1ZC3B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
b'GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-A
publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc3B00
1ISNA 2Z0OA 4P7IA 3SUZA 3AJ4A 2COAA 4NSWA 2NMBA 1IRSA 2MDXA 1LW3A 1RJ2A 2P0HA 4DX90 4HHVA 5J3TA 2BCJA 4HB0B 1PFJA 1WGUA 1U29A 5J3QA 2DHJA 2DHIA 2K2UA 3A98B 2H7EA 4XWXA 4DX8A 3HW2B 4PNKA 3A8PA 3TFMA 1XCGA 1FHXA 1V5UA 3FM8C 5LOPB 2D9ZA 3KY9A 1X05A 1TXDA 2ELAA 3ZVRA 3QWMA 2D10A 3PP2A 5HE1A 1U5GA 2CAYA 3G9WA 2COCA 4IOYX 3CIKA 4MT7A 1ZM0A 4ZRKA 2OTXA 3WA0A 1V61A 1NTVA 4TKNA 4HAUB 2NZ8B 3GYPA 2W2WA 1N3HA 1X86A 5HE3A 3PVWA 2D9YA 5D27A 4CHMA 2YS5A 1FGZA 1W1GA 4Y94A 4MY6A 1U5DA 1W1HA 1B55A 3UZTA 3PVLA 3N7CA 4ZRJA 2OQBA 1UEFA 2UZRA 4GPTB 3M1IB 3TW1A 2EMSA 2VKIA 4HB4B 1EVHA 3SYXA 2UZSA 5CLQB 2RSGA 1GG3A 2COFA 3U8ZA 4KHBB 2YSZA 4Z2MB 5JHHA 2MWNB 1V88A 4DXAB 1XX0A 1FGYA 4EJNA 1MAIA 4Z2NA 1FHWA 1QQGA 4HAWB 1XD4A 2DA0A 4CYEA 2DTCA 2RVBB 2GCLA 1XKEA 4YONA 2QKMA 2FJLA 1UNRA 2EMTA 2LYDA 1MKEA 3TCAA 1KZGA 1BTKA 2LOZA 1MPHA 1UNQA 1PMSA 3ULBA 2RUKB 4WVFB 1WGQA 4GMXB 3FEHA 4CHJA 2M14A 3T06A 1DBHA 2DFKA 3KZ1A 5D3WA 1WVHA 4KAXB 3TVVA 2G35A 2D9WA 2HE7A 3AU5A 3PEGA 5C79A 2EJ8A 4HAYB 2X18A 3VIAA 3ODOA 4EKUA 5LONB 3LJUX 4A6FB 1I7AA 5C16A 2MFQA 2Z0PA 2GS0A 1X11A 5JP4A 2DX1A 1M7RA 1V5PA 3MPXA 3X23A 4B6HA 4F7HA 1UNPA 5DHFB 1BTNA 2R09A 1MK9B 5C5BA 2I5CA 4KHAA 3KSYA 3ODXA 5JHGA 3KRWA 1U27A 3IVFA 2W2XC 4ZRIA 1U5EA 1Y19B 2YRYA 4TYZA 5KQ1A 4IAPA 4PQ0A 5DIFB 1ZVRA 2Y8FA 2CODA 3FSSA 1J0WA 3D8EA 4MK0A 2RNRB 1FOEA 1OY2A 1H10A 3ULCA 5DHAB 3GYOA 1MIXA 2J0KA 2YS1A 1V89A 4WSFA 2KCJA 4GMVA 1ZC3B 4HB3B 1DDWA 2CY5A 3U7DA 1SGHA 1TQZA 1QC6A 3TO1A 1H4RA 2V76A 3NSUA 2KUPA 2I1KA 2CRFA 4HDOA 3V5WA 1V5MA 2D11A 2J0MA 2DKQA 3SO6A 2UVMA 2VRWB 5KCVA 2D9VA 2CY4A 1U5FA 3WYFB 1K5DB 2LG1A 2N0YA 2YS3A 3BINA 3P6AA 4GN1A 2IYBA 1KI1B 1KZ7A 3SV1A 2ROVA 3PZDA 1MIZB 4A6KA 2LULA 1K5GB 3A8QA 2ROZB 1ZC4B 2J0JA 1GC6A 4KVGB 4HAVB 2DYQA 3KRXA 2IFSA 4GXBA 4F7UP 1XR0B 2Z0QA 1GC7A 3OANA 1M7EA 1FAOA 2P8VA 1BAKA 4KHOA 2J59M 1LB1A 5FI0A 2GCJA 2DX5A 2DYNA 2K2JA 2P0DA 4WJ7A 5D3XA 2DKPA 2YVCA 1AQCA 5HE0A 4H8SA 1NTYA 2ADZA 4K17A 1NI2A 4BBKA 1WI1A 4A6HA 4A6FA 5FI1A 2I1JA 3HK0A 1W1DA 2KGXB 2P0FA 3CXBB 2H7DA 1P3RA 5GOWB 1DROA 5D3YA 1J19A 4K2OA 1EGXA 3PG7A 1FHOA 5J3YA 3F5RA 1FB8A 4HATB 3DXDA 3D8FA 1Q67A 5C5BB 1XODA 1WJMA 2I5FA 2Y8GA 3D8DA 2N23A 5JLJB 2D9XA 1OMWA 1WJ1A 1P6SA 2DLWA 1RRPB 2M38A 3HQCA 3AU4A 3ZDTA 4HAXB 4C0AA 1X1GA 5KQ4A 1DDVA 2Y7BA 1E5WA 2YF0A 4GZUA 2YT1A 4IFSA 3DXCA 1DYNA 5CLLB 4F7GA 5DI9B 4HDQA 1Y5OA 2W2XD 2XQNM 2EC1A 2AL6A 1I2HA 1AWEA 2ELBA 4HAZB 1P5TA 3ML4A 5L81A 2YT0A 2MKRA 2ZPYA 1BWNA 1U2BA 2D2QA 3DXEA 3ODWA 2GJYA 1UPQA 2LOXA 2VSZA 3QIJA 3F0WA 5EFXA 5HE2A 2E2XA 3QBVB 3SNHA 1OQNA 1TJ6A 2Q13A 2RGNB 4K81A 1SHCA 3PSCA 5DH9B 4L6EA 4YL8A 5C6RA 1UPRA 1EF1A 1WG7A 4K2PA 4A5KA 2QKLA 1X1FA 1DDMA 3PVUA 3MDBC 4NY0A 2AEHA 2L2IA 3RCPA 3P7ZA 2DHKA 4HB2B 3O96A 4EMOA 2D4QA 2RLOA 2PZ1A 2DN6A 4D0NB 1NU2A 1PLSA 2R0DA 1Z87A 3VOQA 1ZSQA 2LKOA 2K00A 5D3VA 2HTHB 4DBBA 2L1CA 2JP2A 1EAZA 1MK7B 3BJIA
chains in the Genus database with same CATH superfamily
1ISNA 2Z0OA 4P7IA 3SUZA 3AJ4A 2COAA 4NSWA 2NMBA 1IRSA 2MDXA 1LW3A 1RJ2A 2P0HA 4DX90 4HHVA 5J3TA 2BCJA 4HB0B 5I2MA 1PFJA 1WGUA 1U29A 3HIEA 5J3QA 2DHJA 2Z4DA 2DHIA 2K2UA 3A98B 2H7EA 4XWXA 4DX8A 3HW2B 4PNKA 4QXAB 3A8PA 3TFMA 1XCGA 1FHXA 1V5UA 3FM8C 5LOPB 2D9ZA 4QJ4B 3KY9A 1X05A 1TXDA 2ELAA 3ZVRA 3QWMA 2D10A 3A58A 3PP2A 5HE1A 1U5GA 2CAYA 3G9WA 2COCA 4IOYX 3CIKA 4MT7A 1ZM0A 4ZRKA 2OTXA 2GUMA 3WA0A 1V61A 1NTVA 4TKNA 4HAUB 2NZ8B 3GYPA 2W2WA 1N3HA 1X86A 4QJ3B 2KR0A 5HE3A 3PVWA 2D9YA 5D27A 4CHMA 2YS5A 1FGZA 1W1GA 4Y94A 3NW8A 4MY6A 1U5DA 1W1HA 1B55A 3UZTA 3PVLA 2FJUB 3N7CA 4ZRJA 2OQBA 1UEFA 2UZRA 4GPTB 3M1IB 3TW1A 3NWDA 2EMSA 2VKIA 4HB4B 1EVHA 2K8EA 3SYXA 2UZSA 5CLQB 2RSGA 1GG3A 2COFA 3U8ZA 4KHBB 2YSZA 4Z2MB 5JHHA 2MWNB 1V88A 4DXAB 1XX0A 1FGYA 4EJNA 1MAIA 4Z2NA 1FHWA 1QQGA 1ZYIA 4HAWB 1XD4A 2DA0A 4CYEA 2DTCA 2RVBB 2GCLA 1XKEA 4YONA 2QKMA 2FJLA 1UNRA 2EMTA 2LYDA 1MKEA 3TCAA 1KZGA 1BTKA 2LOZA 1MPHA 1UNQA 1PMSA 3ULBA 2RUKB 4WVFB 1WGQA 4GMXB 3FEHA 4CHJA 2M14A 3T06A 1DBHA 2DFKA 3KZ1A 5D3WA 1WVHA 4KAXB 3TVVA 2G35A 2D9WA 2HE7A 3AU5A 3PEGA 5LG4B 5C79A 2EJ8A 4HAYB 2X18A 3VIAA 3ODOA 4QJ5B 3U12A 4EKUA 5LONB 3LJUX 4A6FB 1I7AA 5C16A 2MFQA 2Z0PA 2GS0A 1X11A 5JP4A 2DX1A 1M7RA 1V5PA 3MPXA 3X23A 4B6HA 4F7HA 1UNPA 5DHFB 1BTNA 2R2YA 2R09A 1MK9B 5C5BA 2RRFA 2I5CA 4KHAA 3KSYA 1T77A 3ODXA 5JHGA 3KRWA 1U27A 3IVFA 2W2XC 2ZKMX 2KIEA 4ZRIA 1U5EA 1Y19B 2YRYA 3NWFA 4TYZA 5KQ1A 4IAPA 4PQ0A 5DIFB 1ZVRA 2Y8FA 5M4YB 2CODA 3FSSA 1J0WA 3D8EA 4MK0A 2RNRB 1FOEA 1OY2A 1H10A 3ULCA 5DHAB 3GYOA 1MIXA 2J0KA 2Z14A 2YS1A 1V89A 4WSFA 2KCJA 4GMVA 4GOUA 1ZC3B 4HB3B 1DDWA 2CY5A 3U7DA 1SGHA 1TQZA 1QC6A 3TO1A 1H4RA 2V76A 3NSUA 2KUPA 2I1KA 2CRFA 4HDOA 3V5WA 1V5MA 2D11A 2J0MA 2DKQA 3SO6A 2K49A 2UVMA 2VRWB 5KCVA 2D9VA 2CY4A 1U5FA 3WYFB 1K5DB 2LG1A 2N0YA 2YS3A 3BINA 3P6AA 4L1RA 4GN1A 2IYBA 1KI1B 1KZ7A 3SV1A 2ROVA 3PZDA 1MIZB 4A6KA 2LULA 1K5GB 3A8QA 2ROZB 1ZC4B 2J0JA 3FVCA 1GC6A 4KVGB 4HAVB 2DYQA 3KRXA 2IFSA 4GXBA 4F7UP 1XR0B 2Z0QA 1GC7A 3OANA 1M7EA 1FAOA 2P8VA 1BAKA 4KHOA 2J59M 1LB1A 5FI0A 2GCJA 2DX5A 2DYNA 2K2JA 2P0DA 3OHMB 4WJ7A 5D3XA 2DKPA 2YVCA 1AQCA 5HE0A 1MI1A 4H8SA 1NTYA 2ADZA 4K17A 4HSIA 3DCXA 1NI2A 4BBKA 5IRSA 1WI1A 4A6HA 4A6FA 5FI1A 2I1JA 3HK0A 1W1DA 2KGXB 2P0FA 3CXBB 2H7DA 1P3RA 5GOWB 1DROA 5D3YA 1J19A 4K2OA 1EGXA 3PG7A 1FHOA 5J3YA 3F5RA 1FB8A 4HATB 3DXDA 3D8FA 1Q67A 5C5BB 1XODA 4CSQA 1WJMA 2I5FA 2Y8GA 4GNKB 3D8DA 2N23A 5JLJB 2D9XA 3NWAA 1OMWA 1WJ1A 1P6SA 2DLWA 1RRPB 2M38A 3HQCA 3AU4A 3ZDTA 4HAXB 4C0AA 1X1GA 5KQ4A 1DDVA 2Y7BA 1E5WA 2YF0A 4GZUA 2YT1A 2Z13A 4IFSA 3DXCA 2KUQA 1DYNA 5CLLB 4F7GA 5DI9B 4HDQA 1Y5OA 2W2XD 2XQNM 2EC1A 2AL6A 1I2HA 2KIGA 2ELBA 4HAZB 1AWEA 4OT1A 1P5TA 3ML4A 5L81A 2YT0A 2MKRA 2ZPYA 3B77A 5I2SA 1BWNA 1U2BA 2D2QA 4D6WA 3DXEA 3ODWA 3HSAA 2GJYA 1UPQA 2LOXA 2VSZA 4KHBA 3QIJA 3F0WA 5EFXA 5HE2A 2E2XA 3QBVB 3SNHA 1OQNA 1TJ6A 2Q13A 2RGNB 4K81A 1SHCA 3PSCA 5DH9B 4L6EA 4YL8A 2NBVA 5C6RA 1UPRA 1EF1A 1WG7A 4K2PA 4A5KA 2QKLA 1X1FA 1DDMA 3PVUA 3MDBC 4NY0A 2Z59A 2AEHA 2L2IA 3RCPA 3P7ZA 2DHKA 4HB2B 3O96A 4EMOA 2D4QA 2RLOA 2PZ1A 2DN6A 4D0NB 1NU2A 1PLSA 2R0DA 2YT2A 4OSNA 1Z87A 4DIXA 3VOQA 1ZSQA 2LKOA 2K00A 5D3VA 2HTHB 4DBBA 2L1CA 2JP2A 1EAZA 1MK7B 3BJIA
chains in the Genus database with same CATH topology
1ISNA 2Z0OA 4P7IA 3SUZA 3AJ4A 2COAA 4NSWA 2NMBA 1IRSA 2MDXA 1LW3A 1RJ2A 2P0HA 4DX90 4HHVA 5J3TA 2BCJA 4HB0B 1PFJA 1WGUA 1U29A 5J3QA 2DHJA 2DHIA 2K2UA 3A98B 2H7EA 4XWXA 4DX8A 3HW2B 4PNKA 3A8PA 3TFMA 1XCGA 1FHXA 1V5UA 3FM8C 5LOPB 2D9ZA 3KY9A 1X05A 1TXDA 2ELAA 3ZVRA 3QWMA 2D10A 3PP2A 5HE1A 1U5GA 2CAYA 3G9WA 2COCA 4IOYX 3CIKA 4MT7A 1ZM0A 4ZRKA 2OTXA 3WA0A 1V61A 1NTVA 4TKNA 4HAUB 2NZ8B 3GYPA 2W2WA 1N3HA 1X86A 5HE3A 3PVWA 2D9YA 5D27A 4CHMA 2YS5A 1FGZA 1W1GA 4Y94A 4MY6A 1U5DA 1W1HA 1B55A 3UZTA 3PVLA 3N7CA 4ZRJA 2OQBA 1UEFA 2UZRA 4GPTB 3M1IB 3TW1A 2EMSA 2VKIA 4HB4B 1EVHA 3SYXA 2UZSA 5CLQB 2RSGA 1GG3A 2COFA 3U8ZA 4KHBB 2YSZA 4Z2MB 5JHHA 2MWNB 1V88A 4DXAB 1XX0A 1FGYA 4EJNA 1MAIA 4Z2NA 1FHWA 1QQGA 4HAWB 1XD4A 2DA0A 4CYEA 2DTCA 2RVBB 2GCLA 1XKEA 4YONA 2QKMA 2FJLA 1UNRA 2EMTA 2LYDA 1MKEA 3TCAA 1KZGA 1BTKA 2LOZA 1MPHA 1UNQA 1PMSA 3ULBA 2RUKB 4WVFB 1WGQA 4GMXB 3FEHA 4CHJA 2M14A 3T06A 1DBHA 2DFKA 3KZ1A 5D3WA 1WVHA 4KAXB 3TVVA 2G35A 2D9WA 2HE7A 3AU5A 3PEGA 5C79A 2EJ8A 4HAYB 2X18A 3VIAA 3ODOA 4EKUA 5LONB 3LJUX 4A6FB 1I7AA 5C16A 2MFQA 2Z0PA 2GS0A 1X11A 5JP4A 2DX1A 1M7RA 1V5PA 3MPXA 3X23A 4B6HA 4F7HA 1UNPA 5DHFB 1BTNA 2R09A 1MK9B 5C5BA 2I5CA 4KHAA 3KSYA 3ODXA 5JHGA 3KRWA 1U27A 3IVFA 2W2XC 4ZRIA 1U5EA 1Y19B 2YRYA 4TYZA 5KQ1A 4IAPA 4PQ0A 5DIFB 1ZVRA 2Y8FA 2CODA 3FSSA 1J0WA 3D8EA 4MK0A 2RNRB 1FOEA 1OY2A 1H10A 3ULCA 5DHAB 3GYOA 1MIXA 2J0KA 2YS1A 1V89A 4WSFA 2KCJA 4GMVA 1ZC3B 4HB3B 1DDWA 2CY5A 3U7DA 1SGHA 1TQZA 1QC6A 3TO1A 1H4RA 2V76A 3NSUA 2KUPA 2I1KA 2CRFA 4HDOA 3V5WA 1V5MA 2D11A 2J0MA 2DKQA 3SO6A 2UVMA 2VRWB 5KCVA 2D9VA 2CY4A 1U5FA 3WYFB 1K5DB 2LG1A 2N0YA 2YS3A 3BINA 3P6AA 4GN1A 2IYBA 1KI1B 1KZ7A 3SV1A 2ROVA 3PZDA 1MIZB 4A6KA 2LULA 1K5GB 3A8QA 2ROZB 1ZC4B 2J0JA 1GC6A 4KVGB 4HAVB 2DYQA 3KRXA 2IFSA 4GXBA 4F7UP 1XR0B 2Z0QA 1GC7A 3OANA 1M7EA 1FAOA 2P8VA 1BAKA 4KHOA 2J59M 1LB1A 5FI0A 2GCJA 2DX5A 2DYNA 2K2JA 2P0DA 4WJ7A 5D3XA 2DKPA 2YVCA 1AQCA 5HE0A 4H8SA 1NTYA 2ADZA 4K17A 1NI2A 4BBKA 1WI1A 4A6HA 4A6FA 5FI1A 2I1JA 3HK0A 1W1DA 2KGXB 2P0FA 3CXBB 2H7DA 1P3RA 5GOWB 1DROA 5D3YA 1J19A 4K2OA 1EGXA 3PG7A 1FHOA 5J3YA 3F5RA 1FB8A 4HATB 3DXDA 3D8FA 1Q67A 5C5BB 1XODA 1WJMA 2I5FA 2Y8GA 3D8DA 2N23A 5JLJB 2D9XA 1OMWA 1WJ1A 1P6SA 2DLWA 1RRPB 2M38A 3HQCA 3AU4A 3ZDTA 4HAXB 4C0AA 1X1GA 5KQ4A 1DDVA 2Y7BA 1E5WA 2YF0A 4GZUA 2YT1A 4IFSA 3DXCA 1DYNA 5CLLB 4F7GA 5DI9B 4HDQA 1Y5OA 2W2XD 2XQNM 2EC1A 2AL6A 1I2HA 1AWEA 2ELBA 4HAZB 1P5TA 3ML4A 5L81A 2YT0A 2MKRA 2ZPYA 1BWNA 1U2BA 2D2QA 3DXEA 3ODWA 2GJYA 1UPQA 2LOXA 2VSZA 3QIJA 3F0WA 5EFXA 5HE2A 2E2XA 3QBVB 3SNHA 1OQNA 1TJ6A 2Q13A 2RGNB 4K81A 1SHCA 3PSCA 5DH9B 4L6EA 4YL8A 5C6RA 1UPRA 1EF1A 1WG7A 4K2PA 4A5KA 2QKLA 1X1FA 1DDMA 3PVUA 3MDBC 4NY0A 2AEHA 2L2IA 3RCPA 3P7ZA 2DHKA 4HB2B 3O96A 4EMOA 2D4QA 2RLOA 2PZ1A 2DN6A 4D0NB 1NU2A 1PLSA 2R0DA 1Z87A 3VOQA 1ZSQA 2LKOA 2K00A 5D3VA 2HTHB 4DBBA 2L1CA 2JP2A 1EAZA 1MK7B 3BJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISN A;  2Z0O A;  4P7I A;  3SUZ A;  3AJ4 A;  2COA A;  4NSW A;  2NMB A;  1IRS A;  2MDX A;  1LW3 A;  1RJ2 A;  2P0H A;  4DX9 0;  4HHV A;  5J3T A;  2BCJ A;  4HB0 B;  1PFJ A;  1WGU A;  1U29 A;  5J3Q A;  2DHJ A;  2DHI A;  2K2U A;  3A98 B;  2H7E A;  4XWX A;  4DX8 A;  3HW2 B;  4PNK A;  3A8P A;  3TFM A;  1XCG A;  1FHX A;  1V5U A;  3FM8 C;  5LOP B;  2D9Z A;  3KY9 A;  1X05 A;  1TXD A;  2ELA A;  3ZVR A;  3QWM A;  2D10 A;  3PP2 A;  5HE1 A;  1U5G A;  2CAY A;  3G9W A;  2COC A;  4IOY X;  3CIK A;  4MT7 A;  1ZM0 A;  4ZRK A;  2OTX A;  3WA0 A;  1V61 A;  1NTV A;  4TKN A;  4HAU B;  2NZ8 B;  3GYP A;  2W2W A;  1N3H A;  1X86 A;  5HE3 A;  3PVW A;  2D9Y A;  5D27 A;  4CHM A;  2YS5 A;  1FGZ A;  1W1G A;  4Y94 A;  4MY6 A;  1U5D A;  1W1H A;  1B55 A;  3UZT A;  3PVL A;  3N7C A;  4ZRJ A;  2OQB A;  1UEF A;  2UZR A;  4GPT B;  3M1I B;  3TW1 A;  2EMS A;  2VKI A;  4HB4 B;  1EVH A;  3SYX A;  2UZS A;  5CLQ B;  2RSG A;  1GG3 A;  2COF A;  3U8Z A;  4KHB B;  2YSZ A;  4Z2M B;  5JHH A;  2MWN B;  1V88 A;  4DXA B;  1XX0 A;  1FGY A;  4EJN A;  1MAI A;  4Z2N A;  1FHW A;  1QQG A;  4HAW B;  1XD4 A;  2DA0 A;  4CYE A;  2DTC A;  2RVB B;  2GCL A;  1XKE A;  4YON A;  2QKM A;  2FJL A;  1UNR A;  2EMT A;  2LYD A;  1MKE A;  3TCA A;  1KZG A;  1BTK A;  2LOZ A;  1MPH A;  1UNQ A;  1PMS A;  3ULB A;  2RUK B;  4WVF B;  1WGQ A;  4GMX B;  3FEH A;  4CHJ A;  2M14 A;  3T06 A;  1DBH A;  2DFK A;  3KZ1 A;  5D3W A;  1WVH A;  4KAX B;  3TVV A;  2G35 A;  2D9W A;  2HE7 A;  3AU5 A;  3PEG A;  5C79 A;  2EJ8 A;  4HAY B;  2X18 A;  3VIA A;  3ODO A;  4EKU A;  5LON B;  3LJU X;  4A6F B;  1I7A A;  5C16 A;  2MFQ A;  2Z0P A;  2GS0 A;  1X11 A;  5JP4 A;  2DX1 A;  1M7R A;  1V5P A;  3MPX A;  3X23 A;  4B6H A;  4F7H A;  1UNP A;  5DHF B;  1BTN A;  2R09 A;  1MK9 B;  5C5B A;  2I5C A;  4KHA A;  3KSY A;  3ODX A;  5JHG A;  3KRW A;  1U27 A;  3IVF A;  2W2X C;  4ZRI A;  1U5E A;  1Y19 B;  2YRY A;  4TYZ A;  5KQ1 A;  4IAP A;  4PQ0 A;  5DIF B;  1ZVR A;  2Y8F A;  2COD A;  3FSS A;  1J0W A;  3D8E A;  4MK0 A;  2RNR B;  1FOE A;  1OY2 A;  1H10 A;  3ULC A;  5DHA B;  3GYO A;  1MIX A;  2J0K A;  2YS1 A;  1V89 A;  4WSF A;  2KCJ A;  4GMV A;  1ZC3 B;  4HB3 B;  1DDW A;  2CY5 A;  3U7D A;  1SGH A;  1TQZ A;  1QC6 A;  3TO1 A;  1H4R A;  2V76 A;  3NSU A;  2KUP A;  2I1K A;  2CRF A;  4HDO A;  3V5W A;  1V5M A;  2D11 A;  2J0M A;  2DKQ A;  3SO6 A;  2UVM A;  2VRW B;  5KCV A;  2D9V A;  2CY4 A;  1U5F A;  3WYF B;  1K5D B;  2LG1 A;  2N0Y A;  2YS3 A;  3BIN A;  3P6A A;  4GN1 A;  2IYB A;  1KI1 B;  1KZ7 A;  3SV1 A;  2ROV A;  3PZD A;  1MIZ B;  4A6K A;  2LUL A;  1K5G B;  3A8Q A;  2ROZ B;  1ZC4 B;  2J0J A;  1GC6 A;  4KVG B;  4HAV B;  2DYQ A;  3KRX A;  2IFS A;  4GXB A;  4F7U P;  1XR0 B;  2Z0Q A;  1GC7 A;  3OAN A;  1M7E A;  1FAO A;  2P8V A;  1BAK A;  4KHO A;  2J59 M;  1LB1 A;  5FI0 A;  2GCJ A;  2DX5 A;  2DYN A;  2K2J A;  2P0D A;  4WJ7 A;  5D3X A;  2DKP A;  2YVC A;  1AQC A;  5HE0 A;  4H8S A;  1NTY A;  2ADZ A;  4K17 A;  1NI2 A;  4BBK A;  1WI1 A;  4A6H A;  4A6F A;  5FI1 A;  2I1J A;  3HK0 A;  1W1D A;  2KGX B;  2P0F A;  3CXB B;  2H7D A;  1P3R A;  5GOW B;  1DRO A;  5D3Y A;  1J19 A;  4K2O A;  1EGX A;  3PG7 A;  1FHO A;  5J3Y A;  3F5R A;  1FB8 A;  4HAT B;  3DXD A;  3D8F A;  1Q67 A;  5C5B B;  1XOD A;  1WJM A;  2I5F A;  2Y8G A;  3D8D A;  2N23 A;  5JLJ B;  2D9X A;  1OMW A;  1WJ1 A;  1P6S A;  2DLW A;  1RRP B;  2M38 A;  3HQC A;  3AU4 A;  3ZDT A;  4HAX B;  4C0A A;  1X1G A;  5KQ4 A;  1DDV A;  2Y7B A;  1E5W A;  2YF0 A;  4GZU A;  2YT1 A;  4IFS A;  3DXC A;  1DYN A;  5CLL B;  4F7G A;  5DI9 B;  4HDQ A;  1Y5O A;  2W2X D;  2XQN M;  2EC1 A;  2AL6 A;  1I2H A;  1AWE A;  2ELB A;  4HAZ B;  1P5T A;  3ML4 A;  5L81 A;  2YT0 A;  2MKR A;  2ZPY A;  1BWN A;  1U2B A;  2D2Q A;  3DXE A;  3ODW A;  2GJY A;  1UPQ A;  2LOX A;  2VSZ A;  3QIJ A;  3F0W A;  5EFX A;  5HE2 A;  2E2X A;  3QBV B;  3SNH A;  1OQN A;  1TJ6 A;  2Q13 A;  2RGN B;  4K81 A;  1SHC A;  3PSC A;  5DH9 B;  4L6E A;  4YL8 A;  5C6R A;  1UPR A;  1EF1 A;  1WG7 A;  4K2P A;  4A5K A;  2QKL A;  1X1F A;  1DDM A;  3PVU A;  3MDB C;  4NY0 A;  2AEH A;  2L2I A;  3RCP A;  3P7Z A;  2DHK A;  4HB2 B;  3O96 A;  4EMO A;  2D4Q A;  2RLO A;  2PZ1 A;  2DN6 A;  4D0N B;  1NU2 A;  1PLS A;  2R0D A;  1Z87 A;  3VOQ A;  1ZSQ A;  2LKO A;  2K00 A;  5D3V A;  2HTH B;  4DBB A;  2L1C A;  2JP2 A;  1EAZ A;  1MK7 B;  3BJI A; 
#chains in the Genus database with same CATH topology
 1ISN A;  2Z0O A;  4P7I A;  3SUZ A;  3AJ4 A;  2COA A;  4NSW A;  2NMB A;  1IRS A;  2MDX A;  1LW3 A;  1RJ2 A;  2P0H A;  4DX9 0;  4HHV A;  5J3T A;  2BCJ A;  4HB0 B;  5I2M A;  1PFJ A;  1WGU A;  1U29 A;  3HIE A;  5J3Q A;  2DHJ A;  2Z4D A;  2DHI A;  2K2U A;  3A98 B;  2H7E A;  4XWX A;  4DX8 A;  3HW2 B;  4PNK A;  4QXA B;  3A8P A;  3TFM A;  1XCG A;  1FHX A;  1V5U A;  3FM8 C;  5LOP B;  2D9Z A;  4QJ4 B;  3KY9 A;  1X05 A;  1TXD A;  2ELA A;  3ZVR A;  3QWM A;  2D10 A;  3A58 A;  3PP2 A;  5HE1 A;  1U5G A;  2CAY A;  3G9W A;  2COC A;  4IOY X;  3CIK A;  4MT7 A;  1ZM0 A;  4ZRK A;  2OTX A;  2GUM A;  3WA0 A;  1V61 A;  1NTV A;  4TKN A;  4HAU B;  2NZ8 B;  3GYP A;  2W2W A;  1N3H A;  1X86 A;  4QJ3 B;  2KR0 A;  5HE3 A;  3PVW A;  2D9Y A;  5D27 A;  4CHM A;  2YS5 A;  1FGZ A;  1W1G A;  4Y94 A;  3NW8 A;  4MY6 A;  1U5D A;  1W1H A;  1B55 A;  3UZT A;  3PVL A;  2FJU B;  3N7C A;  4ZRJ A;  2OQB A;  1UEF A;  2UZR A;  4GPT B;  3M1I B;  3TW1 A;  3NWD A;  2EMS A;  2VKI A;  4HB4 B;  1EVH A;  2K8E A;  3SYX A;  2UZS A;  5CLQ B;  2RSG A;  1GG3 A;  2COF A;  3U8Z A;  4KHB B;  2YSZ A;  4Z2M B;  5JHH A;  2MWN B;  1V88 A;  4DXA B;  1XX0 A;  1FGY A;  4EJN A;  1MAI A;  4Z2N A;  1FHW A;  1QQG A;  1ZYI A;  4HAW B;  1XD4 A;  2DA0 A;  4CYE A;  2DTC A;  2RVB B;  2GCL A;  1XKE A;  4YON A;  2QKM A;  2FJL A;  1UNR A;  2EMT A;  2LYD A;  1MKE A;  3TCA A;  1KZG A;  1BTK A;  2LOZ A;  1MPH A;  1UNQ A;  1PMS A;  3ULB A;  2RUK B;  4WVF B;  1WGQ A;  4GMX B;  3FEH A;  4CHJ A;  2M14 A;  3T06 A;  1DBH A;  2DFK A;  3KZ1 A;  5D3W A;  1WVH A;  4KAX B;  3TVV A;  2G35 A;  2D9W A;  2HE7 A;  3AU5 A;  3PEG A;  5LG4 B;  5C79 A;  2EJ8 A;  4HAY B;  2X18 A;  3VIA A;  3ODO A;  4QJ5 B;  3U12 A;  4EKU A;  5LON B;  3LJU X;  4A6F B;  1I7A A;  5C16 A;  2MFQ A;  2Z0P A;  2GS0 A;  1X11 A;  5JP4 A;  2DX1 A;  1M7R A;  1V5P A;  3MPX A;  3X23 A;  4B6H A;  4F7H A;  1UNP A;  5DHF B;  1BTN A;  2R2Y A;  2R09 A;  1MK9 B;  5C5B A;  2RRF A;  2I5C A;  4KHA A;  3KSY A;  1T77 A;  3ODX A;  5JHG A;  3KRW A;  1U27 A;  3IVF A;  2W2X C;  2ZKM X;  2KIE A;  4ZRI A;  1U5E A;  1Y19 B;  2YRY A;  3NWF A;  4TYZ A;  5KQ1 A;  4IAP A;  4PQ0 A;  5DIF B;  1ZVR A;  2Y8F A;  5M4Y B;  2COD A;  3FSS A;  1J0W A;  3D8E A;  4MK0 A;  2RNR B;  1FOE A;  1OY2 A;  1H10 A;  3ULC A;  5DHA B;  3GYO A;  1MIX A;  2J0K A;  2Z14 A;  2YS1 A;  1V89 A;  4WSF A;  2KCJ A;  4GMV A;  4GOU A;  1ZC3 B;  4HB3 B;  1DDW A;  2CY5 A;  3U7D A;  1SGH A;  1TQZ A;  1QC6 A;  3TO1 A;  1H4R A;  2V76 A;  3NSU A;  2KUP A;  2I1K A;  2CRF A;  4HDO A;  3V5W A;  1V5M A;  2D11 A;  2J0M A;  2DKQ A;  3SO6 A;  2K49 A;  2UVM A;  2VRW B;  5KCV A;  2D9V A;  2CY4 A;  1U5F A;  3WYF B;  1K5D B;  2LG1 A;  2N0Y A;  2YS3 A;  3BIN A;  3P6A A;  4L1R A;  4GN1 A;  2IYB A;  1KI1 B;  1KZ7 A;  3SV1 A;  2ROV A;  3PZD A;  1MIZ B;  4A6K A;  2LUL A;  1K5G B;  3A8Q A;  2ROZ B;  1ZC4 B;  2J0J A;  3FVC A;  1GC6 A;  4KVG B;  4HAV B;  2DYQ A;  3KRX A;  2IFS A;  4GXB A;  4F7U P;  1XR0 B;  2Z0Q A;  1GC7 A;  3OAN A;  1M7E A;  1FAO A;  2P8V A;  1BAK A;  4KHO A;  2J59 M;  1LB1 A;  5FI0 A;  2GCJ A;  2DX5 A;  2DYN A;  2K2J A;  2P0D A;  3OHM B;  4WJ7 A;  5D3X A;  2DKP A;  2YVC A;  1AQC A;  5HE0 A;  1MI1 A;  4H8S A;  1NTY A;  2ADZ A;  4K17 A;  4HSI A;  3DCX A;  1NI2 A;  4BBK A;  5IRS A;  1WI1 A;  4A6H A;  4A6F A;  5FI1 A;  2I1J A;  3HK0 A;  1W1D A;  2KGX B;  2P0F A;  3CXB B;  2H7D A;  1P3R A;  5GOW B;  1DRO A;  5D3Y A;  1J19 A;  4K2O A;  1EGX A;  3PG7 A;  1FHO A;  5J3Y A;  3F5R A;  1FB8 A;  4HAT B;  3DXD A;  3D8F A;  1Q67 A;  5C5B B;  1XOD A;  4CSQ A;  1WJM A;  2I5F A;  2Y8G A;  4GNK B;  3D8D A;  2N23 A;  5JLJ B;  2D9X A;  3NWA A;  1OMW A;  1WJ1 A;  1P6S A;  2DLW A;  1RRP B;  2M38 A;  3HQC A;  3AU4 A;  3ZDT A;  4HAX B;  4C0A A;  1X1G A;  5KQ4 A;  1DDV A;  2Y7B A;  1E5W A;  2YF0 A;  4GZU A;  2YT1 A;  2Z13 A;  4IFS A;  3DXC A;  2KUQ A;  1DYN A;  5CLL B;  4F7G A;  5DI9 B;  4HDQ A;  1Y5O A;  2W2X D;  2XQN M;  2EC1 A;  2AL6 A;  1I2H A;  2KIG A;  2ELB A;  4HAZ B;  1AWE A;  4OT1 A;  1P5T A;  3ML4 A;  5L81 A;  2YT0 A;  2MKR A;  2ZPY A;  3B77 A;  5I2S A;  1BWN A;  1U2B A;  2D2Q A;  4D6W A;  3DXE A;  3ODW A;  3HSA A;  2GJY A;  1UPQ A;  2LOX A;  2VSZ A;  4KHB A;  3QIJ A;  3F0W A;  5EFX A;  5HE2 A;  2E2X A;  3QBV B;  3SNH A;  1OQN A;  1TJ6 A;  2Q13 A;  2RGN B;  4K81 A;  1SHC A;  3PSC A;  5DH9 B;  4L6E A;  4YL8 A;  2NBV A;  5C6R A;  1UPR A;  1EF1 A;  1WG7 A;  4K2P A;  4A5K A;  2QKL A;  1X1F A;  1DDM A;  3PVU A;  3MDB C;  4NY0 A;  2Z59 A;  2AEH A;  2L2I A;  3RCP A;  3P7Z A;  2DHK A;  4HB2 B;  3O96 A;  4EMO A;  2D4Q A;  2RLO A;  2PZ1 A;  2DN6 A;  4D0N B;  1NU2 A;  1PLS A;  2R0D A;  2YT2 A;  4OSN A;  1Z87 A;  4DIX A;  3VOQ A;  1ZSQ A;  2LKO A;  2K00 A;  5D3V A;  2HTH B;  4DBB A;  2L1C A;  2JP2 A;  1EAZ A;  1MK7 B;  3BJI A; 
#chains in the Genus database with same CATH homology
 1ISN A;  2Z0O A;  4P7I A;  3SUZ A;  3AJ4 A;  2COA A;  4NSW A;  2NMB A;  1IRS A;  2MDX A;  1LW3 A;  1RJ2 A;  2P0H A;  4DX9 0;  4HHV A;  5J3T A;  2BCJ A;  4HB0 B;  1PFJ A;  1WGU A;  1U29 A;  5J3Q A;  2DHJ A;  2DHI A;  2K2U A;  3A98 B;  2H7E A;  4XWX A;  4DX8 A;  3HW2 B;  4PNK A;  3A8P A;  3TFM A;  1XCG A;  1FHX A;  1V5U A;  3FM8 C;  5LOP B;  2D9Z A;  3KY9 A;  1X05 A;  1TXD A;  2ELA A;  3ZVR A;  3QWM A;  2D10 A;  3PP2 A;  5HE1 A;  1U5G A;  2CAY A;  3G9W A;  2COC A;  4IOY X;  3CIK A;  4MT7 A;  1ZM0 A;  4ZRK A;  2OTX A;  3WA0 A;  1V61 A;  1NTV A;  4TKN A;  4HAU B;  2NZ8 B;  3GYP A;  2W2W A;  1N3H A;  1X86 A;  5HE3 A;  3PVW A;  2D9Y A;  5D27 A;  4CHM A;  2YS5 A;  1FGZ A;  1W1G A;  4Y94 A;  4MY6 A;  1U5D A;  1W1H A;  1B55 A;  3UZT A;  3PVL A;  3N7C A;  4ZRJ A;  2OQB A;  1UEF A;  2UZR A;  4GPT B;  3M1I B;  3TW1 A;  2EMS A;  2VKI A;  4HB4 B;  1EVH A;  3SYX A;  2UZS A;  5CLQ B;  2RSG A;  1GG3 A;  2COF A;  3U8Z A;  4KHB B;  2YSZ A;  4Z2M B;  5JHH A;  2MWN B;  1V88 A;  4DXA B;  1XX0 A;  1FGY A;  4EJN A;  1MAI A;  4Z2N A;  1FHW A;  1QQG A;  4HAW B;  1XD4 A;  2DA0 A;  4CYE A;  2DTC A;  2RVB B;  2GCL A;  1XKE A;  4YON A;  2QKM A;  2FJL A;  1UNR A;  2EMT A;  2LYD A;  1MKE A;  3TCA A;  1KZG A;  1BTK A;  2LOZ A;  1MPH A;  1UNQ A;  1PMS A;  3ULB A;  2RUK B;  4WVF B;  1WGQ A;  4GMX B;  3FEH A;  4CHJ A;  2M14 A;  3T06 A;  1DBH A;  2DFK A;  3KZ1 A;  5D3W A;  1WVH A;  4KAX B;  3TVV A;  2G35 A;  2D9W A;  2HE7 A;  3AU5 A;  3PEG A;  5C79 A;  2EJ8 A;  4HAY B;  2X18 A;  3VIA A;  3ODO A;  4EKU A;  5LON B;  3LJU X;  4A6F B;  1I7A A;  5C16 A;  2MFQ A;  2Z0P A;  2GS0 A;  1X11 A;  5JP4 A;  2DX1 A;  1M7R A;  1V5P A;  3MPX A;  3X23 A;  4B6H A;  4F7H A;  1UNP A;  5DHF B;  1BTN A;  2R09 A;  1MK9 B;  5C5B A;  2I5C A;  4KHA A;  3KSY A;  3ODX A;  5JHG A;  3KRW A;  1U27 A;  3IVF A;  2W2X C;  4ZRI A;  1U5E A;  1Y19 B;  2YRY A;  4TYZ A;  5KQ1 A;  4IAP A;  4PQ0 A;  5DIF B;  1ZVR A;  2Y8F A;  2COD A;  3FSS A;  1J0W A;  3D8E A;  4MK0 A;  2RNR B;  1FOE A;  1OY2 A;  1H10 A;  3ULC A;  5DHA B;  3GYO A;  1MIX A;  2J0K A;  2YS1 A;  1V89 A;  4WSF A;  2KCJ A;  4GMV A;  1ZC3 B;  4HB3 B;  1DDW A;  2CY5 A;  3U7D A;  1SGH A;  1TQZ A;  1QC6 A;  3TO1 A;  1H4R A;  2V76 A;  3NSU A;  2KUP A;  2I1K A;  2CRF A;  4HDO A;  3V5W A;  1V5M A;  2D11 A;  2J0M A;  2DKQ A;  3SO6 A;  2UVM A;  2VRW B;  5KCV A;  2D9V A;  2CY4 A;  1U5F A;  3WYF B;  1K5D B;  2LG1 A;  2N0Y A;  2YS3 A;  3BIN A;  3P6A A;  4GN1 A;  2IYB A;  1KI1 B;  1KZ7 A;  3SV1 A;  2ROV A;  3PZD A;  1MIZ B;  4A6K A;  2LUL A;  1K5G B;  3A8Q A;  2ROZ B;  1ZC4 B;  2J0J A;  1GC6 A;  4KVG B;  4HAV B;  2DYQ A;  3KRX A;  2IFS A;  4GXB A;  4F7U P;  1XR0 B;  2Z0Q A;  1GC7 A;  3OAN A;  1M7E A;  1FAO A;  2P8V A;  1BAK A;  4KHO A;  2J59 M;  1LB1 A;  5FI0 A;  2GCJ A;  2DX5 A;  2DYN A;  2K2J A;  2P0D A;  4WJ7 A;  5D3X A;  2DKP A;  2YVC A;  1AQC A;  5HE0 A;  4H8S A;  1NTY A;  2ADZ A;  4K17 A;  1NI2 A;  4BBK A;  1WI1 A;  4A6H A;  4A6F A;  5FI1 A;  2I1J A;  3HK0 A;  1W1D A;  2KGX B;  2P0F A;  3CXB B;  2H7D A;  1P3R A;  5GOW B;  1DRO A;  5D3Y A;  1J19 A;  4K2O A;  1EGX A;  3PG7 A;  1FHO A;  5J3Y A;  3F5R A;  1FB8 A;  4HAT B;  3DXD A;  3D8F A;  1Q67 A;  5C5B B;  1XOD A;  1WJM A;  2I5F A;  2Y8G A;  3D8D A;  2N23 A;  5JLJ B;  2D9X A;  1OMW A;  1WJ1 A;  1P6S A;  2DLW A;  1RRP B;  2M38 A;  3HQC A;  3AU4 A;  3ZDT A;  4HAX B;  4C0A A;  1X1G A;  5KQ4 A;  1DDV A;  2Y7B A;  1E5W A;  2YF0 A;  4GZU A;  2YT1 A;  4IFS A;  3DXC A;  1DYN A;  5CLL B;  4F7G A;  5DI9 B;  4HDQ A;  1Y5O A;  2W2X D;  2XQN M;  2EC1 A;  2AL6 A;  1I2H A;  1AWE A;  2ELB A;  4HAZ B;  1P5T A;  3ML4 A;  5L81 A;  2YT0 A;  2MKR A;  2ZPY A;  1BWN A;  1U2B A;  2D2Q A;  3DXE A;  3ODW A;  2GJY A;  1UPQ A;  2LOX A;  2VSZ A;  3QIJ A;  3F0W A;  5EFX A;  5HE2 A;  2E2X A;  3QBV B;  3SNH A;  1OQN A;  1TJ6 A;  2Q13 A;  2RGN B;  4K81 A;  1SHC A;  3PSC A;  5DH9 B;  4L6E A;  4YL8 A;  5C6R A;  1UPR A;  1EF1 A;  1WG7 A;  4K2P A;  4A5K A;  2QKL A;  1X1F A;  1DDM A;  3PVU A;  3MDB C;  4NY0 A;  2AEH A;  2L2I A;  3RCP A;  3P7Z A;  2DHK A;  4HB2 B;  3O96 A;  4EMO A;  2D4Q A;  2RLO A;  2PZ1 A;  2DN6 A;  4D0N B;  1NU2 A;  1PLS A;  2R0D A;  1Z87 A;  3VOQ A;  1ZSQ A;  2LKO A;  2K00 A;  5D3V A;  2HTH B;  4DBB A;  2L1C A;  2JP2 A;  1EAZ A;  1MK7 B;  3BJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...