1ZBQA

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
302
Chain Sequence
b'SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 4
publication title Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1zbqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zbqA01
3JQBC 1JVSA 5KJ1A 2LDXA 1MC5A 3G49A 4PLWA 3T4XA 3ONEA 2ZATA 3LVFO 1GR0A 1HKUA 4YT5A 4CMIA 4OXNA 3WGZA 4AJ4A 1X15A 4IJKA 3F6YA 2PV7A 4OJNA 3RROA 3ZWOA 1C0LA 3K30A 5ICMA 3CUKA 3H9JA 2CVQA 1PJ3A 3ZWVA 3OETA 3ANNA 3VTFA 4B4UA 3JD0A 4YJFA 3FBTA 1I2BA 2DVMA 1T2CA 1O0SA 4J49A 1YDEA 5TGDA 3AFMA 4DIBA 1M2WA 4DXHA 1C0IA 2EF1A 2Q46A 3INGA 4MOWA 1EDOA 2Y1DA 1R66A 4R5HA 1YL6A 3ROMA 2CD9A 3PLRA 2FMUA 4G65A 4NJMB 3S8MA 1RM3A 3G79A 2VQ3A 3IS3A 5TRTA 4EITA 1OC2A 2GDZA 4RL6A 3AI1A 3Q3CA 4TRNA 1YQXA 3DBLA 3X2FA 2ZTMA 3OEWA 2G5CA 3OFSA 3TZKA 2IZ1A 2NACA 1ADFA 2DTEA 2V6FA 4MINA 4Z9XA 4J16A 1YXMA 3I9LA 4GQAA 1DC3A 3UH1A 4B8ZA 3WSWA 3KEQA 5IZCC 4WLFA 5KIAA 3MJ4A 5BSEA 4PFJA 1UXIA 1T4DA 1B0AA 3RUIA 4A03A 4Q3NA 2R6JA 2X86A 3DZGA 3EGOA 4CMEC 4EUEA 2PTGA 2AQ8A 1O8CA 2AE1A 4YAJA 4BMSA 1Y5RA 4HADA 2J5QA 2Z5LA 3Q11A 3SLKA 1DSSG 1E0DA 5DP1A 4R1SA 4MIYA 1ZEJA 2X6TA 3NJ8A 1HYHA 2P9CA 2O4UX 1GFSA 3D4NA 3E5MA 4NQZA 4OM8A 4Z9YA 4UUPA 1H0KA 2QYSA 1BXKA 1CQJA 4XWYA 4AJOA 4CLOA 2CVZA 5L4NA 2PD3A 2P5YA 3VHRA 2DBRA 2SCUA 2ZIZA 1BDMA 1JKJA 4Y6PA 4RJTA 1GZ4A 4ZN6A 4WOKA 1ULSA 4RF5A 3B1KA 3VAZA 1P31A 5F5LA 3C7AA 2RCYA 1ID1A 4KOAA 5FF9A 4W99A 3RC2A 3WMXA 4E21A 2I5PO 1OI7A 2O2SA 2IEBA 4PRLA 4QX6A 1IPFA 2HJRA 2JFHA 4YVFA 1Z73A 3CPSA 1PR3A 5G4KA 4YT2A 3Q2KA 3DB2A 1UXHA 2A4KA 5IZ4A 2GSDA 1MB4A 4Z0TA 3AUUA 3TNLA 2HAEA 1P0FA 2VHWA 3NT5A 5I9MA 4R68A 2OZPA 4PVDA 2RHCA 1GADO 5T8KC 3ONFA 2EW2A 1HT0A 3GA0A 3VDRA 2GYYA 1E7QA 2EIHA 2BFAA 1EVJA 2CY0A 4IMPA 2ZB4A 4J6FA 3UICA 3PRJA 2BD0A 1MFZA 1E1NA 4CLDA 4BIIA 1LSSA 4FFLA 1ARZA 4D0RA 1KERA 3DONA 2YDYA 3CXRA 3QJ5A 3JYOA 1UZMA 3AM4A 2BI8A 2LDBA 4R1TA 4OKNA 2YY7A 3KXDA 1I32A 2Q2WA 4IMRA 5L7TA 5L95A 4RPJA 4FOOA 1A71A 1MUUA 2CFCA 2PZKA 1WZEA 2ZB3A 2ZKLA 5JSFA 1KC3A 4Y8VA 3ON5A 2E82A 4YJGB 3I83A 1DC6A 1KETA 4D43A 1EE2A 4B4WA 2FPIA 2BGLA 1Y6JA 5F21A 1E3LA 3KO8A 4GL4A 4HXYA 5THKA 1PWZA 2EEZA 1S6YA 5FFFA 3LC2O 4CMKA 4LK3A 2ZTVA 2CVOA 5TC4A 4XA8A 1HSOA 4IJVA 3I6QA 4XYGA 4MP3A 5DBIA 2X9VA 4WKGA 2C54A 3E9NA 3GRPA 3I9JA 4BMNA 4RF4A 3AM3A 3V2HA 5JXWA 3TZCA 2I3AA 1DAOA 1CF2O 5DOZA 3ICPA 4A10A 5IXSA 3EMKA 4GSKA 1ADCA 2VUTA 1W6UA 3L77A 2IZZA 2WYVA 4DVJA 3I1JA 1YONA 3NTRA 1HYGA 3CZRA 3A9WA 4H15A 2FR1A 2GZ3A 4OYRA 3AM5A 1AE1A 4Y6RA 3GMDA 3Q1LA 2GN9A 3LSYA 4HKTA 2O2YA 1NWCA 4W4TA 3UXYA 4K6FA 3STHA 4BL5A 3SJ7A 1KEPA 1LXCA 4KUHA 3GVHA 3TZHA 3C1OA 3PIDA 4WEQA 2NM0A 4RQUA 2W90A 4ZRNA 1XR3A 4M89A 3GY0A 3KRTA 3KV3O 4CM1A 1YRLA 2X4GA 4M8SA 1JTVA 4DYDA 4YCAA 1QG6A 3O8QA 1QYDA 4YRDA 3PZRA 1MGOA 4ESOA 4DLAA 3U4HA 3RKRA 1PS0A 3GPIA 4CM8A 1BW9B 5IDXA 1U1IA 2IXAA 4DQVA 4OSPA 2ZB7A 1G6KA 3VDQA 1GZ6A 1XKQA 3VOSA 1T1SA 4TSKA 1P1JA 5G4LA 1EVIA 4TQGA 4Y98A 4FFPA 1OOEA 3PYMA 2EKLA 4Z3KA 1Y7TA 1ZMTA 1HDCA 1D4FA 1RM0A 4IPTA 1DLIA 4L76A 3WG9A 5KJFA 4FOSA 3OICA 2BRUA 1N1GA 4B4VA 3D3WA 5F5NA 4OL9A 3RKUA 3HB5X 3KSUA 3LLVA 4N5MA 4ND5A 2JHGA 4MVJE 1F8GA 1FDVA 3ZWWA 3ZN2A 2E49A 5KNLA 5HBRA 3K8ZA 2X7HA 3HSKA 1ZSYA 4BGEA 4JJIA 4OSOA 2C5EA 4E4YA 5ITWA 4CUZA 1XDWA 4H16A 4U6SA 4C4OA 3DZKA 4U0KA 4QTZA 3C85A 4ZD6A 3LC7O 3QHAA 2X9NA 1LDGA 4WCFA 1NASA 3JQFA 3MOGA 1VJTA 3WLEA 4ALNA 5JDCA 3WSVA 4KUGA 1LSOA 3HZZA 1T2AA 3JQDA 1WPQA 2OL4A 3PGXA 5CEFA 1YB4A 4UEKA 1XEAA 2FRDA 3MTJA 3M1LA 4PZEA 4DLLA 1UXJA 1CDOA 4PLCA 4K28A 3TQHA 3OMLA 4J90A 2B4TO 3FHLA 3IP1A 3OH8A 2WTBA 3DZFA 1EDZA 1BG6A 3BZUA 4L4RA 3IL2A 1DFIA 1ZCJA 4Q9NA 3U3XA 3K96A 4TRJA 4N5LA 1ZH8A 3ZWNA 3B1JA 4UVDA 1LDNA 3F1LA 4BNVA 3HDYA 1Q0LA 1LA2A 4HP8A 2Y0EA 2VZ9A 4OH1A 4UEJA 3D3EA 3QWHA 2AE2A 1P1FA 4RPGA 4CLRA 3KOUA 1KVRA 3LT2A 1EVZA 3EHEA 4OXKA 3GK3A 3ST7A 2I66A 3JQ9A 2NWQA 4FBGA 3FN4A 2RBEA 5EERA 1DIBA 1ENOA 5I7FA 4WLEA 1H9BA 3WFIA 3W6UA 3GNSA 1C1XA 2C0CA 4FGSA 3KYDA 3QVOA 1ZO8A 4OMUA 1N8KA 2Q50A 3N58A 3CE6A 3NUGA 1GQ2A 3L4SO 4X54A 1V6AA 2YFHA 4W82A 1TLTA 2YQ5A 1GD1O 2CNBA 4Q3DA 1PL6A 1KVTA 5DNAA 1JAYA 2VYVA 3FTNA 3PWSA 3FI9A 2OUIA 5EPOA 1UXGA 1QYVA 3GEDA 4IINA 1NFRA 3ZHYA 4CM5A 3GQVA 4IS3A 1T2FA 2Z1MA 2EHDA 3Q9NA 5L51A 4KWHA 3AOEA 4CQMD 3GRKA 3VPSA 1LLDA 2RHRA 4R54A 4BNLA 5GZ1A 1YBAA 2AG8A 3BMNA 5ENVA 2AQHA 3QVXA 1I3NA 5EJ2A 4J1NA 1RWBA 4PIVA 3ZZNA 3PTZA 2DBZA 4E2YA 4MO2A 2CZCA 4WLOA 5DN9A 2B69A 3WGTA 5DULA 1U4OA 3WOHA 4ILKA 1SEVA 4HX5A 4BOYA 4FJ0A 1N1EA 4D79A 2B35A 1P77A 2VRCD 1E1KA 3LC1O 4PG5A 3ETDA 2JCXA 1EK6A 4MVJA 4XX0A 4B79A 1B15A 5EESA 2A35A 5THQA 4KMSA 1BMDA 1IE3A 5C5IA 5TS3A 1WDMA 5FEUA 4AL4A 2GO1A 3AK4A 1KEWA 5HTOA 3TZQA 4AJHA 3DOOA 5JDIA 1DHTA 4R9SA 4BNTA 1E3JA 5HS4A 1YQDA 2PZJA 1K5HA 1ISGA 3G17A 4IUYA 3BMQB 1CQIA 2PD6A 3PLNA 2JCYA 1ML3A 1ZXBA 3PFFA 5CPBA 4WPGA 1LLUA 2GUGA 2XAAA 1Z7BA 3AUSA 1M76A 3K6JA 1LX6A 3DFUA 4FJ2A 1KVQA 4P8RA 3RC9A 1KOLA 2Q49A 2Y0CA 2VHXA 1BXZA 1CRWG 1LRLA 3H4VA 5DF1A 5GZ3A 1ISJA 2VRCA 4AJJA 1LSJA 3JQGA 4BGVA 4DQXA 1PJCA 1JKIA 1L7DA 1CEQA 1H9AA 2EXXA 1WAMA 4YBZA 3WQSB 3H65A 4GVLA 2POQX 4B7UA 4O0LA 2UAGA 3DZHA 3H3JA 2CDAA 3ITDA 5JCXA 1QXSA 4WECA 3ZW8A 5A5EA 1Q1NA 4GX0A 4FCCA 1YOVA 4RF3A 4K26A 1KVSA 3DWFA 4PLVA 5JAIA 1PQWA 3GFGA 1DIRA 4BNZA 2Y93A 3IIEA 2ZYGA 4LVUA 5ILOA 3MEQA 5ILGA 1N9GB 1A7KA 1V0JA 3GNTA 4R51A 4BNYA 4EEXA 4YT8A 1XHLA 2NU7A 3MTGA 4PG7A 3LF1A 4NU5A 3SXPA 5FWNA 1QYCA 2CDCA 3RVDA 1I3KA 5CG1A 1BWSA 4B4OA 2H9IA 3GEGA 2J8ZA 3COSA 3GZNB 2VWQA 2Y1GA 1OAAA 2ET6A 3IOYA 4WLUA 4GMGA 4NBRA 1A7AA 4BMVA 2RIRA 3VKVA 1S7CA 3E9QA 1ZZEA 3LT1A 2WYWA 3BHIA 2EKPA 4AICA 2OBNA 4J7UA 3OJEA 4KDFA 4EJMA 2WE8A 4BB6A 1QLHA 3I9NA 3HADA 2BH9A 5KJEA 5GZ6A 2BFPA 3GH3A 3ASUA 2C20A 5G0SA 3NDJA 3I52A 2EJWA 3PDUA 4NNJA 3GDGA 3I4CA 3LDHA 5A9RA 3AFNA 1YJQA 5KKCA 2PY6A 1LTHR 1NQTA 3F1KA 1L1FA 2C2YA 3NDIA 3QY9A 1ZEMA 3ZWXA 4A73A 4CM7A 1B7GO 1H2BA 3AOGA 2PA3A 4J7CA 4PLFA 5DT9A 3E5RA 3WXBA 2AA3A 2AEJA 3U62A 1E7YA 1F12A 1DJQA 2PLAA 5JCJA 3OF2A 4W7IA 1DJNA 3WNQA 2NQTA 1DLJA 2AG5A 3M2PA 4INAA 4R16A 3BA1A 4Y6SA 4BO9A 3EVTA 1YS4A 2VCYA 2G17A 2D4AA 4CV0A 2ZJ0A 4OO3A 3C8MA 2V6MA 3DAGA 1RKXA 3IUSA 5L7YA 2HO5A 4ITUA 1F0YA 3ZDFA 3CIFA 3CKYA 3U9LA 5LDGA 1HF3A 1LQUA 1MXFA 2FHSA 4L8VA 4MIOA 4NPCA 4IZIA 3W4KA 1U3TA 4IS2A 1T25A 4JJFA 2WEKA 4E13A 3FF4A 3L07A 2I65A 4FSHA 4WNIA 4FDAA 4GWGA 4CJXA 5CFZA 4YEDA 3E8XA 1QV7A 4KTTE 4CM6A 3R3JA 3ROQA 4GBJA 4NK4A 4BNFA 1U5AA 3FD8A 2UDPA 3TOZA 2VUSA 3X2EA 1WNTA 1R4NB 1XG5A 1EBUA 1YKFA 1P1IA 1P1KA 3T7EA 4HFJA 1I2ZA 3A06A 2Q1UA 2R00C 2JD2A 1PS8A 4YWJA 3JQBA 3TDKA 4BUCA 3PFWO 4BO1A 4LSMA 4RPLA 4UULA 4MJLA 4UUOA 3ZNOA 4XB2A 5TT0A 3MWDB 1SBYA 1E6WA 4IGFA 3GC6A 1GU7A 3WGQA 3K31A 4IM7A 4I5FA 1U28A 2Y66A 2J3IA 8ADHA 2UUOA 5G0VA 2ZK7A 5DP2A 1EQ2A 3GHHA 5CDGA 3TL3A 3VVBA 4PG6A 2VZ8A 5CHEA 1CJCA 3INRA 1LQTA 1T2EA 4PG4A 4UUNA 5I8ZA 2X0RA 3IP3A 3MJTA 2HMSA 2PK3A 2JD1A 2H5LA 2R2GA 1EFKA 4IDFA 4CM4B 2BFOA 3JTMA 3FWZA 1J5PA 4XB1A 1YE3A 3OQ1A 1HZJA 4XR4A 2DPGA 1BHSA 3EDMA 2PKQO 4G2NA 3UGKA 2VWGA 4IBOA 1MG0A 3QVSA 2Z95A 2HLPA 3E82A 1V3UA 1LC3A 4Q3CA 3FSRA 4BKPA 4RLHA 3W4IA 2YHIB 4NG5A 3H6KA 3PQEA 1NP3A 1TT7A 1R0SA 5L4SA 2C07A 2DPHA 2QYTA 3UCXA 5T64A 5MDHA 3CH6A 1NFFA 1JKFA 1M67A 1SAYA 5IZCA 3C7DB 3C3XA 2D3TA 1NXQA 2DBVO 3RBXA 1X0VA 2Y1OA 4XD2A 5F3RA 5EINA 3ORFA 4JN6B 1LDBA 2Y68A 4CMEA 4RF2A 1OFGA 1AXEA 1HE3A 1Q0QA 2BGMA 4E5MA 2BGKA 3PHGA 4R1NA 4BV8A 3B1FA 3U4DA 1MX3A 1SNYA 1I3LA 3JQEA 1QRRA 1HSZA 3PEFA 1GUZA 1I36A 2JL1A 4FJ1A 3FR7A 1XA0A 4WLNA 2YW9A 4JBGA 1EUDA 4PN3A 4GVXA 1YVEI 4CLEA 5ENDA 2J3KA 2A94A 3VZQA 5J23A 2WWRA 3AWDA 2NSDA 2PH3A 1ZSNA 2CF6A 4ONEA 4A7PA 1VL0A 4KP7A 4CV3A 2O3SA 4BNJA 1BDBA 4PZCA 4J4BA 4PGFA 4TRRA 4YJGA 3ICCA 1EBFA 1VPDA 5JAZA 5IDWA 4KQXA 2FZEA 3VH2A 4L9RA 2O50A 5GY7A 2X5JO 2C59A 4XDYA 1CERA 1PR9A 1GAEO 1RYDA 5BSGA 1XQ1A 2B5VA 2C29D 4CL3A 3JQAD 1VL6A 5KWEA 3HDQA 3L6DA 2V6BA 4JQCA 5T67A 2V7PA 4R01A 4O1MA 3C24A 1GYPA 4U5QA 4BQPA 3F9IA 1SO8A 1ZK3A 3OM9A 4MPDA 5T8KA 4UVHA 4AG3A 1DOHA 2WD7A 3VH3A 5H81A 4ZU3A 2VT3A 2IYOA 5BQFA 4J9UE 1GL3A 1IL0A 1U4SA 4FW8A 2HKIA 2DLDA 3CEAA 4BNHA 4I9HA 3RUDA 3M2TA 5BT9A 3LU1A 2C7VA 4PLPA 2OXIA 1Z6ZA 1UUFA 1Y5MA 4B8WA 4ND4A 3RUCA 3JQAA 4TZTA 3OECA 4HFRA 1Y81A 3ZW9A 3UUWA 1HDOA 4ZA2A 1E77A 2GN8A 4FD3A 4NU6A 1ZK4A 3S1LA 2B37A 4DC0A 3KVOA 4E12A 4M86A 4TROA 4JX8A 3TOXA 4YPOA 3HN2A 5F1OA 4L74A 3NTOA 1EUCA 1J0XO 1JLLA 1I01A 3ENKA 4BO6A 1LLCA 1XQ6A 1EVYA 5CAEA 2CMDA 4D41A 5EL0A 3ROKA 1E92A 1XSEA 2B4RO 2Q4BA 1YB1A 4BNXA 4Z9FA 4UVGA 4BGIA 5H83A 4H3VA 2IRWA 1NPTO 4A5OA 4QUKA 4BKQA 2O23A 4MIEA 1NAHA 1J6UA 1N2SA 1IY8A 4E5NA 1GPDG 2B5WA 3PI7A 4GKBA 5A3VA 3AI2A 4NFHA 4TKMA 4I8XA 3IKTA 3P19A 4NHEA 1O9BA 4XIJA 2Y99A 4L4SA 1QKIA 3SX2A 5HM8A 1GPJA 1LC0A 5K6AC 2P68A 5FYDA 5AXCA 4E33A 1JU9A 3HE3A 3JD2A 2BLLA 2RH8A 4HY3A 3EAGA 2IODA 1ORRA 4IZHA 1HEUA 2D1YA 4N7RA 1EMDA 1VSVA 2EKQA 3A14A 5KKAA 3WGOA 8LDHA 2EP5A 1LSUA 3GVXA 2Q4EA 4ZQEA 4NFYA 3WTBA 7MDHA 4HWKA 4UREA 1PX0A 4YQZA 4JLWA 3NJ4A 3PJEA 2GERA 4QXMA 1WDLA 3VVCA 3ZWPA 5COQA 4AJ2A 1HDYA 3A28A 2YJZA 4YJFB 7ADHA 5A3JA 3GLQA 1B8VA 4JBHA 2DU8A 4YAIA 1PZGA 3EC7A 1H93A 3O03A 3UKOA 2Y0DA 4EDFA 1IHXA 3ZGYA 3ZWBA 3PHHA 2FWMX 3N74A 4NZ9A 4F46A 2G1UA 4FB5A 1D1TA 1LRJA 1BXGA 1GCUA 1PGOA 3QW2A 3RU9A 2YV2A 2JJYA 3TFOA 1ZVMA 3LK7A 4E0BA 4XQGA 5HS6A 3NT2A 4CMAA 4QECA 2Q2QA 3PK0A 1GUYA 4R3NA 5JYEA 3GZ4A 4MKRA 4M87A 3UAGA 2GR9A 1HWYA 2OP1A 5DCUA 5B12A 3JV7A 4XGIA 4D45A 2NQ8A 2RAFA 2X23A 4FGWA 3WGHA 4AJ1A 5IJZA 3ZHXA 1OZAA 3IQDB 4NMHA 1D7OA 2VOEA 3HQ4O 2HCTA 3QRWA 1FDUA 2HMWA 4NK5A 3M6IA 3B20A 5AXDA 2HUNA 1NTOA 3WR5A 5A9SB 4Y9DA 3B6ZA 4WJZA 4U8GA 1EFLA 1K6XA 1E7WA 3C7CB 1FJHA 4J9VA 4F3YA 3KSZO 3BTUA 5T5QA 1RPNA 1Y9AA 4QO7A 3KHUA 1DO8A 3ULKA 3W6ZA 4A0SA 5CDSA 4LISA 4XRGA 5A9TA 4IXWA 1XGKA 1A27A 1MLDA 1AUPA 1ZJYA 3HWRA 1B16A 3K5PA 4TRMA 3GPDG 2PH5A 2B36A 4IQ0A 4EI2A 4HUJA 4WE3A 2DUWA 3UOGA 4B7CA 4CLOB 1BTOA 1PGQA 3GHYA 3WX0A 4LSWA 4BV9A 4RPKA 4KZPA 4ZVVA 2VHZA 3IMFA 4ALMA 1C0KA 3D4PA 1E5QA 3JYQA 4D46A 4NR0A 2H6EA 5LCXA 4WASA 1QLJA 3DAFA 3IAHA 2D59A 2XOXA 2I9PA 1A5ZA 1Q2XA 3KSDO 4DGSA 1VM6A 3E6AA 1VJ0A 1NVGA 5A4DA 1Y8RB 4IDGA 3DL2A 2FR8A 3NYWA 1P44A 1R4MB 2DC1A 2GCGA 4IIUA 4KTVE 5I7SA 5KOIA 3P2YA 4AVYA 1D1SA 5COAA 5ADHA 1WP4A 3BMQA 2WYUA 2GD1O 5BNFA 4CR8A 2QHXA 3JQ6A 5CDUA 5G4KB 2VTEA 3R3SA 5EIOA 1H94A 4LCJA 5JE8A 3H9GA 1QYXA 3DMTC 1O89A 4YTEA 5IG2A 3VPHA 3OJOA 3JD1A 4DA9A 5A5FA 1YDWA 4RLSA 1NYTA 2GN6A 3JYPA 2PKRA 1M6HA 4MKZA 5JBIA 2PZLA 4XQEA 2W2KB 3VPFA 3HB4X 4XR9A 3L0DA 3BXXA 1U9JA 3A4VA 4E6PA 4J4HA 3S2IA 2Y1FA 4D3DA 1E5LA 3DOJA 1CYDA 3VPXA 1RM4A 3O9ZA 2VYVD 3QSGA 1Z75A 3L6OO 4N54A 2CSUA 4DPMA 1HLPA 4KQWA 4CQLB 5CDYA 1U2GA 1NVTA 2O3JA 4GLOA 5TJHA 4F45A 2XXBA 4BKOA 1R37A 1UZLA 4UAGA 3S2FA 3TSCA 1LJ8A 1J49A 3UHAA 3GZNA 4JNKA 4ZJUA 4BNWA 1H2HA 3ZNNA 4DQUA 3ROPA 3JYLA 5I9NA 2VN8A 1UR5A 2EGHA 2P4QA 4XGKA 2P9EA 1A9ZA 4XIYA 5DOVA 2FR0A 3MZ0A 4NBWA 1PTJA 4BB5A 1SPXA 1R12A 5C7IO 4MVJD 3KYCA 3OIFA 1VSUA 2UV8A 2OHXA 3QWAA 5A04A 1PQPA 4AFNA 2YQ4A 1F17A 2QX7A 4OKIA 4F6CA 5JMWA 1Z7EA 3PHIA 4RVSA 4BO0A 4HFNA 2BFMA 4BNNA 4K9DA 3FNHA 1H6DA 4GAEA 3RQSA 4DMLA 1NNUA 3I9OA 3OP4A 1YBMA 1T26A 2OFPA 2ILTA 3RBVA 4ALJA 5JNLA 4B7XA 5DDIP 1P74A 1NM5A 3R6DA 3PYXA 4CMBA 2FY8A 4EEZA 1C1DA 4GGPA 1XWFA 1I30A 4M54A 5B1YA 2YV1A 5ER6A 2OGUA 4CMCA 3D7LA 3ZU4A 4W9NC 4BNUA 3PJFA 1NPYA 2E48A 1UAGA 5BR7A 3UF0A 3O8QB 4BO8A 2ZTLA 4AJKA 1FDSA 3ZWMA 5MGBA 1G0NA 2P4HX 3RFTA 3RUFA 2EWMA 3V2GA 3EZYA 5AVOA 2HSDA 3GUYA 1KC1A 3EVNA 4UVIA 4DWVA 3PJDA 3DOCA 4CR6A 4ZGWA 1ZNQO 3AW9A 1VC2A 3LLSA 1QP8A 2WD8A 1A4UA 3HDHA 5KVQA 1J4AA 2NU8A 2YZ7A 4F6LA 3LF2A 6ADHA 1PS9A 1ZKMA 4J91A 1R4NA 4FIZA 4RCVA 4ZHSA 4RGBA 2I99A 4J3FA 3GN2A 1XLTA 1NWHA 4A27A 1MC4A 3L4BC 4YAEA 5I7EA 1U3WA 5CPFA 5K9ZA 4EJ0A 3D3WB 5C7OO 3BIOA 4HNGA 3DBHA 1YH3A 2JAHA 1HLDA 9LDTA 2HJSA 1VKOA 1XELA 2E37A 2NVUA 1AN9A 2CDBA 5AXAA 2X8LA 3PXXA 4YRAA 3TRIA 5CDTA 3PWKA 1NPDA 2H63A 1VL8A 3B70A 3OIDA 1DIAA 1WMAA 3NEPX 3KB6A 4XCVA 3H5AA 4PLGA 1KYQA 1DC4A 3NT4A 1HDGO 3ETGA 4OHUA 3V1UA 3VZPA 2C7GA 3SBOA 1LLQA 2W2LD 1O94A 1SOVA 3GGGA 3K73O 1XU9A 4BNGA 3E9MA 1U7TA 1YBVA 4I9UA 1HTBA 4BKUA 1ZMOA 1EEHA 4CM4A 1PZFA 3PJGA 3F5SA 1D3AA 2PWZA 3EW7A 1ZFNA 3ZH2A 1TB4A 3QP9A 5K6AA 1KEUA 5I9LA 2BHLA 3WJ7A 1HL3A 2WE7A 5JCJD 1BRMA 1E7RA 5I7VA 3H9QA 4R5MA 4JP2A 1BVUA 1T24A 2QQ5A 5KVSA 1N7GA 5A02A 3LT4A 2D0IA 2IDZA 2YHIA 2ZCUA 4QQRA 1JA9A 3CMCO 4YAKA 4XYMA 1NR1A 3FPLA 1ADBA 2AHRA 3KTDA 1WLYA 3FRJA 2AXQA 2W2LA 4H7PA 2R00A 2QRJA 1K89A 3E18A 3RC7A 4G81A 2I3GA 3BTOA 3HJAA 2FSSA 4CV2A 1HETA 3PGJA 4EUHA 2P2SA 2QW8A 1P45A 3UW3A 4IDAA 4FFNA 5DCYA 3F5QA 5ER9A 3H5NA 4EYEA 3IJRA 3OA2A 1K2WA 2IEDA 3DQPA 3OEYA 1LU9A 4I1IA 4N18A 4XQCA 2WJPA 4OOEA 3SVTA 3MCVA 4D0SA 1OMOA 4BQRA 5KJ6A 1JAXA 4MVJI 3GAFA 2FPGA 1ISHA 2GPTA 3NGXA 3RJ9A 3SJUA 1I5RA 1WDKA 1I2CA 4MVJP 3V8BA 4RDHA 1UZNA 3BMOB 1G0OA 4NJMA 1YWGO 3DC2A 4MP6A 3NRCA 2VWPA 1K3TA 4UVEA 2IXBA 2HMTA 3KLPX 1LRKA 1E3WB 1VJ1A 1E3SA 4OAQA 4LGVA 4W6ZA 2DUUA 1JWBB 1MFPA 2BF7A 1ADGA 3E03A 3EY4A 1QR6A 3D64A 3P2OA 4D3SA 5JY6A 3F47A 2OMEA 4FR5A 5DBFA 1N92A 4E3ZA 1PU2A 3UCFA 2GZ2A 4GLLA 1G1AA 3PIIA 4MKXA 4WNCA 1C0PA 2YYYA 1ZK1A 1Q7GA 2D2IA 2FPPA 4TVOA 4ZQHA 4K6CA 4WCDA 4Q3BA 3U5TA 4RZHA 3DTYA 4CQMB 2EJVA 4XQ9A 3TL2A 1DC5A 3DTTA 3T4EA 1I3MA 4IXTA 1XYGA 4YJHB 4I9NA 3D0OA 1U7HA 3H2ZA 1MA0A 2J5RA 3BTVA 1EK5A 4DYVA 3GUCA 1DRVA 3NX4A 5COBA 3WGYA 2P9GA 2X22A 5F1KA 3JSAA 4U6QA 2YV3A 4C7KA 4P38A 4IDDA 1NQ5A 1SCUA 3IUPA 3S55A 1R0LA 3SC6A 5L45A 3VTZA 4K1LA 1ZUD1 4CV1A 3G1UA 1P0CA 2NNLD 5IAAA 4R4JA 1JQBA 1ISFA 1DAPA 4WLVA 2BMAA 5B4TA 4CL8A 2I67A 4IJWA 1FF9A 4LW8A 4TMFA 1F06A 1L7EA 2FSVA 2ZQYA 3E48A 1SOWA 1IB6A 4E2ZA 2AEMA 3F3SA 5ES3A 5TNXA 1GY8A 1PSDA 2JAPA 3DBRB 3FNEA 1IULA 5JPIA 1DFGA 3PHJA 5CG2A 3Q9UA 1YOVB 2AEFA 5U4QA 2W4QA 2IE0A 4CMHA 2CF5A 3GVPA 3PPIA 4OOFA 4JGBA 1X7HA 3DHEA 1HYEA 3JYNA 4BNMA 3DFZA 4BO2A 4CMJA 1E7SA 3PDJA 2JFFA 4JJGA 2JD0A 3P7MA 3R1IA 4YB8A 3OIGA 4J1SA 3M1AA 4ND3A 1PGJA 5L40A 4WK6A 3I3OA 3F4BA 4GMFA 2EP7A 1GEEA 3ZWYA 4D3FA 3ZU2A 3G1TA 4J0FA 3ABIA 1T2DA 5JYDA 2VHVA 3AUAA 4BVAA 4WGGA 1GQYA 4BKRA 5JFOA 4EGFA 4YDRA 1OC4A 3W1VA 4XYLA 3CINA 5C7LO 3JD4A 1SEPA 1Y8QB 1TT5B 1DHRA 1IYZA 1DDOA 1PZHA 4E30A 1B26A 1HRDA 1XCBA 2VT2A 3WWYA 4QEDA 5L4LA 1WVGA 2ZYAA 3TF5A 4ZRMA 4XGNA 1FXSA 1C3VA 4J1TA 5CP8A 4RQTA 1DXYA 2EGGA 1EZ4A 4CM3A 3EUWA 4JK3A 4II2A 5L9AA 1EUZA 2HRBA 3WICA 2Q3EA 4QFCA 3NAQA 3MJEA 4L73A 1QMGA 1IZ9A 2C82A 3C1TA 4XJSA 3U09A 2AQIA 2PGDA 1V8BA 4L75A 1ISIA 4DREA 3BMCB 5JW6A 1A9YA 1LDYA 3WQRA 1YL5A 1AHHA 3PWZA 4J43A 4EW6A 5A1TA 2IZ0A 1DRUA 2RH4A 3QIVA 2OO5A 1PJLA 3K92A 3GN1A 3WBBA 4ALIA 3BHJA 3HDJA 4PLHA 1ONNA 2UYYA 1JDJA 3ENNA 4R3WA 3V5NA 5U9CA 2QG4A 2O7QA 5JAMA 1OBFO 1UDBA 4DBVO 4RDIA 2DTXA 3UN1A 1AHIA 3AY7A 3S2GA 4D44A 1IHYA 1X1EA 2X0NA 3GAZA 4LRTB 3JQ8B 4XYEA 3KUXA 3OQ6A 4II3A 1Z45A 5BNIA 2G0TA 1MXHA 1BVRA 1XIVA 5AQ1A 5IXYA 4NBUA 4I5DA 2WSBA 4CLHA 1R0KA 1WW8A 3I5MA 1TVEA 1QORA 4PLZA 1LDEA 2V65A 2WDZA 2X5OA 3DHYA 1F14A 4DRYA 1R6DA 1U2DA 1KS9A 2YFQA 3VH1A 3FTPA 1UH5A 3ZV5A 3IJPA 3QWIA 1P33A 2AQKA 2PGLA 5G0UA 4LCEA 3GMSA 4S1VA 4RORA 5A9SA 2GLXA 3HFGA 2VYND 4R41A 4URFA 1ISMA 4MVJF 4RV9A 5JO0A 4GX1A 2VZ0A 3HUDA 5K0ZA 1PEDA 4QT0A 1WWKA 1BW9A 2O3UA 3RSHA 2QRKA 4EUFA 4IIVA 2YDXA 2JCVA 3WTCA 1VRWA 2GRAA 4D42A 1WMBA 3CTMA 3ONDA 3Q6IA 1RYEA 1DIGA 5JC1A 2NTNA 1UP7A 3DR3A 3L9WA 3V2UA 3VZSA 4E5KA 1P3DA 2PD4A 5KCZA 5JMPA 1DEHA 5AYVA 1AXGA 5IN5A 3HHPA 2QIOA 4YJDA 2ZQZA 3ZWCA 3GF4A 5H82A 1GYRA 1ZJZA 3JQ7B 1M6WA 3WDSA 3H9UA 4ALKA 2PKQP 3LQFA 4YQYA 3AY6A 3BYZA 1Y8RA 3GGOA 2NU6A 1R4MA 2VYNA 4FFOA 3W4JA 1LUAA 1PJBA 3RUHA 2H1SA 1E3EA 3VZRA 1WZIA 3HNPA 4DPKA 2GASA 1U3UA 4ND2A 4LRSB 3WIDA 2EERA 4NJOA 2A92A 3PYLA 1PJSA 2EG9A 4PG8A 1JW9B 1D8AA 1A72A 1B2LA 3K2EA 4ZQBA 3WYEA 1JVBA 5DCWA 3AY3A 4QFDA 2Y05A 1GUFA 2Q1TA 1NHWA 1GV0A 4FQ8A 5L3ZA 4CMIB 2VWHA 1LDMA 5KTKA 3ZWAA 2HQ1A 1W8DA 4XDZA 4M49A 3RUEA 2GNAA 2W2KA 4OXYA 4QO8A 3D5QA 4S3MA 4HV4A 1X7DA 4YR9A 3H5RA 4BO3A 1DBVO 1ULUA 3DO5A 3FNGA 4NDNE 2ZYDA 3OQBA 1WXDA 4WUVA 3JD3A 4PVCA 1UAYA 3PQFA 4BO5A 4IGEA 5IN4A 4GKVA 3KYBA 4HBGA 5FI5A 4FFRA 3TFQA 4U7WA 4CQLA 1VKNA 5I8WA 3KZVA 4LVCA 3E1KA 2PFGA 4FFMA 3PHLA 4AJPA 2X1HA 4PRKA 5JY1A 1UDAA 2F00A 5FI3A 3DBLB 3FWNA 2IYPA 5DZSA 3IKVA 1YB5A 3I9KA 4DL9A 1HZZA 3GVIA 4NBVA 4WEOA 3U4CA 4P4GA 5EMHA 1ONPA 1B8PA 2PZMA 4DPLA 2I76A 1R16A 2Y1CA 3ETEA 4YRBA 1KVUA 4P22A 4R1UA 2GZ1A 4NFSA 4AJIA 4MP8A 4ND1A 3DMTA 3S2EA 4B3HA 1PL7A 5JS6A 3WIEA 4IJUA 2NV6A 4JCOA 4AJEA 4GGOA 2C2XA 3IDSA 1RM5A 2QRLA 2WD7B 3U49A 3RBZA 2X58A 3I4FA 1W0CA 1NQOA 3R0IA 4ALLA 4IY1A 1KBZA 2JHFA 2X9GA 3KEOA 1HE5A 4LN1A 5TLSA 1PGPA 4Z0HO 2XF8A 3QVWA 5L7WA 1JWAB 2D5CA 3WYBA 4E5PA 1ZXLA 3RIHA 1UDCA 2DAPA 1TA4A 3DHNA 1O95A 4GSLA 1V35A 3OJFA 1ENPA 1LEHA 3CMMA 3C1AA 3JQAB 4E2XA 1QSGA 3RI3A 4RVHA 4A26A 1H6AA 2J6IA 4LMRA 1K6IA 3VC7A 4GI2A 3OJ0A 4XZ3A 2O3RA 3DMYA 2YHUA 4Q39A 5JC8A 2PNFA 4PLTA 2B83A 3I23A 2BELA 3ADOA 3L6EA 3MJVA 3GVCA 5F1PA 3PVZA 1CWUA 3ZNQA 4TVBA 3GFBA 2GGSA 4GPD1 5ITVA 1N5DA 3PP8A 5TIIA 4J0EA 3RFXA 3ZI0A 4Z6KA 1SB9A 3FPCA 4DMMA 3QE3A 3AU8A 1DFHA 4CR7A 5BNTA 3EYWA 2FN7A 2NTVA 4CPDA 3GG9A 3ZV3A 3HG7A 2VHYA 3WMWA 4ZICA 4J7XA 1LNQA 3LT0A 5HWSA 5C37A 3RAJA 1TEHA 2X0IA 4B3JA 3SLGA 3WJAA 4GX5A 3ZU5A 2TMDA 3ZU3A 4U0JA 4AJNA 1PJ2A 4N5NA 3VKUA 2O7SA 1Y1PA 3GDOA 2DFVA 4RVUA 2NU9A 2Q99A 2AMFA 3ITKA 4C7JA 1UXKA 2QZZA 4L0QA 5L53A 3U4IA 2WM3A 1QYWA 4YYZA 4IQ8A 3AI3A 3GDFA 4R69A 4W9NA 5AXBA 1N9GA 3NV9A 3ANMA 5JO9A 1P9LA 4G5HA 4NIMA 2O4CA 1CETA 2V6GA 3GOHA 4Q3AA 3WYCA 4M1QA 3TJRA 4BNIA 3QQPA 4DLBA 3GG2A 4UEOA 3GT0A 1U8FO 4KUEA 2E6UX 3DXFA 4RO0A 1MP0A 1VE9A 3DEYX 2NVWA 3DZIA 2Q1WA 2VNSA 4AJLA 3ZNPA 3PQDA 1O6ZA 1GCOA 3QVTA 4Z3DA 4BS9A 4O5OA 4CUJA 4P4LA 5BSFA 3LZ6A 1SC6A 1X7GA 3KBOA 2NADA 2AW5A 3D5TA 3U0BA 5BSHA 5B4UA 1Q0HA 4RZIA 4DIOA 3L9XA 1MV8A 1I33A 4MDHA 1FK8A 3RD5A 1A4IA 5B4VA 4TWRA 1IPEA 3JCZA 3L4BA 4GWKA 1O5IA 2O3TA 2J5KA 2UVDA 1BGVA 1ZBQA 4JP3A 1PL8A 3TPCA 4XKJA 4DC1A 1X13A 1I24A 1BXGB 1ZSVA 4YAGA 1R15A 1U5CA 4A2CA 1Z82A 2HU2A 2P5UA 2DKNA 2VUUA 1T1RA 1W4ZA 1ZK0A 1H5QA 3TWOA 5ICSA 2NUAA 3FR8A 2J3JA 3AU9A 1N7HA 3H3FA 4OQZA 3OSUA 1E6UA 3BAZA 2C5AA 3INTA 2ZJ1A 3KM0A 5T6BA 4IDCA 4MVJM 4P4NA 1BSVA 3GNQA 4RVGA 4WCFC 1E6EA 2EW8A 2GN4A 3JQFC 5JDCC 3ZV6A 3K9QO 3NKLA 4NBTA 4KDEA 3A1NA 2DFDA 3RUAA 3ZCXA 3QA9A 3PZBA 1KIFA 1Y9EA 1Q7CA 3RFVA 1FMCA 2E4AA 5GMOA 3RJ5A 1NBOA 3BMOA 1GTMA 4CM8B 1I8TA 5IDQA 1M66A 3F46A 1Q7BA 1KY5A 1YO6A 1E3WA 4HFMA 1NHGA 4CM9D 4FS3A 3HN7A 4M55A 4E2WA 1LI4A 3QV1A 4L4XA 3WS7A 1I10A 9LDBA 3RASA 2FZWA 4IDBA 2X0JA 1U3VA 3V1TC 1VI2A 1H6CA 2NVBA 2OOSA 2W8ZA 2BI7A 3FNFA 1C14A 4BO7A 2Y67A 2DBQA 1HXHA 1P1HA 3JQ9C 1KEVA 1YJ8A 4I5EA 2OP0A 1PQUA 4CQMA 3DZJA 4ZQGA 5LDHA 4J4TA 3AUTA 4YJHA 3ZV4A 1X1TA 1W73A 4RVFA 4YACA 4O59O 4Q3EA 4QSMA 2G82A 2X5KO 1ZW1A 1ZK2A 4WOJA 3H2SA 3RC1A 5KVVA 3OHSX 2DQ4A 4Y67A 3H8VA 3O4RA 1I0ZA 3Q2IA 4J2OA 4NI5A 2YUTA 4CM9A 4ID9A 4OQYA 4WCFB 4XEHA 3ADPA 4CLXA 1AGNA 4EJ6A 1GYQA 3SEFA 3GGPA 5A06A 3AOEC 4JIGA 1NX6A 2JFGA 5EQFA 5HRUA 1T4BA 3UVEA 3RWBA 1NR7A 4YT4A 4MVJG 4FC7A 2UUPA 5LC1A 3DBRA 3NTQA 4BNKA 2FP4A 1DB3A 1HDRA 3W8EA 2Y1EA 5U1PA 1B3BA 3SC4A 1E1LA 1RJWA 4O6VA 3ANLA 5CEEA 2PR2A 5TF4A 1KY4A 5TQVA 3MJSA 3I9MA 3VPGA 4KWIA 2FOIA 4MVJH 5TSDA 4CLRB 4IDEA 3DDNA 2NLOA 5IDYA 3O26A 3WLFA 5TJ9A 2JKVA 4RPHA 3KLMX 2OORA 1LBEA 2XPCA 3G0OA 3NDRA 1HE2A 1HDZA 1PJ4A 5G2OA 4BHTA 1C1XB 3KYDB 5A03A 2HK8A 1UJMA 1EQUA 1YL7A 4XJTA 1V3TA 3F4LA 5JDIC 1HDXA 4B3IA 3BTSA 3DBVO 1K6JA 1QV6A 1GEGA 6LDHA 2O48X 1Y8QA 3H7AA 4J1QA 3H9EO 1TT5A 1UP6A 1PJQA 4GX2A 2HK9A 4E5YA 3KYCB 3DZBA 1TI7A 2D5AA 3TZ6A 5C3MA 2HMUA 1V3VA 4YXFA 3UFXA 4JXKA 2I6TA 3HFSA 2EV9A 2HMVA 2J3HA 4Z0PA 3CZMA 3IC5A 3G3EA 4DIFA 4O63O 3DAPA 1NVMB 1IUKA 1HE4A 2VOJA 4JROA 4DBZA 4EBFA 3BMNB 2OBYA 5TX7A 4JBIA 2DTDA 2A9FA 4PZDA 5G0TA 4OIMA 5EN4A 3I6IA 1K0UA 1ONOA 4TKLA 4DUPA 4CUKA 4PCVA 2NTJA 3W8FA 5IF3A 1E3IA 4FC6A 3D1LA 1C1DB 1U8XX 5B37A 3QWFA 1VLLA 4I08A 1NAIA 3BMCA 4IQGA 2WMDA 1IOLA 3WFJA 3P5SA 4XYBA 4BGUA 3AJRA 3CSDA 3QLJA 4R9RA 3WGIA 1H6BA 5DBGA 4CODB 3O38A 4E31A 1V9LA 1SB8A 3MJCA 4NH4A 2HRZA 1B8UA 4XRRA 2F1KA 3FBGA 1JN0A 1PIWA 3GR6A 2Q45A 5KVCA 2B4QA 5TT1A 3N7UA 4FN4A 4TZKA 3OBBA 3WB9A 2CUKA 3D4OA 3EK2A 4FPXA 1CIVA 3JQ8A 4HNHA 2O3QA 4BO4A 2Q1SA 2HK7A 1TXGA 2ZB8A 3VH4A 3MOIA 5A05A 1GDHA 1P1RA 2VRBA 3RCBA 4RVDA 3RU7A 1DRWA 4CMGA 4E32A 2TMGA 3WNVA 3DBHB 3EZLA 1B14A 1EE9A 1M75A 4W7HA 5JAQA 2Q2VA 2G76A 3JQGB 1XU7A 2Z1NA 3LYLA 2NVUB 4EZBA 1DIHA 1ZIDA 3K2BA 1FDWA 3ZHZA 1SMKA 1ENYA 1PZEA 1X14A 1ENZA 2ZCVA 5EQDA 3WGGA 4LMPA 3JQCA 1PGNA 4PLYA 3OJLA 1PWXA 2D8AA 5T57A 2VTDA 5AOVA 3UCEA 4J2HA 3MWEB 4ZQFA 3TN7A 1GZ3A 1F8FA 1YGYA 4UUMA 4YA6A 3Q0EA 1GV1A 3V1YA 4I5GA 5G0WA 4DTIA 1UP4A 1DPGA 1Z74A 3FCOA 2PGJA 1PJTA 1SZJG 3GEMA 2HDHA 3QWBA 4OGWA 2DT5A 1MG5A 1NQAO 3OA0A 1B3RA 5JLAA 5KJCA 1X0XA 2XXJA 3W8DA 5IFLA 2W98A 2P91A 3JQ7A 3NGLA 4D7AA 3ASVA 1GQQA 2QZ9A 5HA5A 5CEJA 3BHMA 1FDTA 2DM6A 4ROSA 1YQGA 3WWZA 2ZTUA 3T7CA 2BKAA 1E7MA 3ZHBA 3KETA 3WQQA 2B0JA 2GF2A 1NFQA 4GH5A 3WBFA 1E1MA 2VNAA 1IZ0A
chains in the Genus database with same CATH superfamily
5KOHA 1VP3A 4ZT3A 4DJJA 3KHSA 5EKXA 1K4KA 3BGSA 5TY0A 4RTJA 1EK0A 1CE8B 4G4SP 1KZ9A 4OCZA 4PLWA 3BILA 1EFPA 2F1JA 4XIIA 3T4XA 4IYRA 1SCQA 1E3DA 3FZNA 1HKUA 4YT5A 1HNZE 2X13A 5B3JA 3RH0A 2GF9A 1O96B 4CMIA 3CW8X 3T7TA 2QQEA 2Z83A 1C81A 1DKOA 4IJKA 2BFCB 3SHWA 3V8EA 3NANA 3ZWOA 1RZRA 1G8FA 4YMSA 3BWDD 3BSSA 2LIVA 3K30A 4DMKA 3C8ZA 3CUKA 3HRKA 2VBCA 2CVQA 4HDKB 2YTFA 3MTEA 1KL7A 1QRAA 4MQFA 4UCQA 5F52A 4J3JA 3M82A 5A4FS 1MIOB 1QIHA 2B6NA 2C5SA 2EIXA 3KXIA 1VOTA 2R97A 1F2UB 3FMIA 1N2JA 4YJFA 5WRFA 1I2BA 1USVA 2ATCA 4HMOA 1VCNA 2QTBA 1L7BA 3AFMA 3EEQA 3HCPA 2DFLA 4G85A 4RULA 4MMYB 4F8JA 1B41A 3EEYA 2Q46A 4HEA1 2D7CA 3CKMA 2ZSEA 3GELA 4MOWA 3A1VA 2Y1DA 2JJ2A 4GP7A 1FXWF 4R5HA 5HF6A 4OV6B 3ROMA 1XDBA 2MDGA 2CD9A 4G65A 4DNOA 2RCNA 1T0BA 1PUIA 4YUAA 1LPAB 2WWVD 2VQ3A 5EQTA 4RGVA 3AVYA 5TRTA 2XWBF 1NSYA 1TLLA 1I6WA 2B61A 2RKWA 3WWDA 2XD9A 2QRVB 3X2FA 1FVHA 1I4DD 3AZOA 3FVQA 3T54A 3NASA 2DTEA 1YA6A 3KTAA 3UH1A 4G36A 2QYOA 5K8IA 3WSWA 2XWQA 3WJ1A 3O92A 4CNQA 2Z9DA 1L6RA 1YCFA 3TL6A 4NEQA 1UXIA 4LF4B 1V1RA 4K0KB 4M0KA 3HUTA 3RUIA 3DNPA 1JDZA 2B7LA 4I8DA 1E1YA 3R3ZA 4NH0A 3FPKA 3C8UA 3EGOA 5B30A 3F5FA 3AR4A 5AK0A 4WV3A 2RMKA 2AQ8A 1OYWA 4DAOA 4IV5A 1Y5RA 2GESA 3H0CA 2BKLA 2J5QA 3BGHA 1R0YA 3FNIA 4B6JA 3F6HA 3QPDA 1C3JA 1DRJA 1KYZA 1JPJA 4RKRA 4EKIA 1FYFA 2Q21A 4DABA 1DSSG 1SCUB 3CB2A 3GA5A 4KQIA 1XMQE 1A98A 3QLUA 4YECA 5DIFA 4U6NA 1TYEB 2F48A 2NO5A 3EPHA 1VMIA 5J2TB 5HZHA 3KJEA 1HYHA 4US0R 2O4UX 6ABPA 4MV4A 3D4BA 2JARA 3P0EA 4I6GA 5D6NA 1Y9JA 1XVTA 2C83A 3D4NA 3E5MA 5KYWB 1KRXA 1J00A 1H0KA 4KO2S 4NYMR 2ZXUA 4G3XA 4PHHA 3RC8A 4ZCIA 3QE9Y 4PTLA 3AXTA 4H0FA 4KLZA 3CWCA 5HFAA 2CVZA 1N0HA 4H0NA 4DXDA 4X65E 2XHZA 3T7AA 2PD3A 2DBRA 2AUMA 1H3FA 4LYHA 5H1YA 2DFTA 4KE6A 1ECLA 4OMFG 2UU9E 2GI4A 2Z4TA 4WOKA 1USWA 3QMPA 1T91A 2JH8A 3H1EA 4KC0A 4NVRA 5KHLB 2ZYVX 2I2BA 1JQDA 1F6DA 4EGSA 2VJPA 2RCYA 4KOAA 4E21A 4W99A 2OPHA 1Z7GA 1N2BA 3D6UA 1JMKC 1NY6A 2XW6A 4FFBB 3IMCA 1I4EB 3OEHA 1TM5E 4PRLA 4C0BA 2C61A 3WMFA 2WCC3 1JPUA 1KY2A 3FNQA 3Q87B 1DUIA 4DV4B 4AZ3B 1Q3HA 4X9JA 3CPSA 1BN6A 1QBGA 3N8HA 2ACWA 3DVQX 1FUEA 5G4KA 4FDLA 5DTQA 1XTVA 3DB2A 3UGJA 5IZ4A 2Q3HA 1EH5A 5AJZA 4ZZ1A 1SUSA 1J8QA 1Z0IA 3P9SA 2Q5QA 1UK6A 1T6YA 2OZPA 3V4PB 4PVDA 1QTRA 3NHKA 3STXA 2KE5A 4XLZA 4KQ2A 4J76A 2QTNA 3U7RA 3EEOA 4LMAA 3AINA 3OFNA 2HA7A 3FOBA 2GJAA 2HM7A 2R62A 1QGED 2VHUA 1Q6YA 3GA0A 2GYYA 3G9QA 3QUAA 3DPIA 5DNEA 1EVJA 4IMPA 2UYOA 3COPA 1ZONA 4EMSA 3J7AC 2AMJA 4YJ2A 1EX7A 1TKRA 3UICA 2C9MA 4OQMA 5JVDA 1KI6A 4URVR 2GEBA 3EXFA 4L0DA 2VPZA 3ORQA 3MUEA 1T2NA 1ARZA 1ORWA 2OBBA 4PZPA 1QIGA 1O87A 1F2TA 2YDYA 2H2AA 3CXRA 3ZDYB 2CFSA 3IA2A 4ARUA 4JP1A 4LFAE 4EQ6A 2BI8A 3AR9A 4JEIA 4L0MA 4L28A 1XCMA 3TEFA 3EPJA 5C34B 4V0ME 3R20A 5L95A 1WCXA 2OZKA 4PNHA 4QREA 1JZSA 3FCAA 2OFFA 1KYXA 3HU1A 1ULHA 5LYYA 5FKJA 2O0HA 5CVDA 3PEWA 2J0SA 3B53X 2E82A 3I83A 3UA3A 4E46A 1DC6A 2TMKA 4LKRA 4JYMA 5ALOA 1EE2A 4WN9A 3HSSA 2GEDA 3S28A 4TWJA 4B4WA 4EO9A 4B7AA 2ZBRA 2OAQ1 2E9SA 1YGPA 2I4NA 3GUVA 4YRIA 1J22A 1L8LA 1T4GA 2RH5A 3DXYA 4HXYA 4FYWA 2B20A 1HTWA 2Z5FA 4JSRA 5KSZA 2QN2A 3OM8A 3LO5A 2BHSA 1L4GA 2EE8A 4XQ0A 5FFFA 3VYYA 2HIGA 2VO1A 4PO1A 2ZTVA 1JDSA 4BLPA 2XI4A 3MAGA 4IJVA 4UOQA 3FLAA 1YZUA 3KOWA 4LXTA 4MP3A 3CWZA 1AKWA 4NDZA 4REOA 5DBIA 3Q5EA 3H5WA 3DDUA 3D4IA 4TTVA 4BMNA 5LMZA 4RF4A 3HVKA 3LDFA 2I4RA 2V7UA 3ESAA 3V2HA 1IXYA 5JXWA 4B81A 1TK2A 3EF0A 1DP4A 4HDSA 2DY1A 2QAJA 3HYNA 4A10A 1GILA 2G04A 3EMKA 3IBGA 4P4SB 3FLEA 4GSKA 4HMQA 4M0PA 2X8JB 3IVCA 3L8CA 1PFWA 2R1VA 4FKZA 4IIEA 3WL8A 2WJ6A 4DVJA 3I1JA 1F6WA 2HTEA 3NTRA 5BW6B 3DE6X 3FCXA 2YOFA 4H15A 2C3PA 2GZ3A 5DI9A 3KP1A 3Q1LA 1X5WA 2JLBA 1LBHA 3MPOA 4W4TA 1KYVA 2PS1A 1BH2A 2E1PA 3STHA 4BL5A 1LXCA 5HYVA 1AKEA 1YSAC 3TZHA 3QIAA 4WEQA 3DM5A 5ALEA 4ZAXA 4ZRNA 5BYAA 1GSOA 5JCOA 4M89A 4JJEA 3VU8A 1M72A 2EORA 3DHVA 5LXTF 2QRZA 4MQ4A 2YHAA 2AKEA 4L4ZA 5LOVA 1Z0SA 2EX0A 5I3CA 2YTGA 3AETA 2WICA 5ECWA 1FU4A 5FPPA 1DMSA 2D2XA 3PF9A 5C18A 5JSUA 2ZUFA 4ESOA 4DLAA 4B1FA 1QO9A 4WVFA 3VPCA 4IMJB 1EUCB 2B2NA 2NZJA 2VQDA 4FMDB 3QA3E 3WZMA 4CM8A 2BBWA 3M1YA 1GPBA 3A9TA 4DQVA 1RWPA 1BEEA 4OSPA 2BEKA 3PQ4A 1TJ3A 3OI7A 1N8NA 4KLAA 1AIPA 1R0XA 3MWJA 2OGWA 1NG9A 4W1RA 5HQTA 2EMFA 4U7TB 1Y7TA 1Q11A 3ORRA 4H7IA 2QUJA 1HDCA 1QK4A 5LB2A 1G21A 1IUOA 1RM0A 2R8PA 2WSLA 4LEIA 2KQUA 3ZV7A 4DLRA 4EF4A 1OLOA 1DADA 2QA5A 2Y1XA 3ND7A 1V96A 4FOSA 4TTAA 5KJFA 1MX1A 4G0UA 3L5KA 2EQ0A 1TU3A 3HXMA 1ES9A 3L41A 5F5NA 3TMAA 4V1CI 4AS3A 2D54A 4E22A 5BVHA 2AJCA 3LQQA 5TMEA 4E08A 1QS0B 1CVIA 5CXQA 2VKQA 1GSHA 5F7XA 1M1XB 2BDUA 2P30A 3K8ZA 1AG9A 2ZUUA 1WP9A 3EXG2 1F60A 2ZJ5A 4ZQCB 2GHRA 4IO0A 2C5EA 3NOOA 4KSBA 4E4YA 2IC5A 1H2EA 5I8PA 3IMGA 4Q28A 2J7PD 4TVKA 2VYCA 4ENTA 2DZDA 3C85A 4HUQA 3KPWA 5JD5A 3FWHA 4WCFA 4QBGB 4P2GA 2E5FA 4R6WA 1VJTA 4ALNA 4MQMA 2ZULA 4GE3A 1LSOA 1VB3A 3OIYA 1FJGB 1T2AA 3PGXA 3QPCA 1GGFA 4Y2PA 3RWMB 2E1MA 4JI5B 4D6PA 1Y89A 2CNOA 4R7GA 2D06A 3B6KA 3M1LA 3MOSA 3VO9A 4CFSA 4W7SA 3TQHA 4GPEA 3FHLA 1CZNA 1UFOA 2QN3A 2TMYA 1EDZA 3FA2A 2QUAA 5CVEA 2GSWA 5EXSA 1RRKA 1NW5A 2IKQA 2PFKA 2WUDA 3NM6B 2EYQA 4DILA 3ZD9A 5F23A 3M33A 3O4HA 3B9BA 3L1JA 1O6BA 3RS4A 5CLQA 4WY2A 5BWBA 6Q21A 1LDNA 5EWMA 2CL5A 1NRJB 3IQIX 4LZPA 1QRSA 4KKXB 3W34A 1WKCA 1LA2A 4HLUC 1AZWA 2GX6A 2VSOA 2Y1WA 1U1CA 2YIVX 4MUYA 4V2IA 2O8FB 1PR1A 4RPGA 1TRHA 4KQFA 2SKEA 3HR8A 3LT2A 4TT8A 3ZWDA 1XRLA 4BMXA 3OPYA 4B2YA 4AIRA 1QB8A 3JQ9A 1VYUA 3OTQA 5GADl 5LLSA 3UJ7A 1ENOA 1PT6A 1KOFA 3W6UA 4X6YA 2C0CA 4FGSA 3R3WA 4MA0A 4UBIA 4EB0A 2VP6A 2FR8C 2ORIA 2FNAA 4OMUA 5HE8A 5DWDA 3MMSA 1E2PA 3D2LA 1GQ2A 4HQLA 3O1LA 2XX3A 5JH7B 2ABWA 3FUVA 4HYYA 5LIPA 3N87A 5ALJA 1YU6A 2PNJA 4DIMA 1JV2B 4XFKA 2YQ5A 4ER6A 4Q3DA 4H77A 2XMQA 3DNMA 4DE5A 4GUAA 1A4XA 2VYVA 4RJIA 2EM4A 1SBZA 3FI9A 1QX3A 2QPLA 2OUIA 4I14A 1UXGA 5DLEA 2PIAA 3TBHA 5K3OA 2XIQA 3KZCA 4JI6E 3V55A 4BQFA 5I7UA 4C2UA 3UXMA 2E72A 1T2FA 2C92A 1PD0A 2X8WA 3AOEA 4KWHA 3GRKA 1Y8CA 2RHRA 3V7FA 2IDJA 2WV7A 4R31A 3SR3A 2W00A 2P62A 2PSHA 5GZ1A 1BKSB 5G3YA 3WISA 2WTXA 5ENVA 3NFYA 4WHMA 5IZCA 1REQA 2CNDA 3CRW1 1I3NA 3QVXA 5ECYA 5EJ2A 2OCLA 2ENCA 3C3JA 5F2OA 2RH9B 3PTZA 2FMTA 3INNA 4EWLA 4FMCF 1PT9A 1NATA 1I6MA 4WLOA 5E3JA 3X43A 3BZWA 2B69A 2BI4A 3ID6C 1PDWA 5DULA 1U4OA 3KD3A 5JYBA 1RHKA 2JRCA 2YJNA 2A1IA 4BOYA 1N7JA 3VMFA 1N1EA 4KZKA 3SPXA 2VH1A 2FAXA 3LC1O 2JGEA 1PQ4A 3NVAA 4HLCA 3RIGA 4DIEA 1Y1TA 4F5EA 3OZUA 5LZ4A 1Z6AA 3NI2A 1DAMA 1ZHOA 3K9GA 2C04A 2H4HA 4L4YA 1E0AA 2A35A 1FP2A 1QFMA 2WSYB 3T5MA 3GP8A 4KMSA 3KS9A 3DV0A 1IY1A 3F5DA 1G8MA 2IUUA 2ZETA 4EGCB 2XBUA 4AL4A 1X1BA 1VMKA 4WN3A 1KEWA 4TUYB 3TZQA 2QUHA 1L7NA 5JDIA 2JC3A 2ZROA 5HS4A 5K03A 4FEYA 1IBRA 1XRQA 1K5HA 1YQDA 3HI6A 3PNSA 3WLLA 2CNNA 1MEJA 2I87A 4C4RA 4EAQA 3W3AH 2BGNA 4LWZA 2ZR7A 4JBNA 1CNMA 5JQGB 1I2MA 1PTJC 1ZXBA 5HZMA 3UK3C 3PFFA 2JJQA 2M6LA 1F1JA 4EG8A 3K6JA 4ZXFA 3AMVA 2P6PA 8ATCA 2VF8A 3C97A 3LAWA 4P8RA 2HIAA 4YRJA 3RC9A 3UMGA 4P5EA 4O2AB 2VHXA 3KZZA 3H4VA 4MWCA 4G0QA 4AX4A 1Z07A 5DTMA 4BHCA 4AJJA 2BTOA 1LSJA 2E5WA 3JQGA 2FLKA 4N6NA 1CEQA 1W88B 3BRWD 1IM2A 4L6IA 2UUBB 2EN7A 3H65A 3LRPA 1T15A 2Y2UA 4QDOA 4B7UA 4O0LA 1AOXA 3TDMA 1CQXA 4D9MA 3IL2A 3DVRX 4HGNA 2ZSDA 5A5EA 2FPOA 4DV7B 2O1SA 1VLHA 3LPDA 4YMTA 3AXSA 1PJAA 2ZT8A 3AVWA 3FI0A 3DWFA 5BWCA 4DV1B 2HLHA 1D2EA 4CQJA 2Y93A 2ONJA 5DYNA 2PN1A 2ZYGA 3MQFA 3ZU6A 5I47A 5GIPE 3I1IA 1WF3A 1Y7PA 4ITRC 1Z28A 3A04A 3ABZA 3GNTA 4R51A 1W34A 4DRZA 4YT8A 3N9IA 4PG7A 2QSJA 3SXPA 1M2VA 2BC9A 1G20E 1VLMA 4GEQB 2CDCA 3FYDA 4U3JB 5AKGA 4E5KA 1I3KA 1Y5LA 3R3VA 1PI3A 4D4MA 1XZKA 4FYIA 4HRAA 1OAAA 1HM5A 1QB7A 2BIFA 1RQ2A 3IOYA 2WA1A 1A7AA 1H1LA 2ZJAA 4MUGA 1DV1A 1GNTA 4NBRA 3ZEAA 5E0OA 4DIUA 1ZZEA 4W1PA 3BE8A 2PRZA 3LT1A 4NS1A 4L5NC 5D85A 2EKPA 1A3CA 2OBNA 1WABA 4EJMA 4QU8A 2WE8A 3QI2A 4RMHA 4NXNE 1QLHA 3I9NA 4BX9A 1KFJB 4M7PA 1SIOA 5KJEA 2AZXA 2QF7A 3CX7A 1R6AA 3HV2A 4HNAB 2D6FA 1RWMA 4U9HS 1M1NA 1YBFA 1KSGA 1Q1ZA 2C20A 3B48A 3QVUA 3VISA 3LHFA 3VNUA 3PKZA 2EMCA 2YH2A 3EPKA 3LNCA 1LPBB 5FUXA 5B6PA 3LDHA 3TLEA 4YJ2F 3KPVA 5B58T 4CWAA 2XB2A 3H5LA 2FUKA 2G0NA 3ER8A 2BJWA 2C2YA 3NDIA 2FX2A 2VDRB 4ZWNA 5D5HA 1B7GO 3AOGA 1A1IA 2PA3A 2J4CA 3H75A 1RMTA 4OQDA 2FQQA 5DT9A 4EY4A 5CBPA 5ELXA 1R0ZA 3IJEB 3BXZA 2J9YB 3SYTA 1SXJD 2AEJA 3OEED 1FW8A 5LMUE 1FRFS 1KMCA 2ZJ3A 3THOB 3DVAB 3K5HA 3P20A 1DJQA 1M33A 2FEKA 1FUYB 3LLHA 3A2LA 4TTPA 4W7IA 2D0DA 1DLJA 1Y6GA 2OENG 3BA1A 1JTFA 4YXWD 4ACAA 3U7JA 1O94C 3SY8A 4BGDA 1SCBA 3RSZA 4OU4A 4EFKA 2O8DA 2XNCA 1MDFA 3I1YA 3C7TA 3PPXA 1GGEA 4FT2A 4N0QA 3C8MA 1RI4A 4ROTA 3Q2OA 1A1KA 4YP0A 3IUSA 5EUMA 1R6VA 4D3ZA 4C5AA 3U3DA 3WBKA 3N0TA 2KYRA 3AONB 2Q2OA 4NX2A 2JFQA 2A9RA 4ZOQI 3CIFA 5CX1B 3N2KA 2ZAMA 4MIOA 5K0NA 3OQPA 5DRYA 5K6AC 2EG5A 2A8YA 3UMMA 2H1OA 2B5OA 4ADSG 3LDUA 2VLBA 1TMGE 4FSHA 1SKUA 4FDAA 2D62A 4WNIA 2ZWIA 2YRXA 4PZ9A 5CFZA 4HN4B 4AX8A 3R3JA 3RTBA 2IPNA 1A2OA 3E58A 3BIDA 5JEEA 3BRCA 1C7ZA 2CLLB 5EHGA 1MO3A 1BB8A 1RXIA 1YKFA 5KC9A 1GFWA 2BISA 1P1KA 5M5BA 1S7GA 1SZCA 4HFJA 5CVUA 3BHNA 3B9RA 2ORYA 2CUNA 2FB9A 4PFQA 3UJBA 2JD2A 2WP0A 4JBLA 1E96A 2GPJA 4LJLA 3O9VA 4B34A 1EUQA 1ZICA 2ZYUX 3PFWO 2YWDA 1HOXA 4OBBA 3TNFA 4M9ZA 4UUOA 4A2QA 3R3HA 4QJ5A 3WWPA 4DW8A 1NJ5A 2C3MA 2Q7XA 4M1TA 1M7HA 5TT0A 3RRNA 2PKYX 1Z4JA 2JRLA 5C1OA 1F5SA 1GU7A 2X3FA 1GQEA 3C14C 1Q83A 3K31A 5HJEA 2YJ5A 1Z4LA 8ADHA 7MHTA 4RWZA 2ZM6E 4ZPJA 2ZK7A 3DT8A 4QOFA 5G0VA 5K3FB 4ZI7F 1JT9A 1YFLA 2HC9A 5GPBA 2FW6A 3Q3VA 4MQEA 1RHRA 3FOZA 2CMGA 5JUWA 4EHBA 1JB1A 2IVZA 2ZIXA 4U2GA 4QKQA 3SJCA 5TPWB 1LQTA 2OECA 1T2EA 3Q4GA 3A1WA 4UUNA 3WAKA 5H16A 3KELA 2HMSA 3TGPA 4CIWA 3OT5A 2R2GA 4IDFA 1PK7A 2IHYA 2D8MA 1QWSA 4IHJB 1J5PA 4TXMA 3HL4A 1OBCA 3KWMA 3R75A 3M5CA 5JQWA 2E87A 4G2NA 3UGKA 1WQ4A 5AJWA 3QBJA 3QVSA 4NCJA 1N6HA 3P1JA 4ZYHA 1RZRD 1O5OA 5KDDA 4KHPB 1YIDA 3FSRA 2R1TA 2ENAA 1N1MA 5FBHA 1AB6A 3ZWKA 4IOMA 4LHYA 3NPMA 4WNAB 3D6MA 4RH3A 1B23P 1KP9A 1KMHA 2BCGY 4WDQA 2E7ZA 5DTEA 3G0HA 2QBYB 3TM5A 1ODIA 2C1EA 2MINA 3FDZA 4O29A 4TS9A 3AV0A 3GBPA 4C0KA 4O4IF 3SHVA 3UCXA 3NWPA 9MHTA 1J25A 3GLIA 1M67A 1SAYA 5ALMA 2DPMA 3C3XA 5ERXA 1NXQA 2CPNA 4EBFA 1EXMA 1X0VA 4XD2A 2QZPA 3L8ZA 3PDHA 4DHEA 1LDBA 3E9RA 3QVGB 3NM4A 2D5IA 3PR1A 3CCFA 2GBCA 4PIMA 1A96A 4CMEA 5L3VA 1OFGA 1XMOE 2PPVA 1WUKS 1HG1A 2BEWB 2GHFA 1XKLA 1JFFB 1MJGM 4C21A 4UNRA 4R2RA 2CBZA 1WMFA 2OCDA 3ZLUA 1SNYA 3FPEA 1I3LA 5ESXA 1AQ6A 1P5FA 1DMRA 1SOUA 1QE5A 3CH4B 1BQEA 3PEFA 4R2KA 5FT9A 3RFUA 2E5LE 2DEUA 2JL1A 3O3OB 4FJ1A 4LBYA 4KR2A 1S4MA 3A2NA 4RHCA 1U63A 4HAYA 2G5PA 5SYMA 2JIZA 5CM2Z 3T38A 1O6CA 3HUEA 4N40A 2TSYB 1IY0A 3IH5A 1PKEA 3G68A 4YPVA 1TYAE 4Q9DA 3VGPA 1KKUA 3J81k 1PBTA 1ZNWA 3W5AA 2GF0A 2XYVA 5DXAA 2X0FA 5J23A 2EL6A 1W0JA 4OLJA 4A7PA 2IDMA 3O94A 4A36A 1XZEA 5DGHA 4BMOB 1VL0A 1NMZA 4AKEA 1U04A 3K6SB 3VR6A 2ZM5A 1HNWE 1G7CA 4BNJA 3DF9A 4L15A 2GCNA 4UM9B 3ENWA 1FMLA 1KJZA 2C3YA 5CH8A 4J4BA 4TRRA 5LWQA 3QE2A 3FTDA 2ZBEA 4QDKA 4TMYA 4KQXA 2WKRA 3ABQB 4HAOA 1JXAA 4YFYA 5J2UA 2RGCA 1J20A 2PDAA 5GY7A 1MDBA 1CERA 3FOCA 1EBBA 1GAEO 1QG4A 1J0AA 2AC4A 1P2BA 2FA9A 2JDID 4UOZA 3PC3A 1YD7A 2NGRA 3TKYA 3UHFA 1FBNA 3TNYA 2FWBA 3UOWA 3H0KA 2CV2A 2WB2A 2QZ4A 3TB6A 5DNDA 5CYGA 1SUEA 2V7PA 1YZYA 2OVFA 2GXSA 3C24A 1CFJA 1RC1A 3HKEB 4JQZA 1FTYA 4RA6A 4Y1RA 3OQHA 4BQPA 1T1EA 1UBLS 4LQ4A 2O2CA 4X9XA 4ANFA 1SO8A 1WOMA 3IWBA 1A5SB 1NUPA 1ST2A 2ZT7A 4MPDA 1FZQA 4GECA 4UVHA 5T8KA 1YR1A 5IU6A 2GWHA 2E89A 1CIPA 2R44A 4BVEA 3BS4A 5E1BA 2OHIA 3V4SA 3DTVD 1UFRA 4CIVA 5FP0A 4EGQA 1EVKA 5K8JB 1G8JA 4J9UE 1U4SA 1WOYA 4FW8A 5ALRA 3EC1A 1W19A 1YS2X 2QX6A 3BEOA 2XCOA 4BECA 1NN1A 1PNOA 2AK2A 2DLDA 2Q2NA 4KSYA 2A33A 4LDQA 3DD5A 3QHPA 4MRAA 2AN9A 2C7VA 4B71A 4RVCA 3R9KA 5IF9A 2IA5A 3IBFA 1MW9X 2YR0A 3S2YA 3RRYA 2G9UA 3G8CA 2CJPA 3JTEA 3M8KA 3D1JA 3MM4A 1EJBA 1Y5MA 4B8WA 4ND4A 4TZTA 4YGYA 4HFRA 3F4KA 4N7BA 3AKYA 1HDOA 2EDCA 5IJ0B 1OWLA 4AUKA 2V7GA 4KLRA 2PGXA 1EIZA 2B37A 3K35A 1Q15A 2ZWOA 2WG1A 2BW0A 2DPLA 3JVEA 4JX8A 4TROA 3HN2A 3TOXA 3LSTA 1X7WA 2ARKA 4L74A 5ALVA 4BO6A 4Y2SA 1TZBA 2Y71A 1NONA 1SU8A 3H1FA 3HCNA 4FKBA 1XQ6A 4CBVA 3NW9A 1Q50A 2B8EA 4RKYA 1QOQB 5EL0A 1ULBA 2BR5A 2Q0XA 3G5MA 3L7JA 3ROKA 2CXSA 1RE1A 2Q4BA 1YB1A 2J3LA 2NSJA 2WKQA 1V8FA 2XUJA 4N5IX 3WWOA 4DM3A 1PNVA 2UVPB 1NPTO 2BTQB 3EC2A 2J9FB 3L92A 2PUDA 4LZJA 1XRSB 2JEOA 4HX9A 1N2SA 3VYRB 4KGZA 3PUVA 2OKGA 3U5ZB 1KH3A 3PI7A 5A3VA 3EVGA 1I4TD 2H7XA 1SUBA 1S0UA 2GPSA 4F4IA 2OESA 8OHMA 3GRAA 3LQ2A 3QU9A 1C41A 1M74A 4J8ZA 4L4SA 1PUJA 3DFMA 4KVZA 3RS9A 3S1AA 2DCMA 1LC0A 1Y3IA 3AI7A 5AWFC 2P68A 4E4RA 5SZJA 4E33A 3JD2A 1H2FA 3GLVA 3AF3A 3HE3A 4X44A 2RH8A 5ESRA 4CKEB 2RKBA 3B52X 3L6UA 5G41A 2HLDA 3FCEA 4TTRA 1H9CA 3DJWA 5ALXA 1ZN7A 8LDHA 5KKAA 1OTHA 3OLVA 4GICA 1LSUA 3WRYC 4YQFA 4MR9A 4Q4JA 4CF3A 2Q4EA 4HN2A 1CRZA 3KYJB 4HWKA 1TAQA 5JWHA 4YQZA 3U4QA 3QEAZ 3L8EA 1MZVA 1PEYA 4RD6A 3EZ9A 4W63A 4XM1A 1CV2A 2GERA 2WU1A 4PXAA 4JWKA 3VVCA 3THRA 4OHXA 3MLBA 3RFFA 3ZWPA 2FPWA 4RFVA 4D3YA 3O5AA 2PE5A 1WCIB 1HNXE 2R4TA 1JLSA 3WZ2A 1XO1A 1PDVA 1X7ZB 1XB2A 4EW2A 4I3HA 2V1XA 1FNCA 2C31A 5K3SA 4HQ6A 2F3RA 1Y3HA 1AN0A 3SZGA 3W0LB 3H83A 1P2DA 2QX8A 2VC2B 5AJUA 3UKOA 4EDFA 2EDAA 4GQBA 3NUZA 4G0PA 1GAXA 1ZUWA 5B3AA 1JB9A 5BQ5A 1YHZA 4JI1B 3PHHA 4PICA 3T1NA 1SIBE 3ZWBA 4JH0A 5JWOA 4R8KA 1D2CA 3BIXA 4NZ9A 1OILA 1YFHA 5KCMA 1KYIA 4WZZA 3P32A 4FB5A 4HK4A 3B1WA 5FD8A 1GCUA 1PGOA 4CI9A 1QG2A 4DARA 1GZVA 3QW2A 2Y4NA 2CE2X 4C7OA 1JHMA 4E0BA 1E9FA 5ADWA 2K5UA 2R4UA 3DCJA 2XECA 3FUUA 4EHLA 9GPBA 4O2BA 3R23A 4PAMA 4JD5A 1CNFA 1GUYA 4LYAA 4GS5A 2JF0A 5JYEA 1QCDA 2AN1A 1QO0A 1TA9A 4HDMA 1AZLA 2LNDA 4B87A 2EQBA 3V33A 5HHTA 4JL6A 2QUIA 5EP1A 5IJZA 5JROA 1NMXA 1OZAA 1PYDA 3H04A 4HEA6 2RJ3A 2VOEA 2PJDA 3IR5A 4NMHA 3SBDA 3SFZA 3NCTA 3RT1A 2VAXA 3OLWA 2EZ8A 5JSZA 1Q0UA 4KX3A 4TKZA 4KXMA 4R2LA 3RIMA 2HMWA 3B20A 2HUNA 2C97A 2R96A 5A9SB 5E1OA 4DV2B 4DT1A 3KR0A 1K6XA 1E7WA 2GCIA 3PICA 5FHRA 3W2TA 4AUMA 4F3YA 3BD6A 2WZCA 3BUSA 1K8XB 3DH0A 1RPNA 3FDXA 4MYTA 1E4VA 4QO7A 1UDRA 4JB2A 4QAQA 1BA3A 3FWKA 3WV4A 4BEWA 5CFOA 4KQ1A 4HNTA 2MDRA 4Z99A 3QSYA 2OKCA 3T3OA 2JK0A 1H8HA 2NYVA 1AUPA 4G56A 2NAFA 1B16A 1ZESA 1N34B 2EOYA 2XMSA 1VGRA 4TRMA 3GPDG 4M1WA 2P75A 3PL5A 4HUJA 3W2IA 1DNPA 3H2JA 4P3XA 1PGQA 1ZYUA 3DUFA 1KGDA 2XYHA 3HHEA 2PT9A 3GHYA 3N76A 4BV9A 4E14A 3DOHA 4KIUA 2YYAA 3UBTA 4KZPA 2SCUB 5JASA 4GPAA 2ISSD 1XFDA 4BP8A 3EA5A 4ALMA 5H5JA 2GK7A 2ZBQA 4NR0A 5LCXA 3ELBA 4ZCLA 1MO5A 3TLGA 5EKSA 4KRYA 2GAOA 4KXXA 3ZK8A 1YZ3A 1VM6A 4DUYB 1W96A 4HEQA 3EZ6A 4PS1A 2XVXA 2NU6B 4KAAA 2DC1A 3T7KA 1PKPA 5I7SA 4A2PA 5KOIA 3TTWA 3LUDA 3M5PA 4BFVA 1Z22A 2WAXA 3GXBA 3QVKA 1Z68A 2VTVA 2D0OB 5HKKA 5BNFA 3JQ6A 2AWOA 1QONA 1DGCA 4ECEA 3KDAA 5C0OE 4H60A 2HV9A 3TI7A 3UJAA 3T7JA 4NE9A 1O89A 5EIFA 2G72A 1OU4A 1Z36A 1KAQA 2BR4A 3OJOA 3CR7A 5AOBA 1LV7A 3W9BA 3KQKA 3NKVA 3I6ZA 3L05A 4RLSA 3GX1A 2GN6A 1LGYA 3E4DA 3JYPA 3P9QA 4NBLA 2PKRA 4QULA 4V1CB 1O77A 1XEWX 1Z15A 2EFYA 2J30A 2AFHE 2O6LA 2W2KB 4MHSA 4DR4B 1XXLA 3BB3A 4FM9A 3BH6A 1KMNA 3HKDA 2JFXA 1YHYA 3OZEA 1OYYA 1U9JA 4M1SA 4AO6A 1P39A 3OVMA 4DA7A 2NUFA 2X6RA 3ESCA 3HJHA 4HX2A 1P61B 4DSZA 2IDKA 1U5BA 1II9A 1NT2A 3CR8A 4NAVA 2QGFA 4MGIR 2FF5A 4L95C 1SVOA 2I3BA 1RM4A 3GP3A 2VYVD 3IESA 3O9ZA 3DLHA 3H99A 4TXLA 3Q7QA 4G07A 1IN7A 1YR2A 2W8BB 2ZB2A 2QVCA 1Z88A 3K1TA 4L5BA 4QJBA 4DPMA 1NJ2A 4FD2A 4Y7DA 5DYYA 2XUDA 3BH7A 3D43A 1UBMS 2O3JA 4YV1A 2P2LA 4NV3A 5J40A 4BKOA 5H80A 2XUQA 5DJ5A 1WJGA 3VR5A 2KS6A 4UAGA 5AM0A 3S2FA 1GTVA 4Q1CA 3TSCA 2YRWA 1LJ8A 5TMDA 2WAMA 3GZNA 2B7VA 4G4GA 1L9XA 1GXSB 5J4LA 2YNMC 5CA0B 3KXLA 3EPLA 3MMXA 4BVGA 1MB9A 5K8LA 3TCNA 2XAUA 4EB8A 2OBLA 5A4KA 4RKEA 4KK4A 1UR5A 2P4QA 5TV2A 4XGKA 1JRLA 3URMA 2GEKA 2VDQB 1WDWB 2HWUA 1NQVA 2UUCE 1EFRA 3A4TA 4BJ3A 4BB5A 4P93A 4CKWA 1SPXA 1Q84A 3LKDA 3OLXA 1D6JA 1E2EA 2UV8A 4ZGBA 2VEDA 3TG2A 1XVUA 1UWCA 2GJ8A 2XRFA 4I7EA 4KRGA 2RHMA 3I61A 2QX7A 4B6GA 2I4TA 4F6CA 8AT1A 4FUQA 4RVSA 1FY2A 3ZI7A 3LP8A 2BFMA 1KFKB 3KL2A 2CCKA 2FEPA 4R3UC 3KK0A 4NIMA 3IP8A 4RTLA 1T0UA 4GAEA 1E4OA 2V3VA 1IWOA 2ZRAA 4AMGA 3EZXA 2C5FA 5CFPA 1KFBB 1T26A 2ILTA 4Z7QB 1ZJ5A 5DEIA 1SFRA 4MNTA 2F62A 3GL9A 1PW5A 3ZDZB 1U0RA 1XCGB 1NM5A 13PKA 3N70A 3OE7A 4Q93A 4DLWA 3QKTA 5EFOA 3C43A 1QH8A 3BREA 3VNQA 1RYBA 2H4XA 3CF0A 4LNUB 5B1YA 2YV1A 4QWMA 5ER6A 3P9IA 3D7LA 3STYA 2YTEA 2IYTA 4W9NC 5BT8A 1ZR9A 2EKBA 3D0RA 1L5LA 1XQYA 3O8QB 3NHBA 2R84A 2ZTLA 2Z2KA 3VI3B 2B7CA 5REQB 1KGSA 1VHDA 3UYLA 3RFTA 2P4HX 2V85A 4AWAA 5KTPA 3HXTA 2XMGA 3MIZA 5AVOA 1E5DA 2HSDA 4K6GA 5DGTA 1B69A 3EVNA 1CRQA 4UVIA 2EZ9A 3DOCA 3F71A 1L5QA 3GJZA 5EJGA 3HC7A 3SZUA 1WXRA 4KZSA 2CFTA 2H0RA 2RHHA 3DT6A 3GYGA 3LLSA 4EENA 5C8ZA 2LW7A 2NU8A 2DWUA 3W5HA 4C0WA 4DA6A 3IX7A 1H3EA 1HEIA 2O2IA 3QU5A 2H1HA 1R4NA 2P79A 4J91A 3G23A 4NF2A 1FFAA 2I99A 4HNQA 4J3FA 2CWDA 3GN2A 3U3ZA 1NWHA 3PXDA 4A27A 3NVDA 1TTHA 4BZZA 4YI5A 2A0WA 3PXAA 4TYWA 3D3WB 4OX9Y 5C7OO 3BIOA 3W04A 2IYWA 2RQLA 1R10A 4DJFC 5LQKA 4ZQIA 1UHZA 5H02A 1XELA 2E37A 2FMIA 1WBBA 3BJIC 1EINA 1DKPA 1RXCA 3DE1X 5AXAA 4MB6A 4R1PA 4V03A 4YRAA 3IAM6 2IY9A 1W2HA 1E2DA 1ODJA 2FP3A 1VL8A 3B70A 4PPQA 4LF4E 1ID8A 5ARCA 4J6EA 5J4KA 4ZREA 1H69A 4K0KE 2BZ0A 1V6CA 2ZXFA 4PLGA 4W5QA 4CDNA 5FNVB 1P7PA 1BXRB 3YASA 4Z4GA 1I1QB 1DC4A 1GU0A 2WZQA 1HDGO 3MUNA 2Z5GA 3CLHA 4Q4HB 2HJ9A 2C7GA 3RPEA 1L5FA 1GPMA 1SOVA 1XZGA 2XQGA 2AXNA 5F1YA 1CZLA 3A1FA 4MIKA 4NG4A 1NRWA 4G0VA 4CIYA 5HUHA 3RLIA 5FI0B 2VRWA 1HTBA 4AXXA 3OPYI 1UWKA 1VE5A 5KOYA 3EW7A 1SVNA 1VFPA 1ZFNA 2ZP1A 5IANA 4H6PA 4KRXA 4L85A 5EZ5A 3W77A 1RBMA 2BHLA 2YWJA 2WWHA 4X84A 3HYCA 3PBKA 3R9IA 1UK9A 3TW8B 3SD7A 1CHDA 4F1JA 2E4VA 5DWVA 5I7VA 1BDJA 3ZDXB 1XZJA 3SFVA 2Z4SA 5DLDA 5LA6A 1P7ZA 1ZJ6A 2Z56A 2FKAA 5MN5A 3ZJ4A 2XKBA 4C01A 5A02A 1CF4A 1P2FA 4YAKA 5BR4A 1JA9A 1T8WA 3U39A 2I80A 2MMGA 3QITA 1F8UA 3QKSB 4GM4A 1ICEA 1ADBA 1C9DB 2AHRA 2GNOA 3KTDA 4XYMA 1UWLA 3DJYA 2KM1A 4FI3C 3RHZA 5HQ3B 1JJVA 1OLSB 3CEHA 1UKEA 2R00A 2VR1A 1K89A 1G2FC 1DKUA 4G1UC 3NHWA 4G4SO 1FNDA 4BFCA 4BAGA 4EKNB 2WQ7A 3RYHA 2I3GA 3BTOA 1E1CB 2ZYWX 2C5BA 3VVLA 1DTSA 4YV2A 3PGJA 5IWAB 5CCDA 4A91A 4XFDA 1HR0E 4XOIA 1JEJA 2GBLA 1P45A 1VP9A 3HWSA 3A4LA 3RGWS 3ZGVA 2JGDA 4IFEA 5K01A 4IDAA 2EZ6A 2AV6A 4N3GA 1LKZA 2DULA 5K3CA 3S81A 1H2AS 3ZCRA 2GKOA 3EGIA 3FG9A 3PQ7A 5CDHA 2EMAA 1WSBA 3LNTA 3OA2A 3D6JA 1MU0A 4H3KB 4LF5E 3FZYA 3KX2A 5FOTA 2BR3A 3DKPA 3OEYA 5J47A 3T9FA 2LTSA 1YV9A 4XQCA 1XZLA 5ES4B 3PNVA 1Y1SA 3SVTA 2V7TA 3ICEA 5A6VA 4AN4A 3QLVA 3T5GA 1OMOA 1VJRA 2OB2A 3PUHA 1V25A 2XUIA 1JAXA 3GAFA 2XBLA 3N5KA 1ISHA 1OAOA 2HSGA 4EZIA 1FP4A 2R48A 3RJ9A 1ECPA 3KQSA 4BWVA 3H6HA 1I5RA 1K8ZB 2LIPA 1XDDA 5JWRA 4DR6E 1JLMA 3H5OA 1BD4A 4EOGA 2IHNA 4ND7A 4I4TF 4MVJP 5KOJB 4MUIA 1J2UA 1NLZA 3IPAA 4FINA 3W5UA 5LN1A 1UJ2A 1EUYA 4WT7A 1N2CA 1UT8A 2EPXA 4LYGA 4EG5A 4QUGA 1GM5A 1OXVA 4MP6A 4QGFA 2HQBA 3ZH9B 3TO5A 3Q7SA 1J1ZA 2F90A 5CIQA 4UVEA 1P75A 2OCXA 4HGPA 4LXQA 2HMTA 1LRKA 1VJ1A 2IHJA 5GGXA 3NHZA 5CUQA 4KBFA 4W6ZA 3ADLA 2DUUA 2QLNA 3LA8A 4D3SA 2EJ4A 5EJ5A 4K03A 3F47A 3U1VA 3I2FA 4C7MA 2NV0A 4JGGA 5AVXA 1N5JA 3BE4A 4C30A 1CRPA 4EG1A 4GLLA 1G1AA 1WXQA 2A1TS 3PIIA 4L4UA 1C0PA 4HAZA 3K72B 3ZCUA 4YJ3F 1POXA 4P33A 5IK2D 5EJIA 1O4VA 5JJCA 1X3CA 3NAGA 5BVGB 1AQYA 3NALA 1PEKE 1FNNA 1ZM7A 2OA0A 1XYGA 3OOWA 3D0OA 3ML1A 1DJOA 1U7HA 3ZVRA 5SY4A 3MW8A 4EF5A 1DRVA 3WGYA 3L0YA 5IVHA 1MGTA 3PVSA