1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
5IFLA 4PLYA 3TPCA 2VHVA 3WJAA 1Y9AA 4BKUA 1XLTA 5JC8A 3MOGA 3GFBA 1ZKMA 1W73A 3EUWA 4UVDA 3T7EA 3EVTA 4CMEC 9LDBA 5FYDA 5KJ6A 4YB8A 3UKOA 4B3JA 4BQRA 2VRBA 4NH4A 4BO7A 4YRAA 1A9YA 4BNKA 1Z75A 4LVUA 4AJJA 1DSSG 2J5KA 3KUXA 4BOYA 5A9SA 2V7PA 4J7UA 3I9MA 3W1VA 4CLOA 1V6AA 2QHXA 3PJDA 4WCFC 5L7YA 4DQXA 3EW7A 3DHEA 2VOEA 1T4BA 2ZQYA 3JQ7B 2B37A 4H7PA 1PGJA 1FDWA 1G1AA 5IZCA 4J4HA 4RLHA 2QG4A 4CLRA 3PI7A 4MVJP 2JL1A 3IUPA 5KJCA 1GYPA 2CY0A 2VYND 1MFPA 1P33A 4A03A 4WCFB 4GGOA 3ZWOA 4ND4A 5IF3A 1KVSA 2AMFA 3IL2A 1PZHA 1R0KA 3DBRB 3VDQA 2Q2QA 1U2DA 1C0PA 2PNFA 4R4JA 3UHAA 3GUCA 4YAEA 4XYBA 4J2OA 2NWQA 3SBOA 5BR7A 3WSWA 3ZI0A 1F12A 4BNWA 4CM6A 1LQUA 3KO8A 1ISMA 4ZQEA 4BS9A 1GEEA 3GVIA 1J5PA 3BMQB 3KTDA 1HE3A 3PLNA 3PP8A 4RL6A 3ZNPA 3EZLA 1E3EA 2FR1A 2DUUA 3C24A 1PZGA 3VPSA 5ER6A 1NVGA 4AFNA 3ROQA 2Y0CA 4BNFA 2X86A 2TMDA 1D1SA 2I3AA 2G1UA 2YDYA 4L8VA 2EKLA 1P1HA 4O59O 2X7HA 5EQDA 3RJ9A 3I83A 3ONDA 5BSFA 4PLGA 3LC1O 1ZK3A 2QYSA 3MJSA 1X1TA 2J6IA 2WEKA 3HJAA 4XGIA 3IJPA 4XZ3A 2DQ4A 3E82A 2B5WA 4CQLB 3DMYA 4JCOA 2CFCA 4RDIA 2YYYA 4IINA 3F3SA 5DBGA 5L7TA 2ZYGA 4EI2A 3BYZA 4YA6A 1I33A 3VZRA 1GCUA 4HFRA 2RBEA 2VUUA 1YJQA 1DAOA 3ITDA 2ZYAA 1P3DA 3F1KA 4XA8A 3GG9A 4AJ4A 4NU6A 4Z9FA 1F8FA 2PD4A 5JLAA 3JQFC 3BMCA 4DIFA 1K6JA 2YUTA 4JJFA 4P38A 4TMFA 4OSOA 1E7SA 2Q4EA 3JQ8A 3WQSB 1OMOA 1I32A 4JBGA 4NI5A 5IG2A 3AWDA 3GFGA 4W6ZA 3U5TA 3H3JA 2GO1A 2J5QA 5LCXA 3UOGA 3V2HA 1QV6A 5L4NA 3EVNA 4NU5A 2NVUA 4YBZA 1KEPA 1B0AA 5CDGA 2JCYA 2VCYA 3CIFA 3FWNA 3I6QA 4OXKA 4QXMA 4PLFA 4CPDA 3DXFA 1R4NB 4PRLA 1Y8QA 1LU9A 2D4AA 4EUEA 3NV9A 4R1SA 4CM1A 4B7CA 1R0SA 1YS4A 2GZ2A 3GGOA 1LLQA 5EINA 1FK8A 3PIIA 4BV8A 2G0TA 4IMRA 1A4UA 1E0DA 3KV3O 2Q49A 1T4DA 4JJIA 2XPCA 1B15A 4J7XA 4CMAA 1KY5A 4L4SA 4BKOA 2AE1A 1Y1PA 3HSKA 1B2LA 4ZGWA 3OA0A 3GQVA 4TRJA 3TZCA 3GDGA 2J5RA 3WBBA 3BMNA 5T6BA 3ANLA 3WFIA 1DFHA 2FP4A 2PZLA 4MVJA 4P8RA 3QIVA 5JDCC 3OEWA 4MIYA 4D79A 1UXHA 3ABIA 3FBTA 5TRTA 5B1YA 4WK6A 1V0JA 2OHXA 2X5OA 4GPD1 1Z82A 3ZDFA 5TLSA 4QECA 3V2GA 1PJBA 3JYQA 1PQUA 1TEHA 2BELA 3HB4X 4BKPA 4JXKA 2PZJA 1V35A 4ILKA 1TLTA 1OZAA 2P4QA 3WX0A 2NM0A 2Y05A 4FPXA 5A1TA 2B4RO 2VN8A 3PHIA 4WLEA 1LJ8A 4LISA 4E5KA 1TVEA 3PLRA 1MUUA 3UVEA 2CSUA 5F1PA 3STHA 3VPGA 1K6XA 1WP4A 2BH9A 3RFTA 2H6EA 3V5NA 3INTA 3NGXA 4J49A 2VYVA 4PVCA 2W90A 5BNIA 1MP0A 5ITVA 2CDBA 1OAAA 1JAYA 1DHRA 3DO5A 2VRCD 5G0TA 3C7DB 3VVCA 1X14A 1O5IA 1U3VA 2B4QA 3D1LA 2GD1O 2P9CA 3DOJA 1E92A 3DMTC 3KOUA 4CMEA 1EVJA 4R54A 4BO5A 1ZH8A 2PD3A 1JTVA 4L0QA 3NUGA 2YV1A 2DBQA 5CEEA 1QORA 2ZB8A 2FR8A 4U8GA 4UUMA 3U4IA 5AYVA 3Q0EA 2JD2A 1Z7EA 3TZHA 3UF0A 4BNUA 3RCBA 1I3KA 3WGQA 3KYDA 4F6LA 4XQEA 3HFSA 1IYZA 3WWYA 4I08A 3HE3A 1QYDA 3MEQA 4FGSA 4YAJA 4MVJH 1U3UA 3RC7A 4N7RA 2HRBA 4M87A 3ORFA 4INAA 1EDOA 1LA2A 4IIVA 4MIOA 2W2KA 4WE3A 3HHPA 4DUPA 1XYGA 2PH3A 4QSMA 1E5QA 4E5MA 5JY6A 4CMJA 3G49A 5LC1A 2WWRA 2NTNA 5HRUA 1ZK0A 2FPGA 2J3IA 5EMHA 2ZKLA 1KVUA 3RD5A 1IPEA 3HFGA 3GUYA 3WYEA 2Q3EA 3MWEB 3I9OA 3K73O 3PYMA 3I6IA 3VAZA 3VTFA 1ADBA 1R15A 2CVOA 1R12A 3H4VA 4I5DA 2HMTA 2Q99A 3IJRA 2A4KA 2VWQA 5DBFA 5ENVA 1ZCJA 1LDGA 3OSUA 2I9PA 1G0OA 3Q6IA 4WPGA 3OQ1A 4YJHB 3GF4A 4NFYA 2EIHA 3V8BA 1YOVA 3NTOA 5IXYA 4BGVA 5JBIA 4WKGA 3GEGA 1WVGA 5JO0A 1YQGA 2CMDA 2DTXA 1E6UA 3D3WB 2YV2A 5IDQA 2VNSA 4L74A 4GVXA 3Q3CA 4XDZA 5L4SA 3WBFA 4AJOA 4MVJE 5CG2A 4BMVA 1DC5A 3PDUA 1CWUA 3JV7A 3OEYA 4JP3A 4Z0PA 1KVQA 2PKQO 4GMFA 1JWBB 3PHHA 2X5KO 4FIZA 4DRYA 3RUEA 3KSZO 4PG5A 4Y8VA 2EKQA 4WASA 2I99A 1Q7BA 3R3JA 1U2GA 4WGGA 3E1KA 5FFFA 1BXGA 2EHDA 2PKQP 2W98A 1YONA 2BI7A 1ISHA 4ALMA 3U4DA 2OMEA 3R6DA 1Z73A 3TFQA 3K31A 3WGOA 1ZZEA 3JQGB 4DWVA 3OJ0A 1HWYA 4Z0HO 1RM0A 1FDVA 3DZGA 5HBRA 4RPGA 4QO8A 2JJYA 4IDGA 4R9SA 5G0SA 2R00C 3WIDA 2NU9A 4R1TA 3ZU3A 1VM6A 4YTEA 4AJHA 1HRDA 4CLDA 2NU6A 3AU9A 4A73A 3TL2A 1WWKA 1Q7GA 4DLLA 3TF5A 1BGVA 4IQ0A 4J91A 1NR1A 3GH3A 1PJQA 3FN4A 3FRJA 1LLCA 4KQWA 1T1RA 2G17A 3UICA 3VZPA 5C7LO 1IY8A 4ONEA 1UXKA 3KETA 2YFQA 2PY6A 2JAHA 1D1TA 1U4OA 3LVFO 3X2FA 4EITA 4HV4A 9LDTA 1VSVA 5K9ZA 1F17A 2X0JA 4GBJA 3NDIA 4UVGA 1GFSA 3RBVA 4K6FA 3LK7A 4CM9D 1U8FO 2TMGA 4OQYA 2RAFA 3AFNA 3LLVA 2Y68A 1ZK2A 3ICPA 3AW9A 4PRKA 1RWBA 3K5PA 2V6MA 3RIHA 1A7AA 3VOSA 5H81A 5JDCA 2UAGA 5IDYA 1F0YA 2J3HA 3D4PA 1LSJA 2E6UX 4I9HA 3Q9NA 4DIBA 3DBLA 3ETDA 5COQA 5IJZA 1PIWA 2D1YA 4D42A 1H6CA 2D8AA 4CQMB 2PTGA 3GHYA 2WE7A 4Q3DA 1QP8A 2CD9A 1NWHA 5T8KC 1VJ1A 1I3MA 4GX0A 5CDUA 1E6WA 4CLHA 3LT4A 4O0LA 1ZFNA 1LSUA 4R16A 1P31A 3JCZA 3SC4A 1MLDA 2P91A 4EJMA 4OO3A 2P5UA 1EMDA 3ANMA 3JD2A 2IYPA 3ZU5A 4MO2A 2OO5A 2YV3A 3ZHBA 4RQUA 1MXHA 2GZ1A 3DZKA 3PRJA 1QSGA 4IJKA 4MP8A 3PTZA 4AJLA 3IUSA 2JD0A 3OFSA 1B7GO 1NASA 3V1YA 1CETA 5KKAA 4DQUA 2YQ5A 5C5IA 3BHMA 1NFFA 4CODB 3PQDA 2GSDA 1WMAA 3AU8A 1AXEA 4DBZA 1SOWA 5EL0A 1XDWA 1F06A 1G6KA 2AG8A 3KEOA 3KSUA 1JKFA 5F1OA 1PJCA 2O3UA 3R1IA 3ZU4A 2J3KA 5I8ZA 3PFFA 4YCAA 2ILTA 5A9SB 3G1TA 1O8CA 2VHXA 3NT5A 4CLOB 2BGLA 3P5SA 4P4LA 2B0JA 2B36A 3PEFA 1PL6A 4RVHA 3JD4A 1N2SA 4TVBA 2O3TA 2EJWA 5TC4A 2FPPA 5I9NA 5JAZA 4RVGA 3JQ6A 1RPNA 2AEMA 2PR2A 5U4QA 3F4BA 2DT5A 4CLRB 2Q50A 5JAQA 2RH8A 3RUCA 3CPSA 3ROMA 4I5EA 1ML3A 4XX0A 4YXFA 3UUWA 2R6JA 2AEFA 3ZWNA 4KZPA 1M67A 3VHRA 3L07A 3FTPA 4FOOA 1GPDG 1XIVA 3QWFA 5A04A 5A3JA 3WNVA 4RO0A 4L4XA 3GGGA 1ULSA 4II2A 3HB5X 2ZB4A 1M2WA 2AXQA 4AJEA 4OOFA 2D2IA 1H5QA 5FI5A 1WZEA 3CKYA 3DOOA 4HADA 4MKXA 4TSKA 5LDGA 3S55A 1BSVA 4RVUA 1RM4A 1KEUA 4N54A 3KB6A 5JMPA 1EK5A 4IPTA 4FFMA 2NTVA 4IDAA 5COAA 5DCYA 4DC0A 2J8ZA 1YL6A 4CR8A 4IXTA 2RCYA 1H6DA 1R6DA 2GN8A 1LDBA 2D5AA 1IZ0A 4RPJA 2WE8A 4HFJA 3PWZA 2OXIA 3WDSA 4Q3EA 1PSDA 1IL0A 4G5HA 3Q11A 1YBAA 3UAGA 5L3ZA 3C1TA 3I5MA 3FNGA 4BQPA 4QUKA 4E2ZA 1RJWA 1U3TA 1YB1A 3D7LA 4NK4A 3H2ZA 4XR4A 4BL5A 3MOIA 1P0CA 3CSDA 2EW2A 3PJFA 4EEZA 3GVPA 5AXAA 4TKMA 5K6AC 5THQA 4E5NA 1ZXBA 4PZDA 1ZEMA 2JFGA 4IGEA 5TT0A 1QXSA 4L73A 2HQ1A 2UUPA 4O1MA 4RORA 3LT2A 4NBWA 4EZBA 4ZJUA 1UZLA 2PWZA 4BGEA 5K0ZA 4A2CA 1E3WA 2WDZA 1ZIDA 3PHLA 1P44A 1CRWG 5T57A 1LX6A 2Y0DA 4Z0TA 5HM8A 1RM3A 2WD7A 1EUDA 3KBOA 4NQZA 1LDEA 1E5LA 4YJGA 3VC7A 4WNIA 2HCTA 2EGGA 2R00A 3TFOA 1AN9A 4BMSA 1YWGO 2D5CA 3A4VA 1NWCA 3JQ8B 2C82A 3DBHA 4S1VA 3I23A 3QVSA 2EW8A 3GA0A 4XQCA 4BNTA 5G0VA 4J9VA 2FOIA 5BSHA 2JCXA 1A72A 3GY0A 3O26A 3PDJA 1I01A 3LC2O 4D3FA 1N1GA 5JYEA 1VSUA 2AQKA 2WJPA 2NVUB 2OGUA 4NBRA 2X0RA 5CFZA 3RI3A 1PGOA 4GX5A 4E30A 1Y8QB 3I9NA 3JQCA 4A0SA 3OMLA 4PCVA 1N9GB 1U3WA 1T2CA 1LDYA 4FFRA 5JS6A 1Q0LA 4QTZA 3FR8A 2CNBA 4XGNA 2H5LA 1O6ZA 1M75A 3AM3A 2X6TA 3DHNA 2ZCVA 4E2YA 1TB4A 2F00A 1HKUA 3I4CA 4A27A 3OH8A 1K0UA 3DZHA 4UULA 5F21A 3L4BA 3ZNNA 3ZW8A 1F8GA 4GAEA 4CM3A 1ZW1A 1UXGA 3BMNB 4M54A 3GZNA 2IXBA 4RZHA 2NADA 5A02A 1P1RA 3IC5A 4UUNA 3TZKA 1FDUA 4X54A 4HXYA 3HZZA 4E2XA 4K26A 4NIMA 1EFKA 1KOLA 3O38A 3WGGA 2PLAA 1I8TA 4A7PA 4CLXA 4NR0A 4DLBA 2Z1MA 5L53A 3U0BA 1HF3A 3E5MA 5JSFA 3JYLA 1YXMA 1BXZA 1PL7A 1GDHA 2P4HX 1BVUA 2NVBA 3D4NA 4MDHA 5EQFA 3NEPX 5T8KA 3OIDA 3PGXA 4ZQGA 4IZIA 4DMLA 2X58A 1HSZA 1GD1O 3CMMA 3RU7A 3K6JA 3GNQA 1YQXA 1O9BA 3KHUA 2GR9A 1MV8A 3WGTA 1LDNA 4CJXA 3ZV3A 1OFGA 2ZTUA 4IJVA 2PH5A 3GZ4A 3D64A 3M2TA 4CUZA 4CQMD 3TQHA 4J43A 4TWRA 5FF9A 3K2EA 1P1FA 3O9ZA 1AHHA 3CH6A 3IAHA 3BAZA 3VH3A 3D5TA 5IN5A 2YQ4A 3H8VA 1MB4A 4WEQA 4YVFA 1FMCA 1X7GA 5AOVA 2HMVA 3OIFA 4ZU3A 1D8AA 4FJ1A 5CAEA 4CMBA 2XOXA 1EEHA 4OMUA 3QVOA 1XA0A 1NX6A 4Q3AA 4BNMA 4XIJA 4Z3KA 3W8EA 1BWSA 4C7JA 1Y8RB 3KYDB 3NKLA 5T64A 5IN4A 4L4RA 4LSWA 4B7XA 5C37A 1H6BA 2AQIA 3WIEA 2OP0A 1HE2A 3ZWYA 3KLPX 4DA9A 4DBVO 1TT5A 2W2KB 1GYRA 1JQBA 1ZUD1 3OF2A 4ND1A 4A26A 4DL9A 3H5NA 1UH5A 5I7EA 1VJ0A 3BMOB 1GUZA 3ASVA 4W9NC 3AY3A 1DRWA 4H3VA 5KCZA 3PYLA 1DIRA 3JQ9C 4BNJA 5ER9A 1JN0A 1AE1A 4WEOA 3JSAA 4FDAA 2PFGA 1H9AA 3KXDA 3U4HA 5BQFA 4Q3BA 4CR6A 1PJTA 4BKRA 4JN6B 1WMBA 3A14A 3AM5A 3ST7A 4R51A 2BHLA 3NTRA 4IJUA 1YOVB 2OBYA 5ITWA 3B6ZA 5G4LA 1B8UA 3ZWVA 2DPGA 3H9GA 4XYMA 5CPFA 1X0XA 2GF2A 3C1AA 2BFPA 2QZ9A 5B4UA 1VPDA 3T4XA 5EERA 4XJTA 4YPOA 3H2SA 3UH1A 3A9WA 1NYTA 1UDCA 5GMOA 4O6VA 3LC7O 1ENOA 4HFMA 4JGBA 2R2GA 2FR0A 4OL9A 1DIGA 1ARZA 3RUFA 5JCXA 3VZSA 4OJNA 4BV9A 4MP3A 1BXGB 5U9CA 5K6AA 1KC3A 2ZK7A 2VZ0A 2DM6A 4AJNA 4PLPA 3GDFA 3TL3A 4MIEA 4TZKA 3ZHXA 3NJ8A 1LI4A 1U5CA 3GLQA 3DHYA 3OIGA 3AUAA 1H9BA 2DBRA 4DTIA 3QVTA 3SX2A 3L6EA 3QV1A 1SNYA 4BO9A 2E49A 5CPBA 5CG1A 5A4DA 1IULA 4D0RA 2YFHA 4CM4A 2HK8A 3QY9A 3AFMA 5F5NA 3VDRA 2BFMA 2BMAA 1NQAO 5L95A 1XEAA 3QWAA 1KY4A 1I2BA 1SC6A 3A1NA 5TJHA 3RSHA 3VPFA 4FN4A 2I66A 2X9VA 4CL3A 1RKXA 3RUIA 1D3AA 4E31A 1FDTA 1NAIA 3BTOA 2Y1DA 3RU9A 2WD8A 1R4MA 5MGBA 3LQFA 3FNEA 2X8LA 1BG6A 3E9QA 3SXPA 5LDHA 1IOLA 3KRTA 3MZ0A 3AUTA 3JD3A 1GZ6A 2UDPA 1HE5A 1X15A 5IDXA 3BZUA 3QHAA 5I7SA 4ZHSA 2HMWA 3G79A 4R68A 3DONA 5C7OO 4PZCA 3A28A 2D59A 1J4AA 2E48A 3GVXA 2O3SA 1ZO8A 4H15A 5HS4A 1JA9A 5JFOA 1GV1A 4YT5A 4BO6A 3EZYA 4XJSA 1JAXA 3DZIA 3Q1LA 4O63O 3NAQA 4WLFA 2FRDA 5JMWA 5DOZA 1VL6A 3BTUA 3D4OA 1B8VA 1LRKA 1W8DA 4QO7A 4ZRMA 1QLJA 1DLIA 1IHYA 2FWMX 1CERA 1NHGA 2IZZA 3Q2KA 2GLXA 4E0BA 2C54A 5CDYA 5CDTA 1GUYA 5A9RA 2G76A 2YJZA 3QLJA 1HDGO 4DMMA 3BTSA 1ZBQA 1MA0A 3AK4A 3GG2A 4AJIA 4PLCA 4IY1A 3G17A 4L9RA 4XEHA 1ISGA 3DAPA 5A05A 3PYXA 1B3BA 4PFJA 3S1LA 2JHFA 4BNXA 4WLVA 2GERA 1LBEA 4BB6A 1SB8A 5DBIA 3HN7A 2ZQZA 4XR9A 3PWSA 3PPIA 4TQGA 4YR9A 3E8XA 4GSLA 4OIMA 4CUJA 4RF5A 1HYEA 3WS7A 3T7CA 1HYHA 1XR3A 3WTCA 3OJEA 1X7DA 3W4IA 1AHIA 1GQQA 3A06A 2FPIA 1U5AA 4WUVA 2Y1OA 1AXGA 3RFVA 5KWEA 1YL7A 3ZWMA 1D7OA 2I67A 4B4OA 2BGKA 2X22A 5A5FA 1Z45A 2RIRA 4XRGA 2DC1A 2HU2A 2WYWA 1ZMTA 2E4AA 4KTTE 2HO5A 4JROA 4U6QA 3JQ7A 4IGFA 3GT0A 4KUHA 1XGKA 4M8SA 1DOHA 1SPXA 2POQX 1SZJG 4WLOA 4G2NA 2O2YA 1EE9A 3TSCA 1AGNA 1B8PA 1NVMB 5B4TA 3FNFA 3UGKA 1FJHA 3U09A 3JYNA 4W9NA 2EG9A 1C0IA 2I3GA 1S7CA 3DBRA 2QRJA 3ZWAA 1YDEA 3WQRA 5HWSA 2Q45A 3JQ9A 4NBTA 5L40A 2Q1WA 4OHUA 2FZEA 3OP4A 1PGPA 1DRVA 3S2FA 1YJ8A 1YE3A 3ADOA 1EK6A 4K28A 1Z74A 4UAGA 1XHLA 1QRRA 1E3LA 4RV9A 4CMHA 3IKTA 5DZSA 4CL8A 1Y81A 5BT9A 3ZV4A 3MJEA 2NU7A 2FMUA 3CE6A 2CZCA 3AM4A 1T2EA 3W4KA 2C07A 2YY7A 4FSHA 4MVJF 3JTMA 4R41A 3H9UA 3ZV6A 5DP2A 4KUGA 3HNPA 1I24A 1M6WA 3CUKA 1C1DA 1EUZA 2EF1A 2NQ8A 1JVBA 1UDAA 1PL8A 2OZPA 5C3MA 5JPIA 4RPKA 1P1KA 4WOJA 2CF5A 3KYCB 1PS0A 4DPKA 1NPDA 2PGJA 3TZ6A 1PGQA 2VUSA 4C4OA 5G2OA 4L75A 4ALKA 3AY6A 3ULKA 3EY4A 3WOHA 3DFUA 3W8FA 4ALLA 4IQGA 1I36A 1PQPA 3P7MA 5GY7A 1P77A 3QVXA 4J90A 3WYCA 1E1NA 4E33A 4CM7A 2BF7A 3EAGA 1DDOA 2FN7A 1FDSA 4JQCA 3E9MA 1HLDA 4N5NA 2V6FA 5GZ6A 3PHGA 1E3WB 3KZVA 2ZTMA 1KVRA 3VPXA 1DO8A 1ZVMA 3EK2A 1GYQA 4PG4A 3H9EO 2VTEA 2WD7B 2NNLD 1HDOA 1BTOA 2ZTVA 4FJ2A 4CV1A 4UREA 4YJGB 4JP2A 3ZWBA 2AW5A 5TX7A 4WJZA 1EBUA 1JDJA 2HK7A 3B70A 2VZ8A 4BNYA 2JD1A 2QIOA 3F47A 4E5YA 1UP4A 3RQSA 3TDKA 3UCXA 4D43A 2B35A 3OECA 4P22A 1NM5A 1O95A 1Y9EA 2VHZA 4ITUA 2IEBA 2OORA 4RCVA 2XAAA 3GVHA 4OXNA 3IKVA 2D0IA 4GL4A 4N18A 4NZ9A 1T2FA 4BO3A 1R4NA 2VOJA 4GWGA 3K9QO 3DOCA 1BW9A 3ENNA 1PZEA 2X1HA 4BNGA 5AQ1A 1YB4A 2H63A 4RVDA 2E82A 1ZSVA 1YL5A 2NACA 1DPGA 1ONOA 2X0NA 1PTJA 3RFXA 1AUPA 2GYYA 2O4CA 2JAPA 3BA1A 3L4BC 2ZJ0A 1KEWA 1C3VA 3C3XA 2VTDA 3MCVA 2JHGA 1SMKA 1YBVA 1HL3A 4YACA 5TF4A 5L51A 1ZSYA 3UW3A 1PS9A 3FR7A 1QYXA 3GGPA 4MKRA 1R0LA 2EV9A 3DBVO 1K6IA 1CYDA 4IDBA 4LRTB 4RJTA 2X9GA 4ZICA 5C7IO 1C14A 4OM8A 1OOEA 3ITKA 1JU9A 2EGHA 1VI2A 4Z9XA 1J6UA 3WJ7A 1T1SA 1W4ZA 4ZRNA 1NXQA 3F6YA 3RUHA 4DGSA 3K30A 1UXIA 4BO8A 3GPIA 2QX7A 4E4YA 1CQJA 4PVDA 3EGOA 4YQYA 4TRNA 2NUAA 2P68A 5BSEA 1LRJA 1NR7A 2GRAA 3DDNA 5DP1A 3GMDA 1CDOA 3M6IA 3TWOA 4YAGA 7ADHA 1PJ4A 5JE8A 2HMUA 3U49A 3P2OA 2C7GA 4HWKA 2Y1GA 3SJUA 4UVHA 2EKPA 1I0ZA 1HE4A 3DTYA 3PQFA 4TRMA 5HA5A 5THKA 2IYOA 2YW9A 3HDJA 1HEUA 3ONEA 3DWFA 1NQOA 4RLSA 3W6ZA 1YRLA 3K92A 2W4QA 1N92A 4E21A 2PV7A 4A5OA 3H9JA 4FFNA 4N5MA 4XDYA 4LMPA 4ZQHA 3V2UA 2PGLA 2OOSA 1EVYA 4K1LA 4XRRA 5ICSA 4P4GA 2VHYA 1WDLA 3C8MA 5JDIA 1L1FA 3ZWXA 1UAGA 1Z7BA 3DFZA 5TS3A 3FSRA 4XIYA 2P9GA 3QVWA 3HQ4O 2AQ8A 1LDMA 4YYZA 2RHCA 2BFAA 2SCUA 5MDHA 1XCBA 4YRDA 5ICMA 2Y0EA 4J1TA 3AUUA 1U7HA 4GI2A 4KQXA 3RVDA 4BMNA 1DEHA 4R3WA 1ID1A 2DBVO 4FOSA 3ZCXA 3WYBA 2BD0A 4IDEA 2X4GA 3EDMA 4J2HA 3DC2A 2LDBA 3AUSA 4CLEA 2CDCA 1E7YA 2B83A 2WSBA 5EESA 2P9EA 3RUAA 1MGOA 5L7WA 2W8ZA 1LC3A 2A92A 3B1FA 1X0VA 3H9QA 3H7AA 4J1QA 3UN1A 3OHSX 1PWZA 1W6UA 3FTNA 5KJFA 4LN1A 2X5JO 1WLYA 4TROA 1YGYA 5I7VA 2O3JA 4WECA 3IQDB 4JX8A 3ZV5A 4CMIA 4NG5A 5JW6A 3WG9A 4E3ZA 1UXJA 3RC2A 2WYUA 1IHXA 3CXRA 4YJHA 2W2LA 5JO9A 3V1UA 3ETGA 3S2GA 4WLUA 1XG5A 3RJ5A 2GGSA 2WM3A 2UV8A 1V3UA 2OL4A 4CM8A 3T4EA 2FSSA 4GWKA 3WICA 4M89A 3ZZNA 4UUPA 4J0FA 2YZ7A 4EGFA 4XWYA 3VH1A 1DBVO 1ZJZA 3PIDA 3ZGYA 1TI7A 1E3JA 1DB3A 4LCJA 3R0IA 4OKIA 3M2PA 5CDSA 1S6YA 2Y93A 2IEDA 1KVTA 2RHRA 2ZTLA 3Q2IA 4I9NA 3VPHA 3WGIA 2C5EA 3FNHA 1H93A 4LSMA 1VKNA 4RF4A 3O8QA 2GASA 4DYDA 4KDFA 1X7HA 4ESOA 1MC5A 1SEVA 2AEJA 4OAQA 3JQAA 1KYQA 1FF9A 3F46A 4CR7A 3MWDB 1M6HA 4U5QA 1UAYA 4ALNA 2Y99A 3SLKA 1H0KA 2YHUA 3EHEA 4AJ1A 4W82A 3WGHA 1DAPA 4BO4A 4EYEA 3DAGA 2GN6A 1ISIA 5IZ4A 4K9DA 1E1LA 3BMCB 3RASA 1HDXA 4MPDA 4OSPA 5H82A 1A7KA 1T26A 4PZEA 4RQTA 4J0EA 3LT1A 5A3VA 2QRLA 2O23A 5ILOA 2O7QA 4E13A 1DJQA 1I30A 3GNTA 4AJ2A 4NMHA 4XYGA 1DIHA 2Y1CA 4WOKA 1DHTA 5L9AA 4XB1A 4CM4B 1GR0A 4GLOA 5HS6A 4BIIA 3TJRA 3ZNOA 2WYVA 4UUOA 5H83A 1E7RA 5DF1A 4GMGA 1LEHA 3HG7A 4KWIA 4YT4A 4R1NA 4GX2A 4Z6KA 3H5RA 3GC6A 1C1XA 4AVYA 3L0DA 2AQHA 1DC4A 2PKRA 3DTTA 3TRIA 1G0NA 1I3LA 1P74A 1QMGA 3MTJA 4ALIA 1R4MB 3DZFA 4LW8A 5KVSA 2DTEA 4RGBA 2EP7A 4F46A 5CEFA 2HRZA 3GAZA 2HAEA 1IUKA 1A5ZA 2BGMA 2X0IA 1U1IA 3VKUA 1LXCA 4KTVE 5JAIA 3WNQA 4B4UA 3H65A 4RPLA 2C0CA 5CP8A 1KERA 4NJMA 4XYEA 5AXBA 1QYVA 2O3QA 5KIAA 4R1UA 1VKOA 4EUFA 3FPLA 2PZKA 1QR6A 2ZJ1A 2GUGA 4U6SA 3PJEA 1O89A 1ZK4A 3X2EA 2DBZA 3EYWA 1ADFA 1UDBA 1J0XO 4Z9YA 2I65A 1U7TA 2EWMA 3DB2A 4MVJG 5TNXA 3ZWCA 4FCCA 1YB5A 3V1TC 1B14A 1PZFA 4IIUA 1CF2O 4EJ6A 2H9IA 4PLTA 3SVTA 5I7FA 2VWPA 4FC7A 4OQZA 1DFIA 1V3TA 1E1MA 3SLGA 1SO8A 3RROA 3RWBA 2Q1UA 1JWAB 1U4SA 3NDRA 4PLZA 3GMSA 4UVIA 2C2YA 3UCEA 4W7IA 4EBFA 2HJRA 3S2EA 1ZNQO 4BVAA 5JAMA 1HYGA 1DXYA 2UUOA 4Y6RA 1OC4A 1UZMA 1NNUA 4ROSA 4BNZA 1XELA 4CUKA 3ASUA 5JCJD 3JQEA 2VYNA 3Q9UA 1GAEO 4FS3A 3N58A 4FD3A 4PGFA 1ONPA 1XWFA 4D3SA 4ZVVA 5KJEA 2FY8A 1Y5MA 4LK3A 1N7HA 1SEPA 3AJRA 2Z5LA 4MINA 3RC1A 1GQ2A 3I9KA 4IMPA 4RF3A 3ZHYA 4B8WA 3ENKA 4HNHA 2EEZA 4J1SA 3WGZA 1DFGA 1PJ3A 4Y9DA 8LDHA 1EE2A 4R69A 3DZBA 1YH3A 8ADHA 4CV0A 2HKIA 4IDDA 4E32A 2JFHA 2IDZA 2Y1EA 3IDSA 3KM0A 3LDHA 3MJTA 4FFLA 1K5HA 2UYYA 4CV3A 4Y98A 1NQTA 4MJLA 4U0KA 3UXYA 3ZN2A 4CMGA 5G4KA 4BO1A 2EJVA 3F5SA 3N74A 3D3EA 3QJ5A 5TGDA 4G65A 1WZIA 3E9NA 4ID9A 1BRMA 4KUEA 1I5RA 3I52A 1KC1A 3K96A 3L4SO 4EW6A 2I6TA 3ZHZA 4XD2A 4YRBA 4GQAA 1HT0A 3U4CA 5U1PA 3EC7A 4DXHA 3OETA 1YVEI 4JNKA 3M1AA 3AI2A 4YWJA 1KEVA 2Q1SA 3OBBA 3S8MA 3GK3A 4HBGA 4GGPA 4M1QA 1ADGA 1LSOA 1NFRA 3KSDO 1YKFA 4NFSA 3WQQA 1KBZA 5L45A 3U62A 1Y7TA 4KDEA 4OGWA 4W99A 5A5EA 4BNHA 2NSDA 2BKAA 3F4LA 2VNAA 2DKNA 2ZB7A 1GADO 4U7WA 3FBGA 1C1DB 3GRKA 1P0FA 3OQ6A 1ZJYA 3RBXA 5ENDA 1UUFA 4D3DA 3FPCA 3VKVA 4NFHA 2O4UX 3L6OO 5AXDA 2H1SA 4BNNA 4ND3A 3AY7A 3N7UA 3QSGA 1PX0A 5HTOA 3VTZA 3GPDG 2YHIA 3WGYA 4M86A 4AICA 3FF4A 4J16A 5KTKA 2JKVA 3MJ4A 5CHEA 4ZQFA 5DNAA 1GZ3A 1PJ2A 3CTMA 1MXFA 3F1LA 1PR9A 1C0LA 1ENYA 1XU9A 3PFWO 3DR3A 4CV2A 4I5GA 1WDKA 1N7GA 1ZEJA 2DU8A 2QQ5A 3AI3A 3OQBA 1R16A 1ENPA 5DT9A 2EERA 2G5CA 2QYTA 1YO6A 1BDBA 5FWNA 4PIVA 2DTDA 3SC6A 3UCFA 2CF6A 1XU7A 4M49A 4YAIA 4YJFA 4YJDA 3D5QA 3GN2A 4J7CA 2HUNA 1QV7A 4MVJM 2XF8A 2B69A 4HP8A 2O48X 4L76A 4B3HA 1R37A 1ULUA 1SB9A 2GN9A 4FBGA 2I76A 1T25A 4W4TA 2PK3A 4GLLA 4RF2A 4DVJA 4ND5A 4J9UE 4NBVA 1BW9B 4OXYA 3WFJA 3ON5A 3UFXA 5B37A 1N9GA 1QYCA 3MJCA 4K6CA 1E6EA 1PU2A 3JD0A 3R3SA 2NV6A 3VVBA 4XQ9A 1B16A 4DIOA 2Q1TA 4H16A 1E7MA 4FFPA 1UZNA 3IMFA 2QZZA 2C59A 1HLPA 5IXSA 4B7UA 1UP7A 3L9WA 4XKJA 4FGWA 5A06A 3F5QA 3CEAA 5EIOA 4IJWA 2HLPA 4JIGA 5EJ2A 1LSSA 2VRCA 1QG6A 4UEKA 3WTBA 4IZHA 2V6GA 1LRLA 3DBLB 1N5DA 4NHEA 4RVFA 5KVVA 1ISFA 3GRPA 5ADHA 5BNTA 2OBNA 3WWZA 2QW8A 3H6KA 4FC6A 4B4VA 4P4NA 5ES3A 1TT7A 4MP6A 1IE3A 3KYBA 4GKBA 4CMCA 4MVJD 2HJSA 2CVQA 2JFFA 3AOEA 3OJLA 3G1UA 2A94A 5DDIP 4AJPA 1M76A 1ENZA 4KOAA 1MX3A 4E5PA 1GUFA 1LNQA 2A9FA 4HNGA 1K3TA 1PR3A 1NTOA 1KS9A 3ANNA 4MOWA 4PG7A 4XGKA 1OC2A 2GPTA 4A10A 3HN2A 1V9LA 4IBOA 4ZQBA 1ZMOA 2AHRA 4QFCA 5JDIC 1KETA 4XB2A 4I8XA 3TZQA 1I10A 1RM5A 2A35A 2E37A 1HDYA 1PS8A 1YDWA 4XQGA 3RKRA 4KWHA 2Z1NA 1EDZA 4J3FA 3JYPA 2FHSA 3RAJA 3PGJA 3I4FA 2IZ1A 2O2SA 1SOVA 2UVDA 4G81A 2X23A 1PJLA 3B1KA 5B12A 4EDFA 1EQUA 3ZNQA 3GNSA 1VE9A 4F6CA 1JW9B 2DAPA 3OM9A 2V65A 1XQ1A 1ZSNA 3E18A 2VYVD 3SEFA 1A27A 3HADA 3QA9A 1PWXA 1I3NA 5AXCA 4URFA 1Y8RA 4PLVA 3O03A 1Y5RA 3LSYA 2WMDA 3LYLA 4R5MA 3GAFA 3FHLA 4FB5A 1VJTA 4RDHA 1B3RA 1BXKA 2AE2A 4WLNA 4WCFA 5TQVA 4B3IA 3WMWA 4YT2A 2DPHA 1HDRA 4BB5A 3HUDA 3IS3A 5A03A 3BMOA 3TNLA 2BLLA 2P2SA 3K8ZA 1HSOA 3BIOA 4D0SA 3I9LA 3PQEA 4EUHA 4IDCA 3ICCA 4WCDA 5KNLA 3L77A 1A4IA 1B26A 1D4FA 3E6AA 3VH4A 2LDXA 5I9LA 4I9UA 3BMQA 4QEDA 1E3IA 4CMIB 3O4RA 4GSKA 4DREA 2EXXA 4FQ8A 1OI7A 3WB9A 3DZJA 4YAKA 2AA3A 4CM8B 2ZB3A 2VZ9A 4HX5A 5KVQA 3WXBA 1OBFO 4AJKA 1EQ2A 2Q2WA 4R5HA 4GX1A 5CEJA 4NBUA 4Q39A 2V6BA 3ADPA 4CQLA 2ET6A 3P2YA 1NHWA 3P19A 2VWGA 5DN9A 2B5VA 1HETA 3CZMA 3PZBA 5B4VA 2Y66A 1Q0HA 2DFDA 3PK0A 1MG5A 4D44A 3H3FA 4ZN6A 4LGVA 3KVOA 1WNTA 4IQ8A 2IODA 5JYDA 4Q3NA 3G0OA 3O8QB 2B4TO 3KLMX 1WW8A 3CMCO 2VHWA 3ONFA 4JJGA 5IAAA 3IP1A 4BGIA 3JQAB 3B20A 3OJFA 4NPCA 1WDMA 4UEOA 1PEDA 4D46A 2HDHA 4DPLA 3L9XA 4FW8A 3BHJA 5J23A 1BVRA 1H2BA 2RH4A 1MFZA 4FFOA 3U9LA 2ZATA 3PWKA 1ONNA 1NQ5A 1K2WA 2Q46A 3VH2A 4ALJA 3L6DA 5KVCA 4F3YA 2PGDA 3W8DA 3JQFA 3K2BA 3I9JA 4CM9A 3WSVA 3LF1A 3DBHB 2YDXA 1A9ZA 3B1JA 4U0JA 4IUYA 1BDMA 3E5RA 1EZ4A 3TN7A 3C7AA 3MTGA 1C0KA 3KEQA 4D7AA 2QRKA 4E2WA 3FCOA 3ZWWA 3MJVA 4BNVA 2DLDA 3ETEA 4RVSA 1GPJA 3FI9A 3NJ4A 3QE3A 4KP7A 5FI3A 3NDJA 3GVCA 4PLWA 2AG5A 1C1XB 1LLUA 3TOXA 4GH5A 1T2AA 1VL0A 1MC4A 5IDWA 4Y67A 2CUKA 2IRWA 4HUJA 4Q9NA 4GVLA 5DCWA 1K89A 4R01A 1E7WA 1MG0A 4LRSB 4W7HA 1P9LA 2XXJA 2IE0A 3JQBC 4BNIA 4NK5A 1UP6A 3ROPA 1DC3A 3BTVA 1EVZA 3QWBA 5DOVA 4FR5A 2CDAA 2J3JA 3D0OA 3NT4A 3HDYA 1IPFA 5DULA 4BKQA 4BUCA 5F5LA 4B8ZA 4TKLA 4UVEA 3SJ7A 3IP3A 1EVIA 4QFDA 2C7VA 1Q1NA 3GZNB 4R9RA 1GL3A 1ADCA 1WAMA 4NJMB 5I8WA 1TXGA 3QWIA 3H5AA 2GNAA 3ZU2A 2XXBA 3I3OA 1HZJA 1DLJA 3FD8A 1Z6ZA 3JQDA 4YT8A 1VRWA 5JNLA 3PZRA 3OJOA 4N5LA 2VUTA 3OA2A 1N1EA 1NPYA 4JK3A 5F1KA 1ZXLA 4JBHA 2CVZA 4NJOA 1HZZA 4MKZA 3PXXA 4EJ0A 2VT2A 4YQZA 1GEGA 3WLEA 6LDHA 4FJ0A 3QQPA 4RZIA 5EPOA 1EBFA 1NBOA 5I9MA 3PVZA 3CZRA 3NT2A 2VQ3A 5KKCA 1SBYA 2IXAA 2OP1A 5KJ1A 3M1LA 1BHSA 2C20A 2NQTA 4QT0A 2BFOA 3WMXA 1CIVA 1DRUA 2D3TA 4NNJA 1CEQA 1GY8A 1KIFA 1PJSA 1E7QA 1GU7A 4YEDA 1JLLA 1SAYA 2ZIZA 3ZWPA 2C5AA 2DFVA 3QP9A 2NU8A 1XSEA 2FSVA 1GZ4A 1LQTA 3S2IA 4TRRA 1WPQA 5COBA 1QLHA 4LVCA 3NYWA 1ORRA 4M55A 4RPHA 1H6AA 3LZ6A 4OH1A 4E12A 4XYLA 3DMTA 2BRUA 3QRWA 1SCUA 4MVJI 1LUAA 1GCOA 4DPMA 3EMKA 1R66A 1X13A 1BMDA 1VLLA 1A71A 1M66A 1X1EA 2ZYDA 3GR6A 4IS3A 4II3A 4OOEA 3ROKA 4Q3CA 5IZCC 1FXSA 4TVOA 4B4WA 1HTBA 3LF2A 1QYWA 4ND2A 3PHJA 3C1OA 4HKTA 1TT5B 5AVOA 1U28A 2GN4A 1ZK1A 1ISJA 4JLWA 4OKNA 1XKQA 4J6FA 5G4KB 1IZ9A 4IDFA 2VWHA 3ZH2A 3RC9A 5BNFA 1HDCA 4CM5A 4R3NA 3BXXA 2O3RA 4QQRA 1EUCA 3COSA 3HDQA 1Q2XA 1DC6A 4KMSA 2Q2VA 3D3WA 3F9IA 3PJGA 3INGA 4PG6A 1J49A 1DIBA 2FZWA 1YQDA 4XCVA 3RKUA 3W6UA 4D45A 7MDHA 4I5FA 4O5OA 3U3XA 4QX6A 1VL8A 1T24A 2HMSA 3DQPA 4PG8A 3TOZA 1RYDA 3JYOA 3DAFA 4UEJA 3GEMA 5T67A 1JVSA 1H94A 5F3RA 1XQ6A 1Q7CA 3AI1A 5L4LA 3FWZA 1CJCA 2PZMA 2GZ3A 2PA3A 3QWHA 3LU1A 2BI8A 2F1KA 2GDZA 3KYCA 1NPTO 1PQWA 4LMRA 2P5YA 2W2LD 1DJNA 1N8KA 1TA4A 4Y6SA 3JQGA 3LLSA 4HFNA 3E48A 2O50A 1O0SA 3INRA 1GTMA 4BO0A 5JC1A 4DYVA 4OYRA 3NRCA 1U8XX 2WTBA 4ZA2A 3GHHA 5A9TA 4J1NA 3NX4A 2DUWA 5G0UA 1Y6JA 1E1KA 4GKVA 1PGNA 3ZW9A 4LCEA 3IOYA 1QKIA 1V8BA 4WNCA 2YHIB 5JXWA 3G3EA 4J4TA 4C7KA 4JBIA 4DC1A 3C85A 1VC2A 3WR5A 4DQVA 1I2CA 3GOHA 3I1JA 1HXHA 1LLDA 2C29D 5G0WA 4IXWA 5TJ9A 2GCGA 1U9JA 4AG3A 4ZD6A 5KOIA 3JQAD 2ZCUA 3GN1A 2JCVA 2EP5A 5JY1A 4YJFB 4J4BA 2O7SA 2DVMA 4IM7A 2Y1FA 5GZ1A 2G82A 1EFLA 4YDRA 2Q4BA 5EN4A 3OICA 4F45A 1IB6A 3AOGA 5TIIA 3BHIA 4E6PA 1UR5A 5DCUA 5GZ3A 2Z95A 1P1IA 2HK9A 3JD1A 3GDOA 3DL2A 4BHTA 2HSDA 4BGUA 3E03A 3JQBA 1GQYA 1LTHR 1E77A 2IZ0A 1GV0A 1W0CA 4HY3A 5TSDA 5TT1A 1LC0A 4D41A 2PD6A 2OFPA 1P45A 2OUIA 3HWRA 3HDHA 3RUDA 1F14A 5FEUA 4B79A 1JKJA 2NVWA 3QW2A 2Y67A 2VT3A 5T5QA 4CQMA 1L7EA 3LT0A 1NFQA 3NTQA 6ADHA 1RYEA 1HDZA 2C2XA 3GEDA 4TZTA 3WLFA 4DLAA 4NDNE 4PLHA 4BO2A 1T2DA 5JCJA 4AL4A 1NP3A 3CINA 3AOEC 3C7CB 2X9NA 4BNLA 4Y6PA 5BSGA 1DIAA 1I2ZA 1JKIA 3RBZA 1L7DA 3DEYX 1CQIA 1P1JA 1UJMA 4Z3DA 3VZQA 3NGLA 1YBMA 4S3MA 3IIEA 4IS2A 5ILGA 1E3SA 3W4JA 4EEXA 1H2HA 1Q0QA 1NAHA 1O94A 4I1IA 1V3VA 1NVTA 2I5PO 2NLOA 2NTJA 4CMKA 1WXDA 4PN3A
chains in the Genus database with same CATH superfamily
1ESDA 1KP9A 1MPXA 3I1IA 4FZRA 3TPCA 1ZI9A 2QPLA 1J70A 4IO1A 1Z5WA 4LF4E 5CVEA 5ESRA 3VYXA 5TPZD 1VTKA 1W73A 3JARA 9LDBA 2O54A 2V5AA 2FX5A 4BTEA 4QUEA 3ZV7A 4MB2A 3QBJA 4B3JA 2VCEA 4NH4A 5AVWA 5D84A 1QF7A 4BO7A 3QLVA 4YRAA 3I04M 4KQFA 4MRMA 4QHTA 1MAAA 1DSSG 3N2GB 3ZTTA 1I4EB 3KUXA 4PO9A 4U1RA 3I9MA 1ZOSA 3RYHB 2QHXA 2O8FB 2JAQA 2FLKA 3A6LA 3P2EA 2J9YB 4WCFC 4G5FA 2EPLX 2HF7A 1T4BA 5HIIA 1R0YA 1E9FA 4B35A 4NBWA 4Q3KA 2PQ0A 2PR7A 2ZI4A 2A5YB 3TIVA 1RJGA 3KOWA 2FN4A 3KJNA 1YZHA 1WA5A 4EF4A 4CLRA 1MRZA 5KTPA 1HUQA 1CIPA 4MW0A 2FPLA 5KJCA 4PNZA 1GYPA 3QU2A 2CY0A 4W5JA 5M04A 3DWEX 3E15A 2VATA 3KQLA 4M76B 4DCVA 4WXCA 1MFPA 4WN9B 2PGIA 2YN4A 3KSMA 2ENAA 3CNQS 4N8DA 4Y1RB 3WHIA 5JALA 2GLIA 1SHZA 3ICOA 5IF3A 1GZVA 2IL1A 2W8BB 1KVSA 3DUFA 2MDGA 1FPQA 1PZHA 1TKBA 1X80B 5FH9A 2EN2A 1J2TA 2NSHA 3BRWD 1C0PA 1SOAA 1BKDR 3HYTA 3GUCA 3P8ZA 3ZQ6A 4XYBA 2EMGA 3DULA 3FMVA 3SBOA 3GLFE 1IEXA 2ZSEA 1D2HA 4O2RA 1F12A 1N6NA 4G5YA 4MUIA 3ZI0A 1LQUA 4WOBA 2B3TB 1ISMA 1Y8CA 2QR3A 2DPYA 2VQ6A 4ARIA 3JY6A 3PP8A 3U7QA 3I8XA 1HE3A 1HI9A 3QUBA 3ZNPA 4R03A 3CKMA 3IAM6 4Q1BA 3AKEA 3C24A 2F43A 1E89A 1IZZA 4ARAA 1NUHA 1II8B 1RQNA 2WJ4A 5TMEA 4P34A 2RK3A 4AFNA 1FLAA 2Y0CA 4PIMA 1JPVA 1EHCA 2BE9A 2JKZA 2OWEA 2W5UA 4BNFA 1D1SA 1XA3A 2XUDA 1KQFA 2EKLA 2IIQA 3SQMA 3RJ9A 3OZCA 3I83A 1VPLA 4LYGA 2MR6A 3COVA 1W2HA 4LZLA 4PGGA 4RH3A 4Q9LA 5AI4A 4UUAA 4DLYA 3MJSA 3BD7A 4AY3A 4W5NA 3B6MA 4XGIA 3R24A 3ZDAA 3IJPA 5HOQA 3E82A 4CEJB 4S1TA 3LUKA 1OQAA 5DM70 3N5KA 4I4IA 4YN3A 4HEA6 1K66A 4RDIA 1LZKA 2MSLA 2YYYA 4I4CA 4CDGA 2M6LA 1TZBA 2XNSA 1UDWA 4DIUA 4K0KB 1VL1A 4TS1A 5LXTB 1OH8A 2GLUA 2PUTA 4YA6A 1I33A 1M1ZA 3H1EA 3CCCA 1QIDA 1GCUA 3B3AA 2RBEA 3ND8A 4FK8A 2YNMC 4NEGA 5EKUA 1MVOA 1G291 3F7TA 3ITDA 4BDTA 2I9KA 2CHUA 2EL5A 4S2UA 2YXPX 3G2LA 1L5QA 4O3FA 4NU6A 4AJ4A 8MHTA 2ZYHA 4TOIA 1T8SA 3BMCA 3GFPA 4ND6A 4H31A 5AASA 2V5UA 4MRPA 2OM6A 4U2BA 4NLLA 1G66A 1FP4B 3OFKA 4IKPA 2BCEA 2YHBA 3SBXA 2R1FA 1QS0A 2NZJA 1AXRA 2GYWA 1YB2A 3ESBA 3JQ8A 1I32A 4JBGA 4MV3A 5BWLA 2NT4A 2Q6KA 3AWDA 2NUTB 1W75A 3OX3A 4X7PA 1NA5A 4B3DA 1TTQB 1GPWB 2XLBA 4IVPA 1NQXA 3V2HA 1OWOA 4N0QA 5JARA 5JJLA 1B00A 4PO8A 3QEMA 2HNAA 2XTZA 4G1CA 2YPNA 2P90A 1KEEB 2R8XA 3FWYA 4Y6LA 3RDPA 3KKNA 4KZKA 4KL8S 3DXFA 2DHEA 3IAEA 3TMKA 4CPDA 1U2TA 3I62A 2CUTA 3LDFA 3U26A 5EE1A 3ZOKA 1Q19A 3UQYS 5E2BA 4EUEA 3LA8A 4YNBA 1W5EA 2GZ2A 4XFDA 4ZT4A 3GGOA 4TSFA 1YU6A 4PPFA 1E2FA 2WTAA 4IMRA 2AXNA 3GJXC 4BVBA 1WBDA 3R6WA 3KV3O 5B7QA 4YJ2B 2Q49A 1T4DA 4JJIA 4KXYA 3EN0A 5LNK1 3H2JA 4IX9A 1JAZA 5FOXA 1KY5A 2XXAB 1DKPA 2AE1A 2IF0A 5KDDA 2DSNA 4DDTA 1Y1PA 1JHYA 4X3OA 3ZY2A 4ZGWA 1OLSA 4TRJA 1NNSA 2P6NA 1KAGA 3GDGA 3W05A 4JT9A 1RWKA 4PZLA 3BMNA 1QZXA 1XAIA 3RTBA 4LXYA 5T6BA 3T7TA 2HSJA 1Y1RA 1U0JA 4WXYB 3Q7IA 4H18A 1SXJD 5E7MA 1Y42X 2WWHA 2YIVX 4HH3C 5C31A 2VZLA 1NBHA 3OEWA 3DE6X 3WJ2A 5CFOA 3HO8A 1UBKS 3SS7X 4E4RA 4Y6GB 5B1YA 1GSIA 1FTNA 4WK6A 1NZDA 1HZZC 2P3SA 2WF8A 2ZUSA 4B5KA 4ARZA 3SP1A 3HXKA 3I2YX 5TLSA 1KSJA 5K7SA 1Y82A 2R8OA 3JYQA 3D5EA 1Q16A 1WZCA 2BELA 3KHSA 4BKPA 2EL7A 2PZJA 4MA5A 3LFTA 5CA0F 5CFRA 4LK2A 2YKGA 4NHOA 3HLKA 3DZ8A 1OZAA 2EOOA 1AGXA 4WVLA 2UUAE 2VN8A 3SLRA 1RAAA 1LJ8A 2Y6UA 1DRKA 1QHXA 2HDNB 4NZPA 4F2WA 3SM9A 2IP1A 1HURA 2CNKA 1WP4A 2JJ8A 4HNTA 4ZI3A 2VEDA 3B7WA 3B53X 4I1VA 1W7AA 3BE5A 3INTA 1TU0A 4G84A 2VJKA 3WQHA 2JH3A 5BNIA 3BWEA 1RT9A 2CDBA 2DB2A 3IOEA 5ITVA 3AEUA 4HC4A 1OAAA 3FZGA 1DHRA 3DO5A 3H4IA 5B30A 4QYIB 1VKRA 5CFLA 1IIRA 2FA9A 2B8EA 5T4EA 2MSCB 3MIZA 3TQSA 4WBNF 1FTSA 2HA6A 1CP2A 2IBTA 1CQZA 4R2JA 4QG7A 3GB9A 3RRFA 1DQNA 2X7JA 2GXQA 1QFMA 3OJCA 3UWOA 1U2QA 3EE6A 3VO8A 4MROA 4RANA 2DBQA 3OY2A 4UCQA 4HI0E 5GGXA 2ZB8A 3TQQA 3H2KA 4PAOA 1K27A 8ABPA 3U4IA 3UF0A 1Z7EA 2CXXA 4S35A 1Q44A 3RCBA 2WFZA 3FJ1A 5LQNA 2ZT6A 4UW9A 1IWOA 5K3CA 1IYZA 4I08A 3IEIA 1JXMA 4YAJA 4N7RA 1RVDA 4KE8A 1XD9A 3PLAE 1GQOA 1H2AS 2HDOA 4B3TE 4RK7A 2N8XA 5IMSA 3R4CA 1XYGA 4E5MA 2A5FA 5JY6A 3NAZA 1AC5A 4CZ2A 1ZMBA 5LC1A 1MJGM 3TQRA 1YR2A 5HRUA 5IT4A 4NCHA 2FZ4A 3FVVA 1GP2A 2FQXA 1IPEA 1R50A 3Q8WA 5JCZA 4IYJA 3PYMA 3MPUA 5BV2P 4U9HS 1AJEA 3EPJA 1SCIA 1KSHA 1ADBA 1R15A 1V39A 1XXHB 4I5DA 1ST2A 2CLFB 3UXEA 5DBFA 3IILA 3W7AA 1ZN2A 1JGTA 1ZCJA 2COEA 2DCMA 2DBYA 1GA1A 2X42A 1KQOA 3FI0A 3I2HA 4IH1A 4JP8A 4GOLD 4IXMA 1AF4A 1SCDA 4TV8B 4D9EA 3OQ1A 2R8BA 3ONVA 4JOCA 1XYYA 3GF4A 4J7AA 3V8BA 5FBHA 4BGVA 5KPDA 1H4SA 3GEGA 5JO0A 5DNEA 2DZDA 3CUYA 1P7WA 1YQGA 1LW6E 4Q82A 2DTXA 5LYJA 4F06A 4DCJA 2C78A 2PFKA 1E6UA 1PFWA 1UEXC 5IDQA 4BMJA 2VNSA 1UODA 4L74A 3MRVA 1XPRA 5FWXA 2JZCA 2VLIA 5CMLA 2WNHA 3M4ZA 3MRXA 4X92A 3ZLJA 2HUPA 3PNSA 4Z0PA 2EFEB 4MWZA 3DEKA 2R76A 4BRZA 2X5KO 4Q93A 4MITA 2FX2A 4R0VA 4L5IA 3RUEA 4DRYA 2DETA 1PF7E 2C4MA 3EUAA 2C77A 4S24A 1IY1A 2C9ZA 1RQGA 2RHLA 4Y8VA 3UENA 4BLVA 2P9YA 5C4IA 5C8YF 1TW3A 1MX9A 1TIBA 2KW5A 2PRJA 1RLUA 5ALTA 4YCMA 1N32B 4YRPA 3M6LA 3HJBA 3OT4A 1GRRA 4WNAA 3WKAA 1A98A 1BXGA 2MKNA 3BMXA 5CM8B 1EM6A 3R7NA 3I8OA 2DFTA 2PSHA 2O05A 3CCBA 4MUBA 1A2BA 3N05A 3CLSC 4B3GA 1BBOA 3B2NA 4ALMA 3Q9LA 4EHHA 2RJ3A 3U4DA 3O83A 4ZK2A 5CDHA 3IV7A 1JQAA 3KD2A 3FMIA 4H08A 4UNPA 2AR9A 2YNMA 4LF4B 3VKGA 1HWYA 1RM0A 3IKLA 4PWZA 3DZGA 1V4NA 1J24A 5DHUA 4KB5A 1E2IA 1M5RA 4IDGA 4WBXC 4JXXA 3AHCA 3F74A 3L8MA 4FUTA 4Q7JB 3SF8A 5KUTA 3FWPA 3WIDA 2IWHA 5AHWA 3RAPR 3AP2A 5E6UB 2GN1A 2GVDC 4CG1A 1N3BA 1YI0A 3P45A 5D01A 5KOYA 4A73A 3JSXA 4ZIRB 5HIKA 2OQ2A 3GBPA 4ND7A 4HDRA 2E6KA 1FSPA 2V0NA 2AOUA 4NDZA 3OX4A 4H4CA 4J91A 3DM9B 3MS2A 3P0JA 3V80A 1EFCA 3GH3A 5AUQA 2G17A 2WSIA 3EYAA 3R6TA 5C7LO 3MINB 4GLJA 4GRDA 1GRNA 1VGVA 2X9QA 2YFQA 4PQFA 4EG1A 2ZBVA 3HKBA 3N7AA 3IBSA 2JAHA 4AY2A 3WDMA 3N76A 5SZIA 3C6BA 2XQIA 3NIGB 4UPVA 2QG9A 4EITA 9LDTA 5K9ZA 1WTCA 2VXYA 3O4GA 4OI1A 4KVGA 4ZAGA 3UJ3X 2JA2A 4FUQA 1JLMA 4DB4A 1Q14A 3FIGA 3GXOA 4E07A 5AM2A 4GDFA 3GLFB 2J4FA 1EJBA 4UVGA 3O8LA 3PUXA 4MMZB 1KGSA 2Y76A 4IKEA 1J97A 4DGQA 2Q9BA 3TCXB 2XCOA 2Y68A 5I4CA 3ZE8A 3ICPA 2GTIA 3NV7A 3GEPA 3OESA 4GR4A 3P2MA 3JX9A 1MB2A 1A4XA 4PO3X 2V3CC 4H60A 5TQ2A 2C98A 2GEKA 2I7DA 4EA8A 2I2FA 3OIUA 1KARA 3T7SA 2E6UX 2R79A 2YXBA 3ZE2B 4ZEMA 3DBLA 1IDOA 4KGDA 5COQA 2FETA 3X1DA 4EI9A 2IZ7A 3UUEA 3WL7A 2D8AA 2ZZNA 3GHYA 2WE7A 3WLKX 2F9FA 2ZE6A 4Q3DA 1QP8A 1U6KA 2LXNA 3HA5A 3LDGA 5T8KC 4GX0A 1NN5A 3ZQKA 1SVLA 3WLQA 1ZR4A 5THXA 2WM9B 1F4VA 3W8NA 3M6MD 4EJMA 3L7CA 2BHNA 4ID3A 4OO3A 4AQYE 2HYDA 5M3BA 1IJBA 1NLMA 2K7FA 1XLTC 4MO2A 1E18A 2OCYC 3F2VA 4RQUA 1KBOA 3PRJA 2BYTA 1OAKA 1BMFA 1IG3A 3IUSA 2JD0A 3DEFA 4O25A 3FKJA 3HGQA 3RANA 3V1YA 4E1BA 4KREA 1FFHA 2UXBE 3BX1A 3U6KA 4KXWA 3QX7A 3RGGA 1NFFA 3I6YA 5CURA 1DAKA 3EZ7A 4HT3B 2HJJA 3JARB 5HGXA 1T9GS 3E53A 3Q15C 3RLIA 3OZEA 3UM9A 5HQ3B 1O6GA 1NTRA 1F06A 1G6KA 3CNEA 3I01M 1M2NA 1MHPA 5F1OA 2QNIA 1ACLA 4MRMB 4CL0A 2O3UA 3DAHA 3PNKA 3CLVA 3WGKA 1SHLA 1O8CA 1Z62A 2DHCA 3NT5A 2YWFA 3KNZA 1EP9A 3DZCA 2BGLA 4LDAA 5IEJA 4P84A 3BORA 4RVHA 1N2SA 4LRQA 2I4OA 3S5JA 2EJWA 1ZHFA 3TW6A 2ZXEA 3HRHA 4DLUA 2XE8A 2ZIVB 5JAZA 2LVHA 4ZJPA 2AEMA 5HUQA 1OI3A 4PCLA 1WS6A 3MHSC 1M54A 4QAJA 1EKXA 4CLRB 4IG9A 2Q50A 6GPBA 4QT4A 4WADA 3UV3A 1C2YA 1P4HA 1V9SA 2P35A 4XX0A 3UUWA 4Z4FA 2QL6A 3A36A 3EMVA 3FTPA 2EU8A 4DNOA 1XIVA 2DERA 2QT9A 5HRCA 4YRKA 3RVQA 5A04A 1Z6GA 2OYSA 3BXGA 3DUFB 3F6HA 3UMCA 1NDUA 4RO0A 1GARA 3ENWA 1GKKA 3GO4A 3ILXA 3GGGA 1ULSA 4WK2B 4B7AA 3GIWA 4F9TA 1QCCA 5CTJA 2X0EA 2OV4A 2AXQA 1QQ7A 4AJEA 1VYVA 5KQSA 4GOJA 5BRNA 4I19A 4HADA 4MKXA 1TZMA 4TSKA 2ZUBA 1BDIA 1BSVA 1WXEA 1GUAA 1DADA 4QPPA 5JMPA 1YDFA 2D0PB 2RBKA 4IPTA 5DNUA 2YRHA 4IDAA 2W6NA 4DC0A 1CZUA 3M99B 1OX4A 1YL6A 2Q0QA 2Q8QA 3VPCA 3U7QB 2RCYA 2OUKA 3UJ9A 2RHGB 1V8DA 5F7XA 3L4EA 4P81A 4N0DA 3IWBA 3EIXA 1PSDA 1HFEL 4EHDA 2RHOA 4L4UA 1YBAA 3Q7SA 3V8RA 2UUAB 1K75A 2JRLA 4QNMA 2C58A 4RIFA 4B9AA 4L5NC 4AYWA 3I12A 4R6WA 4BQPA 5BSUA 3V9PA 1RJWA 3NIWA 3CSUA 2GHTA 1UKVY 3D7LA 3H2ZA 1W9HA 2IT1A 1GVNB 2PGNA 4RHCA 4TYQA 1FU8A 3C3DA 1O5TA 2OTCA 4DNXA 1QRTA 1BZYA 2EAUA 3D7RA 4MW7A 1OVMA 3L49A 1NXSA 4A91A 2OA0A 5K6AC 3VAYA 4OB7A 4JGGA 4PZDA 5B58T 1HK7A 1ZEMA 2DHDA 3CW2A 3HV0A 5TT0A 2CV2A 3GPCA 1PKEA 3QIAA 2X0DA 4F4CA 1CZOA 3LT2A 3HA2A 1JU4A 2EOHA 2CW5A 2WJIA 3HP4A 1FOEB 1IBCA 4FMDB 4WSOA 4KN8A 5F33A 3U1VA 4AI6A 2VYFA 5K0ZA 1E2EA 1DV2A 1TJPB 4LPKA 5HQ3A 5DBOA 3A1SA 1CRWG 5C5EA 1NC3A 5TXGA 2Y0BA 2BCGY 3OWXA 1LH0A 4Z0TA 2QQFA 1OZHA 1RM3A 2JRCA 3GA7A 5DB4A 5HM8A 1KO8A 2QRMA 2B2CA 1LB1B 5LMCA 1TE2A 4R9UC 1UMDA 4WNIA 4OQDA 2C2KA 4AXBA 2P9FA 3BDAA 3FFTA 4QTTB 4RSGA 3KZZA 2HRCA 1YWGO 2YJGA 3FM9A 4BMSA 3OPXA 5KHAA 3TVDA 1NWCA 1QS0B 3JQ8B 1ZGZA 1QH1A 3OLYA 5E4TA 4E2FA 5HIAA 4ABTA 2EW8A 4NV0A 3MWFA 5D7BA 1XD2A 1HOTA 4G0XA 4B3TB 1E2KA 2JCXA 2R1VA 2X5XA 3ZUPA 3O26A 3FCSB 2SECE 1YS2X 1I01A 2PUCA 5IKPA 4FVTA 4HDCA 2WJPA 2JIZD 2W58A 3QEMB 2OGUA 5CFZA 1DOZA 5TPWA 3CC8A 4QAQA 1FDIA 1PGOA 2H1VA 2V74B 4K9NA 1O1YA 4G25A 1N5JA 1H2XA 4M83A 4A0SA 3C70A 3L4JA 3NXKA 1UPBA 2IH5A 3EWSA 1UBCA 2NXWA 1KHTA 3UK6A 3QG5C 3GAZA 3BERA 1N9GB 3E61A 2NSYA 4NULA 4O3MA 1LI5A 1H22A 2EFJA 3FR8A 3MUEA 4QTZA 2DEUA 1QV9A 2DQSA 3DHNA 1VBMA 2ZM6E 2GM3A 1JIKA 1FRNA 2JCGA 1G5PA 1E1DA 1MDFA 1TB4A 2JHCA 2F00A 3JZAA 4E2YA 2VA8A 5FPTA 3OH8A 4A27A 5K8IA 2J3QA 2QTHA 5F21A 3X44A 4C0AC 1O6FA 3OLWA 4EMUA 1LFDB 3E4CA 3Q2OA 1W5BA 3BMNB 1IBKE 4E11A 5JCPA 3NM6B 4RENA 4RZHA 2NADA 3SYLA 3U17A 3HB7A 2Z2XA 1SQ0A 3LP6A 3QUCA 4Y2JA 1P73A 4DLKA 1GILA 1FDUA 4L2IA 3HZZA 4IVNA 4JBXA 4K26A 1M2KA 3DGEC 2NO1A 4E2XA 4Q15A 2HH9A 5CDFA 1TF6A 1I4DD 1RAFA 1ORDA 3D7NA 3NWBA 1RXEA 4P58A 5E6SA 2VDPB 4NXNE 2QZ4A 4KI0A 2Z1MA 2X6QA 3RVNA 5L53A 2B8JA 2I54A 3E5MA 4P0PB 1HNXE 2FSPA 3JYLA 4ARZB 4HWOA 3HEBA 4JVSB 1Y63A 2HA3A 2EQ0A 1G5TA 2XECA 2ZJOA 2B25A 1BXZA 2R6CA 1PL7A 3CXUA 4EGAA 4MRRA 1EDEA 5EQFA 1WSAA 2I8AA 5DWQA 5T8KA 3L00A 1UMBA 4IZIA 3PNOA 4DMLA 1YDMA 2G9QA 2X58A 3BD9A 4OUDA 1QCDA 4L3WA 4WKBA 4ZODA 2W2VA 4G5GA 4HQFA 1IXKA 2YTGA 1OFUA 4J0HA 5FNVA 4LWOA 4IGIA 1IVSA 1O9BA 4RK1A 4Y6QA 2DXIA 4HQLA 1ZDMA 2XWPA 1MV8A 3K53A 3M1YA 4QJ4A 4I7EA 3ZIDA 1LDNA 4DCPA 3MGCA 4ZT6A 1HOXA 3TXXA 3ZV3A 4EZEA 1OFGA 2A59A 2ZTUA 5HVNA 2V9ZA 4JOSA 2Q8PA 4IJVA 2PH5A 3N0XA 4LOHA 4GM0A 4NE2A 2I78A 3FUWA 3M2TA 4I14A 2ACVA 1OYOA 4W63A 2DY0A 4B48A 3ROXA 3ZK8A 4ERNA 3D6NB 5K8CA 2UZ4A 3AEUB 4DSAA 4EG0A 2P65A 1JPUA 2GPAA 1JQDA 4UOEA 5ECYA 3KS9A 4K9OA 1PT8A 3CH6A 2O8DA 4N0PA 2AF4C 3VH3A 4YV1A 5C1BA 3NOXA 1EWRA 3KPVA 4QXRA 2WABA 3TLCA 2WB4A 5AOVA 1NF2A 5AJVB 4KQMA 5TF0A 1WJGA 2PEYA 4LSGA 1FVHA 2UYCA 3RTDA 5TMPA 4GVPA 3E7DA 5HG0A 4NBSA 5IH3A 4Q3AA 1V5IA 2AN4A 5E7JA 2TS1A 3NCTA 1NEIA 2NUEA 1BWSA 4OLJA 1M2EA 1Y8RB 3NKLA 2WNIA 5T64A 5K0SA 2G63A 3KVRA 3LIIA 4C05A 4Z53A 2J3LA 5FUWA 1JDUA 4X61A 1SD1A 4HGQA 5HXAA 2AQIA 4EFMA 4RTSA 5B1DA 3LM8A 2J08A 3CHYA 4DA9A 3HYNA 4R71A 4NENB 1Z8NA 1ZUD1 3FG9A 3SFTA 4DL9A 3I04A 3TGWA 1UT5A 1GUZA 3ASVA 3UJ8A 5KNBA 3PUKA 4NCBA 4MO9A 5J2UF 1DRWA 2WB2A 3QMVA 2E21A 2OPBA 2ZVQX 1THGA 3F6EX 1JN0A 2R8RA 1TN9A 4Q37A 2IYVA 1T0JB 3KXDA 5BQFA 3U4HA 2DB3A 3THNA 3E9RA 4Q3BA 1PJTA 1RWQA 4JN6B 2PCJA 4P7FA 3B36A 3T3PB 4F11A 3C87A 4WXHA 1XTQA 3M6UA 4A6PA 3S1SA 2Q0SA 1HMPA 3S28A 5KEIA 5ITWA 2ODPA 1FCJA 3TKYA 3ZY3A 1QKJA 1W25A 4ZGGA 5LL6R 1CY6A 4W1RA 4XYMA 5LYJB 1VPEA 1X0XA 2GF2A 2I80A 2ZWMA 3H4MA 4WZAA 5KQPA 1YIAA 3HMQA 3P96A 3R5XA 3UXHA 3OIVA 2WU0A 5G1PA 5K45A 3QITA 2VRWA 3T4XA 4MV0A 5HZMA 3NATA 4PHHA 3U3DA 3V6MA 1N6IA 3JRXA 4FZVA 4MGEA 3UH1A 5CDFE 4JZKA 1A95A 3PUYA 3A9WA 1OFIA 2H06A 2B61A 3WRYC 3WYAA 1WBBA 1CJKC 1CJSA 4U2KA 4HFMA 1ENOA 3ISTA 4M0EA 4RHXA 1L9XA 4AQYB 2HHJA 1UBMS 2FR0A 2QXTA 1DIGA 3MWDA 3OFJA 1X3LA 3VVLA 4CDNA 3E8MA 1RQ2A 4H3KB 5JCXA 1TAUA 1ZLYA 1XK6A 1SUCA 2D74A 4MI3A 4BV9A 3O8OA 1BXGB 4U7FA 3LHKA 2FFQA 2C7QA 2FTXB 2R6AA 3BGOS 5BXQC 1KC3A 1EVQA 1RQPA 2EC5A 5K6AA 4NWIA 1E6MA 2VZ0A 3AVOA 2DM6A 2GYVA 2HWWA 5AVQA 5DYNA 1SR8A 3HU1A 3PEUA 1WCWA 3OD5A 1B8OA 1U0BB 2ZJ7A 2V8QB 3KG2A 5H8WA 4OMCA 2DH5A 2B1JA 2UXBB 1U5CA 2G28A 3GLQA 2C8KA 3LFHA 4XWKA 1GG5A 4FQ7A 3QV1A 1M0SA 1SNYA 4FHDA 1HQYE 1E0JA 4V0NA 2E49A 4K2HA 1CG6A 2QTGA 3CGGA 5DISB 2ZETA 3OU6A 2HK8A 3QY9A 2YJ5A 3U3JA 3CF2A 3DE3X 1WOYA 1C3OA 4Q6WA 3SF8B 2BMAA 3UV6A 1CY1A 1NQAO 1CV2A 1XEAA 3OT5A 3CQ9A 4FFWA 4EGCB 5AW1A 3NPAA 3UGQA 1XAJA 3BIJA 4AIIA 5TDHA 1YU9A 4DXDA 2YS7A 1QRUA 3VC2A 3E3NA 4BVJA 4ZU1X 2AOUB 4DIKA 4DQDA 1NAIA 4TTJA 1P9RA 1CUHA 2FYTA 2NXNA 3CX3A 4UBJA 4A8TA 2GXUA 3LQFA 5MGBA 3E9QA 1Q6YA 2NSJA 3KRTA 4QLAA 1JDSA 1R4ZA 2P7IA 2K7ZA 3MZ0A 4BP3A 3JD3A 1GZ6A 1JK1A 1ECBA 1Q6ZA 1PTJC 1UFVA 3KVYA 4HWPA 2DQKA 4WDQA 4Z7JA 3BZUA 5IDXA 3W1EA 3HKBB 4IRMA 4ZHSA 2HMWA 1Z39A 3E2MA 1EFVA 3DDZX 3FOWA 1MQSA 1JNYA 2QM8A 3HBNA 4IIJA 4PZCA 3DAYA 3AT1A 5DGIA 1J4AA 2BTQA 5HS4A 4QDTA 3NIDB 2J41A 4JR2A 4MEBA 1P5JA 5EOVA 3DZIA 3EEFA 1E2BA 5K01A 3UHOA 2H9AA 3DJFA 2WMYA 1XZGA 3IH5A 1SUFA 3BTUA 4PBRA 4MDFA 4K9RA 2FPWA 4ETNA 5ALZA 4AZWA 2R96A 4G97A 2WWIA 1XZDA 3EQ9A 2PH1A 3EA0A 5ELXA 2UXCE 4IL5A 4LV5B 2FSUA 1VMDA 4GR9A 2V7UA 1RWOA 1STOA 1JEOA 1NHGA 1TJYA 2QMYA 3Q2KA 4TSFD 4YCDA 5CDYA 1GUYA 5A5DA 3QKRA 2G76A 1G8MA 2GRUA 2YJZA 1HDGO 2AV6A 4DMMA 3ZR4B 2EL9A 4Y1EA 1YE8A 4WZAE 2WJHA 5LJLA 5I5EA 2PUFA 4DJJA 2EDAA 2VNIA 2Q29A 1UJ2A 2JXPA 3ASYA 1XFAA 2OO5C 2JVJA 3VHRA 1MAUA 2DG2A 2N3HA 3DAPA 4G0MA 4LY0A 3IVAA 3CN7A 2H54A 5SICE 5CG2A 1YQWA 2NMVA 4YX9A 4MW1A 3L5OA 4B6PA 2QL9A 4H59A 1CJUC 1ZIPA 4BB6A 4OA8A 1WR8A 4QZVA 2FUG1 2H07A 1AB5A 1EP2B 1EYZA 3BD8A 3I42A 2W2XA 3FE2A 4HWRA 4IDHA 2ZYVX 3FZNA 5FLKA 5IMBA 4EYKA 2W37A 2QIPA 1OGYA 4XCXA 3PKJA 4URZR 1R8XA 3AF4A 5DK6A 2OBBA 5ALRA 3T7CA 5JADA 2O8EA 2G4LA 1GQQA 1QVVA 1UIRA 2QP9X 4JWTA 3CJRA 4C4PA 1RAHA 4DA6A 3BGDA 4WUVA 521PA 2Y1OA 3W2EA 1A1IA 4D4LA 3BKWA 1CU1A 1AQUA 5ESWA 3W78A 2JLVA 2PUDA 4XVHA 1Z6PA 2XIJA 3ZE9A 4B4OA 4NOMA 2BGKA 3QF4B 4MV6A 5A5FA 1Z45A 5BV1A 3QXJA 1SZDA 5JVDA 2DC1A 1EGVB 1ZMTA 4KFUA 5EHNA 5JQGF 1PR0A 2KBFA 2UZAA 2NN3C 3BQMB 5MFZA 3O2QB 4IGFA 3WK5A 1XGKA 1W4LA 4KYVA 4YRLA 1DOHA 3DVAA 4QWWA 1QR2A 2POQX 4N7JA 3RYIB 1SZJG 1YKSA 1MF7A 3KKQA 4KQ2A 4WLOA 1D03A 2FW1A 4FT4A 1MC8A 3BXHA 1B8PA 1DQYA 2R1TA 1I2AA 1L4HA 2LVBA 1E5XA 3O1LA 4H3SA 4JL5A 1YYKA 4MWGA 3GAMA 4CFZA 4M36A 4RL4A 1MH9A 3EVFA 1PVVA 1QHIA 2QVLA 3TFWA 3F3YA 2Z4RA 3BREA 1S4QA 2QRJA 4RTLA 2HA4A 4XX0B 3WQRA 4YMUA 4BIMA 4L07A 5L40A 2WINI 1OU0A 4PNHA 1A8HA 1GG8A 3S2FA 4AY6A 2ZDGA 1IBKB 4MJ3A 4DC9A 4DNFA 5IFKA 1QHHA 4UAGA 2W2TA 3TTVA 1XHLA 2BMWA 2JJMA 1EFDN 1AA6A 4NFLA 1MJGA 2VJDA 4P82A 4KGVA 3CE6A 4JXZA 2CZCA 4Q4JA 4TLCA 1RHKA 4XVRA 3W4KA 4NXNB 2GXSA 3RK1A 1IAQA 2GJAA 2YY7A 1HNXB 3HU3A 1BB8A 3IOCA 1COWD 1OX4B 1D9XA 2QLBA 1OPRA 3G2QA 3PQCA 2ESRA 3DPIA 1I24A 5AH0A 1VPTA 1EWYA 2YRMA 1C1DA 3CUKA 4YGXB 3OCWA 4UC0A 3WIUA 5EXXA 2RJOA 3SHWA 3EEQA 4C01A 1JVBA 1OTYA 1Q57A 1S02A 2WU4A 5AOBA 3MUFA 3WRYA 4WOJA 5EG5A 1A1HA 3NYRA 4BAZA 4DPKA 2R6ZA 3V9AA 2EZ6A 5DU2A 3KTOA 4EI8A 3TZ6A 4F2JC 5HKBA 3DVSX 3AG5A 5G2OA 1W46A 3SIXA 2QD2A 3AEKB 3O6VA 1KWGA 3OPYI 2C2WA 3V34A 1ZJWA 3OAAD 1HY3A 2AK2A 1N5MA 4B40A 4DAOA 3W8FA 1XDUA 3KDPA 1T1IA 3PNVA 1HC7A 1X9HA 1D09A 3PNBA 3VGJA 4HVCA 3FRIA 1N75A 4IVRA 3ESDA 2BF7A 1YMVA 2G8NA 3IE2A 1RJDA 4OM7A 4ZZ1A 1QZUA 2C9YA 4HZUA 1BGXT 1TIKA 3DO8A 3PUJA 4RX1A 2CJYA 3A2MA 3PHGA 4FX2A 2ZTMA 1YUMA 1LWOA 4RTJA 1G9XA 1R6TA 2VAMA 2IYLD 3EK2A 4PG4A 5FUYA 4C0QC 3H9EO 2V7WA 2YSPA 4CIXA 4DUYE 1KMHA 2O9JA 1L8LA 4U63A 2YTZA 4UREA 4WD3A 5JD3A 4CV1A 5J4KA 2EM2A 1NUTA 4Z4GA 1NOJA 1U98A 5TX7A 1NMZA 1CRQA 1T8TA 1JDJA 4NV3A 4ARSA 4BNYA 1VG0B 4LX0A 1FC0A 3F47A 1UP4A 4NU0A 3RQSA 2W71A 3NXSA 1R7RA 1YRHA 2GNOA 4LRWA 1CXZA 1ESCA 2H7VA 1Y89A 3IMKA 1Y9EA 4G9GA 1XLUA 2FB9A 3LGSA 5K3AA 4RCVA 1XE3A 5LOVA 1YR7A 4N18A 4CETA 3CBGA 2HADA 1T5TA 4B5LA 1R4NA 1S5PA 2R1VB 3NLLA 3RAFC 2HBQA 5C46F 2YNMD 3A6DA 4JV5E 3K9QO 4JS0A 3TX6A 3ENNA 1N0UA 4PIPA 1YB4A 4OJYA 4Y30A 4R2PA 4I1UA 1OILA 1VE3A 5TPWB 5LQUA 2C83A 3UGJA 2Z6QA 3ER8A 2QV7A 1PTJA 4L6AA 4DZTA 2O4CA 1QOZA 4LHSA 3RQIA 1KEWA 5BYAA 2FSGA 1SQ5A 4JODA 5E1BA 2I3DA 3IP7A 2JAXA 4JLDA 5L51A 1HL3A 1YPNA 4JI6E 1XZCA 2GPJA 4PFQA 4Q48A 1JTFA 3ROGA 1BX3A 3M0EA 1NUAA 4TLBA 1P5HA 4LA4A 2P27A 2Q1XA 1G8AA 2FQQA 2K4MA 5ECDA 3PDIB 3DFMA 4EHBA 4MI1A 1R0LA 2YWEA 3DBVO 3RIMA 2IHUA 2NPFA 3OOYA 3TXAA 4EG5A 2FWBA 1E2JA 2EQ3A 3SHFA 4Z5XA 3CPHA 4F5ZA 1DKLA 2JWOA 1RAEA 2C61A 3DLPX 3IIKA 1KKLA 3PSHA 1OZGA 1GA4A 3HV2A 1ICIA 2OM2A 4G89A 5DHPA 3WP1B 3HHEA 3RSOA 4AO6A 3D0KA 3IAXA 1NXQA 3EARA 3F6YA 4FX5A 4L2IB 4QDKA 5F78A 4M8NE 4DGSA 3K30A 1M74A 2F3QA 1CIJA 3GPIA 4HPXB 4U9IS 2QX7A 4BO8A 5LBUA 1DKMA 5EP2A 2ONKA 3FVTA 4PX2A 4RHEA 4B0OA 4CEHA 1C7JA 2NUAA 4FEAA 3N07A 4HB0A 1KJIA 3RRNA 2LGJA 4YMIA 4DRZA 1JAHA 4X0EA 1FXWF 1KO5A 3GMDA 1CDOA 4YCBA 7ADHA 2M6SA 4J07A 2JARA 2WFMA 5DJ5A 5JE8A 2HL6A 3U49A 2CHFA 1UMBB 4RV4A 2Y1GA 1R5NA 1TADA 3OFNA 1I0ZA 3DB1A 3I9V1 1Z4NA 3PQFA 5LP6C 4FBMA 4YDQA 4UQOA 1DAMA 2IYOA 3HDJA 3JWEA 1IOVA 2LJHA 1EG2A 1K7CA 1JEJA 1NYQA 3M9XA 4J3JA 1ZAYA 1NQOA 1E6LA 3K92A 2W4QA 1N92A 3GLIA 1GTRA 1QGOA 2PZFA 3WWEA 3KLNA 4TWIA 4MA4A 2PV7A 3H9JA 1WUJS 2JFVA 4FFNA 4LMPA 2Q6IA 4RGYA 4X1YA 5B2EA 3N8KA 5HK8A 5CITA 4EY3A 4K81B 4P4GA 1WDLA 2JANA 1T6NA 4RGQA 1U0LA 1V26A 3GAAA 3LWBA 2ODWA 3ZWXA 3FSRA 4HWSA 4ZMBA 2O8DB 1Z9BA 1ZGJA 2XWBF 3CRVA 3QVWA 4A16A 2D4HA 1PP4A 2DPXA 4LJKA 3B1XA 3HTXA 3K4HA 3LSTA 5KYWA 5AMXA 4ZVTA 3QE9Y 2RHCA 4UQPA 1XRMA 1YZKA 4MUKA 3S5UA 2EPNA 5MDHA 4B3ME 1Y5NA 3DG9A 3RVDA 1DE0A 4R3WA 3ZCXA 1RLIA 2VDOB 2BD0A 4IDEA 3EDMA 5C1OA 3WLLA 2K4VA 1C4WA 1QUFA 2LDBA 1IN1A 5KU1A 4U7PB 1BMFD 2CDCA 1E7YA 2I33A 2WSBA 3MT9A 4TV9F 1MGOA 3VU1A 5L7WA 1KRWA 4AKHA 4KVZA 2CNWA 4FD2A 5E6RB 2EPRA 3Q7TA 1LC3A 4NYIQ 4KSCA 3B51X 2A92A 5JZSA 3THYA 2CLLB 2EM0A 4TPKA 2RGBA 2XTNA 4RD0A 4F0JA 4F8EA 3OWOA 3FTNA 3I01A 4YCSA 2CDRA 2KBEA 5KJFA 1V6CA 3HVKA 2F1OA 3KBBA 3MCWA 3MF4A 4KHZA 2LP4Y 3UCXA 1WLYA 5B64A 4PYKA 4WECA 5FTNA 4NTZA 5CXUA 4Y2GA 1US8A 1PQYA 2P7HA 1KXZA 1IM2A 2QUKA 3N59A 4NG5A 3WG9A 1G2PA 5DCLA 3VPBA 2WYUA 3CXRA 5JO9A 4YRQA 5EY5B 1NVBA 5DNVA 1JILA 2WM3A 1JIXA 1J9EA 1WU8A 2UV8A 4DR4B 5LZ9A 5HMLA 5CFNA 1WPGA 4FP9A 4S1PA 2GS9A 3EIEA 5HCUA 2UXCB 1QBGA 3KWJA 3ZZNA 1CJMA 4LV6A 4UUPA 3F7NA 2J67A 3KXIA 4D57A 4MSUA 3HVUA 3ZGYA 4FQ5A 3H75A 3DLCA 3KKMA 4IIXA 2DGCA 5K4HA 1XP8A 4QGBA 1AN0A 2C9CA 2QNRA 1L0BA 5BUCA 2EWWA 3MC1A 2N42A 3NHMA 4WZAB 4YASA 3T1QA 2GB4A 2XGMA 4OX9E 3OFVA 4GKAA 2XUZA 3B1WA 2OXTA 4QPNA 3ZXUB 1QVRA 2BEWA 3IPCA 1JJBA 2ZR8A 5BY2A 1FRVA 4EABA 2AMLA 1GGFA 5LJIA 1H93A 3T1YB 3P9YA 1SCJA 4DMKA 4GP6A 5CT6A 3KZXA 1M83A 1UANA 4KDFA 1C4KA 2GYUA 1MC5A 2I13A 2XCUA 3K94A 5JT1A 2PA0A 3NC4A 2R7MA 1YMUA 1UEIA 5DTMA 4CR7A 2ZRCA 3MWDB 5DW3A 5KTMA 1NVAA 2Z5GA 4DT1B 4W5TA 1UAYA 2GBLC 4P7DA 2R8ZA 2HDWA 3LHSA 3SLKA 3O8OB 1VA5A 2V3VA 2LJUA 3T34A 3MAGA 3G88A 4P08A 4ZEXA 2ON6A 1T1EA 1L1QA 2PVCA 2GWHA 3MOSA 3RASA 1PR2A 3ZS8A 1A7KA 2GZHA 4EA9A 5HOEA 5FIUA 2ORYA 4PZEA 4RQTA 3QX3A 3IMEA 4J0EA 5BQ5A 3LT1A 2O2JA 1DNPA 2BTOA 2QRLA 1YC2A 3CSSA 3N6VA 1SXGA 3NHPA 4WXRA 1V8OA 5BYBA 1ZJ6A 3D31A 1ECJA 1TD1A 5AKGA 5AW2A 2VJOA 3JVUA 3GLIE 1XTKA 5ALPA 3O4IA 1T0BA 3JU3A 5EEHA 2F62A 3T41A 2KM1A 2HX1A 1W29A 4DOMA 1RXYA 4PSDA 4TTVA 3RHFA 2JAOA 4YPVA 1XNHA 2ERXA 2ZJ2A 3ETLA 3QYFA 4RK4A 4BIIA 1C3OB 2WYVA 3LOQA 3ZEAA 3AKDA 4BVEA 4UUBA 3F9RA 1RZUA 4H7EA 3UMSA 3GA5A 1AY0A 3T3NA 1AKWA 3ADLA 2OK8A 3CLSD 2VLBA 3H5RA 3KKOA 3BSSA 2ZJ3A 1PX2A 3C16C 4KV7A 1DTWA 2XD4A 4N0MA