1ZC3B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-A
publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc3B00
5D3WA 2VSZA 3V5WA 3PG7A 1MPHA 1OY2A 1U27A 1FGYA 2YRYA 3D8DA 1WVHA 2M14A 1NTVA 1V61A 2ZPYA 1DYNA 4A6HA 2ROVA 1NTYA 2P0FA 1LB1A 4GZUA 3RCPA 3O96A 1N3HA 2DN6A 1M7EA 4HAWB 4P7IA 2N23A 1X05A 3GYOA 2DYQA 4WJ7A 1XODA 2DHKA 2YVCA 4HB4B 2NZ8B 1FOEA 1K5GB 3MDBC 4A6FB 1ZC3B 1FHXA 5LOPB 3GYPA 2DX1A 4ZRKA 1X86A 1DROA 2J0JA 5KCVA 2CODA 3SYXA 3D8FA 5C5BB 2RNRB 2I1KA 1ZC4B 1AQCA 4CHJA 2L1CA 3KY9A 5FI1A 1XX0A 2GCLA 5JLJB 1RRPB 1RJ2A 2MDXA 3PSCA 1B55A 3T06A 2IFSA 2YT0A 1NI2A 4HB0B 1WGQA 1BAKA 2H7DA 4Z2NA 5HE1A 2ELBA 2LOZA 4GXBA 2Z0OA 3WYFB 3AJ4A 2R0DA 2Z0QA 1EGXA 2COAA 4K17A 1ZSQA 4L6EA 1FAOA 2P0HA 2QKMA 3BJIA 1UNQA 2D9ZA 1DDWA 2P8VA 3LJUX 1EF1A 3IVFA 2D9VA 2I5FA 1V5UA 3PP2A 2D9WA 3HQCA 1W1GA 2OTXA 1AWEA 4HB3B 1KZGA 5D3YA 3U8ZA 5C79A 2OQBA 2XQNM 2P0DA 2DYNA 4ZRIA 5D27A 3TCAA 4K2PA 1MK7B 4KAXB 3FM8C 5KQ1A 1P6SA 3ODOA 1MIXA 4F7UP 5HE2A 1P3RA 4DX8A 1UPQA 3CXBB 2D9XA 2DLWA 4F7GA 4PNKA 4HHVA 1QC6A 2DKPA 3A8QA 2DA0A 1UPRA 2DHJA 1V89A 1K5DB 4GPTB 4K81A 1GG3A 2YT1A 2J0KA 3KSYA 1XR0B 1Z87A 3NSUA 4GMVA 2J0MA 2JP2A 4HATB 3FEHA 2COCA 4IFSA 2Y7BA 3X23A 4YONA 2MKRA 4WVFB 2CY4A 1OQNA 4IOYX 1U5GA 5L81A 1MK9B 3PVUA 2DFKA 3G9WA 4CYEA 1OMWA 4EJNA 1PLSA 1IRSA 1J0WA 3ZDTA 2GS0A 3SUZA 2CY5A 4ZRJA 2YF0A 1WJMA 1WI1A 1W1DA 2Y8GA 3N7CA 2D2QA 3DXEA 2LKOA 4B6HA 1M7RA 2Y8FA 3VOQA 2W2XD 4C0AA 1U5FA 4MY6A 1Y19B 2E2XA 1U5EA 3ODXA 2D10A 3ZVRA 2D4QA 3DXDA 1UNRA 1GC7A 1TXDA 2ELAA 3QIJA 4HB2B 2G35A 3A98B 5D3XA 3F0WA 2YS3A 2UZSA 4DX90 2YSZA 1UNPA 2AEHA 3KRWA 1U2BA 3AU4A 3OANA 1PMSA 2ADZA 2RUKB 4KHOA 4BBKA 1X11A 1TJ6A 2Q13A 1X1GA 3P7ZA 2YS5A 3ML4A 2DX5A 3M1IB 5KQ4A 2M38A 2X18A 2LYDA 2V76A 2NMBA 2DTCA 1BTNA 2HTHB 4F7HA 3BINA 1SGHA 2VKIA 4CHMA 1ISNA 3HK0A 1MAIA 1DBHA 4D0NB 1DDMA 5C16A 2J59M 2L2IA 2BCJA 1SHCA 2RVBB 2IYBA 4A6KA 2LOXA 3KZ1A 3U7DA 5DHAB 2QKLA 1WJ1A 1U29A 2K2JA 3SNHA 2MFQA 4K2OA 2LG1A 1V5PA 2KUPA 3TFMA 4HAYB 1MIZB 3KRXA 2HE7A 3DXCA 4HDQA 2K00A 1GC6A 2RLOA 2UVMA 2W2WA 5CLLB 2LULA 2UZRA 4DBBA 3SO6A 1NU2A 4PQ0A 2EC1A 2W2XC 4A5KA 4Y94A 3PVLA 4HDOA 3PZDA 4HAVB 3PEGA 2DHIA 3ODWA 3TO1A 1UEFA 2DKQA 4IAPA 1H10A 2EJ8A 5DIFB 4YL8A 1BTKA 2EMTA 5CLQB 2R09A 5J3YA 2D9YA 3P6AA 2MWNB 3VIAA 2GJYA 3WA0A 3F5RA 2CAYA 5D3VA 5GOWB 2K2UA 3A8PA 5HE0A 3CIKA 3ULBA 4NY0A 1DDVA 3UZTA 3TW1A 4A6FA 4HAXB 1EAZA 5EFXA 1Y5OA 2D11A 1XD4A 4WSFA 1KI1B 4EMOA 4KVGB 2COFA 5JP4A 1XCGA 5C5BA 5FI0A 2AL6A 1MKEA 1J19A 3MPXA 4GN1A 1I2HA 1KZ7A 1LW3A 1P5TA 1WG7A 2KCJA 5JHGA 3SV1A 1E5WA 1FB8A 2YS1A 4DXAB 4TYZA 1BWNA 1XKEA 4HAUB 1ZVRA 3PVWA 5DH9B 1PFJA 2I1JA 3TVVA 2H7EA 2GCJA 1TQZA 1QQGA 1W1HA 5C6RA 2RSGA 2ROZB 1WGUA 1X1FA 2I5CA 5DI9B 4EKUA 5LONB 1U5DA 4NSWA 4Z2MB 2FJLA 4XWXA 3FSSA 1V88A 2N0YA 5HE3A 1V5MA 5J3QA 4KHAA 3AU5A 2Z0PA 5DHFB 1FHOA 2VRWB 3QWMA 1EVHA 4MK0A 1Q67A 3ULCA 1I7AA 2RGNB 3HW2B 4GMXB 4H8SA 2EMSA 1FHWA 2KGXB 2PZ1A 3QBVB 4HAZB 1ZM0A 5J3TA 4MT7A 4TKNA 1H4RA 4KHBB 1FGZA 2CRFA 3D8EA 5JHHA
chains in the Genus database with same CATH superfamily
5D3WA 2VSZA 3V5WA 3PG7A 1MPHA 1OY2A 1U27A 1FGYA 2YRYA 3D8DA 1WVHA 2M14A 1NTVA 1V61A 5M4YB 2ZPYA 1DYNA 4A6HA 2ROVA 1NTYA 2P0FA 1LB1A 2GUMA 4GZUA 3RCPA 3O96A 1N3HA 2DN6A 1M7EA 4HAWB 4P7IA 2N23A 1X05A 3GYOA 2DYQA 4WJ7A 1XODA 2DHKA 2YVCA 4HB4B 2NZ8B 1FOEA 1K5GB 3MDBC 4A6FB 1ZC3B 1FHXA 5LOPB 3GYPA 2DX1A 4ZRKA 1X86A 1DROA 2J0JA 5KCVA 2CODA 3SYXA 3D8FA 5C5BB 2RNRB 2I1KA 1ZC4B 1AQCA 4CHJA 5I2SA 2L1CA 3KY9A 5FI1A 1XX0A 2GCLA 5JLJB 1RRPB 1RJ2A 2MDXA 3PSCA 1B55A 3T06A 2IFSA 2YT0A 1NI2A 4QJ5B 4HB0B 1WGQA 1BAKA 2H7DA 3DCXA 4Z2NA 3NWFA 5HE1A 5LG4B 2ELBA 2LOZA 4GXBA 2Z0OA 3WYFB 3AJ4A 2R0DA 2Z0QA 5IRSA 1EGXA 2COAA 4GNKB 4K17A 1ZSQA 4L6EA 1FAOA 2P0HA 2QKMA 3BJIA 1UNQA 2D9ZA 1DDWA 2P8VA 3LJUX 1EF1A 2ZKMX 3IVFA 2D9VA 2I5FA 1V5UA 3PP2A 2D9WA 3HQCA 1W1GA 2OTXA 1AWEA 4HB3B 1KZGA 5D3YA 3U8ZA 5C79A 2OQBA 2XQNM 2P0DA 2DYNA 4ZRIA 5D27A 3TCAA 2KR0A 4K2PA 1MK7B 4KAXB 3FM8C 5KQ1A 1P6SA 1ZYIA 3ODOA 1MIXA 4F7UP 2YT2A 1P3RA 5HE2A 1UPQA 4DX8A 2Z14A 3CXBB 2D9XA 2DLWA 4F7GA 4PNKA 4HHVA 1QC6A 2DKPA 3A8QA 2DA0A 1UPRA 2DHJA 1V89A 1K5DB 4GPTB 4K81A 1GG3A 2YT1A 2J0KA 3NWAA 3A58A 3KSYA 1XR0B 1Z87A 3NSUA 4GMVA 2J0MA 2JP2A 4HATB 3FEHA 2COCA 4IFSA 2Y7BA 3X23A 4YONA 2MKRA 4WVFB 2CY4A 1OQNA 4IOYX 1U5GA 5L81A 1MK9B 3PVUA 2DFKA 3G9WA 4CYEA 1OMWA 4EJNA 1PLSA 1IRSA 1J0WA 3ZDTA 2GS0A 3SUZA 2CY5A 4ZRJA 2YF0A 1WJMA 2Z59A 1WI1A 4QXAB 1W1DA 2Y8GA 3N7CA 4HSIA 2D2QA 3DXEA 2LKOA 4B6HA 1M7RA 2Y8FA 2KUQA 3VOQA 2W2XD 4C0AA 1U5FA 4MY6A 1Y19B 2E2XA 1U5EA 3ODXA 2D10A 3ZVRA 2D4QA 3FVCA 3DXDA 1UNRA 1GC7A 3B77A 1TXDA 2ELAA 3QIJA 4HB2B 2G35A 3A98B 5D3XA 3F0WA 2YS3A 3OHMB 2UZSA 4DX90 2YSZA 1UNPA 2AEHA 3KRWA 1T77A 1U2BA 3AU4A 3OANA 2FJUB 1PMSA 2ADZA 2RUKB 4KHOA 4BBKA 1X11A 1TJ6A 2K49A 2Q13A 1X1GA 3P7ZA 2YS5A 3ML4A 2DX5A 3M1IB 5KQ4A 2M38A 2X18A 2LYDA 2V76A 2NMBA 2DTCA 1BTNA 2HTHB 4F7HA 3BINA 1SGHA 2VKIA 4CHMA 1ISNA 4GOUA 3HK0A 1MAIA 1DBHA 4D0NB 4CSQA 1DDMA 5C16A 2J59M 2L2IA 2BCJA 1SHCA 2RVBB 2IYBA 4A6KA 2LOXA 3KZ1A 3U7DA 5DHAB 2QKLA 1WJ1A 1U29A 2K2JA 4OSNA 3SNHA 2NBVA 2MFQA 4K2OA 2LG1A 1V5PA 2KUPA 3TFMA 4HAYB 1MIZB 3KRXA 2HE7A 3DXCA 2K8EA 4HDQA 2K00A 3HIEA 1GC6A 2RLOA 2UVMA 2W2WA 2KIEA 5CLLB 2LULA 2UZRA 4DBBA 3SO6A 4KHBA 4L1RA 3NW8A 1NU2A 4PQ0A 2EC1A 2W2XC 4A5KA 4Y94A 2R2YA 3PVLA 4HDOA 3PZDA 4DIXA 4HAVB 5I2MA 3PEGA 2DHIA 3ODWA 3TO1A 1UEFA 2DKQA 4IAPA 1H10A 2EJ8A 5DIFB 4YL8A 1BTKA 2EMTA 5CLQB 2R09A 5J3YA 2D9YA 3P6AA 2MWNB 3VIAA 2GJYA 3WA0A 3F5RA 2CAYA 5D3VA 2Z4DA 5GOWB 2K2UA 3A8PA 5HE0A 3CIKA 3ULBA 4NY0A 1DDVA 3UZTA 3TW1A 4A6FA 4HAXB 1EAZA 5EFXA 1Y5OA 2D11A 1XD4A 4WSFA 1KI1B 4EMOA 4KVGB 2COFA 5JP4A 1XCGA 5C5BA 5FI0A 2AL6A 4OT1A 1MKEA 1J19A 4QJ3B 3MPXA 4GN1A 1I2HA 1KZ7A 1LW3A 1P5TA 1WG7A 2KCJA 5JHGA 3SV1A 1E5WA 1FB8A 2YS1A 4DXAB 4TYZA 1BWNA 1XKEA 4HAUB 1ZVRA 3PVWA 5DH9B 1PFJA 2I1JA 3TVVA 2H7EA 2GCJA 1TQZA 1QQGA 1W1HA 5C6RA 2RSGA 2ROZB 4QJ4B 1WGUA 1X1FA 2I5CA 5DI9B 4EKUA 5LONB 2Z13A 1U5DA 4NSWA 4Z2MB 2FJLA 4XWXA 3FSSA 1V88A 3U12A 2N0YA 5HE3A 1V5MA 5J3QA 2RRFA 4D6WA 4KHAA 3AU5A 2Z0PA 5DHFB 1FHOA 2VRWB 3QWMA 1EVHA 4MK0A 1Q67A 3ULCA 1I7AA 1MI1A 2RGNB 3HW2B 3NWDA 4GMXB 4H8SA 2KIGA 2EMSA 1FHWA 2KGXB 2PZ1A 3QBVB 4HAZB 1ZM0A 5J3TA 4MT7A 4TKNA 1H4RA 4KHBB 3HSAA 1FGZA 2CRFA 3D8EA 5JHHA
chains in the Genus database with same CATH topology
5D3WA 2VSZA 3V5WA 3PG7A 1MPHA 1OY2A 1U27A 1FGYA 2YRYA 3D8DA 1WVHA 2M14A 1NTVA 1V61A 2ZPYA 1DYNA 4A6HA 2ROVA 1NTYA 2P0FA 1LB1A 4GZUA 3RCPA 3O96A 1N3HA 2DN6A 1M7EA 4HAWB 4P7IA 2N23A 1X05A 3GYOA 2DYQA 4WJ7A 1XODA 2DHKA 2YVCA 4HB4B 2NZ8B 1FOEA 1K5GB 3MDBC 4A6FB 1ZC3B 1FHXA 5LOPB 3GYPA 2DX1A 4ZRKA 1X86A 1DROA 2J0JA 5KCVA 2CODA 3SYXA 3D8FA 5C5BB 2RNRB 2I1KA 1ZC4B 1AQCA 4CHJA 2L1CA 3KY9A 5FI1A 1XX0A 2GCLA 5JLJB 1RRPB 1RJ2A 2MDXA 3PSCA 1B55A 3T06A 2IFSA 2YT0A 1NI2A 4HB0B 1WGQA 1BAKA 2H7DA 4Z2NA 5HE1A 2ELBA 2LOZA 4GXBA 2Z0OA 3WYFB 3AJ4A 2R0DA 2Z0QA 1EGXA 2COAA 4K17A 1ZSQA 4L6EA 1FAOA 2P0HA 2QKMA 3BJIA 1UNQA 2D9ZA 1DDWA 2P8VA 3LJUX 1EF1A 3IVFA 2D9VA 2I5FA 1V5UA 3PP2A 2D9WA 3HQCA 1W1GA 2OTXA 1AWEA 4HB3B 1KZGA 5D3YA 3U8ZA 5C79A 2OQBA 2XQNM 2P0DA 2DYNA 4ZRIA 5D27A 3TCAA 4K2PA 1MK7B 4KAXB 3FM8C 5KQ1A 1P6SA 3ODOA 1MIXA 4F7UP 5HE2A 1P3RA 4DX8A 1UPQA 3CXBB 2D9XA 2DLWA 4F7GA 4PNKA 4HHVA 1QC6A 2DKPA 3A8QA 2DA0A 1UPRA 2DHJA 1V89A 1K5DB 4GPTB 4K81A 1GG3A 2YT1A 2J0KA 3KSYA 1XR0B 1Z87A 3NSUA 4GMVA 2J0MA 2JP2A 4HATB 3FEHA 2COCA 4IFSA 2Y7BA 3X23A 4YONA 2MKRA 4WVFB 2CY4A 1OQNA 4IOYX 1U5GA 5L81A 1MK9B 3PVUA 2DFKA 3G9WA 4CYEA 1OMWA 4EJNA 1PLSA 1IRSA 1J0WA 3ZDTA 2GS0A 3SUZA 2CY5A 4ZRJA 2YF0A 1WJMA 1WI1A 1W1DA 2Y8GA 3N7CA 2D2QA 3DXEA 2LKOA 4B6HA 1M7RA 2Y8FA 3VOQA 2W2XD 4C0AA 1U5FA 4MY6A 1Y19B 2E2XA 1U5EA 3ODXA 2D10A 3ZVRA 2D4QA 3DXDA 1UNRA 1GC7A 1TXDA 2ELAA 3QIJA 4HB2B 2G35A 3A98B 5D3XA 3F0WA 2YS3A 2UZSA 4DX90 2YSZA 1UNPA 2AEHA 3KRWA 1U2BA 3AU4A 3OANA 1PMSA 2ADZA 2RUKB 4KHOA 4BBKA 1X11A 1TJ6A 2Q13A 1X1GA 3P7ZA 2YS5A 3ML4A 2DX5A 3M1IB 5KQ4A 2M38A 2X18A 2LYDA 2V76A 2NMBA 2DTCA 1BTNA 2HTHB 4F7HA 3BINA 1SGHA 2VKIA 4CHMA 1ISNA 3HK0A 1MAIA 1DBHA 4D0NB 1DDMA 5C16A 2J59M 2L2IA 2BCJA 1SHCA 2RVBB 2IYBA 4A6KA 2LOXA 3KZ1A 3U7DA 5DHAB 2QKLA 1WJ1A 1U29A 2K2JA 3SNHA 2MFQA 4K2OA 2LG1A 1V5PA 2KUPA 3TFMA 4HAYB 1MIZB 3KRXA 2HE7A 3DXCA 4HDQA 2K00A 1GC6A 2RLOA 2UVMA 2W2WA 5CLLB 2LULA 2UZRA 4DBBA 3SO6A 1NU2A 4PQ0A 2EC1A 2W2XC 4A5KA 4Y94A 3PVLA 4HDOA 3PZDA 4HAVB 3PEGA 2DHIA 3ODWA 3TO1A 1UEFA 2DKQA 4IAPA 1H10A 2EJ8A 5DIFB 4YL8A 1BTKA 2EMTA 5CLQB 2R09A 5J3YA 2D9YA 3P6AA 2MWNB 3VIAA 2GJYA 3WA0A 3F5RA 2CAYA 5D3VA 5GOWB 2K2UA 3A8PA 5HE0A 3CIKA 3ULBA 4NY0A 1DDVA 3UZTA 3TW1A 4A6FA 4HAXB 1EAZA 5EFXA 1Y5OA 2D11A 1XD4A 4WSFA 1KI1B 4EMOA 4KVGB 2COFA 5JP4A 1XCGA 5C5BA 5FI0A 2AL6A 1MKEA 1J19A 3MPXA 4GN1A 1I2HA 1KZ7A 1LW3A 1P5TA 1WG7A 2KCJA 5JHGA 3SV1A 1E5WA 1FB8A 2YS1A 4DXAB 4TYZA 1BWNA 1XKEA 4HAUB 1ZVRA 3PVWA 5DH9B 1PFJA 2I1JA 3TVVA 2H7EA 2GCJA 1TQZA 1QQGA 1W1HA 5C6RA 2RSGA 2ROZB 1WGUA 1X1FA 2I5CA 5DI9B 4EKUA 5LONB 1U5DA 4NSWA 4Z2MB 2FJLA 4XWXA 3FSSA 1V88A 2N0YA 5HE3A 1V5MA 5J3QA 4KHAA 3AU5A 2Z0PA 5DHFB 1FHOA 2VRWB 3QWMA 1EVHA 4MK0A 1Q67A 3ULCA 1I7AA 2RGNB 3HW2B 4GMXB 4H8SA 2EMSA 1FHWA 2KGXB 2PZ1A 3QBVB 4HAZB 1ZM0A 5J3TA 4MT7A 4TKNA 1H4RA 4KHBB 1FGZA 2CRFA 3D8EA 5JHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3W A;  2VSZ A;  3V5W A;  3PG7 A;  1MPH A;  1OY2 A;  1U27 A;  1FGY A;  2YRY A;  3D8D A;  1WVH A;  2M14 A;  1NTV A;  1V61 A;  2ZPY A;  1DYN A;  4A6H A;  2ROV A;  1NTY A;  2P0F A;  1LB1 A;  4GZU A;  3RCP A;  3O96 A;  1N3H A;  2DN6 A;  1M7E A;  4HAW B;  4P7I A;  2N23 A;  1X05 A;  3GYO A;  2DYQ A;  4WJ7 A;  1XOD A;  2DHK A;  2YVC A;  4HB4 B;  2NZ8 B;  1FOE A;  1K5G B;  3MDB C;  4A6F B;  1ZC3 B;  1FHX A;  5LOP B;  3GYP A;  2DX1 A;  4ZRK A;  1X86 A;  1DRO A;  2J0J A;  5KCV A;  2COD A;  3SYX A;  3D8F A;  5C5B B;  2RNR B;  2I1K A;  1ZC4 B;  1AQC A;  4CHJ A;  2L1C A;  3KY9 A;  5FI1 A;  1XX0 A;  2GCL A;  5JLJ B;  1RRP B;  1RJ2 A;  2MDX A;  3PSC A;  1B55 A;  3T06 A;  2IFS A;  2YT0 A;  1NI2 A;  4HB0 B;  1WGQ A;  1BAK A;  2H7D A;  4Z2N A;  5HE1 A;  2ELB A;  2LOZ A;  4GXB A;  2Z0O A;  3WYF B;  3AJ4 A;  2R0D A;  2Z0Q A;  1EGX A;  2COA A;  4K17 A;  1ZSQ A;  4L6E A;  1FAO A;  2P0H A;  2QKM A;  3BJI A;  1UNQ A;  2D9Z A;  1DDW A;  2P8V A;  3LJU X;  1EF1 A;  3IVF A;  2D9V A;  2I5F A;  1V5U A;  3PP2 A;  2D9W A;  3HQC A;  1W1G A;  2OTX A;  1AWE A;  4HB3 B;  1KZG A;  5D3Y A;  3U8Z A;  5C79 A;  2OQB A;  2XQN M;  2P0D A;  2DYN A;  4ZRI A;  5D27 A;  3TCA A;  4K2P A;  1MK7 B;  4KAX B;  3FM8 C;  5KQ1 A;  1P6S A;  3ODO A;  1MIX A;  4F7U P;  5HE2 A;  1P3R A;  4DX8 A;  1UPQ A;  3CXB B;  2D9X A;  2DLW A;  4F7G A;  4PNK A;  4HHV A;  1QC6 A;  2DKP A;  3A8Q A;  2DA0 A;  1UPR A;  2DHJ A;  1V89 A;  1K5D B;  4GPT B;  4K81 A;  1GG3 A;  2YT1 A;  2J0K A;  3KSY A;  1XR0 B;  1Z87 A;  3NSU A;  4GMV A;  2J0M A;  2JP2 A;  4HAT B;  3FEH A;  2COC A;  4IFS A;  2Y7B A;  3X23 A;  4YON A;  2MKR A;  4WVF B;  2CY4 A;  1OQN A;  4IOY X;  1U5G A;  5L81 A;  1MK9 B;  3PVU A;  2DFK A;  3G9W A;  4CYE A;  1OMW A;  4EJN A;  1PLS A;  1IRS A;  1J0W A;  3ZDT A;  2GS0 A;  3SUZ A;  2CY5 A;  4ZRJ A;  2YF0 A;  1WJM A;  1WI1 A;  1W1D A;  2Y8G A;  3N7C A;  2D2Q A;  3DXE A;  2LKO A;  4B6H A;  1M7R A;  2Y8F A;  3VOQ A;  2W2X D;  4C0A A;  1U5F A;  4MY6 A;  1Y19 B;  2E2X A;  1U5E A;  3ODX A;  2D10 A;  3ZVR A;  2D4Q A;  3DXD A;  1UNR A;  1GC7 A;  1TXD A;  2ELA A;  3QIJ A;  4HB2 B;  2G35 A;  3A98 B;  5D3X A;  3F0W A;  2YS3 A;  2UZS A;  4DX9 0;  2YSZ A;  1UNP A;  2AEH A;  3KRW A;  1U2B A;  3AU4 A;  3OAN A;  1PMS A;  2ADZ A;  2RUK B;  4KHO A;  4BBK A;  1X11 A;  1TJ6 A;  2Q13 A;  1X1G A;  3P7Z A;  2YS5 A;  3ML4 A;  2DX5 A;  3M1I B;  5KQ4 A;  2M38 A;  2X18 A;  2LYD A;  2V76 A;  2NMB A;  2DTC A;  1BTN A;  2HTH B;  4F7H A;  3BIN A;  1SGH A;  2VKI A;  4CHM A;  1ISN A;  3HK0 A;  1MAI A;  1DBH A;  4D0N B;  1DDM A;  5C16 A;  2J59 M;  2L2I A;  2BCJ A;  1SHC A;  2RVB B;  2IYB A;  4A6K A;  2LOX A;  3KZ1 A;  3U7D A;  5DHA B;  2QKL A;  1WJ1 A;  1U29 A;  2K2J A;  3SNH A;  2MFQ A;  4K2O A;  2LG1 A;  1V5P A;  2KUP A;  3TFM A;  4HAY B;  1MIZ B;  3KRX A;  2HE7 A;  3DXC A;  4HDQ A;  2K00 A;  1GC6 A;  2RLO A;  2UVM A;  2W2W A;  5CLL B;  2LUL A;  2UZR A;  4DBB A;  3SO6 A;  1NU2 A;  4PQ0 A;  2EC1 A;  2W2X C;  4A5K A;  4Y94 A;  3PVL A;  4HDO A;  3PZD A;  4HAV B;  3PEG A;  2DHI A;  3ODW A;  3TO1 A;  1UEF A;  2DKQ A;  4IAP A;  1H10 A;  2EJ8 A;  5DIF B;  4YL8 A;  1BTK A;  2EMT A;  5CLQ B;  2R09 A;  5J3Y A;  2D9Y A;  3P6A A;  2MWN B;  3VIA A;  2GJY A;  3WA0 A;  3F5R A;  2CAY A;  5D3V A;  5GOW B;  2K2U A;  3A8P A;  5HE0 A;  3CIK A;  3ULB A;  4NY0 A;  1DDV A;  3UZT A;  3TW1 A;  4A6F A;  4HAX B;  1EAZ A;  5EFX A;  1Y5O A;  2D11 A;  1XD4 A;  4WSF A;  1KI1 B;  4EMO A;  4KVG B;  2COF A;  5JP4 A;  1XCG A;  5C5B A;  5FI0 A;  2AL6 A;  1MKE A;  1J19 A;  3MPX A;  4GN1 A;  1I2H A;  1KZ7 A;  1LW3 A;  1P5T A;  1WG7 A;  2KCJ A;  5JHG A;  3SV1 A;  1E5W A;  1FB8 A;  2YS1 A;  4DXA B;  4TYZ A;  1BWN A;  1XKE A;  4HAU B;  1ZVR A;  3PVW A;  5DH9 B;  1PFJ A;  2I1J A;  3TVV A;  2H7E A;  2GCJ A;  1TQZ A;  1QQG A;  1W1H A;  5C6R A;  2RSG A;  2ROZ B;  1WGU A;  1X1F A;  2I5C A;  5DI9 B;  4EKU A;  5LON B;  1U5D A;  4NSW A;  4Z2M B;  2FJL A;  4XWX A;  3FSS A;  1V88 A;  2N0Y A;  5HE3 A;  1V5M A;  5J3Q A;  4KHA A;  3AU5 A;  2Z0P A;  5DHF B;  1FHO A;  2VRW B;  3QWM A;  1EVH A;  4MK0 A;  1Q67 A;  3ULC A;  1I7A A;  2RGN B;  3HW2 B;  4GMX B;  4H8S A;  2EMS A;  1FHW A;  2KGX B;  2PZ1 A;  3QBV B;  4HAZ B;  1ZM0 A;  5J3T A;  4MT7 A;  4TKN A;  1H4R A;  4KHB B;  1FGZ A;  2CRF A;  3D8E A;  5JHH A; 
#chains in the Genus database with same CATH topology
 5D3W A;  2VSZ A;  3V5W A;  3PG7 A;  1MPH A;  1OY2 A;  1U27 A;  1FGY A;  2YRY A;  3D8D A;  1WVH A;  2M14 A;  1NTV A;  1V61 A;  5M4Y B;  2ZPY A;  1DYN A;  4A6H A;  2ROV A;  1NTY A;  2P0F A;  1LB1 A;  2GUM A;  4GZU A;  3RCP A;  3O96 A;  1N3H A;  2DN6 A;  1M7E A;  4HAW B;  4P7I A;  2N23 A;  1X05 A;  3GYO A;  2DYQ A;  4WJ7 A;  1XOD A;  2DHK A;  2YVC A;  4HB4 B;  2NZ8 B;  1FOE A;  1K5G B;  3MDB C;  4A6F B;  1ZC3 B;  1FHX A;  5LOP B;  3GYP A;  2DX1 A;  4ZRK A;  1X86 A;  1DRO A;  2J0J A;  5KCV A;  2COD A;  3SYX A;  3D8F A;  5C5B B;  2RNR B;  2I1K A;  1ZC4 B;  1AQC A;  4CHJ A;  5I2S A;  2L1C A;  3KY9 A;  5FI1 A;  1XX0 A;  2GCL A;  5JLJ B;  1RRP B;  1RJ2 A;  2MDX A;  3PSC A;  1B55 A;  3T06 A;  2IFS A;  2YT0 A;  1NI2 A;  4QJ5 B;  4HB0 B;  1WGQ A;  1BAK A;  2H7D A;  3DCX A;  4Z2N A;  3NWF A;  5HE1 A;  5LG4 B;  2ELB A;  2LOZ A;  4GXB A;  2Z0O A;  3WYF B;  3AJ4 A;  2R0D A;  2Z0Q A;  5IRS A;  1EGX A;  2COA A;  4GNK B;  4K17 A;  1ZSQ A;  4L6E A;  1FAO A;  2P0H A;  2QKM A;  3BJI A;  1UNQ A;  2D9Z A;  1DDW A;  2P8V A;  3LJU X;  1EF1 A;  2ZKM X;  3IVF A;  2D9V A;  2I5F A;  1V5U A;  3PP2 A;  2D9W A;  3HQC A;  1W1G A;  2OTX A;  1AWE A;  4HB3 B;  1KZG A;  5D3Y A;  3U8Z A;  5C79 A;  2OQB A;  2XQN M;  2P0D A;  2DYN A;  4ZRI A;  5D27 A;  3TCA A;  2KR0 A;  4K2P A;  1MK7 B;  4KAX B;  3FM8 C;  5KQ1 A;  1P6S A;  1ZYI A;  3ODO A;  1MIX A;  4F7U P;  2YT2 A;  1P3R A;  5HE2 A;  1UPQ A;  4DX8 A;  2Z14 A;  3CXB B;  2D9X A;  2DLW A;  4F7G A;  4PNK A;  4HHV A;  1QC6 A;  2DKP A;  3A8Q A;  2DA0 A;  1UPR A;  2DHJ A;  1V89 A;  1K5D B;  4GPT B;  4K81 A;  1GG3 A;  2YT1 A;  2J0K A;  3NWA A;  3A58 A;  3KSY A;  1XR0 B;  1Z87 A;  3NSU A;  4GMV A;  2J0M A;  2JP2 A;  4HAT B;  3FEH A;  2COC A;  4IFS A;  2Y7B A;  3X23 A;  4YON A;  2MKR A;  4WVF B;  2CY4 A;  1OQN A;  4IOY X;  1U5G A;  5L81 A;  1MK9 B;  3PVU A;  2DFK A;  3G9W A;  4CYE A;  1OMW A;  4EJN A;  1PLS A;  1IRS A;  1J0W A;  3ZDT A;  2GS0 A;  3SUZ A;  2CY5 A;  4ZRJ A;  2YF0 A;  1WJM A;  2Z59 A;  1WI1 A;  4QXA B;  1W1D A;  2Y8G A;  3N7C A;  4HSI A;  2D2Q A;  3DXE A;  2LKO A;  4B6H A;  1M7R A;  2Y8F A;  2KUQ A;  3VOQ A;  2W2X D;  4C0A A;  1U5F A;  4MY6 A;  1Y19 B;  2E2X A;  1U5E A;  3ODX A;  2D10 A;  3ZVR A;  2D4Q A;  3FVC A;  3DXD A;  1UNR A;  1GC7 A;  3B77 A;  1TXD A;  2ELA A;  3QIJ A;  4HB2 B;  2G35 A;  3A98 B;  5D3X A;  3F0W A;  2YS3 A;  3OHM B;  2UZS A;  4DX9 0;  2YSZ A;  1UNP A;  2AEH A;  3KRW A;  1T77 A;  1U2B A;  3AU4 A;  3OAN A;  2FJU B;  1PMS A;  2ADZ A;  2RUK B;  4KHO A;  4BBK A;  1X11 A;  1TJ6 A;  2K49 A;  2Q13 A;  1X1G A;  3P7Z A;  2YS5 A;  3ML4 A;  2DX5 A;  3M1I B;  5KQ4 A;  2M38 A;  2X18 A;  2LYD A;  2V76 A;  2NMB A;  2DTC A;  1BTN A;  2HTH B;  4F7H A;  3BIN A;  1SGH A;  2VKI A;  4CHM A;  1ISN A;  4GOU A;  3HK0 A;  1MAI A;  1DBH A;  4D0N B;  4CSQ A;  1DDM A;  5C16 A;  2J59 M;  2L2I A;  2BCJ A;  1SHC A;  2RVB B;  2IYB A;  4A6K A;  2LOX A;  3KZ1 A;  3U7D A;  5DHA B;  2QKL A;  1WJ1 A;  1U29 A;  2K2J A;  4OSN A;  3SNH A;  2NBV A;  2MFQ A;  4K2O A;  2LG1 A;  1V5P A;  2KUP A;  3TFM A;  4HAY B;  1MIZ B;  3KRX A;  2HE7 A;  3DXC A;  2K8E A;  4HDQ A;  2K00 A;  3HIE A;  1GC6 A;  2RLO A;  2UVM A;  2W2W A;  2KIE A;  5CLL B;  2LUL A;  2UZR A;  4DBB A;  3SO6 A;  4KHB A;  4L1R A;  3NW8 A;  1NU2 A;  4PQ0 A;  2EC1 A;  2W2X C;  4A5K A;  4Y94 A;  2R2Y A;  3PVL A;  4HDO A;  3PZD A;  4DIX A;  4HAV B;  5I2M A;  3PEG A;  2DHI A;  3ODW A;  3TO1 A;  1UEF A;  2DKQ A;  4IAP A;  1H10 A;  2EJ8 A;  5DIF B;  4YL8 A;  1BTK A;  2EMT A;  5CLQ B;  2R09 A;  5J3Y A;  2D9Y A;  3P6A A;  2MWN B;  3VIA A;  2GJY A;  3WA0 A;  3F5R A;  2CAY A;  5D3V A;  2Z4D A;  5GOW B;  2K2U A;  3A8P A;  5HE0 A;  3CIK A;  3ULB A;  4NY0 A;  1DDV A;  3UZT A;  3TW1 A;  4A6F A;  4HAX B;  1EAZ A;  5EFX A;  1Y5O A;  2D11 A;  1XD4 A;  4WSF A;  1KI1 B;  4EMO A;  4KVG B;  2COF A;  5JP4 A;  1XCG A;  5C5B A;  5FI0 A;  2AL6 A;  4OT1 A;  1MKE A;  1J19 A;  4QJ3 B;  3MPX A;  4GN1 A;  1I2H A;  1KZ7 A;  1LW3 A;  1P5T A;  1WG7 A;  2KCJ A;  5JHG A;  3SV1 A;  1E5W A;  1FB8 A;  2YS1 A;  4DXA B;  4TYZ A;  1BWN A;  1XKE A;  4HAU B;  1ZVR A;  3PVW A;  5DH9 B;  1PFJ A;  2I1J A;  3TVV A;  2H7E A;  2GCJ A;  1TQZ A;  1QQG A;  1W1H A;  5C6R A;  2RSG A;  2ROZ B;  4QJ4 B;  1WGU A;  1X1F A;  2I5C A;  5DI9 B;  4EKU A;  5LON B;  2Z13 A;  1U5D A;  4NSW A;  4Z2M B;  2FJL A;  4XWX A;  3FSS A;  1V88 A;  3U12 A;  2N0Y A;  5HE3 A;  1V5M A;  5J3Q A;  2RRF A;  4D6W A;  4KHA A;  3AU5 A;  2Z0P A;  5DHF B;  1FHO A;  2VRW B;  3QWM A;  1EVH A;  4MK0 A;  1Q67 A;  3ULC A;  1I7A A;  1MI1 A;  2RGN B;  3HW2 B;  3NWD A;  4GMX B;  4H8S A;  2KIG A;  2EMS A;  1FHW A;  2KGX B;  2PZ1 A;  3QBV B;  4HAZ B;  1ZM0 A;  5J3T A;  4MT7 A;  4TKN A;  1H4R A;  4KHB B;  3HSA A;  1FGZ A;  2CRF A;  3D8E A;  5JHH A; 
#chains in the Genus database with same CATH homology
 5D3W A;  2VSZ A;  3V5W A;  3PG7 A;  1MPH A;  1OY2 A;  1U27 A;  1FGY A;  2YRY A;  3D8D A;  1WVH A;  2M14 A;  1NTV A;  1V61 A;  2ZPY A;  1DYN A;  4A6H A;  2ROV A;  1NTY A;  2P0F A;  1LB1 A;  4GZU A;  3RCP A;  3O96 A;  1N3H A;  2DN6 A;  1M7E A;  4HAW B;  4P7I A;  2N23 A;  1X05 A;  3GYO A;  2DYQ A;  4WJ7 A;  1XOD A;  2DHK A;  2YVC A;  4HB4 B;  2NZ8 B;  1FOE A;  1K5G B;  3MDB C;  4A6F B;  1ZC3 B;  1FHX A;  5LOP B;  3GYP A;  2DX1 A;  4ZRK A;  1X86 A;  1DRO A;  2J0J A;  5KCV A;  2COD A;  3SYX A;  3D8F A;  5C5B B;  2RNR B;  2I1K A;  1ZC4 B;  1AQC A;  4CHJ A;  2L1C A;  3KY9 A;  5FI1 A;  1XX0 A;  2GCL A;  5JLJ B;  1RRP B;  1RJ2 A;  2MDX A;  3PSC A;  1B55 A;  3T06 A;  2IFS A;  2YT0 A;  1NI2 A;  4HB0 B;  1WGQ A;  1BAK A;  2H7D A;  4Z2N A;  5HE1 A;  2ELB A;  2LOZ A;  4GXB A;  2Z0O A;  3WYF B;  3AJ4 A;  2R0D A;  2Z0Q A;  1EGX A;  2COA A;  4K17 A;  1ZSQ A;  4L6E A;  1FAO A;  2P0H A;  2QKM A;  3BJI A;  1UNQ A;  2D9Z A;  1DDW A;  2P8V A;  3LJU X;  1EF1 A;  3IVF A;  2D9V A;  2I5F A;  1V5U A;  3PP2 A;  2D9W A;  3HQC A;  1W1G A;  2OTX A;  1AWE A;  4HB3 B;  1KZG A;  5D3Y A;  3U8Z A;  5C79 A;  2OQB A;  2XQN M;  2P0D A;  2DYN A;  4ZRI A;  5D27 A;  3TCA A;  4K2P A;  1MK7 B;  4KAX B;  3FM8 C;  5KQ1 A;  1P6S A;  3ODO A;  1MIX A;  4F7U P;  5HE2 A;  1P3R A;  4DX8 A;  1UPQ A;  3CXB B;  2D9X A;  2DLW A;  4F7G A;  4PNK A;  4HHV A;  1QC6 A;  2DKP A;  3A8Q A;  2DA0 A;  1UPR A;  2DHJ A;  1V89 A;  1K5D B;  4GPT B;  4K81 A;  1GG3 A;  2YT1 A;  2J0K A;  3KSY A;  1XR0 B;  1Z87 A;  3NSU A;  4GMV A;  2J0M A;  2JP2 A;  4HAT B;  3FEH A;  2COC A;  4IFS A;  2Y7B A;  3X23 A;  4YON A;  2MKR A;  4WVF B;  2CY4 A;  1OQN A;  4IOY X;  1U5G A;  5L81 A;  1MK9 B;  3PVU A;  2DFK A;  3G9W A;  4CYE A;  1OMW A;  4EJN A;  1PLS A;  1IRS A;  1J0W A;  3ZDT A;  2GS0 A;  3SUZ A;  2CY5 A;  4ZRJ A;  2YF0 A;  1WJM A;  1WI1 A;  1W1D A;  2Y8G A;  3N7C A;  2D2Q A;  3DXE A;  2LKO A;  4B6H A;  1M7R A;  2Y8F A;  3VOQ A;  2W2X D;  4C0A A;  1U5F A;  4MY6 A;  1Y19 B;  2E2X A;  1U5E A;  3ODX A;  2D10 A;  3ZVR A;  2D4Q A;  3DXD A;  1UNR A;  1GC7 A;  1TXD A;  2ELA A;  3QIJ A;  4HB2 B;  2G35 A;  3A98 B;  5D3X A;  3F0W A;  2YS3 A;  2UZS A;  4DX9 0;  2YSZ A;  1UNP A;  2AEH A;  3KRW A;  1U2B A;  3AU4 A;  3OAN A;  1PMS A;  2ADZ A;  2RUK B;  4KHO A;  4BBK A;  1X11 A;  1TJ6 A;  2Q13 A;  1X1G A;  3P7Z A;  2YS5 A;  3ML4 A;  2DX5 A;  3M1I B;  5KQ4 A;  2M38 A;  2X18 A;  2LYD A;  2V76 A;  2NMB A;  2DTC A;  1BTN A;  2HTH B;  4F7H A;  3BIN A;  1SGH A;  2VKI A;  4CHM A;  1ISN A;  3HK0 A;  1MAI A;  1DBH A;  4D0N B;  1DDM A;  5C16 A;  2J59 M;  2L2I A;  2BCJ A;  1SHC A;  2RVB B;  2IYB A;  4A6K A;  2LOX A;  3KZ1 A;  3U7D A;  5DHA B;  2QKL A;  1WJ1 A;  1U29 A;  2K2J A;  3SNH A;  2MFQ A;  4K2O A;  2LG1 A;  1V5P A;  2KUP A;  3TFM A;  4HAY B;  1MIZ B;  3KRX A;  2HE7 A;  3DXC A;  4HDQ A;  2K00 A;  1GC6 A;  2RLO A;  2UVM A;  2W2W A;  5CLL B;  2LUL A;  2UZR A;  4DBB A;  3SO6 A;  1NU2 A;  4PQ0 A;  2EC1 A;  2W2X C;  4A5K A;  4Y94 A;  3PVL A;  4HDO A;  3PZD A;  4HAV B;  3PEG A;  2DHI A;  3ODW A;  3TO1 A;  1UEF A;  2DKQ A;  4IAP A;  1H10 A;  2EJ8 A;  5DIF B;  4YL8 A;  1BTK A;  2EMT A;  5CLQ B;  2R09 A;  5J3Y A;  2D9Y A;  3P6A A;  2MWN B;  3VIA A;  2GJY A;  3WA0 A;  3F5R A;  2CAY A;  5D3V A;  5GOW B;  2K2U A;  3A8P A;  5HE0 A;  3CIK A;  3ULB A;  4NY0 A;  1DDV A;  3UZT A;  3TW1 A;  4A6F A;  4HAX B;  1EAZ A;  5EFX A;  1Y5O A;  2D11 A;  1XD4 A;  4WSF A;  1KI1 B;  4EMO A;  4KVG B;  2COF A;  5JP4 A;  1XCG A;  5C5B A;  5FI0 A;  2AL6 A;  1MKE A;  1J19 A;  3MPX A;  4GN1 A;  1I2H A;  1KZ7 A;  1LW3 A;  1P5T A;  1WG7 A;  2KCJ A;  5JHG A;  3SV1 A;  1E5W A;  1FB8 A;  2YS1 A;  4DXA B;  4TYZ A;  1BWN A;  1XKE A;  4HAU B;  1ZVR A;  3PVW A;  5DH9 B;  1PFJ A;  2I1J A;  3TVV A;  2H7E A;  2GCJ A;  1TQZ A;  1QQG A;  1W1H A;  5C6R A;  2RSG A;  2ROZ B;  1WGU A;  1X1F A;  2I5C A;  5DI9 B;  4EKU A;  5LON B;  1U5D A;  4NSW A;  4Z2M B;  2FJL A;  4XWX A;  3FSS A;  1V88 A;  2N0Y A;  5HE3 A;  1V5M A;  5J3Q A;  4KHA A;  3AU5 A;  2Z0P A;  5DHF B;  1FHO A;  2VRW B;  3QWM A;  1EVH A;  4MK0 A;  1Q67 A;  3ULC A;  1I7A A;  2RGN B;  3HW2 B;  4GMX B;  4H8S A;  2EMS A;  1FHW A;  2KGX B;  2PZ1 A;  3QBV B;  4HAZ B;  1ZM0 A;  5J3T A;  4MT7 A;  4TKN A;  1H4R A;  4KHB B;  1FGZ A;  2CRF A;  3D8E A;  5JHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...