B7QA 2FETA 1YC2A 3RYFB 3Q5GA 3WFZA 5KWJA 1EXDA 2DUNA 3CUEF 1Z7EA 1RRKA 4EPYA 1UOOA 5LPNA 1GOTA 5F7JA 2ASVA 2CVZA 2QRUA 2Z2ZA 1UXGA 2GJAA 2QTMA 4BMJA 2A1UB 1Y33E 4G09A 4PBTA 3A4LA 1CJUC 2SCUA 2J07A 4DUGA 4CF6A 5DRYA 1W87A 2V7TA 4J3NA 2V3VA 1G8PA 4WLVA 3KSDO 4YRJA 4Y67A 1R00A 1NVMB 4WA7A 4B6SA 5U9CA 3IVMA 3KZKA 2ST1A 1JXOA 2RGAA 3ND5A 4Q1EA 3VH1A 3O38A 5KI6A 1FK8A 5TRTA 5G0TA 1FYFA 4WZAB 4BEBA 2YN4A 1X1SA 3KHKA 1J7KA 1GFZA 2PBLA 2XYPA 3OQBA 1TTHA 3VZDA 1MB4A 3RU3A 4RTRA 1T5OA 4HX2A 4N01A 1QKJA 1NQWA 1Z35A 4FCWA 1WSAA 3G23A 1NMSA 4J6EA 4J0DA 1GT6A 4KXYA 5ICFA 2G72A 4ZODA 4D42A 4UBJA 1P31A 2FPLA 4O5OA 3L4JA 2PJUA 1NRXA 4POAA 1L1FA 3WS7A 3JWIA 4AYWA 1PL0A 3ZBTA 4DDVA 1VL2A 1M1NA 1X1DA 4NXME 3NDIA 3H09A 3O83A 1P5FA 1V8ZA 4R71A 2GXSA 5CDYA 4ND2A 1ITZA 6LDHA 4S0XA 5AJHA 1UEXC 2OZLA 4A2QA 4Z0TA 2QZ9A 4UDYX 2PT6A 4A3SA 3VSDA 1ZK2A 5TQJA 1BE1A 1USGA 2HCFA 5JYCA 4DR3B 1EG2A 4B3RE 2BFCB 3B2EA 3IIMA 1V41E 4ITRC 1DAIA 1ORIA 4FB5A 3C85A 4KX3A 4RCZA 1G20E 5EA2A 1HK7A 3Q3GE 1XPOA 2BJVA 2VTKA 2WV9A 2LZ0A 3RAFC 3ILYA 4D9EA 1OWPA 2PG3A 5TF4A 1GM5A 4NSNA 2V7QD 3C3KA 3LL4A 4I55B 3SICE 3FMFA 1Z73A 4ZYYA 3IDQA 5KJFA 2R5WA 4JENA 1FP6A 4MUYA 3R8FA 1CU1A 1HQKA 2VUSA 3DE0X 1OYYA 4U7GA 1HFEL 1FA9A 2X41A 2WF5A 4QPDA 4N8SA 3EXHB 1Y7HA 1JEQA 2HDWA 3UPDA 5C8VA 1QPBA 1ZQ1A 4D98A 2VHWA 3STWA 1H6AA 2YHUA 4AD8A 1FF9A 5C8YB 2O8FB 2XDWA 2Z2JA 5DTIA 3OPVA 4DKJA 1C7RA 3G2QA 1NI5A 1D7AA 1TO1E 3ZPXA 2FMIA 5K0EA 4DV5E 5SICE 3UMVA 1O3YA 1X7WB 1D2NA 1P9WA 1SBCA 1Z47A 2PL1A 3BA6A 3EUWA 3JARB 4MR7B 3V1YA 2VRWA 4GPEA 4BFYA 1N8NA 5BXYA 2QTVA 2XOKA 5SZKB 1YMQA 3GRVA 5GAJA 1WLSA 3ZDYB 3N2ZB 2ZUUA 2GK4A 3DNFA 3SXJA 4BV9A 4JVSB 3R7AA 1XMQB 3D1VA 5ICMA 4LBYA 4MI3A 2QD5A 2RG7A 3DCJA 2PKQP 2VYFA 2WKRA 3HR8A 1UT8A 3LC0A 3L7AA 3IEUA 4GYKA 5LB2A 2NVUA 1JZQA 1P45A 1SCQA 3PGLA 2ZS8A 3B2QA 5C5EA 2Q2NA 1WDKA 3UWSA 2JFZA 3LGXA 3OFVA 1WP9A 3BTOA 4J94A 2IX9A 1ABFA 3AERA 5KOHA 1WDTA 4CTJA 3ZX5A 3EY9A 2FN3A 1ODTC 1ID1A 1NXSA 2ETVA 3L6OO 4PXAA 4PZ0A 2X4IA 4S1VA 2VZ0A 1N5IA 5EQTA 4E3WA 4JLOA 3U7QB 3LU1A 3FHOA 3R7DA 4KR2A 5FI3A 4RGVA 4GR4A 3ZGZA 4OREX 1O9BA 4FFLA 1SD1A 5AUQA 3D43A 3N75A 1IQPA 4OHKA 1EA7A 5ALLA 3OHPA 2R1TB 3PDWA 4YAEA 1MEYC 1T1SA 2QV0A 4GPIB 3AZOA 2WMOB 2OCGA 2AD1A 3L0CA 3W79A 5FUQA 1QU3A 4LNAA 5DWVA 2NU7B 1EFDN 1VE6A 4WECA 3LYHA 2EFHB 3ESYA 4WSOA 4WVFA 4Z3OA 4HH0A 5ADVA 3M6UA 3L05A 3KAQA 1AKTA 2R8ZA 5BUQA 4Q4JB 3ER6A 3KELA 5E2BA 5FOXA 3KJEA 3LJKA 1T2FA 4IJWA 2YYAA 4O4LF 5C2JB 3E1GA 1GZDA 1N92A 3QQPA 2NABA 4XIYA 3H04A 1U28A 2F8MA 2VRCD 3OWHA 3W34A 4RENA 3G3EA 3K5PA 1C3EA 3QYAA 5AK0A 4EH1A 3OT4A 1R9NA 1KDTA 5DTMA 1QU2A 5J2TA 4CEJB 4UEWA 2RAVA 3MJSA 4HBGA 3TIVA 2LTRA 4QBHA 4RVOA 5CJPA 2RKBA 4MK4A 3VI4B 4ARZB 4JL6A 3JZFA 1UBFA 4ZREA 3MD0A 4A0QA 4HNSA 4KDFA 2P2GA 4M21A 5IBQA 4BMZA 1SHKA 4HTFA 3S2YA 3EVZA 4FWIB 4JVMA 1CE8A 4HRYA 3V3TA 2Z8YM 1CQJA 3VPXA 1E1CB 3PHLA 5JSYA 5JVDB 3WLEA 4D2IA 2YRWA 1W4AA 1RKQA 3CSSA 2PCJA 3Q3HA 3H5IA 1Z6PA 1E7RA 3LW7A 1Z6AA 1FZQA 1JH8A 4G3XA 5HS4A 4YCNA 1F38A 1JLLA 3AI3A 2FP4A 2VF4X 4GIBA 1EWTA 1GUYA 1TQDA 1GRNA 2MYNA 1YVRA 1Q57A 2HMSA 3VU9A 1Y8RA 4PTZA 4KRFA 1PG0A 2YZKA 2CVPA 2OGWA 1R4MA 1UZNA 2V58A 3DDCA 1FP1D 1HMYA 2FJ0A 2JCVA 2R47A 3VR3A 2ZUVA 1PRYA 4KBYA 2UXBB 1II8B 2IOYA 2QB5A 3O9MA 4QGAA 1R0RE 2FP3A 4YRCA 1XZNA 4NZNA 2QYTA 2FGKA 3STHA 5K5EA 4QL3A 4XCQA 1V95A 1Y1TA 3QP9A 1KFEB 2X8WA 4D0GA 4NI5A 2C7VA 3OEEA 2Z98A 3K5HA 4Q3EA 2RGRA 2F48A 4C4RA 4EG6A 1Z6XA 3V7NA 1NDQA 2J9RA 2CUZA 5KWVA 4N41A 1PKPA 5H9WA 3NBYC 3ANSA 4NMHA 3NORA 3W3ZB 2F59A 1NT2A 2FCRA 3QXHA 3L8ZA 4OXIA 4B2YA 4CV0A 3IVAA 5F2NA 4IJKA 1XZMA 4OGFA 1B0PA 3SR4A 3HZZA 1SXJC 2JH9A 4LF6E 3JVEA 4TS9A 1ZN8A 4DKXA 2IUEA 1J2RA 3TDKA 2CK3D 1E0DA 3IQEA 4QLAA 3LDFA 2VT7A 1DBPA 3DPSA 13PKA 3GRRA 4TSKA 3GHYA 3JAKB 1CV2A 4ZARA 3RV3A 3VTAA 2BGWA 2HBRA 4P3KA 4YMLA 1DIOB 1TU0A 1TZ2A 2E1RA 2EARA 3FSGD 3TMYA 1O8BA 2P78A 1NNSA 4LC9A 3DBHA 1WSBA 4DV4E 3OZ7A 3RLIA 2QT0A 3Q3EA 3UICA 4K86A 5DLQC 1LS1A 1BRMA 2JATA 4GVLA 4CMAA 5IC4A 1ZIOA 1YGPA 4H4DA 2ID7A 3VR5H 3SIXA 4IMPA 4BCCA 4DZZA 4Z4CA 1PHPA 1VL8A 1UJCA 1YC5A 2PA0A 3D6VA 2F1IA 4FGLA 4LXYA 1JPUA 3SR0A 3W7AA 2W93A 1YJBA 2C2OA 4GW3A 1XGKA 4CIVA 2EATA 4J7XA 5HQTA 3ZNPA 1I3KA 3VO2A 4WPGA 3T3GA 3C4JA 4EITA 2PZ8A 3D4IA 4FTWA 4WVLA 3WO1A 2QEQA 1E96A 4DWJA 4IVQA 5ECYA 4P4LA 1AM4D 4XEHA 4N6OA 3BBLA 3R9XA 3BSYA 3SVLA 1L5FA 1U7DA 3ANXA 1PNOA 3BE4A 3JASB 3OZIA 2AMVA 1CY4A 1XV5A 3BBPA 4R5HA 1E2JA 3VNUA 1ISPA 1H9AA 1HLPA 1XMSA 1X6EA 2ZJ1A 1ESZA 2CSUA 2CZCA 2BFOA 3QE2A 3RBXA 3ZY3A 1EP3B 1FQOA 2O50A 3VH3A 2JY9A 1N2CE 3JQ8B 1BXKA 2FQXA 4IMRA 5ESXA 1RWXA 1ZVVA 1KZHA 2W48A 3ROEA 2QVBA 5GGYA 4E2YA 1EK1A 1JE0A 3ICOA 4U9IS 1A2KC 3LI2A 2O8BB 5HZMA 3BF8A 1WETA 1FZTA 4HXEB 2IODA 3V8EA 1GILA 5KB3A 2OCKA 3A6GA 4PYQA 1ECFA 1LRLA 1Y9ZA 5EJ7A 2HHLA 2P41A 1KRXA 4DYDA 2ZIZA 3W8RA 4MKFA 4ZWNA 1CB0A 2DHCA 3LWDA 4G9GA 4R2IA 4D9MA 2XBUA 2PD4A 3L1JA 3HY6A 2WT4A 2I91A 4ZVOA 1VQ1A 3FYDA 3O4HA 3HDTA 4KPFC 2CT8A 2B61A 1W49A 4X1IA 4Y1GA 4ID3A 3UJ7A 4C1BA 2WJGA 1EKXA 1AKRA 2FR1A 4E2XA 2C88A 3FHCB 3PJEA 5DHUA 5ENZA 4EABA 2QTVB 1OFIA 1Q2UA 2J6CA 1DXQA 3GT4A 3HP4A 3MM4A 4FYXA 5I4CA 3PZRA 3RGGA 3K0CC 2Z4RA 5HF5A 4A6EA 3NFYA 1KK2A 5I7WA 5SZIA 4COOA 1ZAAC 4MQ4A 1V35A 2JKYA 2BSAA 1GGMA 4GP7A 5GZ3A 4E30A 4O59O 3GP5A 1I9GA 1G6Q1 2ZI3A 1U3WA 4QEZA 2IHZA 1Q20A 3FFXA 2ELZA 3QK7A 2WM8A 3ACDA 1QHIA 4KO4S 4BCBA 2IP4A 2DMIA 3A9WA 2FN7A 2AR7A 3BD9A 3JPWA 4PZEA 4TWZA 4WZBE 4PIMA 1WEHA 3EAQA 3AP3A 1YQ9A 2O3QA 4EJ0A 3EASA 4JNKA 5CR9A 5JMPA 1K75A 5FNVF 2OG1A 1F5SA 3TZEA 1FYWA 3LCCA 1EUCA 2O54A 1UPAA 2YWHA 1KJWA 1STUA 1A2QA 2I71A 1R8XA 3G9ZA 4H9GA 3UUFA 5LMCA 3ZHXA 3ZDAA 3G2LA 3AUZA 2PZEA 2I1LA 5ITVA 5CP8A 1KO8A 5J9FA 3IKJA 5JNUA 3QU5A 2NU6A 4B34A 121PA 3GD5A 1TB4A 1AH2A 4MV7A 2CDBA 4XJTA 1MAUA 2JFUA 4KNWA 3A9CA 5I5EA 1QOPB 1V8DA 5JH7F 2AFIB 3DDNA 1GKKA 3KU1A 4LRUA 2D1YA 2QT9A 3FPJA 1ISFA 3GLUA 4TS1A 4IO0A 2QJWA 1YQEA 5GZ6A 1XRRA 4DMGA 2CYAA 4QBGB 2W43A 3S1AB 5EFZA 3LLSA 4P4TA 2AHRA 1YACA 3L00A 1C14A 1C4KA 1BHSA 1N75A 4RA6B 3GGGA 4PG4A 5FOUA 1OGJA 4DCOA 4C76A 2J8ZA 2WVJA 4FXPA 4OUDB 2LCFA 1NN1A 3AC0A 5J23A 5FBHA 1TMGE 4F21A 2IYLD 1KBQA 3HPSA 3DJWA 4BVHA 2YINC 4ZOLA 5IDYA 5TT0A 5KYVA 3FYCA 4OHPA 5BOVA 3TJMA 3ZV4A 2BFBB 3N2YA 2I3AA 4GP6A 4QASA 2WJ6A 3UB4A 4ZYTA 1B0UA 1CUCA 1RWVA 1K08A 1EM8B 1N2ZA 1NL3A 3IUQA 5EIHA 3SC3A 3ANMA 4DIBA 3VU9B 1CIVA 1N6LA 3MBKA 3WGNA 2G82A 3X1WA 4DR2E 1NQXA 3C5HA 4IGEA 1SG6A 1HDGO 2UYYA 2W2MA 4JBGA 4KFCA 5AI0A 4ESOA 4HZIA 2QP3A 4OBBA 3P0HA 5CLHA 5ELMA 4NOJA 4ZYWA 2VP3A 2G08A 2QSJA 1NKTA 4MYDA 2BELA 5AKEA 4YRSA 1GEEA 2IOQA 1ND6A 3BRQA 4MGYR 2R96A 4F4FA 2HY7A 1RABA 4P33A 4ZT6A 3TB4A 4CM7A 4CEHB 2IPLA 3SPXA 4LVCA 3HR4A 1WHQA 4ENVA 2EG5A 1QYWA 2BMFA 5F5LA 1HQCA 2Q2QA 2ZAOA 1DVRA 5FA5A 5BNTA 4TZKA 1XR3A 3IQDB 3PDIB 1XROA 1LUAA 3HL4A 3UB3A 4R54A 1M5RA 2HJRA 1E2FA 2JFOA 1JYSA 4IJUA 3CUTA 1EBUA 3EXIB 1L5HA 5BN4A 2Q5QA 3R44A 1CRLA 3HJNA 2FUKA 1DX4A 3OFNA 1KH1A 2AVDA 3I5MA 4FT2A 4MZXA 4CVNA 1D1TA 5FLKA 3W2GA 2W90A 2ZRKA 3ORYA 2JGRA 1KJKA 3OOYA 4MI9A 4HLCA 4TPKA 4UU0A 1SXHA 1ZOPA 2FEOA 2RGWA 4JA2A 3MAJA 3TR0A 3B1ZA 4JXZA 4PLHA 2HV8A 5FUVA 3LA6A 5IARA 4DIDA 3PEYA 1UBRS 2VC2B 2DPYA 4RFSB 3FPKA 3SKVA 3AETA 3LQ1A 1KJQA 2OECA 3N53A 3PQ2A 1U8EA 2P6RA 4G4SO 1BU5A 4LMBA 3O6VA 1L4MA 2QVGA 3B78A 5F7XA 1SC6A 3SZ3A 3FFBA 4L8FA 4KQMA 3RSLA 2WBTA 5JZBA 4LGYA 1ADBA 4MAAA 1B42A 2FPGA 4NYMQ 1AB5A 5T67A 1YAHA 3G1UA 3C7TA 3LBAA 3N0VA 1LX6A 5ULLA 1CNEA 2OV8A 4GHWA 2D1FA 1E7WA 3DWGA 4MX8A 2CN1A 2C96A 3LGAA 1SR9A 3L43A 1R18A 2ALJA 3QYJA 3OWOA 1R4AA 1D09A 3IOEA 3K35A 4WN9B 1DKNA 2AMFA 2ZUDA 4A1OA 3FZQA 1FX0A 1ZDMA 2VYNA 4KX5A 2XITA 5HZGA 3QKRA 2WB4A 4HMQA 2PD6A 2H08A 3Q3VA 4EUHA 1R9JA 2QW8A 3SU8A 1TNDA 1C2TA 3GK3A 1X19A 4L9WA 5JD6A 3GVIA 3SM3A 4OGKA 5F35A 4F4DA 1G17A 5MN4A 3JALA 1T8UA 1EWYA 2P7HA 2Q4RA 4LRWA 5B6JA 2J30A 2PNFA 5B2ZA 4R68A 2DHRA 4YI3A 5FQNA 1VM6A 4HK4A 5LXTA 5KSPA 5FPHA 1JU4A 1QHEA 4IS3A 3VHXB 4TMZA 3O82A 2CNWA 3KHSA 5I9IA 1HDZA 1RPJA 1Q1GA 2XB6A 4PHHA 2XUZA 3LC7O 2NACA 4GX1A 6CHYA 1R9GA 4PGHA 1Q0PA 4FWTA 1V6SA 2AHOA 3T1YB 2YXNA 5KOJB 1WY5A 2VHCA 4Q7LA 1SD2A 5DVZA 4NJEB 3PKZA 4NJMB 4PXYA 1KAHA 1QHNA 5AH0A 4BRSA 1YE3A 2GLUA 1JUDA 4LZPA 3H1BA 3ETGA 3M70A 1BD3A 2H6EA 4JYBA 4DMRA 3HM9A 1M2EA 1XQ1A 3CX8A 2AMYA 5LMNB 2WUEA 3EDYA 1TC2A 4CM4A 1N9GA 4ND1A 2YZ2A 1M3SA 3Q8MA 3MQ2A 1VSBA 1EDDA 8GPBA 1RWQA 2P9TA 1KKUA 2MYPA 4XJXA 1Z75A 2VNHA 1OYOA 4O3MA 5IC6A 1T2CA 2H0RA 3GLFB 2ZE8A 2JR1A 4LEIA 1LK5A 1U99A 3M2TA 4Q82A 2I2FA 5G4LA 2AOUB 3KWMA 1GP2A 1IVNA 5A6SB 2C7BA 1K6JA 3VC1A 1HFJA 3DOUA 4O24A 1RIFA 3TKYA 4FS8A 1XMIA 3V2UA 3DPIA 2ZETA 4GQAA 2EMKA 2NAPA 3I4CA 4YAOA 1IU9A 1S1MA 2WUWE 4PO3X 3VK6A 1GL3A 5IKPA 4RFVA 5E6UA 4MRAA 3RC2A 4RXUA 1YBAA 1ZWLA 4GBGA 4C7VA 1BBGA 1KFJB 1Z13A 3AF0A 3O4FA 2PZJA 1KARA 2X9NA 4YGXB 3SHFA 4MW4A 3UKJA 5CD1A 1GTRA 1E3MA 4XYGA 1O95C 2JI4A 4TTTS 4F6CA 2C4NA 1RLIA 3EHDA 5EIWA 3T7CA 1NW3A 4X6XA 3HABA 1J97A 4GVPA 4P92A 4R2XA 3SK0A 3GRKA 2ODQA 4FGKA 1LTQA 2JAQA 3CWCA 3DMNA 1I0IA 3NIFB 4E11A 2WUGA 2YR0A 2G1UA 3SS9X 4M7PA 4ENSA 1I94B 1E5XA 3ORRA 1YV9A 3K0BA 2BI4A 2FH5B 2BEVA 5K3AA 4ZHSA 4YV0A 2D7JA 4DUYE 1HEUA 2GYYA 2GBGA 4ZI5A 2GEBA 3PD1A 4FNOA 3VR4D 3VISA 1JHMA 3U4HA 3FBGA 3KEOA 1E9FA 2YW2A 3EQ6A 1XVIA 1Y5IA 3AOEA 4C0AC 5FYQA 5B3KA 1O89A 2WUDA 5FBWB 4EGAA 3IOCA 2EFEB 2O0KA 1M74A 2B1GA 3HO6A 2QL9A 2WHXA 4ZU6X 4NY1A 2D4HA 2VQEB 1P2FA 1G8GA 1M8PA 2PT5A 3L82B 4G63A 5AQ1A 3M49A 3D9QX 3BFJA 5FOWA 3TOVA 5PNTA 1PDWA 4W1QA 1ZN7A 3ON5A 5T8KA 3QWFA 1DCTA 3OHMA 4V3BA 4KYVA 3N2GA 3RJMA 3NDRA 3PFGA 4J29A 5I6DA 2KPOA 3RRJA 1VJ1A 3C3BA 3DW3X 4CF5A 5DV9A 5CDGA 4NMXB 3EZ6A 4HXGA 3U7EB 4CQNA 2GTPA 3L0SA 4YDQA 2VP9A 4MVJD 5FOTA 4PHCA 2PUDA 3P1XA 1SJ9A 2NSDA 2Y1CA 3EGXA 1OB5A 1DHRA 2H7VA 2W2TA 1O5IA 5AW4A 5GJCA 3P26A 5JATA 4X65B 1TFUA 4WY8A 3U5TA 1OYVA 2QG4A 4CL0A 4JLJA 3KXPA 3OX2A 5AHXA 2QE7A 2ZAIA 1R6UA 1Q0ZA 5IYZA 2N3ZA 4KAJA 3SVTA 1A8UA 1KC1A 2Q1XA 1GNVA 1R5JA 1U2PA 1P3Y1 2ZRQA 1FOEB 3NANA 1RXCA 4YMSA 1MAVA 4Z4QA 5B1IA 1K8XB 3A25A 3LIPA 1XTPA 2RS7A 4LWOA 2GJKA 1Z8HA 1U7OA 4YWHA 3TPCA 1FMJA 4BAUA 3CE9A 1I0LA 3RYCB 4JJ6A 1R0CA 3E05A 3DTVB 3QUTA 3AIMA 4B8WA 4BJ3A 1Z56C 1E3SA 1Y80A 3ECAA 3HJHA 4OI2A 5BSFA 5ICSA 1CR1A 1CJVC 1J09A 4UOQA 2CLFB 2AXEA 1J8FA 2I34A 5AW2A 2WM2A 2QTFA 3ADIA 3OBBA 3BL5A 3P2YA 1J07A 3X3HA 1I7LA 1HO3A 4L4UA 3I12A 2GJ9A 2FMHA 1GY8A 2YHAA 3HP1A 3HB9A 4JEUA 3MSWA 4FEAA 1BQ3A 1JK1A 1JA9A 1L4FA 4O29A 2AN4A 2J3IA 4PV7A 1PJ3A 4QXOA 5LOVF 1J0BA 2DLKA 1LJLA 3LSTA 2G06A 2KW5A 3FB4A 5KJ6A 3CVWA 1DDGA 3F98A 3K96A 3JAMA 3H2SA 4UJ3A 3MJRA 4XWGA 2LJHA 3ENZA 1WJGA 3AETB 2V6JA 1X7GA 3K2QA 4GYYA 4Q7JB 3QH4A 2PQ6A 5K0BA 3S4YA 5SYAA 1RXIA 1E9RA 1JX6A 1M5TA 1B6SA 4IZOA 4MJLA 3T8YA 3EEBA 4RSRA 4EAAA 2Z43A 1T1IA 2I9IA 1L4SA 1JJVA 2RGUA 3QKRB 3ZOZA 4KFRA 1Y9AA 3VHRA 4V0OA 3D3JA 3IT3A 3QFCA 4CKEB 2WHEA 5FH9A 1FFAA 3OX3A 3NWOA 4KPYA 2GXAA 3FRJA 4V2UA 3TDMA 1CQJB 5ADZA 2OQRA 1V6AA 3ZDXB 3UC5A 4RL4A 1NZJA 2M1XA 1GDDA 1EZZA 1R0WA 2GZAA 1Q50A 3L5OA 5DCYA 1SUFA 1N2GA 2QXUA 3PG5A 4LZJA 1JR2A 2GM5A 1QBKC 2H7CA 2XQKA 4B4WA 4EF5A 3PQDA 3KR2A 5SY6A 3THYA 2QPTA 1PYOA 3X43A 2QDKA 3DFIA 3FF4A 4JJ8A 4ENRA 2X2EA 4EGCB 1OX4A 4XUEA 3UGKA 5CGQB 2AT1A 2Y1EA 5B1YA 1KVTA 1Z36A 2BKUA 4N0EA 4DRYA 3N5CA 1DC4A 4IPTA 1Q95A 3CKKA 2LP4Y 3GUCA 3M81A 1RC1A 4RGQA 1DS6A 2F00A 2WU4A 4INOA 3SSAA 1U3TA 2QY9A 1DBWA 1DFGA 4ZCQA 4IDCA 1WMDA 4GLBA 1JLLB 3CTPA 4P7GA 1E3EA 2I6GA 2G28A 2O2EA 2Y92A 2WJWA 4WFJA 3TD6A 2CK3A 3AIIA 2W9XA 1DAGA 2G77B 2N1MA 4M30A 2AOTB 3KKEA 4TKUB 4X71A 4HWTA 4PFKA 3PF9A 1U3FA 4QA9A 4R8OA 3L5KA 3FPLA 4TWAA 3VKFA 3V7FA 4CFSA 2CFIA 4BBYA 2PWYA 5FAXA 1C80A 1DIBA 2JAPA 3I0MA 4LF7E 1IHDA 5HK8A 3GDHA 3MQ4A 1ULBA 2GSDA 4XDHA 1MRZA 2BE9A 3K0CA 3M4YA 4PNZA 2NIPA 4R51A 4EYGA 3AKDA 3I64A 3ZOKA 4DIMA 3KLOA 4DOMA 3OLVA 3LDHA 4NBRA 2PLNA 3ZIAD 1C3JA 4AJ1A 4X65E 3QI7A 4EKNB 2R8YA 3QPCA 4YCLA 1GN8A 3LP6A 1RJWA 2DRIA 5IS2A 2BYTA 5AR1A 2EBFX 4O4HB 2D0DA 2B9VA 4PZPA 1D07A 1VDZA 4XDZA 1Q1EA 2IFTA 4NOLA 4NPHA 2C2HA 2EPLX 4M7RA 2X1MA 3F8TA 5K8JB 5CLIA 5DZSA 3ZS8A 2IYVA 4S1TA 3IL2A 5I8WA 1GR1A 2OGUA 3MZ0A 2R6DA 1UMBB 1ZG3A 2B8TA 3LGSA 4FD3A 3W06A 1GEGA 3ZKWB 2HWWA 5I4BA 2Q6KA 3FNIA 4ZT5A 3F4BA 5T5QA 1F17A 1R5NA 3AEKA 4NBTA 2ZUEA 2H85A 2X6QA 4A91A 4Q9HA 2JLSA 3HUEA 1QO0A 3HY4A 5HMMA 3WTBA 4ND3A 1EGHA 1FJ2A 4QQ8A 2IX3A 3H6KA 4CM1A 1L1EA 4F5YA 1J0DA 1U2EA 2FGGA 1U9JA 1V1RA 1W9HA 3F5QA 1AUQA 1Z37A 3LVQE 4URZR 3AILA 3USES 3VM6A 3Q8LA 1OH8A 1FFGA 2E82A 2WZOA 4PCAA 3ZWNA 4KQFA 5JC1A 1J5EB 2HXGA 4OHOA 7MDHA 2A3RA 2J6HA 5DHQA 3UK7A 4UAJA 1ZL0A 5GP1A 1GNQA 2DCMA 1SC9A 4S1WA 2B1JA 4TLEA 4LXIA 2GYWA 3CZ4A 2I6QA 3UC9A 4DARA 2ZOSA 3GAZA 4QFCA 1POXA 3AKEA 3OQIB 1OLSB 3KYCB 1UOQA 1F1BA 2GNPA 4GLLA 4MIEA 3M9XA 4HCJA 4M1QA 3U16A 1X48A 3AXSA 3O4RA 4M3NA 1S8AA 1Z4KA 1SIOA 1XTRA 3GARA 1T5IA 3PGKA 1IY9A 2BGRA 3IBSA 4P7FA 2ZFUA 3ANLA 3CVXA 3EJWA 1IAQA 3I05A 4KG7A 4LIPD 5G53C 1X6HA 1SM4A 3WLPA 1ZXBA 1WPRA 1M33A 1P7YA 4MUNA 2FJUA 3AR4A 5TJHA 4EYQA 4JV5E 2CT1A 3B48A 5A7GA 3UNXA 1N36E 1N2HA 4L74A 3LLHA 3NVDA 1YAJA 3UVEA 1RE1A 2XRYA 3GNLA 3PHBE 3Q3CA 4JLMA 3AU8A 3CZMA 3S5JA 1B16A 2OE2A 3GVXA 4XEUA 1WRJA 1E2HA 4QELA 1A5ZA 2VHYA 2CVHA 2IZ5A 2ZRFA 1U5AA 1UBNA 2ZTMA 3DJYA 3EZ2A 1YS4A 3G82C 4HH3C 4ZOBA 5DMHA 5HCIA 4QOIA 4W5HA 2G25A 3VZPA 3ZIUA 4BATA 4QGSA 1CDDA 1KEEB 2YV4A 1NQ5A 3PYXA 4P81A 5AIBA 1IVSA 2QRHA 4FGUA 1NUQA 1T5TA 1Z8DA 5BR8E 2JGFA 3W5AA 1MEOA 2MT9A 4EB8A 4BNJA 3GUHA 1RHQA 4IUBS 4RTPA 1QUEA 4Q4DA 3W5IA 1JLKA 5BUZA 2JBWA 3DHEA 3F2IA 3AB8A 3UAOA 3EDMA 4JIGA 5DCWA 1H2YA 4R8SA 2A0YA 1W59A 3LFHA 4TQ9A 3ZEAA 4HWGA 3K1JA 1NVVR 3E22B 1NTOA 1QDUA 3L1HA 2R84A 2FOXA 1E8MA 3WGMA 4W9MC 3ZTTA 1JIIA 2HH9A 1OX5A 3D0OA 2EQ3A 2FUG1 3E7FA 1KZ6A 4ZOCA 4BNNA 1NR5A 4MW7A 1V7ZA 3TNDA 3HC7A 4X1IB 3CJRA 1TAHA 1NLMA 4NCIA 4PF1A 1C7QA 1GTVA 3IV9A 1T8PA 5LQKA 2J3JA 3CWZA 2BM1A 3R3SA 4BV3A 4PHGA 4FLMA 1YB2A 1N6PA 1QV9A 3M6AA 5BW6B 2XX3A 5BYBA 3GPDG 4Y7DA 4AM8A 1QPZA 2L3JA 3CZRA 3O7WA 4E70A 3MGCA 1O6BA 1K4KA 3UMSA 1DKLA 1R6DA 2P8JA 3KTAA 3QU4A 4OL0A 3ZUPA 1D04A 4AP9A 5JAPA 4AURA 1Z16A 2NU9B 2O05A 3X1KA 4I81A 4MCAA 5KTYA 4LMAA 3IA7A 2O8NA 1A1HA 1C7JA 2FX2A 3NBXX 3DD1A 3OQVA 2C9ZA 3GYGA 1Z28A 1T0JB 1TCBA 4CLHA 4CKCB 2BCGY 4TX1A 4AJ9A 4FD2A 4GWLA 4WZAA 3MUOA 4DILA 3QNMA 2PWPA 5B58T 1XDDA 2R7LA 3ITNA 4XYLA 1L6IA 2GS9A 2FUNB 3PCRB 5CHYA 3P0FA 2I13A 3L7NA 4JT2A 2QIOA 3FAKA 3RU7A 3RU2A 2FEPA 1YKFA 2DUJA 2XBMA 1QSGA 3NG1A 2YV1A 1UR5A 3CYFA 5K2OA 4GC9A 1G5IA 1MOQA 3RIMA 2A58A 1UN6B 2I2BA 2RK4A 1ANKA 3A6EA 3K8OE 3QG1A 2ZDHA 1FB5A 1G6KA 2R6CA 1FFYA 3KCNA 1RXUA 2FNAA 2PRKA 2FHSA 1FRQA 2ORWA 3IMCA 4X66B 2CLEB 1FY2A 4ENWA 2B9EA 1NDHA 3BWEA 3GA5A 5EKDA 1JBKA 2W6JA 3H97A 4RF3A 1BN6A 4LWZA 1ZZEA 4NBUA 4LVUA 2P8SA 3ROKA 4MTCA 4F04A 1KWGA 2XOEA 5AVYA 1GYRA 1VP3A 3E4DA 1H2WA 2D4AA 4X9XA 1GGEA 4JC4A 4Z1OA 3CLHA 2O48X 1RMTA 1U63A 2VQDA 1IJEA 4ZHQA 2L2QA 1J20A 3NEYA 4GPAA 4YV2A 3CRRA 5A6AA 1RSZA 1E2KA 4G85A 3H11A 2Z1DA 1LF0A 1FJGB 2HK6A 3L84A 5BRJA 2R0QC 1H05A 4RH8A 3QWAA 4H0CA 1NI3A 4Q7KA 2C8JA 5A5DA 1OGIA 1Q91A 5EJ2A 4ERXA 2Z95A 4ENUA 3AUJB 5IAOA 2VG8A 1MTZA 2AOWA 4DDKA 1NQTA 2RHTA 5BY2A 4MQLA 4DBLE 4DQKA 5JVDF 2WSYB 4K9KA 1ABEA 3BZUA 1C8LA 3EMVA 4JJGA 3NC1C 3A2MA 3FCOA 4RX1A 5BMOA 2QRQA 4E12A 3I01M 5C8XA 2EMIA 1MR3F 4LRSB 5KNCH 4XUGB 3NOVA 4NEQA 5C8ZA 2YTNA 3I0ZA 4KN5A 1CYDA 5FPSA 1OASA 4KXNA 5JO9A 3F78A 2L82A 3TCNA 4A23A 2D5AA 3NHJA 3NWJA 4DSZA 4EL5A 4ZDJA 1TAUA 1QC5A 2ZSEA 1HE1C 3TXAA 4F5ZA 4CMKA 2NUFA 2P1ZA 4Q3AA 2E48A 4D8VA 3AUTA 1ZH0A 2AFRA 3B1KA 2VBGA 3D7NA 5DLPA 3TTXA 4EBFA 1NIJA 4CM8B 5BMVB 4GBED 1E2QA 4F4JA 2BT4A 3CLRC 2G1KA 3FRIA 1CF9A 3S1SA 5COQA 5LP6B 3U56A 1UZAA 3MCAA 4KLNA 3DDUA 4X66E 3A10A 4P5DA 5ALKA 4H15A 5AVRA 1A3CA 1PFWA 4WCFB 5B4VA 2VQSA 1I4DD 2JHAA 2X5NA 1BDBA 4I9UA 4NEHB 5K6TA 5E6UB 3L0PA 2A7QA 1TTPB 2WOJA 5CDSA 1QK3A 1O2DA 1RCUA 3N2EA 2PMCA 5THKA 3UG6A 1Q3TA 5EMNA 3LQYA 4ZVNA 5BSWA 5LNK1 1DEOA 1VKZA 1ZK0A 2IIPA 3U7JA 3ONNA 5F2EA 5FCDA 3K1AB 1M72A 1W88B 4FPXA 1K3FA 4QYIB 1D1QA 1EBBA 4UQLA 2IXDA 5E9WA 3RUAA 5LLDA 1XKXA 1F51E 2ZBRA 2XMRA 3PICA 3HNPA 4MUJA 3NMUF 4OGWA 2LTAA 4U9HS 2ZRBA 1DNPA 1TO2E 4ZQFA 5EZYB 3WNDA 2GPTA 621PA 3K0FA 3FOFC 4L6CA 3JU3A 1PTKA 1A1KA 2O7NA 4GRAA 3N2KB 4Y6GB 1UANA 2HF9A 1P6XA 2JAHA 3OE5A 2QJFA 2O0MA 3MTQA 1NATA 4FE3A 5DWQA 3U1BA 3N28A 2B6NA 1T25A 1ZJZA 1PZHA 4BPRA 3ZQJA 4EFDA 5DO9A 5LXTB 1IHPA 4PLWA 3F97A 3L4SO 3QG5A 3UJPA 5ITZA 1A4XA 3LG2A 2UXBE 1KFCB 1YOVB 2EKZA 4FLFA 4RIHA 4WACA 2RC6A 4NBVA 5BNFA 1TN9A 5ERGB 3B1WA 5IJXA 2XLCA 1L7DA 2B20A 4OMFG 5KMGA 3J7AC 4R83A 1RXWA 4JI0B 3ZJ4A 1J00A 3AEQA 3DT6A 4KIFA 3UT5A 4JAVC 4ZPXA 3R5FA 1W36C 4M53A 3SZMA 1XKLA