1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
1IPFA 3OFSA 4E30A 4Z6KA 1MXFA 4BKOA 5TT1A 4IDAA 4GL4A 2PY6A 3UFXA 3AFNA 1NQ5A 2AEMA 1G0NA 4CM9D 1U5AA 3KSUA 5EQDA 1BTOA 1LI4A 1UZLA 4BKPA 3E48A 3F6YA 1YQDA 3HDJA 1NQTA 3DMYA 3QW2A 1I0ZA 4MVJM 3E9MA 3T7CA 4B8ZA 2VUSA 3QSGA 2WYWA 2HMUA 1UZMA 4RQTA 4QFCA 4UVIA 3KYBA 4C7JA 1ISFA 2PLAA 1GDHA 2J5QA 4XYGA 1ZK2A 1LRLA 3JQ6A 3DZIA 4J4HA 4EITA 3KETA 4CQLA 3TQHA 1I2ZA 4NFYA 1PJ2A 2Q1UA 3WBFA 1JU9A 1YB4A 3FR7A 1ZKMA 3B70A 3OQBA 4BVAA 4PLVA 2A94A 2NQ8A 4P4GA 4PG7A 2X86A 3L07A 5COAA 4M55A 1F17A 3GVXA 1H93A 1T25A 1GZ6A 5T57A 4YT8A 3GVPA 1WVGA 4CLHA 1UDBA 3L4BC 3ZWAA 2AEJA 1GQ2A 1HL3A 1FF9A 4PLYA 3S55A 1N7HA 4OJNA 1E6UA 4P4LA 4JROA 5EN4A 1QLHA 3F4LA 1ZJZA 3CMCO 4BO5A 1PWZA 2FY8A 4LSWA 4NMHA 4CMIA 4D43A 4EBFA 1HYGA 4EUEA 4GX1A 4TWRA 1WNTA 1MV8A 4FSHA 2AQ8A 2YJZA 1PU2A 1ZEJA 4A10A 2Y1EA 4YEDA 4AJEA 3FN4A 3K31A 3UW3A 1E92A 4B4WA 2NU8A 3INGA 2AA3A 3DAFA 3PQDA 4H15A 1NXQA 4HFNA 1O94A 1KVQA 5A9SB 3ASUA 1PGPA 4PG8A 2VHWA 1XR3A 3DBRA 3RAJA 4CMAA 3Q1LA 4KUEA 3WDSA 4B3JA 2JD1A 4BKUA 4RVDA 1ZK0A 5B4UA 3DOOA 3H9GA 3KEOA 4CUZA 3W8EA 3HDHA 2BGMA 1JWAB 2I76A 5G0TA 1NFRA 4AJPA 4C7KA 4YT2A 5U4QA 4ALJA 4UEOA 4IY1A 5LCXA 3V1YA 4F6CA 2NV6A 5C3MA 5IZCA 1K6IA 2UYYA 4Y98A 2H5LA 1ISMA 1ULSA 4EZBA 3PZBA 2GN6A 3GAFA 5JAIA 1F0YA 4QO8A 1JN0A 3JQBC 2DPGA 2A35A 2Q3EA 3P7MA 4OM8A 5JPIA 5IN5A 4MVJF 3BXXA 5JBIA 3KYCA 3DWFA 4ID9A 3G79A 1R4NA 3ONEA 4RLSA 3WLEA 1BDBA 1HYHA 3DZFA 4R16A 3MCVA 4H16A 3T4XA 1RWBA 4WNIA 4YRAA 2JKVA 1GYPA 1KEUA 2JFFA 2EGHA 3VPGA 4K1LA 1Y1PA 2E82A 2Q2QA 5G2OA 1XDWA 1NVMB 4MDHA 1JLLA 4B79A 3L77A 1WPQA 3EY4A 3U4IA 1PGOA 1ZUD1 3OF2A 3RIHA 4NNJA 4FOSA 1UP6A 4L4RA 3SJ7A 4C4OA 4L74A 4J2OA 2ZTVA 2QQ5A 5JAZA 4II2A 4OMUA 3MJEA 1RM4A 3MJSA 4U8GA 5KJFA 2VCYA 4CQLB 3RUIA 4BO9A 1YRLA 2ZATA 3DR3A 3HDYA 2Y0CA 1DIRA 4XGIA 2FMUA 1ONOA 2EEZA 4PLTA 5H82A 3GRKA 3LQFA 4BNZA 2AG5A 3GHYA 5ILOA 4IBOA 1G1AA 3ANNA 2EXXA 4KP7A 4CQMD 3AM5A 2AMFA 1Z73A 2OUIA 1M67A 1MC4A 4AJ2A 1Z75A 2JHGA 3BTOA 2P5YA 4YA6A 4U7WA 4AG3A 3PWKA 4CV2A 3PYXA 1LC0A 8ADHA 4CMIB 4JBIA 3UCFA 2Z95A 3BTVA 2HMVA 4WCFC 1J0XO 3UCXA 1VSVA 3I6IA 3I6QA 5JDCA 3OEWA 2D2IA 4WLUA 4MJLA 5HBRA 5TGDA 4BQPA 3PEFA 4J1QA 5L95A 1B15A 1NYTA 5F21A 2FZEA 5JO0A 2EJWA 4EEXA 3O9ZA 2DAPA 4W9NC 4ITUA 4PLGA 4EGFA 1T4DA 4NBRA 4L4XA 1YONA 2G17A 4WLEA 3F3SA 1DDOA 3DBRB 6LDHA 1NAHA 3RC1A 3ZNOA 3EC7A 1UXHA 2CFCA 4E5YA 4TVOA 2O3SA 3G3EA 5TSDA 1HZZA 4IJUA 1JWBB 3MOIA 1H6AA 4LMPA 2TMGA 5ER9A 4WOKA 3SVTA 4KUGA 4DYDA 4XCVA 1U4OA 3ANLA 4WGGA 4ZVVA 1SPXA 3GRPA 3IDSA 1CRWG 1W4ZA 4QQRA 5JMPA 4X54A 2VHXA 3R0IA 3F47A 4PZEA 1GYQA 4OXNA 3CZMA 1DLIA 2EP7A 1UP4A 1QLJA 3BZUA 3CH6A 3FWZA 3KYCB 4MVJP 4YAIA 1LQUA 5I7VA 1GCOA 3AM4A 3PTZA 1I3KA 4I9UA 2ZK7A 2ZIZA 1B14A 5IN4A 2EWMA 4D3SA 3JYQA 1BXGA 1X0XA 3A9WA 2P91A 4Q39A 2OBYA 1U8XX 3OA0A 2EHDA 2DQ4A 3RD5A 1HEUA 4I5FA 2DLDA 4BUCA 3EVNA 2CDBA 3GHHA 2IZ1A 2A4KA 4JCOA 4R41A 1E1KA 3DBLA 1CJCA 3L9WA 4NR0A 4TRJA 3RUCA 3WMWA 4UUOA 3NGXA 3TF5A 4EUFA 4M49A 2OFPA 4CV0A 5KJ1A 4TZKA 1V9LA 3L4BA 4MOWA 4IXTA 3BMNA 5EINA 3V5NA 4CR7A 2X9NA 3KLPX 4I9HA 3OICA 3NJ4A 3LT4A 2WYUA 2JAHA 3FD8A 4DLAA 1ZXLA 1EVJA 4YJGB 1ZEMA 3GLQA 4A73A 2HKIA 1Z82A 2Q2VA 4DGSA 3HB5X 3JD1A 2WWRA 1VKOA 1V3VA 3JQGB 4MVJI 2ZTMA 5JMWA 4BV8A 1DC6A 2CF6A 1VL8A 3A14A 4GAEA 3OJEA 2ZYAA 1G6KA 3PYMA 2V6FA 2DUWA 2VZ0A 3PYLA 5A4DA 3JQAD 2DT5A 2X0IA 2BLLA 5TC4A 2UVDA 4MKXA 1CDOA 4UVHA 4BNXA 4RL6A 2WYVA 2QYSA 4Q3AA 4BNYA 3D5QA 1A7AA 1YJ8A 3PWZA 1GUFA 3H3FA 4KDFA 5KVVA 3TWOA 1MG5A 1ENOA 2QW8A 2VN8A 3S2FA 1Q0LA 4O1MA 2HCTA 4HP8A 1KVSA 1PL6A 3AY6A 4Z0HO 5TT0A 2R2GA 5A03A 2B36A 4J16A 4J1NA 4YTEA 1K6JA 5KVCA 4CUJA 1JDJA 1DEHA 1HE3A 1VJ0A 1H94A 5K6AC 3O8QA 5G4LA 5F1OA 1IZ0A 3GNSA 4ZRNA 1DXYA 3DXFA 2XXJA 4IZHA 3PIIA 4PG4A 4G81A 1YDWA 3IUPA 2D0IA 5G0WA 3H9QA 1P74A 3JQBA 4EJ6A 3WFIA 5KWEA 4AJHA 3JQ8A 1R37A 2AE1A 2J6IA 4FFPA 1EVYA 5CAEA 1UR5A 4INAA 4YDRA 1MFZA 2YQ5A 3GNQA 4LRTB 3HADA 4UVEA 2FR0A 3KOUA 4P4NA 4BO2A 3RFVA 1BXKA 1GU7A 2VOEA 4PLCA 3WB9A 1DHTA 3H6KA 2NU7A 1PGNA 2IODA 2X6TA 4FJ0A 4TSKA 3ZNQA 2ET6A 4NFSA 4B3HA 4YCAA 4RPHA 3DC2A 3MJ4A 4OIMA 1YQGA 3LC2O 4IQ0A 1ZZEA 2C54A 3WGGA 3KYDA 3ZWVA 5EIOA 1LLUA 2ZCVA 3ZU5A 2PZMA 3D0OA 1YOVA 1SEVA 4RVSA 2D3TA 4UVDA 3ZHBA 2YUTA 5CDSA 4RV9A 5G4KA 2BHLA 1XQ1A 4NI5A 3ZU3A 2JHFA 1BXGB 2X5KO 5JAMA 4IDBA 1PJTA 3E5MA 4BNKA 3D4OA 2GNAA 4GSKA 3PJGA 1X7HA 3GDOA 3GF4A 5I7FA 5JW6A 2I6TA 1JKJA 3PJEA 6ADHA 1HT0A 1PS8A 3C7CB 1TI7A 3DBLB 3H9UA 3OIFA 4RVHA 4S1VA 4XRRA 3RC7A 3E9QA 4HBGA 4YAJA 2QRLA 1YQXA 4LRSB 2P5UA 3STHA 3WGYA 1JVSA 1UH5A 3TZ6A 4IGFA 3IOYA 4XYBA 1HDXA 4E6PA 4BO3A 8LDHA 1KY5A 3K2BA 2DTDA 4A0SA 2GF2A 3Q0EA 3SJUA 2YQ4A 5JDIA 3BMNB 3S1LA 4KQWA 3PI7A 1VSUA 4GMFA 4BV9A 1SB8A 1CEQA 1D4FA 1Z6ZA 2GLXA 3DTTA 3QQPA 2J5RA 2V6BA 4LGVA 1C14A 3GG9A 3VKVA 1VC2A 4M54A 3BMQA 4E2XA 4JXKA 1DOHA 1TT5A 3E6AA 1LLDA 2V6MA 4J6FA 1C3VA 3ITDA 2FRDA 3FTNA 1I2BA 1LJ8A 2JCXA 5FWNA 3QLJA 5HTOA 3HFSA 2BFAA 1PR3A 4W9NA 4JBGA 5AXBA 1U3VA 5G0SA 2YV2A 1YVEI 3LLSA 4TMFA 1U3WA 2P9CA 3P19A 3BAZA 3DEYX 1TT7A 3A1NA 1P1KA 1A71A 4U6QA 3Q2IA 1R16A 4GX2A 2AQKA 2NVBA 4IMRA 2E48A 4UAGA 3JD4A 5T67A 4JBHA 1U8FO 4BMVA 5FF9A 1CIVA 5CHEA 2GD1O 3F5SA 4UEKA 3ZWWA 4BO1A 3OBBA 5L40A 1PJLA 2VZ9A 2X0JA 1P1RA 2GCGA 4CLRA 5DF1A 4NQZA 2W8ZA 3HFGA 3R3SA 4E5KA 1VJTA 1RM0A 1YS4A 1B3BA 3L0DA 1HZJA 1TLTA 2UV8A 1A5ZA 3JQ8B 3F5QA 2C2XA 4AVYA 1T2DA 4ROSA 2YW9A 5GZ3A 1UXKA 3TZKA 5JLAA 3TPCA 4AJOA 1GR0A 2VHZA 3GNTA 3ZWCA 1HXHA 1TXGA 3SEFA 1T2CA 1QYCA 1ISGA 4CMJA 5DP1A 1HE5A 4L9RA 1VPDA 3GA0A 1P44A 3PGXA 1NWCA 1T1SA 2PKRA 5IXSA 5JYEA 4CMEA 3HQ4O 2G0TA 3AOEC 4GX5A 1HDCA 2NM0A 1C0IA 4J90A 4MP6A 3ZV5A 4D44A 3JV7A 1IHXA 1XKQA 1LBEA 3KYDB 2PH5A 2VNSA 4Z0TA 3H9EO 4XRGA 4O5OA 4IDGA 4QECA 3GN1A 1YOVB 4GGOA 1WXDA 3JQ9C 3LC7O 5GZ1A 3RJ9A 4GBJA 1K2WA 2PWZA 5G4KB 1F12A 4WOJA 5TIIA 1NQOA 3AY3A 4PLZA 3FCOA 1PQWA 1F8GA 1L7EA 3COSA 4KWIA 1J6UA 4DVJA 2I66A 4M87A 4IXWA 2JCVA 1C0LA 1LDMA 2DBRA 3GY0A 2O3JA 4U6SA 1ZO8A 1H9BA 2WSBA 4MP8A 4J1TA 9LDBA 1LX6A 4WJZA 4L4SA 4XR4A 4KZPA 1L1FA 3ICPA 4ALNA 2ILTA 3HDQA 1DFGA 3OSUA 4XZ3A 3PHIA 1ZMTA 3LC1O 1B8UA 1JVBA 1G0OA 2G1UA 3I4CA 4PIVA 4BHTA 1ZW1A 3OIDA 4TKMA 2IXBA 4CM5A 1E6EA 3BMOA 3EDMA 4WCFB 3WS7A 2GYYA 1XIVA 2IEDA 3RBXA 3HN2A 4DPLA 4F45A 1AHHA 3AI1A 2FPIA 4YXFA 5L9AA 1SB9A 4IJWA 4RF3A 4BGVA 5DCWA 1I5RA 2OO5A 2VWQA 3D7LA 3VVBA 4RVGA 3K96A 2OL4A 5AYVA 5K0ZA 2DPHA 3HJAA 1Y81A 3LZ6A 5K6AA 4P8RA 3QWIA 4WK6A 4PRKA 1BSVA 5ILGA 1VL6A 1LA2A 2HMWA 1Y7TA 1K5HA 2BFMA 3D64A 4WECA 4MKRA 3VPXA 4GWGA 4BNWA 1QYXA 1V8BA 4DIOA 5F1KA 3DFUA 4CR8A 5A9SA 5L53A 4NH4A 4L76A 1LNQA 3L4SO 5DOVA 1Z45A 1P0FA 3WG9A 2O3TA 1PS9A 5ES3A 5F5LA 3NTQA 2NWQA 4DIFA 1GL3A 5CDGA 1R66A 3K30A 4RF2A 3DBHB 4NIMA 1XU7A 2QZ9A 1OI7A 1HSOA 2WE7A 3U4HA 4FCCA 4A2CA 4WLVA 2B69A 4DWVA 4D79A 1DSSG 3P2YA 3LVFO 2OBNA 5A9TA 1DHRA 5BNTA 1P1IA 3QIVA 1O5IA 2VHYA 3DZKA 2O3RA 3VAZA 4AJKA 3D4NA 2VTEA 4Y6RA 2AE2A 2SCUA 3W8DA 1BMDA 4OHUA 5B37A 4IJKA 1E5LA 3OQ1A 3I3OA 4II3A 5J23A 2VUTA 5CPBA 5LC1A 4GMGA 4FR5A 4J7CA 3RKUA 5HS4A 5ENVA 1JAXA 3DZBA 2HUNA 5AXAA 5C7LO 1KVRA 4XD2A 1V6AA 2YHIA 4E32A 1PS0A 1X1EA 4ALIA 4OOFA 3W6UA 3WQRA 1MG0A 1NHWA 4UUPA 1S6YA 1XYGA 4QUKA 1MUUA 1LTHR 3ZHYA 3UCEA 4K9DA 4W4TA 3X2EA 1V3TA 3GVIA 3PJDA 4O59O 4YJFA 4QSMA 3DZGA 1MLDA 1RPNA 2PD6A 4BNTA 1GD1O 4DXHA 4DIBA 3L6OO 2Y66A 3MEQA 2FPPA 3SX2A 1HTBA 1Q7GA 1LSSA 1E1LA 3K2EA 2OXIA 3TFOA 5JC8A 5BSHA 1CETA 3TL3A 2FPGA 1NNUA 1WDLA 1FDWA 2PNFA 3WX0A 4DUPA 5L7TA 3ULKA 4XB1A 1ZJYA 3PFFA 4BKRA 5U9CA 1A72A 4MP3A 1M6WA 2HDHA 1EE2A 2IZ0A 3BMOB 3RSHA 5IF3A 5KJ6A 3U4CA 5DBIA 3K5PA 5KNLA 4LK3A 3U09A 4YT5A 2P9EA 2YDXA 3WJ7A 1R12A 3QV1A 4IDFA 4GVXA 3GC6A 3JD0A 5CEJA 2A9FA 4JGBA 5AXDA 1PGJA 2YFQA 4KWHA 1EVZA 2PGJA 4A5OA 7ADHA 3PQEA 2JD0A 2GDZA 5JCJA 4E12A 1VJ1A 1TVEA 3IJRA 2RIRA 2RH8A 1Y9AA 2HMTA 3FTPA 4EYEA 4ZGWA 5DCUA 4R1UA 1O95A 2ZJ1A 3JCZA 4FOOA 4A7PA 2J3JA 1QV7A 2NADA 2X5JO 4UREA 2B35A 4Y67A 4DLBA 5L45A 3Q3CA 1P0CA 4AJ4A 1PTJA 3DO5A 4LW8A 5TRTA 4JP3A 3N7UA 4GQAA 4Z9FA 4CV1A 3IS3A 3RROA 5AOVA 4IPTA 3TNLA 1M75A 3HN7A 4R9SA 3GVHA 4I5EA 1VM6A 5C37A 2ZJ0A 5THQA 5TX7A 5TJ9A 1E3SA 2IXAA 1EQUA 2C7VA 3ZWYA 3QRWA 4GGPA 5IZ4A 1IYZA 4MVJD 4R1NA 3AOEA 3DZHA 1LQTA 1QORA 2WD7A 3KXDA 4R68A 4CLOB 2WTBA 3QWHA 4D45A 5ITVA 1A4UA 1DIHA 1LLQA 3ICCA 1D1SA 3F46A 5DULA 3FPCA 4WPGA 3JQ9A 4GLLA 3TN7A 3ZU4A 4B4OA 3RU9A 4GX0A 4GWKA 4LN1A 2FSSA 2B83A 3EW7A 4YQYA 2CDAA 1BG6A 2P2SA 3GDGA 3IP3A 2BI8A 3NDIA 1E7WA 3FSRA 4IUYA 4BB5A 5JXWA 4ZQBA 4FIZA 3UXYA 1T2EA 5JY1A 5ICSA 3ONDA 4M1QA 4YYZA 1P33A 4Y6SA 5A06A 1CQIA 3OIGA 3TOZA 1KC1A 3Q9UA 2YHIB 4DREA 4ZRMA 3LT2A 4LCJA 3RUAA 1IY8A 2O2SA 2P4HX 4TKLA 2R00C 3JD2A 1JTVA 2ZTUA 3UF0A 4CLDA 3ROPA 5EESA 2BFOA 1IUKA 2PZLA 3DHNA 3LDHA 4N5NA 2CVZA 2PGDA 3CZRA 3HUDA 3QWAA 3NX4A 4YJFB 4OAQA 2BRUA 1N7GA 5A3VA 2YYYA 3A06A 3QE3A 4RPLA 1XG5A 1HRDA 3LF1A 3H5NA 1QG6A 1OZAA 4G5HA 3L6DA 2W98A 1V0JA 3U5TA 4F3YA 1XSEA 3C7DB 3LLVA 3WYBA 2EIHA 3WICA 3LK7A 1X7DA 2Y1CA 4J4TA 1WW8A 2Z1MA 4YJGA 2RBEA 3GZ4A 3NUGA 3RBZA 1LDBA 3TJRA 3AI3A 4JJIA 5JS6A 5L4LA 2VZ8A 3JQGA 3G49A 2GN8A 4NG5A 1RYDA 4F6LA 3WYCA 5DP2A 1MA0A 1U7TA 4DA9A 3D4PA 4ZHSA 3I83A 2BGLA 2D8AA 3E82A 3GK3A 4OO3A 1BGVA 2VRBA 2FR8A 4CM8A 3PFWO 3H8VA 3WWZA 3NEPX 4IDDA 4NJOA 3ZNNA 5CG2A 3OECA 3JQ7A 3LSYA 1PZGA 1BRMA 4IJVA 3AK4A 1ULUA 1ZK3A 2JJYA 2W90A 4WLOA 3WIDA 3VHRA 3GZNA 2JCYA 4HWKA 1UUFA 2I67A 2EKPA 1R0LA 3JQAA 3ZDFA 2X5OA 2EW8A 3JYLA 4JX8A 4NK4A 1DJNA 1P1FA 2W2KA 5JC1A 1KIFA 4WE3A 1LC3A 1FDUA 4L0QA 3I9KA 3NKLA 1IOLA 1EEHA 1GV1A 2Y1GA 2J3IA 4BO0A 1NBOA 4XYMA 3S2EA 4KQXA 3G1TA 4P38A 4E31A 2ZQYA 2Y1OA 2NSDA 1PQUA 1OOEA 4ND1A 2UUPA 1F06A 1B16A 1JKIA 1SNYA 2LDXA 1NP3A 3DONA 1D1TA 5DZSA 1SEPA 5LDGA 3K73O 2Q4BA 5C7OO 3ZGYA 1HDRA 1IB6A 4FFLA 1P1HA 3M2PA 1NVTA 3WTCA 1Z74A 2WD7B 1A7KA 2HAEA 1AUPA 2GZ2A 2BGKA 1VE9A 2P4QA 3PWSA 1ZK1A 2WM3A 4XGKA 1DAOA 1JA9A 1FK8A 2D4AA 5FI3A 2FN7A 5U1PA 2Y93A 2NUAA 4Z3KA 2IRWA 1MX3A 1IL0A 4JQCA 4NK5A 1X14A 1R0SA 4CR6A 5KVSA 3DOJA 2HU2A 5KJCA 1NFQA 2O3QA 4BL5A 2Y99A 1SCUA 5F1PA 1LSJA 1F8FA 1YB5A 4ND3A 1RYEA 1XQ6A 3MZ0A 3H65A 3IJPA 3VOSA 4AJ1A 1PX0A 4MIOA 4FJ1A 1A9YA 3B1FA 5IDWA 3OJOA 4A26A 3JYOA 3PDJA 5KCZA 2ZTLA 1EDZA 5I8ZA 1HYEA 1B0AA 5CDUA 2Y0EA 2R6JA 4OSPA 1E5QA 4XIJA 1BVRA 1ENYA 1ZK4A 4IS3A 4MPDA 2ZB3A 2BH9A 3KLMX 1TEHA 2BI7A 3I1JA 3W4KA 3JQEA 2VUUA 3VH4A 3DOCA 4OYRA 4YQZA 1O8CA 3U62A 4YR9A 3IKTA 1JQBA 5TJHA 1XWFA 4E33A 5B4VA 1NPTO 4S3MA 2NACA 2NTJA 3P2OA 5LDHA 4DQXA 4OXYA 1DB3A 2PGLA 2HLPA 4ESOA 1PJCA 3F1KA 4DTIA 1H2BA 4CV3A 2PK3A 4CM4A 1XCBA 1UXJA 1ZSYA 3M1LA 3ZU2A 1M2WA 1E3JA 5TS3A 4CM8B 4HX5A 4U0KA 3DBVO 1KYQA 1N1GA 2J5KA 5COQA 1LDGA 2VWPA 2X9VA 3C3XA 3JQ7B 2Z1NA 1M76A 4CMBA 1DIBA 1PZHA 3M6IA 1YDEA 1HLDA 1SC6A 2GN4A 4TROA 1H9AA 2FP4A 1X13A 3FPLA 3GZNB 5EERA 4WCDA 2ZYDA 1WP4A 2FSVA 1M66A 2GASA 3JQAB 1EBFA 2ZB4A 2DU8A 2B4RO 4BO8A 1U7HA 2YDYA 4WEQA 4NU6A 2DFDA 2W2KB 3ZH2A 1U3TA 3GR6A 1UDCA 2UAGA 3GEDA 4JIGA 3EZYA 1LSUA 3ASVA 3DAGA 5CEFA 1OBFO 1RM5A 3UHAA 1DFIA 4BOYA 4XWYA 3WOHA 2EG9A 1LUAA 2VHVA 3AUAA 3HE3A 5DT9A 2DUUA 3W6ZA 3K8ZA 4PGFA 3WLFA 5JCXA 4J91A 3K9QO 4KUHA 4BGUA 2B4TO 3ROKA 1V3UA 1I33A 3CIFA 1R15A 4QFDA 4XJSA 4B7CA 2C5AA 5EL0A 4J2HA 2H9IA 1DRVA 3EVTA 1RM3A 4YT4A 4MIEA 1EK5A 2R00A 2XPCA 4IS2A 4CL3A 4BMSA 3DFZA 3A4VA 2BD0A 2OORA 3UOGA 3ZWOA 4BMNA 2X22A 1T2AA 3E1KA 3H2SA 1W8DA 5EJ2A 2X58A 4A03A 4WLFA 2QG4A 2H6EA 2HJSA 1KOLA 4Z9XA 2QRKA 1PEDA 1E7SA 2JAPA 3ZW9A 3I9OA 3VZSA 1GADO 1K6XA 2I99A 3CUKA 1VI2A 4PRLA 3RJ5A 3JQFC 5L7YA 3WGIA 1FJHA 3IC5A 2CSUA 2EERA 1DC4A 2I9PA 1O89A 1Y6JA 1PJQA 2G76A 4JJFA 1AXGA 2O3UA 5CPFA 4BO4A 3F1LA 1T4BA 2X1HA 2E6UX 3AU8A 3D3EA 5EQFA 2VT2A 2X4GA 1ZXBA 2OHXA 4FC7A 4O6VA 2GZ3A 2X0RA 2VRCD 4PLFA 2Z5LA 2DM6A 3ZHZA 1GAEO 5A1TA 3DMTC 3RFXA 2I5PO 3GDFA 3GMSA 1ZSVA 3KB6A 2E49A 4WCFA 3RUHA 1C0PA 1PJBA 2OMEA 3PLNA 5H81A 4UEJA 2BKAA 2J3HA 3INTA 1WZIA 2OZPA 3WFJA 4WKGA 4CM4B 4AL4A 2CD9A 5DNAA 4PG6A 1DLJA 2CDCA 3ETDA 3FBTA 1SZJG 5AQ1A 5JYDA 4D3FA 1Y8QA 3BHJA 2O48X 3CSDA 2PTGA 3X2FA 2D59A 1DPGA 4ND5A 1EDOA 3RVDA 3PP8A 3PQFA 1WZEA 4BO6A 4A27A 1NHGA 2HSDA 1W6UA 4HUJA 3DAPA 1P3DA 4J9UE 3HNPA 4CL8A 2JFGA 3TOXA 3HSKA 1KEVA 1TA4A 2D5AA 3ANMA 1H6DA 2O2YA 5KKCA 1I2CA 4YAKA 3HWRA 1Y9EA 4XA8A 1SMKA 4ZQFA 1O0SA 5T5QA 1JKFA 1EQ2A 4L75A 2VYND 2TMDA 3QY9A 3DBHA 5CG1A 2HQ1A 4J43A 3IP1A 2C0CA 4JK3A 3PHGA 4QO7A 3OA2A 4RO0A 1AN9A 1U9JA 3H2ZA 1N92A 1HF3A 1MP0A 3NT2A 4TZTA 2W2LD 4DQUA 2GPTA 4N5LA 2GERA 1U1IA 1GTMA 4R9RA 1D7OA 4FS3A 4EDFA 1B8PA 4QXMA 4O0LA 2Y1FA 1V35A 4ND4A 3RC9A 1HDYA 2D5CA 4DQVA 2G82A 3QVWA 2VYVD 4ZQGA 5FFFA 1GCUA 1RKXA 4M86A 2V65A 2CUKA 1Q1NA 4PVCA 1NPYA 1ADFA 1T1RA 3T7EA 5EMHA 3UVEA 4PCVA 3GPDG 1T26A 3DB2A 4OGWA 2QZZA 1F14A 3DZJA 1R4MB 3MJCA 1QYWA 2RAFA 4NDNE 1NM5A 1I30A 1ISIA 4YPOA 4YJHA 3OJFA 1U4SA 3TL2A 4HNGA 1A27A 4Q9NA 3VH3A 3KV3O 3L6EA 5DBGA 1DIGA 1UJMA 2DBQA 3V2UA 4CM9A 3G0OA 2PFGA 3H3JA 5A02A 5L4SA 1BW9B 2O23A 3H7AA 3IAHA 4KMSA 4CMCA 1NR1A 4NBTA 2RHCA 2Q1WA 4MINA 3GUCA 3RKRA 3PRJA 2B37A 4HV4A 1IZ9A 1I01A 5THKA 1MC5A 3ZWXA 2AW5A 4EI2A 4I08A 2VOJA 4UULA 1HLPA 2C59A 5GY7A 3PZRA 1QMGA 4DL9A 5BNFA 3KM0A 4Q3CA 4YACA 2GGSA 4DPKA 3O38A 3PHJA 3RQSA 4CMKA 4ZN6A 3D1LA 4BNFA 5HS6A 1VLLA 4BGIA 1LDEA 2PKQO 3G1UA 3U49A 3U0BA 1YO6A 4RPJA 1N1EA 3VZRA 3FNFA 3ETGA 4B4VA 4MVJE 2GR9A 3B6ZA 3C7AA 4NJMA 1PR9A 1Y8QB 3VPHA 4YJDA 3OEYA 3H5AA 4K26A 1E7QA 1O9BA 1J5PA 3RC2A 3GGPA 4BQRA 1N9GA 4IIUA 4J3FA 5I9LA 1YXMA 1QR6A 3SXPA 3HG7A 1LDNA 1P45A 2NQTA 2YFHA 2VWHA 2Q49A 2GN9A 4J4BA 1TB4A 1GQYA 4FB5A 1NPDA 4R01A 1QYDA 1DC5A 3M2TA 2HRBA 2ZB8A 3MJVA 1YE3A 3VPFA 1B7GO 4URFA 3VZQA 3NDJA 2GZ1A 4FFRA 3W4IA 2CVOA 3GOHA 5ADHA 3VDQA 1ARZA 3PLRA 3FHLA 2ZKLA 2PA3A 2EP5A 5K9ZA 2IEBA 4CLOA 4HFMA 5A9RA 3EHEA 1XLTA 1OMOA 4ZQEA 1LDYA 4ALLA 3RWBA 4YAEA 1EUDA 2X23A 3CE6A 3BTUA 1OFGA 3NTOA 4XYLA 3U9LA 1B2LA 1KVUA 1CYDA 2AQHA 5A05A 1NAIA 4AICA 1PJSA 4FPXA 3JQFA 1CF2O 5FEUA 5IAAA 1E3IA 1H6CA 1Z7BA 3WQQA 1FMCA 2I3AA 3D3WB 1E1NA 3TFQA 4NHEA 3KSZO 1UXIA 3ROMA 1N2SA 2O50A 4B3IA 4NBWA 1PZFA 2XF8A 3C85A 3V2GA 4CUKA 2C07A 4YJHB 2CZCA 4XQCA 4BNMA 3QP9A 1W0CA 4JJGA 4GLOA 3DMTA 4DYVA 2DVMA 1Q7BA 2VQ3A 2C2YA 5IDXA 2O7QA 3KVOA 3NT4A 4HFRA 2QYTA 4KTTE 4JNKA 3EYWA 5JY6A 5BT9A 2BFPA 4ZJUA 1BHSA 1XEAA 4FFOA 5JE8A 1NR7A 3SLGA 4L73A 1P1JA 4MO2A 4Z0PA 3WR5A 1PWXA 3V1UA 5I7EA 1GYRA 1I24A 1YGYA 2HK8A 1QP8A 4WUVA 4EW6A 3QVTA 4BO7A 4JN6B 2JD2A 4K28A 1KETA 1QKIA 4W82A 3O03A 5BSFA 4E5NA 5COBA 5CEEA 1GUYA 1UAGA 2FZWA 3ZI0A 4EUHA 3JQCA 1PL7A 1HETA 3IIEA 4LCEA 1GZ3A 1GPDG 4BNUA 4DMMA 4I5GA 3H5RA 1HDGO 2Y0DA 4CM7A 2PH3A 3W4JA 2OP1A 3WSVA 4Q3NA 1C0KA 3OM9A 4FW8A 5C7IO 2C20A 4DPMA 1SBYA 4LVCA 1DO8A 4NJMB 3ZV4A 4CQMA 1E3LA 4FGWA 2Q2WA 2O4UX 1DRUA 4RPKA 4GSLA 1GY8A 3GFBA 1CERA 5TLSA 3CEAA 4J7UA 1LRJA 4KDEA 3W1VA 5B4TA 5BQFA 4DBZA 1N9GB 3LF2A 4OH1A 3WQSB 1H0KA 3ADPA 1QRRA 1ADGA 4RCVA 4RZIA 1Q0QA 2EF1A 4YAGA 3RI3A 1SOWA 1GQQA 4BIIA 1ZMOA 2DTXA 1KVTA 2OGUA 3DL2A 2IYOA 1KC3A 3E9NA 5DOZA 3TDKA 1SOVA 3FRJA 5T8KC 5A3JA 3RFTA 2BELA 4XR9A 3WIEA 1YJQA 4XKJA 2B4QA 4LSMA 4GVLA 3CPSA 4I1IA 4FDAA 1H5QA 3PHHA 4R51A 2GO1A 3F4BA 1L7DA 3QHAA 5CFZA 2RH4A 4OQZA 4XIYA 2W4QA 3KSDO 1ISHA 1EFKA 4IIVA 1P31A 4NZ9A 4B8WA 1P9LA 4U5QA 4YB8A 1M6HA 1Z7EA 4GPD1 1H6BA 1SO8A 3B20A 1XGKA 2PR2A 4HKTA 1HWYA 5KJEA 3VVCA 2OP0A 5B1YA 2RHRA 3Q2KA 1DRWA 3AY7A 4P22A 2DBVO 4IINA 5CDYA 4OKNA 1BDMA 1KS9A 3RUEA 3AOGA 1YBAA 4W7IA 3ITKA 2Y67A 3GFGA 3UUWA 4MKZA 1ML3A 1PQPA 4OXKA 2PZJA 3I9MA 2AEFA 4CPDA 5B12A 2WE8A 4RVUA 1PZEA 3TSCA 4MIYA 4NPCA 1CWUA 3RCBA 1LRKA 3GVCA 5IG2A 1EBUA 5IJZA 1R0KA 3AM3A 1WDKA 1NFFA 1YL7A 3LT1A 2VWGA 4DC1A 1EUZA 2HK7A 4WNCA 3KUXA 2B0JA 4R5HA 4BNGA 1BVUA 5G0VA 2YHUA 3C24A 3I52A 2PKQP 3WJAA 5FI5A 2A92A 3ZCXA 4AJIA 1U3UA 3WGHA 5KTKA 1XU9A 5IDYA 4F46A 5DDIP 2VNAA 3WBBA 4RVFA 2EJVA 3ZWMA 4N5MA 1AXEA 4JP2A 1DBVO 1E1MA 5H83A 1HE2A 1MXHA 4CMGA 5A04A 2ZQZA 3U4DA 4AFNA 5L4NA 1PJ4A 1H2HA 4I5DA 4FGSA 1EZ4A 4PZDA 1DIAA 4XYEA 3FWNA 2HMSA 4NFHA 1OC4A 3BTSA 1K89A 4FBGA 5IXYA 3VDRA 4AJNA 1E3WA 1C1DA 2GSDA 2HJRA 2NVWA 4MVJH 4CQMB 2NVUA 4CM1A 5KKAA 4CLXA 4D42A 3R1IA 4ALKA 1PL8A 1RJWA 2AHRA 4YRBA 2DBZA 3I9LA 1DJQA 3GG2A 3HHPA 3ZN2A 1UP7A 4H3VA 4Z3DA 5JCJD 1PSDA 3GQVA 2UUOA 3DHYA 9LDTA 4UUNA 3EUWA 2BMAA 5ER6A 5L51A 5JDIC 1I10A 2X9GA 2FR1A 3MWDB 3VH1A 4L8VA 4TRNA 4ZD6A 1YBMA 3PJFA 1PJ3A 1E77A 2YV1A 2CVQA 4J0FA 2C5EA 2DKNA 2RCYA 5DN9A 5TF4A 1I36A 1N8KA 1OAAA 4N54A 1HDOA 3CTMA 2C82A 1MB4A 4ZU3A 5BR7A 4RLHA 2EKQA 4E21A 1ENPA 2Q50A 4BGEA 4HY3A 4R54A 1P77A 3OETA 1AHIA 2X7HA 3PK0A 3GPIA 4RDHA 1QSGA 4IQ8A 4XJTA 4G65A 2Q45A 4LMRA 5AVOA 1ZFNA 1E7YA 5GMOA 1Q2XA 3GN2A 5F5NA 5IFLA 2POQX 2C29D 2Y68A 3IUSA 5GZ6A 5JO9A 4E2WA 3O26A 1KEPA 3G17A 2X8LA 5BSEA 4TRMA 4DMLA 2CF5A 4PVDA 1B26A 1UZNA 2AXQA 1IPEA 3KHUA 3VC7A 3VTZA 3Q9NA 3LU1A 2IDZA 2GUGA 1NQAO 2Q4EA 5JSFA 1I3NA 2QX7A 1CQJA 1QYVA 1LXCA 2I3GA 2P68A 1ZBQA 3MOGA 4W6ZA 3JYNA 1K3TA 5L3ZA 3AW9A 1R4NB 4RJTA 3RUDA 2CY0A 1KY4A 2AQIA 2NU6A 4GH5A 3NGLA 3OMLA 4HXYA 5A5EA 1ONPA 4PLHA 4TRRA 2C7GA 1W73A 2J8ZA 3BMCA 1GEGA 2X0NA 4I9NA 3SC4A 3WGZA 4E5MA 2G5CA 3O4RA 4KOAA 1E7RA 1LU9A 3AUUA 3PIDA 4M8SA 2E37A 2WD8A 4RF5A 4BNLA 4CMEC 1A9ZA 5CP8A 1GV0A 3FF4A 2B5WA 3UH1A 4CM6A 2QRJA 1S7CA 3BYZA 3M1AA 3S8MA 4QEDA 1ZCJA 4D0RA 4IM7A 3K92A 1I3LA 2WMDA 1Y5RA 3C1AA 2CMDA 4RQUA 2O4CA 2VRCA 4Q3BA 3GGOA 4NBUA 3HB4X 2EGGA 1KEWA 3E18A 1LSOA 3N74A 3UGKA 1IULA 5I7SA 3ZZNA 1WMBA 5EPOA 1ZNQO 5C5IA 3JYPA 3NYWA 1E3WB 3SBOA 3C1TA 4R3WA 1C1DB 2NVUB 1BXZA 3FNEA 4XX0A 1D3AA 1LLCA 5T8KA 3QA9A 4IDCA 3PXXA 3HZZA 2DC1A 1K0UA 2ZB7A 1N5DA 3H4VA 1A4IA 4ALMA 2Q99A 3V8BA 1LEHA 3KO8A 4EJMA 3ST7A 1YB1A 3PVZA 7MDHA 1WWKA 5MGBA 2IYPA 4EEZA 3R6DA 4HFJA 4WEOA 3UN1A 4OL9A 2YY7A 3UKOA 3ZW8A 4J49A 3SLKA 1DFHA 4ND2A 1ENZA 3IMFA 1IE3A 4HADA 4R69A 2F1KA 4WASA 4BKQA 1ONNA 3DTYA 4FQ8A 3A28A 3ZHXA 3S2IA 4XGNA 2WDZA 5DBFA 1DC3A 4ONEA 4FC6A 3VZPA 1GUZA 2VYNA 1J49A 1XHLA 4RORA 3INRA 2YZ7A 4DBVO 3CINA 1FDVA 4PG5A 5I9NA 1Q7CA 4K6FA 3JD3A 4FN4A 2HO5A 5JAQA 3BIOA 5I8WA 3QVOA 4CLEA 4GI2A 2PZKA 1UDAA 4B7XA 2PV7A 2QHXA 4J7XA 1AE1A 4FFMA 3I5MA 4I8XA 2W2LA 1MGOA 3VPSA 3OHSX 2V6GA 4RGBA 1I32A 1Y8RA 1R4MA 4O63O 3MTGA 2VYVA 4IZIA 3LYLA 3AFMA 1I8TA 3OP4A 1GEEA 4YBZA 4IDEA 3UICA 3AWDA 1YH3A 1I3MA 1VL0A 3WYEA 3N58A 2E4AA 3B1JA 3VKUA 4W99A 3FBGA 5FYDA 1B8VA 3Q6IA 3L9XA 4Y8VA 4ZA2A 1BW9A 1OC2A 2WJPA 4IMPA 4RPGA 3V1TC 4E4YA 5F3RA 4DRYA 4TVBA 4AJJA 2IZZA 5CDTA 3CKYA 3KTDA 3BMCB 5T64A 4YRDA 3CMMA 5TQVA 1PIWA 2IE0A 1EFLA 4N7RA 3ZV3A 1U28A 4PLWA 4QT0A 4YVFA 4B7UA 4XEHA 3ETEA 3CXRA 3KRTA 3DQPA 4UVGA 4GKVA 1T24A 3FNGA 1WAMA 2GRAA 1JAYA 1QV6A 1E3EA 4Q3DA 3GEGA 3E03A 3AUTA 2UDPA 4G2NA 1BWSA 3EK2A 4D41A 1YL5A 1VRWA 4D7AA 1KERA 3MWEB 1C1XA 3DHEA 4J9VA 3NAQA 3ABIA 2XAAA 1U5CA 2Q46A 1X0VA 2FWMX 4E2ZA 5BSGA 4D0SA 4QX6A 3ENNA 3NTRA 3H9JA 1XA0A 5TNXA 3ADOA 4CODB 5ICMA 1HKUA 4PN3A 1Q0HA 2QIOA 1HDZA 5DCYA 3MTJA 2WEKA 3EMKA 4XQEA 3VTFA 3OH8A 3WGQA 3KEQA 1U2GA 1ORRA 1ZVMA 1E0DA 3MJTA 4NU5A 1EUCA 3EGOA 3JTMA 4IQGA 1NX6A 3GGGA 4Z9YA 1VKNA 3LT0A 4H7PA 3RU7A 1ADBA 5A5FA 4KTVE 3WGOA 4Y6PA 4ILKA 3P5SA 2HRZA 4XDZA 3GEMA 5KOIA 1E7MA 4XQGA 1GZ4A 1WDMA 3AU9A 3BHMA 2NLOA 3K6JA 3ON5A 4R3NA 1XELA 2NNLD 3O8QB 2VTDA 3JQDA 2DFVA 1WMAA 4K6CA 1X7GA 5MDHA 3ORFA 1T2FA 5BNIA 3F9IA 3QVSA 3TZQA 2HK9A 3IL2A 1EK6A 3BHIA 3ONFA 4BB6A 4LVUA 3D3WA 4LISA 3WGTA 4R5MA 2EW2A 3QVXA 3NT5A 4E5PA 2F00A 3WXBA 1Y8RB 2EV9A 4FD3A 4CMHA 5I9MA 5HRUA 3QWFA 5ENDA 5G0UA 3ENKA 3AI2A 2NTNA 4BNVA 2Y1DA 3OQ6A 5IZCC 3KBOA 1GPJA 1ZIDA 1QXSA 4OSOA 3FI9A 4PLPA 1X1TA 1YWGO 1IHYA 4CM3A 2B5VA 2PD3A 3ZNPA 3WTBA 4E13A 1KBZA 4J0EA 1AGNA 1MFPA 2OOSA 2ZCUA 4RF4A 3WSWA 1HSZA 4RZHA 1NTOA 3TZCA 1U2DA 2V7PA 1NWHA 3SC6A 3PPIA 4OKIA 2FOIA 2NU9A 3EAGA 4Y9DA 3UAGA 3ZV6A 3B1KA 3W8FA 4DC0A 3GMDA 3TZHA 4E2YA 1HE4A 2Q1TA 3I9JA 3KZVA 4W7HA 3GUYA 4R1SA 3QJ5A 3R3JA 4XQ9A 4BNHA 2D1YA 5T6BA 4FFNA 4BNJA 1DAPA 4JLWA 3WMXA 4BNIA 3I9NA 2BF7A 1C1XB 4AJLA 3C1OA 4GKBA 3Q11A 1JW9B 3QWBA 1NASA 2Y05A 3ROQA 4TQGA 4Q3EA 3I23A 1O6ZA 2H1SA 3D5TA 2I65A 1ZSNA 3OJ0A 3PGJA 1J4AA 3ZWPA 4OOEA 2JFHA 2O7SA 5ITWA 4YWJA 3GAZA 2YV3A 3BMQB 5JFOA 4WLNA 3IKVA 3T4EA 4N18A 1YBVA 1TT5B 4PZCA 3U3XA 2DTEA 4FJ2A 3NJ8A 2CNBA 4MVJG 5AXCA 1X15A 3AJRA 4HNHA 1E6WA 2XOXA 2Q1SA 1UAYA 3PHLA 4B4UA 4R1TA 1ISJA 3BA1A 3E8XA 4IGEA 4J1SA 1ZH8A 4D3DA 4XB2A 1ADCA 1SAYA 3GH3A 2H63A 4XDYA 1B3RA 3NDRA 3JSAA 4E3ZA 3IQDB 4OQYA 2ZYGA 4BS9A 2P9GA 2PD4A 4U0JA 3NRCA 5JNLA 1YKFA 5KIAA 3FR8A 1FDSA 2LDBA 3RBVA 2EKLA 3RUFA 4E0BA 3FNHA 4DLLA 3WNVA 1EE9A 2FHSA 2JL1A 4NBVA 5JDCC 1YL6A 1UXGA 3E5RA 3ZWNA 4ZICA 1D8AA 3ZWBA 4MVJA 1WLYA 3WNQA 3WWYA 3OJLA 3S2GA 1EVIA 1EMDA 3PDUA 4CLRB 1NVGA 3RASA 4CJXA 3C8MA 1GFSA 4M89A 4R4JA 1ID1A 3GT0A 4PFJA 3TRIA 4RDIA 1FXSA 3V2HA 5HA5A 3AUSA 2VT3A 1R6DA 3NV9A 1Y5MA 2AG8A 4UUMA 5IDQA 2J3KA 3EZLA 2NTVA 3VH2A 5HWSA 3I4FA 1FDTA 2XXBA 4QTZA 4ZQHA 5KVQA 4D46A 4EJ0A 5HM8A 4BNNA 5L7WA 1PGQA 3DDNA
chains in the Genus database with same CATH superfamily
3DLIA 1IPFA 4LPSA 1Z0ZA 1H2FA 1N2OA 3IQEA 1O4VA 2X5NA 3WL4A 3KK0A 2KB0A 4RM2A 2PY6A 3OPVA 3UFXA 4O3MA 1PFVA 3AFNA 4NYJQ 1E79D 1X1RA 1YQ9A 4RS4A 1U5AA 3DSRA 1YR2A 4V0OA 3AEQA 1CRLA 1LI4A 4A6XA 3ES9A 5AD1A 3F6YA 2IIQA 3R44A 1KK3A 4KEAA 1KJ9A 1NQTA 2QORA 2ZZKA 1PT5A 1I0ZA 4XIGS 3E9MA 1IHUA 4J0GA 4RQAA 4L0DA 4HB4A 1CT9A 1SUWA 2CCGA 4X1KA 1ACLA 1YMVA 1JT9A 1YTLA 3GBVA 4FP9A 2JFZA 4TWBA 4QFCA 5LZ8A 1RHMA 3Q9LA 3GCWA 5K3OA 2EX1A 1GDHA 1Y5NA 4PE5B 5BQXA 1L5HA 4A2QA 2O8CA 4F3CA 1T4MA 5H70A 4KRYA 4RETA 1ADJA 3KETA 1M2OA 1HV8A 4JS0A 4LXTA 4BQFA 3TNFA 1J70A 4W7SA 3WBFA 4M6WB 1JU9A 3FR7A 3MF4A 3B70A 3OQBA 1VYUA 2XGGA 4HDOB 1BS1A 4PLVA 4KXLA 1OX6A 2NQ8A 1GL6A 3F3MA 4IG4A 3L6UA 1Z06A 4M55A 1WY7A 4U7JA 1RLJA 2D2EA 3FYCA 4Y2VA 1C9YA 3SSNA 1X1BA 4DUZE 4EL0A 3IQFA 4OHVA 3RU9A 2XYRA 2WVAA 1WVGA 5K7SA 1UDBA 3L4BC 4G85A 4AJ9A 1JEDA 4M9SA 1DWQA 1FF9A 1XRQA 3B1WA 3EZFA 3KWLA 4FCVA 3NS7A 2QD3A 1Z0FA 2ZJAA 4IH4A 1Y1KE 1WG8A 4K3UA 3CMCO 1H23A 3TNJA 1VPLA 5B53A 1YUBA 2FY8A 4P82A 5EHIA 4EBFA 2H16A 2BFBB 4EUEA 1EFCA 2QSYA 2J9RA 4GX1A 1K98A 2WZOA 4QFBA 1P7WA 1GTJ1 1I7LA 1MV8A 1WNTA 4UE2A 3LUDA 2YJZA 3M34A 5JS1A 1ZEJA 2OGWA 3MT0A 2A9RA 4JH0A 2EE8A 4KXVA 1P62B 1TEVA 5LQNA 3FYHA 5D5PA 3FN4A 3K31A 1KPIA 2R76A 4B4WA 3HB9A 1FS6A 2L3JA 1ZM7A 2VDJA 3OIYA 1T6XA 3AJ9A 1Q5PA 4BECA 1F3OA 4GD3Q 4BJ1A 4Y1GA 1IEQA 1QIMA 3PQDA 1NXQA 2R11A 1KVQA 1JIVA 2V4UA 2NXEA 2QW0X 3QPUA 1GA1A 4HAXA 3CCBA 3ILYA 2JCBA 3PC4A 4G5XA 3C4VA 4AYWA 2JH9A 1NMXA 3DBRA 3VSCA 3WDSA 1KU6A 2CB0A 2IXDA 1FFGA 4LRYA 4RH3A 3H9GA 3DLPX 3HM2A 3DFKA 1JJBA 2BGMA 2IUEA 1XZIA 3CRZA 1Z7WA 1PI3A 4YT2A 5U4QA 4IIJF 4R2HA 3A58B 5IZCA 2F8SA 5C3MA 4UQOA 3IBGA 2R7AA 1U6IA 3BIWA 2CVFA 3H11A 1ISMA 3CEMA 5FNVF 1ULSA 4NZNA 5H68A 1MW9X 2OHIA 2HHHE 3EPPA 4IMJB 2R7MA 3CUYA 4GPZA 1F0YA 3JQBC 1X42A 2DPGA 2Q3EA 1MBZA 2Z9BA 2W2XA 1MJHA 4OM8A 5IN5A 3T9BA 3TIGA 4FMCB 3GLIB 1VKZA 5E2AA 1P19A 3KYCA 5C8ZA 1MO6A 1TQ2A 1R4NA 3ONEA 1UBDC 2A1UA 4JX9A 1I4WA 5HFAA 1H65A 5J47A 3SVLA 4GMDA 4AMBA 1W2HA 4YMVA 1STUA 4XQ0A 4FEEA 3ZBPA 1P2UA 1WZCA 1OA0A 2GLTA 1XXLA 2Q8QA 2Q6TA 3T4XA 4YRAA 1H1DA 3E27A 2M4IA 3EZ6A 1KARA 5EG5A 3TKAA 2JFFA 2VK2A 4MTCA 2EGHA 3AEQB 3X0DA 1Q11A 1XDWA 1NVMB 3U3KA 2GK4A 3DXXA 1E2EA 3KOYA 1LPSA 3I72A 2WTMA 2ZJ2A 2KS6A 3R3WA 3GLUA 3KUUA 5HF8A 3BC1A 3IP7A 1HGXA 1V5FA 3ESQA 5E3HA 1OPRA 4XEUA 4X1KB 5CVVA 1MNAA 2PUEA 4WUTA 4FOSA 1UP6A 4C4OA 3AEZA 4DMKA 3BRSA 4L74A 3HUUA 2UYHA 2V03A 4J2OA 1RR6A 4X94A 1ZC4A 4UE6A 4C21A 2GFIA 1L5HB 2O8CB 3DFMA 2EFJA 2IZOA 1RM4A 3B8EA 3MJSA 5DB4A 3TLAA 1FSFA 4MGHA 5AKYA 1X1SA 1M2OB 2VCYA 4RTKA 1APBA 4BO9A 1U8ZA 1DPFA 1XNGA 1XOIA 1ZC3A 2XNJA 3TR6A 1JU4A 2PS9A 3PL5A 4FQ5A 1V8DA 5EEHA 2IPNA 3GRKA 3U3DA 5CURA 2FWPA 2AG5A 4F2PA 4FNAA 1NUSA 1G1AA 4IBOA 4MR7A 2PJUA 2Q07A 4HDNB 5F73A 2VC2B 1R10A 1Z73A 3QXHA 1WMSA 4UQLA 3AESA 4DM7A 1K7FB 3GGDA 3NIBA 3PNVA 3HR8A 1UC4B 2CVPA 3FZQA 4UDXX 1JJVA 3PX2A 1JQLB 1FVXA 1B41A 4EHDA 4G8BA 3SX4A 2HH9A 2J6HA 4RFVA 1Q6YA 2V8QB 4QYIA 1LC0A 8ADHA 1IBMB 4JBIA 5KQRA 1QRAA 1WXHA 2V7VA 3UCXA 3I6IA 1LPOA 2AVNA 4UEWA 4QFMA 3AG5A 3DD5A 3PTLA 4KQJA 3G59A 3OEWA 4S2EA 4GGMX 4WLUA 5HBRA 4BQPA 1BBGA 5TPWA 1IZZA 1X47A 2P9ZA 2PQ6A 3ELWA 2FRDC 5IJ9A 3T1HE 4YLGA 3LMLA 4D3YA 1JR3D 2FZEA 3VXKA 4EA9A 2HC9A 4F21A 5I51A 3I62A 2EPRA 1TD9A 1P2VA 4WOBA 3T7KA 1XPUA 4HEA1 5BOSA 4OI1A 3VV2A 1PAUA 1PX2A 5J59A 3K6SA 1EHIA 1JDZA 2RG1A 4GKKB 4FUQA 1RBZA 1DCMA 3BL8A 2QLBA 2R4UA 2YCLA 4L4XA 1KQNA 2XRFA 1BZYA 4HTAA 1ZN7A 2DPMA 2ZT6A 1RWQA 1Y4AE 3DBRB 2ZSAA 4QDOA 6LDHA 3OZVA 3ZNOA 3OHPA 2CT8A 5EZYB 4X7PA 3QUQA 4WSOA 3WV4A 3G3EA 4G1UC 1HZZA 2B8JA 1AS0A 2HADA 3SEZA 3CT6A 1C3OA 2D3WA 2Q6LA 1RSZA 2FPWA 4OKSA 1FTYA 2X6RA 3OZFA 1VJGA 1G60A 2A33A 3Q5GA 1U4OA 3ANLA 2VF1A 3H11B 4WGGA 3GPBA 4XCVA 4ZVVA 3SQOA 3T15A 4DMUB 4E7PA 4O4LA 4LSZA 2BB8A 1QUFA 2IQ5A 3A1TA 3WKAA 4X0EA 1CTQA 2VHXA 4QHYA 4PZEA 4RW0A 1GYQA 4UHHA 4BVKA 5A5VA 1FYWA 4GHWA 3OLZA 2PPLA 1UP4A 5KDDA 2BFDA 2J0EA 5BR8E 3CH6A 3KYCB 4UXJA 3TS1A 2JFVA 2VTKA 2IXEA 5A0VA 3VNVA 5KYGA 4C7VA 3SQLA 1YCDA 3EXEA 2AB0A 3CLHA 3UJNA 2ZK7A 3G89A 1B14A 1XZBA 2IKQA 3HS3A 2C84A 1SULA 2I4IA 1EWQA 2XT9A 1BXGA 4Q39A 3LRPA 3OA0A 2FUKA 2H1LA 4IYJA 3I09A 3KXKA 4I5FA 1XMVA 3IKLA 2VNHA 2ODNA 4BUCA 3B12A 4JCOA 2A4KA 2EATA 1RQNA 2R6FA 1CJCA 1RQ7A 3WMWA 1D0SA 1A5AB 1X9GA 3NGXA 1X86B 1MX5A 2DFNA 2NT3A 3QNMA 3GA7A 3L5KA 4IOMA 3EVZA 1Z7GA 2YYSA 2G36A 2HRDA 4LF9B 1E0KA 2VUHB 1RHJA 3NOQA 3ZZUA 5A62A 1U0JA 3SGLA 2I7XA 5IBPA 3BMNA 5EINA 2OCLA 1KEZA 3DNFA 2X9NA 3V9AA 4CR7A 1RZRD 4H7KA 1CDEA 1EAMA 1VJ5A 2W6ID 3LT4A 4K05A 2UZ1A 1IQ0A 1RP1A 4C20A 2GBGA 2XDYA 4LY3A 2QL5A 1JI0A 3HGTA 4BFTA 4A73A 4M9RA 1D9XA 1YU9A 2P6OA 3DD1A 1COZA 1I51A 2Q2VA 3CNQS 3K0HA 3NP9A 3G9UA 2ENUA 1WW3A 2WWRA 3PF8A 1RS0A 2DIXA 4MR7B 4ZAWA 5KYNA 2NSYA 1YYWA 2P3OA 5E4YA 5BQOA 3EIEA 1A97A 4IR7A 1VL8A 3AESB 2AN3A 4GAEA 1GPNA 1G6KA 2V6FA 1QZTA 3FKSD 2V7QA 1JHAA 2I2DA 5A4DA 1JR4A 2DT5A 2X0IA 5TC4A 2ZFUA 3UKDA 2UVDA 3A4NA 1SHTX 1CDOA 4J76A 5DNDA 3W90A 4PYRA 1Q0SA 1FJGE 4U2FA 3ZDDA 4JC8A 2WKWA 2WB2A 2OD2A 2WYVA 4FCTA 1JMKC 3OCXA 4Q3AA 5HQ3A 1A7AA 1YJ8A 1GUFA 3SMQA 2HX1A 2QW8A 5FA6A 3S2FA 2WT9A 4R9VA 2OPBA 3ROGA 4D9NA 4DA0A 5DGTA 3G2JA 5TPWB 1KVSA 3G2HA 3AY6A 3OE1A 3AH8A 4Z0HO 5AVUA 1Z63A 1ZNYA 1CUGA 1Z7YA 2L92A 4EMUA 3JWJA 5IJ9B 4LF8B 4RD1A 2TYSB 2WZCA 4YTEA 2W22A 4EQ6A 2IU6A 1HE3A 1VJ0A 2ID4A 1HBJA 5BOSB 1H0SA 1G6OA 2CNLA 1IZ0A 1V6SA 3CNHA 3D2BA 4YRCA 3HPRA 4ZRNA 1DXYA 3DXFA 5K1ZA 4Q3KA 2YSOA 2XXJA 4CL0A 5L3VA 1H8EA 4G81A 3VU3A 4RTQA 1COWA 1OCEA 3SZMA 1K97A 5G0WA 5KNBD 1P74A 4EJ6A 1DWOA 1JXMA 3EBOA 4FIDA 2CMFA 4MB6A 4EFDA 3GFOA 2G1KA 3DV0A 2DKOA 1NI4A 5C1IA 2PFSA 2C7PA 1EVYA 4AF8A 1BRTA 1UR5A 3MWJA 1U9YA 4U3JA 5CFPA 1CR1A 4KO3S 1C3OB 4UVEA 3RFVA 1TVKA 4XOIA 1AX9A 2VP6A 4MPRA 4PLCA 2HA0A 4Q7JB 5B7PA 2CV1A 1JPVA 4D1YA 4DV5E 4D57A 1W44A 1G19A 3EISA 1UXOA 2X6TA 4O4LB 1SA0B 2XECA 4S1TA 2ET6A 4NFSA 1EFHA 4TSKA 3QKSA 1FYFA 4GEKA 1JIUA 4OGKA 2OGZA 3FETA 4RPHA 4ZOLA 3ZV7A 4B3HA 3OKAA 4IQ0A 3FOFC 1P3JA 3NMUF 3KVVA 1QX3A 4MMXB 5D3MA 2BFDB 2CNWA 2WOOA 4X7RA 2RI0A 5EIOA 2L0XA 3G5TA 4LK2A 4WADA 1Q1BA 2XB9A 4DR6B 3D0OA 1CJVC 2V7UA 1WHNA 3EXEB 4CCWA 1R9GA 2GNOA 1T8SA 2YUTA 3PNOA 1D2EA 1EX9A 3K1JA 3M81A 1SCUB 1EFUA 1DTWA 4OYLA 1BXGB 1OW3B 2QEQA 3A1FA 1DG1G 1IHOA 2JI6A 2WTXA 1WB5A 4HNTA 2ATEA 4TZ6A 3D4OA 2B8EA 3K8YA 4Q6BA 1XTJA 3T3EA 1OFHA 3GDOA 3GF4A 4KXYA 4AB1A 3FDZB 4E1AA 1J22A 1CZRA 1PS8A 2NSLA 3H9UA 4LGMA 5T3UA 3SE0A 1E1RD 2EOSA 3T5BA 4BB0A 3AF6A 1ZI6A 1HMYA 3N2KA 4H1UA 1RJGA 2P5UA 4LRSB 4ZJPA 1UH5A 4GEGA 1EJ6A 4IGFA 4KLCA 1Y8ZA 4E6PA 3RJZA 4NXNB 4HLCA 1CUCA 4MKGA 3U9TA 4ARUA 2LIVA 3L6CA 2GF2A 3NALA 1YZ9A 1UJ6A 3BMNB 3S1LA 1YZGA 2FG6C 4JDPA 5FBZA 2C92A 1VSUA 2JF0A 2XCTB 3BFPA 1RWOA 4LGYA 3LCMA 4GZ3A 2UZ1B 1NF3A 5EJ5A 4BV9A 4ZXFA 5JJBA 3HBJA 1LW7A 2FJUA 1SB8A 1XVUA 1YR1A 1WCYA 4RMNA 3QQPA 3HBLA 1Y0BA 1P7ZA 5CCXA 1KZHA 4YO8A 4JUIA 1E2LA 3WMGA 3U44B 2D7DA 1DOHA 4G25A 2FAXA 3GWZA 4FXPA 2ALJA 2R7KA 4J6FA 4PTYA 3ECRA 3B1YA 4CGZA 3QX9A 5FCDA 3RF6A 2JCXA 5H16A 3IRVA 2V5VA 1HFKA 3HFSA 3QLJA 5KNBH 3OQPA 1DINA 1YKSA 1F51E 1DU4A 5I45A 3LLSA 1V4NA 1KZGB 1FTGA 1NL3A 2BCGY 2O7VA 2P9CA 4TMFA 5KAMA 2RE8A 2EN6A 1TT7A 5HQ3B 2XZLA 4MEAA 4WY2A 2E1MA 1V26A 1A71A 1K5GA 1XV5A 4GPBA 3DF9A 1YK1A 1YMQA 2AQKA 2E48A 2GJKA 3P97A 5GONA 3JD4A 5JNRA 1RWVA 4BMVA 3IPCA 2FETA 2XTAA 4PX5A 1QFZA 5FF9A 1CIVA 4F11A 1L1EA 3IAUA 3EA4A 3OCZA 4K2HA 4KKXB 2FDRA 3LO8A 2FGGA 2HQSA 3PF9A 4LXQA 2WUEA 5CHEA 2GD1O 1IVYA 1E3QA 2PMBA 1TL7C 3F5SA 3MSCA 3EA0A 3ZWWA 4F86A 3KOMA 1YGPA 4TKUA 2BCJQ 4BO1A 4CQMD 2H4JA 2VZ9A 5IU6A 2GCGA 4MVYA 1O95C 2ZSKA 4NQZA 5DF1A 3R3SA 3H19A 4MAAA 1VJTA 4OD0A 1JHUA 3UUGA 5KTTA 1L0BA 1SD5A 1TLTA 3CF4G 3OM8A 1F9AA 4OXQA 3AGQA 2VP4A 2HSWA 1PTJC 1NI4B 2ORED 4HYEA 1DAMA 4O33A 2C2XA 4F5DA 1WETA 2P3QA 2W93A 3FMIA 5KCMA 5GZ3A 2OOKA 4U3JB 3THNA 1R3DA 1UXKA 4NZOA 4O4HA 2HEIA 1L5NA 2KHXA 3TMYA 4CTOA 4DDWA 1HR0B 1TVKB 2R7LA 4MR9B 5AM1A 3MGAA 4R8VA 2C58A 2NZ2A 2O2JA 3H1AA 3OCCA 3OIWA 4G23A 3QKSB 4ZOLB 5IBQA 1NWCA 2CXNA 3WWDA 4F7WA 2PKRA 5IXSA 2BN4A 5JYEA 3QEBZ 4J90A 4GX5A 4FKZA 2JAUA 5FAXA 1C0IA 3G5MA 2XWQA 2EMKA 1O6GA 1P6XA 1LBEA 1Q3TA 3EW9A 3JV7A 3FNBA 3HVIA 5D3MB 4Z0TA 4PR3A 4KH0A 4ZXPA 4Z3OA 1KJZA 3I6ZA 4IDGA 3GN1A 4O5OA 4PC6A 4QECA 2XUJA 4GGOA 4F4JA 3UPDA 2XYGA 3CF4A 4QBTA 4B6QA 4PC3A 4LOIA 4TS9A 3HBNA 1F12A 4RY8A 2MSNA 4KPFC 5HKOA 1DTWB 1NQOA 2HTFA 2CNKA 2H59A 3COVA 3U13A 4M46A 3O8CA 4R7GA 5KYXA 4ZZ3A 3OLWA 1ZA2A 1M2GA 4GDFA 5IJAA 3GDWA 3L7LA 1OIVA 4KWIA 1J6UA 4E88A 1E79A 2REOA 2I66A 3SHVA 2Q41A 1DDGA 2Q27A 4EKGA 3NQ41 5FHRA 2DBRA 2IH4A 3N2KB 3ZJUA 2O3JA 4G1VA 1PVDA 3K32A 3VNAA 3U7HB 4LU9A 1BA3A 5JS2A 4UPDA 1ZO8A 1WQ1R 2EM0A 1G16A 4I1UA 4MP8A 3LQQA 3I42A 2IE8A 3LA6A 4KR2A 2JGMA 3GJRA 1T35A 4B48A 2EN2A 2CNDA 2ILTA 3MQFA 4KQKA 1YR6A 1AMNA 2DX7A 5LBIA 4ATNA 4B33A 4KBFA 3RBAA 1DKQA 4GI5A 3PHIA 3LC1O 1UMCA 1P7CA 2BF4A 2GILA 1CEEA 3I4CA 4X00A 2W6JD 1M5TA 1RMYA 1GRVA 1KZYC 1R0RE 2VYCA 4K2AA 2IXBA 4KRXA 3P20A 4CM5A 3BMOA 3DFFA 4WCFB 4LYJA 1XIVA 3NM6B 3A37A 4GOXA 4UHFA 1OWNA 1FLAA 2B4AA 3A10A 3HN2A 4MI9A 4DPLA 4Z4FA 1AHHA 3AI1A 1SC3A 2L42A 1D2AA 5EI5A 1OT3A 1TM4E 1ODSA 5CT8A 1SB9A 2GPWA 4PPGA 4UBNA 4RF3A 5ALIA 3JYHA 3ONNA 4PZUA 3C5WP 4NV1A 4PIMA 4RMHA 3FZNA 3D7LA 3VVBA 4BWFB 5BSWA 5LOVA 1GA6A 4Q16A 2I2XB 4H6WA 4BQOA 3VVMA 5JRDS 1LFAA 1WBJB 1Z12A 4GWLA 3VI3B 2PBFA 1Y4SA 4XWTA 5IBCA 2DFLA 1YI0A 4JZYA 4IVNA 3VHXA 2KONA 5H02A 2IDKA 1OBCA 1UDXA 4YH1A 1K5HA 3DJFA 1PCXA 1QQAA 2M6SA 4GWGA 3ZWDA 3ZCSA 4JMPA 4WFIA 1NJ2A 1QYXA 4BNWA 1IIBA 4NBNA 3SQDA 5AVKA 3UMMA 4LEIA 3MELA 4TTRA 3QX3A 4EH1A 5A9SA 3L1IA 4D9KA 4RTLA 1KFEB 1UBOS 5DOVA 2JGJA 5GONB 4BMCA 3O9MA 1VKHA 1SUPA 4M60A 3TE7A 1EFVA 2EMWA 5F5LA 5CNJA 1RFLA 1G8YA 1OGJA 2G7MC 3HU1A 3I6MA 4ECEA 2BUAA 5IVDA 1M2HA 1C8VB 4JI6B 1TIPA 4YMUA 2FZ5A 2XBUA 3K30A 4NIMA 4RF2A 5ALLA 3ZY6A 3KFVA 1OH6A 2H11A 1O97D 2X2EA 4EF6A 4O2AF 2QTMA 1ZGJA 5J4KA 3OOYA 4BLWA 4WACA 3OOJA 4GZMA 4F8YA 4D79A 1DSSG 5EJ8A 1JMVA 1GRNA 1P7PA 4AQYB 2FLWA 5CTJA 5DBEX 5EJGA 1FS4A 1V48A 3B3QA 3L7JA 2QX9A 5GGYA 4F06A 3CH4B 1L8OA 1P1IA 3QIVA 2FQWA 4O4HB 2OHHA 4JQOA 4I66A 4AJKA 1SBHA 5FULA 2GBPA 4LYFA 2XB8A 3U7GA 2FSUA 3H17A 4HGOA 4K6MA 4Y6RA 5CXXA 4Q7MB 1P9WA 2NAPA 3NR2A 2B1IA 2FZKA 2L18A 3HXOA 3HXKA 2F8LA 3CX3A 3X3HA 4HYQA 4OHUA 5B37A 3SLRA 7ABPA 1E5LA 1M34E 2FXVA 4II3A 5LP6A 5J23A 3DEHA 5CPBA 3DMFA 4P78A 4X62E 1SKYE 3O93A 2BTQA 4BB9A 4PPQA 5KTNA 1GZ5A 3DZBA 2P9FA 1K86A 3CX6A 2C0QA 5FTNA 4N0QA 2UUCE 2PX6A 4QAQA 1DUSA 3W6UA 4ZYGA 1MG0A 4OV6B 4UUPA 1XYGA 1ZZGA 2WT8A 4CTJA 5T4FA 3ZHYA 2X13A 2NSJA 3BK7A 3E8SA 3DW3X 5KYXB 4W4TA 3V8QA 3X2EA 2LE0A 3ELDA 3GVIA 3PJDA 2A78A 4B35A 4XUGB 3EEIA 4C0LA 5J63A 4A8JB 1AGPA 1CR0A 3LHIA 3PEWA 3P2IA 3B6IA 3VSBA 4X90A 3JVIA 3MT8A 1RQ2A 1YJ5A 2B4KA 2FPPA 2VP0A 2ZRHA 1HTBA 5J40A 2IX9A 1RZVA 1XN4A 5GJCA 1E1LA 4FXOA 3S70A 2YH2A 2ZBVA 4LI3X 4QICA 5JC8A 1BXRA 3MAJA 4URWR 1ESDA 1AK2A 1RAHA 4BQEA 5E8RA 2R86A 3CUEF 2PNFA 4JXZA 2QXUA 4JBXA 4LF4B 1A4XA 1ISPA 3AVXA 4AS1A 1IDN1 3M83A 2XIQA 4ZKDA 1A72A 2HDHA 3DULA 2CJXA 3RM3A 3LUGA 5CYOA 1A50B 1WUHS 3BMOB 3B9QA 3G2MA 3ZCQA 1IEVA 5ESRA 4LY9A 5KJ6A 4OFZA 3U09A 3KAPA 3PX3A 4BLRA 1R12A 3QV1A 1NGSA 2AMVA 3ZS8A 4AIRA 2B8WA 5CFMA 2NZWA 4FCWA 5JD5A 1JSZA 3MYYA 5LOVB 2KMLA 3F6RA 4UZEA 2EM2A 4TSFA 5D00A 5KNDD 1KDOA 7ADHA 3GCZA 3A32A 5JCJA 4EI7A 4RY2A 1VJ1A 2AJDA 3AHJA 5SY9A 4D9GA 3CZ5A 3IJRA 5T4HA 2RPCA 4DBLE 4HPJB 2OZEA 2RIRA 3VHXB 3CKMA 4LFBE 4CWAA 1I1QB 1QCYA 5T41A 1ZWLA 5K3FA 3FTPA 4B6RA 3KJGA 1JXAA 4Q24A 2ZJ1A 2BH2A 4FMBB 1F20A 2G9QA 2NADA 3BWMA 3DKVA 1T0HB 4MWOA 2M6RA 3U17A 1EFPA 1KPHA 1OB5A 2BMDA 1A9OA 2VXYA 4AJ4A 5DEIA 3PQ5A 2FLKA 4MQLA 4LW8A 3IPRA 4N4RB 1PN3A 3A6KA 1QRSA 1FPQA 1ZPDA 2HXSA 1R8QA 3BXPA 2LWIA 1EFVB 3AR6A 3GGJA 5AK5A 5C8YB 3SC2B 1CU1A 3H4TA 1JDTA 5JCZA 5MN5A 1E6MA 5AOVA 3N2LA 4A6EA 1JA0A 1B73A 3CKLA 3FTQA 2CXQA 3FUVA 2G67A 3NTUA 4FZVA 5C37A 5DXAA 3TSYA 4AO8A 5HM6A 1JR3A 2FPOA 4M1SA 4TMKA 3U37A 4RD0A 1QVVA 2C7VA 3JALA 3DLHA 1MX1A 3ZWYA 4AN4A 4CN8A 5CJ2A 2PUJA 3ZI4A 1BCSB 1IYZA 1TX4B 3LY9A 4GYKA 6YASA 2C94A 1KFJB 3AOEA 5IAKA 5C4MA 1QQTA 1U31A 3CB2A 2SICE 1NXPA 2WTBA 4CLOB 4I19A 4MCAA 3ZGZA 1GOTA 3H13A 3S2SA 1ZD1A 3VPAA 1DEAA 4W5TA 3QPBA 3N6VA 2B1QA 4B3ME 2M98A 4WPGA 4ENSA 2VQ6A 4K1XA 3ZU4A 1B2RA 5LQJA 1ZWKA 4LN1A 1I2DA 1SH7A 1P5FA 4IO1A 2V74B 4PZAA 4L9SA 3BJZA 1LK0A 3KZNA 4OA5A 1WDWB 5D84A 4KE8A 4BQNA 2PVCA 3LKBA 3T9FA 3CM0A 4BB5A 4ZQBA 3R9KA 5ED0A 2JRCA 5JXWA 2BTQB 3Q8XB 1JG4A 5HRUA 4M1QA 4OQNA 4MPJA 2R1FA 1P33A 4Y6SA 1GSHA 3KR9A 5FWXA 3E15A 3RK0A 2OCBA 4MUJA 3Q9UA 2C5FA 3RUAA 4LCJA 2H52A 2O2SA 2NGRA 3L7NA 4PGMA 3E3LA 3PDCA 2ZTUA 3VZCA 1ZHFA 3CLRC 2BFOA 3OBIA 3U1VA 1IUKA 1G7SA 2WRZA 3LDHA 2WM8A 1JEOA 4F97A 3CZRA 3QTTA 1P7YA 4WZAA 2IPLA 4C07A 4HAUA 4KHPB 4DDVA 3NX4A 3BVPA 2QP3A 2HREA 5LXTA 1N3LA 5CFOA 2PH1A 1VLZA 4DSTA 1RIFA 4RPLA 5AVYA 2ZJ6A 5KNDH 1I6KA 3JVUA 1OZAA 1HA3A 1FZTA 1WM1A 1PE0A 2FPPB 1UK7A 3L6DA 4IH9A 5BORA 1V0JA 5AI9A 4J7AA 3L46A 4BZWA 1HNZE 3U4GA 4WFJA 4EHHA 2NTEA 3WICA 1BXRB 4JC4A 3ZEIA 4YJGA 1Z2OX 1Z35A 3X44A 3GZ4A 3IQZA 3RBZA 2BFCA 3NCTA 1BDHA 4AZVA 4F91B 3D3NA 2B2CA 2EOQA 1OZFA 4H31A 1M2JA 4PZ9A 4YRTA 3C45A 4WBNB 1ZI8A 4OHOA 5B3JC 4PQRA 3KQKA 3FWHA 1JLHA 3D4PA 3FPBA 4ZHSA 2BGLA 2ES4A 2O8EA 4OBXA 2R9VA 2ZS8A 3GK3A 1BGVA 2DMRA 2VRBA 1E9FA 5JD4A 5F5XA 4WD3A 4JYMA 3H8VA 2P8SA 3HCOA 3H0EA 4TSRA 5KVAA 3VPCA 5CG2A 5A2GA 2AJLI 1G2OA 4N4AA 4EB8A 1GPLA 3BILA 1ZK3A 1V5IA 4WWHA 4P3OA 5F3WA 2W90A 1W5BA 1XJ0A 1WHQA 1I1NA 2BM9A 2EKPA 4X93A 2VSFA 2AT1A 4IKPA 2X5OA 2BHTA 3KAKA 1RVV1 1CUFA 2P5SA 5K3FB 1Z29A 2G0AA 2PWBA 3K9BA 4UKDA 3T7SA 4WHMA 3RVMA 1EFPB 1HQCA 1LC3A 4P58A 3ISTA 5HILA 4ASUD 3I9KA 4EY6A 2NO0A 3ANYB 1RHUA 1OIXA 1ZH2A 3TUJC 4LV8B 3DM5A 2ZM6B 4BO0A 4G89A 4XYMA 1HT3A 2QY6A 5IT9C 2ZQYA 1N5RA 2NSDA 2QBYA 3PUVA 2UUPA 2F9FA 4DARA 1F06A 1JKIA 3EMVA 3PUXA 5HCIA 3TB6A 4JWKA 4A5SA 4F9AB 2BBGA 2Q1YA 1MKYA 3JALB 4GOMD 1SEPA 2JCSA 3LLUA 1C2YA 2Z6UA 2RONA 1HDRA 1HMPA 3ZGYA 1YBHA 4JKYA 4PV7A 2GN2A 1Z74A 4HZGA 4K6HA 3ZE7A 4MUKA 1A7KA 1CLEA 1BMFD 1SUIA 2BGKA 4CN9A 1VE9A 1Z68A 5KNBA 4DV4E 3CLTC 5G3YA 3FROA 1ATIA 3GJ7A 1XQYA 4J29A 1G5FA 4REMA 8GPBA 3TSWA 2L2KB 3GV0A 1KS2A 2WNIA 5FD8A 4XGKA 5AVRA 1OF1A 1JA9A 1FK8A 1JDSA 1NRXA 2ONZA 1NI3A 5FI3A 2IC5A 1JHDA 3P9NA 1N5MA 4PQGA 1C80A 1GGEA 4NK5A 4UFNA 2P6UA 5EJ6A 1E2FA 1IB0A 4GYYA 2HU2A 2ZIGA 5HOQA 2KWIA 4F5EA 2C1EA 2JI9A 2ZIVB 4UFPA 1LSJA 2FPLA 1IY9A 4HH0A 2PMEA 1IN4A 1S3GA 5FWXB 4S1WA 4KAAA 2BC9A 2JATA 1E64A 3MD9A 3MZ0A 4QVKA 5EUMA 5F12A 5J43A 2NZVG 1FUKA 1EDZA 4C03A 2O14A 1V6CA 3R41A 3KTAA 4X65E 1FQKA 1GPYA 4WZAB 2Y0EA 3DV9A 4Z8YA 4OSPA 4KDRA 4F04A 1C7FA 2PXAA 1ENYA 5IC6A 5T6MA 2JLBA 2ZB3A 3AKYA 3LPDA 1S9HA 1X2EA 2BH9A 3CY6A 1KJ8A 4J94A 3UMFA 1XMJA 2GEDA 1I0IA 1OUMA 3C3MA 5CA1F 4WY5A 3VJKA 3A05A 2YWCA 3W4KA 1RI5A 2VUUA 3G5UA 1NQWA 3VH4A 4D9BA 4I55F 3ZJVA 4OYRA 4BLQA 4D26A 1JQKA 1TAQA 1P6QA 1E1RA 5CB6A 3DEAA 3ZVLA 4YR9A 1G41A 1SVWA 1JQBA 1UZUA 3AUXA 5TJHA 3NFRA 3UT0A 4B2YA 4JL6A 1XWFA 2AHOA 2SHKA 1OX4A 2FSHA 3G9TA 3QKTA 3SIRA 4E33A 1RYFA 1N6PA 2BFCB 1P2DA 5BPFA 4BZXA 5LDHA 2D4HA 3O82A 1KQGA 4M21A 1DB3A 4DV0B 4BUJA 2PGLA 2HLPA 4RGVA 1TKBA 3VAYA 1X6VA 1QIHA 4O02B 2K7FA 2BKXA 2XNSA 1H2BA 2N3HA 1NJSA 1QKJA 3AUJB 1UXJA 4GPAA 2E21A 3OLVA 3CC8A 2R7NA 3ZU2A 5DSTA 4NCHA 4L8NA 4XM0A 2O8EB 2CXTA 1E3JA 2ZEJA 1Z38A 4HX5A 4U0KA 5FRDA 4AP9A 3TKLA 4KXQA 3V80A 2EKDA 2AJCA 5COQA 3ABQB 3NIGB 1MZPA 2O8BA 1NN0A 3BULA 3C3XA 2RHOA 3H5WA 4GSYA 4D8VA 5KVCA 3PU6A 3BN3A 4HRYA 1YDEA 5D7NA 4TROA 4D4GA 5TARA 5F3WB 3HWX1 3FPLA 5EERA 1NXTA 5JZOA 4BWGA 1BVHA 5K0BA 4MEBA 1IJEA 2ZB4A 2ZRGA 1GJRA 3LY5A 5K8CA 4BO8A 2P2CA 3CA8A 2XA9A 4WEQA 4NU6A 1GPWB 2DFDA 4UTOA 3ZH2A 1YAJA 4BN5A 2IA5A 5M7EA 4MRAA 2F55A 1SY7A 1N8NA 4TV9A 3KB1A 4EFMA 3GEDA 1ECCA 4BV2A 4CDRA 1PV2A 3ZOKA 3UATA 4IGIA 4C2UA 1AG9A 3CVUA 1UKEA 4AMGA 1Y82A 4FYXA 3JPYA 1NQUA 3I45A 2BM1A 4BFYA 3BCUA 4TL8A 5DK6A 1D07A 3F3KA 2BDEA 2C98A 4I3FA 5CM2Z 1TO6A 4KPGA 4BOYA 2VHVA 1QWOA 4AUKA 4BE4A 3OFNA 2AI3A 5JZ9A 4CU5A 3W6ZA 3L7BA 4UHBA 4ZQIA 4BN4A 4MHSA 2DG2A 3K9QO 2X1VA 4ESHA 4R9NA 3ROKA 3B3GA 1OX5A 1I33A 2EJCA 2WJZB 3CIFA 4QFDA 1NG9A 1ZP6A 4B7CA 4EG5A 5K6TA 2W11A 3REQA 4J2HA 4WI1A 1DRVA 4GP9A 1W0JD 3EVTA 2HZBA 3TAUA 3Q3GE 4JB0A 3KIPA 3OX1A 3PGA1 2Z6AA 3AFOA 3CPEA 4IS2A 3GJ6A 4Z2AA 4QNMA 1JR2A 3DVSX 3K0FA 3F71A 3DFZA 3A4VA 3DUWA 3M6WA 2RGRA 2F3PA 3UOGA 1CV2A 2XB6A 3ZWOA 4BMNA 2V4ZA 3E1KA 3H2SA 1W8DA 4ARVA 2J7PA 4DLWA 4ZI7A 2X58A 4U8HA 2IOYA 1UBJS 1BJRE 2QG4A 4TKVA 5JUWA 2HJSA 3B36A 4GI3A 1L1RA 3RV3A 1PEDA 2Q7DA 3ZS9A 5A6SA 2FW9A 2PL9A 2QTRA 3G0BA 3IMCA 3I9OA 3MTBA 4EYSA 2JJ2D 4EG1A 3CSUA 1K6XA 1YS7A 2Q3FA 2CFTA 3CUKA 3PC8A 4IVPA 4MUXA 3RIEA 5KL3A 1KHHA 4R7ZA 1FJHA 4KMOA 5F9HA 3BD6A 4FVTA 5JXGA 1NNEA 3KTAB 1PJQA 4JJFA 4L8FA 5BWBA 4OREX 5CT6A 3KT8A 2F1HA 2O3UA 4OVKA 4I14A 5DNCA 1KEKA 3K0SA 4R8LA 3A6DA 3QITA 4NC9A 4XFDA 2QTZA 4ZARA 3BD9A 4JYAB 3DO6A 1T4BA 2F59A 2CL7X 1B0ZA 2I1VB 4D8YA 3X1DA 1G291 1Z0IA 4O6VA 4EABA 1GPUA 2FN4A 3FTFA 1K0FA 2EHJA 1XRLA 3AV0A 1YUIA 2IYQA 1GP2A 1X8XA 1QHIA 2CCJA 3NU1A 1M0SA 2WBLC 3RARA 1OX4B 3ZX5A 4LHVA 4F5ZA 3RUHA 5AKXA 3KQSA 4MSUA 4S24A 1PT7A 3EB9A 5E6SB 2CHVA 3OOHA 3PEEA 4E5UA 5JJLA 1RWPA 1E0SA 3QIAA 3MRXA 5F2EA 4AL4A 1X5WA 3FB1A 3FBWA 1ZS9A 3PWTA 4X20A 1SZJG 4BEWA 4PONA 2QX8A 1EP3B 4HRAA 3ZUGA 4P80A 3BHJA 4DLVA 4B3XA 1NMYA 2W6JA 4BX8A 2IH2A 2O48X 3RE1A 3VOBA 1J21A 1DPGA 4ND5A 2DHRA 3Q88A 1TF5A 2O8BB 2IV3A 5IFKA 2I4RA 3V1MA 1DT3A 4NPHA 4BVJA 3BGOS 1IPHA 3ORHA 3W7VA 2P6RA 4Y7CA 4HUJA 2GBFA 2ONJA 4AULA 3G2KA 1GDTA 2JFGA 4KSBA 3V4FA 2Q8UA 3TOXA 1AS3A 1NLFA 1KEVA 3ABZA 2M2IA 3CXUA 3D8SA 3PNBA 3H5VA 3KL2A 5ALHA 3QPAA 2O2YA 2G80A 5KKCA 3TECE 4TYPA 4ZYEA 2HHJA 4XA8A 2QTNA 4TV9B 1O0SA 5BSMA 1JKFA 3SPXA 2LR0A 5FPYA 4D0LB 3LWDA 5AE3A 4KXXA 1CUIA 2P11A 2ZE6A 1YZTA 4JJAA 4DXAA 1C3XA 2JBHA 2FN8A 3UBTA 2YRWA 4IHKA 3LBFA 3UJAA 2BGJA 4AZ3A 1F60A 3I30X 4HMOA 5KPJA 1DOAA 4JI1B 2YZ2A 3FUUA 1MO5A 3K9CA 1U9JA 4URZR 4NLLA 5AK4A 4P6VF 3QXGA 1X49A 3TM4A 3NT2A 4PHHA 4YIHA 1TPYA 3MK31 4LBWA 4QNNA 4QRDA 2JNWA 3S7TA 2RDMA 4N5LA 2GERA 4DQUA 4RABA 3HO1A 4R9RA 3REOA 2W83A 2XI4A 4QXMA 5EP4A 5KQPA 4V0ME 3ZI7A 3RC9A 3TVYA 4DQVA 1GTSA 4F2JC 3M9WA 4LDJA 3J80C 2PT6A 4M30A 1EA7A 3HSSA 3Q6MA 3PXEA 4FHCA 1GCUA 2RI6A 3RADC 3QUSA 5CB4B 3K0FB 1NPYA 3UVEA 5EMHA 4NY1A 3ZNQA 3JW8A 3BRCA 1KP9A 1NE7A 2BM0A 4ZI7B 4BKPA 5FUMA 4ZYZA 4TKVB 1XX6A 3MJCA 1P4GA 5EIXA 1O8BA 1QYWA 2RAFA 2QMUA 1OGIA 2FN3A 4HQOA 4G5OA 5A6SB 1ISIA 2UU9B 2FZLA 4YJHA 3W3ZB 2GZMA 5MFPA 3VKFA 1JLRA 3QPWA 4GOKA 1L5WA 2O20A 1JSCA 2N75A 4DDMA 1KDPA 2H8GA 3ER6A 4LJAA 5DGCA 3KV3O 3L6EA 1UJMA 2O5VA 3K09C 5IYZF 4FM9A 5A02A 4KLRA 1TKCA 2ISCA 2GXSA 2XUOA 3CJQA 4KMSA 4M0DA 4NBTA 3HU2A 4MINA 4N7MA 2GM3A 4GC5A 3BUSA 2IUUA 1RXWA 2HPVA 5ALMA 3NNDA 4RY0A 3L8HA 1FQOA 3ZWXA 3U81A 1N36B 2BZGA 2RGYA 2H4XA 1NUQA 4NU8X 1OI4A 4KGZA 4P86A 1TDJA 2VPQA 1LPPA 4UULA 5DX0A 5I47A 1ZM9A 3SIXA 1JP7A 2L2QA 1MQ9A 3PZRA 1VGVA 1QMGA 3AV0B 4MAMA 5I48A 2ECPA 4Q3CA 3TGPA 3BE4A 4YMLA 3PHJA 3RQSA 4CMKA 2MTBA 3C8DA 4ZN6A 2ACKA 2VDKB 3K94A 2F9MA 1VLLA 1V1MA 3EIQA 4M0UA 1YO6A 4EARA 3VZRA 1N1EA 1BHJA 3FNFA 3LX4A 4UEQA 5DKFA 4Q1AA 1JFVA 2CMKA 5HJ2A 1JK1A 1L5KA 3LLCA 4X20B 1WNFA 3RSFA 5SZKB