1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
3RAJA 4KMSA 2J3HA 2DC1A 3IJPA 1P0CA 3JD4A 1LBEA 5LDHA 4LCJA 3LQFA 1LDYA 1ZXLA 2JD0A 2C5EA 2I66A 3U4DA 3U5TA 1HDXA 4E5KA 2NU8A 1QG6A 4PLHA 2HK8A 2H63A 4J0FA 4K9DA 4BO3A 2PH3A 2EIHA 2DBRA 3VZPA 2VQ3A 5IDWA 1C1DA 2Z95A 3F3SA 4UEOA 2UYYA 2CDAA 5HM8A 3K30A 5IN4A 2DTEA 3WYEA 4CL3A 3HDJA 1XGKA 3GZNA 1EE9A 4I9NA 4GBJA 4ZQBA 1KIFA 1ADCA 3BIOA 2FR8A 1ZEJA 3LSYA 3R6DA 1I30A 3ZU4A 5JBIA 4CR6A 5CDGA 3PWKA 4CLOB 3A28A 3W4IA 2I99A 3ZWXA 4ZRNA 3D4NA 1QLHA 2V6GA 2GZ3A 2Q4EA 3I9JA 4CMEA 3Q6IA 5JAIA 4ALNA 4BB5A 5H83A 4NHEA 2ZK7A 2W2KA 3JV7A 2B4TO 4S3MA 3LC1O 2E49A 4BNVA 2I3AA 2DKNA 2GERA 2OXIA 1G6KA 5IJZA 5ICMA 3IJRA 1KETA 1Y5RA 3KV3O 4YVFA 4ZHSA 5JXWA 3WGIA 2EKPA 1PGOA 1BDBA 1WNTA 2DBVO 2JD1A 3HN7A 3PTZA 3HB5X 3FR7A 1ISHA 4CMEC 4AJOA 5IZ4A 4NR0A 1F12A 4FW8A 2VOJA 3E6AA 1QRRA 4FOSA 4CJXA 4E13A 3U4CA 3DMTC 4DYVA 4Q3CA 1U7TA 1LJ8A 4AJPA 1E6WA 3I1JA 3PJEA 2X9VA 2V6MA 2ZB4A 4HP8A 4CM7A 2HRZA 4NI5A 5CAEA 1UR5A 4XJSA 4HBGA 3CZMA 1I36A 3E5MA 4X54A 1MB4A 4XIYA 2CNBA 1U3TA 2ZQZA 4AFNA 2Q1SA 4N5NA 3VPXA 1PZEA 3GG2A 3GUYA 1SZJG 4HUJA 4QTZA 2WDZA 3O8QA 2GLXA 5L53A 1J0XO 1C0LA 3LF2A 3A4VA 4GLOA 3RFVA 1JAXA 3B1JA 2IYPA 4ND2A 1T26A 4K6FA 3S8MA 2YZ7A 4LMRA 3DBHA 1SEPA 1VSUA 4M89A 3V1TC 5DBFA 2GPTA 2QZ9A 2Y68A 5DBIA 5EESA 3ZN2A 3GY0A 5DN9A 1R66A 5F1KA 4GSKA 1DFGA 2PZKA 1DRVA 1SMKA 2DUWA 5DULA 3GLQA 3H4VA 3SX2A 3DB2A 4NIMA 1U8XX 2BGLA 1BTOA 4RPKA 3ICCA 2J5QA 3COSA 2HMTA 4L9RA 1H93A 3L0DA 3TZKA 1MGOA 2AQ8A 4WLEA 1N2SA 1ONNA 3JQCA 1BRMA 4J16A 3ENNA 5ILGA 4II3A 4C7KA 2PFGA 3I6IA 1NAHA 2W2LD 3DTYA 4J4HA 1BMDA 1V3UA 1PGNA 1F14A 2G82A 3B6ZA 3FNHA 4IGEA 4NBTA 4GX1A 4RF2A 2H1SA 1CQIA 4Z9FA 1NQTA 3WQSB 2V7PA 1A7AA 3OFSA 4ALMA 1N9GA 2UUOA 3F6YA 2QYTA 4CLHA 3WR5A 3IIEA 4D43A 1P1IA 2Q1WA 5JW6A 5COQA 3K6JA 4YJFB 1TXGA 2PK3A 1JKJA 1ORRA 3GA0A 3R0IA 2GDZA 1BSVA 4EDFA 3I9OA 2B5WA 4RVDA 3ABIA 4Q3BA 1XSEA 4HFJA 4BO2A 1E1KA 1LDGA 5JC8A 1QYDA 2ZQYA 5JDIC 5CEFA 4PFJA 2GO1A 5TT0A 4UEJA 1L1FA 4XR9A 3WG9A 1IUKA 1LA2A 1HT0A 4GL4A 4RF3A 3AUAA 2DQ4A 1UP6A 4NU6A 2Q2VA 5A03A 4YJGB 4PG5A 2DPGA 5BQFA 1KEWA 2X7HA 4CMCA 1XELA 1D4FA 1T4BA 4DYDA 1Q0QA 1OI7A 1E6UA 3SC4A 3I83A 1WDKA 5A9SA 1CYDA 2IE0A 3G1TA 4CQMB 2G0TA 5TQVA 4DVJA 5IXYA 4FIZA 2JL1A 1GCOA 4YPOA 3CXRA 3U3XA 5TJ9A 4KP7A 3H9QA 1NVGA 4E4YA 4J2HA 4PZDA 2EW8A 4F6LA 1OC4A 2CDBA 2WYWA 5H82A 5A02A 1EDZA 1Y9EA 3JQ8A 3DQPA 3NTRA 1HLPA 4IZIA 1G1AA 3PHLA 2G1UA 4PCVA 2EWMA 1NHWA 2D5AA 5TSDA 3OBBA 4R01A 1P9LA 1HF3A 2GD1O 1W4ZA 2G5CA 2W90A 4YT2A 1EQUA 2IDZA 1B26A 3GRPA 3QRWA 4M55A 4N18A 3E5RA 4CMAA 3AI2A 4BO5A 5ICSA 1HDYA 1N7HA 1XU9A 1Z82A 5DDIP 4YQZA 3ZV3A 3GUCA 4ALIA 2B4QA 2IZ1A 4JGBA 1HLDA 2HQ1A 2NQTA 4H16A 3ZWMA 1WVGA 1KVQA 3P2OA 1BGVA 4UUPA 3C1OA 1DHTA 3I23A 5IG2A 1PS0A 3OJ0A 5MDHA 2Y1EA 4PZCA 2FHSA 3SVTA 2I9PA 4Z9YA 4DLAA 1GYRA 1ZXBA 4A03A 3JQFA 3OIFA 1QV6A 3I5MA 4LRSB 2AQKA 3GT0A 1ENYA 3DMTA 4XRGA 1XEAA 4D46A 5B1YA 1ZFNA 2JKVA 5BR7A 1P31A 4BGIA 4ZD6A 4IMPA 5T67A 4EGFA 1CQJA 3I9LA 5HRUA 1AHIA 4WJZA 3WTBA 4IQGA 1PZHA 2ZCUA 3LT2A 2OP0A 2DBZA 3V2HA 4BL5A 3STHA 2R6JA 1C14A 2YJZA 3L9WA 1BVRA 4BGEA 3W8EA 3FNGA 3ZU5A 2VYNA 4DQVA 2NV6A 1NAIA 3U9LA 1T2AA 4NFYA 1KVUA 3RC1A 4D3FA 1E1LA 3ZGYA 1Q0HA 4MINA 3SLGA 4BNGA 5BNFA 5IDXA 2NLOA 4FFPA 3ZU3A 2XAAA 3CMMA 5C7OO 1Y6JA 3FNEA 5TS3A 1NBOA 3W8DA 2FWMX 1U3UA 1WXDA 5U1PA 5K0ZA 2EKQA 3M1AA 3RUIA 3UF0A 1B15A 7ADHA 2X0RA 3HDQA 2O48X 3JQAB 3RJ5A 4CMIB 4AJNA 2Y1OA 1UAGA 3DAFA 1DOHA 1LX6A 3N7UA 4IMRA 1ZSYA 4FS3A 1RYDA 2JD2A 5KCZA 1UJMA 2CY0A 1ZCJA 3E82A 3QWHA 1NWCA 3BTVA 5L3ZA 2VHZA 4I1IA 2JFGA 1LNQA 3AOGA 1IE3A 2OOSA 2WMDA 3AI3A 1ISGA 4BNKA 2UV8A 4U8GA 4DUPA 2Y66A 1ZKMA 3WGQA 3O9ZA 4Y6PA 2X58A 3KVOA 1ISIA 3P2YA 1JAYA 3UCFA 2EXXA 1JWBB 4XRRA 1XDWA 3EAGA 3NGLA 4LGVA 3KSUA 1JN0A 3MEQA 3PK0A 4PLZA 1R16A 3KBOA 3VVBA 4NDNE 1YKFA 4LSMA 4Z3KA 5DCYA 3EZLA 1RM5A 4A27A 3JSAA 2NU7A 2CVZA 3VZSA 2VRBA 1G0OA 2CUKA 3CSDA 4A7PA 1EQ2A 3WXBA 1PJBA 3RU7A 4AJ2A 4CM8A 1DIRA 1EUDA 3PHIA 3A9WA 1EVIA 2J3IA 3GZNB 4K1LA 3UUWA 4RJTA 1V3TA 4ZQFA 4PLTA 4GWGA 1NP3A 3KM0A 5AXCA 3BXXA 1DBVO 4G65A 1ENOA 3RUHA 5TF4A 3DZKA 4WPGA 5I7VA 3D64A 1PQWA 6LDHA 4R3WA 4RPLA 4CM5A 4YRDA 1GY8A 2X22A 4IJVA 1DC5A 1GDHA 3JYQA 1A4IA 8ADHA 3GQVA 3UOGA 5A9TA 2OZPA 3AM4A 4QO7A 4XGNA 3P5SA 3WGTA 2ILTA 3KO8A 1WZIA 4KQXA 4XIJA 3U62A 1P33A 3BYZA 3EUWA 3MJEA 4PLPA 4BKQA 3ASVA 3OJFA 2UAGA 2O3SA 2BLLA 1BXGA 2QZZA 2C2XA 3AI1A 3QJ5A 1E5LA 2RHRA 1O9BA 2PLAA 3JQ6A 5TGDA 3TNLA 4NG5A 2VHYA 5A5EA 1C0KA 4DIFA 1U8FO 1H6AA 1WDLA 2UUPA 3RCBA 3SC6A 3EYWA 4IDDA 4MIOA 4AL4A 5JY6A 2OGUA 1D1TA 3QVSA 1P3DA 1QYWA 3A06A 4J49A 1I8TA 1BVUA 4QXMA 3F4LA 3VH3A 4Y98A 3UVEA 3JQBA 4XYGA 3O8QB 4PN3A 3DBRB 3EW7A 5CG1A 4CM3A 1D8AA 1SOVA 2Y93A 1P77A 1TT5A 3PQFA 4ALJA 4CLRA 2DFVA 3KXDA 3KYDB 2PA3A 4R9RA 3EGOA 5I7EA 1PEDA 2QYSA 4CV2A 3DBLB 3GR6A 4EUHA 4E6PA 2ZTMA 4MOWA 1C3VA 1HXHA 4EUEA 4IDGA 3ETGA 5TRTA 4B4UA 2PZLA 3PLRA 4IPTA 2G76A 2QG4A 3HADA 4JBGA 2YV1A 1GV0A 1H2HA 1SAYA 4E2ZA 1WLYA 5I8ZA 4BMNA 1K89A 3D1LA 5BSGA 2HCTA 3OJEA 4OQZA 1ADGA 2QW8A 3L77A 4FFMA 1A9YA 1H6DA 3ZU2A 4NFHA 2SCUA 3O4RA 2CMDA 2P4QA 3RI3A 2X6TA 2HMUA 4CM4A 3PQDA 2UDPA 3PIDA 1KY5A 2X23A 3GMSA 3WNQA 2JCXA 4D45A 1ZK3A 1Y1PA 3GDFA 2PD4A 4NZ9A 4Q3DA 4I5EA 4U6SA 4GPD1 2BGKA 2GNAA 4Z0PA 5JCXA 5KKCA 3RSHA 1DIHA 4JROA 1HSOA 2B69A 4DC0A 1Z7EA 1YJ8A 3GFBA 5AYVA 1GPDG 2POQX 4PG4A 4J9VA 4IDAA 3UICA 2I65A 5TX7A 4WEOA 1E7RA 1E3IA 4L74A 4NBUA 4A26A 4CQMD 4J9UE 3AM3A 4RZIA 5JSFA 1YWGO 4MPDA 5KWEA 1R37A 1KVSA 5AXBA 3K73O 3GVPA 1HE3A 3H3JA 4PGFA 1NWHA 3VPGA 1NQAO 1B7GO 3C24A 4J2OA 1ZEMA 2EP7A 1TVEA 3ZWCA 2AE1A 5FI3A 3WWZA 2VUSA 4NBWA 1MV8A 3DHEA 4CM9D 1XYGA 3DZFA 5EERA 5KVCA 4OOEA 4R54A 3V8BA 3PWSA 1ZK4A 1IB6A 3RU9A 3Q0EA 4O63O 4YT4A 4R69A 1OMOA 3ROQA 1FDVA 2EG9A 1Y7TA 1YOVA 4II2A 1A7KA 3WSVA 3UW3A 4L4SA 4J3FA 3INGA 1GYQA 1LQUA 4BMSA 1O89A 4KTVE 1U2DA 1FJHA 3NTOA 3B20A 5A05A 3VVCA 3ETDA 4IS3A 1HWYA 2ET6A 4WGGA 4WK6A 3PJGA 4MIYA 4AJJA 2W8ZA 3WGYA 1B3BA 1E7WA 4H3VA 4LW8A 1LSJA 4OHUA 2DLDA 1I3MA 2ZJ0A 5KVVA 4J7CA 2R00C 3BAZA 5BSFA 3TF5A 5JYEA 2LDXA 4BO4A 5T6BA 3HWRA 2CZCA 3ONFA 4N5MA 1IPEA 3VTFA 5MGBA 5IDYA 4RGBA 1DO8A 5F5NA 5B4UA 4FFOA 1Y8QB 1R15A 4IJKA 4ZN6A 1YOVB 3N58A 2PTGA 3OHSX 1J6UA 4B79A 1JKFA 3MJ4A 2I5PO 4EJ6A 2ZB7A 3SLKA 2FOIA 4BNTA 3RUAA 1ZBQA 2X9GA 1C1XA 4I5GA 3H9UA 1I24A 3DZBA 3F9IA 4YAGA 2X86A 4MVJA 4BVAA 3QW2A 4PLVA 3I9KA 4TRJA 1QV7A 1T24A 1UXJA 3H2SA 2VUUA 4RORA 5IZCC 3HZZA 3AWDA 1Y5MA 2WYUA 1B0AA 3K2BA 3MOGA 4FPXA 3JQAD 3PYMA 3E18A 4KUGA 4NQZA 5JY1A 5JS6A 1YL6A 5COAA 4CMBA 2FR0A 3HUDA 1R6DA 2DTDA 2E48A 4PLYA 4G2NA 1FDTA 4Y8VA 2OORA 4GGOA 3GFGA 3W1VA 2PKQP 3GN2A 3SJ7A 1KS9A 1WW8A 1QMGA 4WCFC 2GN6A 5A5FA 3ASUA 1GQYA 1PX0A 3TDKA 3AFNA 3EZYA 3TPCA 1NFQA 2NNLD 1T2EA 3JQFC 1PQUA 1LLQA 1GEEA 1YL5A 1JVSA 4CUJA 5F3RA 1YB5A 3PJFA 2NU6A 1XR3A 4RV9A 4DPKA 3CUKA 5L40A 4Z9XA 3PIIA 2ZB8A 1M66A 3BMCB 3L6OO 4CR8A 4XB2A 5THQA 4NNJA 3GDOA 4R5MA 3VOSA 1YBMA 1LDNA 4P8RA 4JNKA 1OAAA 4RVGA 4FB5A 1AXGA 2PR2A 1ML3A 3ZH2A 1SBYA 1VJTA 1N9GB 4OJNA 3TSCA 2YDYA 1LXCA 3IP3A 3BMNA 1LRKA 3HSKA 1O94A 4R9SA 1CEQA 1DB3A 2RHCA 3ANLA 4YJFA 2YFQA 3K5PA 5HWSA 4L4XA 3JQ7B 4WEQA 1BXKA 4YT5A 2ZIZA 5ITVA 1N5DA 4R5HA 3TL2A 1HYEA 2GN4A 9LDBA 4ZGWA 4FGWA 3E48A 3K2EA 4MVJG 5JPIA 5TT1A 3ZV5A 4DMMA 3ZWOA 1LRJA 3DOCA 1ZO8A 2AXQA 4XZ3A 2BGMA 5A3JA 3ENKA 2YDXA 4WCFB 2OBYA 2Q99A 4JJGA 2I6TA 2X9NA 4J4TA 2O2SA 5EQDA 4LISA 2VRCD 5HS4A 4JN6B 4MKZA 3NV9A 5EMHA 4U5QA 1IL0A 3JQGB 4NBRA 1ISJA 5BT9A 1DPGA 2GZ1A 3VPHA 4YQYA 3V2GA 4DIBA 4HFRA 1DJNA 3G49A 3KB6A 4R51A 1OZAA 3FBTA 3GOHA 1EFLA 4MJLA 3RIHA 1IPFA 1BDMA 3JQEA 5L95A 3LVFO 1J49A 4ND1A 3T7EA 1VL0A 3DHNA 3F1KA 3BMQA 1ONPA 3OA2A 4CMGA 4CODB 1IHYA 4P38A 2PGDA 3VZRA 3JQ7A 2PZJA 4UULA 2O23A 3NYWA 4I08A 3WQQA 4JBHA 5GY7A 2P5UA 4KTTE 4N7RA 3RUEA 1ZNQO 1DC4A 2X5JO 1ZUD1 3QLJA 1HDGO 4L76A 3IUPA 3PFWO 5KKAA 4CLRB 4BNIA 2DU8A 1VPDA 4AJ1A 4CUZA 1E92A 5KJEA 1GR0A 3DBRA 3KRTA 4XA8A 4YDRA 3B1FA 3O03A 4BNWA 1KVTA 4FJ0A 4IUYA 3QQPA 3RUFA 3IDSA 1X0VA 1LLUA 4ZVVA 1ENPA 4FSHA 2HU2A 4AJIA 4E21A 2RH8A 1CRWG 2AEMA 2YQ5A 4WLOA 2J5KA 1R0SA 1X13A 2C7GA 1GU7A 4I9UA 4DTIA 3VDQA 4OM8A 1FF9A 3MJVA 5EL0A 1XKQA 1P1HA 2OL4A 4TRRA 3GG9A 3IOYA 4WECA 3TZHA 4OSOA 3D5QA 4YRBA 2OMEA 4IJUA 3ZV6A 5JAZA 1DJQA 1MC4A 1LSOA 1C0IA 1V9LA 1PJ4A 2IRWA 1AE1A 4CUKA 3GEDA 4YT8A 3ZZNA 4BNMA 4HNHA 1I3NA 1QSGA 3BTUA 1SNYA 3DXFA 1U5CA 2X8LA 1KVRA 2WD7B 1R4NA 1Q7GA 3DZIA 4J7XA 5KVSA 1RM0A 1UZNA 4XR4A 2GGSA 3JYLA 4CL8A 2NQ8A 4BIIA 4Q3EA 3GGOA 3ZWYA 2Y05A 3IL2A 4ZJUA 1E7MA 4HNGA 3ICPA 4M87A 1FDWA 2C20A 4O5OA 1OC2A 1T1SA 3NDJA 4J43A 3NAQA 1NPYA 4HWKA 5L9AA 2GF2A 4IXTA 4QSMA 1V0JA 1UDCA 2ZTVA 2PD6A 2O50A 1X0XA 5C37A 2EGGA 4B4OA 1E3LA 1U9JA 3Q2IA 3EDMA 4INAA 3ZHYA 4F45A 3RC2A 1U7HA 3ANMA 1PL8A 5DP2A 1NR1A 4GKVA 4YJHB 3PYXA 3VZQA 1T1RA 4YJDA 4DLBA 3D3WA 4NH4A 1TT5B 1QXSA 4Y67A 4BKUA 3FSRA 3ZI0A 3GAFA 3MJTA 4M1QA 2PKQO 1PTJA 9LDTA 1YGYA 1GQ2A 1RM3A 3AW9A 2R2GA 3ZV4A 5CPFA 4IGFA 3FF4A 4PRKA 4BKRA 1YB4A 1RYEA 4NJMB 4GH5A 3PJDA 3K31A 4W82A 4ZQEA 1HEUA 2IXAA 3FPCA 3KETA 1YDWA 3GGGA 4D41A 4ALLA 4FFNA 3JD2A 4NBVA 3OH8A 3D3EA 4IDBA 2BKAA 4LRTB 2GUGA 4AJEA 3OSUA 1OOEA 5T8KA 3AJRA 2W4QA 1Q0LA 3LT1A 4XQCA 4ILKA 4KUHA 4XYBA 4E2WA 2HAEA 1WP4A 1B8UA 1YRLA 2CF6A 5CDSA 1DAPA 1P1FA 1DIAA 3JD3A 1W8DA 1XLTA 4YCAA 1I0ZA 1TI7A 3WGGA 4CM8B 1M75A 1PR9A 1T4DA 2FRDA 3HFGA 1UZLA 4FD3A 1XU7A 3NGXA 1MP0A 5DNAA 5L51A 4H7PA 2Q2QA 4AJ4A 2Q1UA 4HKTA 4MVJF 1K6IA 5I9LA 1H5QA 3SJUA 3WDSA 4FFLA 4OQYA 4Z0TA 1DIBA 5IXSA 1UZMA 4BGVA 3U0BA 2AG8A 1W73A 4EYEA 4GQAA 1ZJYA 4PVCA 5A3VA 1YBAA 1ADBA 3PQEA 4BMVA 5C7IO 5TJHA 3BMQB 1Y8QA 3QE3A 2C82A 4CM9A 1LQTA 1N92A 2O4UX 3E9QA 3OMLA 1GUFA 3NEPX 1RKXA 4YWJA 4EEXA 1KC1A 1EUZA 2Q46A 4W9NC 1O5IA 1PQPA 4QECA 4ZRMA 1E0DA 5L7WA 3GK3A 2C54A 4FGSA 1P1JA 2R00A 1RPNA 4WLFA 5ENVA 1JWAB 3NKLA 1ZIDA 2XF8A 1ZZEA 5FFFA 2RCYA 3UFXA 4Z3DA 4FBGA 4J6FA 3MWEB 3D4PA 5K9ZA 4CM4B 1MXHA 2I3GA 4RL6A 3VPSA 1R0KA 4UUOA 1T2CA 5L7YA 3WYBA 5AQ1A 1CWUA 3Q9NA 3AUUA 4UAGA 5L7TA 3NTQA 3CZRA 2FP4A 5LC1A 5F21A 1W6UA 3R1IA 3RFTA 4BGUA 1NASA 3H5RA 2Y1CA 2OFPA 4BNFA 3E9MA 3IS3A 1GV1A 2VTDA 3IQDB 5LCXA 4HXYA 3OQ6A 4I5FA 4BV9A 3DTTA 4NJOA 1NM5A 5AXDA 1UXIA 3UHAA 5JDIA 1HZZA 2C0CA 2X5KO 3G0OA 1VM6A 4QEDA 4R68A 4A0SA 1BXZA 1JW9B 3K96A 1MG0A 2Q2WA 4CPDA 3LLSA 4GAEA 3NDIA 1FDUA 1E7SA 2BFOA 4RZHA 3F47A 3LT4A 4P22A 1N1EA 1MLDA 4E12A 5FEUA 3AU9A 4ZQHA 1ONOA 2NSDA 3TJRA 2CDCA 2AMFA 4B3IA 5FF9A 4TZTA 2YFHA 4CMHA 1A4UA 4K28A 1CIVA 3U4IA 1VC2A 3Q1LA 3C7DB 3FR8A 2B36A 4E31A 2HLPA 3ULKA 1E5QA 1PIWA 3AUSA 3H9GA 3ADOA 5F5LA 2J3KA 4ND4A 5K6AC 1JKIA 3G79A 4FQ8A 2CSUA 5G0VA 3E9NA 3FRJA 4ONEA 4A73A 2Q50A 5CHEA 5CEEA 1IYZA 3ZW8A 1JTVA 1QP8A 2VTEA 1PWZA 1I01A 3DBLA 2BHLA 4DQUA 5L4NA 5JC1A 2NACA 5I8WA 1H2BA 3PHJA 5L4LA 3E8XA 4A10A 1DXYA 1NYTA 1SPXA 4J91A 1SB9A 1WWKA 3LLVA 3LT0A 5B4TA 3JQGA 1QYVA 3WOHA 3NJ4A 3MJCA 4BNXA 4OKIA 3ROPA 2AQIA 3ZHBA 1PSDA 3CKYA 3ON5A 5T5QA 2IZZA 3BA1A 5I7SA 2Q4BA 2A4KA 4CLOA 1E7QA 1PR3A 1P74A 2GN9A 2V6FA 4YEDA 1F8FA 2Z1MA 1YL7A 3EK2A 3ETEA 2DUUA 4W4TA 2ZATA 1R12A 2OP1A 1Y8RA 3EC7A 4XDZA 3WSWA 1YQDA 3WBBA 1YVEI 5B4VA 2ZJ1A 4F6CA 1NQOA 2PH5A 4DBZA 3EVNA 4J1NA 3DBHB 2EJVA 3UGKA 4R16A 4B4WA 2GRAA 3GAZA 3AY7A 4XX0A 1S6YA 3M6IA 4MKRA 2FPPA 5TC4A 2O4CA 4GX0A 2CVQA 2JFHA 3D5TA 3DC2A 3PGXA 4FC7A 3OECA 4BQRA 1IOLA 1HETA 4PG7A 2Q45A 2EKLA 1TLTA 1P1KA 4OL9A 4ZQGA 3ZWWA 2VYVD 2NTVA 5THKA 2Y0CA 3AU8A 1NXQA 3NT4A 1I32A 2D0IA 3AM5A 2W2KB 5FI5A 3ORFA 2C29D 2WD7A 2O3UA 3WFIA 1B3RA 2YHUA 5IAAA 1MC5A 3GNSA 2X1HA 4QUKA 4E2YA 2BH9A 3BMOA 1F06A 3WGZA 2A9FA 1O0SA 2HJSA 4FR5A 4RCVA 1HKUA 2I76A 4CLXA 5G4KB 4XEHA 1FDSA 1UXGA 1I2CA 1DRUA 4OH1A 2D3TA 1AXEA 1HTBA 3Q11A 1OFGA 3AFMA 4B8ZA 3V5NA 4J4BA 4RPHA 2JCYA 3GVHA 3H2ZA 4TMFA 4OSPA 5H81A 3OETA 3JYPA 4QT0A 4IQ8A 4JQCA 4FN4A 5HA5A 1NFFA 3ZWAA 3VDRA 3DWFA 2W98A 3GNTA 3DHYA 5KJ6A 1SEVA 4TRMA 4W9NA 1GCUA 1VL6A 3EMKA 1VL8A 4XJTA 4FOOA 4OOFA 4B4VA 1HDOA 2HDHA 3GVIA 4WOJA 2WD8A 3FNFA 3PDUA 4YAJA 4KQWA 1I5RA 3RJ9A 2IODA 3I4CA 4Y6RA 5J23A 1K2WA 1PL6A 2WJPA 2YY7A 4KWIA 1DC3A 2ZCVA 3IC5A 3H9EO 4YAEA 1YONA 3KTDA 5ADHA 2BI7A 2A94A 2AW5A 3PHHA 3PZRA 2OHXA 3S2FA 3QP9A 1F17A 4RVUA 2VOEA 4JJFA 3UN1A 4J1QA 3F5QA 1PJ3A 5AOVA 4P4GA 2AE2A 1U4OA 2WE8A 5CEJA 2DVMA 1PGQA 2CF5A 4F3YA 3ANNA 4JLWA 3GEMA 3FBGA 4CMIA 4UUNA 4L73A 3LC2O 5G0SA 4BNLA 4WCDA 3T7CA 3WX0A 3IAHA 1YXMA 1PWXA 3A14A 4BNUA 3WICA 3P7MA 3OJOA 4O1MA 1N8KA 2B37A 4NFSA 3QVWA 2YW9A 1KBZA 1YDEA 4XGKA 5A9RA 1IHXA 4YA6A 5JE8A 4WLNA 4YB8A 1Z7BA 2FN7A 2IYOA 4DQXA 3RVDA 2CD9A 3ZWBA 5JMWA 1ZK0A 5KOIA 1VSVA 3AOEC 1E6EA 1EDOA 2TMGA 4DMLA 4UVEA 3LYLA 3QWFA 1E7YA 3INRA 2ZYDA 3BTSA 3L9XA 1ADFA 2YQ4A 1K6JA 1CF2O 3OA0A 1CETA 1TT7A 4QFCA 1KYQA 4XWYA 3OJLA 2VWPA 1SOWA 1JDJA 5LDGA 5TNXA 5IZCA 4Y6SA 3WJAA 4BUCA 2YV2A 4P4LA 4HV4A 4BNJA 5KNLA 5GZ3A 4W99A 4CV0A 1JA9A 3DMYA 3H5NA 5F1PA 4HFMA 3UAGA 3N74A 3TZQA 4BO0A 1PJQA 3U09A 2FR1A 1GL3A 2JCVA 2NTJA 2VYND 4BNHA 4XB1A 1DEHA 4UEKA 4YJHA 3KEOA 3JQDA 3SEFA 1YH3A 2C5AA 1Y81A 4OMUA 1HYHA 1K5HA 3DOOA 3OIGA 4CQMA 4J1SA 2LDBA 5DCWA 2FZWA 2GN8A 4U7WA 3KSDO 4MDHA 1IZ0A 2PD3A 3DAGA 3DZGA 3WWYA 3ZWNA 3QHAA 3LC7O 1YS4A 1NQ5A 3W8FA 1WMBA 2O2YA 1LI4A 4O6VA 3KEQA 3JD0A 3RROA 5HBRA 4E30A 2Q3EA 3X2FA 2HUNA 2Y0DA 3V1UA 1NFRA 4ITUA 4OYRA 2ZKLA 4D0SA 3VPFA 2WYVA 4XYLA 5IFLA 4RQUA 2NVWA 3HB4X 1XA0A 3TL3A 1BXGB 1FK8A 1AHHA 3B70A 4JXKA 4Q3AA 2YUTA 3GH3A 4GX5A 5ITWA 4OO3A 3KLPX 3RKUA 1SO8A 3DO5A 2PV7A 2XOXA 1VJ1A 2GYYA 4EW6A 3EHEA 2YV3A 5KVQA 2EERA 1KERA 3UH1A 5GZ1A 1ZVMA 3DR3A 4I5DA 4LVUA 2EEZA 3I52A 3PI7A 3JCZA 2Y1FA 1JLLA 1DDOA 1UP4A 4GMFA 4D42A 3TWOA 3D7LA 3HQ4O 3JQ8B 3W4KA 1MFZA 3RBZA 3WLEA 1QR6A 3VH1A 4EJ0A 3TZCA 1JVBA 2BRUA 5A06A 4KWHA 4TKMA 2WM3A 4MIEA 3KHUA 2ZYAA 3QV1A 4IBOA 2RAFA 4PLFA 4YAIA 2RIRA 4N5LA 2DTXA 4EBFA 1VJ0A 1NR7A 4MVJE 3B1KA 3IP1A 5F1OA 1T2FA 2VN8A 4FDAA 2BI8A 1WMAA 3ZDFA 2BFMA 5COBA 4WKGA 3PWZA 3PZBA 5G2OA 3JQ9C 1CJCA 4IDCA 4EEZA 4D7AA 1KEUA 4CM1A 4GKBA 4RF4A 2AEJA 4PLCA 2JJYA 3HFSA 4Q3NA 3G3EA 4EJMA 1HYGA 3FD8A 3DBVO 1R4MA 2EP5A 3JD1A 2F00A 1EVZA 1EZ4A 4TZKA 3WMWA 2Q1TA 4YJGA 4E32A 5BSEA 1ZH8A 1C0PA 4CQLB 2Y67A 2HO5A 2PZMA 3S2EA 1NTOA 2VYVA 3MWDB 2UVDA 1U4SA 2VCYA 1E1NA 2D5CA 1ZK1A 3L07A 3L6EA 4B3JA 3JQAA 3LF1A 2I67A 4MVJM 3ZHXA 4RO0A 4R1UA 2VZ0A 4RLSA 2NVUA 4U6QA 3PEFA 2BELA 4LCEA 3NT5A 2QIOA 3FPLA 3V2UA 1YJQA 1VLLA 2Z5LA 4LN1A 1H9AA 1YO6A 1IY8A 3PDJA 3RC9A 2X0IA 4OGWA 1A5ZA 4GX2A 1J4AA 4RLHA 4WNCA 1R4MB 3F5SA 1EEHA 3KLMX 3PYLA 1HE2A 3T4XA 3R3SA 4E2XA 1QKIA 3FTNA 3TN7A 1ULUA 1HZJA 2OUIA 4UVDA 3W6ZA 4DA9A 3BHMA 1P1RA 4PLGA 4YBZA 3U4HA 4HFNA 3MCVA 4M49A 2AHRA 2Y0EA 2VZ9A 4IINA 3WGHA 3WJ7A 1IZ9A 1NHGA 1U28A 1EVJA 6ADHA 3FI9A 1KC3A 2EHDA 2A92A 1Z75A 2O7SA 1RM4A 3TQHA 1K0UA 3AY6A 3CINA 3G17A 1K3TA 3ITDA 1ZW1A 1KOLA 1UXHA 1LC0A 4XGIA 5JDCC 3IUSA 1QYXA 3NDRA 1HSZA 2AEFA 4KUEA 3WS7A 1RWBA 5EIOA 3L6DA 2WTBA 3NT2A 1D1SA 2GASA 3R3JA 4OIMA 3BHIA 1Z6ZA 3RFXA 4ROSA 4NMHA 3C85A 3GHYA 4CLEA 3BTOA 5C5IA 1XQ6A 3KZVA 4E5PA 2VT2A 1LSUA 2JAHA 5DOZA 3U49A 3VAZA 4L8VA 4B7CA 2P68A 3NJ8A 4AG3A 4K6CA 4OKNA 2BD0A 1X14A 2FY8A 2J6IA 1XWFA 3L4BA 1OBFO 2VHXA 2ZTLA 3ROKA 4LVCA 2YYYA 1PGJA 4CV1A 2P91A 2PGJA 1DSSG 5L4SA 1F8GA 2BFAA 4DBVO 1X7DA 5I9NA 3JTMA 2O3RA 3ST7A 1QYCA 1BG6A 4U0KA 3S2IA 2J8ZA 4G81A 2B83A 5KJ1A 5CG2A 2GR9A 1JQBA 1M6HA 3OQBA 3JQBC 4DIOA 1GADO 1PS9A 2F1KA 2C59A 2WWRA 1DIGA 2VRCA 2HMSA 2BMAA 1FXSA 2HKIA 5JO0A 4XQGA 4RDIA 1HDZA 3DZHA 3OQ1A 4JCOA 4GLLA 1LTHR 3D4OA 1B14A 1T2DA 3ADPA 5ER9A 3ZWPA 3CH6A 1LRLA 4XQ9A 4TKLA 2BF7A 4PRLA 4Y9DA 2D4AA 4LK3A 3BHJA 3WIDA 3UCXA 1GD1O 1C1DB 1CERA 4BV8A 3MOIA 3H3FA 4L75A 2X5OA 3CE6A 5TLSA 4M86A 1NPTO 2A35A 3OEWA 5KTKA 2YHIA 2VHVA 1DLIA 4Q39A 4MP8A 4AJHA 2GZ2A 3M2TA 4XYEA 4DGSA 1DFIA 4ZA2A 4FJ2A 1Z45A 2VWGA 3F46A 2CVOA 2JAPA 1DRWA 3OICA 4GGPA 4DRYA 1O8CA 5DF1A 4RPGA 5L45A 4BKPA 3GVCA 5G0TA 1KEVA 2JFFA 4E5NA 3I9MA 1UP7A 4R1TA 3GC6A 1ZSNA 4E5YA 2X0NA 1S7CA 3L4BC 1ENZA 4WOKA 1B8VA 4GI2A 4MP6A 4YACA 3S1LA 3OP4A 1YB1A 3G1UA 1WPQA 3CEAA 3QA9A 3GVXA 3GPDG 2OO5A 3KYCA 4CV3A 2TMDA 3PGJA 4ND5A 1GEGA 3QVXA 1E3EA 1LLDA 2O3TA 3RQSA 2NADA 3TZ6A 1Z73A 5CDUA 5C7LO 4P4NA 1I33A 2QQ5A 1LEHA 4O0LA 1XIVA 4GVLA 3HE3A 1UXKA 4IJWA 4WLVA 1HDCA 2O7QA 4DL9A 3C7AA 4I8XA 3RBXA 3HDHA 3QSGA 2WSBA 1LSSA 3DFZA 4ALKA 3FWZA 1RJWA 1X1EA 1E77A 4IM7A 1YBVA 1E3WA 3DL2A 4UUMA 1KEPA 3GHHA 3RKRA 4EZBA 2ZB3A 3C1AA 4TROA 5JLAA 4E33A 2AQHA 5KIAA 4JX8A 3PRJA 5JNLA 2HMWA 4TWRA 1PJTA 1PJLA 3W4JA 2NU9A 3WBFA 5BNIA 2HJRA 1BW9B 4BO7A 4GSLA 3KYCB 1PJSA 3I6QA 4HX5A 2NWQA 1NVTA 1NX6A 2E6UX 5U4QA 3ZWVA 1GZ3A 3GPIA 4C4OA 3RC7A 2IEBA 5IF3A 1GQQA 4N54A 3X2EA 5JO9A 1X1TA 4BNNA 3CIFA 1M67A 2DFDA 4QQRA 4NK5A 3OM9A 1EFKA 3RUDA 4BHTA 1XHLA 4JJIA 3P19A 3ZNQA 4BNZA 3C7CB 1HL3A 4KZPA 1ZSVA 1AUPA 2Q49A 1C1XB 1MFPA 1VI2A 4IZHA 1AN9A 2P5YA 4DPLA 3NUGA 1ARZA 1CDOA 1LUAA 4XCVA 5GZ6A 4R41A 5AXAA 4WUVA 5I7FA 4TRNA 1MX3A 5I9MA 3WGOA 4BO1A 3FCOA 4MVJH 5T57A 4MVJD 5G0UA 3QVTA 3VTZA 4OXNA 4F46A 2WE7A 3QY9A 2VZ8A 1PL7A 3QWBA 4UVHA 3ITKA 4DXHA 2PWZA 4J90A 3NRCA 1A72A 4IXWA 5JMPA 4XDYA 1UH5A 1D7OA 1P44A 4W7HA 3H65A 3VKVA 4KDFA 1I2ZA 3H6KA 4MO2A 5CFZA 1L7EA 2E37A 4RDHA 3A1NA 1U2GA 3WIEA 5AVOA 4XD2A 3WYCA 2NVUB 5ES3A 4L0QA 3QWAA 3SXPA 3H8VA 3UKOA 2HMVA 3PXXA 4QFDA 5JFOA 3DEYX 1Q2XA 3PVZA 1AGNA 4LSWA 3D3WB 3BZUA 4C7JA 4WCFA 2HSDA 4MVJI 4TQGA 3VC7A 3S2GA 1MUUA 1W0CA 1GYPA 1EBFA 5JCJD 2P2SA 3AOEA 4BQPA 4J7UA 3HDYA 3H9JA 1H6BA 2Z1NA 4AVYA 1WAMA 5G4LA 4IQ0A 2QX7A 1LDMA 1YQGA 1U3WA 1VRWA 2J3JA 3CPSA 4Z0HO 1PGPA 3KYDA 4TVBA 4D44A 3IKVA 2DT5A 4CLDA 4IDEA 2B35A 1XCBA 1ISMA 1E3JA 2PNFA 3I4FA 4GWKA 4BO6A 3GNQA 2V65A 5DZSA 3VKUA 3GMDA 4EI2A 4XKJA 1DFHA 1ULSA 1E3SA 1KY4A 4YRAA 1PJ2A 4PVDA 1TA4A 4E5MA 2C07A 4PLWA 4DC1A 3C3XA 4TSKA 2E82A 1H0KA 1E1MA 5T8KC 5TIIA 4JP2A 2O3JA 3HJAA 3VH4A 1EMDA 1WDMA 1GZ4A 2VHWA 3K9QO 1X7HA 2HK9A 4J1TA 4WE3A 4DPMA 1HE4A 3F4BA 1XQ1A 1I3LA 4IIUA 1BWSA 3DDNA 2PY6A 4MKXA 3RBVA 4FFRA 2FPGA 1N1GA 5DBGA 4B3HA 2W2LA 3CTMA 4R3NA 4H15A 3M2PA 2NTNA 5EPOA 4ZU3A 3ROMA 5A1TA 3ZNPA 2WEKA 1HRDA 4QX6A 4UREA 4BS9A 2H5LA 2PGLA 2EW2A 3IKTA 4RQTA 1EBUA 3OF2A 1H94A 2GCGA 2V6BA 4A2CA 4IY1A 2XXJA 4YAKA 4YYZA 1Q7BA 5FYDA 3DAPA 3HN2A 3JYOA 3I3OA 4IS2A 2FPIA 4HADA 4JP3A 1A71A 3V1YA 5B12A 3T4EA 2GSDA 5KJCA 2VT3A 1SCUA 8LDHA 2VWHA 5JAMA 7MDHA 2FMUA 3QVOA 3ONDA 3IMFA 3UXYA 4CM6A 4PG8A 3ZCXA 1PJCA 1ISFA 2XPCA 1O95A 2FSSA 2VNSA 4R1NA 3ZNOA 4NPCA 1LDEA 3WB9A 1BHSA 1UDAA 3FN4A 3WFJA 3GGPA 5FWNA 3MZ0A 5A04A 4R4JA 3HHPA 4GMGA 3OEYA 3RUCA 1WZEA 1X7GA 5BNTA 5GMOA 2D59A 4O59O 3K92A 3RD5A 4D0RA 3TOZA 2RBEA 4S1VA 4JIGA 3BMNB 3AY3A 3ZNNA 1V35A 3F1LA 3HG7A 4YTEA 3DOJA 2NVBA 2JHGA 4ZICA 3RASA 5EN4A 4GVXA 1F0YA 2QRKA 1B16A 4DLLA 3FTPA 2B5VA 3M1LA 3MTJA 2VNAA 1V8BA 5ENDA 5A4DA 1YE3A 4QO8A 4RVSA 3ZW9A 4R1SA 4WLUA 1SC6A 1GFSA 1EVYA 4UVGA 2P9GA 5EINA 1MXFA 1A27A 1I2BA 4A5OA 4RPJA 4RF5A 4D3SA 4AICA 2EGHA 1N7GA 2DM6A 4PIVA 3PPIA 5JCJA 1DC6A 3LU1A 4OAQA 2DBQA 2NUAA 3GRKA 2QRLA 2C2YA 5G0WA 5U9CA 1V6AA 1Z74A 3WNVA 4NU5A 1H9BA 1PZFA 2CFCA 4HY3A 4AJKA 4B8WA 1JU9A 3O38A 3I9NA 5C3MA 2P9EA 5IDQA 4JK3A 1LLCA 3RWBA 3QIVA 3VHRA 3VH2A 3PLNA 5ER6A 4BNYA 3K8ZA 4BO8A 3DFUA 3HNPA 1PU2A 3L4SO 1QORA 3PP8A 5ILOA 4PG6A 3MJSA 2C7VA 4W7IA 4CMKA 3KSZO 4WNIA 3KOUA 1V3VA 2FZEA 1Y9AA 4RVFA 3BMCA 3GEGA 5HTOA 5B37A 1B8PA 3KYBA 1B2LA 3O26A 3DZJA 5CP8A 4J0EA 1M2WA 3SBOA 4JBIA 4TVOA 3H7AA 3WQRA 1DLJA 1U3VA 3GZ4A 1EE2A 1MA0A 1SB8A 5HS6A 3WLFA 1R4NB 4IIVA 1U5AA 2J5RA 1UDBA 2Y1GA 3H5AA 1VKNA 4OXKA 5K6AA 2IEDA 2JHFA 3TOXA 4B7UA 4KDEA 3GN1A 1EK6A 1J5PA 4M54A 4EITA 3TFQA 2DPHA 3GF4A 1GUYA 2EF1A 3CMCO 3Q3CA 1VKOA 1HDRA 5JDCA 4EUFA 5CDTA 1ZJZA 4FCCA 5EQFA 3ZHZA 1M76A 1YQXA 3EY4A 3JYNA 5EJ2A 1Q1NA 5KJFA 1A9ZA 2D1YA 1ID1A 4B7XA 1G0NA 2P9CA 1P0FA 4ESOA 4BB6A 4E0BA 4CQLA 3OIDA 3GDGA 1X15A 3WMXA 2P4HX 1TEHA 4YXFA 1I3KA 4RVHA 2YHIB 1K6XA 1LU9A 5DCUA 4XYMA 4I9HA 5DT9A 1IULA 2QRJA 4BKOA 4D3DA 3PHGA 2FSVA 4KOAA 1GAEO 1GTMA 4UVIA 1I10A 5JAQA 2ZTUA 1R0LA 5JYDA 2NM0A 4NJMA 1GZ6A 3UCEA 3E03A 2ZYGA 3S55A 4BOYA 2D2IA 5IN5A 1L7DA 2IZ0A 1EK5A 4CR7A 2Y1DA 2PKRA 3AK4A 1ZMTA 2DAPA 5CDYA 3WTCA 3BMOB 1H6CA 4K26A 5DOVA 4DREA 5A9SB 3ONEA 4MP3A 4BO9A 4OXYA 3FHLA 3C8MA 3INTA 4Z6KA 2E4AA 5G4KA 3D0OA 1QLJA 1Y8RB 4D79A 1Q7CA 1TB4A 2X0JA 3DONA 4ND3A 5DP1A 3MTGA 4IDFA 3PFFA 4E3ZA 4YR9A 3KUXA 1NNUA 2AA3A 1PS8A 1U1IA 1UAYA 1EUCA 2Y99A 2HRBA 3Q9UA 2VWQA 1NVMB 1ZMOA 1M6WA 2EJWA 4WASA 2AG5A 2X4GA 2G17A 2VUTA 1XG5A 4L4RA 4DWVA 2IXBA 1NPDA 4MVJP 2O3QA 5T64A 3QWIA 5BSHA 4LMPA 3FWNA 1E3WB 4AJLA 1GPJA 1DHRA 1GUZA 2BFPA 3LZ6A 1LC3A 2H9IA 2B0JA 2RH4A 4FC6A 4M8SA 4NK4A 4PZEA 1O6ZA 3Q2KA 3JQ9A 1BW9A 1UUFA 5CPBA 1MG5A 3C1TA 3TFOA 2H6EA 4URFA 4FJ1A 3EVTA 4ID9A 1LDBA 1ZK2A 2QHXA 4Q9NA 3E1KA 2XXBA 4G5HA 2D8AA 2OBNA 3AUTA 3TRIA 1T25A 4W6ZA 3NX4A 2B4RO 2EV9A 1HE5A 4XQEA 1D3AA 4U0JA 4CMJA 2HK7A 3W6UA 1VE9A 1FMCA 3LDHA 1DAOA 1PZGA 3LK7A 1P45A
chains in the Genus database with same CATH superfamily
1K4YA 4KMSA 2J3HA 1HNNA 1A8HA 2UZIR 1LBEA 1Q95A 4MUBA 4F5WA 1KP2A 5F77A 5BYBA 1KFJB 1MZVA 2C5EA 3QXJA 4G5FA 5ESXA 1HDXA 5GADl 2GYVA 2GKGA 2SKEA 3CNLA 4R9UC 4U2EA 2XUZA 1D2RA 2EIHA 3CGWA 2FUG1 2VQ3A 3OT1B 1C1DA 2WNSA 2ADRA 1KAGA 2Z95A 2AX4A 4PPQA 4QOJA 5F73A 5EMJA 4F1KA 2DYKA 4UUBA 4PBRA 2N46A 5K2OA 8GPBA 2RD2A 3LKVA 4M0LA 4D9GA 1II9A 5I4BA 1XGKA 3K9WA 5D3MA 1PHRA 3N39C 1KIFA 1FJGB 4DZRA 2C4KA 1ZEJA 2J48A 2QTCA 5AJVB 3H2JA 4QJBA 1E4EB 4DR3E 1ZUWA 1DBQA 3WJ2A 2O1SA 2XVYA 4BCAA 4AC9A 2QT0A 4DEVA 3D7SA 4DKXA 4IXMA 3ZWXA 4R2SA 1KH1A 2FPXA 4UBKA 3TVYA 3Q6IA 4XUEA 4O5AA 5H83A 2ZK7A 4BLUA 4Y2JA 3PUWA 3HMQA 2EFDB 3GJ6A 4BNVA 1D2CA 3UW1A 5EWLA 2X19A 2OXIA 4WHMA 3H18A 3IJRA 2CUZA 3KV3O 4ITRC 5SY4A 4DJ5X 1C0EA 2PL1A 5JXWA 2ZIGA 2JGAA 4DDWA 1SRQA 5EUQB 2CW5A 1BDBA 1C41A 5FAXA 1OUMA 2AG0A 3CLSD 1O97D 3SR3A 4BZZA 4F54A 1NN0A 2A1TS 4QJ5A 1NJ6A 4DARA 2I6QA 3R8XA 4GZ6A 3QNWA 4NR0A 4CMEC 4YMVA 5IZ4A 3R8FA 1LJLA 2DUJA 4KPUA 2RGXA 1Q0SA 4O2BA 3ETNA 1DKLA 4FW8A 4RDCA 7AT1A 1TM1E 1G8HA 2DF8A 3LIPA 2XUKA 1QRRA 1NIPA 2PBRA 1FX0B 4G6ZA 5E38A 1W19A 2VDKB 2W22A 3JRNA 1MCZA 4MI3A 2YWDA 4RD2A 1K7CA 1Y8CA 4AJPA 3MMZA 1TOAA 2GPIA 1CE8B 1ZM3A 4A6XA 3KD2A 3IERA 4YCSA 2WP8J 2DULA 3HJNA 2OV8A 5TARA 3E5MA 5HDBB 1DJMA 1G9TA 1SHLA 1U3TA 2GQ0A 4AFNA 3HBMA 4TVSA 4TMYA 3FDZB 5FPTA 1PZEA 2GZRA 2ODBA 2R8EA 2W6ID 2AYXA 1Y6RA 2BTOA 2LRSA 4ARIA 1V8FA 2EPUA 2MT9A 4L50A 4DGQA 4Q21A 2WDZA 4C9BA 3SI7A 5JADA 5ISMA 1N2CA 3O8QA 4EB6B 1TLFA 2GLXA 4MW2A 3D3JA 5CJJA 3TLGA 3PNPA 1X48A 3B1JA 5ALPA 3V8NA 4JLUA 1RQGA 1BKSB 1BU8A 2IYPA 2XE6A 1T26A 3KKQA 4C0KA 2IU4A 2CE2X 2XB9A 1C7ZA 4UTNA 4YMGA 1FQOA 1AOXA 2GBLA 2G3YA 1PF7E 2BZGA 4TSFA 1XEXB 3A0UA 4F4HA 2FWBA 3QKIA 1VSUA 1XX6A 3V1TC 3THYB 2GPTA 4O4JB 3RS8A 5B6IA 3S29A 3ZJVA 1LVUA 2OBBA 4CIWA 5JRDS 2YSPA 4QG3A 1O54A 4V0RA 3I2FA 2GJ9A 1TMGE 2JH8A 4I1VA 3TIFA 1KDRA 3UHOA 2JAXA 1P4HA 1FIUA 3AESA 5AK3A 1QHIA 3EZ7A 3E7PA 1DFGA 2I34A 2PU7A 3AEKA 3A3YA 4QD3A 2IYRA 3DB1A 1OWLA 3H4VA 3NOOA 3L79A 4NIMA 5CX1B 2HLDA 5F51A 2OXFA 3QELA 2NUFA 5DNYB 2J5QA 3KHTA 4FYKA 4ZYDA 1DOZA 4L9RA 4QEKA 4UDOA 3L0DA 1SUFA 1GFWA 2WQZA 3NO4A 4KH1A 4BYGA 4DA4A 2AQ8A 1U1GA 1ONNA 1GGHA 4WLEA 3T5PA 5AM1A 3MWJA 1ZQ1A 2CK3D 3ROGA 4UBJA 1PVOA 4ZAFA 1RXCA 1Z4JA 2G36A 2EMCA 3KQOA 4G5SA 5H16A 1EX1A 3L8ZA 5M7EA 4OB8A 1I6WA 1R8JA 4DNFA 4BMPB 3ZVLA 1UFQA 5D5PA 5JQGF 5KO2A 3DTYA 1V3UA 3DDWA 3C4BA 1IB0A 1F14A 1XTKA 3FNHA 4JLMA 5CB6A 1EAYA 2B9VA 2JI9A 3I72A 1KJKA 2CXHA 3KLBA 4YDHB 3VI4B 4BZWA 3ZLUA 1FU8A 1XXHE 2ZVQX 3PITA 2I87A 4DIKA 2C7QA 3R7WA 4ALMA 3CBGA 3PNYA 4X44A 3OCYA 2ZFUA 2QYTA 1UC8A 3IIEA 3R5XA 1ZAKA 1QH8B 5K4AA 1JZSA 4D43A 4JI0B 4N3CA 1UK6A 1PT7A 3VYYA 3EASA 3KQSA 4OBXA 2CL7X 1W94A 2G0AA 4YJFB 1UFVA 4MW0A 2CVFA 4NQRA 1JKJA 2QM8A 2NO5A 1TJ3A 1Y0BA 3VZCA 4WA8A 3K0CC 4G1FA 4DDTA 1F51E 1GRVA 2XJ4A 3ABIA 4E07A 1Z5ZA 1NNSA 2WMNB 5JC8A 4BYMA 4EY4A 5KNBD 4RV4A 2MR5A 2MINA 3G02A 4QYMA 5CEFA 1G3MA 4PFJA 4EHFA 1M0TA 1JYEA 5TT0A 2J0SA 1L1FA 4XR9A 2Z5GA 3WG9A 4LHVA 1G7SA 2NUTA 4GL4A 1F20A 3AUAA 4PINA 5IJ0B 2CLCX 4GPIB 4NU6A 3V8RA 5A03A 3JVEA 3CH5A 1E5XA 1TADA 5BQFA 4XDHA 2X7HA 2OESA 3P4YA 2EM6A 3C6BA 1QE5A 2VK1A 2WA1A 3P0FA 2UYCA 1QO9A 4EGQA 5HRAA 5JG7A 3I83A 4ZFNA 3TE7A 1WDKA 3U4MA 2Z0MA 4LHEA 4OATA 4OXXA 3CONA 3I04A 3G1TA 3THOB 3JARB 3WL7A 1PT5A 1S9HA 2CXSA 1J0EA 1Y1TA 1KQGA 1QG2A 2NU8B 3HVRA 2P78A 1JHDA 2R7KA 1EE1A 2PQ6A 3ZJYA 1W34A 3CXRA 4TGLA 2OAQ1 1KK3A 3TBKA 1SKMA 4OI4A 2HOQA 4KP7A 3LWBA 2AR9A 5TMBA 4PZDA 1M34E 3EA4A 2EW8A 2OQIA 3HCRA 1OC4A 1XQ9A 1NVXQ 2FPPB 2BFEB 2VH5R 3GL9A 3JQ8A 4Y0VA 4IZIA 4CZ2A 3WOHA 4GXTA 3EPKA 5DM2A 3W3AH 4A0HA 4JV5B 1XDGA 2BEWB 2OMKA 5JWOA 3ELDA 3OBBA 1FSGA 1HF3A 3D4BA 4A1OA 2G5CA 3PSAA 1CLEA 4EYGA 1ATIA 4C21A 4KWYA 2AR7A 1NMXA 2I1LA 5E9JA 4B85A 4NY1A 4JODA 5BN1A 3KQNA 1XNJA 2OM2A 3GROA 1E99A 2GAAA 4QIHA 2ZETA 1QB8A 2DP4E 3ZV3A 1QWSA 4Q47A 3UC5A 3HVIA 3STUA 5L3QA 1HLDA 1E9AA 1QTRA 2HQ1A 3ZWMA 4A3SA 1S3FA 2X8JA 2GVNA 4G8CA 3CO0S 5E4JA 3P2OA 4K9RA 1UBNA 2H5EA 3I5UA 4GG1A 3C1OA 1DHTA 1DC7A 3I23A 1PS0A 3OJ0A 3U7QB 2Y1EA 4PZCA 4WBXC 5IG2A 4HAOA 4PW0A 3MWFA 1GGJA 1Y3CE 3G2OA 3BFPA 4XWTA 3COVA 4ITVA 3K9BA 3MQ2A 4A03A 13PKA 1DBRA 3W2TA 4BTVA 4P3YA 3WO1A 5BOSB 5HIIA 10MHA 2E4UA 1CUFA 4ETNA 1Y6GA 1FNCA 2F3RA 4Q3OA 4TWIA 4Y2VA 1GTSA 2QI9F 4XW2A 3OKCA 1CRQA 1ZFNA 4V0LA 4B3BA 2ZM6B 1UK7A 2QQGA 2YSOA 1GL7A 3HKBB 4NJEA 5AI0A 3EGVA 4IMPA 4H1WA 1YZNA 2H0RA 3G68A 4IUCS 2B8WA 2ZI6A 4IHKA 3WLAA 1WO8A 3KHSA 1QF9A 3K9LA 3OF5A 4DV0B 1RLTA 2OP0A 3RB8A 2PPLA 2A25A 2AF4C 4NBLA 2EOYA 1AKMA 5KAPA 5DGHA 1BVRA 3FNGA 4K6GA 1G4UR 3ZY4A 1VCOA 4BX9A 2FEWB 1MPXA 5HKLA 4Q4JA 2P62A 2R5NA 2QXUA 4HWRA 1U7XA 4R2XA 3ZGYA 2GCIA 5FH9A 2VPTA 3T95A 2BE9A 5IHPA 1VG0B 2UZ1B 5DV9A 4FFPA 4ZAZA 1OBHA 3E27A 4BAGA 3SMQA 4OJTA 2FWMX 5U1PA 5K0ZA 2Q4RA 2VDQB 3RUIA 4OLAA 1B15A 2NABA 3A7DA 2A3RA 3AEXA 2O48X 3HDQA 4MS4A 7ADHA 1J8VA 3ISTA 4NEGA 4AJNA 4C5CA 2Y1OA 1XZIA 1GCIA 3DLTA 3M6LA 1ICIA 1DBSA 4EY7A 3JAWB 1P19A 1WXQA 5CCEA 2L42A 3AHFA 4DV5E 1KJYA 1ZCJA 4GPEA 4BVKA 3I92A 4DEYA 1ZBTA 3DEAA 3QWHA 1I13A 4I1IA 4R31A 3AI3A 1RXWA 2OOSA 2WMDA 1ISGA 3CZ4A 4ZT7A 4BNKA 3ZJTA 2P3OA 4C04A 2O0KA 4I55F 3KVOA 4P7KA 4EHAA 5LQDA 1QZTA 5FAKA 1F38A 2I8LA 2WZCA 2PYIA 3MEQA 5K09A 1DS6A 1P73A 3ZH9B 1ONBA 2FZ4A 1U2EA 4NDNE 4DC9A 4X7BA 4AZ0B 2KONA 4DWOA 4DMGA 2OXTA 3EZLA 2P1ZA 3QTLA 5ELXA 4IIBA 3QBEA 2B7BA 3NBXX 3PFNA 4D9JA 5LQRA 1JFTA 3CN7A 2YTQA 3JSAA 3TQOA 2HT6A 2A0WA 1MOPA 2H2IA 1AKEA 3E61A 3M4NA 3OPYI 1TGYA 2IV3A 4EFKA 1G0OA 3RVRA 5JD6A 5E7MA 2CUKA 2QN1A 4X1KA 3LBYA 1EUDA 3GT4A 3A9WA 3BFKA 1DCTA 3Q7EA 4LXUA 1V3TA 1R5OA 4EMSA 1PD1A 2H9YA 4PLTA 3PGVA 3A4IA 4HWOA 2Z3VA 3L02A 1NP3A 2WAXA 1SHUX 2J08A 1FX0A 3MS4A 3OLYA 4DR6E 1UC5B 1KK2A 1F5SA 3OO0A 2OZVA 3BXXA 1UDWA 2XSZD 4QDTA 4U3JA 1Z5PA 4YUVA 1ESMA 1DBVO 3EISA 4FZJA 1GL9B 2C4HA 5C1BA 1CE8A 3LUPA 1VIYA 3O9MA 2ZWMA 5EGNA 2BM1A 3ZGLA 2VAPA 2W58A 3C43A 1EP2B 1G98A 3D64A 3AR2A 5EA2A 2H51A 4R8KA 1P2DA 2DWQA 2JIQA 4GOXA 4FS8A 2JFNA 3ESYA 4YRDA 2YYAA 4A23A 4BNDB 2ASEA 2W2NA 3OUTA 2WG0A 1V41E 1DC5A 1A4IA 2QMQA 3L1IA 2DQKA 2OA0A 4CKXA 2NPIA 1QHGA 5A9TA 3SY8A 3AM4A 1KKUA 2M2IA 3P5SA 3KO8A 3WGTA 1UBHS 5JS7A 1NONA 2FUEA 3V7YA 1XB2A 3MJEA 3WB0A 2VDRB 3ILHA 5AJXA 1I7QB 3ASVA 3OJFA 4S1WA 5DNDA 2RHRA 1O9BA 4JL8A 3DEZA 4O4HA 4PS1A 2VP2A 1UILA 1VE3A 2C2WA 2E5LE 3OFVA 4NG5A 4PTZA 3TNLA 4DJJA 1BGXT 1TQDA 1GQEA 1DUVG 2BGNA 5IAJA 1N75A 4N39A 4YI3A 4ZK2A 4JP5A 3F6HA 1ZCFA 4Y0AA 4G5OA 3EYWA 4AL4A 1UK8A 2FG7C 2QIPA 3OKAA 2OGUA 3G0GA 3A9RA 1SC4A 4JSTA 1D1TA 3FWPA 3QVSA 3WGLA 6GPBA 1JG6A 3G0IA 3HACA 4FI3F 4J49A 5FO0A 4X84A 5ALNA 4NE9A 5FUXA 1PWHA 1BVUA 3QU5A 1W93A 1TTHA 4CF4A 3EEYA 4Q1DA 2LBPA 5AH0A 1RWKA 4IOKA 1J8FA 3JQBA 4WVLA 4N48A 4HZUB 3SSOA 3EZ6A 3PUHA 3T3OA 2FAXA 2WRZA 4FMDB 2AN9A 4RL4A 3V3KA 4UOEA 4CM3A 2XT6A 1K68A 5CG1A 4DB4A 3K6RA 1SOVA 4JBWA 2ZRQA 1YJBA 4UBLA 4AX8A 1L3CA 2KQUA 2RHGB 4GRIA 2R86A 4H6WA 3K6KA 3AKCA 2KLHA 2GLIA 3TDNA 5KL6A 1K8RA 4MR8A 3WRVA 4N0DA 1NDQA 4ALJA 4DE5A 4CLRA 5LP6F 1D1QA 2C5SA 2YC2C 2PZGA 5JAOA 1RWXA 1TTPB 3Q88A 2KX7A 3NQ41 5TEVA 4NNPA 6Q21A 1T8YA 1WTCA 3IEUA 3EXHB 2ZTMA 5EJ8A 1QK3A 1DAGA 4M9XA 3TPFA 4JJEA 4KH0A 3HB1A 2B3TB 4WPYA 1YUJA 3G2HA 3PLRA 3IV6A 2G76A 2QG4A 2QVLA 5L6LB 1GV0A 1H2HA 1DP4A 1RKVA 1OU4A 2PUVA 1G291 1DTWA 2JBHA 1PTKA 1UBMS 2EFGA 2RQLA 1K89A 3NBAA 5AM0A 2UYGA 3NWOA 5ADVA 2RC5A 3IOBA 1KDVA 3RK1A 2H2AA 3HABA 4HZGA 2XWPA 2FLVA 3UWSA 1P18A 4QYTA 1XKLA 1H6DA 4WDQA 2JFXA 3B9BA 4J0GA 5AUPB 4NFHA 4LF5B 2BUCA 1WKBA 3DNFA 3O4RA 1QWOA 2H4JA 4YO8A 2P4QA 3CLSC 3C6QA 3QVVA 5LQSA 2HMUA 5A2GA 2UDPA 3QBJA 4LBZA 2O2EA 2X23A 1EJ0A 2GLTA 2R8RA 2GS9A 4KL8S 1CUEA 1I1OA 4FKBA 4QQNA 5LYJB 3K1ZA 5FFMA 4DLYA 2PTHA 2JCXA 4F97A 2UZ3A 1NN5A 1ECBA 1Y1PA 4JB8A 3M1YA 4Z0PA 5JCXA 2G5TA 4GPD1 2BGKA 3ESAA 2QE7D 5AOBA 3WHIA 3WYFA 4CT4B 5JISA 3DR5A 4LSZA 3RSHA 3KKOA 4RETA 5KCMA 2B69A 4DC0A 4IDOA 1GSOA 1EVEA 3GFBA 3JAKB 5AYVA 3B78A 2POQX 1JQ5A 3CSUA 5DCLA 4ZVSA 1ODCA 3BCRA 3K71B 3OOJA 5AI9A 3VSCA 5TX7A 1TVKA 4MPTA 5AOCA 1T6XA 1TQ6A 3ZQ4A 1CZHA 2PQMA 3AFIA 5T41A 3HXPA 1E3IA 1SK8A 4L74A 4A26A 1XNRB 3EY9A 3AM3A 5JSFA 3B1YA 1CNFA 1U0OC 1VZ3A 2GTHA 4R98A 3VC1A 4HQOA 1J9GA 3H3JA 3ZHTA 2EMGA 4GI7A 1RQLA 1B7GO 5EIHA 4BBAA 3ELUA 4DBLC 2H1FA 2EP7A 4YREA 3I12A 3REGA 4B3GA 1AJEA 1CXZA 2X15A 2VUSA 1AT1A 5HP4A 2B9EA 4NBWA 2JFPA 2IUUA 2HFKA 3QTBA 1QHNA 1XYGA 2WABA 2JXPA 1LS1A 1MABA 5EERA 1M8KA 2ZRCA 2PJZA 2GM9A 3PWSA 2JAQA 3A70A 1ZK4A 4DV4B 2G40A 1FVXA 1ABBA 2V4UA 4LY3A 4MAFA 1YT5A 1OMOA 3ROQA 4MI6A 3THXB 1D9ZA 3M89A 3TTVA 1YOVA 4LY9A 2YWXA 3AJAA 5E8JA 4OJQA 5IBQA 3LFTA 4MH0R 3ZHCA 5KS2A 2GX6A 4QXOA 3H5TA 1V8DA 4WZAE 3T1TA 1VPWA 2XCOA 1V1MB 3IUQA 1IY1A 1CVIA 1WUYA 1GYQA 2VQ6A 5HXAA 4NMLA 3ZZ0A 5JIBA 3BJEA 3NHYA 1EXWA 4KTVE 2AI1A 2QP9X 3T5TA 5MN4A 3ERCA 1GZDA 3BGVA 2L2KB 3ETDA 4IS3A 4PPGA 1HWYA 4JD5A 3AXSA 4KK3A 1M0SA 4WK6A 4FYYA 4C3ZA 5D5QA 3WGYA 1E7WA 3A4MA 1VG9B 1RTTA 3IA7A 3W5CA 3RVMA 1YE8A 1XP5A 3HGMA 5EHGA 2DLDA 1WXRA 2WFLB 2ZJ0A 4JT2A 4J7CA 3H0EA 4EHHA 2WQ7A 5JBQA 2V6IA 5I7UA 3I61A 2A5DA 3BAZA 1SJ9A 4PWZA 4C78A 1O95D 1TKAA 5CTAA 3PUZA 2R8OA 3EARA 5K8VA 4MYDA 2Y92A 4GC5A 3GELA 4M1OA 1KORA 3IUBA 4MLCA 1G2DC 4F6RB 3C3CA 5ALUA 3VR2D 4EHJA 4DJAA 4LOLA 5IDYA 5AM3A 4OI1A 1NSTA 1XTIA 4HQ0A 3ZIDA 1Z3CA 5KYXB 4CKBA 1R15A 4YMLA 3MB5A 1R9GA 1CNEA 2IXGA 2O5RA 3SKVA 3N58A 3IMKA 4DT1B 1IEVA 1FUKA 4F92B 4X61A 5AIBA 5FV7A 1U3DA 2I5PO 4NICA 5HK8A 4EJ6A 1E66A 2FOIA 4BNTA 3PNOA 3SXUA 4TTSA 4M3NA 4U9HS 2QV0A 1C1XA 3A1TA 3H9UA 3N0WA 3PUVA 3HLYA 4J6EA 3F9IA 3QY0A 5F64A 2X86A 1KR5A 1OSNA 4GLFA 4MVJA 4J0CA 3QLVC 4D9MA 4TRJA 3S7TA 4MRAA 3W06A 3K05A 1QKKA 3AV0B 1KYZA 2VUUA 1O87A 5C31A 3STWA 2RG7A 4AP6A 1GTZA 3QPWA 3AWDA 3R5JA 2WYUA 3MOGA 4FPXA 4LKRA 5AVRA 1RAGA 3HI6A 5KL5A 3JATA 1VMEA 3IJ5A 3OQPA 3I6ZA 4KLCA 1NMQA 1M2GA 1SKUA 4NQZA 1OZFA 1NC3A 2FLWA 1K66A 3CZCA 2FR0A 3DUFB 4PHCA 4PR0A 5COAA 3V4OA 1G8SA 5KBYA 1IY0A 4DR7E 3PNQA 4BBJA 3HNRA 3TSWA 2XCUA 2ZBRA 1YR1A 4PU0A 3V4ZA 2E48A 2IF2A 1WXWA 1FDTA 2CC2A 4Y8VA 2HWWA 1G66A 2H2FA 2OORA 4GGOA 4HGOA 3F6EX 4OGFA 4YIHA 4TTPA 2QVYX 2O7VA 3PCXA 1Q91A 3QI2A 2PKQP 5IEBA 3ZHOA 4NEQA 2TMKA 2QRPA 3TDKA 3EZYA 2MU1A 3FUTA 3J81k 4E51A 2X9QA 2NNLD 4KPYA 2VYFA 2SKDA 4FNOA 1GEEA 4BN4A 3NEYA 2J6CA 2ONZA 4QDOA 4WSGA 1OIXA 3PJFA 4CL0A 4A82A 1VPTA 1JLKA 2QKYA 3RTDA 4A1FA 4NMWA 5CVEA 1PLKA 4Z9XA 4F7WA 5UKDA 2EDCA 3GDOA 5G1PA 3KPVA 4RFLA 4P8RA 3GLHB 2JS7A 4JNKA 5EJEA 3LIIA 4ZO8A 1AXGA 1B4DA 4HLUC 3UV6A 2Z6AA 1SBYA 5JLJA 4CWAA 1LXCA 1MDBA 1NL3A 4OXQA 4CFZA 1JYSA 4R9SA 5JJ5A 1ZHHA 1U5BA 3CF4G 1YC2A 5DNCA 3ANLA 4AXBA 3PA6A 3HXQA 1YYOA 5HWSA 1M6EX 1XWWA 2HSEA 3KE8A 4K88A 1EVQA 3HM9A 2EYQA 2QMHA 4GM1A 2Z4TA 3VJRA 3B6EA 2ZIZA 3HL4A 1OLSA 5ALLA 3PHBE 1N5JA 3F5FA 1JFRA 4IJ6A 4JBNA 4ZGWA 3E48A 3AG6A 2HCRA 3IB3A 1AA6A 4DV5B 3A26A 1LRJA 4XZ3A 2R6CA 4CIVA 4KIUA 3FZYA 5ICGA 3ENKA 3CR7A 2J87A 4WCFB 2JVJA 1JR3D 3HJHA 4JJGA 5CM2Z 4CKEB 1UAAA 1WHTA 3ENQA 5HPYB 4LISA 2VRCD 4EECA 5HS4A 4JN6B 3M6VA 3NV9A 4MKZA 2OBFA 2NUEA 1YS9A 2F7SA 1EM6A 3B51X 3ZGOA 2OUKA 4KX3A 1RJDA 4RBNA 1HTTA 2EFHB 5ELMA 4BRUA 1L9KA 3SPXA 1A1GA 3GBSA 1YJCA 2Y0BA 4JVMA 5CA0A 3QVGA 1RTKA 1VOTA 3K53A 4HSEA 3KB6A 3SOPA 1T43A 5BYAA 2CV0A 1ODJA 1QOQB 5LOVB 4J0KA 1VB5A 2GD2A 1JPJA 2Z4RA 3RIHA 3LVFO 3SS7X 3U3KA 5CVDA 4XWOA 2IOHA 2WKRA 2PGIA 1ONPA 4I55A 3L7JA 3RTCA 4ENUA 2CKDA 4P38A 4JKYA 1VYHA 3JQ7A 5GIOE 2NW6A 4R7ZA 4WIAA 3HU3A 3EYAA 3JX9A 4JBHA 4IHJB 3AONB 3N8DA 3OP1A 3GT7A 4KTTE 1T6YA 4JA0A 4N7RA 2C4WA 1DQZA 1KH2A 4LXIA 1OBVA 3RUEA 4ZYEA 4MK4A 1G3IA 1HDGO 1IBCA 4WOCA 2Q2NA 3EGDA 3O8BA 2WI8A 3KCQA 4RX1A 1AUOA 4NHOA 3K0KA 4NOMA 1KJJA 4QU5A 3TW4A 1T0IA 2DU8A 1G2FC 1OZHA 2P41A 4Z8YA 4L9SA 5GOZA 1RWNA 5K51A 2PM8A 1E92A 4HDMA 3WLPA 1MF7A 1JQ3A 4YDRA 1DEOA 4BNWA 3IUNA 3H5IA 4IUYA 3RUFA 1REQA 3FTFA 4QTXA 4DA0A 4WV3A 3HP4A 2HU2A 5AW4A 4E21A 1M2OB 3DTNA 4P92A 5IBPA 2FGJA 1R0SA 2IYAA 1B6TA 4ZQCB 4E09A 4MRMA 4L0CA 2C7GA 1GU7A 1JXOA 4O08A 2QVZX 1WHNA 1X47A 3MTBA 2QYOA 3ZLJA 3DOEA 3MJVA 2NIPA 2HV8A 1P1HA 5CLHA 2A57A 4YPFA 3DJYA 4H77A 1V47A 3MFYA 3N9IA 3FCAA 4B3SB 2B21A 4IJUA 4NYJQ 1LVGA 2QL6A 1GGKA 2Y71A 3ZV6A 4DM3A 5JAZA 1Q92A 4LE0A 1C0IA 5H02A 4QKQA 4CKCB 5L8VA 3O1HB 4CUKA 1LPBB 4ESHA 3GEDA 3K0FA 3ZZNA 1YRYE 1QIIA 1T34A 1I3NA 2VJBA 5IK2D 4OUKX 2AHOA 1R4NA 4AK9A 1M2FA 5AM2A 4BFYA 3L43A 3T0GA 4X7RA 4LF7E 3AB8A 1Z9BA 1QQ6A 5K3EA 3JYLA 4CL8A 2ZUUA 2VS1A 3SZGA 3WSTA 3WC4A 2Y05A 3NEJA 2I4IA 3R24A 3ZYZA 1O7JA 2GEBA 2J0UA 2Z2JA 3HCOA 1UPCA 4ARAA 2X1MA 3KWLA 1E7MA 3CXUA 2I55A 3OU2A 4HNGA 1EFPA 4ZC8A 3HZRA 3ICPA 3D1JA 3SLRA 4M87A 1FDWA 4AJ9A 2C20A 3CVXA 5DNEA 1YUIA 4O5OA 2JHPA 3NAQA 1L5FA 3BDIA 2GF2A 1JNXX 5KSYA 1JUDA 1A9RA 2B2CA 3ET5A 3P9PA 1DKNA 2TSYB 4QSMA 4Z4GA 2G9NA 2QGNA 3ZDDA 4F91B 1V39A 5LIRA 1C4KA 5F7OA 5GM1A 5AW9A 3UJDA 3PRKE 4MI1A 1YS2X 5JALA 4F45A 4NRDA 3F2IA 1PT6A 3ANMA 4GKKB 1PL8A 3MSCA 1MJNA 1CYEA 3G5MA 2BZ1A 1NR1A 1L1EA 2XA9A 1T2VA 5KDDA 3VZQA 2XB2A 1DRJA 1VMAA 1T1RA 4HLDA 2GLUA 4MVXA 2HXSA 4M30A 1AUXA 4UOQA 4YJDA 1A1KA 2QSYA 1EM8B 3W6OA 3JSXA 3DF6A 4Y67A 3FSRA 3V9AA 1QYRA 3K5IA 4E08A 2CL0X 4HYEA 1GQ2A 2QTFA 3U3OA 3AW9A 3EXFA 3JQRA 1SKAA 3ZV4A 3LL4A 3KL2A 2EPPA 1XA4A 2YJ5A 2WVGA 3PCTA 4PRKA 4UFOA 2HLDD 1RYEA 1JJ7A 3LKBA 1IPHA 2NUPB 2ODPA 4W82A 4EAAA 1QAOA 1HEUA 4WGFA 3FDIA 3E2MA 4G26A 4MYTA 1X1SA 3C5VA 3KQMA 3VO1A 4AW9A 4BVJA 3KS9A 3AVXA 2E1MA 2QJWA 4NBVA 5C9ZA 4IDBA 4LRTB 1A8PA 2A4MA 3TSAA 2P4EA 4BNYA 2W4QA 5HF9A 1Z07A 1GT6A 4OKSA 4EY5A 3BXEA 4RAOA 5MF6A 4XYBA 3ZCQA 1W59A 2WSYB 1YRLA 2G6TA 2CF6A 1U0FA 2TS1A 2ZSEA 5IBRA 5EMNA 1DAPA 3A9TA 4QVIA 1Y4DE 1SWWA 2V87A 3L04A 1SUEA 3ZGZA 1IN4A 1TI7A 4HYTA 1MIOB 2D74A 3SM9A 2EMHA 4HR7A 3V6LA 3FPBA 2RB5A 1IOWA 2HPVA 4EZEA 3GLGE 1FYWA 2NTYC 1Y42X 4LDRA 4P58A 2EOSA 4YMTA 1N2HA 3UNXA 3A05A 2I33A 1OXMA 2CEAA 3NM6B 5L51A 4B4KA 1QRSA 4AJ4A 1C81A 2R8XA 3ESDA 2WV9A 2B7CA 1K6IA 3A1WA 3I01M 1UMBA 1N5IA 1USGA 3LRTA 5ALYA 3CQ9A 3H3XA 5AWFC 4S05A 1UZMA 1YACA 4UJ3A 3FLAA 4PHHA 2HD4A 2OSVA 5B2ZA 1FMFA 4F6RA 3R20A 5CK4A 3VDMA 2PU5A 7ABPA 3B6IA 1ADBA 3I1FA 5FWDA 2EMAA 3IWCA 1V7QA 2VK4A 3EVFA 3QE3A 2Y1LA 2O1XA 3M4XA 2VR1A 1KFEB 3E9QA 1L5VA 3B6MA 1NRWA 1COZA 1ORDA 1SA0A 2JA2A 2C77A 4UHBA 2Q46A 4K05A 3LO5A 3PD1A 3TOVA 3UHFA 4CG3A 3KEMA 3E8SA 5JJCA 2XTAA 3WLQA 2I4RA 1PQPA 4O29A 3EXIA 1YZ9A 4DDVA 2F3TA 1P7YA 3MGKA 1Z18A 1VGVA 4HAXA 2HW8A 1T4LB 2BP7B 2GEUA 3JZAA 2FB9A 4OHKA 3IOEA 4OP1A 4IDPA 3GWGA 2PRZA 4FOTA 4MA0A 4QDKA 3RRYA 2BLNA 2XF8A 4DHWA 1S2DA 5H9WA 2WIDA 2RAVA 4JKIA 5FFFA 2FFAA 1X19A 3LVQE 4Z3DA 5IJ9B 4J6FA 2GCOA 3MWEB 4IGAA 5JANA 3PFBA 2ES4A 1MXHA 4JC0A 4OI0A 1QRDA 2I3GA 3GRYA 4FILA 2QS9A 3VPSA 1X7WB 4UUOA 1N4DA 4B1FA 2JLRA 2VZLA 2RHOA 4KMOA 1U0LA 1NNI1 4D9HA 1M7GA 3AUUA 3Q9NA 1YSAC 5DK6A 1E0SA 3B1WA 2CXNA 2FP4A 1ZJJA 4JVSB 5F21A 3FIJA 5EP3A 4A0QA 4DR7B 5F5XA 3AT1A 3C87A 3I9FA 4HDNB 1FSSA 4LJAA 5FEMA 3H5RA 4KFTA 1ZA2A 2Y1CA 3IS3A 2O06A 3MHPA 3LUHA 5K0NA 4ARSA 2VTDA 1DQYA 2GPAA 3IQDB 4RPCA 5LCXA 4F0JA 1JPNA 1OD6A 2BFFA 2WHQA 1TAHA 2ODAA 4HWTA 2ETVA 3RSFA 3DTTA 4FYJA 4ZCPA 5NULA 1IZ7A 4BV9A 3HJCA 5E2IA 5JDIA 1H0SA 4E4TA 3G0OA 3HY6A 1M74A 4QEDA 1UPXA 5E6RA 1BXZA 1XD2A 4GR5A 1ZW6A 5IC6A 1X9HA 4A0SA 4B6PA 4DLKA 5JCOC 1JW9B 1BOFA 1D6JA 1SVNA 1UMDA 2PSDA 3EQZA 1MG0A 3Q3VA 4EH1A 1H22A 2PSHA 1OYVA 4CPDA 2RGAA 1LS6A 2HF9A 3LLSA 1S1CA 6NULA 1E7SA 4FDMA 5G53C 3F47A 3D7MA 3LT4A 1GQOA 3PC6A 4L6AA 4O2LA 5C18A 2IW1A 3X1KA 3AU9A 4WERA 4K2HA 1PNTA 3EC2A 3TJRA 1O8BA 4I1PA 5HGJA 2O7RA 1A2OA 4OYHA 3TO5A 2BR5A 4TZTA 4ZI3A 4N65A 3C7DB 1H1LB 3FCUB 3FR8A 2P67A 1PVVA 4ODIA 2EORA 4Q02A 1PIWA 4BBPA 3BGIA 4UBIA 621PA 3AUSA 3EF0A 3H9GA 4W1PA 4JYPA 5AD1A 4K5QA 1Z06A 2HQBA 2H2HA 1E1QD 2J3KA 1Z68A 2O57A 4ND4A 3RS0A 4C6RA 1JKIA 2HF7A 3G79A 1XK6A 1G42A 4FQ8A 4PYNA 2L82A 3C15C 5EJ4A 3ND7A 3U39A 5G0VA 3WMEA 1QCYA 1JLMA 4FK5C 3FRJA 2F4VB 2ZBEA 2PUHA 5CHEA 1TDJA 1IYZA 3EFEA 3H2YA 4RXUA 2BL4A 4AYWA 2ISSD 1HMPA 2PJDA 3M4JA 4IUBS 2G80A 3DBLA 5EP2A 4DQUA 5JC1A 1WP9A 2NACA 4V24A 1H2BA 1P29A 1C8LA 5CYOA 1MC1A 2GM3A 1M8PA 4A10A 5KQPA 2FSGA 2PGOA 1B6GA 5SYMA 2ZT7A 1Y8AA 1MPTA 4KRXA 2NMVA 1VLVA 1KY2A 2YTNA 1QYVA 3WRXA 1WPXA 3NJ4A 5AW2A 3MJCA 1L5HB 3C6XA 3ZHQA 2J7KA 4UPEA 1QRUA 3ZVRA 4QARA 4L72A 1G8PA 4DA6A 3EX7C 3OCXA 4AUMA 1N0WA 1MENA 4GI1A 4LZNA 4EO9A 4IJQA 3WWPA 1ZIYA 3ON5A 1FU7A 1WQ4A 4LTNA 4RHXA 4HT3B 5I6DA 1TD9A 3CNQS 1NG9A 1PHPA 3BIXA 3G2QA 4D9IA 4TPKA 2V6FA 2PRIA 4YEDA 4AECA 1OR8A 2Z1MA 1T9HA 2DUUA 3ETEA 2ZRIA 3TCNA 4JU8A 2OP1A 4AKEA 4GE0A 2BSQA 1HE1C 1Y8RA 2LW7A 3EC7A 4XDZA 4LDJA 4LOHA 5AK5A 5NLLA 2V89A 3O93A 4HB3A 1F8UA 1FMTA 2QDKA 4MAMA 4F6CA 2PH5A 2R5FA 5GJVC 1GARA 5A71A 3EQ2A 3EVNA 3KOWA 1LK5A 4Q4AB 3B82A 3ZQ6A 3UGKA 4UHFA 1S8NA 1Q6YA 2O8BB 1EJ2A 4FFBA 1KO8A 4GF5A 4GICA 4XX0A 3U1VA 1H23A 3M6IA 1AQJA 2FPSA 1JMVA 5TC4A 1YDFA 3A11A 2EMLA 1GFIA 3IQIX 1CY7A 1NMEA 2QYHA 2EARA 2WWIA 3LHFA 1S4MA 3LBAA 3PGXA 4X45A 3SQXA 1BWPA 2YN4A 3QFFA 3VR5H 2IIBA 2QX9A 4Z9BA 1IOLA 4AMVA 2E72A 2IHBA 2Q45A 3W5HA 4Q1AA 2P6PA 1DPFA 1A9XB 1P5JA 2G7ZA 4F1JA 2WCC3 3NLLA 4S0XA 4GXRA 3WNCA 1KK0A 1QVWA 1Y9JA 3U26A 2VYVD 3W5UA 2NTVA 4RC9A 5JQGB 4DKJA 3V4PB 1WETA 4YLYA 3K6SB 4OX9E 1L4BA 2AOUB 4GOND 2D0IA 2QRHA 3ORFA 1UKZA 1WU8A 3WFIA 3TW0A 1GN9A 1SQ6A 4ZHQB 1BJRE 3TD9A 5KQGA 3CVVA 5HIAA 1W8IA 3DFIA 3QXHA 2JVIA 1GNLA 3OY2A 3TLAA 3H2HA 2VDWB 3GNSA 3LW7A 1YHNA 1L4EA 4CCSA 4OGKA 1FDRA 2OCKA 3TKAA 8OHMA 2BH9A 1YRWA 3BMOA 4YNBA 1NW5A 4MWCA 4KGVA 5KTTA 2V8BA 2OR3A 3E3NA 3AUYA 3BX1A 2RHJA 3DL0A 3LQQA 1HKUA 4FR5A 4M0DA 5JSQA 2I76A 5G4KB 3PTAA 2RJ3A 4LS3A 1Q5PA 3SM3A 3N2EA 1SBTA 5HK9A 2IYFA 2XVZA 1FDSA 4ABYA 4GR9A 3UV7A 1UXGA 3DW1X 3GEIA 1K06A 2D3TA 4OH1A 1TU0A 1HTBA 1PR4A 2Y4OA 5CW2A 4ADSG 1L4SA 2DSYA 1OFGA 3V5NA 4JEUA 3BSYA 5A4AA 4Q1CA 1R6VA 4OSPA 5H81A 4QT0A 2F17A 5E6SB 4FN4A 4X64E 3HJGA 1HT2E 2QORA 1FVOA 3DWFA 3VDRA 3PEWA 1S8AA 5I45A 3CRQA 3DHYA 2FX2A 4LRUA 1SXJE 4J75A 1XVIA 1JALA 1HZZC 1Q15A 2JP9A 1GCUA 2MYPA 3EMKA 4O8CA 1TIBA 3IBFA 4ARUA 4BTLA 4ND8A 2RGGA 3T54A 3PI6A 4OOFA 4WOJA 2D4HA 2WD8A 1RVV1 4NE2A 4YAJA 4KQWA 3E22B 3P9IA 1J8MF 3RJ9A 2EP8A 2NAFA 4FONA 2YY7A 1O5TA 1P9WA 3H9EO 2GARA 4XUDA 1TPYA 2IY9A 5SY9A 1JNYA 2F67A 2GFQA 5BWNA 2A94A 3CF2A 3PHHA 3BKXA 3P0IA 1BS9A 1MB2A 4FVTA 3R7DA 4JDPA 2VOEA 4UUAA 2DHQA 2CHFA 3SF8A 4UHDA 3IPRA 1J23A 4AP5A 3F5QA 5EE5B 1A1JA 4KKXB 4HS9A 1V8OA 2AE2A 1U4OA 3A2KA 2W6MA 2CF5A 2ODNA 3NTVA 3F3MA 2ZU6A 1NNLA 3MHHC 3DCNA 3QU7A 3Q98A 3R40A 4JLWA 1LKZA 1UDXA 5DX8A 2PGNA 2QAGA 2QJTA 2VP3A 5F4BA 2ECPA 3EDOA 2A6PA 3HXLA 4Y6LA 3IAHA 2H3HA 3C7TA 4DS3A 1R6BX 1NUTA 2XT9A 3OTOB 1GGEA 2XUJA 3OJOA 3DEIA 5DHTA 3QOYA 5ALQA 3RTBA 4JY7A 2Q5LA 3Q8WA 1XE3A 4TLAA 1U8UA 3HO6A 1JDSA 1KBZA 3FYUA 3T1OA 4EG7A 2A59A 4IXNA 1ETHA 4ZKDA 2A9QA 3I2JA 3T9EA 1T4NA 1IONA 1T9DA 2Q4DA 1Z25A 2ZLBA 2EQ1A 4ZOCA 4BQOA 1ZK0A 2EQ5A 1EDOA 3CLUC 2TMGA 1Q2UA 4QBGB 1ZGHA 3IH5A 1JHYA 3QWFA 1H85A 4P4TA 4XVUA 1QF6A 2F3QA 4UU0A 3GEHA 3VHLB 5K8LA 4GSYA 3CJTA 4ZMSA 4QFCA 2FRXA 3ISJA 3MRTA 1DCKA 4MWSA 4LF4B 4XWYA 4MIKA 1Q0ZA 3OJLA 1SOWA 1JDJA 1T3HA 4H1UA 4X1YA 1T36B 3W5IA 4Y6SA 5JPDA 2F64A 4BFZA 4AXXA 1NOKA 3BXOA 3KXPA 1DBIA 4K6OA 1E4VA 1ZR2A 3KHKA 2HZBA 2QQEA 1JA9A 3G9QA 1UEJA 2I4TA 3WRWA 4IIEA 1ATZA 3STTA 2VRNA 3N70A 3N74A 3ONVA 4HFMA 4PE5B 1P75A 4PM4A 3UAGA 4AY3A 1DNPA