1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
1IE3A 1VRWA 5COBA 1GZ3A 3H5RA 4RJTA 4D45A 1RWBA 3DOOA 3HUDA 4ALIA 4BO3A 2FP4A 4YEDA 1MA0A 1RM5A 2OHXA 4UEKA 2O7SA 3RFTA 3ZHYA 4CV0A 3K92A 4R4JA 3KETA 1K89A 4O0LA 3WGTA 3DONA 4DQXA 4B8WA 1XSEA 4HFJA 2JD0A 2DTDA 2HMVA 1EQUA 2CVZA 3FR7A 1NPTO 3MJVA 4YWJA 2JCVA 1Z7BA 2CZCA 4MJLA 3U4HA 2J3JA 3MZ0A 1BXGB 1KC1A 3JQ9C 5JO9A 4NMHA 3UOGA 3RC1A 1UR5A 4IDFA 1RJWA 1BXGA 1B3RA 1R4NA 1DFHA 4YJHA 3JQGB 1ISJA 1J4AA 3LLSA 3MJCA 3R1IA 4FSHA 4E2ZA 5H82A 2O3QA 1N1EA 2GPTA 5I8ZA 4W7IA 1Z6ZA 3DZKA 3RKUA 4IPTA 1UZNA 2NM0A 1NASA 4PZDA 1IPFA 3DAPA 3OEWA 3OQBA 4AL4A 5IXYA 2P9EA 1R12A 4HFMA 3D7LA 1PGOA 2A94A 4Y6PA 3HJAA 1DRUA 3OMLA 4F3YA 2VRCA 4YACA 1NQAO 2AEJA 3W6UA 3OA2A 4PCVA 4C7KA 1H94A 5IZ4A 4BO8A 2G82A 3COSA 1YE3A 3GH3A 3K31A 4RDIA 1YRLA 5GZ1A 4J6FA 2PKRA 5L9AA 1DAOA 3EUWA 1P0FA 4E31A 2EP5A 3RU9A 3FCOA 4Q3AA 4E5NA 2O4CA 2GGSA 2OL4A 5F1OA 3U49A 1XQ6A 4RVSA 4XD2A 4D0SA 5JCJD 5DCYA 1K6XA 2CNBA 4AJ2A 5A4DA 1GPDG 1V3TA 4FDAA 3SEFA 3JYNA 1E7SA 1XHLA 4PVCA 1MXFA 3DBHB 1C1DB 3EYWA 1O6ZA 3OEYA 3ONEA 4INAA 2G17A 1WMBA 5JAIA 1YQXA 4CM9D 4CM4B 4E3ZA 5LDGA 4E21A 2NACA 3OQ6A 5DBIA 1CERA 5IDWA 1QORA 2GSDA 2Y1EA 3HSKA 4JCOA 3Q2IA 3BMNA 3DAFA 2IDZA 3ADOA 1BXZA 1U2GA 3O38A 3WNVA 4IJWA 2LDXA 3GEMA 4DQUA 2VQ3A 1B14A 1YDWA 4WKGA 3FI9A 3SJUA 2WYVA 4XWYA 4NDNE 1KVQA 5MGBA 1NNUA 2ZJ0A 1SB9A 1EDZA 1LXCA 4EJ0A 2OXIA 5CDTA 1ID1A 3GOHA 4AJ4A 4DTIA 1ULSA 4BMVA 3DFZA 3LQFA 4D3SA 2C7VA 3GC6A 2OUIA 4CMEC 1LQUA 2EKLA 3KSUA 2ZYGA 4GX0A 2FRDA 3OH8A 3WICA 1VC2A 1I33A 3DBVO 2NTNA 4JX8A 4R1SA 3FNGA 1DIGA 2Q3EA 4Y98A 3OIGA 1I36A 3I9JA 1E5QA 3R0IA 3U62A 4L9RA 3DBRB 1GV1A 4CMBA 3UHAA 1U3TA 1Y9EA 3F3SA 3UW3A 3D4NA 1PS9A 1YWGO 3JSAA 4KZPA 2D2IA 4NBRA 5F1PA 3WIDA 3RASA 3I9KA 4FGSA 1G0NA 4CMAA 3H2ZA 3QHAA 2QX7A 2DTXA 4BMNA 3RJ5A 1XWFA 3DWFA 3RD5A 4DXHA 1PJSA 4IJUA 5BNIA 4TRRA 2GD1O 3DTYA 1GR0A 4M86A 4IDBA 1ENOA 3M2TA 4PLFA 4Q39A 1R15A 4U7WA 1DO8A 1H9BA 3WQSB 1N1GA 4NBTA 4GPD1 1ARZA 3OHSX 1EK5A 1T2CA 3QRWA 1ZIDA 1EFLA 4RORA 1KEWA 1GFSA 4Y67A 3C7AA 3WLFA 3LF2A 2X5OA 3RC2A 1EBUA 5KKAA 3NJ4A 4NIMA 3WGHA 3PRJA 3L4SO 2AHRA 1DLIA 4UUPA 4PG4A 1I01A 2D8AA 3M1AA 5AYVA 4WOKA 1KETA 5ICSA 4EITA 2PV7A 1KVRA 8LDHA 2G5CA 2QQ5A 3G49A 5BQFA 3HADA 3HWRA 2FWMX 2I6TA 2JHFA 1EUDA 4RPGA 1BGVA 3TZQA 3RKRA 2Q99A 1NVTA 4D41A 3DDNA 3HDJA 5A1TA 1JWAB 2Y66A 1F17A 2CD9A 2HKIA 5TNXA 1P1FA 3MOGA 3S2EA 2DQ4A 3M2PA 3FNFA 1ENPA 1DC3A 2I67A 1SNYA 1JVBA 1LTHR 3AOGA 1H5QA 4FJ0A 2G0TA 2XXBA 4N5NA 2ZTUA 4YA6A 5B4UA 3LYLA 1DSSG 4M49A 2NTJA 1M6WA 2Q2WA 3ZW8A 2VHYA 2WEKA 4HKTA 5CG1A 1OBFO 4M87A 4R41A 3AM3A 4U5QA 4CLOA 1QMGA 3KSZO 1E5LA 4FBGA 4IXWA 4XR9A 3NT4A 4ZU3A 1U3WA 3GVIA 2ZYDA 5BNTA 4RV9A 1A9YA 4QO8A 8ADHA 1PWZA 2HMTA 1NTOA 3GG9A 3L77A 4IQ0A 4IMPA 1LJ8A 1PEDA 2PY6A 3DZHA 1DFGA 3LLVA 5CPBA 3WQQA 3CZMA 1QXSA 2YYYA 3DZFA 4Z0TA 2ZB4A 1ONPA 2IYOA 3NDRA 4EGFA 3GEDA 3GG2A 4J4BA 4XQ9A 3EGOA 4BGUA 2VCYA 3P2YA 4H16A 2EKPA 3JYPA 3JQBC 4J1NA 5CEFA 5FWNA 4I5GA 1Q0HA 4ZQEA 5FEUA 1E7MA 4GMFA 4BVAA 1ISFA 1LSSA 4OOEA 1KYQA 3GAZA 1U8FO 4RZIA 4BO4A 1PJCA 1MC5A 3NAQA 5KVSA 4YQZA 1UXKA 1U2DA 3JQ8B 1P1IA 4FD3A 1R16A 3MJSA 3ZWCA 4JLWA 1HDGO 4G65A 1KEUA 3AWDA 5H83A 5T8KA 1P44A 3GHYA 1BWSA 1TB4A 4DWVA 1VL6A 4LCEA 1TA4A 3ZU3A 1L7DA 5I7EA 3OFSA 3ZV6A 2W2LA 4E0BA 2RIRA 1QLJA 1R0SA 3JQAB 1N9GB 1IL0A 1E6WA 1UDAA 4MVJD 2I76A 4E33A 5I7VA 3MJTA 3LDHA 4WCFC 1N9GA 2J3KA 3KYCA 2E4AA 4QXMA 4U0KA 4BNVA 4CUZA 4MKZA 1C0LA 4BOYA 3MCVA 1QYWA 3DFUA 2PD6A 3H5AA 4ND1A 1SZJG 3JD3A 1KS9A 3W8EA 1HYEA 2ZKLA 2HK8A 1LI4A 2AQHA 4XGNA 4TVBA 5TC4A 3TFQA 4ALLA 3IL2A 1O89A 2FPIA 4YRBA 2P9GA 3D3WB 2NADA 4J9VA 4HNHA 1T2AA 2PD4A 2PGLA 1MLDA 1Q0QA 4Z9XA 5THKA 4QO7A 1Y8RA 3ZV3A 3D0OA 2YHIA 1R6DA 2FY8A 5ILGA 3B20A 4NPCA 1YQGA 1I3KA 2WSBA 1KVSA 1ZK4A 3G1UA 1BDBA 1DHTA 2JCXA 4E12A 4ZD6A 2AA3A 1ZK2A 4PLWA 3W4IA 2IE0A 1Y7TA 5EJ2A 3A06A 3PK0A 3IAHA 2O2SA 4NK4A 5TIIA 2BH9A 3U4IA 1TXGA 4DPKA 3V5NA 1AUPA 3PIDA 3NRCA 1V3VA 5KJ6A 3AI2A 3LZ6A 1VPDA 2HQ1A 2VUSA 3HDYA 1E0DA 1S6YA 3S1LA 2CVQA 1J0XO 3G17A 3VZSA 2I66A 4MIYA 1ZBQA 3ZI0A 1DFIA 1ZXBA 2BFMA 1LLDA 3KXDA 4J90A 2GZ2A 1ZK3A 1X7HA 3L6DA 3KHUA 3RIHA 3SJ7A 1AXGA 4HWKA 4MO2A 4D3FA 2HRZA 3DQPA 2HMSA 4IS2A 1HDCA 3TZ6A 3KEQA 3HZZA 4CMIA 4E32A 4P4GA 3HG7A 2X8LA 3HB4X 3PJDA 1NWCA 1OAAA 1DIRA 1E1MA 4RF4A 4YJHB 5T5QA 5F3RA 2RH8A 3DOJA 3JQ7A 4NJOA 3GDOA 2BELA 4GWGA 3WTCA 4BO5A 4ILKA 2NU6A 2Y1GA 1EK6A 2VNAA 1Y5RA 4BNMA 1UXHA 1WP4A 1C0KA 3FBTA 4WK6A 5IXSA 2V65A 4TVOA 3GVPA 1HZJA 2C20A 1IUKA 4CM6A 3SXPA 4CM9A 1ZMOA 4IMRA 4M89A 3OJOA 4J1SA 3GDGA 2FSSA 4JROA 4I5EA 3DBLB 4G2NA 4Y9DA 3KVOA 2P5UA 3TZKA 3UF0A 5JYEA 1F0YA 2Q49A 4EUHA 1V3UA 3IP3A 3E5RA 3GVXA 1ZXLA 2O3TA 1HE3A 2P2SA 2XPCA 3N58A 5IDYA 4CLOB 4YT2A 3ETDA 1W0CA 5IZCC 3ON5A 1QP8A 4YRAA 2F1KA 1E3EA 4R3NA 3R6DA 1PZFA 3EY4A 3GVCA 5ENDA 5FI5A 1D3AA 1ENZA 2O2YA 2Y99A 2NQTA 2EJVA 3RUIA 5A3VA 2WD8A 1A4UA 4XB1A 1UH5A 4BNFA 3SBOA 4CM3A 1J6UA 1R0LA 4PRKA 1SC6A 1U3VA 5J23A 1YBVA 1XG5A 4KUGA 4R3WA 3D3EA 4DC1A 2UVDA 4ONEA 4U6SA 2JAPA 2VHXA 4BO2A 4YAJA 3WJ7A 3TZHA 1L1FA 1E7YA 4XDYA 3BMNB 1EVIA 1JU9A 2EG9A 3TN7A 1C3VA 5BSFA 2PZLA 1K2WA 1U5AA 4RPLA 4H15A 3IQDB 2NU7A 1JN0A 2PKQP 3V2GA 1E1NA 2YW9A 2IXAA 3ICPA 5G2OA 4CLEA 1P1KA 3T7CA 4FJ1A 2ZQYA 1ZVMA 4LK3A 2HMUA 3OF2A 4YRDA 2HAEA 3H9EO 3AU9A 1EDOA 1PQWA 5COQA 4BNWA 5G0TA 3H5NA 5CFZA 4J4HA 3KLPX 5U4QA 4OQZA 2OP0A 1PIWA 5ITWA 1VJ0A 2Z5LA 4RVHA 3WIEA 1I32A 2PZJA 2IEBA 2QZZA 1Q7BA 3OQ1A 1LUAA 4DYVA 2D5CA 2BI8A 4KUHA 4DIBA 1Y8QA 4LVUA 4B4OA 2Y0DA 4IDGA 4UULA 2QYTA 3IIEA 3PTZA 2I3AA 2FPPA 4LCJA 2ZB8A 3PPIA 1F8FA 4CLDA 2F00A 4Z6KA 1C1XA 1PS0A 1E77A 3INRA 1XYGA 4BNHA 5JY6A 1ZSVA 2RHRA 3KYDA 1ISHA 4OMUA 2DFVA 4IJKA 5KVCA 4UVHA 3VPSA 2VYND 1H6CA 4MPDA 3TWOA 4FFRA 5U1PA 3IJPA 1P1JA 1VL8A 1RM4A 3I6IA 1YBMA 4LRSB 1BW9A 3NUGA 3K2BA 4NBVA 5BR7A 3E8XA 4K28A 5G0VA 1BW9B 1ENYA 2EV9A 2ZJ1A 4N5MA 3FD8A 3X2FA 1VJ1A 3D1LA 1HDYA 4ZICA 2WD7B 2Z95A 3CKYA 4FC7A 3WMXA 3G79A 4B4VA 2AQKA 2PGJA 5MDHA 2B5VA 3F5QA 1SEPA 2EIHA 2R00A 2TMGA 2X9VA 3DO5A 3GFGA 4Z0HO 4LISA 2PWZA 1ZSNA 1ISIA 2BFAA 1QYVA 1UP4A 2VHVA 2DUUA 5G0UA 5TX7A 4FC6A 4FOOA 4GX1A 4WLFA 4MP8A 3VPFA 4XYEA 5IG2A 1AE1A 1T1SA 4AJ1A 2HO5A 2YV1A 3HNPA 1V35A 3PZBA 4KWIA 4B4WA 2BMAA 4JK3A 3ZCXA 1I5RA 3UH1A 2GZ3A 2QRLA 3F9IA 1M67A 3ZHZA 1R4NB 3ABIA 4JJIA 1KC3A 2BLLA 3AOEA 4CM5A 3EVTA 3KYBA 1D1TA 1Z74A 2Y1CA 3PLNA 4KQXA 4BL5A 4XQCA 4H7PA 1LC0A 1K5HA 5IN4A 1YB4A 2VHZA 1KERA 3BMCA 4CL8A 4DBVO 4UEOA 3I1JA 3UCEA 3BMOB 4D3DA 3AUUA 2GF2A 3PDUA 1KVUA 1LRJA 3PZRA 1ZEJA 4RQTA 3GA0A 3HN2A 4WLNA 5IFLA 1MP0A 3K2EA 2X4GA 4L75A 1B8VA 1YB5A 5CG2A 1KIFA 1G6KA 3Q0EA 1I8TA 1E7QA 3E9NA 4N5LA 1PJTA 4RLSA 5HBRA 4AJNA 2QRKA 1XDWA 4JXKA 4OXKA 3UAGA 4AVYA 1VKOA 2FZEA 2DTEA 1DEHA 5TRTA 1H93A 5AXAA 1GYPA 3HDHA 3FF4A 5F5NA 4LSWA 5A3JA 3HHPA 3BMQB 3BHMA 3QP9A 4CV2A 4TSKA 3PLRA 3L9WA 3I9OA 4PGFA 3U3XA 3TPCA 4HXYA 1SMKA 1M66A 3BHJA 1NAIA 2GNAA 2I99A 3VH3A 5B1YA 1YBAA 1T1RA 4ESOA 3CMMA 4KDEA 4NFYA 7ADHA 1BHSA 2FMUA 3WXBA 1HEUA 3S2IA 3WGYA 3A4VA 4MINA 3E1KA 3TJRA 4D0RA 4IDAA 1GZ6A 3V2HA 1E3JA 1G1AA 4GAEA 4BNNA 2Y1OA 3IDSA 4BV9A 4MVJI 5TJ9A 1FDSA 3RC9A 3H65A 1PWXA 4J7XA 3OICA 4RF2A 1YL5A 5KKCA 4RF3A 1XKQA 4IY1A 2BGKA 4JGBA 4PLZA 4ZHSA 2DUWA 2B4TO 1X1EA 5BSHA 4FCCA 4FPXA 3KYCB 3ANLA 1DLJA 5TSDA 4QTZA 3JYLA 2JHGA 3WR5A 3AI1A 3ZHXA 4D46A 3DL2A 4ZQFA 4R16A 1EUZA 3E18A 3LK7A 3ST7A 4BNLA 4BO1A 1DPGA 1H0KA 1HSZA 4QFCA 3EK2A 3EZLA 2AEMA 3H3FA 5TT1A 1DJNA 4E5KA 4WCFA 1CF2O 3DZGA 2W2LD 5ICMA 4XJSA 4J0EA 1WMAA 4WLEA 4HNGA 3I9NA 1N7HA 1N92A 2WE7A 4NG5A 1QKIA 3D3WA 1MFZA 2GYYA 1DC4A 1NHGA 4DGSA 1P33A 1NPDA 2Q1SA 2J5QA 3TFOA 3VOSA 4N18A 2A9FA 1IULA 5AXCA 5JDCC 3V8BA 1MG0A 3JQFA 3Q2KA 5ES3A 3U9LA 1O94A 2PA3A 1XQ1A 3VH2A 5I9NA 2WD7A 2X6TA 3ZWAA 4AFNA 1TT5A 2IRWA 2GCGA 4NFHA 1LLQA 3CTMA 5A06A 2EGGA 3WYCA 1NAHA 3GFBA 3DZIA 3G1TA 3AM5A 4YQYA 2OMEA 1V0JA 1R0KA 4BKRA 4B79A 3ROKA 1R4MA 2RH4A 3OIDA 2CF5A 5JPIA 3ENKA 3BZUA 3JQDA 3RBVA 3ZWWA 1R4MB 4EI2A 1T2DA 1YDEA 3C7CB 1DC5A 9LDBA 3OA0A 3WTBA 4CODB 2A35A 5A04A 4MIOA 1VI2A 4N7RA 3TL3A 1WDKA 3DC2A 3ZNPA 4FJ2A 4AG3A 1XA0A 2NSDA 3PIIA 2ZCUA 4XB2A 3V1TC 5T57A 1Q7CA 1HYGA 2CFCA 3UFXA 3PHJA 4CMIB 5DN9A 1E3WB 1PJLA 4EJMA 3GNTA 4YT4A 2HRBA 4GH5A 1U8XX 3ZU4A 5EIOA 5K0ZA 2DFDA 4D43A 1SCUA 4Y8VA 3LVFO 1H6BA 4XCVA 1JQBA 4OXYA 3TOXA 5KJCA 4DA9A 3QWAA 4B8ZA 3BMCB 4TRMA 3W4JA 2JJYA 3QVSA 2GLXA 4Z3DA 1I3MA 1DOHA 3WG9A 2FN7A 5HS6A 4NNJA 2JCYA 4HBGA 5ENVA 4IINA 2Q1TA 3GNQA 4ND3A 1ZK1A 4LVCA 4BKOA 3BMQA 2X0NA 3WBBA 3I52A 2BF7A 4FN4A 2OO5A 4A2CA 4RQUA 5FI3A 4BKUA 5T67A 3V2UA 3C1TA 2GN6A 3FRJA 3ONDA 4HUJA 4J1QA 4I08A 2VZ8A 4L8VA 1I10A 3ULKA 4BNUA 4CUKA 4EYEA 3PQFA 4GVXA 3ANMA 4IJVA 4PLPA 4RVFA 3B1JA 3PYXA 3F4LA 3JQEA 2CMDA 5TS3A 5IDQA 2NVBA 1JDJA 4XQEA 4D42A 3IMFA 2JAHA 5JNLA 3ZWPA 5A02A 2AQIA 1N5DA 3D5TA 1A71A 3LF1A 4PRLA 1ULUA 1JWBB 2O4UX 1XELA 5AXBA 4BNTA 1GEGA 3FN4A 1LLCA 3QWIA 4BQRA 1GCUA 1YS4A 5DZSA 1AN9A 2AE2A 4Q3DA 3K9QO 4NZ9A 4CQMD 2JD2A 2J5RA 4RO0A 3WFJA 3VKVA 1EUCA 2VN8A 4JQCA 4R9SA 4B3JA 3UXYA 1JKFA 4ALJA 3PEFA 4C4OA 4E4YA 3EDMA 1GPJA 4QX6A 1SB8A 3D4PA 5KOIA 2FZWA 4XIJA 1GL3A 4CLRA 2C59A 2WTBA 3RUFA 3MJ4A 2X5KO 3NT2A 1FDVA 5TLSA 4UUOA 4L74A 3JD2A 2B4QA 1K6JA 2NNLD 2XF8A 4FFPA 1KEVA 1PL8A 3CH6A 3JQ6A 1U4SA 4BGIA 3VH4A 4YJFA 3MTGA 4BUCA 4MVJE 4PZCA 4PLYA 4JBHA 3DBRA 3DTTA 2EHDA 5HS4A 3VPXA 4PLTA 1P1HA 2A4KA 5JY1A 1DBVO 2Q2VA 5TQVA 3KRTA 1PX0A 4CM8A 4YB8A 1PQUA 2H9IA 4GI2A 2O48X 5KNLA 3AM4A 3A9WA 4XRRA 5AVOA 2J3IA 3RUCA 4BNXA 4TZKA 4DREA 1ONOA 4HFNA 2X1HA 3A14A 1F12A 1A7KA 1XU7A 2CUKA 2DPHA 3GDFA 4NI5A 4WNCA 5JLAA 1Y81A 4XA8A 1ZNQO 2EF1A 1QV6A 1E1KA 2D5AA 3NTRA 4Z9FA 1F14A 2OORA 1BMDA 3KYDB 4IGFA 4ZJUA 3VVCA 5JDIA 4P38A 3EC7A 2HK9A 5DOZA 1B16A 4CMKA 1OZAA 4OOFA 1GV0A 1I2BA 1U5CA 5BT9A 1GQYA 3GGPA 1HYHA 3WQRA 2DT5A 2EW2A 2HJSA 4MP6A 1HL3A 3UGKA 3H9GA 2VYVA 3JD4A 5B37A 3LT2A 1HT0A 2I5PO 4J7CA 2Y1DA 5DP1A 4XKJA 3H2SA 4L0QA 4HP8A 1NVGA 4R9RA 4W6ZA 2Q2QA 2FR0A 4GQAA 2BRUA 4BNYA 4D7AA 4M8SA 4I1IA 4M54A 3RQSA 1E3SA 4LRTB 1QR6A 4NBWA 1FXSA 3T4XA 4BO0A 3QWFA 3UCFA 1CQJA 2PH5A 4I5DA 3M6IA 3NTOA 1PR3A 4DRYA 1M75A 3H7AA 2I3GA 3GN1A 4K6CA 5JE8A 1EFKA 1PZEA 5CEEA 2C07A 1TI7A 9LDTA 3RUEA 3ZU2A 3NKLA 1I3LA 4EUFA 3GGOA 2C82A 2IZ1A 1VSUA 5DDIP 1T2EA 2VYVD 3FNEA 2DM6A 4BHTA 4DUPA 2DKNA 3P7MA 5HWSA 1ADGA 1WAMA 4OO3A 4CMJA 4BO7A 2Q1UA 4IS3A 3RAJA 2GN4A 1IZ9A 2VWQA 3Q9UA 4PLCA 4NK5A 4IZIA 2VOEA 2AQ8A 2D0IA 4XR4A 5JXWA 1D8AA 2JFHA 2FR1A 2ZATA 4ND2A 4Q3NA 3VVBA 5AXDA 4TKMA 3Q11A 2PNFA 1ZSYA 2VZ0A 3LSYA 3OJFA 1KEPA 1WNTA 3EVNA 2YV3A 1NWHA 5C3MA 4P4NA 5L7YA 1ONNA 1B2LA 3IJRA 4W9NC 1DIAA 3TRIA 5LCXA 4OXNA 5CEJA 4KMSA 3L6EA 2HMWA 4W99A 4R68A 5JW6A 1PGJA 4J1TA 4TKLA 4YT8A 3WX0A 5C7LO 1PGNA 3EW7A 5EERA 3GRPA 4NQZA 3RROA 1DRVA 5BNFA 1E6EA 3IUPA 2OFPA 2GZ1A 2UV8A 1QG6A 4WEQA 5KJ1A 2X0JA 1BSVA 4NU5A 1J5PA 3IUSA 1EVYA 4I8XA 4A10A 4ALNA 4UREA 2RHCA 1ORRA 1HETA 1W4ZA 3DXFA 4LSMA 1NR1A 4A73A 3PWKA 5DF1A 1UP6A 2I65A 5A9SB 4IGEA 1DXYA 4PLGA 2RBEA 4FOSA 2P68A 4MIEA 3SX2A 3AOEC 4TWRA 1OFGA 1MG5A 4PG7A 2O23A 3WFIA 3AU8A 2E37A 4GGOA 4II3A 3VTZA 4UVDA 2VHWA 3O4RA 2HU2A 4GMGA 3PFWO 3AUSA 3CUKA 1OOEA 1PL6A 4YR9A 4FIZA 4ND5A 3ZN2A 2H5LA 3BTOA 2JFFA 1QSGA 2HSDA 3ZWMA 1A27A 1PS8A 2YFQA 1UP7A 1MX3A 3MJEA 5K9ZA 1AGNA 2PK3A 1YJQA 1UDCA 4YJGA 4KOAA 4PG6A 1E7WA 1XU9A 4OHUA 1EE9A 5G0WA 2Y0CA 4ZQGA 3Q1LA 3BTSA 4YJGB 3PHHA 3WSVA 5GMOA 3GUCA 3A28A 2DBVO 1M76A 1NP3A 4OJNA 3K8ZA 4JJFA 3UUWA 3H9QA 1GYQA 3NT5A 4Q3EA 1LDYA 2P9CA 3DAGA 4RGBA 1OC2A 1YKFA 2Q1WA 1BVRA 2O7QA 3ASVA 2PTGA 5JC1A 1B15A 1CJCA 4UEJA 3HFSA 4EJ6A 4FS3A 4PFJA 4IDDA 3W4KA 4A5OA 4WLOA 3VKUA 1LU9A 4RVDA 1B26A 2P5YA 4P4LA 3WLEA 4Z0PA 6LDHA 1EZ4A 4EDFA 2SCUA 3ANNA 5AOVA 3W1VA 3K6JA 3QE3A 4WECA 4D79A 1PJQA 2OP1A 2YUTA 3PQDA 3N7UA 3JCZA 5L51A 5CPFA 4HADA 5CDGA 3E48A 5EL0A 1VL0A 3GN2A 1CETA 4E2XA 5KJFA 2QIOA 4BKPA 5IDXA 4IBOA 3OJLA 5JC8A 3DHYA 1DAPA 2C29D 3T4EA 1YXMA 3O8QA 4BO6A 5DT9A 1WZEA 3VZQA 2QG4A 2EWMA 1U7HA 4RPJA 2BI7A 3PGJA 4UUNA 3VDRA 2XOXA 2EEZA 4P8RA 3GZ4A 2J6IA 3HB5X 2AG5A 4GLOA 4DYDA 3C1AA 3H9UA 4EBFA 2XAAA 2IODA 1E3LA 3DMTC 4YAIA 1B3BA 1I2ZA 3JQ7B 2BHLA 1PQPA 1FK8A 3TDKA 4R01A 3ZWBA 3RFXA 1JLLA 3AK4A 4GKBA 4AJEA 1O5IA 4HV4A 4QUKA 1WDLA 3QIVA 1DB3A 4J3FA 4JNKA 5JAQA 1GY8A 4YXFA 4NHEA 1UAYA 1GZ4A 5KWEA 1MC4A 3ZV4A 3JQFC 1OC4A 4RPHA 2OZPA 2O3UA 4WLUA 4Q9NA 3PDJA 3JD0A 4J0FA 4CQMB 4R5MA 3OETA 3E03A 2FR8A 2GERA 1R66A 2Q4EA 1GEEA 1YH3A 4DLAA 1FMCA 3IS3A 3QSGA 3LU1A 2EGHA 2NVUA 3B1FA 5JAMA 1Q7GA 1FF9A 2QZ9A 3OM9A 2B36A 3ENNA 4Z9YA 4MVJA 5DBFA 4B3HA 3SLGA 1GUFA 1ZW1A 1VSVA 4W4TA 1A7AA 2YHUA 5JSFA 2QYSA 4EEZA 3RVDA 3C3XA 3L6OO 3H4VA 3RC7A 2NTVA 2CSUA 1XLTA 4TZTA 3GT0A 1YOVA 2PZKA 1CEQA 1ZJYA 3U09A 2X23A 4Z3KA 2XXJA 1LRLA 4NU6A 3TNLA 3NX4A 4FR5A 3OBBA 1VM6A 4OYRA 5IZCA 5L53A 4I5FA 3LT4A 2DLDA 2X7HA 3CXRA 1GDHA 1CYDA 2GN9A 2G1UA 3KLMX 4A0SA 1DRWA 1A9ZA 2C54A 4M55A 3ZU5A 2HUNA 4GSKA 4LN1A 5C7OO 3OP4A 1NXQA 1YQDA 5IF3A 2NVWA 5KIAA 2ZK7A 1P1RA 4XDZA 2NV6A 2PLAA 3KSDO 4CV3A 5GZ3A 4KTVE 1CRWG 1ZKMA 3WGOA 4YAGA 4XZ3A 1PZHA 2P4QA 2PKQO 5T64A 3KO8A 3KZVA 3HDQA 1MUUA 2B5WA 4ZQBA 1WLYA 1ADBA 3F5SA 3G0OA 1V8BA 5KJEA 4U6QA 4DL9A 1EVJA 3WJAA 4E5MA 3ETGA 5A03A 1NQOA 2W8ZA 3RJ9A 4CL3A 3WNQA 5L40A 1U4OA 3B6ZA 2VOJA 4QQRA 5FYDA 3AY7A 4MKRA 3PJEA 4BNGA 3O26A 3RCBA 1JW9B 1I3NA 5AQ1A 3E6AA 1YB1A 1U7TA 3ROPA 1M6HA 5CDYA 3BXXA 3E5MA 3AW9A 5TJHA 1EEHA 1TVEA 4B7CA 3H3JA 3I9MA 3G3EA 2J8ZA 1BVUA 1C1DA 1O8CA 2DBZA 1NQTA 1Y9AA 3BTUA 4CM8B 2ZCVA 3DEYX 6ADHA 1W8DA 2UUPA 4IUYA 5G4KB 5T8KC 4YJDA 1NPYA 2BFOA 4E2WA 1H6AA 3P2OA 4KQWA 3OJEA 5G4KA 1GUZA 1Q0LA 1IOLA 2W2KA 2Q46A 5JAZA 1PGQA 1UZLA 4A27A 4CR8A 3F1KA 2QHXA 3TSCA 1VE9A 5CDUA 4H3VA 1HDZA 2GDZA 4IZHA 4ZGWA 3PWZA 1UJMA 4OSPA 2HDHA 2VYNA 3VHRA 3C24A 4WPGA 1NM5A 2G76A 5LDHA 1GUYA 1BDMA 4L4RA 1JKIA 3WYBA 2GR9A 1H6DA 3STHA 3CE6A 2V6FA 3L9XA 3JQ8A 5KTKA 4FFLA 4B7UA 1UDBA 3H8VA 4IIVA 3UKOA 4KUEA 2D1YA 3RBZA 2BGMA 4O63O 4BS9A 1GAEO 3NDIA 4ZN6A 5CAEA 1ZEMA 3PYMA 3VAZA 1B8UA 1RYEA 3HN7A 2Y67A 3QV1A 5K6AC 4E13A 4NH4A 1NQ5A 3PYLA 3JQAA 1Z45A 1P77A 4PG5A 1BXKA 1CIVA 1BRMA 4RZHA 3LC2O 4BNZA 1ADCA 2YQ5A 5U9CA 3E82A 1ML3A 4GL4A 1DHRA 3TL2A 2X58A 2D59A 1KBZA 3A1NA 2JKVA 3DHNA 4WGGA 3CEAA 1NFQA 2V6GA 4XYBA 1N2SA 4II2A 3F6YA 1E6UA 3FSRA 5JFOA 3BIOA 4OIMA 3HFGA 3H6KA 3VC7A 2Q4BA 2X5JO 5F1KA 3FPCA 2GRAA 1JA9A 3GMDA 1YL6A 1SOVA 4CMGA 3VZRA 5TT0A 3FTNA 1HSOA 1NVMB 3DBLA 3GRKA 4JP2A 4XGIA 2V7PA 4A03A 3QVOA 4K9DA 1PSDA 4PG8A 4F6LA 2E48A 1CQIA 4J9UE 4ROSA 1Z75A 4O5OA 3ZNQA 1B8PA 3GNSA 3FWZA 3TF5A 1X15A 3MOIA 2NVUB 3T7EA 1IHXA 3ZWXA 2PZMA 1HLDA 1F8GA 4UVGA 4XEHA 1WW8A 4DLBA 2W98A 1SEVA 1C0PA 2C2YA 2PH3A 3NEPX 4NBUA 4R54A 4YBZA 2E6UX 2EXXA 2ET6A 4BNJA 4GGPA 3I6QA 2ZTMA 3LC1O 4ITUA 4TMFA 1QLHA 1ZUD1 5B4TA 1X13A 3ROQA 3UICA 1DDOA 1UXIA 2EKQA 1NBOA 4YPOA 4YAKA 1O9BA 5JMWA 1KOLA 5L45A 5F21A 3GUYA 1WXDA 4M1QA 1M2WA 4JP3A 1AHIA 1ISGA 1BG6A 1L7EA 1YOVB 3JQ9A 4B7XA 3GLQA 3RUAA 3JYQA 1NFFA 4Y6SA 2W4QA 2Y0EA 4MP3A 4BGEA 5L4NA 1X1TA 3JD1A 3P5SA 3X2EA 1GYRA 3TOZA 1QYDA 3K5PA 5ER6A 4YVFA 4DLLA 4E5YA 4AICA 2WMDA 4GBJA 1YONA 1C14A 2POQX 3JV7A 4NFSA 5IJZA 2WWRA 1GQQA 3AUAA 2O3JA 3P19A 3RU7A 2OBNA 3W8DA 5ITVA 3FBGA 3VDQA 4DVJA 3ZNNA 2Q50A 1DC6A 3RI3A 4CR7A 1H2HA 2O3SA 1QRRA 4WE3A 2P91A 4FB5A 3AJRA 2D4AA 5L7WA 3PJFA 4QFDA 3EZYA 1RYDA 3ZWOA 2VUTA 5EQDA 3PHIA 2P4HX 1H9AA 5EMHA 1Y6JA 3OIFA 4URFA 1P74A 3GPIA 3GZNB 1C0IA 2AMFA 2B4RO 5A05A 1ZH8A 1OMOA 3OJ0A 3EMKA 5EESA 1S7CA 1PU2A 4I9HA 3UN1A 2UDPA 2W90A 1JTVA 2Z1NA 2BGLA 4YJFB 3CINA 5HA5A 4ALMA 3PJGA 5ER9A 1IZ0A 1HE5A 3DHEA 1NR7A 1D4FA 1LDBA 1N8KA 4OL9A 3W8FA 4QEDA 3WGQA 3CMCO 5T6BA 1G0OA 4O1MA 2ILTA 1Y5MA 3DBHA 3ADPA 2VT3A 4IDCA 1LA2A 1AHHA 2RCYA 5BSGA 1SO8A 2JFGA 2FHSA 1E1LA 5I9MA 3SC6A 1HLPA 1I0ZA 2GASA 1UXJA 2CVOA 1A5ZA 2RAFA 3QLJA 3QWHA 2VWGA 2W2KB 3QW2A 1ADFA 4MVJM 3RBXA 2C5AA 4J91A 2ZTLA 3NGLA 2YFHA 4CM7A 3FHLA 4JJGA 2H63A 2CDAA 4F6CA 4ZQHA 2VWHA 5DP2A 3QQPA 1GU7A 5JDIC 1TT5B 1U9JA 3B1KA 3CPSA 1GQ2A 3KV3O 2Y68A 4WOJA 4EUEA 4MVJG 1IY8A 3DZBA 1FJHA 3K30A 3O03A 1O0SA 3O8QB 4FFMA 5KVQA 4JBGA 1B7GO 2GO1A 2NUAA 4YTEA 1FDUA 4R1NA 3WMWA 4MVJP 3AY6A 4OH1A 1CWUA 4A7PA 3INTA 1H2BA 1NFRA 1UAGA 4X54A 2WYWA 4AJOA 3OSUA 3U0BA 1SBYA 2X0RA 4JBIA 2CF6A 2VTDA 3AY3A 4G81A 4DC0A 3ZW9A 1XGKA 3KBOA 1PL7A 4ZRMA 4U0JA 1ISMA 2NWQA 3D4OA 4DMMA 5JYDA 1HRDA 1SPXA 3WGZA 3DOCA 4MVJF 4XRGA 3VTFA 3PQEA 4WASA 2EERA 2DBQA 3VPGA 2BFPA 1X7DA 2PFGA 3S2FA 5JO0A 1SOWA 1T25A 4BV8A 2WJPA 3SVTA 4IDEA 1IYZA 2JD1A 3V1YA 3PHGA 1HDXA 4XYLA 2FOIA 2R00C 5B12A 2NLOA 3ZWYA 3TZCA 5EINA 4F46A 2C2XA 3QVTA 2UAGA 3WB9A 5IAAA 2ZB7A 1E3IA 1HTBA 1T4DA 3WSWA 1LDMA 4S3MA 5A5EA 3WWYA 3I5MA 1WPQA 4BB5A 4F45A 3U4CA 1Y8RB 2YHIB 2O50A 1LDGA 4TRJA 1RKXA 5DNAA 4CQMA 5L7TA 3JTMA 3C85A 4J43A 3ETEA 3Q9NA 4K6FA 3D64A 4L4XA 4XYMA 5EQFA 4B3IA 4FGWA 3GVHA 1GTMA 4KDFA 4L73A 4I9UA 2HLPA 3ZH2A 1HDRA 4KTTE 2C5EA 5ILOA 4W9NA 1Q1NA 1MGOA 1YVEI 1D1SA 3NDJA 5L3ZA 3ZWVA 5F5LA 3KB6A 4R51A 2VRBA 4QT0A 5CP8A 3NGXA 3N74A 2OOSA 2V6BA 1Z7EA 3EAGA 1O95A 3FR8A 4DBZA 4FW8A 3WS7A 3C7DB 5A9TA 4RDHA 4ND4A 5K6AA 3KM0A 1QYXA 1XIVA 3GQVA 4WLVA 3ZZNA 2IEDA 3WWZA 4CMCA 4DPMA 5HM8A 2UYYA 3Q6IA 3L07A 4HY3A 4WCDA 1I2CA 5DULA 1ZJZA 4ALKA 4HX5A 4CLXA 2Y1FA 3F47A 4NR0A 4FQ8A 4DIOA 1Z73A 3ROMA 1EE2A 4JIGA 1HF3A 4AJPA 4CPDA 1MXHA 3D5QA 4G5HA 4S1VA 5H81A 4HFRA 1D7OA 2D3TA 3LT0A 4XJTA 2HCTA 2I9PA 3BHIA 4CLRB 1XR3A 3PHLA 3RSHA 1P3DA 4YYZA 4EZBA 4RCVA 1PGPA 3I9LA 3QJ5A 3VH1A 5DBGA 4CJXA 4YAEA 2ZTVA 4E5PA 3IP1A 1XCBA 1TLTA 1PJ4A 2O3RA 3BMOA 3L4BC 1U3UA 2JL1A 4GWKA 2DPGA 1GCOA 2AEFA 2J5KA 2NQ8A 2PD3A 3WGIA 2B37A 4OSOA 3PXXA 5L95A 1HXHA 2B83A 3CZRA 2IYPA 1KY5A 1PTJA 1E92A 4GX2A 4IXTA 1FDWA 2IXBA 1UUFA 4MDHA 4R5HA 4PLHA 3TQHA 1HE4A 3ZGYA 1CDOA 3U5TA 2YDYA 1R37A 4AJLA 3ASUA 4RL6A 4RF5A 2HK7A 4CM4A 2VT2A 5CDSA 3F4BA 1I24A 3E9MA 4YCAA 4PZEA 3RUDA 1P45A 3E9QA 4BQPA 3R3SA 5L4SA 2B35A 3C1OA 3BAZA 4AJIA 3INGA 4OM8A 4OKIA 1Y1PA 2C7GA 3RUHA 2B0JA 5EPOA 5I7SA 3QY9A 1GADO 3VPHA 3AFMA 1LDNA 1W6UA 4J7UA 4E6PA 3QVWA 5GY7A 3V1UA 4BIIA 3IKTA 1HZZA 3UVEA 3K73O 1LSUA 1LSJA 1NX6A 4I9NA 4J4TA 4PLVA 3K96A 2LDBA 2H6EA 2DAPA 2ZQZA 3WGGA 2CDBA 3ZV5A 4YT5A 5LC1A 1QV7A 5BSEA 1K0UA 3HQ4O 3LC7O 1N7GA 2AE1A 3WDSA 4K1LA 2X9NA 2YQ4A 4J2HA 2R6JA 4B4UA 4J16A 4XYGA 5I7FA 1LNQA 3F1LA 2ZB3A 4JN6B 4AJJA 1PJ2A 3GY0A 4IM7A 1T26A 3HE3A 2WDZA 4NJMB 2E49A 4UAGA 5C5IA 1A72A 1LLUA 1LSOA 3GR6A 2AG8A 4NJMA 1P0CA 4O59O 4Q3BA 1EQ2A 1X7GA 2CY0A 4W82A 4RVGA 1T2FA 3QA9A 4DQVA 4AJKA 4CM1A 1HDOA 4CR6A 3WYEA 4OGWA 4BB6A 4CUJA 1TT7A 4W7HA 2PR2A 3OECA 4OKNA 5DOVA 1OI7A 5C37A 1P31A 3S8MA 4LW8A 1Y8QB 3JQCA 1E7RA 3B70A 2VRCD 5FFFA 1U1IA 1YJ8A 1YL7A 1W73A 3NV9A 1K3TA 1ZZEA 3PP8A 5C7IO 1KY4A 3JQAD 3I83A 2GN8A 1YGYA 4LMRA 4Q3CA 7MDHA 1V9LA 2IZZA 4GSLA 4ZVVA 1SAYA 1X14A 3KTDA 3U4DA 1NYTA 2Z1MA 4RLHA 4WUVA 2C0CA 1LDEA 2NU9A 3FNHA 1UXGA 1LEHA 1RPNA 4GVLA 1PR9A 4PIVA 1P9LA 3BYZA 2DVMA 3F46A 4ZA2A 3UCXA 1EBFA 3VZPA 1WZIA 4FFNA 3I23A 3ZNOA 1U28A 3MTJA 1MV8A 1VKNA 1ZK0A 4J2OA 3AUTA 3ZWNA 3ICCA 1A4IA 1KVTA 4J49A 5L4LA 3GPDG 1LX6A 3I3OA 3SLKA 3MWEB 1DIBA 4LGVA 5CHEA 3PGXA 3IC5A 2Q45A 5A9SA 3BTVA 2ZIZA 1LBEA 4RPKA 4WJZA 5GZ6A 3KEOA 2J3HA 1X0VA 2AXQA 4PVDA 3ONFA 3L4BA 3PI7A 4R1UA 1B0AA 2ZYAA 1DJQA 3Q3CA 3JQBA 1YO6A 3PVZA 1E3WA 3FWNA 1HWYA 2H1SA 4P22A 1T4BA 4YDRA 3S2GA 4UUMA 1RM0A 1ZFNA 3JQGA 4FFOA 1JAXA 1WDMA 1ZCJA 2QRJA 2PGDA 3L0DA 4QECA 3ZDFA 2FSVA 5KVVA 3ITKA 5FF9A 4BNKA 3FPLA 3AI3A 4R69A 4XGKA 1PJBA 3IOYA 1F06A 1WWKA 4ID9A 2VNSA 4TRNA 3BA1A 5DCUA 2YZ7A 5THQA 4BGVA 1FDTA 1K6IA 4UVIA 2EJWA 4CLHA 3GZNA 5I9LA 4KP7A 1LRKA 4L76A 1LC3A 4BMSA 2AW5A 1TEHA 4GX5A 3ITDA 2UUOA 4N54A 3GHHA 4EEXA 1J49A 2YY7A 2YDXA 4XX0A 3MWDB 4MOWA 4AJHA 3DB2A 5B4VA 3I4CA 5A5FA 4RVUA 3KOUA 4DMLA 2YJZA 2QW8A 2X9GA 3I4FA 3AFNA 5COAA 1HE2A 3NYWA 3WOHA 1JKJA 3SC4A 2YV2A 5JS6A 1VJTA 4KWHA 3GMSA 4OQYA 1X0XA 3DMYA 3GF4A 2X86A 4ZRNA 4TROA 2Y93A 1RM3A 1PZGA 3MEQA 4U8GA 2OGUA 1HKUA 2X0IA 4IQGA 5JMPA 1IHYA 3GGGA 5KCZA 3CIFA 1I30A 4PN3A 4WNIA 4BNIA 3FTPA 3DZJA 5JCJA 2DC1A 2GUGA 4MKXA 1JVSA 3NTQA 5TGDA 2BKAA 2VTEA 4UVEA 5G0SA 1AXEA 3RFVA 3ORFA 1MFPA 3M1LA 3PWSA 3JYOA 3RWBA 2B69A 3IKVA 4A26A 2R2GA 1EVZA 4D44A 1MB4A 2HJRA 1QYCA 1DIHA 2Y05A 3DR3A 1IB6A 3NJ8A 2OBYA 4GLLA 2EP7A 2WM3A 2VZ9A 5DCWA 1LQTA 5JCXA 5JBIA 4XQGA 1UZMA 2FPGA 4IIUA 1IPEA 2VUUA 3QVXA 4CMHA 2VWPA 4CV1A 1ZMTA 2E82A 4MVJH 2A92A 4R1TA 1NHWA 4IQ8A 2V6MA 5EN4A 4C7JA 4TQGA 3C8MA 4LMPA 1Z82A 4CQLA 4WEOA 4E2YA 5JDCA 5HTOA 3R3JA 4L4SA 4WCFB 4QSMA 2WE8A 4CQLB 4BKQA 4GKVA 1Q2XA 2WYUA 3EHEA 2IZ0A 4EW6A 1C1XB 1ZO8A 5ADHA 1GD1O 5IN5A 2NU8A 1JAYA 3GAFA 3PFFA 2CDCA 5I8WA 5HRUA 1EMDA 3W6ZA 2TMDA 4CMEA 5A9RA 2BD0A 3GEGA 3O9ZA 3S55A 1PJ3A 4O6VA 1WVGA 3WBFA 4DIFA 1BTOA 1XEAA 2DU8A 3GK3A 3QWBA 4DPLA 4Y6RA 5TF4A 1V6AA 1T24A 2EW8A 3CSDA 3KUXA 3ZHBA 2X22A 3DMTA 3H9JA 1VLLA 4BO9A 4E30A 4K26A 4XIYA 3LT1A 4OAQA 5G4LA 2DBRA
chains in the Genus database with same CATH superfamily
1BX1A 3P2MA 1W52X 3ANSA 3LO5A 4R2RA 1GZ3A 2Q5JA 4LPKA 5ALPA 5A7HA 3DOOA 3ZE7A 1P2VA 4NXNB 4LYGA 1N78A 1S2DA 1B74A 5IC5A 1SXGA 1XC7A 1BU5A 4FDTA 4RTPA 2XVMA 4G9BA 2JATA 3KJHA 5DLQC 4AO8A 4DUGA 3NWBA 1L1QA 5T3YA 3U3RA 2XITA 3ICVA 2QSZA 2ST1A 1P5FA 2JBAB 2OBBA 4Y1RB 621PA 4OHBA 4B8WA 3A37A 4HFJA 2JD0A 2DTDA 2HMVA 3PSHA 3W9UA 1J0BA 3HU5A 4TX1A 4YI3A 3LXUX 4P7JA 5IABA 1YFLA 1BE6A 1WCWA 2JCVA 2CZCA 3G2QA 3ONWA 2J3JA 3DEFA 3MZ0A 4UHEA 4Y2JA 4LXIA 5JO9A 4NMHA 2QXUA 4BBPA 1WY7A 2H9YA 4WKCA 5JH7F 3CLHA 1IHUA 4G2TA 4ZOQI 2XRYA 5JT1A 3IPCA 3DV0B 3E9EA 1B3RA 3WKCA 1R4NA 4JJEA 5JH7B 3D8UA 3LLSA 4JYAE 2XY4A 5DM70 4E2ZA 4PCAA 1L5SA 3AB8A 2EX0A 3ZIAA 2GPTA 1J56A 2PNJA 4IFTA 4R2LA 4AM8A 4YONB 3RKUA 2DQYA 1ULAA 1NF3A 2KB0A 4IPTA 5DX0A 4EFLA 1UZNA 2ANCA 1IPFA 1GZ5A 1NI4A 1HV8A 3OEWA 5J2UB 1MX9A 3V32A 4AL4A 4BJ3A 5IXYA 1YRAA 1IEXA 4DJAA 5LA6A 3EZ6A 4KQGA 5ALHA 4F3YA 4MUGA 1W85B 3KZOA 4G0YA 3SF0A 2DFKB 3NIBA 2GK7A 4K2HA 2IZ5A 2YNMC 2O2HA 1NQAO 2MYTA 3OKCA 4PCVA 4EUSA 4C7KA 4TMXA 1PLLA 1JIIA 3GRZA 4KW7A 4X5OA 5K3DA 3WA6A 2DLKA 1FP4B 5JTTA 3URKA 2PT7A 1X9IA 1YRLA 3EZ9A 4FSXA 4L51A 3ZXIA 4CT5A 3HO8A 1L2TA 1XXHB 4Q4AA 3RG2A 4GEKA 1PFGA 4B1FA 1OYVA 4R40A 3ZHTA 2GKOA 3AT1A 1KPIA 2GGSA 4IIJB 2CE2X 4D0SA 4ABYA 5JCJD 2RG7A 3KJEA 4OGGA 1K6XA 4AJ2A 2HA5A 1GZHB 4HBZA 4KJXA 1AK2A 2GBIA 5GGYA 3C16C 4WHMA 4QQFA 1NBHA 3VNVA 2Q1XA 4LY0A 3QEMA 2G17A 4INAA 2W2PA 5AHXA 3EF1A 3FCEA 2VTVA 1JJIA 5DLYA 5F2KA 4WXMA 1WOYA 2E4UA 4E21A 1K4MA 2CXTA 2JAXA 3P9YA 4AZ0A 4XSGA 2I4NA 1QORA 2HY7A 3MFQA 5FL7D 3G0GA 1VFNA 1J2TA 2NQ2C 3AHCA 3HSKA 3LY9A 4JCOA 4KXQA 3JZDA 4Q03A 4BWFB 4RMGA 1OA0A 5T4EA 4AZ3B 3DWIA 4V0LA 2JJ2A 5K0LA 2GJKA 3TSWA 1BXZA 3B2EA 3FYTA 2QRPA 2ZSFA 1XQWA 1U0RA 3E7FA 2ZSKA 3B6EA 3ENQA 4IJWA 2AN4A 4LUCA 2YS6A 3EZ7A 2FPXA 4MUEA 5DV9A 5LYJB 4DQUA 2VQ3A 1PUIA 1B14A 3EXIA 4PYOA 4YMTA 1YDWA 4EABA 1TTPB 4J0QA 3SC3A 3D1VA 3H4IA 2ELYA 3L7JA 2P0AA 3N0RA 1SUCA 1KZHA 4JJ8A 2HCFA 2QLMA 5CXXA 1CIJA 1XLVA 1X42A 1Y3CE 4OHOA 3SZOA 1II9A 1KVQA 4KQFA 2FW1A 5F35A 4OY3A 1AK9A 2EZ8A 3QKRA 1T1IA 2H06A 2ZFUA 1ULSA 2Q3JA 3ISVA 1EFRA 4AECA 3GC6A 3G0IA 2OUIA 1W30A 1U0SY 1XAJA 2PXCA 2VF7A 3AEQA 4JGIA 4N0DA 4CMEC 3TEMA 3AEXA 2JH8A 4HEJA 5REQA 4Y98A 1ITZA 1FSGA 3OIGA 3ZYCA 4X45A 1WB5A 2HHHE 3DBRB 4ASUD 1T5HX 2HA6A 2Q0HA 1T13A 4CMBA 1RU3A 4JI0E 1U3TA 1Y9EA 2WYOA 4ICIA 4OQXA 4L5NC 3UW3A 1XU4A 1X1RA 3AHFA 1EVEA 3AHIA 1YJXA 2GZDA 1ONSA 1T8RA 1M8GA 2D2IA 5IJXA 3WIDA 3RASA 1BMTA 1OLOA 3I9KA 1MPXA 1G0NA 5TMDA 3F5FA 4F5YA 1JFSA 2C4NA 2FWPA 1WXWA 1D6NA 3Q7PA 1GCGA 4K05A 2DTXA 4U3JB 4C0KA 1XWFA 2GN0A 1YZUA 1L4GA 3DWFA 4C3OB 4YCSA 4P36A 5BNIA 3R5KA 1PW5A 4Q7EA 2GK3A 1QO0A 2CCJA 1I3CA 2GZRA 4IRMA 4HNTA 1KTVA 4RFLA 5AHOA 5EPUA 2OV8A 4UCWA 1CY7A 3TW6A 5LNK1 2LE0A 4EMTA 3TEFA 2FQYA 2QTFA 1Y63A 3LPLA 1U7PA 3HKEA 1Q6YA 3QX7A 1D5CA 1R15A 4RMJA 1H9BA 1BFKA 4NU8X 2RAUA 4LZZA 4DDKA 1ARZA 1UBKS 3LCMA 1EK5A 3QRWA 3VR2D 2QAGA 3FVVA 4RORA 4LVNA 2LUOA 4HUTA 1Z2PX 4MW7A 1RCTE 4B3BA 5JSZB 3FFAA 4RH0A 1E5TA 1WS6A 2EWWA 3C2QA 1GTRA 3KR0A 3GBVA 2O5EA 1XBTA 1CBUA 2JIOA 2WINI 2ETXA 3AERA 3C8DA 4D0GA 3JAMA 1LZKA 4NIMA 1G98A 1C8KA 4TTTS 4DV6B 3FFXA 4GOXA 4BEVA 2D7DA 2QJTA 1KI8A 2R84A 2G77B 2H2HA 3E9RA 1I01A 2EMHA 5JCOC 1QAMA 2WWXA 3KS9A 5AYVA 3NBFA 4MMZB 1RBMA 5EZYA 1ZL0A 3HL4A 2CJWB 8LDHA 1EM8A 2W71A 2QQ5A 3A2LA 5BQFA 1YI1A 3HADA 3HWRA 4ENUA 5C34B 2I6TA 1L3CA 5I5EA 1BGVA 5AJXA 2YHBA 4D4JA 4E88A 5K5EA 2VK2A 4B9EA 2FDRA 3LGAA 3T38A 1G7TA 1N1DA 3PNPA 5EWLB 5JAUA 3L6CA 5CVJA 4BB0A 3R5FA 4OH7A 1NVTA 1SXJC 4C6SA 4D41A 3HDJA 4EHIA 3AVXA 1NDQA 3KDPA 4K9NA 1JEQA 1I0LA 3BUSA 1O77A 3DHVA 3S2EA 4BRSA 4YCBA 3U1TA 2K7FA 1FOEB 3QU2A 1ZVQA 2ENUA 3O9MA 3VR4H 4EELA 1JVBA 2AJLI 3AOGA 3L1HA 3PXDA 5C3UA 2GPIA 3H84A 2NPOA 3PJRA 3SSAA 2G0TA 4N5NA 4DOMA 1EFHA 3SJCA 5KU7A 3FTQA 4YA6A 1ANKA 2C0PA 3PPYA 3VYRB 2VPYA 1Y5NA 2HTEA 3NHSA 4NZYA 2VP9A 4HKTA 3D8BA 3BHNA 2N3GA 4L4ZA 4M87A 2WTXA 3NHJA 3O4IA 1YBHA 4LMAA 4XM2A 2FMTA 1MVOA 3B36A 2XF2A 3EWSA 1BX0A 4OAOA 4HC4A 4MWSA 4IF4A 1E5LA 4RAQA 3U4MA 1HQCA 1SFRA 3BWBA 3I76A 2IYQA 2H5EA 3D7MA 1T9KA 2WJJA 3EIHA 5TARA 3T7IA 3AFHA 5TGZA 4WXCA 5KPDA 3MTAA 4M98A 4PHCA 2LTRA 1KO7A 1WP9A 2C8JA 4NMMA 4QASA 4RK5A 3GEEA 4CT0A 4ZT4A 1CZRA 2FW8A 3Q8MA 1U2GC 1QBGA 2VJDA 3MD9A 8ADHA 4TWJA 2I4OA 2W8BA 3AXTA 3C3YA 4I6EA 4NMXB 4WK2B 2IP2A 3DL7A 1IBLB 3WYNA 3L77A 1SD1A 3CNOA 4HDKB 4G4SO 4V3BA 4INPA 4UHFA 4AD8A 4WI1A 1HA3A 1QXSA 4GEGA 5ALYA 4Z0TA 1IDN1 2NSLA 3BH0A 3WLHA 3F71A 4BQFA 3OU7A 4WFQA 2IYOA 5MF6A 4EGFA 2SKEA 3GEDA 5KOYA 4UBNA 1E1RD 4NDZA 1IOZA 4XQ9A 4DLYA 2BEUB 3GPLA 4ZO6A 1IZ7A 2OE2A 2HSWA 2VCYA 2Z8YM 3N28A 2EKPA 3JYPA 3P2YA 2FN4A 4J1NA 3CW9A 3EYAA 4ZQEA 5FEUA 1TVKB 3HPZA 2ECFA 3TTWA 4JXZA 4O4LA 2A0WA 4ZVMA 1C0EA 4BVAA 4K9LA 1ISFA 3DKKA 1HDIA 2BVNA 2OXFA 1D2CA 3GAZA 4X1YB 1D6JA 4M0VA 2X5NA 1U2DA 4LF8B 3AETA 1J00A 5TF0A 4K81B 3T5GA 1HDGO 1XWWA 3EJWA 1KEUA 3QM1A 4QRHA 3W8RA 1I6KA 1SOMA 4BBYA 4BX8A 2WNSA 5IFKA 1QU2A 3NZEA 3MLEA 5EIXA 4ABTA 3K9NA 4LCEA 1TA4A 3VU3A 2E5LE 3HY4A 3E5NA 2GRJA 2O8CB 4ZOAA 2RIRA 3IEKA 3HXLA 4P5DA 3JQAB 5AM1A 3ADCA 2O8CA 1FQWA 3IQFA 3TH5A 5JD3A 1VYHA 1XEWX 2I76A 3R8XA 4WCFC 1ZA1A 1CDEA 3DT8A 4HQNA 3TXXA 2E4AA 3AUFA 1WL8A 3Q85A 4MKZA 1YS9A 2OHHA 4ZVNA 4DZTA 1J39A 2GF0A 5EJ9A 1WHTA 2BGTA 1TADA 3JD3A 4JA0A 1KXZA 3I37X 2C7QA 1SCNE 5ARBA 3PICA 4ALLA 2PE5A 3R3YA 4HUQB 2P9GA 3I3SR 2Z8ZA 4IQFA 3TEJA 2H07A 4J9VA 4NCIA 5EE9A 3P5BA 4JR0A 2CHUA 5ARCA 3GEHA 3HXTA 1DX9A 1I4DD 1ECBA 2OYSA 1FRFS 3B20A 4D9FA 1YQGA 1MAHA 4DHEA 1KVSA 4OGKA 1AS0A 1OCEA 1P4RA 2FPMA 2JCXA 3KZZA 3SBEA 4YUAA 1ZGCA 1YA6A 1M2FA 3GD7A 4Y9TA 1Y7TA 3H2IA 3A06A 3HR4A 4HH0A 3BB3A 3PB3A 3AVUA 4KBGA 1ECGA 1S2MA 5HDBB 5BQXA 2BEWA 4D1YA 4NU0A 2OQVA 1RAHA 2EP8A 3NRCA 4QNMA 3ADBA 3AI2A 2H52A 1UMCB 2WPDD 5FPQA 1A77A 3GUVA 5CCXA 4M6WA 1QWOA 3K0FA 4DZRA 1UMCA 1ACMA 1NRIA 1JX6A 1JA1A 1KAMA 2VK8A 1J0XO 3FOAA 2G28A 2IV3A 3WV4A 1C5KA 5LL6P 2XEDA 2I66A 2QGNA 4Q1VA 3TI9A 1FTYA 4QARA 1GGNA 2XBLA 4HZGA 1ZXBA 1LLDA 3WLNA 5JQWA 1RYYA 3ABRB 4DAEA 2FSFA 2QL5A 2OO5C 1ZK3A 3IVRA 3PR2B 2HPHA 4P58A 2CYCA 3NIDB 1ZESA 4HWKA 5DTQA 1WW3A 3SQMA 3H8SA 2B7VA 4Y2HA 3TIGA 2JEYA 4HN9A 4Y3UA 5EJMA 4OMFG 1Z07A 4WXRA 1L4HA 1RKUA 1DNPA 1U6KA 2COUA 2ZUVA 4M83A 5EHNA 4MGIR 1OLUB 3I9V1 5BWCA 3KDAA 2FZGA 4WNIA 4BLQA 1EWVA 1A1SA 5HUJA 3HB4X 3ILXA 2LV2A 1FTNA 1NWCA 1NW5A 3CW8X 1DIRA 1K08A 4RF4A 4YJHB 5LQAA 3ZEIA 3MRSA 3IQIX 3QE2A 3ZHCA 4FE3A 4JI3E 2FJ0A 5JNTA 3QEBZ 3GJRA 3HCDA 2NU6A 1EK6A 2VNAA 4UDXX 1QOPB 3L06A 5E0OA 3TUZC 1WP4A 3C41J 2H4JA 3W2IA 2Z6AA 4G5RA 4QOEA 3CH5A 2JZNA 5FD8A 2QJOA 3KEGA 5IXSA 2CCKA 5J5AA 2V59A 1YZKA 2C20A 3LQ1A 2FSGA 1KKLA 1XMXA 4CM6A 1W2WB 2QX4A 1OXXK 1ZMOA 4IMRA 3SXPA 3ZY4A 4DNFA 1ECLA 1IXKA 3OJOA 4Q4HA 1DBIA 1L4NA 5AVUA 3A1VA 3GDGA 1DXHA 1U3DA 1N75A 3HWX1 2HXYA 1QE5A 3P96A 1E9EA 3TZKA 4P4SB 2WTUA 2C3UA 2EF0A 3IP3A 4K46A 4M8KA 3FM9A 5IUKC 2R1FA 1OE0A 2O3TA 4CLOB 4YT2A 1QNTA 1IXYA 1M1YA 2ID9A 3WIBA 3ON5A 1O54A 1QP8A 4FT4A 4KVFA 2YFKA 2GJAA 3T3MB 3VHQA 4E08A 4YRAA 3RLFA 5KNBD 4YUXA 4R3NA 3J80A 1PZFA 4EB3A 4OP3A 1NJFA 5KEIA 1DVRA 3FVWA 3MB5A 1D3AA 1ENZA 3JWHA 4DMUB 5E4FA 4KODA 2YRHA 2YIMA 4HEQA 2V87A 5C53B 2KJQA 3DE5X 5DSZA 1X80A 2C84A 1G7CA 5ESRA 2VNHA 1KYYA 1J6UA 3IB6A 3V4FA 2GLTA 4KLNA 1NMSA 1FEZA 3HMKA 1DGQA 3A2KA 4CN8A 1T5SA 4E11A 1MHTA 4URZR 3BORA 1N5RA 5L7WA 6AT1A 4HXEB 1BGWA 3MCTA 2PL9A 3VYYA 4KWEA 4DV3B 1P39A 4ONEA 4Q9JA 3NWPA 5C81A 1LTQA 2W5UA 4QOFA 2IHYA 5EAIA 1L1FA 3QKWA 1N0VC 1P17A 1JU9A 3H9BA 2EG9A 3TN7A 2O8FB 1KYVA 4BLSA 1C29B 1DMRA 1K2WA 4FU0A 1OROA 1U5AA 1G8AA 4FZ5A 4G67A 2VDVE 4KFTA 1XK6A 2Q8QA 4UTZA 2G9ZA 1USIA 4H15A 1T34A 4PM4A 4ZAVA 4CKCB 3CX6A 1NJ2A 1DKQA 1G66A 4IYJA 4UBJA 3UK1A 4BX0A 4G0OA 1YS6A 5EXTA 9ABPA 2EMBA 3P9PA 1UADA 3HS3A 5E3IA 1P1KA 2ENHA 3AJ8A 3FCYA 4G5YA 2G9NA 4HVTA 1L7MA 2PJDA 3C5VA 3BIDA 2XWBF 3I1FA 3AEZA 3FFTA 3H9EO 2HK6A 3AU9A 5FB3A 5GONA 4BNWA 1IEQA 4DCJA 5BYKA 2EOXA 4ZEWA 4CDGA 2ZYVX 2JLCA 2EMXA 4WH0A 5HVNA 3IIMA 3CT4A 3ADDA 1HFKA 1KSHA 5ITWA 2DY1A 2IEBA 4F2PA 3OQ1A 1LUAA 1PNOA 1D9XA 1TYZA 2D5CA 3ZK9A 2JB9A 3LBNA 1Y8QA 2PSSA 4LHXA 5SY9A 3T35A 2Y0DA 4CETA 4IDGA 5I7OA 5EWMA 3IUQA 3PTZA 3A32A 3F6PA 2XUHA 4MW4A 4B35A 1P7VA 4HRVA 3ZLVA 4MW1A 4QM6A 1I7QB 3QZUA 1F8FA 2MSWA 5C8YB 3VYVA 1C1XA 4MYTA 1LK0A 4FK8A 3BD9A 3H19A 4TWAA 4BNHA 1CY4A 2E3JA 1ZSVA 4JJ4A 5GV7A 3VBEA 3DFIA 3NTUA 4OMUA 3B60A 3RDPA 5AVWA 2WUEA 1H6CA 2PBRA 1PYDA 4FFRA 3KKQA 5U1PA 4ESVA 1S2OA 2I7TA 3EVGA 3CEHA 1MRZA 2DECA 1JP7A 2MTBA 5EJAA 4NCJA 4LYDA 3I6IA 5ALQA 1VSQA 3X1YA 2J9ZB 2X4LA 3NHAA 1PBNA 3NUGA 4NBVA 5C0OE 4UDYX 2WTEA 3E8XA 1U7UA 4JL8A 4BFLA 1ENYA 3THRA 5KSYA 5LMUB 4JVSB 4JSTA 4EHJA 3IERA 2IIPA 2WJIA 3D1LA 3PD0A 2Q4TA 5CDFA 7YASA 2M6LA 2I3DA 2BHNA 3ASYA 4FNAA 4B4VA 1YS1X 2PGJA 4WSPA 3E15A 2ZUTA 4ND7A 1BAPA 4ZGBA 4HMOA 4DA8A 3DO5A 3I5AA 4LISA 5H0IA 3IULA 1BKDR 2O20A 3K70B 2PWZA 2VQEB 3ETNA 4F6NA 1RYBA 4M7RA 4RMHA 4MUXA 4DUYE 1T3TA 2VHVA 1LBHA 4FC6A 4C7OB 1UKZA 1E9FA 2GSWA 4HXFB 4EO4A 4AJ1A 1UPAA 1SD2A 2GM9A 5HCNA 2JK0A 4Z4GA 4FDUA 1PG5A 1ZMBA 1X8KA 3AMVA 2VDQB 4EW2A 3VYUB 1QFZA 4KWIA 2DSTA 2FPLA 4OQEA 2BMFA 5AKLA 4OHKA 2VDRB 3C4QA 3RAGA 1TUBB 5EXXA 3RYCA 5JSUA 2QRLA 2H7VA 3F9IA 5CH8A 4HJXA 1P6XA 1R4NB 3E3LA 4YPVA 3W06A 1YZQA 3S8EA 2BTQA 3PLNA 4FYJA 4BL5A 4ZV4A 3THYB 2IYFA 1Z7GA 2PT9A 1C3JA 3GNLA 3ROZA 4KMMA 5IN4A 3WHIA 1FJ2A 1KERA 3NASA 4H3KB 1W0JA 1WA5A 4DBVO 1YDMA 3UCEA 3RVBA 4DSTA 5BN3B 5C2JB 2NSYA 5FR1A 3N3BC 3PDUA 4XAQA 5BN3A 2EM2A 1LRJA 2RIPA 1W85A 1VPEA 1DWUA 4V0KA 2J9GA 3VR5D 1OW3B 3C1UA 3K2EA 4F5DA 1CQIB 1N6OA 2CNDA 1DBWA 1QRAA 4YRNA 1G6KA 1IQ0A 1NVBA 3NHBA 4PS0A 1E61A 5HF8A 3RRBA 1UMDB 3KPWA 3MUFA 1H2YA 1NW3A 3HP4A 3RE1A 2B0CA 2F67A 4JXKA 1IY0A 1UMDA 4MTCA 4DMKA 2AK3A 3YASA 4F54A 1Z22A 3IKMB 3MWYW 4N03A 5D86A 3C3BA 1H93A 3FF4A 3Q8XB 2F17A 3EGCA 1XZJA 5AIAA 3QUSA 3GJSA 4YCCA 2IV2X 2H0AA 4UMVA 3LV8A 4CV2A 1ZISA 3HU3A 2HRQA 1SQ5A 2C5LA 4TSKA 3GZJA 2OHFA 4UBMA 3ZVNA 3I9OA 4LBYA 4PGFA 4PR3A 4Z53A 4TQAA 4C0WA 1XTJA 2J1LA 2IKQA 2H1FA 3OZCA 1ZCFA 3U26A 5JROA 2EOQA 4AT1A 2GTHA 5K8UA 4B3SB 3X3HA 1X7WA 3BHJA 1VMDA 1E8DA 2GCOB 1O94D 2BHSA 2GAJA 1P4GA 1IDOA 1YBAA 2KOUA 2GNAA 2RKWA 3CHYA 4LDJA 3RJTA 3KDSE 3WO0A 1T5DX 3KFXA 2J7KA 3LC0A 4IW3B 3EH2A 1ZZGA 3IJEB 3NXSA 2A33A 3WXBA 1SCJA 1TK2A 1HEUA 2CVPA 3S2IA 3AHEA 3UHFA 3ZK8A 3CPHA 2IWHA 1QRDA 5KZMB 3A4VA 4OM7A 4EYKA 3OZBA 4AMGA 3VV2A 3TJRA 4BE7B 4JLJA 1E9BA 4RJIA 1RCFA 1NNSA 2V7XA 2QLTA 4QPZA 4AMZA 3V2HA 1E3JA 1NOKA 1G1AA 1EJ0A 3GFPA 4GAEA 1UQUA 3PXEA 3D43A 7AT1A 3DVAB 1TAQA 3MERA 4KH0A 4LRXA 3MK31 3C4VA 1FDSA 3LUBA 3DVAA 3W2GA 4J7XA 2REOA 1L9XA 2X42A 3OICA 3PNKA 4L9WA 3VYSB 1RWNA 3SQNA 4ACAA 4AP6A 4IY1A 1AKTA 1J5XA 4H4DA 4D8UA 2I2FA 2BGKA 2V89A 1C2YA 3KOWA 2Z08A 3ET4A 4OB6A 4UUAA 1X1EA 5BSHA 3O7MA 1M2OA 2ROQA 4FCCA 4FPXA 4PBSA 2IOFK 1Z5ZA 4DJTA 3KYCB 1HMPA 1EZZA 1DLJA 4JLOA 5TSDA 1VPTA 3U3OA 1W1UA 4HZUA 1TVCA 1SPBS 4B32A 2JHGA 3WR5A 1BS1A 4B4KA 4DRXB 1QZZA 4D46A 4GYWA 4ZQFA 3QKSB 1EUZA 4FINA 4DJ5X 1J2RA 4IKEA 1KMIY 2C03A 1EP2B 1DQRA 4B3CA 3MBOA 1HSZA 1FRQA 5J9FA 3EK2A 4KIFA 3TYXA 2QD2A 3UUFA 4MLQA 2H36X 1Z8DA 1KJJA 4ZI5A 5BSTA 2EPMX 1LV7A 2Z2KA 4P80A 2FWAA 3GRYA 3VVMA 3V48A 4MW5A 5ECWA 1MHPA 3ECCA 1KJWA 3IBFA 1SELA 2PAFA 3NAZA 4QUIA 1R18A 1EFPB 1WMAA 3M81A 3AR8A 1ZJWA 5FAKA 4C4SA 1ETHA 3TQSA 3Q87B 5DASA 3NPMA 3DPUA 3NRJA 2MYUA 3CR7A 1AV6A 3PKJA 1OIXA 2QUJA 1MFZA 4E3WA 5I4CA 1DC4A 1NHGA 4JJ6A 1P33A 4UQPA 1Y4UA 4LWPA 3UJCA 3RVLA 4F3RA 3A4NA 1N2JA 1U2DC 4LXXA 2A9FA 1IULA 2I7XA 3PVCA 4QTTB 1T1EA 2EWVA 1XVIA 3B3GA 1WU8A 3H2HA 3NKFA 3OE5A 5ES3A 1ECPA 1O94A 2KI5A 5DGTA 3VH2A 2NO9A 2PT6A 2WD7A 3Q0TA 4QUEA 3R7LA 3C97A 3WK5A 1SUBA 1L7OA 1TT5A 1CVIA 3N8NA 3OPXA 4RJJA 2PV0A 3DMRA 4NE9A 4L3VA 3I53A 4J8PA 1FCJA 1D2GA 4HWPA 3CQ9A 1W1IA 4XVHA 1R0KA 4YECA 4U9IS 1POWA 4XUCA 3NC4A 5T4BA 3ROKA 2XUZA 1R4MA 1SXPA 2OGSA 1L8LA 1SUFA 2DCMA 2CF5A 2ZI9A 2ZGVA 4KPUB 5JPIA 4BJHB 3BZUA 1ULHA 5IMSA 1R4MB 1WTCA 3EVEA 3G9ZA 4KPUA 1NMYA 1R6AA 3LX6A 3EEBA 4D6PA 4BNDA 2ZIVB 3IEPA 4MIOA 1R50A 2X8AA 1FUYB 1Z4NA 2BFCB 1EFRD 4FJ2A 5TR9A 1XA0A 2XOKD 2ZCUA 5KVAA 1XCMA 4XB2A 5T57A 4BASA 2BFCA 2J9XB 2QUKA 2CFCA 1KAOA 2PQ6A 1N2CA 2ZUCA 5DN9A 4CMIB 1E3WB 3H1BA 2JZCA 2X4IA 3P9CA 3SDSA 1PJLA 2Z2XA 1F7UA 3SXUA 2HRBA 1G8HA 3ES9A 1NN3A 1T0IA 2JAQA 1H6BA 1FQKA 3T9AA 5IYZB 4DKXA 1W5TA 4PPQA 1KY3A 2LR0A 1OYOA 4JA2A 3PR1A 1MH1A 3SDBA 4P33A 4HB2A 4Z7NB 1LV8A 4YIHA 3WYDA 4EYQA 5BR8B 2N75A 4PTLA 2BP7A 3NBZC 1KYTA 1N0IA 3L0CA 3P0EA 2XMSA 4LFAB 1JKMA 2OCYC 4RK6A 3OCUA 2YTGA 5ECDA 2XVAA 2BBSA 1EGAA 4Z3DA 5BT8A 3DE6X 5JAPA 3O8CA 4XPIB 3RAPR 2FN7A 2QR3A 2VIIA 3AZOA 3BXEA 2EMAA 3CNNA 3H5LA 4PQEA 3KCQA 1CTQA 4NNJA 4QUDA 2GPNA 4WSGA 2A1UA 1RJEA 1XOIA 1TJYA 1I94E 1Z6TA 2P79A 4JOCA 4CT4B 2P9JA 2ZBQA 4P5EA 4Q5IA 3K4QA 5BQ5A 3I52A 4OYYA 3QUBA 1CSEE 2BF7A 5A62A 2OO5A 1QVRA 1JH8A 2HJGA 2XDQA 4RQUA 1OZHA 2WP8J 4LF8E 4KE6A 3FRJA 2GN6A 4EFMA 4FB4A 4I08A 4CUKA 1I10A 2Z3WA 5AW1A 4JLMA 3ANMA 1N34E 1IM8A 2QKYA 3B1JA 3FOWA 3JQEA 5KSWB 2IY8A 4JYBA 4D42A 5I9IA 2ZSBA 2HJJA 3IA7A 4PO8A 3LLCA 1JIQA 1EFTA 2EMKA 1CUCA 4XOIA 3V80A 1N5DA 1MDBA 4PRLA 5I51A 1FVHA 3L41A 1ZA2A 4C07A 6NULA 5AXBA 4JYZA 3U7JA 2RGUA 2P30A 4RD1A 3HGMA 2W6OA 4LOAA 1S89A 3NOVA 3FN4A 5DKFA 2HRCA 2OAP1 3NAGA 3T34A 3WLLA 2VCEA 5GVRA 1GCUA 1H05A 3Q2OA 4P35A 3VI4B 2GWHA 3NC1C 4RZQA 3WVNA 3C4TA 3ECRA 3TO5A 3K9QO 4M9SA 4JLDA 2M98A 4PRYA 3QSYA 1QNFA 1JQAA 2P6MA 4OQNA 2J5RA 3W1WA 4JSRA 4EUEA 3WFJA 4XCQA 3SOZA 2DWPA 1EUCA 3VKVA 1LF5A 1RKQA 4JQCA 2BM9A 1JZSA 4K8OA 3OWXA 1XZIA 1UJCA 1PWHA 4QX6A 1UXOA 3JTZA 2FZWA 3VTKA 1GL3A 2IK8A 2Y2UA 2OGZA 2IPOA 3E22A 3L84A 3LHIA 1H0HA 3MJ4A 3Q7QA 1TCUA 3Q7EA 1XLTC 2X5KO 2LT7A 1FDVA 1PR5A 2J41A 2HHLA 1X38A 2GHIA 2WICA 3CRW1 3KZKA 3OWOA 2FPGB 1FYVA 3T5PA 3ZDRA 3TKYA 4L74A 3A1WA 2EOYA 3VAYA 4IHQA 2JIZA 3EARA 1KEVA 1EYZA 3TLYA 1S8FA 1PL8A 3CH6A 5EIBC 4BLVA 1G3IA 4CKEA 1LF0A 2FPKA 3I05A 3S7TA 4IJDA 1HQKA 1KMNA 1MTZA 1IG0A 4NRDA 4UQLA 4MVJE 3I5UA 4JBHA 3NVKI 4LDZA 2CLHB 4RIHA 4G8JA 5BVGA 4NZZA 3H8WA 3MLAA 4U8HA 1PQYA 4HDNA 1SC9A 2O52A 2A4KA 1DBVO 2Q2VA 3GUHA 3R5JA 4HDNB 4K9SA 2KWIA 3SDZA 3SX0A 3WO1A 2ZM5A 1TZKA 4HD8A 4C01A 1JEYB 4DSOA 2QTRA 2Z57A 1ADJA 4LYFA 3AM4A 1MW8X 4BNXA 2BDTA 4TZKA 4DREA 3HZRA 4HFNA 1M5TA 1A1JA 1A7KA 1XU7A 2DPHA 2UZ1A 3SFTA 3WY9A 4F60A 1OI3A 1ZX1A 2QROA 3ABOB 1F60A 3AVQA 1ZNQO 3EULA 3M4JA 4Z9FA 1QZXA 1UQTA 4UE6A 3P2JA 4A9AA 1I6WA 4I3GA 3PCTA 4ITVA 3FYHA 3K7EA 3UY4A 4ZKEA 3B5EA 3SY8A 1K92A 4HNVA 3DDSA 1OZAA 1YDGA 1YULA 2E1MA 1JR3E 3D8TA 1M1ZA 1GV0A 5HKKA 4UNNA 1ZOSA 5DXAA 4JJKA 5BT9A 4MA0A 3FJ1A 3VJMA 3GGPA 5KI6A 3WQRA 4N48A 2FV4B 2DT5A 2HJSA 2ZETA 4MP6A 2FKNA 4EIWA 4O3MA 1RPTA 5JI3E 5FTJA 5B37A 2A8YA 5HMMA 3EXG1 1ZP6A 2IZOA 4U2GA 4J7CA 5DTIA 5DP1A 1JHZA 1N33B 4XH9B 1G21E 4H2DA 2V7WA 3FROA 4HP8A 4R9RA 4QOHA 4W6ZA 2Y6VA 2F3PA 3MT7A 4M54A 1ESNA 4YAWA 4IHJF 3RVQA 1Z4QA 4WOCA 1YS7A 1CHNA 1SC4A 4CFYA 1DCFA 2C61A 5L3SB 4OX9B 2LIPA 2ZYTX 2F3UA 2AMYA 1H2WA 4G36A 4PXAA 4WZAE 4G5OA 4ZKDA 2EDCA 1FNSA 1GAWA 4I0WB 3U7EB 4R0MA 1FIUA 2H4FA 2ZUBA 3GN1A 5JE8A 1KOGA 1XRNA 1V5IA 5CEEA 4WJKB 1AMNA 5KWVA 4NJEA 2D2VA 3NKLA 1FLVA 1TZ2A 1VMAA 4HGNA 3ZU2A 4EUFA 3GLFE 4EJSC 5DDIP 1T2EA 2QRZA 3VUEA 1KK1A 4GQBA 2D06A 1H5NA 3P7MA 2QNBA 3PUHA 1CJSA 3HPQA 2Q1UA 2QLLA 5AC4A 2EPKX 3ENZA 5A6BD 1IZ9A 4PLCA 1I3OA 2OAGA 3QXHA 4MEJA 4NK5A 2ZE6A 4PPGA 2OZVA 2AQ8A 2D0IA 3QPBA 2JFHA 3UBMA 2FR1A 4UTPA 4ND2A 2MDGA 3E4CA 1E2DA 3P9KA 5FA5A 5KC9A 3PI6A 3VVBA 5M2QA 3PNQA 3U9TA 5K05A 3HLKA 3MTEA 4COOA 4FKBA 2WWHA 2XT0A 4Q4HB 3QUAA 1XZQA 1K9VF 5CX1B 2IITA 1NJSA 1CVRA 4KIGA 2Q21A 5C3MA 3EDRA 1A1VA 1J23A 1MJFA 4ZYYA 2B7TA 3VR2A 5FEMA 2EWLA 2XT6A 2I3BA 3HJBA 2GVNA 3AIKA 3AGPA 4FYMA 1PGJA 4EG0A 1FXWA 4J1TA 4TKLA 4GNKA 4YT8A 3WX0A 4ARVA 5FI1B 1PGNA 3L7LA 3RRXA 3RROA 4NQZA 3IBYA 4FNGA 2CLCX 5A6BA 4ARAA 5J47A 1DDGA 1R0YA 2JAWA 2PMBA 5SYMA 3V8PA 2AC2A 2DRPA 2QLNA 2UV8A 4WEQA 2IOHA 5C18A 2RK3A 1XUOA 2JA2A 4UREA 1YBFA 1TJPB 3ZE2B 2GX6A 1ORRA 4LOLA 4GOMD 4ED9A 1W4ZA 3A3OA 3DXFA 1XYYA 3Q6NA 4I50B 4LSMA 4ZO9A 3WRYC 2F8SA 3VJRA 5JQGF 1F0KA 4GYJA 3PWKA 1Z4JA 4A73A 1B2RA 1I7DA 2PWBA 4MAAA 1JAHA 5DF1A 1ZQ9A 1XTKA 4IGEA 4CCYB 1VHWA 3HQ1A 1XKXA 2M32A 3BL6A 2F3RA 3PQ4A 2P1ZA 5E38A 3P94A 3FPSA 4AWXA 4B74A 4X62E 2O23A 1DX6A 2A86A 4G0NA 2JJ2D 4RXTA 4EGJA 5A5GA 3NC0C 3OAAD 3GZTB 2HC9A 1SRQA 1NMQA 1JDBB 4AXBA 3D4BA 3VTZA 2HV8A 4MUKA 1DTWB 5FNVA 3A1UA 3I9V6 4M0PA 4WFKA 3RWOA 1NI3A 4GMGA 4E4TA 5TE9A 1VBNA 1K1EA 3NI2A 3CUKA 2ZJYA 3R44A 3LRPA 4LJ4A 4L22A 5ELLA 2CLMB 2DJ5A 1MAUA 1ZOLA 1MO3A 4FIZA 4ND5A 2C94A 2H5LA 1Y34E 3BTOA 3W04A 5KWEA 3IAEA 3TIIA 5KSZA 1M8KA 2HSDA 1RLMA 1Q3HA 3BJRA 2YFQA 1UP7A 2P3QA 3MJEA 4KXNA 4BJ1A 4CKCA 1WB9A 1YJQA 4CEIB 1Y4DE 4JL6A 3WRXA 1E6LA 3KUCA 1Q22A 3G2MA 1EE1A 2H0RA 4YJGA 2W2NA 2A0XA 2JLRA 4QJ3A 4OHUA 1CP3A 4KZKA 1TM4E 2Y0CA 4ZQGA 4MUYA 4YJGB 1YR2A 3PHHA 5IMBA 4RKEA 1QGZA 5EMMA 3CEJA 1I7NA 1M76A 5LP6F 4IDHA 1KO1A 4OJNA 4WKNA 3UUWA 3H9QA 4QT4A 3I12A 4Q3EA 1IJEA 1PUXA 1LDYA 1C2TA 2P9CA 3DAGA 4YN3A 4E70A 721PA 1GNTA 3S8YA 4MPJA 1A2OA 4A6DA 1NUSA 2PUAA 2F8TA 1FTWA 2FW7A 1B93A 1TJ5A 1JEDA 2V7QA 2XNDD 3QYJA 2ZWIA 3BFKA 4TV8A 3VDMA 5IJWA 5JC1A 2PJUA 1TRKA 3K6RA 4M21A 4BXOA 1Q2UA 2WG1A 4NEGA 3UJ3X 1V7ZA 5LJLA 3ILYA 1SBNE 3LQ2A 4FS3A 4HN4B 3KQKA 5F76A 3ACCA 4AY2A 4G4GA 1S4MA 2H4XA 2CV0A 4JAVC 3MWFA 3RRFA 3S70A 4A5OA 2VPWA 1BH6A 3AHGA 4WSOA 4WLOA 5AUNB 3C3KA 1V8OA 3BJIC 5FBZA 4F7WA 2ZI5A 4UZEA 5DK6A 4I66A 2SCUA 3OHPA 4YJ2F 4EDFA 5D3ZA 1Y1TA 3W1VA 1W93A 2UUAB 4D79A 1A2BA 2OP1A 1QGDA 2DB2A 3N7UA 1QF7A 3BZWA 2A57A 4JUDX 5CLHA 5FTKA 4AZTA 1NYLA 2J31A 3P9NA 5CPFA 2W22A 3E48A 4KQ2A 5IDVA 1T39A 1VL0A 1CUJA 1CETA 3DOUA 1EFVB 2WKRA 4QU9A 4C2AA 5L3QB 2GM4A 2IS4A 4JUBA 2ZWAA 4UEQA 1JEJA 4F86A 4LHYA 3ESCA 4BKPA 2B6NA 2NO1A 4EY3A 3KSRA 1IHDA 3G89A 1JXAA 3DHYA 1DAPA 2C29D 3AJAA 5C5EA 1QCYA 1CQJB 1VRVA 3O8QA 4G4IA 4BO6A 4DXDA 1Z15A 5KNBH 3K70C 1OXUA 3M5DA 1I7SB 4F06A 1JA0A 4G01B 4GHWA 1RQLA 2EWMA 4HCJA 1UC8A 4LZLA 1YZ3A 3DZ8A 4MLDA 4Y2UA 1A8HA 1KEKA 4ZAWA 4DR4E 2XB9A 1NU8A 2WF9A 3PGJA 2P9HA 3K6KA 4MPRA 4FHCA 4GGMX 2VJMB 4Q3KA 5H16A 3HB5X 2FFJA 1YZLA 2RGNA 2XIQA 1PFVA 3EMVA 3OOYA 3ESAA 5IS2A 3DMTC 4N6NA 3JQ7B 5E2AA 4QXPA 3UA4A 4F0JA 1XNJA 2BHLA 4FMDB 4URUR 4WN9A 4KYVA 1MAVA 2V8OA 3TDKA 4UU1A 4XCXA 1Q84A 4R01A 1D0IA 3RFXA 3ZWBA 4MJ7A 5AW5A 3L8CA 1Z56C 1TFRA 2GHTA 2VXCA 1UEIA 1ULBA 3NW9A 1O5IA 4W1PA 1WDLA 4EJSB 3MHPA 4JNKA 3L7IA 4YXFA 1GZ4A 2IHR1 1C3XA 2OGTA 1MC4A 2OAEA 2R5WA 2UXCE 1J7KA 1CXZA 1SVOA 3ZV4A 4JU9A 1JR3D 1JT9A 1TTHA 4HGZA 3W2TA 2OZPA 1KDTA 4MQUA 3LDGA 4OYHA 2PQMA 4J0FA 4BX3A 2HBRA 2REQA 3OWHA 3P0HA 4R5MA 4C5CA 2GERA 2I4IA 3D7SA 3EDYA 2FDXA 2Q4EA 3WLPA 2G6BA 5DVZA 3JVVA 3UWMA 4COKA 1E64A 2QEQA 2REQB 1GEEA 1YH3A 4PICA 1E6KA 1FMCA 2XQVA 3QSGA 5KYXA 2XZOA 1AUXA 1RAAA 3KJFA 4UUBA 2EGHA 2X1VA 5G02A 1E2KA 2EM7A 3ZOZA 2EPLX 4O4IF 5LLTA 1CDDA 3O1LA 1L8OA 1IBMB 1OJLA 1IJKA 4W8OA 4OUDB 1GSIA 3HCNA 3LWZA 1T3SA 1O4VA 2BFBB 3FDZA 1Q1QA 3Q41A 4GUDA 4Z9YA 5DBFA 4ZCPA 1ZRSA 2JDID 4QUHA 1A7AA 2YHUA 2WHPA 2X0DA 2ZJFA 3T4PA 4RXUA 3H4VA 3QVUA 3RVPA 2WHPB 1VP9A 4YRIA 1ZAKA 3C4JA 5EJ6A 1QIGA 2V5VA 2PZKA 4AQYE 5C8YF 3NCHA 2AD5A 1IZZA 1Q0PA 4JASB 1YJAA 1N5LA 1XRLA 5BRJA 1T4NA 2EZ6A 3TLZA 1M1UA 1QE3A 4DBLE 4XD7D 4ER7A