1ZBXA

Crystal structure of a orc1p-sir1p complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
197
Chain Sequence
b'AKTLKDLQGWEIITTDEQGNTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title Structural basis for origin recognition complex 1 protein-silence information regulator 1 protein interaction in epigenetic silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 49
structure length 197
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zbxA01
4JJNK 4FSXA 4LD9K 4DOWA 4FT4A 4KUIA 4KUDK 1ZHIA 4DOVA 3TU4K 4DA4A 2FL7A 1ZBXA 4FT2A 4BB7A 4KULA 2FVUA 3PTAA 1M4ZA 3PT9A 1W4SA
chains in the Genus database with same CATH superfamily
4DOWA 3QIIA 2YUQA 4FT4A 3GNGA 5FROA 3CD6Q 1SRMA 2EJGA 3CBOA 2HDAA 2QGGA 2QQRA 2CSIA 5KYWA 4Y28E 3OS2A 3CPFA 5CCAA 1N8RU 5J26A 4E7LA 2YLCA 4XTYA 1WXTA 2PNIA 3JB9H 3OS5A 2DF6A 2O31A 2LJ1A 2D8JA 2K6DA 2CUDA 2RHYA 2X3WD 2WSCE 1ZHIA 3OQ5A 3HRTA 5M9OA 3JRZA 1WIEA 3MEAA 4ZTFA 4C92E 1YIJT 2RN8A 3LH0A 4AG1C 4C92A 5FRNA 2J7IA 1IGQA 4JRIA 1MV3A 1BYMA 2FZCB 3JB9J 1RAEB 1WNLA 2QI2A 3M0PA 2NUTA 4D6WA 4NS5A 3CCVT 3MKDA 1PSFA 2DAQA 4LN2A 2CZ6B 4JS5A 4ANJA 4Z88A 3UATA 3M55A 1NPPA 1M2VA 2HBPA 1QVGS 3JB9G 1KQSP 1IREB 3CCMQ 2JM8A 1N8RC 3EGXB 4ZNXA 1I81A 5I21A 2DIGA 2R5AA 1AWXA 1H8KA 4RTXA 4J9CA 3H6ZA 3ME9A 4A53A 1X2QA 2FZKB 4MDWA 3CCQQ 3QXEB 4QQDA 2AHJB 2K7AA 4PJOD 1XNIA 4J9HA 4VUBA 3C95A 4C5IA 5LJ5j 3FRNA 1UJYA 2RF0A 5DLOA 2XIDA 3OYFA 1S72T 1JBMA 2H3EB 3S3OA 1OX8A 2YT6A 3UA7A 5LJ5g 2VGMA 3CC2Q 2D8HA 1KC8U 3BY7A 4PJJA 2HQEA 1V29B 1G3TA 1TG0A 2JM9A 1VQMT 2DLPA 3X24B 3LLRA 1QCFA 1M9SA 2V8JA 2PVGB 2HSEB 4QKUA 4RCBA 1XJWB 4OMLA 1YJ9T 1Q82R 1T3SA 1GCPA 3G7ZA 2KEAA 3A8HB 2AK5A 3QG1A 2R58A 5A0LA 1VIFA 3IQLA 5LJ5e 1IO6A 3HFOA 3FDRA 4C8QC 2D0QB 3E1SA 1VQ9A 3ASKA 5CKBA 1WLPB 2OTLQ 2VYTA 1X43A 1WX6A 4M7DD 3OB9A 2KXCA 1GCQC 1BI0A 5I22A 1RAGB 4UC4A 3TSWA 3JCMX 1WFWA 5GANj 4GLMA 1YHQT 3RMQA 3I56A 3EGXA 4Q5WA 2B86A 1Q95G 2FPFA 1AEYA 2QA4Q 4C8QG 4OMPA 3CC7A 2DL5A 5GANg 4E7IA 3QHSA 2QQAA 4O6JA 5D6YA 1Q86R 1YITA 3LWHA 1IHVA 1VQ5A 4XU1A 1D3BB 2NYSA 2KR3A 1U06A 1YWOA 1DJ7B 4M75A 1W2BP 1BCOA 2ZPEB 2AT1B 1R0CB 4N4GA 4C0DB 2XD0A 5KE3A 3JCMQ 5GAMf 4KGZB 1O75A 3S6WA 5GMKl 2XU8A 4M7AD 3JCMc 1H641 5GANe 2AIRB 4RTTA 3JAME 1R0BG 3CCUA 5CAIA 1QP2A 2EVRA 2RQRA 3C4SA 3X28B 3NTHA 1U1TA 2HKQB 1QWFA 1JXMA 2LNHB 1Y0MA 2QG9B 1PRLC 2XHCA 4QVCA 3HKSA 2KYBA 3I5RA 4D8DA 3VV0A 4Z89A 4M7DE 2X4YA 3I55A 2ABLA 2WSEE 2DVJA 2DL7A 3QJ6A 1EX4A 3PNWC 4XTXA 1A0NB 4C92G 3QSUA 2A36A 2EYXA 2RQWA 1ZUUA 2HL3A 1KQSA 1W1FA 4AG2C 2E65A 1NEGA 4AT1B 1G5VA 1VQ7A 5LJ5d 5KYUB 1WI7A 3WXMB 2KMTA 4NL3A 3SFMA 2DBKA 2BE7D 3OYEA 2L5QA 4PKCC 1NG2A 2F1LA 2W10A 1ZBXA 1WHLA 5AT1B 4JRQA 2LMJA 3SB2A 1WYXA 2ZPIB 1K76A 4JZ4A 2EQIA 1B7TA 2L3SA 4HVUA 2O4XA 2HBWA 5GAOp 2DD5A 3VS0A 1WQ7A 4LDUA 4LDVA 1V1CA 2DRMA 4N0AA 4OB2B 5AYFA 1VQ8A 1WHHA 3V7RA 1C0MA 5KYNA 2I2LA 1RLQC 4LDYA 4LUEA 1M1GA 3RR6A 1YJNA 1HYOA 4XTVA 1VQKA 1VQPA 1YJWA 1WHMA 1W70A 2LJ3A 2KVQG 2CP3A 4ME7A 5I2MA 2R5MA 3QKJA 2EYZA 5GANd 4AMCA 3VS5A 2X35A 4BE2A 1UGRB 4A4FA 1CSKA 3BDLA 2DL4A 5LJ3f 4PJOC 1B3QA 2FRYA 2ED0A 1JJ2S 1WA7A 3OW2S 3RKXA 3J81E 1QKWA 3UPUA 1WJQA 1BU1A 2K5IA 3BFMA 2RQTA 2O01E 1TSFA 1YWPA 2FRWA 3A8MB 4JZ3A 3GBQA 4KRTA 5KYUA 2MK5A 3HL8A 3M0UA 4IUTA 1M90U 2EGCA 2HL5C 3X26B 4PJOG 1BKBA 2DD4A 2EYQA 3OYAA 1W2BA 2H8HA 4MMLA 2HNIA 1GXIE 1Q82U 3CMEQ 1NPRA 3ZEHA 2L3PA 4HT8A 5GMKj 1V76A 1M3BA 2XDBA 1JRIA 2O9VA 2JW4A 1Y71A 2K3YA 3SD4A 3HP9A 2FEIA 3SEMA 2V8KA 2Y4XA 3L42A 1NYGA 1YBYA 5CO7A 1IGUA 3RDVA 3CC4A 3M57A 1K9MR 4M7DC 1VQ9T 3EG3A 3MHXA 1KFZA 1UECA 3CCJQ 3TSZA 1M90C 2ZPBB 1RADB 1YI2Q 4M78B 4KGXB 3I56T 3PFSA 2DJZA 2G3RA 1VQ4Q 4OB3B 4A4KA 2EGAA 3FJ5A 4C0FA 4KUIA 2QQSA 1Q86U 3CC7T 1Q82C 1VQ6Q 2A7YA 5GMKe 2JVVA 4M7DG 2DYIA 1UJ0A 1YITT 1WXBA 1FMKA 2XDPA 3TEEA 2V1QA 1EFNA 1VQ5T 1TTHB 3CCSA 2QDYB 1UB4A 5LL6S 2KRMA 2RHIA 1VYUA 3DLMA 4M7AC 4FSXA 3P8BB 1C1AA 2D9TA 4EMKC 1X6GA 1K8AR 4AFQC 1WGSA 2EWNA 1VQOA 3JCMb 3QBYA 1N9RA 1RABB 3L2WA 4FT2A 3CCUT 1SHGA 1SKUB 4A54A 1N6AA 2K79A 2RK2A 3VJPA 2JJ9A 3I55T 4ORZA 2LCSA 4M7AG 1VA7A 2KI7A 3G4SA 3S3MA 2CZ0B 1VIEA 3M0TA 1X2KA 2QTVA 1B34B 3J80E 3CCJA 3R6NA 2DNUA 3L2UA 1VQ7T 1K4US 2C0OA 3V8KA 5A0GA 1M2OA 4IIOA 3EAEA 4L6V5 3OYNA 2QK0A 4R0KA 4BDZA 4LD9K 4EPCA 2PQWA 2CDTA 2X51A 3GF5A 4FIBA 5LJ5f 3PIPA 4M78E 2E5KA 2YUNA 4M78A 1QWEA 2CUBA 2GBQA 2DX1A 1Y7XA 2F2XA 5GMKm 2CREA 2RPNA 1GBRA 4CI0C 5GAN2 3G71Q 5FRMA 3O8VA 3CMAQ 4F7UF 2BTTA 1VQ8T 1SSHA 4FCYA 3VS3A 2ZCFB 3JB9I 1VQNQ 5GAOl 4M77B 5FW9A 1OV3A 4QQ6A 1YJNT 3NTKA 1VQKT 4N4HA 3EG2A 1YCYA 1VQPT 4MMKA 1YJWT 3CPWS 1HSQA 3CCRA 2ZPHB 4RTUA 4RG8A 2F2WA 4LD6A 1M1KR 2PTKA 2EW3A 1S1NA 1X6OA 9ATCB 1VYTA 1Y96B 1JJ2P 4ELZC 4YTLA 3JCMh 2LJ0A 2OI3A 2PVOB 3OYCA 2K5LA 3N5BB 1RAIB 3OMGA 5GAN3 1IZ6A 4C8QA 5GANf 7AT1B 2LDMA 4BE0A 2LC4A 2RQUA 3EGDB 3G6EQ 4WCIA 1HJDA 2MI6A 4OMNA 2VWFA 1GCQA 2X3XD 5IXFA 1JU5C 1ZUKA 4L5GA 1OU9A 4XQ3A 2L0AA 2JMCA 3EG1A 5GAOr 4EDUA 3CBPA 2J6FA 5CKHA 2GTOA 1BBZA 5IT9E 4ZTJA 3CCEQ 5CQXA 1RI9A 1PWTA 3KXTA 2RM4A 3VYHB 2FO0A 1BCMA 2DO3A 1VYVA 1QLYA 3UA6A 2KSSA 2GGRA 2KNBB 3FLGA 4D8KA 5FLXE 1U5SA 1M8MA 3QWXX 1GFDA 4OMFB 1PKSA 1KQ1A 3THKA 5GAN4 2MWOA 1Q81C 4KBMB 2CZ7B 1OI1A 1K9MU 4M77E 4J83A 4M77A 1WQWA 2EPDA 3CC4T 1AVZC 2SEMA 2DEUA 4GLKA 1H3HA 2COZA 2E5QA 2VC8A 1KD1U 4PJOB 4LE9A 3L1AA 1EIFA 1MNDA 1M30A 2YRDA 2JXBA 1Y96A 4C92F 5EG2A 2CH4W 3D7SB 2LRQA 3RERA 4KUDK 5EC7A 3P8HA 4M78C 2GTJA 3CCST 4J5YA 2ED1A 2RI2A 5IHIA 2RA2A 1D0XA 3CD6A 1JB0E 3WVDB 1K9MC 2JOYA 1K8AU 2P0QA 1JXOA 2ZZDA 2QQBA 4BY6C 1BB9A 2DBMA 1VQOT 1BIBA 1F1BB 1RLPC 2MAMA 3CCLQ 1TUDA 2JUFA 1KD1C 2P4TA 3HPWA 2FHDA 4JLGA 4M78G 3JCMP 2MF2A 1D1BA 1OQKA 2JT4A 3LH5A 4DQ2A 2Y4YA 4B6MA 4E7ZA 1VQLQ 2E1HA 1AWJA 4M7DB 2YDLA 1UDLA 1U8RA 3G4ST 1AWWA 4FW1A 5FU7B 2DJQA 2DPPB 2RNAA 4GY5A 4RTZA 2KBTA 2E6ZA 4DOVA 4E7SA 3QJYA 4LUDA 2K2VA 2CT4A 1JJ2A 2Y90A 2CSQA 3QDRB 2DKGA 1K8AC 2K3XA 1TWBA 1K73R 2E64A 2YHTA 3M58A 2W0ZA 3CCMA 4AFZC 5KCOA 3OYLA 2K2MA 4PJOE 3OYBA 1SF9A 5DLQE 4PJOA 2FZGB 2OTJQ 2VXFA 4WF2A 3UT1A 2JMAA 1KC8C 2QEXQ 1M8VA 1Y07A 2KRSA 2MIOA 5IHNA 3CCQA 1X75C 3I35A 3CXCS 4OB1B 4PFPA 2KE9A 1Z9QA 1NLPC 1UG1A 4M7AB 2LQWA 3RIRA 4EMKB 3CPWP 1TU0B 2R57A 4OF1A 3L2RA 1ZQ1A 4CC2A 1PNJA 2K5FA 1SG5A 1RAFB 2DETA 1N27A 3E9GA 3CCRT 4KT0E 3CC2A 1M1KU 2BZYA 1KHCA 2D0NA 4Z02A 2F69A 2MMPA 1PC0A 4Y91A 1WJRA 2C0TA 4M77C 3PVLA 1KJWA 4X9DA 4QT7A 2D6FA 2QQ9A 2KROA 2ZAEA 2X9HA 4E7JA 5KH6A 1AHJB 4PK4A 1MUZA 3EHRA 3M5AA 4M7DA 4M75F 2MPXC 4J6WA 5DM7R 1OPKA 3ULRB 4OB0B 4IUPA 3M9QA 4PFZA 4E7KA 4M77G 5CVIA 2OTLA 2LZ6B 4B9WA 3A98A 4IIMA 1D0YA 2YWWA 2EKHA 2L89A 2EQJA 3RUXA 1FMWA 1QVPA 1M1KC 3URGA 4Y92A 4QVDA 2QA4A 3GPLA 1BIAA 2VASA 4XU3A 2DA9A 1I5OB 2PVDB 5GAOn 3J7AF 5IH2A 1JO8A 1WJSA 3FEOA 4M7AE 2X4WA 3M4YA 4M7AA 4EMKA 5GAOq 2CP6A 1H3ZA 2BZ8A 2FL7A 4E7HA 2KYMA 3MJXA 1D3BA 4FYWB 1JQQA 4XTZA 5I11A 2J06A 1QVGP 3M59A 4K11A 5HK0A 2KK4A 2GQVA 4R56A 1KK7A 1X01A 2COWA 4HVWA 6AT1B 3SWNC 4C0GA 1MMAA 1NEBA 4A4HA 2CGHA 2EBPA 3L2QA 4F17A 3VRYA 4A4GA 3OBWA 1IHWA 4HT9A 5DY9A 2J6KA 3SDZA 1YIJQ 1QQJA 4FM4B 4JRKA 1LJOA 3QYGB 3CCVQ 4J9EA 1FX7A 1OOTA 2VB6A 3CD6T 3P8DA 1AWOA 3X20B 1SHFA 4KGVB 1WZOA 2DK3A 3EH2A 2KXDA 5FWCA 2F2VA 3BW1A 4LXCA 3LWIA 1OULA 5KE2A 5LJ3h 4IKFA 3FB9A 1KIKA 4P5NA 5FWBA 2BE9B 2A0FB 3E2UA 4JJNK 2CP5A 3CPWA 1UGVA 2RO0A 1LCKA 1XQHA 3LGFA 1ABQA 3MEUA 3VS6A 1P92A 1UE9A 1NJIR 2ESWA 2LT4A 5IN1A 2YSQA 3G1JA 4QW2A 3HRSA 4J9DA 2L3RA 3OBYA 2A37A 2LX9A 2ZPGB 2LT1A 1S72Q 5J39A 1X6BA 4FU6A 2I0NA 3NGPA 1ZA2B 1NYFA 2GCXA 2DILA 3LW5E 3RNJA 5FU7C 1VQMQ 1M1FA 3CCMT 2O88A 2QAZA 1UGQB 2KT8A 3CQTA 1ZSGA 1OEBA 3QUIA 3A1PA 3LYIA 2E10A 2RJEA 1RL2A 3KUFA 2YLBA 1ZX6A 1YJ9Q 2V1RA 5D7UA 3CCQT 3PGGA 3QDFA 2FPDA 1BI1A 1VUBA 1BI3A 5D6XA 4BY6B 4FYXB 3VS1A 5GAN6 3C12A 2LCCA 3VS4A 4HCKA 4ZGEB 1ZSZB 1RAHB 3L2ZA 5KCHA 1M3CA 3PTAA 1UUEA 1D1AA 1I07A 1W4SA 2VKNA 2K57A 2EYYA 4FW2A 2G6FX 3ZBDA 3CC2T 2E3HA 1YHQQ 4XTWA 5CKDA 1KQSS 2HMAA 2VUBA 4HCCA 2CKKA 4L59A 4RKUE 2V26A 2JTEA 2M02A 5GAN7 1LVKA 3CMEA 5IHKA 4EMGA 3H8ZA 3JCMJ 3E19A 1QVGA 1PRMC 2LX7A 4FYYB 3JCMW 2DXCA 1OPLA 1Q86C 4J8OA 1ZUYA 1QMCA 2OX7A 1W6XA 3OSSC 2KGTA 2XKOC 2OTLT 4HCZA 2BUDA 4IUQA 1UHCA 1QP3A 2CH4A 2EJFA 2XMFA 3RBBB 3NMZC 1WHGA 3HHTB 2L2PA 1B07A 2JN0A 1YI2A 3JB9F 3RMSA 4DBRA 1VQ4A 4A4EA 2QA4T 3M0QA 2DL3A 5KYYB 3M54A 3C94A 4BB7A 1VQ6A 3EG0A 2DL8A 1HK9A 2C0IA 3V7SA 1MMGA 3T9NA 2RMOA 2CYZB 2JZ2A 4F04B 1D09B 2ROLA 5LJ5h 3I5SA 2ENMA 3PE0A 2DZCA 2YRCA 1I1JA 2F5TX 2QYZA 4RG2A 1FXXA 2AZSA 2AKLA 4BI4A 1QKXA 4WTOB 1C6VX 3V8LA 2FVUA 5LJ3g 1KQ2A 3ZL7C 2P0PA 5CKFA 4R55A 4M78F 2V8IA 2IG0A 3RKYA 2COYA 4QQGA 2E70A 2JS2A 2LP5A 3A8OB 2RJDA 1T0HA 2AKKA 2M1HA 2M0OA 3OYKA 3OW2P 2NUZA 3DKMA 1SEMA 1PD0A 1YCSB 2ATCB 4OMQA 1UTIA 3V7CA 1W2BS 1I8FA 3META 4C92D 1QCOA 2LQ8A 2QGFB 4V2SA 1YP5A 2PUKB 4J6YA 4PFOA 2H3JA 1B34A 2RK1A 1JEGA 1WXUA 4B9XA 4OMMA 2C06A 2DYBA 2M0YA 1RAAB 2YUPA 3VUBA 3QO3A 3RESA 2E12A 3EH1A 3TCJA 4NOYA 2MOXA 1SRLA 5KYYA 1NJIU 3ZFJA 3G71A 4C8QF 3CMAA 4II1A 1KG1A 1VQNA 2A3LA 2HEQA 1AZGB 2EQKA 1IB8A 4J9IA 4X34A 4J9FA 2EJ9A 3SWNB 1X27A 4C0ZA 2RB6A 2VGNA 2RJCA 3H0HA 1ZBJA 3Q1JA 4CC3A 2A08A 4OP0A 2DXTA 3RKWA 3PIOA 2D1XA 2XK0A 1HD3A 4PLIA 4NL2A 5D6WA 3JV3A 1UHFA 1TUGB 3NHNA 3EFOB 3MEVA 4FSSA 1NJIC 4DBQA 3MO8A 2NLUA 1VOMA 2VXEA 2QDLA 2CS7A 3M56A 1M27C 3G6EA 3BDUA 5IXBA 4PNOA 2EQMA 1Z9ZA 3OA6A 1VQ9Q 4X1VA 4M77F 2RI3A 1FYNA 5FU6B 3EGDA 5HCKA 5LJ3d 3O5ZA 1BI2A 3MP6A 3HTRA 2KY9A 4IUVA 1G8XA 2DXBA 1K9AA 2DEQA 4JJDA 2GFUA 2YXYA 2A28A 3DLLA 4BE1A 3I56Q 1GRIA 2E4HA 3CCEA 1UEBA 2BZXA 1ZSZC 4E6RA 2P84A 3H9NA 3CC7Q 2GNCA 4F7UG 1PHTA 1LPLA 2X4XA 4M75B 3CMET 1YITQ 2PU9B 3WVEB 2DIQA 1VQ5Q 1SPKA 1ARKA 5GMKi 2RQVA 3OSVA 1FWZA 1G3YA 2CP7A 1KSWA 5CK9A 2P0KA 1M90R 1ABOA 3MP8A 2M16A 3SWNA 2DMOA 4M75D 3MPUB 4MDXA 1XOVA 2MCNA 2HAXA 3CCJT 3OW2A 4QVZA 3A8GB 3UF4A 3CCUQ 2GQIA 1YFNA 3E9FA 1YI2T 1G3SA 4RTVA 3V8JA 2HCKA 2RHZA 3EGUA 3DB4A 1R8OB 2JS0A 1VQ4T 1QVFS 1N5ZA 3I55Q 2M9UA 3EFOA 1VQ6T 3JCMg 4BACA 1FMVA 4OMOA 3M0SA 3BE3A 3CBMA 3OYDA 3VS2A 5KYXB 4ELYC 5IAYA 4A63B 1MNEA 2XG8D 1VQ7Q 2RH2A 1M4ZA 1QCNA 4AFSC 3JCMV 1G3WA 2ZGWA 3GOXA 1YN8A 2IVWA 4KH1B 2O4XB 1K0XA 3CCLA 3X25B 1AOJA 3JCMe 4JJBA 1D0ZA 5C6SA 4PJOF 3NPFA 1MV0B 1CKAA 1LOJA 4E47A 1PKTA 4HA8A 4M75E 1VQLA 1YNZA 3VUZA 2IIMA 3CEYA 3MP1A 1VQ8Q 1NM7A 4F16A 2SRCA 5GMKh 2ZPFB 5GAMh 3H0IA 1J3TA 4C92C 4DEYA 1NZ9A 2MWPA 2ROTA 1RUWA 1YJNQ 2DTIA 2DVEA 1VQKQ 2FG0A 4FL6A 1VQPQ 1YJWQ 3F70A 2AZVA 3TREA 3S3NA 1PD1A 5ECAA 5L23A 1I0CA 1E6GA 4DBFA 3L2VA 3ER0A 2EFIA 3NTIA 1PG5B 2BKDN 3REBB 4HVVA 2OTJA 3OYMA 2YUOA 1WHJA 5HY6A 2ECZA 3MEWA 2QEXA 3PVQA 1PCXA 2HKNA 5GAOm 2J6OA 3JSCA 1OYXA 4F14A 3GIBA 1IXDA 3VYGA 2LTOA 4DBHA 1O9SA 4BUGA 3G71T 4Z8AA 1AT1B 2RJFA 1MMDA 3CMAT 3EFRA 3EFSA 2OAUA 3NFCA 4M7DF 4XAXB 1XTDA 5CQYA 1VQNT 4LNPA 5KYXA 1IRXA 4ATOA 4N4IA 5HK3A 2NWMA 4MZMA 4X9CA 3OY9A 3OYIA 1G2BA 1Q7YR 2MYSA 4C5EA 2PUOB 1N9SA 2LNVA 4MZTA 2XDDA 1UGSB 1OX9A 3JCMd 4MZPA 1PM3A 5GJWB 1ZA1B 4ZN3A 1WDXA 3EHQA 2VV5A 4O5VA 1U1SA 1G83A 1I4K1 2DE0X 3QZ5B 1T0JA 2YRVA 2E41A 1GBQA 2DXUA 4ZGDB 2O9SA 4OVAA 4M7AF 2NUPB 4JRPA 3G6ET 4PL6A 3CC4Q 3GNFB 1K1ZA 4EIKA 1Y57A 1TUCA 3OYJA 2RHXA 2KRNA 3KFVA 2RD1A 1NBEB 2F5KA 4PJLA 5CIUA 3HRUA 4RCCA 3CCET 2L8DA 2DTOA 1HXDA 5FU6C 8ATCB 1RI0A 3MCAB 1LNXA 4CC7A 1Q81R 1D1CA 2OAWA 2WSFE 2K4YA 3CCSQ 2J05A 2CT3A 3HFNA 2QXFA 2B8AA 2HQXA 4JLIA 2RHUA 4J9BA 1R77A 3INZA 4M75C 4JJCA 2HZYA 1U3OA 2EAYA 2KQWA 5HKCA 4HCBA 4BDYA 2XI9A 3OYYA 1VQOQ 4XTUA 4IURA 3DB3A 3REAB 1K73U 1QVFP 2WACA 1N8RR 4XU2A 2FB7A 3QYHB 3LGLA 4ZGJB 4PLLA 4JUVA 2KT1A 4LDWA 1H92A 5GAMj 4AFUC 1BK2A 3OS1A 3UDCA 1YIJA 3CXCP 4RTYA 4F7UB 3PMTA 1EZZB 3JB9D 2M51A 4M75G 3G4SQ 2FYKA 2CP2A 2JNGA 2DM1A 5GAMg 3CCVA 2E6NA 4BI3A 4HXJA 2NUPA 4DA4A 1PSEA 4XK8E 2CP0A 1MMNA 2GF7A 1GFCA 2JTFA 4J6XA 5J3BA 1ZLMA 2OJ2A 3QPHA 1SSFA 1KD1R 4PJMA 1E7OA 3CCLT 1K73C 2EYWA 2KAFA 2HSPA 4EMHA 5A2QE 4FYVB 1KHIA 3TVTA 1TS9A 4DEXA 4ESRA 5GAMe 3VKIA 3TU4K 3FC3A 4IUUA 3EG9B 4C5HA 3R6OA 4PJNA 3M4GA 2HD0A 4J7FA 4BD3A 1VQLT 4M78D 3SHWA 3VRZA 4LDXA 1M3AA 2DFUA 3PT9A 3A5ZB 5CKEA 4N0AC 5CR2A 5GAN8 1OU8A 2DERA 1MGQA 2VVKA 1X69A 2LCLA 1S72A 3H0FA 3H41A 3CCRQ 4CRIA 4J9GA 2LVMA 4C0DC 3AT1B 2L3QA 2K9GA 4XU0A 2EKOA 1VQMA 2RI5A 3UWNA 1KC8R 3GP8A 2BIVA 1RACB 3A8LB 1NE8A 4C8QB 2OTJT 1TXQA 5A0DA 3OYHA 4RUGA 1YJ9A 2PZ1A 2QEXT 4BI8B 1AZEA 2XICA 2Z0WA 1ACMB 4F7UE 1NLOC 1T3LA 3TQ7P 4F7UA 1MHNA 3GLXA 1K0SA 4TVRA 1UFFA 4E2FB 4JS4A 3OMCA 2QASA 2EQUA 4C8QD 3LX7A 1I5LA 4JPBW 2EGEA 4HKEA 5KYWB 2FPEA 1M5Q1 2JTMA 5LJ3j 1ZSZA 5L8RE 1E6HA 2KDSA 1TH7A 3KBGA 2O2OA 1YHQA 4J7IA 1Q7YU 4KH0B 2EIFA 3QZ9B 2DZ9A 1QW1A 2K3BA 2LQNA 3VU3C 4RTWA 4C5GA 1WHKA 2IPOB 4RMOA 1CKBA 1GL5A 3QWYA 3EG9A 4C92B 2DRKA 5GAMd 3OS0A 3C0CA 3PMIA 3U23A 3VS7A 3OYGA 4OGCA 2NUTB 1QVFA 3JCMf 4KULA 3AHUA 2E3IA 8AT1B 1M2VB 5LJ3e 5GAN5 5GJVB 1OZ3A 3M0RA 5I2SA 2LQKA 3CXCA 3FIFA 4JDSA 4M4ZA 3M53A 1AD5A 1UGPB 2P4RA 4M77D 1Q7YC 1WPYA 5C0MA 4ZN1A 4C8QE 2DTHA 1TOVA 2QTXA 2CZ1B 4OGEA 5GANh 2X4JA 3FJPA 3I9QA 2GFAA 1Q81U 2HQHA 4GBQA 4CC4B 3HSBA 1OZ2A
chains in the Genus database with same CATH topology
2GQVA 4R56A 1QVFS 3DLMA 4M7AC 1X01A 4FSXA 3P8BB 3SWNC 4DOWA 2D9TA 4C0GA 2M9UA 3QIIA 4EMKC 4FT4A 1VQ6T 4A4HA 2CGHA 1WGSA 2EWNA 3JCMg 3L2QA 1VQOA 3JCMb 3GNGA 3QBYA 1N9RA 5FROA 4A4GA 4BACA 3OBWA 2EJGA 4FT2A 3L2WA 3CBOA 4HT9A 3CCUT 5DY9A 3CBMA 3OYDA 2QQRA 3SDZA 4ELYC 5IAYA 4A54A 1N6AA 2XG8D 4Y28E 4FM4B 2RK2A 3CPFA 2RH2A 1M4ZA 5CCAA 5J26A 3OS2A 1N8RU 4E7LA 2YLCA 4XTYA 3VJPA 4JRKA 3JCMV 1LJOA 1G3WA 2ZGWA 3GOXA 3QYGB 3I55T 3JB9H 1FX7A 2IVWA 3OS5A 4M7AG 2O4XB 2RHYA 2WSCE 3G4SA 3CD6T 1ZHIA 3S3MA 3P8DA 3X20B 2CZ0B 3CCLA 3X25B 3JCMe 3OQ5A 3HRTA 5M9OA 1VIEA 3JRZA 1VQ4T 2XDBA 3MEAA 2DK3A 4C92E 4ZTFA 1YIJT 3LH0A 5C6SA 4PJOF 4C92A 5FRNA 1B34B 3J80E 3BW1A 3LWIA 5KE2A 3CCJA 1LOJA 4JRIA 5LJ3h 4E47A 3L2UA 1VQ7T 4IKFA 3V8KA 1BYMA 3FB9A 5A0GA 3JB9J 1WNLA 3EAEA 2QI2A 4L6V5 4P5NA 4HA8A 4M75E 3OYNA 4D6WA 4NS5A 3CCVT 3VUZA 1VQLA 1PSFA 3CEYA 4JJNK 3MP1A 3CPWA 2DAQA 4BDZA 2RO0A 2CZ6B 4LD9K 1XQHA 3LGFA 4JS5A 4EPCA 5GMKh 3MEUA 2PQWA 2ZPFB 3M55A 5GAMh 1NPPA 3GF5A 5LJ5f 1P92A 4FIBA 3PIPA 2HBPA 4M78E 4M78A 4C92C 1NZ9A 2MWPA 1QVGS 3JB9G 2LT4A 2DTIA 2DVEA 1IREB 5IN1A 4FL6A 1Y7XA 4QW2A 1N8RC 3F70A 3HRSA 5GMKm 3TREA 1I81A 2L3RA 3S3NA 5I21A 4CI0C 3OBYA 2LX9A 5GAN2 2DIGA 2R5AA 5FRMA 2ZPGB 3O8VA 4F7UF 1VQ8T 3H6ZA 2LT1A 5J39A 3L2VA 4FU6A 3ME9A 3ER0A 2EFIA 4A53A 2ZCFB 4MDWA 3QXEB 3NTIA 3JB9I 2BKDN 5GAOl 4QQDA 2AHJB 2OTJA 4M77B 3OYMA 4PJOD 2GCXA 5HY6A 3LW5E 4QQ6A 3MEWA 5FU7C 2QEXA 1YJNT 1XNIA 3NTKA 1VQKT 4N4HA 1M1FA 1YCYA 5GAOm 4MMKA 3CCMT 4VUBA 3C95A 3JSCA 4C5IA 1YJWT 1OYXA 5LJ5j 3CPWS 1UGQB 3CCRA 3GIBA 2ZPHB 3FRNA 3QUIA 2LTOA 3VYGA 5DLOA 1O9SA 3LYIA 4RG8A 2XIDA 2E10A 2RJEA 4BUGA 3G71T 1RL2A 2RJFA 3CMAT 3OYFA 3EFRA 3KUFA 2YLBA 4LD6A 3EFSA 2OAUA 3NFCA 1S72T 4M7DF 1JBMA 1X6OA 3S3OA 4XAXB 1XTDA 5CQYA 3CCQT 1VQNT 5LJ5g 2VGMA 3PGGA 4ATOA 1Y96B 4N4IA 4ELZC 4YTLA 3JCMh 1BI1A 1KC8U 1VUBA 3BY7A 5HK3A 2PVOB 1BI3A 5D6XA 2HQEA 4BY6B 4MZMA 3OYCA 2K5LA 1V29B 1G3TA 4X9CA 3N5BB 5GAN6 3OY9A 3C12A 1VQMT 3OMGA 5GAN3 1IZ6A 4C8QA 3X24B 3OYIA 3LLRA 2LCCA 1M9SA 2V8JA 4ZGEB 3L2ZA 2PVGB 5KCHA 5GANf 2LDMA 4BE0A 2LC4A 3PTAA 4RCBA 1YJ9T 2MI6A 1W4SA 4C5EA 2K57A 2PUOB 3G7ZA 1N9SA 2LNVA 4MZTA 2XDDA 1UGSB 3A8HB 3ZBDA 3CC2T 3QG1A 2R58A 4MZPA 5A0LA 1VIFA 3JCMd 4XTWA 4ZN3A 5LJ5e 4L5GA 5CKDA 1KQSS 4XQ3A 2VV5A 3HFOA 2VUBA 4HCCA 2CKKA 3FDRA 4C8QC 5GAOr 4O5VA 1U1SA 4EDUA 3CBPA 4L59A 1I4K1 3QZ5B 2D0QB 2YRVA 3E1SA 4RKUE 2E41A 1VQ9A 2DXUA 3ASKA 5CKBA 4ZGDB 5CKHA 5GAN7 4OVAA 2VYTA 3CMEA 4M7DD 4M7AF 4EMGA 4JRPA 5IT9E 4ZTJA 3H8ZA 3OB9A 3G6ET 5CQXA 3JCMJ 1BI0A 3JCMX 4UC4A 3E19A 4PL6A 3KXTA 1QVGA 2RM4A 3VYHB 5GANj 3JCMW 2DXCA 3GNFB 2DO3A 1YHQT 3RMQA 1Q86C 3I56A 4J8OA 4Q5WA 2KSSA 3FLGA 3OYJA 2RHXA 5FLXE 4C8QG 3OSSC 3CC7A 2RD1A 5GANg 4E7IA 3QHSA 2F5KA 4OMFB 2QQAA 2XKOC 2OTLT 1KQ1A 4O6JA 5GAN4 5CIUA 5D6YA 2MWOA 4HCZA 3HRUA 1Q81C 2BUDA 4IUQA 4KBMB 2CZ7B 4RCCA 1QP3A 1YITA 3CCET 1OI1A 2EJFA 3LWHA 1K9MU 4M77E 4J83A 2L8DA 4M77A 1WQWA 2DTOA 1VQ5A 1HXDA 3HHTB 4XU1A 5FU6C 3CC4T 1D3BB 2JN0A 1DJ7B 4M75A 1YI2A 1RI0A 2ZPEB 3MCAB 3JB9F 4GLKA 4N4GA 4C0DB 2XD0A 3RMSA 1LNXA 1VQ4A 5KE3A 4A4EA 2QA4T 2E5QA 3JCMQ 2WSFE 5GAMf 2K4YA 2VC8A 1KD1U 3M54A 1O75A 3C94A 1R8OB 3S6WA 4BB7A 2XU8A 5GMKl 1VQ6A 4PJOB 3L1AA 4M7AD 3JCMc 3HFNA 1H641 1EIFA 2QXFA 5GANe 1HK9A 2B8AA 2HQXA 4JLIA 2RHUA 3JAME 1Y96A 3CCUA 3V7SA 3INZA 5CAIA 1QP2A 4M75C 3T9NA 3C4SA 3X28B 3NTHA 2KQWA 2EAYA 4HCBA 5HKCA 1U1TA 4BDYA 2XI9A 2CYZB 3OYYA 2JZ2A 4XTUA 4IURA 4C92F 5EG2A 5LJ5h 2LRQA 3DB3A 3RERA 1K73U 4KUDK 2XHCA 4QVCA 2WACA 3HKSA 3P8HA 3VV0A 4M78C 4M7DE 2X4YA 3CCST 3I55A 2DZCA 2WSEE 1VQPT 3QJ6A 2F5TX 4J5YA 4XU2A 2RI2A 4RG2A 1FXXA 2RA2A 3PNWC 2FB7A 3CD6A 1JB0E 3QYHB 4XTXA 3LGLA 3WVDB 4BI4A 4C92G 4ZGJB 4PLLA 3QSUA 4JUVA 4LDWA 2FVUA 3V8LA 5LJ3g 1K9MC 2JOYA 1K8AU 1KQ2A 5GAMj 2P0PA 1KQSA 2P0QA 3OS1A 2ZZDA 3UDCA 2QQBA 4BY6C 1YIJA 5CKFA 4F7UB 3PMTA 2E65A 3JB9D 4R55A 4M75G 4M78F 2V8IA 1G5VA 1VQ7A 1VQOT 2IG0A 5LJ5d 1BIBA 2FYKA 2JNGA 3RKYA 4QQGA 2MAMA 2E70A 3WXMB 5GAMg 2KMTA 3A8OB 3SFMA 2JUFA 4NL3A 3OYEA 3CCVA 2E6NA 1KD1C 4BI3A 2L5QA 2P4TA 2FHDA 2RJDA 3HPWA 2M1HA 2M0OA 3OYKA 1PSEA 4PKCC 4JLGA 4DA4A 4M78G 3JCMP 2MF2A 1ZBXA 4XK8E 2GF7A 4JRQA 2JTFA 3DKMA 4J6XA 5J3BA 3SB2A 2ZPIB 3V7CA 4DQ2A 2Y4YA 2E1HA 2O4XA 1W2BS 3QPHA 1SSFA 1I8FA 3META 4M7DB 4C92D 5GAOp 2LQ8A 1U8RA 2DD5A 3G4ST 4V2SA 1WQ7A 5FU7B 2PUKB 4J6YA 4LDUA 4LDVA 3CCLT 2DPPB 1K73C 4GY5A 2KAFA 4OB2B 4N0AA 2H3JA 1B34A 4EMHA 2E6ZA 5AYFA 5A2QE 2RK1A 1KHIA 1VQ8A 4B9XA 4DOVA 3TU4K 3QJYA 5GAMe 2C06A 2K2VA 3V7RA 3VKIA 3FC3A 1JJ2A 2Y90A 4IUUA 2I2LA 4C5HA 3QDRB 3R6OA 3VUBA 3QO3A 3RESA 2DKGA 2HD0A 2K3XA 3M4GA 4J7FA 4LDYA 1K8AC 1M1GA 2E12A 4BD3A 2E64A 2YHTA 3M58A 1VQLT 4M78D 3TCJA 1YJNA 4LDXA 4XTVA 1VQKA 4NOYA 3CCMA 5KCOA 1VQPA 1YJWA 3PT9A 3OYLA 3A5ZB 1NJIU 4PJOE 5CKEA 3OYBA 5DLQE 4PJOA 4N0AC 5CR2A 3ZFJA 5GAN8 2KVQG 3G71A 4C8QF 2VXFA 4WF2A 3UT1A 4ME7A 3CMAA 5I2MA 1MGQA 4II1A 2LCLA 1KC8C 1S72A 2R5MA 1M8VA 1Y07A 3QKJA 1KG1A 3CCQA 1VQNA 1X75C 2A3LA 5GANd 4CRIA 2EQKA 2X35A 4OB1B 3CXCS 2LVMA 4C0DC 1UGRB 4A4FA 4BE2A 4XU0A 4X34A 4M7AB 3BDLA 2EJ9A 2EKOA 1VQMA 3SWNB 2RI5A 3RIRA 3UWNA 4EMKB 4C0ZA 3GP8A 5LJ3f 4PJOC 2BIVA 2R57A 2RB6A 3A8LB 1NE8A 4OF1A 2VGNA 4C8QB 3L2RA 2RJCA 1ZQ1A 2OTJT 1JJ2S 3Q1JA 5A0DA 3OW2S 3RKXA 4OP0A 2K5FA 3J81E 3OYHA 1YJ9A 2DXTA 2QEXT 3UPUA 1WJQA 4BI8B 3RKWA 2XICA 3PIOA 2K5IA 3BFMA 4F7UE 2XK0A 1N27A 2O01E 3E9GA 4F7UA 3CCRT 4KT0E 3CC2A 1M1KU 1MHNA 3GLXA 4PLIA 4NL2A 4TVRA 5D6WA 1KHCA 4Z02A 3A8MB 2F69A 4JS4A 3OMCA 2MMPA 2EQUA 3HL8A 4Y91A 3MEVA 1WJRA 4IUTA 4M77C 1M90U 1NJIC 4C8QD 3MO8A 3LX7A 2NLUA 2KK4A 3X26B 4PJOG 1I5LA 2VXEA 4X9DA 2CS7A 3M56A 1BKBA 2D6FA 2DD4A 2QQ9A 2EYQA 3G6EA 3BDUA 4HKEA 3OYAA 1M5Q1 2JTMA 2EQMA 4PNOA 5LJ3j 1W2BA 4E7JA 5KH6A 4MMLA 3OA6A 2HNIA 5L8RE 1GXIE 1AHJB 2KDSA 1TH7A 3KBGA 2RI3A 3M5AA 4M77F 1YHQA 1Q82U 4J7IA 1Q7YU 5FU6B 4M7DA 2EIFA 3QZ9B 1NPRA 5LJ3d 3ZEHA 4M75F 4J6WA 1BI2A 1QW1A 2DZ9A 3MP6A 5DM7R 4HT8A 4OB0B 2KY9A 5GMKj 4IUPA 3HSBA 4IUVA 2DXBA 3VU3C 2DEQA 3M9QA 2GFUA 1JRIA 4E7KA 4M77G 4C5GA 3DLLA 2K3YA 1Y71A 3SD4A 5CVIA 4BE1A 2OTLA 3HP9A 4RMOA 4B9WA 2V8KA 3CCEA 1UEBA 4C92B 2Y4XA 5GAMd 3L42A 3OS0A 2L89A 1YBYA 5CO7A 3PMIA 3CC4A 2EQJA 3RUXA 3M57A 4M7DC 3OYGA 1VQ9T 1QVPA 1M1KC 4OGCA 4F7UG 3MHXA 3URGA 2X4XA 4M75B 3JCMf 1QVFA 3CMET 4KULA 2PU9B 3AHUA 4QVDA 3WVEB 2QA4A 2DIQA 3GPLA 1M90C 1BIAA 4XU3A 2ZPBB 5GMKi 5LJ3e 5GAN5 3OSVA 1FWZA 4M78B 1OZ3A 5I2SA 3I56T 1G3YA 2LQKA 3PFSA 2PVDB 5GAOn 2DJZA 3CXCA 3FIFA 2G3RA 4JDSA 3J7AF 3M53A 4OB3B 3FEOA 1UGPB 1WJSA 4M7AE 4A4KA 4M77D 2X4WA 5CK9A 4C0FA 4KUIA 2QQSA 2P0KA 3M4YA 1Q86U 3CC7T 1Q82C 3MP8A 4M7AA 2A7YA 2M16A 3SWNA 5GMKe 1Q7YC 2JVVA 4EMKA 4M75D 1WPYA 5C0MA 5GAOq 4ZN1A 4M7DG 4MDXA 1H3ZA 2FL7A 1XOVA 4E7HA 1YITT 4C8QE 2HAXA 3CCJT 2DTHA 3OW2A 1D3BA 2XDPA 3A8GB 2QTXA 4QVZA 2CZ1B 4XTZA 3TEEA 4OGEA 5GANh 2X4JA 1VQ5T 3CCSA 2QDYB 3E9FA 1UB4A 3FJPA 1YI2T 2GFAA 1Q81U 1G3SA 5LL6S 3V8JA 3M59A 2RHZA 5HK0A 3DB4A 2RHIA 1OZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN K;  4FSX A;  4LD9 K;  4DOW A;  4FT4 A;  4KUI A;  4KUD K;  1ZHI A;  4DOV A;  3TU4 K;  4DA4 A;  2FL7 A;  1ZBX A;  4FT2 A;  4BB7 A;  4KUL A;  2FVU A;  3PTA A;  1M4Z A;  3PT9 A;  1W4S A; 
#chains in the Genus database with same CATH topology
 4DOW A;  3QII A;  2YUQ A;  4FT4 A;  3GNG A;  5FRO A;  3CD6 Q;  1SRM A;  2EJG A;  3CBO A;  2HDA A;  2QGG A;  2QQR A;  2CSI A;  5KYW A;  4Y28 E;  3OS2 A;  3CPF A;  5CCA A;  1N8R U;  5J26 A;  4E7L A;  2YLC A;  4XTY A;  1WXT A;  2PNI A;  3JB9 H;  3OS5 A;  2DF6 A;  2O31 A;  2LJ1 A;  2D8J A;  2K6D A;  2CUD A;  2RHY A;  2X3W D;  2WSC E;  1ZHI A;  3OQ5 A;  3HRT A;  5M9O A;  3JRZ A;  1WIE A;  3MEA A;  4ZTF A;  4C92 E;  1YIJ T;  2RN8 A;  3LH0 A;  4AG1 C;  4C92 A;  5FRN A;  2J7I A;  1IGQ A;  4JRI A;  1MV3 A;  1BYM A;  2FZC B;  3JB9 J;  1RAE B;  1WNL A;  2QI2 A;  3M0P A;  2NUT A;  4D6W A;  4NS5 A;  3CCV T;  3MKD A;  1PSF A;  2DAQ A;  4LN2 A;  2CZ6 B;  4JS5 A;  4ANJ A;  4Z88 A;  3UAT A;  3M55 A;  1NPP A;  1M2V A;  2HBP A;  1QVG S;  3JB9 G;  1KQS P;  1IRE B;  3CCM Q;  2JM8 A;  1N8R C;  3EGX B;  4ZNX A;  1I81 A;  5I21 A;  2DIG A;  2R5A A;  1AWX A;  1H8K A;  4RTX A;  4J9C A;  3H6Z A;  3ME9 A;  4A53 A;  1X2Q A;  2FZK B;  4MDW A;  3CCQ Q;  3QXE B;  4QQD A;  2AHJ B;  2K7A A;  4PJO D;  1XNI A;  4J9H A;  4VUB A;  3C95 A;  4C5I A;  5LJ5 j;  3FRN A;  1UJY A;  2RF0 A;  5DLO A;  2XID A;  3OYF A;  1S72 T;  1JBM A;  2H3E B;  3S3O A;  1OX8 A;  2YT6 A;  3UA7 A;  5LJ5 g;  2VGM A;  3CC2 Q;  2D8H A;  1KC8 U;  3BY7 A;  4PJJ A;  2HQE A;  1V29 B;  1G3T A;  1TG0 A;  2JM9 A;  1VQM T;  2DLP A;  3X24 B;  3LLR A;  1QCF A;  1M9S A;  2V8J A;  2PVG B;  2HSE B;  4QKU A;  4RCB A;  1XJW B;  4OML A;  1YJ9 T;  1Q82 R;  1T3S A;  1GCP A;  3G7Z A;  2KEA A;  3A8H B;  2AK5 A;  3QG1 A;  2R58 A;  5A0L A;  1VIF A;  3IQL A;  5LJ5 e;  1IO6 A;  3HFO A;  3FDR A;  4C8Q C;  2D0Q B;  3E1S A;  1VQ9 A;  3ASK A;  5CKB A;  1WLP B;  2OTL Q;  2VYT A;  1X43 A;  1WX6 A;  4M7D D;  3OB9 A;  2KXC A;  1GCQ C;  1BI0 A;  5I22 A;  1RAG B;  4UC4 A;  3TSW A;  3JCM X;  1WFW A;  5GAN j;  4GLM A;  1YHQ T;  3RMQ A;  3I56 A;  3EGX A;  4Q5W A;  2B86 A;  1Q95 G;  2FPF A;  1AEY A;  2QA4 Q;  4C8Q G;  4OMP A;  3CC7 A;  2DL5 A;  5GAN g;  4E7I A;  3QHS A;  2QQA A;  4O6J A;  5D6Y A;  1Q86 R;  1YIT A;  3LWH A;  1IHV A;  1VQ5 A;  4XU1 A;  1D3B B;  2NYS A;  2KR3 A;  1U06 A;  1YWO A;  1DJ7 B;  4M75 A;  1W2B P;  1BCO A;  2ZPE B;  2AT1 B;  1R0C B;  4N4G A;  4C0D B;  2XD0 A;  5KE3 A;  3JCM Q;  5GAM f;  4KGZ B;  1O75 A;  3S6W A;  5GMK l;  2XU8 A;  4M7A D;  3JCM c;  1H64 1;  5GAN e;  2AIR B;  4RTT A;  3JAM E;  1R0B G;  3CCU A;  5CAI A;  1QP2 A;  2EVR A;  2RQR A;  3C4S A;  3X28 B;  3NTH A;  1U1T A;  2HKQ B;  1QWF A;  1JXM A;  2LNH B;  1Y0M A;  2QG9 B;  1PRL C;  2XHC A;  4QVC A;  3HKS A;  2KYB A;  3I5R A;  4D8D A;  3VV0 A;  4Z89 A;  4M7D E;  2X4Y A;  3I55 A;  2ABL A;  2WSE E;  2DVJ A;  2DL7 A;  3QJ6 A;  1EX4 A;  3PNW C;  4XTX A;  1A0N B;  4C92 G;  3QSU A;  2A36 A;  2EYX A;  2RQW A;  1ZUU A;  2HL3 A;  1KQS A;  1W1F A;  4AG2 C;  2E65 A;  1NEG A;  4AT1 B;  1G5V A;  1VQ7 A;  5LJ5 d;  5KYU B;  1WI7 A;  3WXM B;  2KMT A;  4NL3 A;  3SFM A;  2DBK A;  2BE7 D;  3OYE A;  2L5Q A;  4PKC C;  1NG2 A;  2F1L A;  2W10 A;  1ZBX A;  1WHL A;  5AT1 B;  4JRQ A;  2LMJ A;  3SB2 A;  1WYX A;  2ZPI B;  1K76 A;  4JZ4 A;  2EQI A;  1B7T A;  2L3S A;  4HVU A;  2O4X A;  2HBW A;  5GAO p;  2DD5 A;  3VS0 A;  1WQ7 A;  4LDU A;  4LDV A;  1V1C A;  2DRM A;  4N0A A;  4OB2 B;  5AYF A;  1VQ8 A;  1WHH A;  3V7R A;  1C0M A;  5KYN A;  2I2L A;  1RLQ C;  4LDY A;  4LUE A;  1M1G A;  3RR6 A;  1YJN A;  1HYO A;  4XTV A;  1VQK A;  1VQP A;  1YJW A;  1WHM A;  1W70 A;  2LJ3 A;  2KVQ G;  2CP3 A;  4ME7 A;  5I2M A;  2R5M A;  3QKJ A;  2EYZ A;  5GAN d;  4AMC A;  3VS5 A;  2X35 A;  4BE2 A;  1UGR B;  4A4F A;  1CSK A;  3BDL A;  2DL4 A;  5LJ3 f;  4PJO C;  1B3Q A;  2FRY A;  2ED0 A;  1JJ2 S;  1WA7 A;  3OW2 S;  3RKX A;  3J81 E;  1QKW A;  3UPU A;  1WJQ A;  1BU1 A;  2K5I A;  3BFM A;  2RQT A;  2O01 E;  1TSF A;  1YWP A;  2FRW A;  3A8M B;  4JZ3 A;  3GBQ A;  4KRT A;  5KYU A;  2MK5 A;  3HL8 A;  3M0U A;  4IUT A;  1M90 U;  2EGC A;  2HL5 C;  3X26 B;  4PJO G;  1BKB A;  2DD4 A;  2EYQ A;  3OYA A;  1W2B A;  2H8H A;  4MML A;  2HNI A;  1GXI E;  1Q82 U;  3CME Q;  1NPR A;  3ZEH A;  2L3P A;  4HT8 A;  5GMK j;  1V76 A;  1M3B A;  2XDB A;  1JRI A;  2O9V A;  2JW4 A;  1Y71 A;  2K3Y A;  3SD4 A;  3HP9 A;  2FEI A;  3SEM A;  2V8K A;  2Y4X A;  3L42 A;  1NYG A;  1YBY A;  5CO7 A;  1IGU A;  3RDV A;  3CC4 A;  3M57 A;  1K9M R;  4M7D C;  1VQ9 T;  3EG3 A;  3MHX A;  1KFZ A;  1UEC A;  3CCJ Q;  3TSZ A;  1M90 C;  2ZPB B;  1RAD B;  1YI2 Q;  4M78 B;  4KGX B;  3I56 T;  3PFS A;  2DJZ A;  2G3R A;  1VQ4 Q;  4OB3 B;  4A4K A;  2EGA A;  3FJ5 A;  4C0F A;  4KUI A;  2QQS A;  1Q86 U;  3CC7 T;  1Q82 C;  1VQ6 Q;  2A7Y A;  5GMK e;  2JVV A;  4M7D G;  2DYI A;  1UJ0 A;  1YIT T;  1WXB A;  1FMK A;  2XDP A;  3TEE A;  2V1Q A;  1EFN A;  1VQ5 T;  1TTH B;  3CCS A;  2QDY B;  1UB4 A;  5LL6 S;  2KRM A;  2RHI A;  1VYU A;  3DLM A;  4M7A C;  4FSX A;  3P8B B;  1C1A A;  2D9T A;  4EMK C;  1X6G A;  1K8A R;  4AFQ C;  1WGS A;  2EWN A;  1VQO A;  3JCM b;  3QBY A;  1N9R A;  1RAB B;  3L2W A;  4FT2 A;  3CCU T;  1SHG A;  1SKU B;  4A54 A;  1N6A A;  2K79 A;  2RK2 A;  3VJP A;  2JJ9 A;  3I55 T;  4ORZ A;  2LCS A;  4M7A G;  1VA7 A;  2KI7 A;  3G4S A;  3S3M A;  2CZ0 B;  1VIE A;  3M0T A;  1X2K A;  2QTV A;  1B34 B;  3J80 E;  3CCJ A;  3R6N A;  2DNU A;  3L2U A;  1VQ7 T;  1K4U S;  2C0O A;  3V8K A;  5A0G A;  1M2O A;  4IIO A;  3EAE A;  4L6V 5;  3OYN A;  2QK0 A;  4R0K A;  4BDZ A;  4LD9 K;  4EPC A;  2PQW A;  2CDT A;  2X51 A;  3GF5 A;  4FIB A;  5LJ5 f;  3PIP A;  4M78 E;  2E5K A;  2YUN A;  4M78 A;  1QWE A;  2CUB A;  2GBQ A;  2DX1 A;  1Y7X A;  2F2X A;  5GMK m;  2CRE A;  2RPN A;  1GBR A;  4CI0 C;  5GAN 2;  3G71 Q;  5FRM A;  3O8V A;  3CMA Q;  4F7U F;  2BTT A;  1VQ8 T;  1SSH A;  4FCY A;  3VS3 A;  2ZCF B;  3JB9 I;  1VQN Q;  5GAO l;  4M77 B;  5FW9 A;  1OV3 A;  4QQ6 A;  1YJN T;  3NTK A;  1VQK T;  4N4H A;  3EG2 A;  1YCY A;  1VQP T;  4MMK A;  1YJW T;  3CPW S;  1HSQ A;  3CCR A;  2ZPH B;  4RTU A;  4RG8 A;  2F2W A;  4LD6 A;  1M1K R;  2PTK A;  2EW3 A;  1S1N A;  1X6O A;  9ATC B;  1VYT A;  1Y96 B;  1JJ2 P;  4ELZ C;  4YTL A;  3JCM h;  2LJ0 A;  2OI3 A;  2PVO B;  3OYC A;  2K5L A;  3N5B B;  1RAI B;  3OMG A;  5GAN 3;  1IZ6 A;  4C8Q A;  5GAN f;  7AT1 B;  2LDM A;  4BE0 A;  2LC4 A;  2RQU A;  3EGD B;  3G6E Q;  4WCI A;  1HJD A;  2MI6 A;  4OMN A;  2VWF A;  1GCQ A;  2X3X D;  5IXF A;  1JU5 C;  1ZUK A;  4L5G A;  1OU9 A;  4XQ3 A;  2L0A A;  2JMC A;  3EG1 A;  5GAO r;  4EDU A;  3CBP A;  2J6F A;  5CKH A;  2GTO A;  1BBZ A;  5IT9 E;  4ZTJ A;  3CCE Q;  5CQX A;  1RI9 A;  1PWT A;  3KXT A;  2RM4 A;  3VYH B;  2FO0 A;  1BCM A;  2DO3 A;  1VYV A;  1QLY A;  3UA6 A;  2KSS A;  2GGR A;  2KNB B;  3FLG A;  4D8K A;  5FLX E;  1U5S A;  1M8M A;  3QWX X;  1GFD A;  4OMF B;  1PKS A;  1KQ1 A;  3THK A;  5GAN 4;  2MWO A;  1Q81 C;  4KBM B;  2CZ7 B;  1OI1 A;  1K9M U;  4M77 E;  4J83 A;  4M77 A;  1WQW A;  2EPD A;  3CC4 T;  1AVZ C;  2SEM A;  2DEU A;  4GLK A;  1H3H A;  2COZ A;  2E5Q A;  2VC8 A;  1KD1 U;  4PJO B;  4LE9 A;  3L1A A;  1EIF A;  1MND A;  1M30 A;  2YRD A;  2JXB A;  1Y96 A;  4C92 F;  5EG2 A;  2CH4 W;  3D7S B;  2LRQ A;  3RER A;  4KUD K;  5EC7 A;  3P8H A;  4M78 C;  2GTJ A;  3CCS T;  4J5Y A;  2ED1 A;  2RI2 A;  5IHI A;  2RA2 A;  1D0X A;  3CD6 A;  1JB0 E;  3WVD B;  1K9M C;  2JOY A;  1K8A U;  2P0Q A;  1JXO A;  2ZZD A;  2QQB A;  4BY6 C;  1BB9 A;  2DBM A;  1VQO T;  1BIB A;  1F1B B;  1RLP C;  2MAM A;  3CCL Q;  1TUD A;  2JUF A;  1KD1 C;  2P4T A;  3HPW A;  2FHD A;  4JLG A;  4M78 G;  3JCM P;  2MF2 A;  1D1B A;  1OQK A;  2JT4 A;  3LH5 A;  4DQ2 A;  2Y4Y A;  4B6M A;  4E7Z A;  1VQL Q;  2E1H A;  1AWJ A;  4M7D B;  2YDL A;  1UDL A;  1U8R A;  3G4S T;  1AWW A;  4FW1 A;  5FU7 B;  2DJQ A;  2DPP B;  2RNA A;  4GY5 A;  4RTZ A;  2KBT A;  2E6Z A;  4DOV A;  4E7S A;  3QJY A;  4LUD A;  2K2V A;  2CT4 A;  1JJ2 A;  2Y90 A;  2CSQ A;  3QDR B;  2DKG A;  1K8A C;  2K3X A;  1TWB A;  1K73 R;  2E64 A;  2YHT A;  3M58 A;  2W0Z A;  3CCM A;  4AFZ C;  5KCO A;  3OYL A;  2K2M A;  4PJO E;  3OYB A;  1SF9 A;  5DLQ E;  4PJO A;  2FZG B;  2OTJ Q;  2VXF A;  4WF2 A;  3UT1 A;  2JMA A;  1KC8 C;  2QEX Q;  1M8V A;  1Y07 A;  2KRS A;  2MIO A;  5IHN A;  3CCQ A;  1X75 C;  3I35 A;  3CXC S;  4OB1 B;  4PFP A;  2KE9 A;  1Z9Q A;  1NLP C;  1UG1 A;  4M7A B;  2LQW A;  3RIR A;  4EMK B;  3CPW P;  1TU0 B;  2R57 A;  4OF1 A;  3L2R A;  1ZQ1 A;  4CC2 A;  1PNJ A;  2K5F A;  1SG5 A;  1RAF B;  2DET A;  1N27 A;  3E9G A;  3CCR T;  4KT0 E;  3CC2 A;  1M1K U;  2BZY A;  1KHC A;  2D0N A;  4Z02 A;  2F69 A;  2MMP A;  1PC0 A;  4Y91 A;  1WJR A;  2C0T A;  4M77 C;  3PVL A;  1KJW A;  4X9D A;  4QT7 A;  2D6F A;  2QQ9 A;  2KRO A;  2ZAE A;  2X9H A;  4E7J A;  5KH6 A;  1AHJ B;  4PK4 A;  1MUZ A;  3EHR A;  3M5A A;  4M7D A;  4M75 F;  2MPX C;  4J6W A;  5DM7 R;  1OPK A;  3ULR B;  4OB0 B;  4IUP A;  3M9Q A;  4PFZ A;  4E7K A;  4M77 G;  5CVI A;  2OTL A;  2LZ6 B;  4B9W A;  3A98 A;  4IIM A;  1D0Y A;  2YWW A;  2EKH A;  2L89 A;  2EQJ A;  3RUX A;  1FMW A;  1QVP A;  1M1K C;  3URG A;  4Y92 A;  4QVD A;  2QA4 A;  3GPL A;  1BIA A;  2VAS A;  4XU3 A;  2DA9 A;  1I5O B;  2PVD B;  5GAO n;  3J7A F;  5IH2 A;  1JO8 A;  1WJS A;  3FEO A;  4M7A E;  2X4W A;  3M4Y A;  4M7A A;  4EMK A;  5GAO q;  2CP6 A;  1H3Z A;  2BZ8 A;  2FL7 A;  4E7H A;  2KYM A;  3MJX A;  1D3B A;  4FYW B;  1JQQ A;  4XTZ A;  5I11 A;  2J06 A;  1QVG P;  3M59 A;  4K11 A;  5HK0 A;  2KK4 A;  2GQV A;  4R56 A;  1KK7 A;  1X01 A;  2COW A;  4HVW A;  6AT1 B;  3SWN C;  4C0G A;  1MMA A;  1NEB A;  4A4H A;  2CGH A;  2EBP A;  3L2Q A;  4F17 A;  3VRY A;  4A4G A;  3OBW A;  1IHW A;  4HT9 A;  5DY9 A;  2J6K A;  3SDZ A;  1YIJ Q;  1QQJ A;  4FM4 B;  4JRK A;  1LJO A;  3QYG B;  3CCV Q;  4J9E A;  1FX7 A;  1OOT A;  2VB6 A;  3CD6 T;  3P8D A;  1AWO A;  3X20 B;  1SHF A;  4KGV B;  1WZO A;  2DK3 A;  3EH2 A;  2KXD A;  5FWC A;  2F2V A;  3BW1 A;  4LXC A;  3LWI A;  1OUL A;  5KE2 A;  5LJ3 h;  4IKF A;  3FB9 A;  1KIK A;  4P5N A;  5FWB A;  2BE9 B;  2A0F B;  3E2U A;  4JJN K;  2CP5 A;  3CPW A;  1UGV A;  2RO0 A;  1LCK A;  1XQH A;  3LGF A;  1ABQ A;  3MEU A;  3VS6 A;  1P92 A;  1UE9 A;  1NJI R;  2ESW A;  2LT4 A;  5IN1 A;  2YSQ A;  3G1J A;  4QW2 A;  3HRS A;  4J9D A;  2L3R A;  3OBY A;  2A37 A;  2LX9 A;  2ZPG B;  2LT1 A;  1S72 Q;  5J39 A;  1X6B A;  4FU6 A;  2I0N A;  3NGP A;  1ZA2 B;  1NYF A;  2GCX A;  2DIL A;  3LW5 E;  3RNJ A;  5FU7 C;  1VQM Q;  1M1F A;  3CCM T;  2O88 A;  2QAZ A;  1UGQ B;  2KT8 A;  3CQT A;  1ZSG A;  1OEB A;  3QUI A;  3A1P A;  3LYI A;  2E10 A;  2RJE A;  1RL2 A;  3KUF A;  2YLB A;  1ZX6 A;  1YJ9 Q;  2V1R A;  5D7U A;  3CCQ T;  3PGG A;  3QDF A;  2FPD A;  1BI1 A;  1VUB A;  1BI3 A;  5D6X A;  4BY6 B;  4FYX B;  3VS1 A;  5GAN 6;  3C12 A;  2LCC A;  3VS4 A;  4HCK A;  4ZGE B;  1ZSZ B;  1RAH B;  3L2Z A;  5KCH A;  1M3C A;  3PTA A;  1UUE A;  1D1A A;  1I07 A;  1W4S A;  2VKN A;  2K57 A;  2EYY A;  4FW2 A;  2G6F X;  3ZBD A;  3CC2 T;  2E3H A;  1YHQ Q;  4XTW A;  5CKD A;  1KQS S;  2HMA A;  2VUB A;  4HCC A;  2CKK A;  4L59 A;  4RKU E;  2V26 A;  2JTE A;  2M02 A;  5GAN 7;  1LVK A;  3CME A;  5IHK A;  4EMG A;  3H8Z A;  3JCM J;  3E19 A;  1QVG A;  1PRM C;  2LX7 A;  4FYY B;  3JCM W;  2DXC A;  1OPL A;  1Q86 C;  4J8O A;  1ZUY A;  1QMC A;  2OX7 A;  1W6X A;  3OSS C;  2KGT A;  2XKO C;  2OTL T;  4HCZ A;  2BUD A;  4IUQ A;  1UHC A;  1QP3 A;  2CH4 A;  2EJF A;  2XMF A;  3RBB B;  3NMZ C;  1WHG A;  3HHT B;  2L2P A;  1B07 A;  2JN0 A;  1YI2 A;  3JB9 F;  3RMS A;  4DBR A;  1VQ4 A;  4A4E A;  2QA4 T;  3M0Q A;  2DL3 A;  5KYY B;  3M54 A;  3C94 A;  4BB7 A;  1VQ6 A;  3EG0 A;  2DL8 A;  1HK9 A;  2C0I A;  3V7S A;  1MMG A;  3T9N A;  2RMO A;  2CYZ B;  2JZ2 A;  4F04 B;  1D09 B;  2ROL A;  5LJ5 h;  3I5S A;  2ENM A;  3PE0 A;  2DZC A;  2YRC A;  1I1J A;  2F5T X;  2QYZ A;  4RG2 A;  1FXX A;  2AZS A;  2AKL A;  4BI4 A;  1QKX A;  4WTO B;  1C6V X;  3V8L A;  2FVU A;  5LJ3 g;  1KQ2 A;  3ZL7 C;  2P0P A;  5CKF A;  4R55 A;  4M78 F;  2V8I A;  2IG0 A;  3RKY A;  2COY A;  4QQG A;  2E70 A;  2JS2 A;  2LP5 A;  3A8O B;  2RJD A;  1T0H A;  2AKK A;  2M1H A;  2M0O A;  3OYK A;  3OW2 P;  2NUZ A;  3DKM A;  1SEM A;  1PD0 A;  1YCS B;  2ATC B;  4OMQ A;  1UTI A;  3V7C A;  1W2B S;  1I8F A;  3MET A;  4C92 D;  1QCO A;  2LQ8 A;  2QGF B;  4V2S A;  1YP5 A;  2PUK B;  4J6Y A;  4PFO A;  2H3J A;  1B34 A;  2RK1 A;  1JEG A;  1WXU A;  4B9X A;  4OMM A;  2C06 A;  2DYB A;  2M0Y A;  1RAA B;  2YUP A;  3VUB A;  3QO3 A;  3RES A;  2E12 A;  3EH1 A;  3TCJ A;  4NOY A;  2MOX A;  1SRL A;  5KYY A;  1NJI U;  3ZFJ A;  3G71 A;  4C8Q F;  3CMA A;  4II1 A;  1KG1 A;  1VQN A;  2A3L A;  2HEQ A;  1AZG B;  2EQK A;  1IB8 A;  4J9I A;  4X34 A;  4J9F A;  2EJ9 A;  3SWN B;  1X27 A;  4C0Z A;  2RB6 A;  2VGN A;  2RJC A;  3H0H A;  1ZBJ A;  3Q1J A;  4CC3 A;  2A08 A;  4OP0 A;  2DXT A;  3RKW A;  3PIO A;  2D1X A;  2XK0 A;  1HD3 A;  4PLI A;  4NL2 A;  5D6W A;  3JV3 A;  1UHF A;  1TUG B;  3NHN A;  3EFO B;  3MEV A;  4FSS A;  1NJI C;  4DBQ A;  3MO8 A;  2NLU A;  1VOM A;  2VXE A;  2QDL A;  2CS7 A;  3M56 A;  1M27 C;  3G6E A;  3BDU A;  5IXB A;  4PNO A;  2EQM A;  1Z9Z A;  3OA6 A;  1VQ9 Q;  4X1V A;  4M77 F;  2RI3 A;  1FYN A;  5FU6 B;  3EGD A;  5HCK A;  5LJ3 d;  3O5Z A;  1BI2 A;  3MP6 A;  3HTR A;  2KY9 A;  4IUV A;  1G8X A;  2DXB A;  1K9A A;  2DEQ A;  4JJD A;  2GFU A;  2YXY A;  2A28 A;  3DLL A;  4BE1 A;  3I56 Q;  1GRI A;  2E4H A;  3CCE A;  1UEB A;  2BZX A;  1ZSZ C;  4E6R A;  2P84 A;  3H9N A;  3CC7 Q;  2GNC A;  4F7U G;  1PHT A;  1LPL A;  2X4X A;  4M75 B;  3CME T;  1YIT Q;  2PU9 B;  3WVE B;  2DIQ A;  1VQ5 Q;  1SPK A;  1ARK A;  5GMK i;  2RQV A;  3OSV A;  1FWZ A;  1G3Y A;  2CP7 A;  1KSW A;  5CK9 A;  2P0K A;  1M90 R;  1ABO A;  3MP8 A;  2M16 A;  3SWN A;  2DMO A;  4M75 D;  3MPU B;  4MDX A;  1XOV A;  2MCN A;  2HAX A;  3CCJ T;  3OW2 A;  4QVZ A;  3A8G B;  3UF4 A;  3CCU Q;  2GQI A;  1YFN A;  3E9F A;  1YI2 T;  1G3S A;  4RTV A;  3V8J A;  2HCK A;  2RHZ A;  3EGU A;  3DB4 A;  1R8O B;  2JS0 A;  1VQ4 T;  1QVF S;  1N5Z A;  3I55 Q;  2M9U A;  3EFO A;  1VQ6 T;  3JCM g;  4BAC A;  1FMV A;  4OMO A;  3M0S A;  3BE3 A;  3CBM A;  3OYD A;  3VS2 A;  5KYX B;  4ELY C;  5IAY A;  4A63 B;  1MNE A;  2XG8 D;  1VQ7 Q;  2RH2 A;  1M4Z A;  1QCN A;  4AFS C;  3JCM V;  1G3W A;  2ZGW A;  3GOX A;  1YN8 A;  2IVW A;  4KH1 B;  2O4X B;  1K0X A;  3CCL A;  3X25 B;  1AOJ A;  3JCM e;  4JJB A;  1D0Z A;  5C6S A;  4PJO F;  3NPF A;  1MV0 B;  1CKA A;  1LOJ A;  4E47 A;  1PKT A;  4HA8 A;  4M75 E;  1VQL A;  1YNZ A;  3VUZ A;  2IIM A;  3CEY A;  3MP1 A;  1VQ8 Q;  1NM7 A;  4F16 A;  2SRC A;  5GMK h;  2ZPF B;  5GAM h;  3H0I A;  1J3T A;  4C92 C;  4DEY A;  1NZ9 A;  2MWP A;  2ROT A;  1RUW A;  1YJN Q;  2DTI A;  2DVE A;  1VQK Q;  2FG0 A;  4FL6 A;  1VQP Q;  1YJW Q;  3F70 A;  2AZV A;  3TRE A;  3S3N A;  1PD1 A;  5ECA A;  5L23 A;  1I0C A;  1E6G A;  4DBF A;  3L2V A;  3ER0 A;  2EFI A;  3NTI A;  1PG5 B;  2BKD N;  3REB B;  4HVV A;  2OTJ A;  3OYM A;  2YUO A;  1WHJ A;  5HY6 A;  2ECZ A;  3MEW A;  2QEX A;  3PVQ A;  1PCX A;  2HKN A;  5GAO m;  2J6O A;  3JSC A;  1OYX A;  4F14 A;  3GIB A;  1IXD A;  3VYG A;  2LTO A;  4DBH A;  1O9S A;  4BUG A;  3G71 T;  4Z8A A;  1AT1 B;  2RJF A;  1MMD A;  3CMA T;  3EFR A;  3EFS A;  2OAU A;  3NFC A;  4M7D F;  4XAX B;  1XTD A;  5CQY A;  1VQN T;  4LNP A;  5KYX A;  1IRX A;  4ATO A;  4N4I A;  5HK3 A;  2NWM A;  4MZM A;  4X9C A;  3OY9 A;  3OYI A;  1G2B A;  1Q7Y R;  2MYS A;  4C5E A;  2PUO B;  1N9S A;  2LNV A;  4MZT A;  2XDD A;  1UGS B;  1OX9 A;  3JCM d;  4MZP A;  1PM3 A;  5GJW B;  1ZA1 B;  4ZN3 A;  1WDX A;  3EHQ A;  2VV5 A;  4O5V A;  1U1S A;  1G83 A;  1I4K 1;  2DE0 X;  3QZ5 B;  1T0J A;  2YRV A;  2E41 A;  1GBQ A;  2DXU A;  4ZGD B;  2O9S A;  4OVA A;  4M7A F;  2NUP B;  4JRP A;  3G6E T;  4PL6 A;  3CC4 Q;  3GNF B;  1K1Z A;  4EIK A;  1Y57 A;  1TUC A;  3OYJ A;  2RHX A;  2KRN A;  3KFV A;  2RD1 A;  1NBE B;  2F5K A;  4PJL A;  5CIU A;  3HRU A;  4RCC A;  3CCE T;  2L8D A;  2DTO A;  1HXD A;  5FU6 C;  8ATC B;  1RI0 A;  3MCA B;  1LNX A;  4CC7 A;  1Q81 R;  1D1C A;  2OAW A;  2WSF E;  2K4Y A;  3CCS Q;  2J05 A;  2CT3 A;  3HFN A;  2QXF A;  2B8A A;  2HQX A;  4JLI A;  2RHU A;  4J9B A;  1R77 A;  3INZ A;  4M75 C;  4JJC A;  2HZY A;  1U3O A;  2EAY A;  2KQW A;  5HKC A;  4HCB A;  4BDY A;  2XI9 A;  3OYY A;  1VQO Q;  4XTU A;  4IUR A;  3DB3 A;  3REA B;  1K73 U;  1QVF P;  2WAC A;  1N8R R;  4XU2 A;  2FB7 A;  3QYH B;  3LGL A;  4ZGJ B;  4PLL A;  4JUV A;  2KT1 A;  4LDW A;  1H92 A;  5GAM j;  4AFU C;  1BK2 A;  3OS1 A;  3UDC A;  1YIJ A;  3CXC P;  4RTY A;  4F7U B;  3PMT A;  1EZZ B;  3JB9 D;  2M51 A;  4M75 G;  3G4S Q;  2FYK A;  2CP2 A;  2JNG A;  2DM1 A;  5GAM g;  3CCV A;  2E6N A;  4BI3 A;  4HXJ A;  2NUP A;  4DA4 A;  1PSE A;  4XK8 E;  2CP0 A;  1MMN A;  2GF7 A;  1GFC A;  2JTF A;  4J6X A;  5J3B A;  1ZLM A;  2OJ2 A;  3QPH A;  1SSF A;  1KD1 R;  4PJM A;  1E7O A;  3CCL T;  1K73 C;  2EYW A;  2KAF A;  2HSP A;  4EMH A;  5A2Q E;  4FYV B;  1KHI A;  3TVT A;  1TS9 A;  4DEX A;  4ESR A;  5GAM e;  3VKI A;  3TU4 K;  3FC3 A;  4IUU A;  3EG9 B;  4C5H A;  3R6O A;  4PJN A;  3M4G A;  2HD0 A;  4J7F A;  4BD3 A;  1VQL T;  4M78 D;  3SHW A;  3VRZ A;  4LDX A;  1M3A A;  2DFU A;  3PT9 A;  3A5Z B;  5CKE A;  4N0A C;  5CR2 A;  5GAN 8;  1OU8 A;  2DER A;  1MGQ A;  2VVK A;  1X69 A;  2LCL A;  1S72 A;  3H0F A;  3H41 A;  3CCR Q;  4CRI A;  4J9G A;  2LVM A;  4C0D C;  3AT1 B;  2L3Q A;  2K9G A;  4XU0 A;  2EKO A;  1VQM A;  2RI5 A;  3UWN A;  1KC8 R;  3GP8 A;  2BIV A;  1RAC B;  3A8L B;  1NE8 A;  4C8Q B;  2OTJ T;  1TXQ A;  5A0D A;  3OYH A;  4RUG A;  1YJ9 A;  2PZ1 A;  2QEX T;  4BI8 B;  1AZE A;  2XIC A;  2Z0W A;  1ACM B;  4F7U E;  1NLO C;  1T3L A;  3TQ7 P;  4F7U A;  1MHN A;  3GLX A;  1K0S A;  4TVR A;  1UFF A;  4E2F B;  4JS4 A;  3OMC A;  2QAS A;  2EQU A;  4C8Q D;  3LX7 A;  1I5L A;  4JPB W;  2EGE A;  4HKE A;  5KYW B;  2FPE A;  1M5Q 1;  2JTM A;  5LJ3 j;  1ZSZ A;  5L8R E;  1E6H A;  2KDS A;  1TH7 A;  3KBG A;  2O2O A;  1YHQ A;  4J7I A;  1Q7Y U;  4KH0 B;  2EIF A;  3QZ9 B;  2DZ9 A;  1QW1 A;  2K3B A;  2LQN A;  3VU3 C;  4RTW A;  4C5G A;  1WHK A;  2IPO B;  4RMO A;  1CKB A;  1GL5 A;  3QWY A;  3EG9 A;  4C92 B;  2DRK A;  5GAM d;  3OS0 A;  3C0C A;  3PMI A;  3U23 A;  3VS7 A;  3OYG A;  4OGC A;  2NUT B;  1QVF A;  3JCM f;  4KUL A;  3AHU A;  2E3I A;  8AT1 B;  1M2V B;  5LJ3 e;  5GAN 5;  5GJV B;  1OZ3 A;  3M0R A;  5I2S A;  2LQK A;  3CXC A;  3FIF A;  4JDS A;  4M4Z A;  3M53 A;  1AD5 A;  1UGP B;  2P4R A;  4M77 D;  1Q7Y C;  1WPY A;  5C0M A;  4ZN1 A;  4C8Q E;  2DTH A;  1TOV A;  2QTX A;  2CZ1 B;  4OGE A;  5GAN h;  2X4J A;  3FJP A;  3I9Q A;  2GFA A;  1Q81 U;  2HQH A;  4GBQ A;  4CC4 B;  3HSB A;  1OZ2 A; 
#chains in the Genus database with same CATH homology
 2GQV A;  4R56 A;  1QVF S;  3DLM A;  4M7A C;  1X01 A;  4FSX A;  3P8B B;  3SWN C;  4DOW A;  2D9T A;  4C0G A;  2M9U A;  3QII A;  4EMK C;  4FT4 A;  1VQ6 T;  4A4H A;  2CGH A;  1WGS A;  2EWN A;  3JCM g;  3L2Q A;  1VQO A;  3JCM b;  3GNG A;  3QBY A;  1N9R A;  5FRO A;  4A4G A;  4BAC A;  3OBW A;  2EJG A;  4FT2 A;  3L2W A;  3CBO A;  4HT9 A;  3CCU T;  5DY9 A;  3CBM A;  3OYD A;  2QQR A;  3SDZ A;  4ELY C;  5IAY A;  4A54 A;  1N6A A;  2XG8 D;  4Y28 E;  4FM4 B;  2RK2 A;  3CPF A;  2RH2 A;  1M4Z A;  5CCA A;  5J26 A;  3OS2 A;  1N8R U;  4E7L A;  2YLC A;  4XTY A;  3VJP A;  4JRK A;  3JCM V;  1LJO A;  1G3W A;  2ZGW A;  3GOX A;  3QYG B;  3I55 T;  3JB9 H;  1FX7 A;  2IVW A;  3OS5 A;  4M7A G;  2O4X B;  2RHY A;  2WSC E;  3G4S A;  3CD6 T;  1ZHI A;  3S3M A;  3P8D A;  3X20 B;  2CZ0 B;  3CCL A;  3X25 B;  3JCM e;  3OQ5 A;  3HRT A;  5M9O A;  1VIE A;  3JRZ A;  1VQ4 T;  2XDB A;  3MEA A;  2DK3 A;  4C92 E;  4ZTF A;  1YIJ T;  3LH0 A;  5C6S A;  4PJO F;  4C92 A;  5FRN A;  1B34 B;  3J80 E;  3BW1 A;  3LWI A;  5KE2 A;  3CCJ A;  1LOJ A;  4JRI A;  5LJ3 h;  4E47 A;  3L2U A;  1VQ7 T;  4IKF A;  3V8K A;  1BYM A;  3FB9 A;  5A0G A;  3JB9 J;  1WNL A;  3EAE A;  2QI2 A;  4L6V 5;  4P5N A;  4HA8 A;  4M75 E;  3OYN A;  4D6W A;  4NS5 A;  3CCV T;  3VUZ A;  1VQL A;  1PSF A;  3CEY A;  4JJN K;  3MP1 A;  3CPW A;  2DAQ A;  4BDZ A;  2RO0 A;  2CZ6 B;  4LD9 K;  1XQH A;  3LGF A;  4JS5 A;  4EPC A;  5GMK h;  3MEU A;  2PQW A;  2ZPF B;  3M55 A;  5GAM h;  1NPP A;  3GF5 A;  5LJ5 f;  1P92 A;  4FIB A;  3PIP A;  2HBP A;  4M78 E;  4M78 A;  4C92 C;  1NZ9 A;  2MWP A;  1QVG S;  3JB9 G;  2LT4 A;  2DTI A;  2DVE A;  1IRE B;  5IN1 A;  4FL6 A;  1Y7X A;  4QW2 A;  1N8R C;  3F70 A;  3HRS A;  5GMK m;  3TRE A;  1I81 A;  2L3R A;  3S3N A;  5I21 A;  4CI0 C;  3OBY A;  2LX9 A;  5GAN 2;  2DIG A;  2R5A A;  5FRM A;  2ZPG B;  3O8V A;  4F7U F;  1VQ8 T;  3H6Z A;  2LT1 A;  5J39 A;  3L2V A;  4FU6 A;  3ME9 A;  3ER0 A;  2EFI A;  4A53 A;  2ZCF B;  4MDW A;  3QXE B;  3NTI A;  3JB9 I;  2BKD N;  5GAO l;  4QQD A;  2AHJ B;  2OTJ A;  4M77 B;  3OYM A;  4PJO D;  2GCX A;  5HY6 A;  3LW5 E;  4QQ6 A;  3MEW A;  5FU7 C;  2QEX A;  1YJN T;  1XNI A;  3NTK A;  1VQK T;  4N4H A;  1M1F A;  1YCY A;  5GAO m;  4MMK A;  3CCM T;  4VUB A;  3C95 A;  3JSC A;  4C5I A;  1YJW T;  1OYX A;  5LJ5 j;  3CPW S;  1UGQ B;  3CCR A;  3GIB A;  2ZPH B;  3FRN A;  3QUI A;  2LTO A;  3VYG A;  5DLO A;  1O9S A;  3LYI A;  4RG8 A;  2XID A;  2E10 A;  2RJE A;  4BUG A;  3G71 T;  1RL2 A;  2RJF A;  3CMA T;  3OYF A;  3EFR A;  3KUF A;  2YLB A;  4LD6 A;  3EFS A;  2OAU A;  3NFC A;  1S72 T;  4M7D F;  1JBM A;  1X6O A;  3S3O A;  4XAX B;  1XTD A;  5CQY A;  3CCQ T;  1VQN T;  5LJ5 g;  2VGM A;  3PGG A;  4ATO A;  1Y96 B;  4N4I A;  4ELZ C;  4YTL A;  3JCM h;  1BI1 A;  1KC8 U;  1VUB A;  3BY7 A;  5HK3 A;  2PVO B;  1BI3 A;  5D6X A;  2HQE A;  4BY6 B;  4MZM A;  3OYC A;  2K5L A;  1V29 B;  1G3T A;  4X9C A;  3N5B B;  5GAN 6;  3OY9 A;  3C12 A;  1VQM T;  3OMG A;  5GAN 3;  1IZ6 A;  4C8Q A;  3X24 B;  3OYI A;  3LLR A;  2LCC A;  1M9S A;  2V8J A;  4ZGE B;  3L2Z A;  2PVG B;  5KCH A;  5GAN f;  2LDM A;  4BE0 A;  2LC4 A;  3PTA A;  4RCB A;  1YJ9 T;  2MI6 A;  1W4S A;  4C5E A;  2K57 A;  2PUO B;  3G7Z A;  1N9S A;  2LNV A;  4MZT A;  2XDD A;  1UGS B;  3A8H B;  3ZBD A;  3CC2 T;  3QG1 A;  2R58 A;  4MZP A;  5A0L A;  1VIF A;  3JCM d;  4XTW A;  4ZN3 A;  5LJ5 e;  4L5G A;  5CKD A;  1KQS S;  4XQ3 A;  2VV5 A;  3HFO A;  2VUB A;  4HCC A;  2CKK A;  3FDR A;  4C8Q C;  5GAO r;  4O5V A;  1U1S A;  4EDU A;  3CBP A;  4L59 A;  1I4K 1;  3QZ5 B;  2D0Q B;  2YRV A;  3E1S A;  4RKU E;  2E41 A;  1VQ9 A;  2DXU A;  3ASK A;  5CKB A;  4ZGD B;  5CKH A;  5GAN 7;  4OVA A;  2VYT A;  3CME A;  4M7D D;  4M7A F;  4EMG A;  4JRP A;  5IT9 E;  4ZTJ A;  3H8Z A;  3OB9 A;  3G6E T;  5CQX A;  3JCM J;  1BI0 A;  3JCM X;  4UC4 A;  3E19 A;  4PL6 A;  3KXT A;  1QVG A;  2RM4 A;  3VYH B;  5GAN j;  3JCM W;  2DXC A;  3GNF B;  2DO3 A;  1YHQ T;  3RMQ A;  1Q86 C;  3I56 A;  4J8O A;  4Q5W A;  2KSS A;  3FLG A;  3OYJ A;  2RHX A;  5FLX E;  4C8Q G;  3OSS C;  3CC7 A;  2RD1 A;  5GAN g;  4E7I A;  3QHS A;  2F5K A;  4OMF B;  2QQA A;  2XKO C;  2OTL T;  1KQ1 A;  4O6J A;  5GAN 4;  5CIU A;  5D6Y A;  2MWO A;  4HCZ A;  3HRU A;  1Q81 C;  2BUD A;  4IUQ A;  4KBM B;  2CZ7 B;  4RCC A;  1QP3 A;  1YIT A;  3CCE T;  1OI1 A;  2EJF A;  3LWH A;  1K9M U;  4M77 E;  4J83 A;  2L8D A;  4M77 A;  1WQW A;  2DTO A;  1VQ5 A;  1HXD A;  3HHT B;  4XU1 A;  5FU6 C;  3CC4 T;  1D3B B;  2JN0 A;  1DJ7 B;  4M75 A;  1YI2 A;  1RI0 A;  2ZPE B;  3MCA B;  3JB9 F;  4GLK A;  4N4G A;  4C0D B;  2XD0 A;  3RMS A;  1LNX A;  1VQ4 A;  5KE3 A;  4A4E A;  2QA4 T;  2E5Q A;  3JCM Q;  2WSF E;  5GAM f;  2K4Y A;  2VC8 A;  1KD1 U;  3M54 A;  1O75 A;  3C94 A;  1R8O B;  3S6W A;  4BB7 A;  2XU8 A;  5GMK l;  1VQ6 A;  4PJO B;  3L1A A;  4M7A D;  3JCM c;  3HFN A;  1H64 1;  1EIF A;  2QXF A;  5GAN e;  1HK9 A;  2B8A A;  2HQX A;  4JLI A;  2RHU A;  3JAM E;  1Y96 A;  3CCU A;  3V7S A;  3INZ A;  5CAI A;  1QP2 A;  4M75 C;  3T9N A;  3C4S A;  3X28 B;  3NTH A;  2KQW A;  2EAY A;  4HCB A;  5HKC A;  1U1T A;  4BDY A;  2XI9 A;  2CYZ B;  3OYY A;  2JZ2 A;  4XTU A;  4IUR A;  4C92 F;  5EG2 A;  5LJ5 h;  2LRQ A;  3DB3 A;  3RER A;  1K73 U;  4KUD K;  2XHC A;  4QVC A;  2WAC A;  3HKS A;  3P8H A;  3VV0 A;  4M78 C;  4M7D E;  2X4Y A;  3CCS T;  3I55 A;  2DZC A;  2WSE E;  1VQP T;  3QJ6 A;  2F5T X;  4J5Y A;  4XU2 A;  2RI2 A;  4RG2 A;  1FXX A;  2RA2 A;  3PNW C;  2FB7 A;  3CD6 A;  1JB0 E;  3QYH B;  4XTX A;  3LGL A;  3WVD B;  4BI4 A;  4C92 G;  4ZGJ B;  4PLL A;  3QSU A;  4JUV A;  4LDW A;  2FVU A;  3V8L A;  5LJ3 g;  1K9M C;  2JOY A;  1K8A U;  1KQ2 A;  5GAM j;  2P0P A;  1KQS A;  2P0Q A;  3OS1 A;  2ZZD A;  3UDC A;  2QQB A;  4BY6 C;  1YIJ A;  5CKF A;  4F7U B;  3PMT A;  2E65 A;  3JB9 D;  4R55 A;  4M75 G;  4M78 F;  2V8I A;  1G5V A;  1VQ7 A;  1VQO T;  2IG0 A;  5LJ5 d;  1BIB A;  2FYK A;  2JNG A;  3RKY A;  4QQG A;  2MAM A;  2E70 A;  3WXM B;  5GAM g;  2KMT A;  3A8O B;  3SFM A;  2JUF A;  4NL3 A;  3OYE A;  3CCV A;  2E6N A;  1KD1 C;  4BI3 A;  2L5Q A;  2P4T A;  2FHD A;  2RJD A;  3HPW A;  2M1H A;  2M0O A;  3OYK A;  1PSE A;  4PKC C;  4JLG A;  4DA4 A;  4M78 G;  3JCM P;  2MF2 A;  1ZBX A;  4XK8 E;  2GF7 A;  4JRQ A;  2JTF A;  3DKM A;  4J6X A;  5J3B A;  3SB2 A;  2ZPI B;  3V7C A;  4DQ2 A;  2Y4Y A;  2E1H A;  2O4X A;  1W2B S;  3QPH A;  1SSF A;  1I8F A;  3MET A;  4M7D B;  4C92 D;  5GAO p;  2LQ8 A;  1U8R A;  2DD5 A;  3G4S T;  4V2S A;  1WQ7 A;  5FU7 B;  2PUK B;  4J6Y A;  4LDU A;  4LDV A;  3CCL T;  2DPP B;  1K73 C;  4GY5 A;  2KAF A;  4OB2 B;  4N0A A;  2H3J A;  1B34 A;  4EMH A;  2E6Z A;  5AYF A;  5A2Q E;  2RK1 A;  1KHI A;  1VQ8 A;  4B9X A;  4DOV A;  3TU4 K;  3QJY A;  5GAM e;  2C06 A;  2K2V A;  3V7R A;  3VKI A;  3FC3 A;  1JJ2 A;  2Y90 A;  4IUU A;  2I2L A;  4C5H A;  3QDR B;  3R6O A;  3VUB A;  3QO3 A;  3RES A;  2DKG A;  2HD0 A;  2K3X A;  3M4G A;  4J7F A;  4LDY A;  1K8A C;  1M1G A;  2E12 A;  4BD3 A;  2E64 A;  2YHT A;  3M58 A;  1VQL T;  4M78 D;  3TCJ A;  1YJN A;  4LDX A;  4XTV A;  1VQK A;  4NOY A;  3CCM A;  5KCO A;  1VQP A;  1YJW A;  3PT9 A;  3OYL A;  3A5Z B;  1NJI U;  4PJO E;  5CKE A;  3OYB A;  5DLQ E;  4PJO A;  4N0A C;  5CR2 A;  3ZFJ A;  5GAN 8;  2KVQ G;  3G71 A;  4C8Q F;  2VXF A;  4WF2 A;  3UT1 A;  4ME7 A;  3CMA A;  5I2M A;  1MGQ A;  4II1 A;  2LCL A;  1KC8 C;  1S72 A;  2R5M A;  1M8V A;  1Y07 A;  3QKJ A;  1KG1 A;  3CCQ A;  1VQN A;  1X75 C;  2A3L A;  5GAN d;  4CRI A;  2EQK A;  2X35 A;  4OB1 B;  3CXC S;  2LVM A;  4C0D C;  1UGR B;  4A4F A;  4BE2 A;  4XU0 A;  4X34 A;  4M7A B;  3BDL A;  2EJ9 A;  2EKO A;  1VQM A;  3SWN B;  2RI5 A;  3RIR A;  3UWN A;  4EMK B;  4C0Z A;  3GP8 A;  5LJ3 f;  4PJO C;  2BIV A;  2R57 A;  2RB6 A;  3A8L B;  1NE8 A;  4OF1 A;  2VGN A;  4C8Q B;  3L2R A;  2RJC A;  1ZQ1 A;  2OTJ T;  1JJ2 S;  3Q1J A;  5A0D A;  3OW2 S;  3RKX A;  4OP0 A;  2K5F A;  3J81 E;  3OYH A;  1YJ9 A;  2DXT A;  2QEX T;  3UPU A;  1WJQ A;  4BI8 B;  3RKW A;  2XIC A;  3PIO A;  2K5I A;  3BFM A;  4F7U E;  2XK0 A;  1N27 A;  2O01 E;  3E9G A;  4F7U A;  3CCR T;  4KT0 E;  3CC2 A;  1M1K U;  1MHN A;  3GLX A;  4PLI A;  4NL2 A;  4TVR A;  5D6W A;  1KHC A;  4Z02 A;  3A8M B;  2F69 A;  4JS4 A;  3OMC A;  2MMP A;  2EQU A;  3HL8 A;  4Y91 A;  3MEV A;  1WJR A;  4IUT A;  4M77 C;  1M90 U;  1NJI C;  4C8Q D;  3MO8 A;  3LX7 A;  2NLU A;  2KK4 A;  3X26 B;  4PJO G;  1I5L A;  2VXE A;  4X9D A;  2CS7 A;  3M56 A;  1BKB A;  2D6F A;  2DD4 A;  2QQ9 A;  2EYQ A;  3G6E A;  3BDU A;  4HKE A;  3OYA A;  1M5Q 1;  2JTM A;  2EQM A;  4PNO A;  5LJ3 j;  1W2B A;  4E7J A;  5KH6 A;  4MML A;  3OA6 A;  2HNI A;  5L8R E;  1GXI E;  1AHJ B;  2KDS A;  1TH7 A;  3KBG A;  2RI3 A;  3M5A A;  4M77 F;  1YHQ A;  1Q82 U;  4J7I A;  1Q7Y U;  5FU6 B;  4M7D A;  2EIF A;  3QZ9 B;  1NPR A;  5LJ3 d;  3ZEH A;  4M75 F;  4J6W A;  1BI2 A;  1QW1 A;  2DZ9 A;  3MP6 A;  5DM7 R;  4HT8 A;  4OB0 B;  2KY9 A;  5GMK j;  4IUP A;  3HSB A;  4IUV A;  2DXB A;  3VU3 C;  2DEQ A;  3M9Q A;  2GFU A;  1JRI A;  4E7K A;  4M77 G;  4C5G A;  3DLL A;  2K3Y A;  1Y71 A;  3SD4 A;  5CVI A;  4BE1 A;  2OTL A;  3HP9 A;  4RMO A;  4B9W A;  2V8K A;  3CCE A;  1UEB A;  4C92 B;  2Y4X A;  5GAM d;  3L42 A;  3OS0 A;  2L89 A;  1YBY A;  5CO7 A;  3PMI A;  3CC4 A;  2EQJ A;  3RUX A;  3M57 A;  4M7D C;  3OYG A;  1VQ9 T;  1QVP A;  1M1K C;  4OGC A;  4F7U G;  3MHX A;  3URG A;  2X4X A;  4M75 B;  3JCM f;  1QVF A;  3CME T;  4KUL A;  2PU9 B;  3AHU A;  4QVD A;  3WVE B;  2QA4 A;  2DIQ A;  3GPL A;  1M90 C;  1BIA A;  4XU3 A;  2ZPB B;  5GMK i;  5LJ3 e;  5GAN 5;  3OSV A;  1FWZ A;  4M78 B;  1OZ3 A;  5I2S A;  3I56 T;  1G3Y A;  2LQK A;  3PFS A;  2PVD B;  5GAO n;  2DJZ A;  3CXC A;  3FIF A;  2G3R A;  4JDS A;  3J7A F;  3M53 A;  4OB3 B;  3FEO A;  1UGP B;  1WJS A;  4M7A E;  4A4K A;  4M77 D;  2X4W A;  5CK9 A;  4C0F A;  4KUI A;  2QQS A;  2P0K A;  3M4Y A;  1Q86 U;  3CC7 T;  1Q82 C;  3MP8 A;  4M7A A;  2A7Y A;  2M16 A;  3SWN A;  5GMK e;  1Q7Y C;  2JVV A;  4EMK A;  4M75 D;  1WPY A;  5C0M A;  5GAO q;  4ZN1 A;  4M7D G;  4MDX A;  1H3Z A;  2FL7 A;  1XOV A;  4E7H A;  1YIT T;  4C8Q E;  2HAX A;  3CCJ T;  2DTH A;  3OW2 A;  1D3B A;  2XDP A;  3A8G B;  2QTX A;  4QVZ A;  2CZ1 B;  4XTZ A;  3TEE A;  4OGE A;  5GAN h;  2X4J A;  1VQ5 T;  3CCS A;  2QDY B;  3E9F A;  1UB4 A;  3FJP A;  1YI2 T;  2GFA A;  1Q81 U;  1G3S A;  5LL6 S;  3V8J A;  3M59 A;  2RHZ A;  5HK0 A;  3DB4 A;  2RHI A;  1OZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...