1ZBXA

Crystal structure of a orc1p-sir1p complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
197
Chain Sequence
AKTLKDLQGWEIITTDEQGNTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for origin recognition complex 1 protein-silence information regulator 1 protein interaction in epigenetic silencing
pubmed doi rcsb
molecule keywords Origin recognition complex subunit 1
molecule tags Transcription
source organism Saccharomyces cerevisiae
total genus 49
structure length 197
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zbxA01
4LD9K 1ZBXA 3PTAA 4DA4A 1M4ZA 3PT9A 4FT4A 4DOWA 3TU4K 1ZHIA 4JJNK 4FSXA 2FVUA 4KULA 4KUIA 1W4SA 4BB7A 4DOVA 4KUDK 2FL7A 4FT2A
chains in the Genus database with same CATH superfamily
2QQAA 4IURA 2ED0A 2VXEA 2DJZA 2RHUA 3S3OA 4MZMA 1MHNA 4HKEA 3X24B 1D3BA 3PGGA 1R8OB 1WFWA 3ZFJA 1WHMA 1QCNA 5LJ3d 1UHCA 3JB9H 1WDXA 3E9GA 3CCSA 5I21A 4L6V5 4B9XA 3KXTA 1RAFB 1YJWT 1D3BB 1M90U 2D6FA 3OYAA 2E3IA 2EGAA 1B7TA 4LUEA 2MF2A 5L23A 3REAB 2R5MA 4F17A 1YI2A 2JZ2A 1VQKT 5IHIA 3JCMg 2OTLQ 2K4YA 4E7SA 6AT1B 2MIOA 2C0OA 4F7UF 3BY7A 4GY5A 1UJYA 1QQJA 2ZPBB 3EG9A 4A4EA 2DBKA 4WF2A 1BU1A 1SHFA 2JM8A 3PNWC 5FRNA 1YHQT 4GLMA 2C06A 4BUGA 1RADB 2EBPA 2RM4A 2P0QA 2QA4T 2K3BA 4BI8B 3EG9B 2ROLA 3UDCA 2MOXA 3J80E 4PLIA 4MMLA 1M2OA 2DMOA 1VQ5Q 1SEMA 2F5TX 3GP8A 2DLPA 3AHUA 2COZA 4F7UB 5GMKi 1K4US 4F16A 1CSKA 1WXTA 2HL5C 1ZBXA 1RACB 2DD5A 5DLQE 3RNJA 5LJ3g 2J06A 1ZA1B 2E12A 1R77A 2YUOA 3OW2S 1MMAA 2NYSA 2M1HA 4F14A 1W2BA 3DLMA 1PCXA 3MP6A 3RR6A 1VQLA 1ZBJA 9ATCB 1H3ZA 3GF5A 2M0OA 4PJOE 1YFNA 3QJYA 4C0GA 4HCZA 1ZLMA 2YRDA 4LD6A 1WJSA 4LDUA 1Z9QA 1GRIA 4JJDA 2HNIA 5CO7A 3QDRB 4J9IA 4R56A 3TU4K 1WX6A 3RMSA 4QT7A 2L5QA 1DJ7B 1OPLA 4D8DA 1D1CA 3MO8A 4CC2A 3VS7A 1QLYA 2X9HA 4AG2C 4M4ZA 4GBQA 4Y28E 3EG1A 2Z0WA 1IZ6A 4BY6C 4DEYA 4M78F 1TSFA 2E64A 2DL7A 5KE3A 2WSCE 2PTKA 4AMCA 2FVUA 2EYQA 3M4YA 2RJEA 2NUPA 3CCJQ 1D09B 1KC8U 4FYVB 2J7IA 1K73R 5CK9A 5GAN3 4P5NA 4ZNXA 4C0DB 4RG2A 1QMCA 2EAYA 2KY9A 4QVZA 4HA8A 3QHSA 5GANh 2KEAA 4M78B 3JCMe 1RAHB 3KBGA 1M3AA 3PTAA 4XAXB 2ZPIB 1Y7XA 5GANj 2E1HA 2EQJA 2KI7A 1HJDA 2D9TA 2I0NA 2DVEA 3C94A 4BD3A 1JJ2S 2JM9A 5KYWA 2E3HA 2SEMA 1N9SA 1WA7A 2E70A 1VQ4Q 2G3RA 5GJVB 4ELZC 5GAOl 4BE0A 3OYDA 3CC4Q 3CCLT 2O9VA 3A8MB 4HVWA 2GCXA 2QASA 1TUGB 2V8KA 3EHRA 4C92G 2A3LA 5KYWB 3CMEA 1KQ1A 4L59A 4ZGDB 3V8LA 2O88A 1QVGS 1C1AA 4XU0A 4M77F 5FRMA 4MDWA 4CC7A 4PJLA 3E19A 1GBQA 4C5EA 2XDDA 1WHJA 1RUWA 2X4WA 2KRMA 4JUVA 5CKFA 1K0SA 1YCSB 2E5KA 5CIUA 5LJ3e 1KD1C 3JCMV 4EDUA 4XTVA 3PT9A 2ZAEA 3C0CA 3INZA 1IHWA 4C8QG 5I11A 3CCEA 4R55A 3TSWA 2DIQA 1TUCA 3PMTA 3TQ7P 3OYEA 2K6DA 1X75C 4FCYA 2OAUA 4M77B 2DJQA 3OS0A 2EVRA 2RK2A 3LW5E 4E47A 1M1KR 5GAN5 1AWXA 1Y0MA 2ATCB 2HD0A 4MZTA 3HKSA 1KQSP 4BE2A 5IN1A 4M7AC 5D6YA 2DIGA 4J9EA 3V7SA 1LPLA 5KYUB 1YITT 2NLUA 4FIBA 2QGGA 1V1CA 4N4IA 4ORZA 4J7IA 3VYHB 1NJIU 3H6ZA 3G6ET 1YWOA 1VQNT 3I9QA 3ASKA 4FM4B 4M7DE 4V2SA 4M75G 2JJ9A 2FRWA 4PFOA 5D7UA 1NM7A 1SKUB 2CT3A 1BBZA 2P4RA 1FWZA 5LL6S 4J9HA 2EGCA 1F1BB 4EMKB 2HQXA 1VQ7Q 1QP3A 1G3YA 2LX7A 2PZ1A 4N0AA 1U5SA 1K9MR 4Z8AA 4BDZA 4NS5A 3CCMA 3OYLA 4HCKA 1NPRA 3I56T 4M7AE 2X35A 2KNBB 3RERA 2BE7D 1K9AA 1VQMT 1T3SA 3PFSA 1Q82R 2GGRA 1ARKA 1H3HA 4A53A 2GNCA 1RAEB 2VXFA 3F70A 4J7FA 3URGA 2QG9B 3HRUA 3UPUA 2FZCB 3U23A 4C5HA 3J81E 1KJWA 3META 1D0ZA 3EG0A 1WHLA 4XU2A 4E2FB 2QTVA 5GAN4 5CKBA 2VC8A 2RH2A 2RHYA 4NOYA 3A8OB 1K0XA 1I07A 3LLRA 4FYYB 4BI3A 1FYNA 3LWHA 3LX7A 3SD4A 2MWOA 4PLLA 3QIIA 1YIJA 3HPWA 1YJNT 3CCST 4J83A 4M77D 2K3XA 2YSQA 1Q81R 4DOVA 2V8IA 1XOVA 4C92F 5GAOq 2ZGWA 1I5OB 2GQVA 2QGFB 1UGSB 2LMJA 2DL8A 1BYMA 2EJFA 2HL3A 1K8AC 5LJ5h 4TVRA 1UUEA 5A0LA 2XDBA 4C92A 3PIPA 1M90R 3I5SA 2BZXA 3EFOB 3GBQA 1X6OA 4JRQA 5GMKl 3CMAT 2NWMA 5HK0A 2M9UA 3NTIA 2DA9A 3CCRQ 3E2UA 2O9SA 3FDRA 3UA7A 3OBYA 2RA2A 5C0MA 2PVDB 2G6FX 2WSFE 2KT1A 1I8FA 1TH7A 3MJXA 2VYTA 3CCVA 2CZ6B 2LRQA 4C8QA 2DZ9A 2D0QB 3OW2P 4KGVB 4XTUA 1H92A 2HDAA 1KQ2A 3CCQQ 4C8QE 2QQRA 5DLOA 3S3NA 2QAZA 2KYBA 3OYJA 2OTJQ 1SRLA 5LJ3f 1GL5A 1HYOA 2KK4A 2LP5A 3X20B 2RNAA 3VS4A 1W2BS 1RAGB 2JT4A 4XTYA 4OB1B 2L89A 2ZCFB 1FMWA 1EIFA 3JCMQ 3QYHB 4PK4A 2A37A 3O5ZA 4KRTA 2CSIA 4M75F 1M3BA 1VQLT 2WACA 3RIRA 4HCCA 4KGXB 2MPXC 2EGEA 3LH0A 1O9SA 2CSQA 3QKJA 4JZ4A 2M0YA 3NHNA 1NYFA 1IB8A 1BI0A 4M75A 2HQEA 2OTLA 5KYYA 3L1AA 3OYKA 2K7AA 3S3MA 1AT1B 5IXFA 3JCMh 2EFIA 1YJWQ 2MMPA 2RK1A 1S1NA 4ZTFA 4M75B 1EFNA 5J26A 2CP6A 1VQKQ 2E41A 1NEBA 4F7UG 1D0YA 2MI6A 3CC2Q 2QEXQ 2KXDA 5HCKA 3G71T 1VQ5A 2HZYA 4LN2A 4C92D 4AT1B 1YHQQ 2LTOA 2P4TA 1OX8A 4WCIA 1LCKA 3DLLA 1JJ2P 2DTOA 3P8BB 1XQHA 4NL3A 2QA4Q 2AIRB 1Y96A 3DKMA 2CP0A 1G2BA 4J8OA 3D7SB 2ECZA 1PG5B 4E7IA 4EMGA 1IGUA 1GCQA 2CUBA 4LXCA 1G3SA 1QVGP 2GF7A 3SWNA 3EFSA 1J3TA 1U8RA 4DBRA 3I55T 1M30A 2P84A 5D6XA 5A0GA 1BK2A 4AFQC 5I2SA 1VUBA 3MPUB 3SWNB 2JOYA 3X25B 5GMKe 1TU0B 1Y71A 1VYUA 2YLBA 5IAYA 3HFOA 4VUBA 4PJNA 3CXCA 4J9BA 1PKTA 3Q1JA 3RUXA 1Q7YC 3BDUA 3SB2A 5KE2A 2M16A 2DEUA 5KCHA 2VGMA 2LC4A 3M5AA 3OYHA 2JS0A 2RQVA 1IHVA 2AZVA 1WHGA 1OX9A 5A0DA 2VB6A 3CCET 2W10A 4PNOA 2CZ0B 4M78G 4M75D 2RHZA 3CCJA 3MEWA 1I81A 4ANJA 1IGQA 2OX7A 5GAMj 1U3OA 2EYYA 1QW1A 1NLOC 1VQPT 4XTXA 4XU3A 1XNIA 2KAFA 3THKA 3MEAA 3CCUQ 1Q81U 4EMHA 1B34B 1OZ3A 2E4HA 1YJ9Q 1P92A 2DPPB 2DXUA 3OS5A 3OA6A 2PQWA 2XMFA 3HP9A 1M27C 3BW1A 1TWBA 2AT1B 1X01A 2CT4A 2LJ3A 3QWXX 1BI2A 3GNFB 1KC8C 3NGPA 1VQ4A 2J6FA 4J9FA 1SRMA 2H8HA 3RDVA 2CP5A 3TSZA 4J9CA 2KR3A 1WQ7A 4ESRA 4RCCA 1ZA2B 2DXTA 1YCYA 1VA7A 2RI5A 1G5VA 3OYIA 1V76A 2EYXA 3H8ZA 1NJIR 1JRIA 2V26A 3KUFA 2DL4A 4OB3B 3OYNA 3CCLQ 2YWWA 3EGXA 3VKIA 2DTHA 5CCAA 4PJOC 2F2WA 3CCMT 4M77G 4PFPA 4F7UA 1OULA 1JXMA 2LT1A 3NTKA 3EGXB 1WXUA 1N8RC 1WI7A 3CD6T 4IUQA 2L2PA 1QCFA 3QZ9B 2EJ9A 1ZSZC 4IUUA 3M0TA 4OF1A 2RJCA 1OV3A 2ZPGB 3M59A 2DFUA 4AFUC 2VGNA 4AG1C 4ELYC 2BIVA 5GAMd 3MP8A 1C0MA 2CREA 3LGFA 3MKDA 5IH2A 3NPFA 3EHQA 3VS0A 3QUIA 2JTFA 2L0AA 3OMCA 2COWA 3CC7T 1I0CA 2HKNA 2CS7A 4C5GA 4IIOA 3VU3C 2DBMA 4ZTJA 4OGCA 4JRKA 2IPOB 1N9RA 1EZZB 3FB9A 1UDLA 1PRMC 2ED1A 2YLCA 2RHIA 2OAWA 1YITQ 3A98A 1VOMA 4A63B 2HEQA 1KG1A 1VQ7A 1N6AA 2QI2A 1VQNQ 1A0NB 3QBYA 1BI3A 3M9QA 2J6OA 2AK5A 4PJOB 3JB9I 4C0ZA 2MWPA 2BZYA 3L2RA 3UATA 2DXCA 3HL8A 3N5BB 1E6GA 1ZSGA 2ZZDA 1W2BP 4Y92A 2EWNA 4F04B 4M78A 3OS1A 2MCNA 2LQNA 1JO8A 1QKXA 3LH5A 2RN8A 5GAMg 2LVMA 5AT1B 2YDLA 3T9NA 1WJQA 3SEMA 4OMOA 2HKQB 3VYGA 5IHKA 1Y57A 5IXBA 1VQMQ 3I35A 3JCMX 2YUNA 4JRIA 3QO3A 4KH0B 5GAN7 4BACA 5IT9E 2EKHA 1LNXA 4QKUA 1PC0A 1SF9A 1RI0A 2E6NA 1AOJA 1SHGA 2HMAA 3ZL7C 4KGZB 2OTLT 1JQQA 1YJNQ 1ACMB 1ZQ1A 2VV5A 4A4KA 4B9WA 1X2QA 1JU5C 1NBEB 3EH1A 2GTOA 2DRMA 2DF6A 2VKNA 4ZN3A 1UGVA 1G83A 4BY6B 1FX7A 3CCRA 3H0FA 2DRKA 3G7ZA 2O01E 3PVLA 4M7DC 4XU1A 4LNPA 4M77A 3GPLA 3CMAQ 2COYA 2GFUA 2RQWA 4M77E 1W70A 1VQ9Q 5HY6A 1NLPC 3JCMb 3CCQA 1MMDA 1HXDA 3DB4A 2OTJA 4JDSA 2YUPA 3GIBA 2DEQA 2PVGB 3GNGA 2A0FB 1NE8A 5KYUA 4N0AC 1YNZA 2W0ZA 1OI1A 1Y07A 1AWWA 1K73C 2RHXA 4KULA 3AT1B 3P8DA 3OSVA 1MGQA 2PVOB 3FC3A 3VS2A 4PJMA 2HSPA 5CKEA 1FMVA 3S6WA 3VV0A 4M78D 3QXEB 2LNHB 5GANd 5FWBA 5FU7C 5GJWB 4WTOB 4M7DF 4EMKA 3MEUA 4FL6A 4OGEA 2DERA 3NMZC 4ZGEB 3CXCS 2DYBA 2K3YA 5J3BA 4J9GA 1C6VX 1Q95G 2QQBA 3TVTA 1VQOQ 1WQWA 2P0PA 2FZKB 2XG8D 1MNEA 2A08A 1YJWA 3FRNA 4FW1A 3JAME 1VQ8T 1SPKA 2DK3A 1YP5A 5GAMe 3EGDB 2EYWA 3M56A 1VQKA 4IUVA 5L8RE 1Q86R 4CC4B 4M7DB 1AZGB 2CKKA 3G4SQ 4FSXA 4OB2B 3CC2A 4M7AF 2QEXA 2JW4A 4HVVA 1UB4A 3UWNA 1GFCA 1VQ6T 1ZUYA 1YHQA 1G3TA 4E7JA 4DBQA 3HTRA 2QA4A 2V8JA 4E6RA 8ATCB 5KCOA 1RLQC 2EQIA 2DVJA 4OMFB 3M0QA 4CC3A 3CPWA 4A4FA 5M9OA 3G71Q 2YT6A 2FEIA 4FSSA 4RTVA 4RTTA 3RESA 4JJCA 2VVKA 4DEXA 4N4GA 2QXFA 4M7AB 5GANg 1M1KC 1UJ0A 1UEBA 3JB9G 2H3JA 2RJFA 4AFZC 4C8QC 2BUDA 2EJGA 2K5IA 2DD4A 3EFOA 1YI2T 2Y4XA 1PSEA 1QVFA 2F69A 4E7HA 2VUBA 4LDYA 1BIBA 3M57A 5LJ5j 2LQKA 5HKCA 2ABLA 2O2OA 1M1GA 4GLKA 3G1JA 4C92E 2B8AA 4JS4A 1OU9A 1KD1U 3X28B 5KYXA 2L3QA 1SG5A 3I55Q 1SSHA 4IUTA 2K9GA 2KMTA 3L42A 1AD5A 3MP1A 2DETA 2IG0A 2JTMA 1K1ZA 5EC7A 2HBWA 3ULRB 5KYXB 1YBYA 1K9MC 3M58A 1IXDA 1AEYA 3CBOA 2XU8A 3GOXA 4E7KA 1UFFA 3HHTB 1PM3A 1MMGA 2GBQA 1KHIA 1Q82C 3CCUA 1S72Q 1YJ9A 1U1SA 7AT1B 2EPDA 3UA6A 3REBB 4FW2A 3RKXA 1NG2A 1PKSA 4D6WA 2EYZA 3HSBA 4MMKA 4KH1B 1VQPQ 1MV0B 2B86A 3C12A 2CUDA 3M0UA 1VYVA 1QCOA 5FW9A 2H3EB 2V1RA 4B6MA 1EX4A 1Q81C 3QJ6A 3M0PA 1JEGA 3H41A 4J6YA 4X1VA 4M75E 2WSEE 3PMIA 2K79A 1D1BA 3OYMA 4OMMA 2CYZB 3CCLA 2KRNA 5HK3A 1M90C 3A5ZB 4DBHA 3OB9A 1WPYA 1W6XA 2L8DA 1GCQC 1NZ9A 3H0IA 3OYBA 1WLPB 5GANe 2QDYB 4JLIA 4DQ2A 1UE9A 1RLPC 3VUZA 2R58A 3EG2A 2L3SA 2RJDA 1Z9ZA 5GAMf 4PKCC 1B3QA 2NUZA 5KH6A 1ZHIA 2AKKA 3JB9F 4OB0B 2RQUA 1G8XA 3CD6Q 2O31A 1QWEA 5CQYA 2KRSA 2LCLA 5LJ3h 1HK9A 2X3WD 2DL3A 5KYNA 2D0NA 5LJ3j 3FLGA 2QQSA 5CAIA 1K8AU 3OYFA 1E6HA 1H8KA 1KHCA 3TEEA 1UGPB 4JRPA 5AYFA 3CMET 1ZX6A 4PJOG 2FRYA 4DBFA 2MK5A 4HVUA 4ME7A 1BKBA 2DYIA 1M2VB 1Q86U 3CC7Q 4Z88A 5LJ5g 1YITA 3CBMA 3I5RA 2QDLA 3SFMA 2DO3A 1VQNA 3ER0A 2RPNA 3CCRT 5GAOn 2EQUA 3CQTA 2LNVA 4QVCA 5J39A 1UHFA 1XTDA 3JCMc 3C95A 4BI4A 1BCMA 1M8MA 2CP2A 2LZ6B 1B34A 1MMNA 2AZSA 2OTJT 3L2ZA 3BDLA 1OEBA 1AHJB 3RKWA 3M55A 1TTHB 2KE9A 1GFDA 5EG2A 1JBMA 2X4XA 1YN8A 2RQTA 1UECA 4C5IA 1VQMA 2LX9A 3MCAB 3CXCP 3VRYA 3J7AF 3VS5A 3BFMA 3FJPA 4FT2A 1PWTA 1ZUKA 4OVAA 4KBMB 2E5QA 2VWFA 3WVDB 4LUDA 3CC4A 3E9FA 3GLXA 2RMOA 1I4K1 3DB3A 4QVDA 3V8KA 2FPDA 4D8KA 1YJNA 4BE1A 1IRXA 2XDPA 1TUDA 2JXBA 4IIMA 2FL7A 3WXMB 2LJ0A 1UTIA 3EGUA 4J6XA 2RF0A 2EW3A 5I2MA 5IHNA 4RTXA 2M51A 3LWIA 2HQHA 2YHTA 3JB9D 4MDXA 2K2MA 1MV3A 3CC2T 2RO0A 2QEXT 4F7UE 3R6NA 4AFSC 2ENMA 3CMAA 2X3XD 2IVWA 3M54A 1U06A 4Y91A 5ECAA 1VQ9A 3CPWS 4J9DA 4QW2A 2KQWA 2D8HA 1V29B 5GAOr 4RCBA 4UC4A 2I2LA 5CQXA 4RTWA 3EG3A 5GANf 4PFZA 2MYSA 4OMLA 3OYCA 1YIJT 3OQ5A 2QTXA 5LJ5e 4R0KA 3PIOA 3VS6A 4XTWA 4C0DC 1QVFS 1WZOA 4OMPA 2CZ7B 1KIKA 4PJOF 2RB6A 4M78C 2JS2A 3QYGB 3EAEA 3OMGA 4NL2A 3H0HA 1QKWA 4LE9A 3A1PA 2YXYA 4PJOA 3BE3A 2EQKA 4M7DG 1VIFA 1VQOA 1Q7YU 5GAN6 2CH4A 1LVKA 2FPFA 4ATOA 3G6EQ 4ZN1A 1OYXA 2JTEA 1NJIC 1LOJA 1X69A 1GXIE 1KD1R 4RTYA 1ZSZA 3G4SA 3O8VA 3CCVT 1IREB 3JCMW 4PL6A 1PHTA 2QYZA 1VQ8Q 2DILA 2SRCA 3QG1A 2XIDA 2YUQA 4M78E 1ZSZB 2V1QA 4M7AG 1ZUUA 1UGRB 1M9SA 3M0SA 3VS3A 2R57A 3I56Q 3CCUT 1VYTA 2K5LA 4HCBA 1HD3A 1YJ9T 3OY9A 2D1XA 3G71A 1BCOA 3JCMJ 1GBRA 1VQ6Q 5GAN2 4LDXA 3TCJA 4M77C 1OOTA 2KXCA 2Y90A 1D1AA 3UF4A 1N27A 2NUPB 1D0XA 2DKGA 2KYMA 2X4YA 2JVVA 3LYIA 2IIMA 2EIFA 1UG1A 2AHJB 2KROA 3QSUA 5DM7R 3CCSQ 2DAQA 2ZPHB 5D6WA 1R0BG 4XTZA 4YTLA 2K5FA 3JSCA 4XK8E 2DXBA 2NUTA 4QQ6A 1YI2Q 1QVPA 3I55A 1AVZC 1VIEA 5FU6C 5FROA 3JV3A 1N8RU 1KFZA 2P0KA 1RAAB 1KQSA 2NUTB 2FPEA 4EMKC 2LCCA 1VQ5T 2C0TA 2KBTA 3FJ5A 4PJOD 2JUFA 4X9DA 2DZCA 3CPFA 5GMKh 2LQWA 2RI3A 1TOVA 1G3WA 3MEVA 4RTUA 5GMKj 1ABOA 1OQKA 5CVIA 1S72A 4JZ3A 2E65A 3HRSA 1X43A 1NYGA 1TXQA 4II1A 1YWPA 1RL2A 2KSSA 2RQRA 1FXXA 3QPHA 3L2QA 4KT0E 2RD1A 4Z89A 1VQPA 2KT8A 3X26B 1SSFA 1FMKA 3LGLA 5GAOm 1WYXA 2DE0X 1WXBA 3OYYA 2KVQG 2GFAA 3FIFA 3EGDA 2D8JA 1ABQA 5LJ5f 1K8AR 1W4SA 1VQLQ 1TG0A 4C0FA 4M7DA 1NPPA 1T0JA 4Z02A 2JMAA 3HRTA 3RKYA 3JRZA 1WHHA 4PJJA 2X51A 2LT4A 2XICA 3MHXA 1K76A 5FU6B 1HSQA 4QQDA 3P8HA 3OBWA 4HXJA 1OPKA 2O4XA 3JCMP 3UT1A 1PNJA 4BB7A 3CCJT 2F2XA 4C92C 1R0CB 1RABB 2K57A 5CKDA 2O4XB 4JJBA 2CDTA 2C0IA 4M7AA 2BZ8A 4DOWA 5FWCA 2EQMA 4JPBW 4KUIA 3CD6A 2HBPA 1T0HA 1AZEA 3A8LB 1JXOA 1TS9A 4CRIA 2PUKB 3E1SA 1VQ4T 4Q5WA 3CC4T 5FU7B 4XQ3A 4DA4A 1H641 5I22A 2JMCA 2RI2A 4E7LA 4FT4A 2LQ8A 4OMNA 1OZ2A 1T3LA 4RG8A 2LJ1A 4E7ZA 2XI9A 3OW2A 3CC7A 4OMQA 4EIKA 4FYXB 4LD9K 3JCMf 1WHKA 1M1FA 1B07A 4BDYA 1BB9A 3CPWP 3CMEQ 2DNUA 8AT1B 2JN0A 2J6KA 2AKLA 1X2KA 2CP3A 3V7CA 2FG0A 2LCSA 3HFNA 2GQIA 4HT8A 1PSFA 3KFVA 2QK0A 2BE9B 2J05A 2XKOC 4IUPA 2FZGB 4M75C 2X4JA 1PD0A 4C92B 4C8QF 1VQ9T 1Q86C 2E6ZA 3A8GB 1BIAA 3ME9A 1LJOA 2LDMA 4M7DD 1AWOA 1QVFP 3SHWA 3CBPA 2HAXA 4RUGA 1K73U 2PNIA 3CCEQ 1QWFA 2ESWA 3R6OA 4QQGA 4LDVA 3OSSC 4K11A 4O6JA 1I1JA 4A54A 1BI1A 3JB9J 2XHCA 2JNGA 2QQ9A 2GTJA 1W1FA 4C8QB 1XJWB 2PU9B 2CZ1B 3QWYA 2BKDN 1KK7A 4EPCA 1JB0E 5C6SA 3PE0A 2FO0A 3VJPA 4M7AD 1I5LA 1M8VA 4LDWA 1VQOT 5GAN8 5FLXE 1VQ7T 2HSEB 1JJ2A 5GMKm 1CKAA 1N5ZA 1X6GA 2YRCA 1GCPA 5LJ5d 1Q7YR 1IO6A 2PUOB 2DM1A 3ZBDA 3L2VA 4JJNK 3SWNC 3G4ST 1E7OA 3L2WA 2R5AA 2OI3A 1WNLA 3CEYA 1O75A 1WIEA 5GAOp 2YRVA 5KYYB 3ZEHA 1PD1A 1QVGA 1QP2A 3NTHA 3CCMQ 4A4GA 4RMOA 4J5YA 3SDZA 4X9CA 3VRZA 3PVQA 1MUZA 4J6WA 1M1KU 1RAIB 5A2QE 4JLGA 5CKHA 1PRLC 2CGHA 2DL5A 2ZPFB 2L3RA 1AWJA 1M3CA 4OP0A 4A4HA 3A8HB 5CR2A 1NEGA 2HCKA 3IQLA 2EKOA 3QDFA 2FB7A 2KDSA 1CKBA 2M02A 3V8JA 3FEOA 1KC8R 1M2VA 2BTTA 3M0RA 1U1TA 3QZ5B 4O5VA 2F1LA 4HT9A 3V7RA 1YIJQ 2FHDA 2DX1A 2F2VA 3OYGA 1Y96B 2MAMA 1M5Q1 3EH2A 4JS5A 2K2VA 4C8QD 4N4HA 4FU6A 2XK0A 3OS2A 1RI9A 2A7YA 3WVEB 3G6EA 4X34A 1KQSS 1WGSA 3M4GA 4MZPA 3RBBB 2ROTA 3C4SA 2CP7A 2A28A 3EFRA 1K9MU 1KSWA 2OJ2A 2F5KA 3JCMd 2FYKA 1WJRA 3VS1A 4KUDK 2Y4YA 1N8RR 3L2UA 3CCQT 1VQ8A 2ZPEB 3VUBA 3M53A 4ZGJB 4FYWB 1Q82U 2A36A 1M4ZA 1X6BA 2DTIA 3H9NA 2L3PA 3I56A 2XD0A 4RTZA 3CCVQ 1S72T 4RKUE 4L5GA 1X27A 2VASA 5GAMh 3TREA 5DY9A 2KGTA 2CH4W 3NFCA 1VQ6A 4IKFA 2E10A 1MNDA 4CI0C 1OU8A 3RMQA 1UGQB
chains in the Genus database with same CATH topology
4M78E 2QQAA 2DK3A 3LH0A 1O9SA 3QKJA 5GAMe 4IURA 4M7AG 2VXEA 3M56A 2DJZA 2RHUA 1UGRB 3S3OA 1VQKA 4IUVA 4MZMA 1M9SA 5L8RE 1MHNA 2R57A 4HKEA 3CCUT 4M7DB 3X24B 2CKKA 1BI0A 2K5LA 4M75A 1D3BA 2HQEA 4FSXA 3PGGA 1R8OB 4OB2B 4HCBA 2OTLA 1YJ9T 3L1AA 3OYKA 3ZFJA 3OY9A 3CC2A 3G71A 3JCMJ 4M7AF 5LJ3d 2QEXA 3S3MA 3JB9H 1UB4A 3E9GA 3CCSA 3JCMh 5GAN2 4LDXA 3TCJA 2EFIA 5I21A 2MMPA 4L6V5 3UWNA 4B9XA 2RK1A 4M77C 3KXTA 1VQ6T 4ZTFA 4M75B 1YJWT 1D3BB 1YHQA 1G3TA 1M90U 4E7JA 3OYAA 2D6FA 2Y90A 5J26A 1N27A 2MF2A 2DKGA 2E41A 2X4YA 2R5MA 2QA4A 2V8JA 2JVVA 2JZ2A 4F7UG 3LYIA 1YI2A 5KCOA 1VQKT 2EIFA 4OMFB 3JCMg 3CPWA 2K4YA 2MI6A 4A4FA 5M9OA 2AHJB 3RESA 3QSUA 4PJOB 5DM7R 3G71T 2DAQA 4F7UF 3BY7A 4GY5A 2ZPBB 2QXFA 4N4GA 2ZPHB 4A4EA 4M7AB 5GANg 1M1KC 1VQ5A 4C92D 4WF2A 2LTOA 2P4TA 5D6WA 1UEBA 3PNWC 4XTZA 3JB9G 4YTLA 5FRNA 1YHQT 2K5FA 2H3JA 3JSCA 4XK8E 3DLLA 2DXBA 2DTOA 2RJFA 1XQHA 3P8BB 4BUGA 2BUDA 2EJGA 4QQ6A 4C8QC 4NL3A 1QVPA 2K5IA 2RM4A 2P0QA 3I55A 2DD4A 2QA4T 4BI8B 1YI2T 1Y96A 2Y4XA 3UDCA 3DKMA 1VIEA 5FU6C 1PSEA 5FROA 1QVFA 1N8RU 2F69A 2P0KA 4E7HA 3J80E 4J8OA 2VUBA 4PLIA 4LDYA 1BIBA 4MMLA 1KQSA 3M57A 5LJ5j 2LQKA 4EMKC 5HKCA 4E7IA 2LCCA 2F5TX 3GP8A 1M1GA 3AHUA 4GLKA 1VQ5T 4EMGA 4C92E 2B8AA 4JS4A 4F7UB 5GMKi 1KD1U 3X28B 1G3SA 4PJOD 2GF7A 3SWNA 2JUFA 3EFSA 2DZCA 4IUTA 4X9DA 1U8RA 2KMTA 3L42A 3MP1A 3I55T 3CPFA 1ZBXA 2DD5A 5GMKh 5DLQE 2RI3A 5LJ3g 5D6XA 5A0GA 2IG0A 2JTMA 1G3WA 2E12A 3MEVA 5GMKj 5I2SA 5CVIA 3OW2S 1VUBA 1S72A 3SWNB 2E65A 2M1HA 2JOYA 3HRSA 3X25B 1W2BA 5GMKe 1YBYA 1Y71A 2YLBA 1K9MC 3DLMA 3MP6A 4II1A 5IAYA 3HFOA 1RL2A 2KSSA 3M58A 4VUBA 1FXXA 2XU8A 3CBOA 3QPHA 3L2QA 3CXCA 1VQLA 1H3ZA 3GF5A 3GOXA 3Q1JA 3RUXA 2M0OA 4KT0E 2RD1A 1Q7YC 4PJOE 3BDUA 4E7KA 3QJYA 3SB2A 3HHTB 4C0GA 4HCZA 5KE2A 4LDUA 4LD6A 1WJSA 2M16A 1VQPA 3X26B 5KCHA 2VGMA 2LC4A 2HNIA 3M5AA 1SSFA 5CO7A 3QDRB 3OYHA 1KHIA 3LGLA 4R56A 1Q82C 5GAOm 3TU4K 3CCUA 3RMSA 3OYYA 2L5QA 1DJ7B 5A0DA 3CCET 3MO8A 4PNOA 1YJ9A 1U1SA 2CZ0B 2KVQG 4M78G 2GFAA 3FIFA 5LJ5f 1W4SA 4M75D 2RHZA 3CCJA 3RKXA 3MEWA 1I81A 4Y28E 4D6WA 4C0FA 3HSBA 4M7DA 1NPPA 4MMKA 1IZ6A 4Z02A 5GAMj 3HRTA 4BY6C 4M78F 1QW1A 3RKYA 3JRZA 3C12A 1VQPT 4XTXA 4XU3A 2LT4A 1XNIA 2KAFA 2E64A 2XICA 3MEAA 3MHXA 5KE3A 4EMHA 2WSCE 1Q81U 5FU6B 1B34B 4QQDA 1OZ3A 3P8HA 1Q81C 2FVUA 1P92A 2EYQA 3OBWA 3QJ6A 2DPPB 3M4YA 2RJEA 2DXUA 3OS5A 3OA6A 2PQWA 2O4XA 4J6YA 3JCMP 4M75E 3UT1A 2WSEE 3HP9A 3BW1A 3PMIA 4BB7A 1KC8U 3CCJT 1X01A 5CK9A 4C92C 1BI2A 3GNFB 1KC8C 5GAN3 3OYMA 4P5NA 4C0DB 4RG2A 2CYZB 2K57A 1VQ4A 3CCLA 5CKDA 2EAYA 2KY9A 5HK3A 4QVZA 3A5ZB 1M90C 4HA8A 2O4XB 1WQ7A 3QHSA 3OB9A 4M78B 4RCCA 3JCMe 5GANh 1WPYA 3PTAA 3KBGA 4M7AA 2L8DA 4XAXB 2ZPIB 2DXTA 1Y7XA 4DOWA 1YCYA 2RI5A 5GANj 1G5VA 2E1HA 1NZ9A 3OYIA 2EQJA 3OYBA 2EQMA 3H8ZA 2D9TA 1JRIA 4KUIA 5GANe 2QDYB 4JLIA 4DQ2A 3CD6A 2DVEA 3C94A 3KUFA 4OB3B 4BD3A 1JJ2S 2HBPA 3A8LB 3OYNA 3VUZA 2R58A 1N9SA 2RJDA 2E70A 4CRIA 2G3RA 4ELZC 5GAOl 2PUKB 4BE0A 3VKIA 3E1SA 5GAMf 2DTHA 3OYDA 5CCAA 4PKCC 3CCLT 1VQ4T 4PJOC 3A8MB 4Q5WA 3CC4T 2GCXA 5FU7B 4XQ3A 2V8KA 1H641 4DA4A 3CCMT 4C92G 2A3LA 2RI2A 4M77G 4E7LA 4FT4A 4F7UA 5KH6A 3CMEA 1ZHIA 1KQ1A 2LQ8A 4L59A 2LT1A 4ZGDB 3JB9F 3NTKA 4OB0B 3V8LA 1OZ2A 1N8RC 3CD6T 1QVGS 5CQYA 2LCLA 5LJ3h 1HK9A 4RG8A 4XU0A 4M77F 4IUQA 2XI9A 3OW2A 5FRMA 4MDWA 3QZ9B 2EJ9A 5LJ3j 3FLGA 3CC7A 3E19A 4C5EA 2XDDA 2QQSA 4IUUA 5CAIA 4LD9K 2X4WA 1K8AU 4JUVA 5CKFA 3JCMf 4OF1A 5CIUA 3OYFA 1KD1C 2RJCA 1M1FA 2ZPGB 3JCMV 5LJ3e 4BDYA 1KHCA 3TEEA 4EDUA 1UGPB 3M59A 2JN0A 3PT9A 4XTVA 4JRPA 2VGNA 5AYFA 4ELYC 3CMET 3INZA 4C8QG 3CCEA 4PJOG 2BIVA 3V7CA 3MP8A 5GAMd 4R55A 3HFNA 2DIQA 3PMTA 4HT8A 3OYEA 3LGFA 1PSFA 3JAME 4ME7A 1BKBA 1Q86U 1X75C 2JTFA 2XKOC 3QUIA 2OAUA 4IUPA 5LJ5g 3CBMA 4M75C 1YITA 2X4JA 3OMCA 4C92B 4C8QF 1VQ9T 4M77B 1Q86C 3OS0A 3CC7T 3SFMA 2E6ZA 2RK2A 2CS7A 2DO3A 3LW5E 4E47A 1VQNA 3ER0A 5GAN5 3A8GB 3CCRT 5GAOn 4C5GA 1BIAA 3ME9A 1LJOA 2LDMA 3VU3C 4M7DD 4ZTJA 3CBPA 4OGCA 2EQUA 2HD0A 4JRKA 4MZTA 2HAXA 1K73U 1N9RA 2LNVA 3HKSA 4QVCA 5J39A 3FB9A 1XTDA 3JCMc 2YLCA 2RHIA 3C95A 3R6OA 4BE2A 5IN1A 4BI4A 4QQGA 4LDVA 4M7AC 3OSSC 5D6YA 2DIGA 3V7SA 4O6JA 4A54A 1BI1A 1KG1A 1VQ7A 1N6AA 1B34A 2NLUA 3JB9J 1YITT 4FIBA 2QI2A 2XHCA 2JNGA 4N4IA 4J7IA 3VYHB 2QQ9A 3H6ZA 3QBYA 3G6ET 1NJIU 1BI3A 3L2ZA 3M9QA 4C8QB 1VQNT 2OTJT 3BDLA 3ASKA 4FM4B 1AHJB 2CZ1B 2PU9B 4C0ZA 3JB9I 3RKWA 3M55A 4M7DE 2MWPA 4M75G 4V2SA 2BKDN 3L2RA 2DXCA 3HL8A 3N5BB 5EG2A 4EPCA 1JB0E 5C6SA 1JBMA 2X4XA 2ZZDA 3VJPA 1FWZA 5LL6S 4M7AD 4C5IA 1VQMA 2EWNA 2LX9A 1I5LA 1M8VA 4EMKB 4LDWA 3MCAB 2HQXA 4M78A 1VQOT 3J7AF 1QP3A 1G3YA 5GAN8 3BFMA 3FJPA 5FLXE 1VQ7T 3OS1A 4FT2A 4N0AA 4OVAA 1JJ2A 5GMKm 4KBMB 2E5QA 4BDZA 5GAMg 3WVDB 2LVMA 5LJ5d 3E9FA 3GLXA 3CC4A 1I4K1 4NS5A 3T9NA 3DB3A 3CCMA 1WJQA 4QVDA 3OYLA 2PUOB 1NPRA 3VYGA 3ZBDA 3I56T 3L2VA 2XIDA 4JJNK 3SWNC 3G4ST 3V8KA 4M7AE 2X35A 3RERA 3L2WA 1VQMT 2R5AA 3JCMX 1YJNA 1WNLA 3CEYA 3PFSA 1O75A 4JRIA 4BE1A 2XDPA 4A53A 2VXFA 3QO3A 2FL7A 2YRVA 3F70A 4J7FA 5GAOp 3WXMB 3URGA 5GAN7 4BACA 3ZEHA 4J6XA 5IT9E 5I2MA 1QVGA 3HRUA 3UPUA 1QP2A 4C5HA 3J81E 1LNXA 3NTHA 3META 1RI0A 2E6NA 4A4GA 4RMOA 3LWIA 4J5YA 4XU2A 5GAN4 2YHTA 5CKBA 2VC8A 4X9CA 3SDZA 2RH2A 3JB9D 4MDXA 2RHYA 4NOYA 3A8OB 2OTLT 3LLRA 4BI3A 4J6WA 3LWHA 3LX7A 1M1KU 3SD4A 2RO0A 5A2QE 1ZQ1A 2VV5A 2MWOA 4JLGA 3QIIA 4PLLA 3HPWA 2QEXT 5CKHA 4F7UE 1YIJA 2CGHA 1YJNT 4A4KA 4B9WA 3CCST 4J83A 4M77D 2K3XA 3CMAA 2ZPFB 4DOVA 2IVWA 2V8IA 1XOVA 4C92F 2L3RA 4OP0A 4A4HA 3M54A 5GAOq 2ZGWA 3A8HB 2GQVA 4Y91A 1VQ9A 5CR2A 3CPWS 4QW2A 4ZN3A 2KQWA 2EKOA 4BY6B 1UGSB 1FX7A 1BYMA 1V29B 2EJFA 2FB7A 3CCRA 2KDSA 5GAOr 3V8JA 3FEOA 3G7ZA 2O01E 1K8AC 5LJ5h 4RCBA 4UC4A 3QZ5B 1U1TA 4O5VA 4M7DC 4TVRA 4XU1A 5A0LA 2I2LA 3V7RA 2XDBA 4HT9A 4C92A 3PIPA 4M77A 5CQXA 2FHDA 3GPLA 5GANf 1YIJT 3OYCA 3OYGA 1X6OA 4JRQA 1Y96B 2GFUA 2MAMA 3OQ5A 4M77E 2QTXA 5LJ5e 5GMKl 3CMAT 3PIOA 1M5Q1 4JS5A 2K2VA 4C8QD 5HK0A 4N4HA 2M9UA 4XTWA 5HY6A 3JCMb 4C0DC 3CCQA 3NTIA 2C06A 4FU6A 2XK0A 1HXDA 1QVFS 2CZ7B 3OS2A 2A7YA 3DB4A 4PJOF 3WVEB 2RB6A 3G6EA 2OTJA 4JDSA 3FDRA 4M78C 3GIBA 4X34A 1KQSS 1WGSA 3OBYA 3QYGB 2RA2A 2DEQA 2PVGB 2PVDB 3GNGA 3M4GA 4MZPA 5C0MA 3EAEA 2WSFE 1NE8A 3OMGA 1I8FA 1TH7A 4NL2A 4N0AC 2VYTA 1OI1A 1Y07A 3C4SA 3EFRA 1K9MU 1K73C 2RHXA 4KULA 3CCVA 2CZ6B 2LRQA 2F5KA 3P8DA 4C8QA 3JCMd 2DZ9A 3OSVA 1MGQA 2FYKA 2PVOB 4PJOA 2D0QB 2EQKA 4M7DG 3FC3A 1VIFA 4XTUA 1VQOA 5GAN6 1WJRA 1Q7YU 1KQ2A 4KUDK 2Y4YA 4C8QE 2QQRA 5DLOA 5CKEA 3L2UA 3S6WA 3S3NA 4ATOA 3CCQT 4ZN1A 3OYJA 1VQ8A 2ZPEB 3VUBA 3VV0A 4M78D 3M53A 3QXEB 5LJ3f 4ZGJB 5GANd 1OYXA 1Q82U 5FU7C 2KK4A 3X20B 4M7DF 4EMKA 1NJIC 1W2BS 3MEUA 1M4ZA 1LOJA 4FL6A 4OGEA 2DTIA 4ZGEB 3I56A 2XD0A 1GXIE 3CXCS 4XTYA 1S72T 4OB1B 2L89A 2K3YA 3G4SA 2ZCFB 5J3BA 3O8VA 1EIFA 4RKUE 4L5GA 2QQBA 3CCVT 3JCMQ 5GAMh 3TREA 3QYHB 5DY9A 1IREB 3JCMW 1WQWA 4M75F 2P0PA 4PL6A 1VQLT 2WACA 2XG8D 3NFCA 3RIRA 1VQ6A 3CC2T 4HCCA 4IKFA 1YJWA 2E10A 3FRNA 3QG1A 4CI0C 3RMQA 1UGQB 1VQ8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 K;  1ZBX A;  3PTA A;  4DA4 A;  1M4Z A;  3PT9 A;  4FT4 A;  4DOW A;  3TU4 K;  1ZHI A;  4JJN K;  4FSX A;  2FVU A;  4KUL A;  4KUI A;  1W4S A;  4BB7 A;  4DOV A;  4KUD K;  2FL7 A;  4FT2 A; 
#chains in the Genus database with same CATH topology
 2QQA A;  4IUR A;  2ED0 A;  2VXE A;  2DJZ A;  2RHU A;  3S3O A;  4MZM A;  1MHN A;  4HKE A;  3X24 B;  1D3B A;  3PGG A;  1R8O B;  1WFW A;  3ZFJ A;  1WHM A;  1QCN A;  5LJ3 d;  1UHC A;  3JB9 H;  1WDX A;  3E9G A;  3CCS A;  5I21 A;  4L6V 5;  4B9X A;  3KXT A;  1RAF B;  1YJW T;  1D3B B;  1M90 U;  2D6F A;  3OYA A;  2E3I A;  2EGA A;  1B7T A;  4LUE A;  2MF2 A;  5L23 A;  3REA B;  2R5M A;  4F17 A;  1YI2 A;  2JZ2 A;  1VQK T;  5IHI A;  3JCM g;  2OTL Q;  2K4Y A;  4E7S A;  6AT1 B;  2MIO A;  2C0O A;  4F7U F;  3BY7 A;  4GY5 A;  1UJY A;  1QQJ A;  2ZPB B;  3EG9 A;  4A4E A;  2DBK A;  4WF2 A;  1BU1 A;  1SHF A;  2JM8 A;  3PNW C;  5FRN A;  1YHQ T;  4GLM A;  2C06 A;  4BUG A;  1RAD B;  2EBP A;  2RM4 A;  2P0Q A;  2QA4 T;  2K3B A;  4BI8 B;  3EG9 B;  2ROL A;  3UDC A;  2MOX A;  3J80 E;  4PLI A;  4MML A;  1M2O A;  2DMO A;  1VQ5 Q;  1SEM A;  2F5T X;  3GP8 A;  2DLP A;  3AHU A;  2COZ A;  4F7U B;  5GMK i;  1K4U S;  4F16 A;  1CSK A;  1WXT A;  2HL5 C;  1ZBX A;  1RAC B;  2DD5 A;  5DLQ E;  3RNJ A;  5LJ3 g;  2J06 A;  1ZA1 B;  2E12 A;  1R77 A;  2YUO A;  3OW2 S;  1MMA A;  2NYS A;  2M1H A;  4F14 A;  1W2B A;  3DLM A;  1PCX A;  3MP6 A;  3RR6 A;  1VQL A;  1ZBJ A;  9ATC B;  1H3Z A;  3GF5 A;  2M0O A;  4PJO E;  1YFN A;  3QJY A;  4C0G A;  4HCZ A;  1ZLM A;  2YRD A;  4LD6 A;  1WJS A;  4LDU A;  1Z9Q A;  1GRI A;  4JJD A;  2HNI A;  5CO7 A;  3QDR B;  4J9I A;  4R56 A;  3TU4 K;  1WX6 A;  3RMS A;  4QT7 A;  2L5Q A;  1DJ7 B;  1OPL A;  4D8D A;  1D1C A;  3MO8 A;  4CC2 A;  3VS7 A;  1QLY A;  2X9H A;  4AG2 C;  4M4Z A;  4GBQ A;  4Y28 E;  3EG1 A;  2Z0W A;  1IZ6 A;  4BY6 C;  4DEY A;  4M78 F;  1TSF A;  2E64 A;  2DL7 A;  5KE3 A;  2WSC E;  2PTK A;  4AMC A;  2FVU A;  2EYQ A;  3M4Y A;  2RJE A;  2NUP A;  3CCJ Q;  1D09 B;  1KC8 U;  4FYV B;  2J7I A;  1K73 R;  5CK9 A;  5GAN 3;  4P5N A;  4ZNX A;  4C0D B;  4RG2 A;  1QMC A;  2EAY A;  2KY9 A;  4QVZ A;  4HA8 A;  3QHS A;  5GAN h;  2KEA A;  4M78 B;  3JCM e;  1RAH B;  3KBG A;  1M3A A;  3PTA A;  4XAX B;  2ZPI B;  1Y7X A;  5GAN j;  2E1H A;  2EQJ A;  2KI7 A;  1HJD A;  2D9T A;  2I0N A;  2DVE A;  3C94 A;  4BD3 A;  1JJ2 S;  2JM9 A;  5KYW A;  2E3H A;  2SEM A;  1N9S A;  1WA7 A;  2E70 A;  1VQ4 Q;  2G3R A;  5GJV B;  4ELZ C;  5GAO l;  4BE0 A;  3OYD A;  3CC4 Q;  3CCL T;  2O9V A;  3A8M B;  4HVW A;  2GCX A;  2QAS A;  1TUG B;  2V8K A;  3EHR A;  4C92 G;  2A3L A;  5KYW B;  3CME A;  1KQ1 A;  4L59 A;  4ZGD B;  3V8L A;  2O88 A;  1QVG S;  1C1A A;  4XU0 A;  4M77 F;  5FRM A;  4MDW A;  4CC7 A;  4PJL A;  3E19 A;  1GBQ A;  4C5E A;  2XDD A;  1WHJ A;  1RUW A;  2X4W A;  2KRM A;  4JUV A;  5CKF A;  1K0S A;  1YCS B;  2E5K A;  5CIU A;  5LJ3 e;  1KD1 C;  3JCM V;  4EDU A;  4XTV A;  3PT9 A;  2ZAE A;  3C0C A;  3INZ A;  1IHW A;  4C8Q G;  5I11 A;  3CCE A;  4R55 A;  3TSW A;  2DIQ A;  1TUC A;  3PMT A;  3TQ7 P;  3OYE A;  2K6D A;  1X75 C;  4FCY A;  2OAU A;  4M77 B;  2DJQ A;  3OS0 A;  2EVR A;  2RK2 A;  3LW5 E;  4E47 A;  1M1K R;  5GAN 5;  1AWX A;  1Y0M A;  2ATC B;  2HD0 A;  4MZT A;  3HKS A;  1KQS P;  4BE2 A;  5IN1 A;  4M7A C;  5D6Y A;  2DIG A;  4J9E A;  3V7S A;  1LPL A;  5KYU B;  1YIT T;  2NLU A;  4FIB A;  2QGG A;  1V1C A;  4N4I A;  4ORZ A;  4J7I A;  3VYH B;  1NJI U;  3H6Z A;  3G6E T;  1YWO A;  1VQN T;  3I9Q A;  3ASK A;  4FM4 B;  4M7D E;  4V2S A;  4M75 G;  2JJ9 A;  2FRW A;  4PFO A;  5D7U A;  1NM7 A;  1SKU B;  2CT3 A;  1BBZ A;  2P4R A;  1FWZ A;  5LL6 S;  4J9H A;  2EGC A;  1F1B B;  4EMK B;  2HQX A;  1VQ7 Q;  1QP3 A;  1G3Y A;  2LX7 A;  2PZ1 A;  4N0A A;  1U5S A;  1K9M R;  4Z8A A;  4BDZ A;  4NS5 A;  3CCM A;  3OYL A;  4HCK A;  1NPR A;  3I56 T;  4M7A E;  2X35 A;  2KNB B;  3RER A;  2BE7 D;  1K9A A;  1VQM T;  1T3S A;  3PFS A;  1Q82 R;  2GGR A;  1ARK A;  1H3H A;  4A53 A;  2GNC A;  1RAE B;  2VXF A;  3F70 A;  4J7F A;  3URG A;  2QG9 B;  3HRU A;  3UPU A;  2FZC B;  3U23 A;  4C5H A;  3J81 E;  1KJW A;  3MET A;  1D0Z A;  3EG0 A;  1WHL A;  4XU2 A;  4E2F B;  2QTV A;  5GAN 4;  5CKB A;  2VC8 A;  2RH2 A;  2RHY A;  4NOY A;  3A8O B;  1K0X A;  1I07 A;  3LLR A;  4FYY B;  4BI3 A;  1FYN A;  3LWH A;  3LX7 A;  3SD4 A;  2MWO A;  4PLL A;  3QII A;  1YIJ A;  3HPW A;  1YJN T;  3CCS T;  4J83 A;  4M77 D;  2K3X A;  2YSQ A;  1Q81 R;  4DOV A;  2V8I A;  1XOV A;  4C92 F;  5GAO q;  2ZGW A;  1I5O B;  2GQV A;  2QGF B;  1UGS B;  2LMJ A;  2DL8 A;  1BYM A;  2EJF A;  2HL3 A;  1K8A C;  5LJ5 h;  4TVR A;  1UUE A;  5A0L A;  2XDB A;  4C92 A;  3PIP A;  1M90 R;  3I5S A;  2BZX A;  3EFO B;  3GBQ A;  1X6O A;  4JRQ A;  5GMK l;  3CMA T;  2NWM A;  5HK0 A;  2M9U A;  3NTI A;  2DA9 A;  3CCR Q;  3E2U A;  2O9S A;  3FDR A;  3UA7 A;  3OBY A;  2RA2 A;  5C0M A;  2PVD B;  2G6F X;  2WSF E;  2KT1 A;  1I8F A;  1TH7 A;  3MJX A;  2VYT A;  3CCV A;  2CZ6 B;  2LRQ A;  4C8Q A;  2DZ9 A;  2D0Q B;  3OW2 P;  4KGV B;  4XTU A;  1H92 A;  2HDA A;  1KQ2 A;  3CCQ Q;  4C8Q E;  2QQR A;  5DLO A;  3S3N A;  2QAZ A;  2KYB A;  3OYJ A;  2OTJ Q;  1SRL A;  5LJ3 f;  1GL5 A;  1HYO A;  2KK4 A;  2LP5 A;  3X20 B;  2RNA A;  3VS4 A;  1W2B S;  1RAG B;  2JT4 A;  4XTY A;  4OB1 B;  2L89 A;  2ZCF B;  1FMW A;  1EIF A;  3JCM Q;  3QYH B;  4PK4 A;  2A37 A;  3O5Z A;  4KRT A;  2CSI A;  4M75 F;  1M3B A;  1VQL T;  2WAC A;  3RIR A;  4HCC A;  4KGX B;  2MPX C;  2EGE A;  3LH0 A;  1O9S A;  2CSQ A;  3QKJ A;  4JZ4 A;  2M0Y A;  3NHN A;  1NYF A;  1IB8 A;  1BI0 A;  4M75 A;  2HQE A;  2OTL A;  5KYY A;  3L1A A;  3OYK A;  2K7A A;  3S3M A;  1AT1 B;  5IXF A;  3JCM h;  2EFI A;  1YJW Q;  2MMP A;  2RK1 A;  1S1N A;  4ZTF A;  4M75 B;  1EFN A;  5J26 A;  2CP6 A;  1VQK Q;  2E41 A;  1NEB A;  4F7U G;  1D0Y A;  2MI6 A;  3CC2 Q;  2QEX Q;  2KXD A;  5HCK A;  3G71 T;  1VQ5 A;  2HZY A;  4LN2 A;  4C92 D;  4AT1 B;  1YHQ Q;  2LTO A;  2P4T A;  1OX8 A;  4WCI A;  1LCK A;  3DLL A;  1JJ2 P;  2DTO A;  3P8B B;  1XQH A;  4NL3 A;  2QA4 Q;  2AIR B;  1Y96 A;  3DKM A;  2CP0 A;  1G2B A;  4J8O A;  3D7S B;  2ECZ A;  1PG5 B;  4E7I A;  4EMG A;  1IGU A;  1GCQ A;  2CUB A;  4LXC A;  1G3S A;  1QVG P;  2GF7 A;  3SWN A;  3EFS A;  1J3T A;  1U8R A;  4DBR A;  3I55 T;  1M30 A;  2P84 A;  5D6X A;  5A0G A;  1BK2 A;  4AFQ C;  5I2S A;  1VUB A;  3MPU B;  3SWN B;  2JOY A;  3X25 B;  5GMK e;  1TU0 B;  1Y71 A;  1VYU A;  2YLB A;  5IAY A;  3HFO A;  4VUB A;  4PJN A;  3CXC A;  4J9B A;  1PKT A;  3Q1J A;  3RUX A;  1Q7Y C;  3BDU A;  3SB2 A;  5KE2 A;  2M16 A;  2DEU A;  5KCH A;  2VGM A;  2LC4 A;  3M5A A;  3OYH A;  2JS0 A;  2RQV A;  1IHV A;  2AZV A;  1WHG A;  1OX9 A;  5A0D A;  2VB6 A;  3CCE T;  2W10 A;  4PNO A;  2CZ0 B;  4M78 G;  4M75 D;  2RHZ A;  3CCJ A;  3MEW A;  1I81 A;  4ANJ A;  1IGQ A;  2OX7 A;  5GAM j;  1U3O A;  2EYY A;  1QW1 A;  1NLO C;  1VQP T;  4XTX A;  4XU3 A;  1XNI A;  2KAF A;  3THK A;  3MEA A;  3CCU Q;  1Q81 U;  4EMH A;  1B34 B;  1OZ3 A;  2E4H A;  1YJ9 Q;  1P92 A;  2DPP B;  2DXU A;  3OS5 A;  3OA6 A;  2PQW A;  2XMF A;  3HP9 A;  1M27 C;  3BW1 A;  1TWB A;  2AT1 B;  1X01 A;  2CT4 A;  2LJ3 A;  3QWX X;  1BI2 A;  3GNF B;  1KC8 C;  3NGP A;  1VQ4 A;  2J6F A;  4J9F A;  1SRM A;  2H8H A;  3RDV A;  2CP5 A;  3TSZ A;  4J9C A;  2KR3 A;  1WQ7 A;  4ESR A;  4RCC A;  1ZA2 B;  2DXT A;  1YCY A;  1VA7 A;  2RI5 A;  1G5V A;  3OYI A;  1V76 A;  2EYX A;  3H8Z A;  1NJI R;  1JRI A;  2V26 A;  3KUF A;  2DL4 A;  4OB3 B;  3OYN A;  3CCL Q;  2YWW A;  3EGX A;  3VKI A;  2DTH A;  5CCA A;  4PJO C;  2F2W A;  3CCM T;  4M77 G;  4PFP A;  4F7U A;  1OUL A;  1JXM A;  2LT1 A;  3NTK A;  3EGX B;  1WXU A;  1N8R C;  1WI7 A;  3CD6 T;  4IUQ A;  2L2P A;  1QCF A;  3QZ9 B;  2EJ9 A;  1ZSZ C;  4IUU A;  3M0T A;  4OF1 A;  2RJC A;  1OV3 A;  2ZPG B;  3M59 A;  2DFU A;  4AFU C;  2VGN A;  4AG1 C;  4ELY C;  2BIV A;  5GAM d;  3MP8 A;  1C0M A;  2CRE A;  3LGF A;  3MKD A;  5IH2 A;  3NPF A;  3EHQ A;  3VS0 A;  3QUI A;  2JTF A;  2L0A A;  3OMC A;  2COW A;  3CC7 T;  1I0C A;  2HKN A;  2CS7 A;  4C5G A;  4IIO A;  3VU3 C;  2DBM A;  4ZTJ A;  4OGC A;  4JRK A;  2IPO B;  1N9R A;  1EZZ B;  3FB9 A;  1UDL A;  1PRM C;  2ED1 A;  2YLC A;  2RHI A;  2OAW A;  1YIT Q;  3A98 A;  1VOM A;  4A63 B;  2HEQ A;  1KG1 A;  1VQ7 A;  1N6A A;  2QI2 A;  1VQN Q;  1A0N B;  3QBY A;  1BI3 A;  3M9Q A;  2J6O A;  2AK5 A;  4PJO B;  3JB9 I;  4C0Z A;  2MWP A;  2BZY A;  3L2R A;  3UAT A;  2DXC A;  3HL8 A;  3N5B B;  1E6G A;  1ZSG A;  2ZZD A;  1W2B P;  4Y92 A;  2EWN A;  4F04 B;  4M78 A;  3OS1 A;  2MCN A;  2LQN A;  1JO8 A;  1QKX A;  3LH5 A;  2RN8 A;  5GAM g;  2LVM A;  5AT1 B;  2YDL A;  3T9N A;  1WJQ A;  3SEM A;  4OMO A;  2HKQ B;  3VYG A;  5IHK A;  1Y57 A;  5IXB A;  1VQM Q;  3I35 A;  3JCM X;  2YUN A;  4JRI A;  3QO3 A;  4KH0 B;  5GAN 7;  4BAC A;  5IT9 E;  2EKH A;  1LNX A;  4QKU A;  1PC0 A;  1SF9 A;  1RI0 A;  2E6N A;  1AOJ A;  1SHG A;  2HMA A;  3ZL7 C;  4KGZ B;  2OTL T;  1JQQ A;  1YJN Q;  1ACM B;  1ZQ1 A;  2VV5 A;  4A4K A;  4B9W A;  1X2Q A;  1JU5 C;  1NBE B;  3EH1 A;  2GTO A;  2DRM A;  2DF6 A;  2VKN A;  4ZN3 A;  1UGV A;  1G83 A;  4BY6 B;  1FX7 A;  3CCR A;  3H0F A;  2DRK A;  3G7Z A;  2O01 E;  3PVL A;  4M7D C;  4XU1 A;  4LNP A;  4M77 A;  3GPL A;  3CMA Q;  2COY A;  2GFU A;  2RQW A;  4M77 E;  1W70 A;  1VQ9 Q;  5HY6 A;  1NLP C;  3JCM b;  3CCQ A;  1MMD A;  1HXD A;  3DB4 A;  2OTJ A;  4JDS A;  2YUP A;  3GIB A;  2DEQ A;  2PVG B;  3GNG A;  2A0F B;  1NE8 A;  5KYU A;  4N0A C;  1YNZ A;  2W0Z A;  1OI1 A;  1Y07 A;  1AWW A;  1K73 C;  2RHX A;  4KUL A;  3AT1 B;  3P8D A;  3OSV A;  1MGQ A;  2PVO B;  3FC3 A;  3VS2 A;  4PJM A;  2HSP A;  5CKE A;  1FMV A;  3S6W A;  3VV0 A;  4M78 D;  3QXE B;  2LNH B;  5GAN d;  5FWB A;  5FU7 C;  5GJW B;  4WTO B;  4M7D F;  4EMK A;  3MEU A;  4FL6 A;  4OGE A;  2DER A;  3NMZ C;  4ZGE B;  3CXC S;  2DYB A;  2K3Y A;  5J3B A;  4J9G A;  1C6V X;  1Q95 G;  2QQB A;  3TVT A;  1VQO Q;  1WQW A;  2P0P A;  2FZK B;  2XG8 D;  1MNE A;  2A08 A;  1YJW A;  3FRN A;  4FW1 A;  3JAM E;  1VQ8 T;  1SPK A;  2DK3 A;  1YP5 A;  5GAM e;  3EGD B;  2EYW A;  3M56 A;  1VQK A;  4IUV A;  5L8R E;  1Q86 R;  4CC4 B;  4M7D B;  1AZG B;  2CKK A;  3G4S Q;  4FSX A;  4OB2 B;  3CC2 A;  4M7A F;  2QEX A;  2JW4 A;  4HVV A;  1UB4 A;  3UWN A;  1GFC A;  1VQ6 T;  1ZUY A;  1YHQ A;  1G3T A;  4E7J A;  4DBQ A;  3HTR A;  2QA4 A;  2V8J A;  4E6R A;  8ATC B;  5KCO A;  1RLQ C;  2EQI A;  2DVJ A;  4OMF B;  3M0Q A;  4CC3 A;  3CPW A;  4A4F A;  5M9O A;  3G71 Q;  2YT6 A;  2FEI A;  4FSS A;  4RTV A;  4RTT A;  3RES A;  4JJC A;  2VVK A;  4DEX A;  4N4G A;  2QXF A;  4M7A B;  5GAN g;  1M1K C;  1UJ0 A;  1UEB A;  3JB9 G;  2H3J A;  2RJF A;  4AFZ C;  4C8Q C;  2BUD A;  2EJG A;  2K5I A;  2DD4 A;  3EFO A;  1YI2 T;  2Y4X A;  1PSE A;  1QVF A;  2F69 A;  4E7H A;  2VUB A;  4LDY A;  1BIB A;  3M57 A;  5LJ5 j;  2LQK A;  5HKC A;  2ABL A;  2O2O A;  1M1G A;  4GLK A;  3G1J A;  4C92 E;  2B8A A;  4JS4 A;  1OU9 A;  1KD1 U;  3X28 B;  5KYX A;  2L3Q A;  1SG5 A;  3I55 Q;  1SSH A;  4IUT A;  2K9G A;  2KMT A;  3L42 A;  1AD5 A;  3MP1 A;  2DET A;  2IG0 A;  2JTM A;  1K1Z A;  5EC7 A;  2HBW A;  3ULR B;  5KYX B;  1YBY A;  1K9M C;  3M58 A;  1IXD A;  1AEY A;  3CBO A;  2XU8 A;  3GOX A;  4E7K A;  1UFF A;  3HHT B;  1PM3 A;  1MMG A;  2GBQ A;  1KHI A;  1Q82 C;  3CCU A;  1S72 Q;  1YJ9 A;  1U1S A;  7AT1 B;  2EPD A;  3UA6 A;  3REB B;  4FW2 A;  3RKX A;  1NG2 A;  1PKS A;  4D6W A;  2EYZ A;  3HSB A;  4MMK A;  4KH1 B;  1VQP Q;  1MV0 B;  2B86 A;  3C12 A;  2CUD A;  3M0U A;  1VYV A;  1QCO A;  5FW9 A;  2H3E B;  2V1R A;  4B6M A;  1EX4 A;  1Q81 C;  3QJ6 A;  3M0P A;  1JEG A;  3H41 A;  4J6Y A;  4X1V A;  4M75 E;  2WSE E;  3PMI A;  2K79 A;  1D1B A;  3OYM A;  4OMM A;  2CYZ B;  3CCL A;  2KRN A;  5HK3 A;  1M90 C;  3A5Z B;  4DBH A;  3OB9 A;  1WPY A;  1W6X A;  2L8D A;  1GCQ C;  1NZ9 A;  3H0I A;  3OYB A;  1WLP B;  5GAN e;  2QDY B;  4JLI A;  4DQ2 A;  1UE9 A;  1RLP C;  3VUZ A;  2R58 A;  3EG2 A;  2L3S A;  2RJD A;  1Z9Z A;  5GAM f;  4PKC C;  1B3Q A;  2NUZ A;  5KH6 A;  1ZHI A;  2AKK A;  3JB9 F;  4OB0 B;  2RQU A;  1G8X A;  3CD6 Q;  2O31 A;  1QWE A;  5CQY A;  2KRS A;  2LCL A;  5LJ3 h;  1HK9 A;  2X3W D;  2DL3 A;  5KYN A;  2D0N A;  5LJ3 j;  3FLG A;  2QQS A;  5CAI A;  1K8A U;  3OYF A;  1E6H A;  1H8K A;  1KHC A;  3TEE A;  1UGP B;  4JRP A;  5AYF A;  3CME T;  1ZX6 A;  4PJO G;  2FRY A;  4DBF A;  2MK5 A;  4HVU A;  4ME7 A;  1BKB A;  2DYI A;  1M2V B;  1Q86 U;  3CC7 Q;  4Z88 A;  5LJ5 g;  1YIT A;  3CBM A;  3I5R A;  2QDL A;  3SFM A;  2DO3 A;  1VQN A;  3ER0 A;  2RPN A;  3CCR T;  5GAO n;  2EQU A;  3CQT A;  2LNV A;  4QVC A;  5J39 A;  1UHF A;  1XTD A;  3JCM c;  3C95 A;  4BI4 A;  1BCM A;  1M8M A;  2CP2 A;  2LZ6 B;  1B34 A;  1MMN A;  2AZS A;  2OTJ T;  3L2Z A;  3BDL A;  1OEB A;  1AHJ B;  3RKW A;  3M55 A;  1TTH B;  2KE9 A;  1GFD A;  5EG2 A;  1JBM A;  2X4X A;  1YN8 A;  2RQT A;  1UEC A;  4C5I A;  1VQM A;  2LX9 A;  3MCA B;  3CXC P;  3VRY A;  3J7A F;  3VS5 A;  3BFM A;  3FJP A;  4FT2 A;  1PWT A;  1ZUK A;  4OVA A;  4KBM B;  2E5Q A;  2VWF A;  3WVD B;  4LUD A;  3CC4 A;  3E9F A;  3GLX A;  2RMO A;  1I4K 1;  3DB3 A;  4QVD A;  3V8K A;  2FPD A;  4D8K A;  1YJN A;  4BE1 A;  1IRX A;  2XDP A;  1TUD A;  2JXB A;  4IIM A;  2FL7 A;  3WXM B;  2LJ0 A;  1UTI A;  3EGU A;  4J6X A;  2RF0 A;  2EW3 A;  5I2M A;  5IHN A;  4RTX A;  2M51 A;  3LWI A;  2HQH A;  2YHT A;  3JB9 D;  4MDX A;  2K2M A;  1MV3 A;  3CC2 T;  2RO0 A;  2QEX T;  4F7U E;  3R6N A;  4AFS C;  2ENM A;  3CMA A;  2X3X D;  2IVW A;  3M54 A;  1U06 A;  4Y91 A;  5ECA A;  1VQ9 A;  3CPW S;  4J9D A;  4QW2 A;  2KQW A;  2D8H A;  1V29 B;  5GAO r;  4RCB A;  4UC4 A;  2I2L A;  5CQX A;  4RTW A;  3EG3 A;  5GAN f;  4PFZ A;  2MYS A;  4OML A;  3OYC A;  1YIJ T;  3OQ5 A;  2QTX A;  5LJ5 e;  4R0K A;  3PIO A;  3VS6 A;  4XTW A;  4C0D C;  1QVF S;  1WZO A;  4OMP A;  2CZ7 B;  1KIK A;  4PJO F;  2RB6 A;  4M78 C;  2JS2 A;  3QYG B;  3EAE A;  3OMG A;  4NL2 A;  3H0H A;  1QKW A;  4LE9 A;  3A1P A;  2YXY A;  4PJO A;  3BE3 A;  2EQK A;  4M7D G;  1VIF A;  1VQO A;  1Q7Y U;  5GAN 6;  2CH4 A;  1LVK A;  2FPF A;  4ATO A;  3G6E Q;  4ZN1 A;  1OYX A;  2JTE A;  1NJI C;  1LOJ A;  1X69 A;  1GXI E;  1KD1 R;  4RTY A;  1ZSZ A;  3G4S A;  3O8V A;  3CCV T;  1IRE B;  3JCM W;  4PL6 A;  1PHT A;  2QYZ A;  1VQ8 Q;  2DIL A;  2SRC A;  3QG1 A;  2XID A;  2YUQ A;  4M78 E;  1ZSZ B;  2V1Q A;  4M7A G;  1ZUU A;  1UGR B;  1M9S A;  3M0S A;  3VS3 A;  2R57 A;  3I56 Q;  3CCU T;  1VYT A;  2K5L A;  4HCB A;  1HD3 A;  1YJ9 T;  3OY9 A;  2D1X A;  3G71 A;  1BCO A;  3JCM J;  1GBR A;  1VQ6 Q;  5GAN 2;  4LDX A;  3TCJ A;  4M77 C;  1OOT A;  2KXC A;  2Y90 A;  1D1A A;  3UF4 A;  1N27 A;  2NUP B;  1D0X A;  2DKG A;  2KYM A;  2X4Y A;  2JVV A;  3LYI A;  2IIM A;  2EIF A;  1UG1 A;  2AHJ B;  2KRO A;  3QSU A;  5DM7 R;  3CCS Q;  2DAQ A;  2ZPH B;  5D6W A;  1R0B G;  4XTZ A;  4YTL A;  2K5F A;  3JSC A;  4XK8 E;  2DXB A;  2NUT A;  4QQ6 A;  1YI2 Q;  1QVP A;  3I55 A;  1AVZ C;  1VIE A;  5FU6 C;  5FRO A;  3JV3 A;  1N8R U;  1KFZ A;  2P0K A;  1RAA B;  1KQS A;  2NUT B;  2FPE A;  4EMK C;  2LCC A;  1VQ5 T;  2C0T A;  2KBT A;  3FJ5 A;  4PJO D;  2JUF A;  4X9D A;  2DZC A;  3CPF A;  5GMK h;  2LQW A;  2RI3 A;  1TOV A;  1G3W A;  3MEV A;  4RTU A;  5GMK j;  1ABO A;  1OQK A;  5CVI A;  1S72 A;  4JZ3 A;  2E65 A;  3HRS A;  1X43 A;  1NYG A;  1TXQ A;  4II1 A;  1YWP A;  1RL2 A;  2KSS A;  2RQR A;  1FXX A;  3QPH A;  3L2Q A;  4KT0 E;  2RD1 A;  4Z89 A;  1VQP A;  2KT8 A;  3X26 B;  1SSF A;  1FMK A;  3LGL A;  5GAO m;  1WYX A;  2DE0 X;  1WXB A;  3OYY A;  2KVQ G;  2GFA A;  3FIF A;  3EGD A;  2D8J A;  1ABQ A;  5LJ5 f;  1K8A R;  1W4S A;  1VQL Q;  1TG0 A;  4C0F A;  4M7D A;  1NPP A;  1T0J A;  4Z02 A;  2JMA A;  3HRT A;  3RKY A;  3JRZ A;  1WHH A;  4PJJ A;  2X51 A;  2LT4 A;  2XIC A;  3MHX A;  1K76 A;  5FU6 B;  1HSQ A;  4QQD A;  3P8H A;  3OBW A;  4HXJ A;  1OPK A;  2O4X A;  3JCM P;  3UT1 A;  1PNJ A;  4BB7 A;  3CCJ T;  2F2X A;  4C92 C;  1R0C B;  1RAB B;  2K57 A;  5CKD A;  2O4X B;  4JJB A;  2CDT A;  2C0I A;  4M7A A;  2BZ8 A;  4DOW A;  5FWC A;  2EQM A;  4JPB W;  4KUI A;  3CD6 A;  2HBP A;  1T0H A;  1AZE A;  3A8L B;  1JXO A;  1TS9 A;  4CRI A;  2PUK B;  3E1S A;  1VQ4 T;  4Q5W A;  3CC4 T;  5FU7 B;  4XQ3 A;  4DA4 A;  1H64 1;  5I22 A;  2JMC A;  2RI2 A;  4E7L A;  4FT4 A;  2LQ8 A;  4OMN A;  1OZ2 A;  1T3L A;  4RG8 A;  2LJ1 A;  4E7Z A;  2XI9 A;  3OW2 A;  3CC7 A;  4OMQ A;  4EIK A;  4FYX B;  4LD9 K;  3JCM f;  1WHK A;  1M1F A;  1B07 A;  4BDY A;  1BB9 A;  3CPW P;  3CME Q;  2DNU A;  8AT1 B;  2JN0 A;  2J6K A;  2AKL A;  1X2K A;  2CP3 A;  3V7C A;  2FG0 A;  2LCS A;  3HFN A;  2GQI A;  4HT8 A;  1PSF A;  3KFV A;  2QK0 A;  2BE9 B;  2J05 A;  2XKO C;  4IUP A;  2FZG B;  4M75 C;  2X4J A;  1PD0 A;  4C92 B;  4C8Q F;  1VQ9 T;  1Q86 C;  2E6Z A;  3A8G B;  1BIA A;  3ME9 A;  1LJO A;  2LDM A;  4M7D D;  1AWO A;  1QVF P;  3SHW A;  3CBP A;  2HAX A;  4RUG A;  1K73 U;  2PNI A;  3CCE Q;  1QWF A;  2ESW A;  3R6O A;  4QQG A;  4LDV A;  3OSS C;  4K11 A;  4O6J A;  1I1J A;  4A54 A;  1BI1 A;  3JB9 J;  2XHC A;  2JNG A;  2QQ9 A;  2GTJ A;  1W1F A;  4C8Q B;  1XJW B;  2PU9 B;  2CZ1 B;  3QWY A;  2BKD N;  1KK7 A;  4EPC A;  1JB0 E;  5C6S A;  3PE0 A;  2FO0 A;  3VJP A;  4M7A D;  1I5L A;  1M8V A;  4LDW A;  1VQO T;  5GAN 8;  5FLX E;  1VQ7 T;  2HSE B;  1JJ2 A;  5GMK m;  1CKA A;  1N5Z A;  1X6G A;  2YRC A;  1GCP A;  5LJ5 d;  1Q7Y R;  1IO6 A;  2PUO B;  2DM1 A;  3ZBD A;  3L2V A;  4JJN K;  3SWN C;  3G4S T;  1E7O A;  3L2W A;  2R5A A;  2OI3 A;  1WNL A;  3CEY A;  1O75 A;  1WIE A;  5GAO p;  2YRV A;  5KYY B;  3ZEH A;  1PD1 A;  1QVG A;  1QP2 A;  3NTH A;  3CCM Q;  4A4G A;  4RMO A;  4J5Y A;  3SDZ A;  4X9C A;  3VRZ A;  3PVQ A;  1MUZ A;  4J6W A;  1M1K U;  1RAI B;  5A2Q E;  4JLG A;  5CKH A;  1PRL C;  2CGH A;  2DL5 A;  2ZPF B;  2L3R A;  1AWJ A;  1M3C A;  4OP0 A;  4A4H A;  3A8H B;  5CR2 A;  1NEG A;  2HCK A;  3IQL A;  2EKO A;  3QDF A;  2FB7 A;  2KDS A;  1CKB A;  2M02 A;  3V8J A;  3FEO A;  1KC8 R;  1M2V A;  2BTT A;  3M0R A;  1U1T A;  3QZ5 B;  4O5V A;  2F1L A;  4HT9 A;  3V7R A;  1YIJ Q;  2FHD A;  2DX1 A;  2F2V A;  3OYG A;  1Y96 B;  2MAM A;  1M5Q 1;  3EH2 A;  4JS5 A;  2K2V A;  4C8Q D;  4N4H A;  4FU6 A;  2XK0 A;  3OS2 A;  1RI9 A;  2A7Y A;  3WVE B;  3G6E A;  4X34 A;  1KQS S;  1WGS A;  3M4G A;  4MZP A;  3RBB B;  2ROT A;  3C4S A;  2CP7 A;  2A28 A;  3EFR A;  1K9M U;  1KSW A;  2OJ2 A;  2F5K A;  3JCM d;  2FYK A;  1WJR A;  3VS1 A;  4KUD K;  2Y4Y A;  1N8R R;  3L2U A;  3CCQ T;  1VQ8 A;  2ZPE B;  3VUB A;  3M53 A;  4ZGJ B;  4FYW B;  1Q82 U;  2A36 A;  1M4Z A;  1X6B A;  2DTI A;  3H9N A;  2L3P A;  3I56 A;  2XD0 A;  4RTZ A;  3CCV Q;  1S72 T;  4RKU E;  4L5G A;  1X27 A;  2VAS A;  5GAM h;  3TRE A;  5DY9 A;  2KGT A;  2CH4 W;  3NFC A;  1VQ6 A;  4IKF A;  2E10 A;  1MND A;  4CI0 C;  1OU8 A;  3RMQ A;  1UGQ B; 
#chains in the Genus database with same CATH homology
 4M78 E;  2QQA A;  2DK3 A;  3LH0 A;  1O9S A;  3QKJ A;  5GAM e;  4IUR A;  4M7A G;  2VXE A;  3M56 A;  2DJZ A;  2RHU A;  1UGR B;  3S3O A;  1VQK A;  4IUV A;  4MZM A;  1M9S A;  5L8R E;  1MHN A;  2R57 A;  4HKE A;  3CCU T;  4M7D B;  3X24 B;  2CKK A;  1BI0 A;  2K5L A;  4M75 A;  1D3B A;  2HQE A;  4FSX A;  3PGG A;  1R8O B;  4OB2 B;  4HCB A;  2OTL A;  1YJ9 T;  3L1A A;  3OYK A;  3ZFJ A;  3OY9 A;  3CC2 A;  3G71 A;  3JCM J;  4M7A F;  5LJ3 d;  2QEX A;  3S3M A;  3JB9 H;  1UB4 A;  3E9G A;  3CCS A;  3JCM h;  5GAN 2;  4LDX A;  3TCJ A;  2EFI A;  5I21 A;  2MMP A;  4L6V 5;  3UWN A;  4B9X A;  2RK1 A;  4M77 C;  3KXT A;  1VQ6 T;  4ZTF A;  4M75 B;  1YJW T;  1D3B B;  1YHQ A;  1G3T A;  1M90 U;  4E7J A;  3OYA A;  2D6F A;  2Y90 A;  5J26 A;  1N27 A;  2MF2 A;  2DKG A;  2E41 A;  2X4Y A;  2R5M A;  2QA4 A;  2V8J A;  2JVV A;  2JZ2 A;  4F7U G;  3LYI A;  1YI2 A;  5KCO A;  1VQK T;  2EIF A;  4OMF B;  3JCM g;  3CPW A;  2K4Y A;  2MI6 A;  4A4F A;  5M9O A;  2AHJ B;  3RES A;  3QSU A;  4PJO B;  5DM7 R;  3G71 T;  2DAQ A;  4F7U F;  3BY7 A;  4GY5 A;  2ZPB B;  2QXF A;  4N4G A;  2ZPH B;  4A4E A;  4M7A B;  5GAN g;  1M1K C;  1VQ5 A;  4C92 D;  4WF2 A;  2LTO A;  2P4T A;  5D6W A;  1UEB A;  3PNW C;  4XTZ A;  3JB9 G;  4YTL A;  5FRN A;  1YHQ T;  2K5F A;  2H3J A;  3JSC A;  4XK8 E;  3DLL A;  2DXB A;  2DTO A;  2RJF A;  1XQH A;  3P8B B;  4BUG A;  2BUD A;  2EJG A;  4QQ6 A;  4C8Q C;  4NL3 A;  1QVP A;  2K5I A;  2RM4 A;  2P0Q A;  3I55 A;  2DD4 A;  2QA4 T;  4BI8 B;  1YI2 T;  1Y96 A;  2Y4X A;  3UDC A;  3DKM A;  1VIE A;  5FU6 C;  1PSE A;  5FRO A;  1QVF A;  1N8R U;  2F69 A;  2P0K A;  4E7H A;  3J80 E;  4J8O A;  2VUB A;  4PLI A;  4LDY A;  1BIB A;  4MML A;  1KQS A;  3M57 A;  5LJ5 j;  2LQK A;  4EMK C;  5HKC A;  4E7I A;  2LCC A;  2F5T X;  3GP8 A;  1M1G A;  3AHU A;  4GLK A;  1VQ5 T;  4EMG A;  4C92 E;  2B8A A;  4JS4 A;  4F7U B;  5GMK i;  1KD1 U;  3X28 B;  1G3S A;  4PJO D;  2GF7 A;  3SWN A;  2JUF A;  3EFS A;  2DZC A;  4IUT A;  4X9D A;  1U8R A;  2KMT A;  3L42 A;  3MP1 A;  3I55 T;  3CPF A;  1ZBX A;  2DD5 A;  5GMK h;  5DLQ E;  2RI3 A;  5LJ3 g;  5D6X A;  5A0G A;  2IG0 A;  2JTM A;  1G3W A;  2E12 A;  3MEV A;  5GMK j;  5I2S A;  5CVI A;  3OW2 S;  1VUB A;  1S72 A;  3SWN B;  2E65 A;  2M1H A;  2JOY A;  3HRS A;  3X25 B;  1W2B A;  5GMK e;  1YBY A;  1Y71 A;  2YLB A;  1K9M C;  3DLM A;  3MP6 A;  4II1 A;  5IAY A;  3HFO A;  1RL2 A;  2KSS A;  3M58 A;  4VUB A;  1FXX A;  2XU8 A;  3CBO A;  3QPH A;  3L2Q A;  3CXC A;  1VQL A;  1H3Z A;  3GF5 A;  3GOX A;  3Q1J A;  3RUX A;  2M0O A;  4KT0 E;  2RD1 A;  1Q7Y C;  4PJO E;  3BDU A;  4E7K A;  3QJY A;  3SB2 A;  3HHT B;  4C0G A;  4HCZ A;  5KE2 A;  4LDU A;  4LD6 A;  1WJS A;  2M16 A;  1VQP A;  3X26 B;  5KCH A;  2VGM A;  2LC4 A;  2HNI A;  3M5A A;  1SSF A;  5CO7 A;  3QDR B;  3OYH A;  1KHI A;  3LGL A;  4R56 A;  1Q82 C;  5GAO m;  3TU4 K;  3CCU A;  3RMS A;  3OYY A;  2L5Q A;  1DJ7 B;  5A0D A;  3CCE T;  3MO8 A;  4PNO A;  1YJ9 A;  1U1S A;  2CZ0 B;  2KVQ G;  4M78 G;  2GFA A;  3FIF A;  5LJ5 f;  1W4S A;  4M75 D;  2RHZ A;  3CCJ A;  3RKX A;  3MEW A;  1I81 A;  4Y28 E;  4D6W A;  4C0F A;  3HSB A;  4M7D A;  1NPP A;  4MMK A;  1IZ6 A;  4Z02 A;  5GAM j;  3HRT A;  4BY6 C;  4M78 F;  1QW1 A;  3RKY A;  3JRZ A;  3C12 A;  1VQP T;  4XTX A;  4XU3 A;  2LT4 A;  1XNI A;  2KAF A;  2E64 A;  2XIC A;  3MEA A;  3MHX A;  5KE3 A;  4EMH A;  2WSC E;  1Q81 U;  5FU6 B;  1B34 B;  4QQD A;  1OZ3 A;  3P8H A;  1Q81 C;  2FVU A;  1P92 A;  2EYQ A;  3OBW A;  3QJ6 A;  2DPP B;  3M4Y A;  2RJE A;  2DXU A;  3OS5 A;  3OA6 A;  2PQW A;  2O4X A;  4J6Y A;  3JCM P;  4M75 E;  3UT1 A;  2WSE E;  3HP9 A;  3BW1 A;  3PMI A;  4BB7 A;  1KC8 U;  3CCJ T;  1X01 A;  5CK9 A;  4C92 C;  1BI2 A;  3GNF B;  1KC8 C;  5GAN 3;  3OYM A;  4P5N A;  4C0D B;  4RG2 A;  2CYZ B;  2K57 A;  1VQ4 A;  3CCL A;  5CKD A;  2EAY A;  2KY9 A;  5HK3 A;  4QVZ A;  3A5Z B;  1M90 C;  4HA8 A;  2O4X B;  1WQ7 A;  3QHS A;  3OB9 A;  4M78 B;  4RCC A;  3JCM e;  5GAN h;  1WPY A;  3PTA A;  3KBG A;  4M7A A;  2L8D A;  4XAX B;  2ZPI B;  2DXT A;  1Y7X A;  4DOW A;  1YCY A;  2RI5 A;  5GAN j;  1G5V A;  2E1H A;  1NZ9 A;  3OYI A;  2EQJ A;  3OYB A;  2EQM A;  3H8Z A;  2D9T A;  1JRI A;  4KUI A;  5GAN e;  2QDY B;  4JLI A;  4DQ2 A;  3CD6 A;  2DVE A;  3C94 A;  3KUF A;  4OB3 B;  4BD3 A;  1JJ2 S;  2HBP A;  3A8L B;  3OYN A;  3VUZ A;  2R58 A;  1N9S A;  2RJD A;  2E70 A;  4CRI A;  2G3R A;  4ELZ C;  5GAO l;  2PUK B;  4BE0 A;  3VKI A;  3E1S A;  5GAM f;  2DTH A;  3OYD A;  5CCA A;  4PKC C;  3CCL T;  1VQ4 T;  4PJO C;  3A8M B;  4Q5W A;  3CC4 T;  2GCX A;  5FU7 B;  4XQ3 A;  2V8K A;  1H64 1;  4DA4 A;  3CCM T;  4C92 G;  2A3L A;  2RI2 A;  4M77 G;  4E7L A;  4FT4 A;  4F7U A;  5KH6 A;  3CME A;  1ZHI A;  1KQ1 A;  2LQ8 A;  4L59 A;  2LT1 A;  4ZGD B;  3JB9 F;  3NTK A;  4OB0 B;  3V8L A;  1OZ2 A;  1N8R C;  3CD6 T;  1QVG S;  5CQY A;  2LCL A;  5LJ3 h;  1HK9 A;  4RG8 A;  4XU0 A;  4M77 F;  4IUQ A;  2XI9 A;  3OW2 A;  5FRM A;  4MDW A;  3QZ9 B;  2EJ9 A;  5LJ3 j;  3FLG A;  3CC7 A;  3E19 A;  4C5E A;  2XDD A;  2QQS A;  4IUU A;  5CAI A;  4LD9 K;  2X4W A;  1K8A U;  4JUV A;  5CKF A;  3JCM f;  4OF1 A;  5CIU A;  3OYF A;  1KD1 C;  2RJC A;  1M1F A;  2ZPG B;  3JCM V;  5LJ3 e;  4BDY A;  1KHC A;  3TEE A;  4EDU A;  1UGP B;  3M59 A;  2JN0 A;  3PT9 A;  4XTV A;  4JRP A;  2VGN A;  5AYF A;  4ELY C;  3CME T;  3INZ A;  4C8Q G;  3CCE A;  4PJO G;  2BIV A;  3V7C A;  3MP8 A;  5GAM d;  4R55 A;  3HFN A;  2DIQ A;  3PMT A;  4HT8 A;  3OYE A;  3LGF A;  1PSF A;  3JAM E;  4ME7 A;  1BKB A;  1Q86 U;  1X75 C;  2JTF A;  2XKO C;  3QUI A;  2OAU A;  4IUP A;  5LJ5 g;  3CBM A;  4M75 C;  1YIT A;  2X4J A;  3OMC A;  4C92 B;  4C8Q F;  1VQ9 T;  4M77 B;  1Q86 C;  3OS0 A;  3CC7 T;  3SFM A;  2E6Z A;  2RK2 A;  2CS7 A;  2DO3 A;  3LW5 E;  4E47 A;  1VQN A;  3ER0 A;  5GAN 5;  3A8G B;  3CCR T;  5GAO n;  4C5G A;  1BIA A;  3ME9 A;  1LJO A;  2LDM A;  3VU3 C;  4M7D D;  4ZTJ A;  3CBP A;  4OGC A;  2EQU A;  2HD0 A;  4JRK A;  4MZT A;  2HAX A;  1K73 U;  1N9R A;  2LNV A;  3HKS A;  4QVC A;  5J39 A;  3FB9 A;  1XTD A;  3JCM c;  2YLC A;  2RHI A;  3C95 A;  3R6O A;  4BE2 A;  5IN1 A;  4BI4 A;  4QQG A;  4LDV A;  4M7A C;  3OSS C;  5D6Y A;  2DIG A;  3V7S A;  4O6J A;  4A54 A;  1BI1 A;  1KG1 A;  1VQ7 A;  1N6A A;  1B34 A;  2NLU A;  3JB9 J;  1YIT T;  4FIB A;  2QI2 A;  2XHC A;  2JNG A;  4N4I A;  4J7I A;  3VYH B;  2QQ9 A;  3H6Z A;  3QBY A;  3G6E T;  1NJI U;  1BI3 A;  3L2Z A;  3M9Q A;  4C8Q B;  1VQN T;  2OTJ T;  3BDL A;  3ASK A;  4FM4 B;  1AHJ B;  2CZ1 B;  2PU9 B;  4C0Z A;  3JB9 I;  3RKW A;  3M55 A;  4M7D E;  2MWP A;  4M75 G;  4V2S A;  2BKD N;  3L2R A;  2DXC A;  3HL8 A;  3N5B B;  5EG2 A;  4EPC A;  1JB0 E;  5C6S A;  1JBM A;  2X4X A;  2ZZD A;  3VJP A;  1FWZ A;  5LL6 S;  4M7A D;  4C5I A;  1VQM A;  2EWN A;  2LX9 A;  1I5L A;  1M8V A;  4EMK B;  4LDW A;  3MCA B;  2HQX A;  4M78 A;  1VQO T;  3J7A F;  1QP3 A;  1G3Y A;  5GAN 8;  3BFM A;  3FJP A;  5FLX E;  1VQ7 T;  3OS1 A;  4FT2 A;  4N0A A;  4OVA A;  1JJ2 A;  5GMK m;  4KBM B;  2E5Q A;  4BDZ A;  5GAM g;  3WVD B;  2LVM A;  5LJ5 d;  3E9F A;  3GLX A;  3CC4 A;  1I4K 1;  4NS5 A;  3T9N A;  3DB3 A;  3CCM A;  1WJQ A;  4QVD A;  3OYL A;  2PUO B;  1NPR A;  3VYG A;  3ZBD A;  3I56 T;  3L2V A;  2XID A;  4JJN K;  3SWN C;  3G4S T;  3V8K A;  4M7A E;  2X35 A;  3RER A;  3L2W A;  1VQM T;  2R5A A;  3JCM X;  1YJN A;  1WNL A;  3CEY A;  3PFS A;  1O75 A;  4JRI A;  4BE1 A;  2XDP A;  4A53 A;  2VXF A;  3QO3 A;  2FL7 A;  2YRV A;  3F70 A;  4J7F A;  5GAO p;  3WXM B;  3URG A;  5GAN 7;  4BAC A;  3ZEH A;  4J6X A;  5IT9 E;  5I2M A;  1QVG A;  3HRU A;  3UPU A;  1QP2 A;  4C5H A;  3J81 E;  1LNX A;  3NTH A;  3MET A;  1RI0 A;  2E6N A;  4A4G A;  4RMO A;  3LWI A;  4J5Y A;  4XU2 A;  5GAN 4;  2YHT A;  5CKB A;  2VC8 A;  4X9C A;  3SDZ A;  2RH2 A;  3JB9 D;  4MDX A;  2RHY A;  4NOY A;  3A8O B;  2OTL T;  3LLR A;  4BI3 A;  4J6W A;  3LWH A;  3LX7 A;  1M1K U;  3SD4 A;  2RO0 A;  5A2Q E;  1ZQ1 A;  2VV5 A;  2MWO A;  4JLG A;  3QII A;  4PLL A;  3HPW A;  2QEX T;  5CKH A;  4F7U E;  1YIJ A;  2CGH A;  1YJN T;  4A4K A;  4B9W A;  3CCS T;  4J83 A;  4M77 D;  2K3X A;  3CMA A;  2ZPF B;  4DOV A;  2IVW A;  2V8I A;  1XOV A;  4C92 F;  2L3R A;  4OP0 A;  4A4H A;  3M54 A;  5GAO q;  2ZGW A;  3A8H B;  2GQV A;  4Y91 A;  1VQ9 A;  5CR2 A;  3CPW S;  4QW2 A;  4ZN3 A;  2KQW A;  2EKO A;  4BY6 B;  1UGS B;  1FX7 A;  1BYM A;  1V29 B;  2EJF A;  2FB7 A;  3CCR A;  2KDS A;  5GAO r;  3V8J A;  3FEO A;  3G7Z A;  2O01 E;  1K8A C;  5LJ5 h;  4RCB A;  4UC4 A;  3QZ5 B;  1U1T A;  4O5V A;  4M7D C;  4TVR A;  4XU1 A;  5A0L A;  2I2L A;  3V7R A;  2XDB A;  4HT9 A;  4C92 A;  3PIP A;  4M77 A;  5CQX A;  2FHD A;  3GPL A;  5GAN f;  1YIJ T;  3OYC A;  3OYG A;  1X6O A;  4JRQ A;  1Y96 B;  2GFU A;  2MAM A;  3OQ5 A;  4M77 E;  2QTX A;  5LJ5 e;  5GMK l;  3CMA T;  3PIO A;  1M5Q 1;  4JS5 A;  2K2V A;  4C8Q D;  5HK0 A;  4N4H A;  2M9U A;  4XTW A;  5HY6 A;  3JCM b;  4C0D C;  3CCQ A;  3NTI A;  2C06 A;  4FU6 A;  2XK0 A;  1HXD A;  1QVF S;  2CZ7 B;  3OS2 A;  2A7Y A;  3DB4 A;  4PJO F;  3WVE B;  2RB6 A;  3G6E A;  2OTJ A;  4JDS A;  3FDR A;  4M78 C;  3GIB A;  4X34 A;  1KQS S;  1WGS A;  3OBY A;  3QYG B;  2RA2 A;  2DEQ A;  2PVG B;  2PVD B;  3GNG A;  3M4G A;  4MZP A;  5C0M A;  3EAE A;  2WSF E;  1NE8 A;  3OMG A;  1I8F A;  1TH7 A;  4NL2 A;  4N0A C;  2VYT A;  1OI1 A;  1Y07 A;  3C4S A;  3EFR A;  1K9M U;  1K73 C;  2RHX A;  4KUL A;  3CCV A;  2CZ6 B;  2LRQ A;  2F5K A;  3P8D A;  4C8Q A;  3JCM d;  2DZ9 A;  3OSV A;  1MGQ A;  2FYK A;  2PVO B;  4PJO A;  2D0Q B;  2EQK A;  4M7D G;  3FC3 A;  1VIF A;  4XTU A;  1VQO A;  5GAN 6;  1WJR A;  1Q7Y U;  1KQ2 A;  4KUD K;  2Y4Y A;  4C8Q E;  2QQR A;  5DLO A;  5CKE A;  3L2U A;  3S6W A;  3S3N A;  4ATO A;  3CCQ T;  4ZN1 A;  3OYJ A;  1VQ8 A;  2ZPE B;  3VUB A;  3VV0 A;  4M78 D;  3M53 A;  3QXE B;  5LJ3 f;  4ZGJ B;  5GAN d;  1OYX A;  1Q82 U;  5FU7 C;  2KK4 A;  3X20 B;  4M7D F;  4EMK A;  1NJI C;  1W2B S;  3MEU A;  1M4Z A;  1LOJ A;  4FL6 A;  4OGE A;  2DTI A;  4ZGE B;  3I56 A;  2XD0 A;  1GXI E;  3CXC S;  4XTY A;  1S72 T;  4OB1 B;  2L89 A;  2K3Y A;  3G4S A;  2ZCF B;  5J3B A;  3O8V A;  1EIF A;  4RKU E;  4L5G A;  2QQB A;  3CCV T;  3JCM Q;  5GAM h;  3TRE A;  3QYH B;  5DY9 A;  1IRE B;  3JCM W;  1WQW A;  4M75 F;  2P0P A;  4PL6 A;  1VQL T;  2WAC A;  2XG8 D;  3NFC A;  3RIR A;  1VQ6 A;  3CC2 T;  4HCC A;  4IKF A;  1YJW A;  2E10 A;  3FRN A;  3QG1 A;  4CI0 C;  3RMQ A;  1UGQ B;  1VQ8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...