1ZC3B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 28
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc3B00
2I1JA 1XODA 3ODOA 3ZVRA 1OMWA 2JP2A 1XR0B 2DKQA 5KQ4A 2ELBA 5LONB 1ZSQA 1EF1A 2HTHB 3VIAA 1FOEA 1IRSA 5C16A 4HAXB 1AQCA 2J59M 1X11A 5DHAB 1KZ7A 3CXBB 3TCAA 2YF0A 2DN6A 2ROZB 2GS0A 1FHWA 4EKUA 2W2XC 2R09A 2XQNM 4XWXA 2UVMA 1WJMA 1U5FA 2GCJA 3A8PA 2H7EA 4CHJA 4WJ7A 2K2JA 5JP4A 3FEHA 1E5WA 4F7UP 4PQ0A 1PMSA 2EMSA 1MAIA 1X1FA 2MFQA 3UZTA 4MT7A 1GC6A 3O96A 2YS5A 1P5TA 2H7DA 2EJ8A 4Y94A 1WJ1A 3CIKA 1MKEA 5J3YA 5D3VA 2K00A 1FHXA 3ODWA 1OY2A 2RNRB 5DIFB 1QC6A 4EJNA 2LOXA 1BTKA 4GMVA 5C79A 1WVHA 2DYNA 3X23A 4HDQA 4K17A 1KI1B 4D0NB 1TJ6A 2R0DA 1ZVRA 2OQBA 2YT1A 1I2HA 1W1GA 5C5BB 2DYQA 2GCLA 5HE3A 2YVCA 2Z0OA 4K2PA 2CY5A 2DLWA 1U29A 3MPXA 4K81A 4HAVB 4HAUB 1FGYA 3OANA 1P6SA 4HATB 4WSFA 1BAKA 5D3YA 2X18A 2EMTA 2HE7A 1LB1A 3SYXA 4DXAB 2LOZA 2D9VA 4NY0A 3G9WA 1PLSA 4GXBA 4C0AA 1K5DB 2GJYA 4A5KA 5CLLB 2NZ8B 3BINA 5LOPB 3PVUA 1EVHA 1V88A 2D9XA 2Y8GA 4K2OA 2NMBA 1TQZA 2OTXA 4KHOA 4YL8A 3U7DA 1FHOA 4KAXB 1X05A 1P3RA 1UNQA 4HHVA 2D2QA 3SUZA 1FB8A 2EC1A 4MK0A 1Q67A 2IYBA 4BBKA 1EAZA 4Z2MB 3AU4A 1LW3A 3FSSA 2DX1A 3P6AA 3AJ4A 2J0JA 2I5FA 4DX90 5DHFB 5DI9B 2DX5A 3KRXA 3PVLA 2LYDA 1DDMA 1SGHA 3ML4A 2D9WA 1U5GA 4GMXB 1ISNA 2I1KA 3KSYA 1DDWA 2DFKA 1V5MA 4HB4B 3QIJA 4MY6A 4HAWB 5FI1A 3AU5A 1Z87A 3M1IB 1U27A 2YRYA 4F7HA 2FJLA 4HAZB 1J19A 3LJUX 3ODXA 1J0WA 5L81A 1EGXA 1ZC3B 4A6FA 2CODA 2CAYA 2AL6A 1DBHA 3HQCA 2RGNB 1W1HA 3HK0A 4DX8A 2RVBB 2P0HA 3A98B 2LKOA 1U5EA 1PFJA 1N3HA 1XD4A 3PZDA 3P7ZA 1B55A 1ZM0A 4NSWA 5J3QA 2DA0A 2G35A 3PP2A 4ZRKA 4TKNA 2RUKB 5JHHA 4P7IA 3D8FA 3WA0A 1GG3A 3D8EA 2DHJA 2V76A 5J3TA 1UNRA 5KQ1A 4IFSA 1WG7A 1GC7A 5HE2A 2CRFA 2D4QA 2YS1A 2P8VA 4F7GA 1WGQA 4TYZA 3GYOA 2D9YA 5EFXA 2I5CA 2VRWB 3QWMA 3F5RA 1M7EA 4CYEA 4IOYX 1MIZB 1RJ2A 3TO1A 1K5GB 1MPHA 2Z0PA 2AEHA 5HE1A 1X86A 4KVGB 4A6KA 3TFMA 2VSZA 1FAOA 2L1CA 1V5PA 4HB0B 3KRWA 1OQNA 2DKPA 1U5DA 1X1GA 3ZDTA 4Z2NA 2L2IA 1UPRA 3HW2B 4CHMA 2D9ZA 3RCPA 3PEGA 4DBBA 3TVVA 1TXDA 2IFSA 2ZPYA 1KZGA 2Z0QA 1BTNA 1ZC4B 2M38A 1MK7B 1I7AA 3PG7A 5KCVA 4ZRJA 2COAA 1U2BA 3DXEA 2KGXB 1BWNA 4A6HA 3F0WA 3MDBC 1UEFA 2MDXA 1DROA 2D11A 4HDOA 1Y19B 2RLOA 2ADZA 3GYPA 1RRPB 3NSUA 1WGUA 2J0KA 2UZRA 4WVFB 2KCJA 2Y7BA 2LULA 1MK9B 2ROVA 2Y8FA 2VKIA 1UPQA 2E2XA 2PZ1A 2ELAA 2QKMA 1NTVA 3KY9A 2P0FA 1M7RA 2K2UA 5JHGA 1SHCA 2D10A 2YS3A 2QKLA 4B6HA 2YSZA 2KUPA 1XCGA 1MIXA 3SNHA 1V5UA 1H10A 4GPTB 1AWEA 3SO6A 2RSGA 3V5WA 5C6RA 1WI1A 2N23A 1W1DA 5D3WA 2BCJA 1Y5OA 1NTYA 5C5BA 4L6EA 3ULBA 4HAYB 5FI0A 5CLQB 2W2WA 4IAPA 4HB3B 1QQGA 3A8QA 3DXDA 3PSCA 4YONA 5JLJB 2J0MA 4EMOA 1UNPA 2P0DA 1DYNA 5GOWB 3BJIA 3IVFA 2Q13A 5D3XA 3SV1A 5DH9B 5HE0A 2M14A 2MWNB 4GN1A 1H4RA 3PVWA 3QBVB 2N0YA 4PNKA 2DTCA 4A6FB 4HB2B 4H8SA 3KZ1A 4GZUA 2COCA 2UZSA 2DHIA 2YT0A 3U8ZA 3WYFB 4KHAA 2CY4A 3VOQA 2COFA 1DDVA 1FGZA 2DHKA 2MKRA 3DXCA 1NI2A 1XKEA 5D27A 4KHBB 1V61A 1XX0A 2LG1A 4ZRIA 3ULCA 3FM8C 2W2XD 1NU2A 3T06A 1V89A 3D8DA 3N7CA 3TW1A
chains in the Genus database with same CATH superfamily
2I1JA 1XODA 3ODOA 3ZVRA 1OMWA 2JP2A 1XR0B 2DKQA 5KQ4A 2ELBA 5LONB 1ZSQA 3NWAA 1EF1A 2K8EA 2HTHB 3VIAA 1FOEA 1IRSA 5C16A 4HAXB 1AQCA 2J59M 1X11A 5DHAB 1KZ7A 3CXBB 3TCAA 2YF0A 2DN6A 2ROZB 2GS0A 1FHWA 4EKUA 2W2XC 4KHBA 2R09A 2XQNM 4XWXA 2KR0A 2UVMA 1WJMA 1U5FA 2GCJA 3A8PA 2H7EA 4CHJA 4WJ7A 4GOUA 2K2JA 5JP4A 3FEHA 2FJUB 1E5WA 4F7UP 4PQ0A 1PMSA 2EMSA 1MAIA 1X1FA 2MFQA 3UZTA 4MT7A 1GC6A 3O96A 2YS5A 4QJ5B 1P5TA 2H7DA 2EJ8A 4Y94A 1WJ1A 3CIKA 1MKEA 5J3YA 5D3VA 2K00A 1FHXA 3ODWA 1OY2A 2RNRB 5DIFB 1QC6A 4EJNA 2LOXA 1BTKA 4GMVA 5C79A 1WVHA 2DYNA 3X23A 4HDQA 4K17A 3OHMB 1KI1B 4L1RA 4D0NB 1TJ6A 2R0DA 5I2SA 1ZVRA 2OQBA 2YT1A 1I2HA 1W1GA 5C5BB 2DYQA 2GCLA 5HE3A 2YVCA 2Z0OA 4K2PA 2CY5A 4QJ4B 2DLWA 1U29A 3MPXA 4K81A 4HAVB 4HAUB 1FGYA 3OANA 4GNKB 1P6SA 2Z59A 4HATB 4WSFA 1BAKA 4OSNA 5D3YA 2X18A 2EMTA 2HE7A 3NWDA 1LB1A 3SYXA 4DXAB 2LOZA 2D9VA 4NY0A 3G9WA 1PLSA 4GXBA 4C0AA 1K5DB 2GJYA 3FVCA 5CLLB 4A5KA 2NZ8B 3BINA 5LOPB 3PVUA 1EVHA 1V88A 2D9XA 2Y8GA 4K2OA 2NMBA 1TQZA 2OTXA 4KHOA 4YL8A 3U7DA 1FHOA 3HSAA 2NBVA 4KAXB 1X05A 1P3RA 1UNQA 4HHVA 2D2QA 3SUZA 3HIEA 1FB8A 2EC1A 5I2MA 4MK0A 3U12A 1Q67A 2IYBA 4BBKA 5IRSA 1EAZA 4Z2MB 3AU4A 1LW3A 3FSSA 2DX1A 3P6AA 3AJ4A 4QXAB 2J0JA 2I5FA 4DX90 5DHFB 5DI9B 4D6WA 2DX5A 2ZKMX 4HSIA 3KRXA 3PVLA 2LYDA 1DDMA 1SGHA 3ML4A 2GUMA 2D9WA 2KIEA 1U5GA 4GMXB 1ISNA 2I1KA 3KSYA 1DDWA 2Z13A 2DFKA 1V5MA 4HB4B 3QIJA 4MY6A 4HAWB 5FI1A 3AU5A 1Z87A 3M1IB 1U27A 2YRYA 4F7HA 2RRFA 2FJLA 4HAZB 1J19A 3LJUX 3ODXA 1J0WA 5L81A 1EGXA 1ZC3B 2Z4DA 4A6FA 2CODA 2CAYA 2AL6A 1DBHA 3HQCA 2RGNB 3B77A 1W1HA 3HK0A 4DX8A 2RVBB 2P0HA 3A98B 2LKOA 1U5EA 1PFJA 1N3HA 1XD4A 3PZDA 3P7ZA 1B55A 1ZM0A 2KUQA 4NSWA 5J3QA 2DA0A 2G35A 3PP2A 4ZRKA 4TKNA 2RUKB 5JHHA 4P7IA 3D8FA 3WA0A 1GG3A 3D8EA 2DHJA 2V76A 5J3TA 1UNRA 5KQ1A 4IFSA 1WG7A 1GC7A 5HE2A 2CRFA 2D4QA 2YS1A 2P8VA 4F7GA 1WGQA 4TYZA 3GYOA 2D9YA 5EFXA 2I5CA 2VRWB 3QWMA 3F5RA 1M7EA 4CYEA 4IOYX 1MIZB 1RJ2A 3TO1A 1K5GB 1MPHA 2Z14A 2Z0PA 2AEHA 5HE1A 1X86A 4KVGB 4A6KA 3TFMA 2VSZA 1FAOA 2L1CA 1V5PA 4HB0B 3KRWA 1OQNA 2DKPA 1U5DA 1X1GA 3ZDTA 4Z2NA 2L2IA 1UPRA 3HW2B 4CHMA 2D9ZA 3A58A 3RCPA 3PEGA 4CSQA 4DBBA 3TVVA 3NW8A 1TXDA 2IFSA 2ZPYA 1KZGA 2Z0QA 1BTNA 1ZC4B 2M38A 1ZYIA 1MK7B 1I7AA 3PG7A 5KCVA 4ZRJA 2COAA 1U2BA 3DXEA 2KGXB 1BWNA 4A6HA 3F0WA 5LG4B 3MDBC 2K49A 1UEFA 2MDXA 2KIGA 1DROA 2D11A 4HDOA 1Y19B 2RLOA 2ADZA 3GYPA 1RRPB 3NSUA 1WGUA 2J0KA 2UZRA 4WVFB 4QJ3B 2KCJA 2Y7BA 2LULA 1MK9B 2ROVA 2Y8FA 4DIXA 2VKIA 1UPQA 2E2XA 2PZ1A 2ELAA 2QKMA 1NTVA 3KY9A 2R2YA 2P0FA 1M7RA 2K2UA 5JHGA 1SHCA 2D10A 2YS3A 1MI1A 2QKLA 4B6HA 2YSZA 2KUPA 1XCGA 1MIXA 3SNHA 1V5UA 1H10A 4GPTB 1AWEA 3SO6A 3DCXA 2RSGA 3NWFA 3V5WA 5C6RA 1WI1A 2N23A 1W1DA 5D3WA 2BCJA 1Y5OA 1NTYA 5C5BA 4L6EA 3ULBA 4HAYB 5FI0A 5CLQB 2W2WA 4IAPA 4HB3B 1QQGA 3A8QA 3DXDA 3PSCA 4YONA 5JLJB 2J0MA 4EMOA 1UNPA 2P0DA 1DYNA 5GOWB 3BJIA 3IVFA 2Q13A 5D3XA 3SV1A 5DH9B 5HE0A 2M14A 2MWNB 4GN1A 1H4RA 3PVWA 3QBVB 2N0YA 4PNKA 2DTCA 4A6FB 4HB2B 4H8SA 4OT1A 3KZ1A 4GZUA 2COCA 2UZSA 2DHIA 2YT0A 3U8ZA 3WYFB 4KHAA 2CY4A 5M4YB 3VOQA 2COFA 1DDVA 1FGZA 2DHKA 2MKRA 3DXCA 1NI2A 1XKEA 5D27A 4KHBB 1V61A 1XX0A 2LG1A 4ZRIA 3ULCA 3FM8C 2W2XD 1NU2A 3T06A 1V89A 3D8DA 1T77A 2YT2A 3N7CA 3TW1A
chains in the Genus database with same CATH topology
2I1JA 1XODA 3ODOA 3ZVRA 1OMWA 2JP2A 1XR0B 2DKQA 5KQ4A 2ELBA 5LONB 1ZSQA 1EF1A 2HTHB 3VIAA 1FOEA 1IRSA 5C16A 4HAXB 1AQCA 2J59M 1X11A 5DHAB 1KZ7A 3CXBB 3TCAA 2YF0A 2DN6A 2ROZB 2GS0A 1FHWA 4EKUA 2W2XC 2R09A 2XQNM 4XWXA 2UVMA 1WJMA 1U5FA 2GCJA 3A8PA 2H7EA 4CHJA 4WJ7A 2K2JA 5JP4A 3FEHA 1E5WA 4F7UP 4PQ0A 1PMSA 2EMSA 1MAIA 1X1FA 2MFQA 3UZTA 4MT7A 1GC6A 3O96A 2YS5A 1P5TA 2H7DA 2EJ8A 4Y94A 1WJ1A 3CIKA 1MKEA 5J3YA 5D3VA 2K00A 1FHXA 3ODWA 1OY2A 2RNRB 5DIFB 1QC6A 4EJNA 2LOXA 1BTKA 4GMVA 5C79A 1WVHA 2DYNA 3X23A 4HDQA 4K17A 1KI1B 4D0NB 1TJ6A 2R0DA 1ZVRA 2OQBA 2YT1A 1I2HA 1W1GA 5C5BB 2DYQA 2GCLA 5HE3A 2YVCA 2Z0OA 4K2PA 2CY5A 2DLWA 1U29A 3MPXA 4K81A 4HAVB 4HAUB 1FGYA 3OANA 1P6SA 4HATB 4WSFA 1BAKA 5D3YA 2X18A 2EMTA 2HE7A 1LB1A 3SYXA 4DXAB 2LOZA 2D9VA 4NY0A 3G9WA 1PLSA 4GXBA 4C0AA 1K5DB 2GJYA 4A5KA 5CLLB 2NZ8B 3BINA 5LOPB 3PVUA 1EVHA 1V88A 2D9XA 2Y8GA 4K2OA 2NMBA 1TQZA 2OTXA 4KHOA 4YL8A 3U7DA 1FHOA 4KAXB 1X05A 1P3RA 1UNQA 4HHVA 2D2QA 3SUZA 1FB8A 2EC1A 4MK0A 1Q67A 2IYBA 4BBKA 1EAZA 4Z2MB 3AU4A 1LW3A 3FSSA 2DX1A 3P6AA 3AJ4A 2J0JA 2I5FA 4DX90 5DHFB 5DI9B 2DX5A 3KRXA 3PVLA 2LYDA 1DDMA 1SGHA 3ML4A 2D9WA 1U5GA 4GMXB 1ISNA 2I1KA 3KSYA 1DDWA 2DFKA 1V5MA 4HB4B 3QIJA 4MY6A 4HAWB 5FI1A 3AU5A 1Z87A 3M1IB 1U27A 2YRYA 4F7HA 2FJLA 4HAZB 1J19A 3LJUX 3ODXA 1J0WA 5L81A 1EGXA 1ZC3B 4A6FA 2CODA 2CAYA 2AL6A 1DBHA 3HQCA 2RGNB 1W1HA 3HK0A 4DX8A 2RVBB 2P0HA 3A98B 2LKOA 1U5EA 1PFJA 1N3HA 1XD4A 3PZDA 3P7ZA 1B55A 1ZM0A 4NSWA 5J3QA 2DA0A 2G35A 3PP2A 4ZRKA 4TKNA 2RUKB 5JHHA 4P7IA 3D8FA 3WA0A 1GG3A 3D8EA 2DHJA 2V76A 5J3TA 1UNRA 5KQ1A 4IFSA 1WG7A 1GC7A 5HE2A 2CRFA 2D4QA 2YS1A 2P8VA 4F7GA 1WGQA 4TYZA 3GYOA 2D9YA 5EFXA 2I5CA 2VRWB 3QWMA 3F5RA 1M7EA 4CYEA 4IOYX 1MIZB 1RJ2A 3TO1A 1K5GB 1MPHA 2Z0PA 2AEHA 5HE1A 1X86A 4KVGB 4A6KA 3TFMA 2VSZA 1FAOA 2L1CA 1V5PA 4HB0B 3KRWA 1OQNA 2DKPA 1U5DA 1X1GA 3ZDTA 4Z2NA 2L2IA 1UPRA 3HW2B 4CHMA 2D9ZA 3RCPA 3PEGA 4DBBA 3TVVA 1TXDA 2IFSA 2ZPYA 1KZGA 2Z0QA 1BTNA 1ZC4B 2M38A 1MK7B 1I7AA 3PG7A 5KCVA 4ZRJA 2COAA 1U2BA 3DXEA 2KGXB 1BWNA 4A6HA 3F0WA 3MDBC 1UEFA 2MDXA 1DROA 2D11A 4HDOA 1Y19B 2RLOA 2ADZA 3GYPA 1RRPB 3NSUA 1WGUA 2J0KA 2UZRA 4WVFB 2KCJA 2Y7BA 2LULA 1MK9B 2ROVA 2Y8FA 2VKIA 1UPQA 2E2XA 2PZ1A 2ELAA 2QKMA 1NTVA 3KY9A 2P0FA 1M7RA 2K2UA 5JHGA 1SHCA 2D10A 2YS3A 2QKLA 4B6HA 2YSZA 2KUPA 1XCGA 1MIXA 3SNHA 1V5UA 1H10A 4GPTB 1AWEA 3SO6A 2RSGA 3V5WA 5C6RA 1WI1A 2N23A 1W1DA 5D3WA 2BCJA 1Y5OA 1NTYA 5C5BA 4L6EA 3ULBA 4HAYB 5FI0A 5CLQB 2W2WA 4IAPA 4HB3B 1QQGA 3A8QA 3DXDA 3PSCA 4YONA 5JLJB 2J0MA 4EMOA 1UNPA 2P0DA 1DYNA 5GOWB 3BJIA 3IVFA 2Q13A 5D3XA 3SV1A 5DH9B 5HE0A 2M14A 2MWNB 4GN1A 1H4RA 3PVWA 3QBVB 2N0YA 4PNKA 2DTCA 4A6FB 4HB2B 4H8SA 3KZ1A 4GZUA 2COCA 2UZSA 2DHIA 2YT0A 3U8ZA 3WYFB 4KHAA 2CY4A 3VOQA 2COFA 1DDVA 1FGZA 2DHKA 2MKRA 3DXCA 1NI2A 1XKEA 5D27A 4KHBB 1V61A 1XX0A 2LG1A 4ZRIA 3ULCA 3FM8C 2W2XD 1NU2A 3T06A 1V89A 3D8DA 3N7CA 3TW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  1XOD A;  3ODO A;  3ZVR A;  1OMW A;  2JP2 A;  1XR0 B;  2DKQ A;  5KQ4 A;  2ELB A;  5LON B;  1ZSQ A;  1EF1 A;  2HTH B;  3VIA A;  1FOE A;  1IRS A;  5C16 A;  4HAX B;  1AQC A;  2J59 M;  1X11 A;  5DHA B;  1KZ7 A;  3CXB B;  3TCA A;  2YF0 A;  2DN6 A;  2ROZ B;  2GS0 A;  1FHW A;  4EKU A;  2W2X C;  2R09 A;  2XQN M;  4XWX A;  2UVM A;  1WJM A;  1U5F A;  2GCJ A;  3A8P A;  2H7E A;  4CHJ A;  4WJ7 A;  2K2J A;  5JP4 A;  3FEH A;  1E5W A;  4F7U P;  4PQ0 A;  1PMS A;  2EMS A;  1MAI A;  1X1F A;  2MFQ A;  3UZT A;  4MT7 A;  1GC6 A;  3O96 A;  2YS5 A;  1P5T A;  2H7D A;  2EJ8 A;  4Y94 A;  1WJ1 A;  3CIK A;  1MKE A;  5J3Y A;  5D3V A;  2K00 A;  1FHX A;  3ODW A;  1OY2 A;  2RNR B;  5DIF B;  1QC6 A;  4EJN A;  2LOX A;  1BTK A;  4GMV A;  5C79 A;  1WVH A;  2DYN A;  3X23 A;  4HDQ A;  4K17 A;  1KI1 B;  4D0N B;  1TJ6 A;  2R0D A;  1ZVR A;  2OQB A;  2YT1 A;  1I2H A;  1W1G A;  5C5B B;  2DYQ A;  2GCL A;  5HE3 A;  2YVC A;  2Z0O A;  4K2P A;  2CY5 A;  2DLW A;  1U29 A;  3MPX A;  4K81 A;  4HAV B;  4HAU B;  1FGY A;  3OAN A;  1P6S A;  4HAT B;  4WSF A;  1BAK A;  5D3Y A;  2X18 A;  2EMT A;  2HE7 A;  1LB1 A;  3SYX A;  4DXA B;  2LOZ A;  2D9V A;  4NY0 A;  3G9W A;  1PLS A;  4GXB A;  4C0A A;  1K5D B;  2GJY A;  4A5K A;  5CLL B;  2NZ8 B;  3BIN A;  5LOP B;  3PVU A;  1EVH A;  1V88 A;  2D9X A;  2Y8G A;  4K2O A;  2NMB A;  1TQZ A;  2OTX A;  4KHO A;  4YL8 A;  3U7D A;  1FHO A;  4KAX B;  1X05 A;  1P3R A;  1UNQ A;  4HHV A;  2D2Q A;  3SUZ A;  1FB8 A;  2EC1 A;  4MK0 A;  1Q67 A;  2IYB A;  4BBK A;  1EAZ A;  4Z2M B;  3AU4 A;  1LW3 A;  3FSS A;  2DX1 A;  3P6A A;  3AJ4 A;  2J0J A;  2I5F A;  4DX9 0;  5DHF B;  5DI9 B;  2DX5 A;  3KRX A;  3PVL A;  2LYD A;  1DDM A;  1SGH A;  3ML4 A;  2D9W A;  1U5G A;  4GMX B;  1ISN A;  2I1K A;  3KSY A;  1DDW A;  2DFK A;  1V5M A;  4HB4 B;  3QIJ A;  4MY6 A;  4HAW B;  5FI1 A;  3AU5 A;  1Z87 A;  3M1I B;  1U27 A;  2YRY A;  4F7H A;  2FJL A;  4HAZ B;  1J19 A;  3LJU X;  3ODX A;  1J0W A;  5L81 A;  1EGX A;  1ZC3 B;  4A6F A;  2COD A;  2CAY A;  2AL6 A;  1DBH A;  3HQC A;  2RGN B;  1W1H A;  3HK0 A;  4DX8 A;  2RVB B;  2P0H A;  3A98 B;  2LKO A;  1U5E A;  1PFJ A;  1N3H A;  1XD4 A;  3PZD A;  3P7Z A;  1B55 A;  1ZM0 A;  4NSW A;  5J3Q A;  2DA0 A;  2G35 A;  3PP2 A;  4ZRK A;  4TKN A;  2RUK B;  5JHH A;  4P7I A;  3D8F A;  3WA0 A;  1GG3 A;  3D8E A;  2DHJ A;  2V76 A;  5J3T A;  1UNR A;  5KQ1 A;  4IFS A;  1WG7 A;  1GC7 A;  5HE2 A;  2CRF A;  2D4Q A;  2YS1 A;  2P8V A;  4F7G A;  1WGQ A;  4TYZ A;  3GYO A;  2D9Y A;  5EFX A;  2I5C A;  2VRW B;  3QWM A;  3F5R A;  1M7E A;  4CYE A;  4IOY X;  1MIZ B;  1RJ2 A;  3TO1 A;  1K5G B;  1MPH A;  2Z0P A;  2AEH A;  5HE1 A;  1X86 A;  4KVG B;  4A6K A;  3TFM A;  2VSZ A;  1FAO A;  2L1C A;  1V5P A;  4HB0 B;  3KRW A;  1OQN A;  2DKP A;  1U5D A;  1X1G A;  3ZDT A;  4Z2N A;  2L2I A;  1UPR A;  3HW2 B;  4CHM A;  2D9Z A;  3RCP A;  3PEG A;  4DBB A;  3TVV A;  1TXD A;  2IFS A;  2ZPY A;  1KZG A;  2Z0Q A;  1BTN A;  1ZC4 B;  2M38 A;  1MK7 B;  1I7A A;  3PG7 A;  5KCV A;  4ZRJ A;  2COA A;  1U2B A;  3DXE A;  2KGX B;  1BWN A;  4A6H A;  3F0W A;  3MDB C;  1UEF A;  2MDX A;  1DRO A;  2D11 A;  4HDO A;  1Y19 B;  2RLO A;  2ADZ A;  3GYP A;  1RRP B;  3NSU A;  1WGU A;  2J0K A;  2UZR A;  4WVF B;  2KCJ A;  2Y7B A;  2LUL A;  1MK9 B;  2ROV A;  2Y8F A;  2VKI A;  1UPQ A;  2E2X A;  2PZ1 A;  2ELA A;  2QKM A;  1NTV A;  3KY9 A;  2P0F A;  1M7R A;  2K2U A;  5JHG A;  1SHC A;  2D10 A;  2YS3 A;  2QKL A;  4B6H A;  2YSZ A;  2KUP A;  1XCG A;  1MIX A;  3SNH A;  1V5U A;  1H10 A;  4GPT B;  1AWE A;  3SO6 A;  2RSG A;  3V5W A;  5C6R A;  1WI1 A;  2N23 A;  1W1D A;  5D3W A;  2BCJ A;  1Y5O A;  1NTY A;  5C5B A;  4L6E A;  3ULB A;  4HAY B;  5FI0 A;  5CLQ B;  2W2W A;  4IAP A;  4HB3 B;  1QQG A;  3A8Q A;  3DXD A;  3PSC A;  4YON A;  5JLJ B;  2J0M A;  4EMO A;  1UNP A;  2P0D A;  1DYN A;  5GOW B;  3BJI A;  3IVF A;  2Q13 A;  5D3X A;  3SV1 A;  5DH9 B;  5HE0 A;  2M14 A;  2MWN B;  4GN1 A;  1H4R A;  3PVW A;  3QBV B;  2N0Y A;  4PNK A;  2DTC A;  4A6F B;  4HB2 B;  4H8S A;  3KZ1 A;  4GZU A;  2COC A;  2UZS A;  2DHI A;  2YT0 A;  3U8Z A;  3WYF B;  4KHA A;  2CY4 A;  3VOQ A;  2COF A;  1DDV A;  1FGZ A;  2DHK A;  2MKR A;  3DXC A;  1NI2 A;  1XKE A;  5D27 A;  4KHB B;  1V61 A;  1XX0 A;  2LG1 A;  4ZRI A;  3ULC A;  3FM8 C;  2W2X D;  1NU2 A;  3T06 A;  1V89 A;  3D8D A;  3N7C A;  3TW1 A; 
#chains in the Genus database with same CATH topology
 2I1J A;  1XOD A;  3ODO A;  3ZVR A;  1OMW A;  2JP2 A;  1XR0 B;  2DKQ A;  5KQ4 A;  2ELB A;  5LON B;  1ZSQ A;  3NWA A;  1EF1 A;  2K8E A;  2HTH B;  3VIA A;  1FOE A;  1IRS A;  5C16 A;  4HAX B;  1AQC A;  2J59 M;  1X11 A;  5DHA B;  1KZ7 A;  3CXB B;  3TCA A;  2YF0 A;  2DN6 A;  2ROZ B;  2GS0 A;  1FHW A;  4EKU A;  2W2X C;  4KHB A;  2R09 A;  2XQN M;  4XWX A;  2KR0 A;  2UVM A;  1WJM A;  1U5F A;  2GCJ A;  3A8P A;  2H7E A;  4CHJ A;  4WJ7 A;  4GOU A;  2K2J A;  5JP4 A;  3FEH A;  2FJU B;  1E5W A;  4F7U P;  4PQ0 A;  1PMS A;  2EMS A;  1MAI A;  1X1F A;  2MFQ A;  3UZT A;  4MT7 A;  1GC6 A;  3O96 A;  2YS5 A;  4QJ5 B;  1P5T A;  2H7D A;  2EJ8 A;  4Y94 A;  1WJ1 A;  3CIK A;  1MKE A;  5J3Y A;  5D3V A;  2K00 A;  1FHX A;  3ODW A;  1OY2 A;  2RNR B;  5DIF B;  1QC6 A;  4EJN A;  2LOX A;  1BTK A;  4GMV A;  5C79 A;  1WVH A;  2DYN A;  3X23 A;  4HDQ A;  4K17 A;  3OHM B;  1KI1 B;  4L1R A;  4D0N B;  1TJ6 A;  2R0D A;  5I2S A;  1ZVR A;  2OQB A;  2YT1 A;  1I2H A;  1W1G A;  5C5B B;  2DYQ A;  2GCL A;  5HE3 A;  2YVC A;  2Z0O A;  4K2P A;  2CY5 A;  4QJ4 B;  2DLW A;  1U29 A;  3MPX A;  4K81 A;  4HAV B;  4HAU B;  1FGY A;  3OAN A;  4GNK B;  1P6S A;  2Z59 A;  4HAT B;  4WSF A;  1BAK A;  4OSN A;  5D3Y A;  2X18 A;  2EMT A;  2HE7 A;  3NWD A;  1LB1 A;  3SYX A;  4DXA B;  2LOZ A;  2D9V A;  4NY0 A;  3G9W A;  1PLS A;  4GXB A;  4C0A A;  1K5D B;  2GJY A;  3FVC A;  5CLL B;  4A5K A;  2NZ8 B;  3BIN A;  5LOP B;  3PVU A;  1EVH A;  1V88 A;  2D9X A;  2Y8G A;  4K2O A;  2NMB A;  1TQZ A;  2OTX A;  4KHO A;  4YL8 A;  3U7D A;  1FHO A;  3HSA A;  2NBV A;  4KAX B;  1X05 A;  1P3R A;  1UNQ A;  4HHV A;  2D2Q A;  3SUZ A;  3HIE A;  1FB8 A;  2EC1 A;  5I2M A;  4MK0 A;  3U12 A;  1Q67 A;  2IYB A;  4BBK A;  5IRS A;  1EAZ A;  4Z2M B;  3AU4 A;  1LW3 A;  3FSS A;  2DX1 A;  3P6A A;  3AJ4 A;  4QXA B;  2J0J A;  2I5F A;  4DX9 0;  5DHF B;  5DI9 B;  4D6W A;  2DX5 A;  2ZKM X;  4HSI A;  3KRX A;  3PVL A;  2LYD A;  1DDM A;  1SGH A;  3ML4 A;  2GUM A;  2D9W A;  2KIE A;  1U5G A;  4GMX B;  1ISN A;  2I1K A;  3KSY A;  1DDW A;  2Z13 A;  2DFK A;  1V5M A;  4HB4 B;  3QIJ A;  4MY6 A;  4HAW B;  5FI1 A;  3AU5 A;  1Z87 A;  3M1I B;  1U27 A;  2YRY A;  4F7H A;  2RRF A;  2FJL A;  4HAZ B;  1J19 A;  3LJU X;  3ODX A;  1J0W A;  5L81 A;  1EGX A;  1ZC3 B;  2Z4D A;  4A6F A;  2COD A;  2CAY A;  2AL6 A;  1DBH A;  3HQC A;  2RGN B;  3B77 A;  1W1H A;  3HK0 A;  4DX8 A;  2RVB B;  2P0H A;  3A98 B;  2LKO A;  1U5E A;  1PFJ A;  1N3H A;  1XD4 A;  3PZD A;  3P7Z A;  1B55 A;  1ZM0 A;  2KUQ A;  4NSW A;  5J3Q A;  2DA0 A;  2G35 A;  3PP2 A;  4ZRK A;  4TKN A;  2RUK B;  5JHH A;  4P7I A;  3D8F A;  3WA0 A;  1GG3 A;  3D8E A;  2DHJ A;  2V76 A;  5J3T A;  1UNR A;  5KQ1 A;  4IFS A;  1WG7 A;  1GC7 A;  5HE2 A;  2CRF A;  2D4Q A;  2YS1 A;  2P8V A;  4F7G A;  1WGQ A;  4TYZ A;  3GYO A;  2D9Y A;  5EFX A;  2I5C A;  2VRW B;  3QWM A;  3F5R A;  1M7E A;  4CYE A;  4IOY X;  1MIZ B;  1RJ2 A;  3TO1 A;  1K5G B;  1MPH A;  2Z14 A;  2Z0P A;  2AEH A;  5HE1 A;  1X86 A;  4KVG B;  4A6K A;  3TFM A;  2VSZ A;  1FAO A;  2L1C A;  1V5P A;  4HB0 B;  3KRW A;  1OQN A;  2DKP A;  1U5D A;  1X1G A;  3ZDT A;  4Z2N A;  2L2I A;  1UPR A;  3HW2 B;  4CHM A;  2D9Z A;  3A58 A;  3RCP A;  3PEG A;  4CSQ A;  4DBB A;  3TVV A;  3NW8 A;  1TXD A;  2IFS A;  2ZPY A;  1KZG A;  2Z0Q A;  1BTN A;  1ZC4 B;  2M38 A;  1ZYI A;  1MK7 B;  1I7A A;  3PG7 A;  5KCV A;  4ZRJ A;  2COA A;  1U2B A;  3DXE A;  2KGX B;  1BWN A;  4A6H A;  3F0W A;  5LG4 B;  3MDB C;  2K49 A;  1UEF A;  2MDX A;  2KIG A;  1DRO A;  2D11 A;  4HDO A;  1Y19 B;  2RLO A;  2ADZ A;  3GYP A;  1RRP B;  3NSU A;  1WGU A;  2J0K A;  2UZR A;  4WVF B;  4QJ3 B;  2KCJ A;  2Y7B A;  2LUL A;  1MK9 B;  2ROV A;  2Y8F A;  4DIX A;  2VKI A;  1UPQ A;  2E2X A;  2PZ1 A;  2ELA A;  2QKM A;  1NTV A;  3KY9 A;  2R2Y A;  2P0F A;  1M7R A;  2K2U A;  5JHG A;  1SHC A;  2D10 A;  2YS3 A;  1MI1 A;  2QKL A;  4B6H A;  2YSZ A;  2KUP A;  1XCG A;  1MIX A;  3SNH A;  1V5U A;  1H10 A;  4GPT B;  1AWE A;  3SO6 A;  3DCX A;  2RSG A;  3NWF A;  3V5W A;  5C6R A;  1WI1 A;  2N23 A;  1W1D A;  5D3W A;  2BCJ A;  1Y5O A;  1NTY A;  5C5B A;  4L6E A;  3ULB A;  4HAY B;  5FI0 A;  5CLQ B;  2W2W A;  4IAP A;  4HB3 B;  1QQG A;  3A8Q A;  3DXD A;  3PSC A;  4YON A;  5JLJ B;  2J0M A;  4EMO A;  1UNP A;  2P0D A;  1DYN A;  5GOW B;  3BJI A;  3IVF A;  2Q13 A;  5D3X A;  3SV1 A;  5DH9 B;  5HE0 A;  2M14 A;  2MWN B;  4GN1 A;  1H4R A;  3PVW A;  3QBV B;  2N0Y A;  4PNK A;  2DTC A;  4A6F B;  4HB2 B;  4H8S A;  4OT1 A;  3KZ1 A;  4GZU A;  2COC A;  2UZS A;  2DHI A;  2YT0 A;  3U8Z A;  3WYF B;  4KHA A;  2CY4 A;  5M4Y B;  3VOQ A;  2COF A;  1DDV A;  1FGZ A;  2DHK A;  2MKR A;  3DXC A;  1NI2 A;  1XKE A;  5D27 A;  4KHB B;  1V61 A;  1XX0 A;  2LG1 A;  4ZRI A;  3ULC A;  3FM8 C;  2W2X D;  1NU2 A;  3T06 A;  1V89 A;  3D8D A;  1T77 A;  2YT2 A;  3N7C A;  3TW1 A; 
#chains in the Genus database with same CATH homology
 2I1J A;  1XOD A;  3ODO A;  3ZVR A;  1OMW A;  2JP2 A;  1XR0 B;  2DKQ A;  5KQ4 A;  2ELB A;  5LON B;  1ZSQ A;  1EF1 A;  2HTH B;  3VIA A;  1FOE A;  1IRS A;  5C16 A;  4HAX B;  1AQC A;  2J59 M;  1X11 A;  5DHA B;  1KZ7 A;  3CXB B;  3TCA A;  2YF0 A;  2DN6 A;  2ROZ B;  2GS0 A;  1FHW A;  4EKU A;  2W2X C;  2R09 A;  2XQN M;  4XWX A;  2UVM A;  1WJM A;  1U5F A;  2GCJ A;  3A8P A;  2H7E A;  4CHJ A;  4WJ7 A;  2K2J A;  5JP4 A;  3FEH A;  1E5W A;  4F7U P;  4PQ0 A;  1PMS A;  2EMS A;  1MAI A;  1X1F A;  2MFQ A;  3UZT A;  4MT7 A;  1GC6 A;  3O96 A;  2YS5 A;  1P5T A;  2H7D A;  2EJ8 A;  4Y94 A;  1WJ1 A;  3CIK A;  1MKE A;  5J3Y A;  5D3V A;  2K00 A;  1FHX A;  3ODW A;  1OY2 A;  2RNR B;  5DIF B;  1QC6 A;  4EJN A;  2LOX A;  1BTK A;  4GMV A;  5C79 A;  1WVH A;  2DYN A;  3X23 A;  4HDQ A;  4K17 A;  1KI1 B;  4D0N B;  1TJ6 A;  2R0D A;  1ZVR A;  2OQB A;  2YT1 A;  1I2H A;  1W1G A;  5C5B B;  2DYQ A;  2GCL A;  5HE3 A;  2YVC A;  2Z0O A;  4K2P A;  2CY5 A;  2DLW A;  1U29 A;  3MPX A;  4K81 A;  4HAV B;  4HAU B;  1FGY A;  3OAN A;  1P6S A;  4HAT B;  4WSF A;  1BAK A;  5D3Y A;  2X18 A;  2EMT A;  2HE7 A;  1LB1 A;  3SYX A;  4DXA B;  2LOZ A;  2D9V A;  4NY0 A;  3G9W A;  1PLS A;  4GXB A;  4C0A A;  1K5D B;  2GJY A;  4A5K A;  5CLL B;  2NZ8 B;  3BIN A;  5LOP B;  3PVU A;  1EVH A;  1V88 A;  2D9X A;  2Y8G A;  4K2O A;  2NMB A;  1TQZ A;  2OTX A;  4KHO A;  4YL8 A;  3U7D A;  1FHO A;  4KAX B;  1X05 A;  1P3R A;  1UNQ A;  4HHV A;  2D2Q A;  3SUZ A;  1FB8 A;  2EC1 A;  4MK0 A;  1Q67 A;  2IYB A;  4BBK A;  1EAZ A;  4Z2M B;  3AU4 A;  1LW3 A;  3FSS A;  2DX1 A;  3P6A A;  3AJ4 A;  2J0J A;  2I5F A;  4DX9 0;  5DHF B;  5DI9 B;  2DX5 A;  3KRX A;  3PVL A;  2LYD A;  1DDM A;  1SGH A;  3ML4 A;  2D9W A;  1U5G A;  4GMX B;  1ISN A;  2I1K A;  3KSY A;  1DDW A;  2DFK A;  1V5M A;  4HB4 B;  3QIJ A;  4MY6 A;  4HAW B;  5FI1 A;  3AU5 A;  1Z87 A;  3M1I B;  1U27 A;  2YRY A;  4F7H A;  2FJL A;  4HAZ B;  1J19 A;  3LJU X;  3ODX A;  1J0W A;  5L81 A;  1EGX A;  1ZC3 B;  4A6F A;  2COD A;  2CAY A;  2AL6 A;  1DBH A;  3HQC A;  2RGN B;  1W1H A;  3HK0 A;  4DX8 A;  2RVB B;  2P0H A;  3A98 B;  2LKO A;  1U5E A;  1PFJ A;  1N3H A;  1XD4 A;  3PZD A;  3P7Z A;  1B55 A;  1ZM0 A;  4NSW A;  5J3Q A;  2DA0 A;  2G35 A;  3PP2 A;  4ZRK A;  4TKN A;  2RUK B;  5JHH A;  4P7I A;  3D8F A;  3WA0 A;  1GG3 A;  3D8E A;  2DHJ A;  2V76 A;  5J3T A;  1UNR A;  5KQ1 A;  4IFS A;  1WG7 A;  1GC7 A;  5HE2 A;  2CRF A;  2D4Q A;  2YS1 A;  2P8V A;  4F7G A;  1WGQ A;  4TYZ A;  3GYO A;  2D9Y A;  5EFX A;  2I5C A;  2VRW B;  3QWM A;  3F5R A;  1M7E A;  4CYE A;  4IOY X;  1MIZ B;  1RJ2 A;  3TO1 A;  1K5G B;  1MPH A;  2Z0P A;  2AEH A;  5HE1 A;  1X86 A;  4KVG B;  4A6K A;  3TFM A;  2VSZ A;  1FAO A;  2L1C A;  1V5P A;  4HB0 B;  3KRW A;  1OQN A;  2DKP A;  1U5D A;  1X1G A;  3ZDT A;  4Z2N A;  2L2I A;  1UPR A;  3HW2 B;  4CHM A;  2D9Z A;  3RCP A;  3PEG A;  4DBB A;  3TVV A;  1TXD A;  2IFS A;  2ZPY A;  1KZG A;  2Z0Q A;  1BTN A;  1ZC4 B;  2M38 A;  1MK7 B;  1I7A A;  3PG7 A;  5KCV A;  4ZRJ A;  2COA A;  1U2B A;  3DXE A;  2KGX B;  1BWN A;  4A6H A;  3F0W A;  3MDB C;  1UEF A;  2MDX A;  1DRO A;  2D11 A;  4HDO A;  1Y19 B;  2RLO A;  2ADZ A;  3GYP A;  1RRP B;  3NSU A;  1WGU A;  2J0K A;  2UZR A;  4WVF B;  2KCJ A;  2Y7B A;  2LUL A;  1MK9 B;  2ROV A;  2Y8F A;  2VKI A;  1UPQ A;  2E2X A;  2PZ1 A;  2ELA A;  2QKM A;  1NTV A;  3KY9 A;  2P0F A;  1M7R A;  2K2U A;  5JHG A;  1SHC A;  2D10 A;  2YS3 A;  2QKL A;  4B6H A;  2YSZ A;  2KUP A;  1XCG A;  1MIX A;  3SNH A;  1V5U A;  1H10 A;  4GPT B;  1AWE A;  3SO6 A;  2RSG A;  3V5W A;  5C6R A;  1WI1 A;  2N23 A;  1W1D A;  5D3W A;  2BCJ A;  1Y5O A;  1NTY A;  5C5B A;  4L6E A;  3ULB A;  4HAY B;  5FI0 A;  5CLQ B;  2W2W A;  4IAP A;  4HB3 B;  1QQG A;  3A8Q A;  3DXD A;  3PSC A;  4YON A;  5JLJ B;  2J0M A;  4EMO A;  1UNP A;  2P0D A;  1DYN A;  5GOW B;  3BJI A;  3IVF A;  2Q13 A;  5D3X A;  3SV1 A;  5DH9 B;  5HE0 A;  2M14 A;  2MWN B;  4GN1 A;  1H4R A;  3PVW A;  3QBV B;  2N0Y A;  4PNK A;  2DTC A;  4A6F B;  4HB2 B;  4H8S A;  3KZ1 A;  4GZU A;  2COC A;  2UZS A;  2DHI A;  2YT0 A;  3U8Z A;  3WYF B;  4KHA A;  2CY4 A;  3VOQ A;  2COF A;  1DDV A;  1FGZ A;  2DHK A;  2MKR A;  3DXC A;  1NI2 A;  1XKE A;  5D27 A;  4KHB B;  1V61 A;  1XX0 A;  2LG1 A;  4ZRI A;  3ULC A;  3FM8 C;  2W2X D;  1NU2 A;  3T06 A;  1V89 A;  3D8D A;  3N7C A;  3TW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...