1ZCCA

Crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
240
structure length
240
Chain Sequence
MTKIVSHRGANRFAPENTFAAADLALQQGADYIELDVRESADGVLYVIHDETLDRTTNGTGPVGHMLSSEIDTLDAGGWFDDRFKGAIVPRLDAYLEHLRGRAGVYIELKYCDPAKVAALVRHLGMVRDTFYFSFSEEMRQGLQSIAPEFRRMMTLDIAKSPSLVGAVHHASIIEITPAQMRRPGIIEASRKAGLEIMVYYGGDDMAVHREIATSDVDYINLDRPDLFAAVRSGMAELLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit.
pubmed doi rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Hydrolase
total genus 87
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1zccA00
2FJUB 2OOGA 1DJIA 3I10A 4QJ5B 3CH0A 4I9JA 3EA1A 2F9RA 3V1HA 1YDYA 1DJZA 4R7OA 1VD6A 3OHMB 5T9CE 4I8YA 1DJGA 2OR2A 5PTDA 4GNKB 4S3GA 3QR1A 1T6MA 4I90A 1DJYA 2P76A 4RW3A 2OTDA 3QVQA 3EA2A 1DJWA 2PZ0A 3KS5A 1GYMA 2PLCA 3H4XA 2PTDA 4F2TA 1PTDA 1QASA 3V16A 1ZCCA 3PTDA 2ZKMX 3MZ2A 5T9BG 4PTDA 3H4WA 3KS6A 3RLHA 4RW5A 4QJ4B 7PTDA 3RLGA 5T91A 4I9MA 1V8EA 1DJHA 3EA3A 1PTGA 1DJXA 4OECA 4QJ3B 6PTDA 4RV3A 1AODA 3NO3A 4Q6XA 3V18A 2ISDA 4I9TA 4F2UA 1XX1A 3QR0A 1QATA 3L12A 4F2BA 2O55A 1O1ZA 1T8QA
chains in the Genus database with same CATH superfamily
1J0IA 4E2OA 3UPMA 4LOCA 4GVIA 3IJDA 4GIAA 5AYXA 4EACA 3M0JA 1XYLA 1K70A 1QU4A 2QKFA 3I68A 4L65A 3A22A 5H2ZA 2XVPA 3MC5A 4LEFA 4FOJA 4ZE4A 3O06A 4EWND 1IZJA 1TR1A 4CQ8A 1ISXA 2DH3A 4IGNA 3WQEA 1DWHM 4M1BA 3NWRA 1PPIA 1JJKA 3MSDA 3STGA 1OY0A 1E4NA 3RFAA 8CGTA 5BRBA 3TNBA 3APYA 1YDOA 4XAPA 2YCJA 4ACZB 4UTJA 5F2MA 2MANA 3NQBA 4NI3A 3MP4A 5CSRA 4GC3A 3OZPA 4NZJA 4OBTA 3M41A 4GUGA 4JQ4A 2BHYA 4Y6GA 3P7YA 4OU1A 3LEPA 4OUEA 2PODA 2RGMA 1XSJA 4EPBC 4PUMA 1UA3A 4Z2IA 1I0BA 5FJUA 3CTLA 1POKA 3RM8A 5DCBA 3IK4A 2D2OA 4FMVA 4FLOA 4RK8A 3WBXA 1UP3A 3FHAA 3WUFA 1OHLA 3IANA 1ISWA 3BW3A 4TR9A 1IT8A 3BLOA 2VX6A 3LPFA 3TEVA 1A4MA 3LGGA 3U8GA 3EWZA 4CD8A 3W4RA 5IM51 2VJXA 1JEZA 2V69A 1V02E 1GVRA 3H12A 5L6UA 4JDYA 4HCLA 2VZOA 4HHPA 1US0A 4Q8WA 2ACUA 3DXIA 1VIWA 3VXGA 1W5OA 1O5XA 1FH7A 1DEDA 3W1LA 4O12A 3EAUA 2GJRA 2X41A 1FVPA 3U7BA 2G41A 2Z4GA 3GXMA 2BXYA 2G4FA 1WOAA 2Z28A 4GO9A 4U3CA 1IYXA 1CGWA 1BYCA 1FWTA 3SBFA 2D0GA 5HA7A 3FHQA 4XQ6A 4M1RA 4DO5A 9RUBA 1BKHA 4K8GA 2DY3A 3V16A 1WPCA 3CHDA 4Q6JA 1VIZA 2QZRA 3AXMA 4GK8A 5D2TA 4C6IA 2PD5A 2XFFA 4N9EA 3PPFA 3O16A 3GAKA 1HKIA 3IJQA 4FLSA 4AHQA 2XIJA 5I03A 3UWUA 2I56A 2PDFA 4DJEC 5A6TC 2QMKA 5I78A 1Q6CA 3AIBA 3RCYA 4S23A 3VIPA 4U33A 1BXBA 3KUMA 4CD4A 5EKYA 1W37A 5LNUA 4DXXA 1E4IA 3POHA 5JU6A 4O57A 2D73A 2ATMA 1MNZA 1YTEA 2X0YA 3T0TA 1CXLA 3HFYA 3W6LA 3IIOA 4LUSA 1KCZA 3WQVA 1H09A 1V6XA 1UBSA 2YBUA 2VX5A 4O28A 1P7TA 1S5WA 3SY8A 3AS2A 5BW6A 2QF7A 4WSHA 4BY3A 2ALDA 4HSOA 2JBMA 1KXVA 1HKMA 1PZ2A 1RXOB 1KTBA 3TLQA 1B4EA 1LTDA 1MEIA 3WY1A 3HG4A 1VPXA 3QZEA 3UXIA 4M82A 4BJHA 2YL6A 2Z1BA 3VE9A 4NNBA 2Z1VA 3WCZA 4KGLA 3TR2A 1S39A 1HO4A 1LLOA 1C91A 1UD2A 4PUDA 4X60A 3KX6A 2ZX6A 4EPEC 3KOWA 3ARVA 3QC3A 4DBWA 4DBSA 3M1ZA 1CB2A 3MHGA 3A4WA 5E93A 4L80A 2DSWA 3WD1A 3OGVA 2PSNA 4AZIA 3RO6A 2X1TA 3KOXA 4IIDA 2IKJA 4E4PA 1V6WA 1G69A 3FN9A 2V5KA 1YYAA 1M53A 2DVTA 4D6JA 3EMQA 1LL4A 3D0CA 4RNIA 1K02A 4INFA 1E6SM 3W7HA 1H41A 1HT6A 3RPMA 1I6NA 3UXAA 3HV9A 2BX7A 3UR2A 4P7NA 1JDDA 4AZCA 1EOKA 1PX4A 2QCDA 4GCXA 4IX0A 3SM0A 1SPQA 1DQWA 4HB7A 4QCEA 3JVAA 3ICJA 4GQGA 4RPPA 5EMYA 3IGHX 3NQ6A 1BGGA 4PMNA 3TTEA 3ATZA 2OSYA 2PLJA 3FY1A 3ZIZA 1L6GA 4C1NA 4PRWA 3CUXA 3ELFA 3VTRA 3ABXA 5DBUA 3K4WA 2GDUA 1NEYA 4D71A 3WK3A 3IJ6A 1FRBA 2E9LA 4R7JA 4LPCA 4WXYA 2WMIB 3CJPA 4PTVA 1IXPA 3G0UA 2Y6ZA 4L6OA 1R7OA 2BVWA 3OZOA 3KS6A 1AJZA 2QIIA 4EAYA 5FL0A 4CVWA 4DQWA 4S3JA 4HCHA 4H9XA 4AD3A 2BG5A 3W7DA 1MW1A 2QS8A 2E0PA 1T99A 3UG8A 2VCCA 4J3VA 3BAYA 4KESA 4W93A 4Z0JA 4BQ2A 3S5YA 3M43A 2ZC8A 1PUDA 5AYIA 3W28A 3NUKA 2WANA 1XQKA 4QBXA 4AD5A 5BXSA 2HE5A 4LTSA 4AEFA 1HFBA 1A3HA 3M0VA 5I77A 3WQ8A 4IPNB 4FLQA 1I2PA 4XX6A 2QJGA 1HKVA 1O60A 3IGSA 4XKYA 3HPSA 4LB4A 3FSUA 1NIUA 2Y61A 3HGJA 3KTCA 3K1GA 4QTGA 1EO7A 5CLTA 1XIMA 1H1YA 3CPGA 1EJUC 5BRPA 2X42A 1UR1A 3C2VA 3NVTA 3R7MA 1UR9A 3JZUA 5I24A 3M4HA 4Q8OA 2AKZA 3AUJA 4NX5A 3GVVA 3KVKA 4RZ4A 1FXPA 3KDOA 3WBEA 4E5TA 4GQBA 5A2CA 4F2TA 3NSMA 3CXOA 1N8IA 5I07A 1E6NA 4JL2A 2Y5JA 1GJPA 1Y65A 4WK9A 2YZRA 4IIBA 5LIXX 3EXSA 3IJ7A 1UZHA 1DP0A 1QRQA 1YLVA 3KBVA 4ZQMA 3DFOA 3M6DA 5EL1A 3V0SA 3A4AA 4LUYA 4MY9A 1GKQA 4QIUA 1VBUA 4U4MA 1W3TA 2C0HA 2X8RA 1E4LA 1E0WA 1SZNA 1DIKA 2V30A 2VT0A 1PX3A 3UWWA 4W9TA 1SYTA 4Q8VA 1TA3B 3KCOA 4M6QA 5KITA 2X40A 3PBWA 4F8XA 3UW6A 2CLIA 1H0GA 1KFKA 1RY0A 1BWKA 4GJIA 1MSSA 3G24A 1E5JA 2PE4A 3BQ6A 1CYGA 3AYRA 2QDGA 1EF3A 1V79A 2Q01A 4Z2KA 3R94A 2GWGA 2W4XA 4FX8A 3AS3A 5D37A 2V5LA 4O53A 1KWKA 5A6AA 4C6JA 7TAAA 4IP4A 3MSRA 5JH2A 1ZHAA 3EKLA 1V0NA 2V2HA 5DXYA 4LC6A 4QSHA 2JK2A 2E7FA 2XN1A 2TODA 4PFHA 1XD1A 1QWKA 4HNTA 1JXKA 1LZOA 2WNNA 3FFSA 1H51A 3QYSA 1I60A 4OQVA 4PMDA 3TFXA 4E6MA 4TVUA 4FXRA 1UP0A 1V08A 1D2KA 3XIMA 1NFPA 3WLJA 1EFZA 4IH3A 3INPA 2A2IA 2Q3RA 1PHQA 4ZFMA 1BSLA 3EX3A 4M56A 1GG0A 4DLMA 2FTPA 1Q6QA 1QPRA 3UVIA 3DU0A 3NEVA 5HBFA 2J27A 3W86A 1W3KA 4H9UA 5LA1A 1GKRA 1QXLA 3A12A 3BLDA 3WD3A 4GYPA 2J4GA 3DH7A 1TPB1 4WR3A 4GLEA 1DJIA 1DIEA 3M7SA 5D05A 1PCWA 1RLCL 1JCXA 4RNJA 3MV11 1K4HA 2GFTA 3CLMA 1TE6A 3W07A 5LIKX 4HHMA 3TQPA 3U48A 4DJDD 3OHMB 3GW3A 1W5PA 4TV6A 2DJLA 4Z2LA 3R89A 1VEMA 3B9AA 2XZ9A 2BLEA 2G0WA 5I0DA 3FSTA 2W79A 1MMFA 5BMWA 3MUIA 4AIBA 1B30A 3UXDA 1MZHA 3P60A 7TIMA 2Q6ZA 5A6KA 3P14A 4DZIA 1XJBA 3S8HA 1Q6LA 1SUXA 1HJQA 2BFGA 2ESCA 1JCJA 2I5IA 1OT2A 2QDHA 5JBFA 1XLMA 1C29A 3DFQA 3GKFA 3GU9A 3W1XA 1J6OA 2HK1A 1Q8AA 3C3NA 2PGWA 3EEZA 4G8TA 3AIVA 3DHFA 2A3LA 4JN8A 2QF8A 2QDEA 3MDWA 3QQ1A 5CZJA 4H8UA 3KL5A 3T2PA 3PAJA 1K9TA 4GH3A 4REQB 3CYJA 3UYCA 2WSKA 1FWHC 3LLDA 3EXRA 2CPUA 3REQA 2CERA 1FFRA 1XLBA 1Z48A 4ZE5A 1GJWA 5EMKA 2WKJA 1QK2A 2E68A 1VFOA 2WW5A 4UBPC 4LVFA 3SR7A 3APGA 3L23A 3PZNA 2O4MA 4FEZA 4KW2A 3ABZA 2J7BA 3TP4A 1F5ZA 1R9ZA 1NF7A 3BMXA 2RDXA 4Z2GA 2DVXA 4UQEA 2IUZA 3MUCA 4BKNA 2E77A 3ARPA 3SGZA 1TWZA 4BQ3A 4OKDA 1XYMA 4XO7A 1L0PA 1FY6A 3QH2A 4C91A 4A2SA 4XBKA 4NRSA 3M7WA 1X8CA 4S3BA 2Q71A 3RG6A 2PMQA 4MUPA 4GI8A 1Z89A 4ZQRA 4HJWA 3RX3A 4LC8A 5T26A 3C2OA 2O7QA 1ONEA 1I1XA 4Q8TA 3MWCA 1QPQA 1SW7A 4HD5A 4YCOA 1DOSA 5HOSA 7ENLA 4GINA 1A4LA 3E0FA 1RD5A 4YVPA 3O8AA 3VX0A 2I14A 1JYWA 2Q09A 1R2TA 4ZO6A 1A5BA 4ATDA 2J8TA 3HQOA 2VEFA 3ZT6A 3TTQA 3U5UA 1GOWA 5AHEA 3OQEA 2QYGA 3FCPA 2ZX9A 4ZOEA 1W9VA 1XWYA 2Z29A 1AZ1A 1PZ0A 1C92A 2BXZA 2R1MA 2VFGA 4MUZA 2EKGA 3B3DA 5IDIA 4JTLA 1QPOA 3HF3A 1ODZA 3IK2A 4J7RA 3MDUA 4Y9AA 4Q8UA 4QROA 1RY8A 5I3JA 1OWQA 1F8MA 4IWWA 1E71M 1UWAA 1EJVC 4I6VA 4P8VA 2NWRA 4UTUA 5DF0A 3P5YA 1XI3A 1EQCA 2PDYA 4GNJA 3QMSA 4LUIA 3BDKA 4E2VA 4AD2A 1OEPA 3NPUA 5LIYX 4MZYA 5LIUX 3VOIA 2WHJA 4MGGA 2R9RA 5E70A 4RDWA 2PWUA 4XD4A 1LG2A 2SFPA 3OP2A 5DO8A 1VQTA 5HWJA 4JN6A 2ISWA 4K37A 2VGBA 4QNEA 4M29A 1HGYA 4HPHA 5C7VA 3B8IA 4RDZA 3H7VA 2NV9A 5A8MA 3USBA 2HPIA 5CJ5A 1VC4A 2EPNA 1V77A 2F8QA 3UJRA 3W27A 1WX0A 1RD6A 1SU5A 4WCJA 2OYMA 3W7OA 2DSVA 4C7FA 3BJFA 4CNTA 4LVDA 4HMNA 1BHGA 3L68A 2WVVB 2EHHA 3LOTA 1XR2A 3GXPA 1NQKA 2E6DA 4MLRA 2DQWA 2V81A 1XUZA 1KCXA 3H2OA 5A6BD 1HP5A 1XBZA 3LSBA 1GEQA 3T8QA 5JVLA 1JDFA 3S2MA 2HEJA 3E2VA 1AW1A 1A3XA 3KBNA 4ZB0A 4HCDA 1NAL1 2ZX7A 4UTLA 1YE6A 3MMUA 3WFAA 2J62A 1TCDA 1VJIA 3T44A 2BODX 4G7EB 1ZCOA 1JL8A 3GDRA 4GJ1A 3AU2A 4GYPC 3UNDA 2ZA1A 5E9AA 4B92A 3M0IA 3IPWA 1LQ0A 1FKXA 1L2QA 4F9JA 1P1MA 3FA5A 3PPCA 2F6XA 1NOUA 2DSUA 1ZBKA 1EA0A 5T9CE 3OB8A 1EWDA 5BCAA 2C16A 2CBIA 3THAA 3SN4A 3SCVA 3QLLA 3QV7A 3OYXA 1FWRA 5E0KA 1UKPA 1XICA 2TYSA 2ZWYA 3ES7A 2J7EA 3ZR4A 3BAIA 3GDKA 3MKVA 3EWBX 5FAJA 2CW6A 5C2XA 3E38A 1HP4A 3UF9A 3VNZA 2Z24A 1K9DA 5D8ZA 1K8YA 2ZRXA 1W1ZA 1ZNNA 1ZCCA 4JCLA 4V28A 3KRBA 3ARWA 3GZ3A 1IXOA 3TV8A 3V3WA 3LI0A 2PB1A 3VYLA 1TWIA 5A6JA 1W56A 1PZ3A 2O9RA 4O1DA 1BRLA 4BZYA 5F4SA 3B0XA 1EGZA 2A0NA 1FDYA 3R43A 2R8WA 4C6KA 4K7YA 1XLCA 3BCJA 2BGQA 3S42A 1JQXA 1EGVA 2YW4A 4I9TA 3W1UA 1V7AA 1YBQB 1YKWA 5G2HA 1K8XA 3TXZA 3MWAA 4CCEA 4XAGA 2I5GA 4OUIA 4PMXA 1UWQA 4H00A 1E4MM 1Q66A 3HPFA 4MWAA 1HW6A 3B0UX 4C6OA 1HJUA 2WBKA 3LHTA 3B8UA 4DBDA 2J6XA 1SFSA 3CU2A 3NFUA 3DESA 4LS0A 2PWDA 3LHVA 3E74A 3MANA 4N4PA 3R0KA 1IZKA 1G7VA 3EDJA 4HYWA 3NQ7A 3P8JA 4IFKB 2E1WA 4MKSA 4Q33A 4AZGA 4M80A 2ZXBA 1WV2A 1KB3A 5AVHA 2XFRA 2OZ0A 3G22A 4FAMA 4AY1A 4D8AA 1KFEA 1WKFA 4CNOA 1Z42A 2IPWA 4ERIA 2HBXA 3NZGA 3AXXA 4B9YA 4Z08A 1IE7C 2F6KA 2D69A 5H1WA 1XKYA 3T55A 4HOXA 3WJSA 1BLIA 4Z2JA 1IEWA 3B9EA 3PZGA 1TPEA 3FEMA 5DT7A 3TSBA 1SM9A 3KWXA 2C6QA 4UUIA 2QAFA 4ZOBA 2NSXA 1EJXC 3BAKA 3AIRA 4H9VA 1F3XA 5FCZA 4NJKA 4Q4PA 4HK5A 1R6WA 4KFNA 4HMEA 3WLTA 3C2EA 1UH4A 2R24A 5HULA 2GGGA 3F2BA 3ZWSA 4BK9A 1QI2A 4PCFA 1EUAA 1LWHA 3URQA 5D30A 3GIYA 3W22A 4X9SA 1NDYA 2IKHA 1D8WA 3UD6A 4OE7A 3RAOA 4Q8MA 1CWYA 4EPDC 2GSEA 3WBYA 3E2SA 3C4UA 1DTNA 1TPDA 4K36A 2EG7A 3T2OA 1RLDA 3C86A 4M19A 2ZDRA 2W62A 2ZUMA 1V0MA 4GQ0A 4QLJA 3WDHA 3HV8A 3U2CA 2XSAA 3B04A 4J5NA 5U4NA 4PMOA 2J7HA 1GVIA 2YCKX 4AU0A 2V38A 1IQ8A 3RRXA 1PTDA 3SCSA 3QTGA 5HK4A 4LT9A 4KGJA 3KRSA 2BOEX 3B4UA 4XG1A 3MUAA 3UVAA 4RPQA 4GXWA 5C9RA 1TJ2A 1GCYA 4O0ZA 1JCTA 3GXIA 1W1PA 3ZQ9A 1ITQA 2VRQA 3LV5A 4XBJA 3AC0A 4HZ7A 5C70A 1W9DM 1UPMB 6PTDA 2HV5A 3CHCA 2ZZ6A 3VOGA 1G5AA 2VEMA 1XH1A 3ZO9A 1JDEA 3RGTA 1BTCA 4M6UA 5CCZA 3WUBA 3WD0A 2DORA 4YTSA 5C55A 3E2QA 3S2LA 2B7PA 1XLHA 2XIQA 3WLIA 3CGTA 4RKAA 4B4FA 3WJYA 4FF7A 5D38A 2XN0A 3UWYA 1ZZMA 4ERAA 5I06A 1YW1A 5A2AA 4IUOA 3WK0A 4NZ3A 4JTEA 1U1JA 2WB5A 1QT1A 1PIFA 1R3TA 2CEQA 2ODOA 4AYSA 3RK8A 4B5VA 1CCWB 5CC7A 2JF6A 1QMLA 1C8YA 4W84A 3EA2A 3LLXA 1GOMA 1LP6A 4HZ8A 3EX4A 2OSWA 2E6YA 3BUVA 2NQ5A 1HJXA 4RLIA 3ITGA 1KD0A 2VC5A 3WMBA 3S5ZA 4F0KA 1Z6KA 2XWEA 4C1KA 1KFWA 2BZNA 4CQCA 3Q45A 1EDTA 3OEXA 5I7GA 3QV9A 5JIPA 2FHCA 1L6YA 1TV3A 1ZFJA 4CQAA 4K3ZA 1LWJA 3W7LA 3U2OA 5TAOA 3A9BA 3C2FA 1GEHA 1ADDA 1GVEA 3NYZA 4JFSA 1NM9A 1W5MA 3LN3A 3KL0A 4AYGA 1XLKA 3HBLA 1K7EA 1TV8A 1ZJIA 5K7JA 1NP2A 5HNNA 3AICA 1BQGA 3ZR5A 1HX0A 3O6CA 4IQDA 4PSPA 2V6AA 1ENUA 3NG3A 3BPWA 4YWSA 3MUXA 1ISVA 4MWAC 5LYRA 3V1HA 4FO4A 1OD8A 5E09A 2PDMA 1XRVA 1ZENA 3O6AA 2WMHA 3N15A 4IT1A 4ML9A 1VYSX 4AISA 4AMCA 3UT0A 3T0DA 1OJXA 1WDPA 5FIPA 5IDZA 1PIIA 2POZA 4TOQA 4JTDA 5HQMA 3MZNA 5F2IA 4EK7A 1DPMA 1UR8A 4KERA 3WH6A 4MJMA 3PNZA 1DIOA 3G1VA 3LCIA 3ZZ1A 3T0BA 3MHUA 2PF0A 4FNQA 4U5IA 3IS4A 3OG2A 4C6FA 4FS9A 1EP2A 2Y63A 1OADA 5CH9A 2WSQA 5ABFA 4DAFA 1XFCA 2ZZ1A 4YU1A 3IJIA 1GOOA 2VDIA 1C93A 4W89A 3NXLA 4RV3A 3E5BA 1MI3A 4B5UA 3PN8A 4QEHA 1PIGA 4PB5A 4HNLA 3WNOA 2QCGA 4IL2A 4N9CA 3THDA 2CNCA 4AH7A 1X38A 4L9XA 3PBMA 4IMFA 1P5BA 2FJUB 5L9FA 3VDHA 5BYWA 2UWFA 1E51A 4EF8A 1S1PA 2ZICA 2UY3A 2F9RA 1EIBA 3G2GA 8XIMA 1OX5A 4RDYA 4DX3A 5D8WA 1WKYA 5AECA 4LB3A 1YADA 2PWHA 2BASA 3M0YA 1K7XA 2PFHA 3CT2A 1F73A 4YMZA 2PDHA 4I8YA 1NH6A 1B9ZA 4LUSB 4RXGA 1EQPA 3RR1A 2CBUA 4KEVA 3DN5A 1VAHA 2VDHA 4NZ1A 3A13A 3OBAA 1EJ7L 4JEQA 1XGZA 4IMDA 3ZFHA 3VDBA 5CGTA 1SQ7A 1TWWA 3MTWA 1Q2RA 1M7JA 3CZKA 1QI3A 2WC7A 4US6A 1OG6A 5C54A 2BOGX 4LXFA 4H7ZA 5F2LA 3BLFA 2VFIA 1IXNA 2X1SA 3GX9A 2RDTA 2OMAA 4R7WA 3MZ2A 2CLMA 4IG2A 1TMQA 3OO2A 3DZ1A 4Y8EA 1ITCA 1FWEC 3CS2A 4N9DA 3ERPA 3RLHA 5C8BB 1TWSA 3MA8A 4AD0A 3EDKA 3LBOA 2NVAA 2HMCA 1J0KA 1S5NA 1HNYA 2YR1A 3EA3A 3H70A 3WBAA 1GVSA 2DZUA 4M8UA 4R34A 3SADA 1QVBA 3V18A 3DGBA 1VP5A 1WZAA 2O9TA 4POCA 2INZA 1G4EA 2Q8XA 4ENLA 4DBUA 1R85A 2FDSA 3SZ8A 4YCPA 1AVAA 3GG7A 1TE1A 3VM7A 1LOLA 3SY1A 4HU3A 5BOOA 3WENA 1V02A 2FZ9A 2YX0A 3MJYA 2OZ8A 1R7AA 1H4PA 1LOQA 4AZCB 4H04A 5D32A 2VVSA 2J13A 2VFHA 2XH4A 1DHKA 2GVJA 2CKSA 1FHDA 3EZ4A 1VPYA 5K9XA 5TF0A 2DIKA 3BLEA 1QBAA 1E9IA 1E55A 4TMCA 3GTIA 1GVYA 1TIWA 4CN1A 4C1NB 4Z1CA 4DYJA 2QXWA 1C7TA 4ZB2A 3NIYA 1ISZA 4HHLA 2YDQA 4GFIA 2G96A 4TU1A 3T08A 1IT0A 2OCZA 1NOWA 3OJGA 5J5RA 2PDQA 1B90A 1HJWA 4KT2A 2ANUA 2VFDA 4JD4A 3AMKA 2NV1A 3VUSA 1XDJA 2EPKX 3GYCA 5KETA 3LCHA 3PULA 1LBFA 5DMYA 1A5SA 2NW0A 3STCA 3WDRA 2WJEA 3GO2A 2QR6A 3IIVA 1VYRA 3D6NA 3CT7A 4YLWA 4TVCA 3C8FA 4JQ2A 2Z7KA 2ZIDA 1UYQA 3N25A 2VRJA 1XLEA 4UTMA 2A7NA 4IMCA 5G1TA 3TTOA 1DE5A 2P0IA 2V2DA 4Q4RA 1IIGA 1PL9A 1J5SA 4B3LA 4ZOAA 3PFRA 1Q6RA 3LGEA 3AUOA 1GOXA 1S2TA 4US5A 2IMRA 4A21A 1FP8A 4XSMA 2FMOA 3H4XA 2QUTA 2WMFA 1JZ4A 2FVKA 1PKNA 5EYWA 3CIWA 4QG8A 4HU4A 3GBEA 3WMSA 4FXSA 1D3GA 2NXGA 1MRAA 4KF1A 3PUOA 1ZQ5A 3PAOA 3TWAA 3BGJA 3RIKA 3II1A 2OJPA 3TIMA 3HPXA 3NCOA 1QPNA 2VC9A 4ZSTA 3SEPA 5A8QA 5FJOA 2XSBA 2ZFAA 1B57A 1HUVA 2REQA 2P10A 1HGWA 4XD3A 1DV7A 3H53A 1HKJA 4JX5A 3BGAA 2XGIA 1A0CA 3WG6A 3SECA 1KR0A 2ZX8A 3GDMA 2GK1A 2OOFA 1NWRA 4JX6A 1E6QM 1R3YA 1VFFA 1Q6OA 5I5RA 2I9UA 3GIQA 2HWGA 3PJWA 2INFA 2PGEA 4M81A 5DX7A 3NDOA 2Y5SA 5BOFA 3KRUA 3N34A 2GJLA 4AZ5A 1ZU8A 2PEVA 1ME7A 2V5DA 3W01A 1ZAHA 3QGAC 3H24A 3KZPA 1KFBA 1E9LA 4UMBA 1NDVA 1RQBA 3ITLA 2WZTA 4MTVA 1AQHA 3QPYA 4C6BA 1RK5A 3U5YA 1J12A 1GW1A 3GSMA 3PWAA 3K4DA 4A29A 1WZKA 2XM2A 3RITA 2I9EA 3ARSA 4W85A 4LJ3A 1PJ9A 2I17A 2P53A 3FXGA 1TWDA 4NZ5A 4QISA 5C2CA 4R9OA 4R53A 5FJPA 1BXCA 1HXJA 3W87A 4UR8A 1QOXA 2P3EA 3ZVHB 4CN6A 2NX9A 1QOPA 3V5OA 3KLKA 4O50A 1UBPC 2QULA 1VH7A 2PTZA 5CC3A 4Z42C 1WOBA 2V3FA 3S5OA 3EYPA 4BFAA 1S2UA 4A4AA 2QQ6A 1OGGA 3SCUA 3U0HA 3KOFA 2VVNA 4G7FA 2Z6JA 4LS1A 1OX6A 2ISSA 4FNTA 1IHIA 3GC4A 2KZHA 2EJ1A 4CNSA 1AJ0A 3MI3A 2Z1WA 2YW3A 4YXGA 5F7UA 3QPZA 3WK2A 5TNVA 3TOYA 1B2YA 4QQUA 3FNDA 1JF5A 1M6JA 1FH8A 1AD1A 4MLJA 5JXQA 4GNKB 1OD0A 3OVQA 1DVJA 4G1NA 1T6MA 4JQ3A 8TIMA 4LUTB 4IP5A 3GG0A 4GGBA 4ZCWA 1LG1A 3QYQA 1B5TA 3TN4A 2HCVA 2WBGA 3WQGA 1FOBA 5BU6A 3RM9A 4RCXA 1PKYA 4JIPA 4NYYA 5KEZA 2XIMA 4F9DA 3T7VA 3HGOA 1OGSA 2XJ7A 2BOFX 1DORA 4FP1A 2NVCA 1FQ0A 2PDBA 4XISA 1V3IA 4LCQA 3NQVA 3CQKA 3CNYA 1PHWA 4DN1A 4GFSA 4NILA 1ICQA 1CXEA 4HSNA 4X0VA 2V3EA 3CQIA 2OKOA 1E0XA 2ZUWA 2PP3A 3WD2A 4RZ6A 1CGTA 3WDPP 2ISDA 4J2MA 4K8HA 4D6EA 2AOSA 3REQB 1UWUA 6REQA 2Z0IA 3T4CA 3LM7A 1JFXA 4MWAD 4AFYA 2OG9A 4MHBA 2FZDA 4MB5A 1PXGA 5EGRA 1CENA 3VK5A 3WQPA 1WDDA 2VHLA 3SQSA 3G0XA 5F4XA 1OVDA 4AHOA 4O15A 1XINA 4YWIA 2YZ5A 3FGCA 4C65A 1W2VA 3A4XA 2GOUA 4GACA 4JGDA 2VR4A 2PA6A 3NQCA 1J0ZA 2J47A 3PPGA 4HPJA 4JPGA 3VD9A 3W1PA 6A3HA 1XC4A 1NU5A 5GPRA 2Y2WA 4HGXA 4AG0A 1GZJA 3G3DA 1F4AA 2PS2A 3DOPA 4XK2A 3BAWA 1L8NA 1MZRA 2JGYA 2PDCA 1DWJM 2PLKA 3VGHA 1JULA 4R27A 1FWGC 4C7DA 3VNYA 1VPQA 3WUGA 3TE9A 4QGCA 3P81A 4LYKA 1G0CA 1LRQA 1N8FA 2CBVA 2OGJA 4DRSA 4P7OA 3M64A 1GOIA 5FF0A 4MPQA 4E2BA 2Y0FA 4A8NA 3WELA 4NAFA 5ABHA 5A95A 4D6DA 1SO3A 3VNJA 3IACA 4HTYA 4FX7A 2YB4A 3GR7A 4YVXA 1S3HA 2PPGA 2VD8A 1IT7A 1HTIA 3DGRA 4ZB5A 3EWDA 1DKWA 4EKJA 3PP7A 4MFDA 2Z2AA 1P6BA 4AVFA 3AHVA 2HPMA 4XZNX 1KRCC 1RA5A 5DMLA 2HS8A 4RJEA 4L4LA 1XIEA 4IHCA 4FX6M 3CV6A 4KIRA 1GGOA 2IQ0A 4F0LA 4LAUA 4NU7A 4PTNA 4BCEA 4ZGYA 3NDZA 3EBVA 1I8JA 5HAOA 1JYXA 2ZUVA 1U5JA 2FH8A 1QR7A 4Q4QA 4GI9A 4NXKA 3LMYA 4OFCA 2FKPA 4B16A 4OBSA 2J77A 1TUFA 3PUDA 3SUWA 3P2VA 2CLHA 2X7VA 3W7NA 5LIWX 4V1XA 3CHEA 3PWGA 2PLCA 1UPPA 2E5DA 4Y8FA 4R9XA 1V5XA 1O68A 3NAVA 4M5PA 2PAJA 1V6UA 2PGFA 2Z1XA 4WXZA 4PRTA 1Q85A 3MPGA 5D2VA 3CV7A 1OFRA 4ZTYA 3S5NA 1XYCA 1WCGA 3TC3A 4DB7A 1R46A 2IW0A 1YNYA 1I4NA 4OVXA 1UWIA 2J79A 5HNUA 4TUFA 1EP3A 1MEWA 3HN3A 3KM8A 3TSMA 3B0VC 3PANA 2OWXA 5LNVA 4PBFA 3E1F1 3C2YA 2Z2BA 2GJNA 3F4WA 3CV2A 2PCEA 2ZE3A 3O63A 4NP7A 5CKSA 2XIIA 2ZUNA 3GC2A 1CBGA 3VKJA 2P5NA 3E0VA 2ZYFA 4KWWA 4XAZA 4LBUA 2HVOA 3W85A 4D6CA 1V6TA 3B8TA 5LNRA 4FZIA 1LT8A 3KCJA 2PBOA 4QRNA 1IF2A 4Q4KA 3MY9A 1J0HA 2WQDA 4B2DA 3C52A 1J01A 4A3HA 4C6QA 2FZ8A 4HA3A 2G3NA 1AD4A 5ENLA 3MMDA 4NZFA 3DFNA 2VZSA 4GXPA 2AQWA 3WH9A 4LV9A 1NSJA 4GCAA 4M3PA 3KHDA 2G8ZA 1BQCA 2VD9A 3NGJA 1KKRA 5DRIA 3IEBA 2IPFA 4MZ1A 3VMOA 2VOMA 3DHPA 5FESA 2QUMA 3SUVA 2IQTA 3MHFA 5F4WA 1DXFA 3PBVA 3W00A 2X7WA 1WA3A 5I09A 5M2FX 4MB1A 4NUWA 3GXFA 3UU0A 4OBRA 1OINA 5CQ1A 4GYJA 1Q7ZA 3QHMA 1V7YA 1EIXA 3W73A 5AFDA 1UUQA 2HRWA 4QITA 3LHYA 1WZLA 2W67A 5EY5A 3SIZA 4LFYA 2GQ8A 4IPIA 1AA1B 3BH4A 1IZCA 1FUYA 4B9ZA 3F4CA 4OT7A 4FIQA 5GJPA 4L6DA 3R25A 4UZSA 2X09A 4PUUA 3VCCA 1B3WA 5IFTA 4QNWA 3P74A 1JCYA 1RK6A 4O1FA 1OSEA 3MW7A 1ZBCA 3AOFA 4XB3A 1Q6FA 1X1OA 2C1HA 4BA0A 4Z1AA 1QW7A 4C6MA 5DRCA 4MWAB 4E8GA 3HG3A 2RGLA 2ZUSA 3KHJA 1Q7QA 3H2AA 2FZBA 3N18A 1VKFA 1FDZA 3ONBA 3QOMA 3S1VA 2J25A 2Y1HA 2VI0A 1XLJA 3BURA 3LI1A 2HDJA 2HROA 2OKTA 4NJIA 1J11A 4Y90A 3PJXA 3CMJA 2FFIA 1GNXA 1M04A 3GRIA 3H55A 9XIAA 3EWUA 4NF7A 3PHAA 2OT0A 1HJSA 2W61A 1R38A 3SAZA 4ES4A 4QQ3A 4QJ4B 1IEVA 4B5XA 4OV9A 1VB9A 3U2ZA 3WJWA 1UD3A 4WKAA 3M0KA 1TUXA 1GQNA 4BEQA 4HMDA 2VXNA 1GTEA 1X7FA 4KWSA 4NHVA 3RR4A 2VX7A 1KBIA 1JAEA 1U1UA 4W88A 3CUJA 2DH2A 4UQCA 3PR2A 4AIEA 1RCOB 4DWSC 4LVGA 3HU7A 5CEWA 1X96A 5B7ZA 4WRHA 4JTGA 3PBUA 3PB2A 2E6AA 4AC1X 3PZTA 4PUNA 4AQLA 3VGBA 3I65A 1G01A 4H6KA 5BXRA 2RDWA 5CJNA 4R7OA 4L1WA 1VD6A 3UERA 2EPLX 5I3IA 2E8ZA 1ZTVA 2OX4A 1IIHA 3WF3A 4BI5A 4P5UA 2C14A 5PTDA 3VDCA 1H7OA 4WJ8A 5KTLA 2WOQA 3QV6A 2NQHA 4PZVA 2ASHA 4AWTA 3R13A 5J04A 4QLKA 1M01A 3F4NA 3O2LA 2JIWA 4D2JA 1DJWA 4Q32A 1B0IA 2E28A 2ZX5A 4KS0A 5CG7A 4XV0A 3STPA 2D2HA 4NAEB 3FYOA 4MOZA 2YYUA 1EPVA 1W17A 3SRKA 1RH9A 4PMQA 1WDQA 1XBYA 3NZ1A 5CPQA 4AVNA 3TTYA 1BXNA 1KLZA 3MB9A 4QDPA 4L56A 1R87A 5BXPA 2YXOA 2JEQA 2OELA 4KWUA 2VELA 2QJHA 5MKGA 2BDQA 1O12A 8A3HA 3GU2A 3IJ8A 4FHAA 4LNYA 3S9YA 3MI2A 1R2SA 4JY8A 4XZLX 2O9OA 1TZ7A 1NELA 5MHBA 5EFDA 2WO5A 3U6WA 3DYPA 3T8LA 4NVTA 1VEPA 4JR5A 1I2OA 1UASA 4S3DA 3LA4A 4LANA 3M0MA 2QCFA 1JDAA 1C8QA 1TIMA 2JALA 3BWWA 1C9WA 1Q7MA 3Q2DA 3GG8A 1X1NA 5F1UA 4R5EA 3BJSA 1TJRA 2D0HA 3KXQA 2Y4SA 1JGMA 2EF9A 1X39A 3U9IA 2PRHA 3KWSA 4KBXA 1B54A 2ZXQA 1U5HA 4H8HA 3AHXA 3VE7A 1X7IA 2J8GA 1WQ5A 4BI6A 1BFNA 1OX4B 4NYUA 5G2WA 2H8ZA 2QJMA 1JCLA 1E70M 2PI6A 4LH8A 1A5MC 3UY7A 1UR2A 1EEPA 4X22A 1UB3A 1GYMA 5C9ZA 4C6CA 4W8BA 5B7YA 4AXKA 2I57A 4J4KA 4PMVA 3OLIA 4Q4OA 4H6RA 2WPBA 3EB4A 2RDUA 1T41A 3I7RA 4CCDA 4PTDA 3CEUA 3KOYA 8XIAA 2RHGA 3A24A 2C8NA 1P4CA 1RR2A 1KBBA 3VVGA 2MUCA 4S2CA 3OW1A 5T91A 5D33A 3BCFA 3HQPA 1OC7A 4IIFA 2PGRA 3DYOA 5BROA 2PBGA 5BWFA 1FCQA 2GJPA 3CUGA 3HQ1A 1EHAA 5E0FA 2WKLA 4IXHA 3TOPA 2WKGA 1JG9A 1UKQA 1XH0A 5HMSA 2E25A 4E4UA 3VOFA 4F2BA 2O55A 2WCGA 4H1ZA 4N2YA 7CGTA 1IR1A 1F4HA 1UR3M 5IOBA 2D2JA 4W5ZA 3IIPA 2ZRWA 2AMXA 3G1HA 2PZNA 3CWOX 5RUBA 4GIYA 4R3UA 3FKKA 3SRDA 3HO8A 2BBFA 3PJUA 2PTWA 2H9AA 3NVDA 3S83A 3LBMA 3OLEA 3T6CA 3OZMA 1YE4A 4S3GA 2ZQ0A 4IJRA 1E6ZA 3LPOA 2D1ZA 4JTCA 3GFZA 4CU7A 4TX8A 2CFFA 2IKIA 4UOZA 1OK6A 3G6MA 3URAA 1XLIA 4ECLA 1N55A 2PP1A 3P93A 3AIQA 2AGKA 2XWDA 2J7DA 3GWQA 3PC0A 1MXSA 1DBTA 2GVLA 3QC0A 2P1FA 5GJNA 3TYZA 3VO0A 1H1ZA 1WDRA 1YXYA 3OBKA 2WQPA 3PVFA 4O16A 4MB3A 5I6SA 4C6DA 4MJ4A 3ARUA 4WX2A 1ZY9A 2JFEX 3JRKA 3L21A 1AH4A 4ACZA 4MFEA 3E9AA 1EC9A 1LM1A 4AXNA 2A3AA 3AMDA 4WHBA 3TYUA 5ABFB 4ALDA 4PULA 4O1EA 3OPSA 1NWUA 1PTGA 7ODCA 3N12A 1SR9A 1EC8A 3EX6A 3OBEA 3TSDA 4ROQA 3URNA 1XL9A 3N9RA 3LG3A 4EF9A 3NXFA 2FPVA 1KM4A 2XH7A 1TPC1 4B15A 5CG0A 5B80A 3V1PA 4FB7A 3E6EA 3RXZA 1KBKA 1QW8A 1TV5A 4GY1A 1MFVA 3GXDA 3FV9A 3TJIA 2ACSA 4DPPA 4DNHA 3EOEA 1CGVA 4ZQOA 1AW2A 3CZ8A 1P43A 3WQDA 1ML1A 3GLCA 2EBNA 3KVLA 1SJCA 5D03A 1XBVA 3PZ9A 2DUZA 4CUCA 1YPXA 2WLZA 1MQQA 3ABRA 1KFCA 2ZA2A 1GWJA 3QEZA 5C9UA 3WFLA 3STEA 1QNQA 3M6YA 2QPUA 2VP8A 1SZRA 3MCOA 1OZQA 5KZMA 1VGAA 3OGSA 1ZB5A 3STFA 1XLLA 4C6EA 3K8KA 1ONXA 5LNWA 5CPMA 2EPOA 2UY5A 2BGNE 2DQXA 2WSPA 5XINA 4NRRA 3DFHA 4IG2B 4YPJA 2OYLA 4JN7A 1B3VA 2YL9A 4DAIA 1WXZA 3QSRA 1V3KA 4DUOA 2E9BA 3NDYA 4JDBA 4A8IA 3EB2A 4NQ1A 3BJTA 3MBDA 1REQB 4FOKA 4P8WA 1OG0A 3TLLA 4GZJA 3JU2A 5I3HA 3F5KA 3WFZA 3DKJA 4BF9A 4X2PA 2CETA 2GVEA 3NTYA 3PPHA 3M16A 3HA1A 1CLVA 4UNLA 1SMDA 3M44A 5DEZA 3RJXA 4L9YA 3J7HA 3MCNA 4H01A 2ZZ7A 3KBMA 3LTSA 2F2HA 1OCJA 4J35A 5EB8A 3THQA 2O9PA 3VINA 1E72M 3WLSA 1PX8A 1UIPA 1TTQA 3NPWA 3VZZA 2ISFA 3B06A 1NDWA 1XV8A 3NSNA 2I1OA 3S47A 4IMEA 5KMYA 1UZDA 2C0AA 4TQTA 1Q8JA 1P48A 3LNMA 4IX2A 4Z1YA 4JL1A 1MFUA 5BOEA 3WH8A 4ICNA 3JW7A 5LHEA 3P0WA 2GDQA 4TMBA 1I45A 3OLGA 3AYTA 3WLHA 4J2PA 5REQA 4LAKA 3VILA 4Q22A 4Q7IA 2WV8A 1T8XA 3DFPA 4HU0A 3P5ZA 3W24A 3IRSA 4DYEA 5XIMA 3QZ6A 1OIMA 1HN1A 4Z1BA 5HQLA 1XF0A 2OQHA 3WQCA 3JS3A 2VUNA 4K1WA 3A5FA 1K6AA 4JEJA 5M1TA 3IVUA 2BV9A 4KFOA 3K5XA 4X3ZA 1Z7AA 4MAZA 2ICSA 1BSIA 1EX1A 4MDOA 4NKCA 1SW0A 3SFKA 3C56A 2Y8UA 4H6QA 1KGXA 4U28A 2EG8A 4PUKA 3N3MA 2QGYA 1MW3A 2X0SA 4ZVJA 4F0MA 5DANA 4NJHA 4XD6A 3W6MA 4YIWA 3GE7A 3DBPA 3H7RA 1NFGA 1TVNA 3MYOA 2VDGA 5DFAA 3DG7A 1W91A 3GBDA 4U10A 3VNLA 3N6JA 1XLGA 1GW9A 4MDPA 2TPSA 3SGGA 1Y5WA 1OFAA 1CECA 2PUZA 1KM3A 1UOZA 3K30A 1M1BA 2VR2A 2WHKA 3CQJA 2YB1A 4PCNA 3UWVA 1B3XA 2G3JA 1A5OC 2H8XA 5HNTA 1DQXA 2VGGA 1W1VA 4XIMA 3QSTA 1OCNA 3W1QA 4JOMA 1FTXA 2WMIA 4AMAA 4B91A 4I8DA 2W5FA 5G2IA 3QZAA 1WXYA 4D8ZA 4GVFA 4HZMA 3WNLA 1FA2A 2JE8A 2WJFA 1TPFA 4UOQA 3PZOA 2WLYA 4GI4A 3NL5A 1FWAC 1UR0A 1ME9A 2REQB 3UJFA 1UG6A 4S3EA 3WL1A 2OOGA 1AQMA 3VDAA 4D8LA 1F8IA 1PWLA 4IIEA 1Z41A 4UR9A 1HZYA 3VZYA 4LUJA 4G9PA 1YDYA 2PRMA 4OGZA 4PC8A 2W3ZA 1TCMA 4DXVA 2V2CA 3TYDA 1TTPA 1A5CA 1H7XA 3E96A 4HP5A 3CAQA 2CXEA 1CGXA 2VTFA 3CZEA 1QO2A 3BSMA 3DECA 3PS7A 3BAXA 2XPKA 4FOUA 2DW6A 1W8SA 1E1FA 2DZTA 3S6DA 1CXFA 3KVMA 5AC5A 1GQKA 4CCCA 4N9BA 2QPSA 1EDGA 1LL6A 1JUBA 3OVRA 3QY6A 4KH2A 3HQNA 4CD6A 4Q8NA 3VNIA 4WF7A 4HTBA 1OBAA 3BXWA 4EOUA 1F6KA 1BWVA 5KZ6A 2Q02A 7XIMA 4DUVA 3BC9A 3DERA 2TRSA 2PDPA 3UCQA 3CLWA 3A3XA 1Q45A 3OVPA 4UTTA 3QV8A 2J66A 3GUWA 2QDDA 3EOSA 3U2EA 4W8LA 4XZHA 4DNMA 4FIRA 5ECVA 1XYBA 1J6PA 1R0MA 4XVEA 2NZLA 1T8QA 3NQ2A 2ONEA 1EBHA 1PTAA 4YYFA 4FPSA 3VKDA 1S46A 3PBGA 2E09A 4B2DD 1H1NA 1VCGA 1EB3A 4ASTA 1H3GA 1WNOA 3LTYA 4NJJA 2HZGA 1TA3A 3PM6A 2DW7A 2OXNA 2YXXA 1MQRA 4V1YA 5E6ZA 3K4AA 3KRZA 3NQGA 3SN0A 2ZRVA 3G8EA 1OIFA 4E0CA 3Q37A 1VLIA 4JIQA 2G3IA 2QCMA 1XPYA 3QLDA 1OFEA 3OU8A 4K1GA 4AWEA 5AHMA 4FSAA 3SQMA 4JTQA 1M65A 3VKBA 1S1RA 1OYBA 1F74A 2PTDA 1XRSA 3M0XA 1AQ0A 4E8CA 3VIIA 2ZCGA 3UZJA 2JKEA 4IQJA 1KNWA 2CKRA 4C6LA 4IQEA 4AIOA 1XIFA 3GW0A 4X63A 3GD6A 5C0QA 4ERGA 2NQZA 4O19A 1UR4A 1XYZA 4IICA 3L4YA 3AZRA 3TUUA 3AMGA 1FWWA 3W83A 1XCFA 1X6UA 5AHIA 1LOSA 2FGBA 4G1KA 4TV5A 3UCCA 2VL4A 4PRRA 4CKQA 3H4GA 1U22A 2V5BA 3GTFA 3SN1A 4H7VA 2FDMA 3MYPA 4I7VA 3THCA 1PCKA 2DFAA 5CLWA 2WAGA 6REQB 2IQDA 5AYBA 3RUBL 1YPIA 3O05A 2CLPA 3GNDA 1TG7A 4AEEA 2GQ3A 3RRAA 1Q63A 1PZ1A 3WEOA 4I6KA 2VC6A 1XG4A 3WIJA 3FGCB 1HL2A 4K39A 4UTHA 1WYIA 4LS2A 3L4WA 1E6RA 1XDMA 3LX9A 4ZQCA 1V3JA 2R6OA 1TREA 4H3DA 5U7SA 3SURA 4F66A 1NP0A 4DEFA 4O54A 1DHPA 1QTWA 4KKXA 1U83A 1XUUA 1T96A 2QJJA 4UIOA 2VZVA 1FH9A 3N4AA 4FI4A 3NQDA 3ITXA 3EPMA 5E5CA 4FR1A 1BEUA 2I5QA 4U3AA 1E6PA 3UCDA 3UG3A 2V63A 4RW5A 3FW6A 1QFEA 1WE5A 1V3LA 4GY0A 2HVMA 3I4KA 3M5XA 1LL7A 1XIDA 1DWIM 4OECA 3MS8A 5AVNA 3TMLA 3RX2A 2A21A 1MVYA 2QCCA 1F05A 4HNCA 4NAFB 3UWZA 1TJ1A 4WY0B 3TA9A 2ATSA 3G1AA 1GK8A 4BS0A 1L9WA 2VURA 3WQFA 4HQVA 3T81A 2B81A 2BY2A 1AL7A 1CXIA 4O11A 4H2CA 2DZPA 4GWEA 4MKNA 2OLAA 2XSXA 1BYAA 1CW2A 3D3FA 2HTMA 1E73M 4IM4A 4F0HA 1B3ZA 1A3WA 1HL9A 4IZGA 1EXBA 4DM2A 2NQJA 3VIJA 1IV8A 4JTFA 3VMNA 1U5VA 3NOEA 4HNOA 5HPCA 3M0LA 4GO8A 2FGZA 2P50A 3CQHA 1W31A 1S38A 3SGUA 2QUUA 4YYCA 5HMFA 2E6FA 3AI0A 3EKGA 4CNUA 1A5UA 5JH1A 4LU0A 4LVBA 1DQUA 3WDJA 3VU2A 1PSCA 4WKFA 3MSYA 1WKEA 2YDAA 7A3HA 1PO9A 4IGHA 3OOQA 2OPJA 1Q5MA 1GTHA 5CPTA 4ILSA 4UTTC 3G1XA 1K8CA 4JQAA 1OC6A 2DT1A 4PCTA 5EA9A 3QW3A 2Y7DA 3O1NA 4BQ4A 4CEUC 3I7QA 3LZ5A 3TA6A 4UFJA 3W37A 4E8DA 3LERA 3LHWA 3AIEA 2Z1KA 4ZO7A 3APTA 4TIMA 2ZRUA 4Y9NA 3GXNA 3H6OA 1OCQA 1B31A 2V68A 1S5MA 4ADSA 1XD0A 3M5YA 2PDKA 3KDNA 1KBJA 1I1WA 1UD6A 2EQDA 4QXIA 2WWCA 1QI5A 4JKMA 1FKWA 1W3LA 1W5NA 2RH9A 2OODA 2WVUA 3WEMA 2PP0A 1I0DA 3AU6A 1DJYA 3M5VA 2B31A 3BARA 4JIIX 1S2AA 2E3ZA 3UR7A 4LYRA 1EZWA 1T40A 3T78A 5HWMA 1W8GA 5AOUA 5EBUA 4JXCA 4L1GA 1XQLA 3E0LA 5DELA 1JZ6A 3L4UA 3B0YA 2G37A 1HG3A 3BICA 1IEIA 2HNEA 3BG5A 4QEEA 4JHMA 3SDOA 1UMLA 4HNUA 2C1GA 5FJJA 3ZLGA 3PSVA 4ZZ9A 1DJQA 1DJHA 3ITOA 4WLCA 3L7RA 1KV5A 4EX4A 3DIPA 3LLFA 1YX1A 2BY3A 2ZOXA 4RUBA 4Y2WA 1OB0A 2F61A 2PC4A 3AXIA 1T5AA 1UC4A 4ADUA 2XTKA 4PTWA 3BG9A 4LQ1A 1XLFA 2AAMA 3OIXA 3UZYA 2PC8A 1AW5A 1DYSA 1BF6A 4DIAA 1SMAA 2BNJA 1P0EA 2VYOA 4AD1A 3HPZA 2PU1A 5IRPA 2G5WA 3EDDA 3WF4A 3N2XA 3P82A 4RE3A 2FZNA 2VWSA 1DJGA 1ADSA 1OFQA 1AMYA 2XGZA 4OOUA 4ZENA 1NOFA 2ZZ5A 3WUEA 3H2FA 1S5TA 2XM1A 4A6GA 3D3AA 3QKEA 2VNCA 4G2DA 5A5WA 4DJED 3ARRA 3W7JA 4WIWA 1UW9A 1JRCA 1G1YA 3GZAA 2VM8A 2A1YA 4DJDA 3PUGA 3R12A 4IOTA 3FOKA 4XUGA 4PB3A 4N6EA 2ZKMX 4JBRA 1JZ7A 4GZEA 5D9NA 2DDXA 5ECUA 2O4QA 4DWDA 4N7QA 2Y62A 3BLKA 4JKKA 4EPKA 3T09A 3VIGA 1JUKA 5BMXA 2ZE0A 2YCIX 3PG9A 2PDIA 2VZTA 4ZOCA 3GNRA 1EO5A 1T0OA 3AQUA 3A47A 2UV8G 4BI7A 2ZUUA 2R94A 3MI6A 3PTQA 3ANUA 2YA2A 3W1MA 1XSIA 3I10A 3MBFA 2DUAA 4MNKA 3L4ZA 1EJSC 1BKSA 4HBKA 3C5QA 3CH9A 5T8GA 3ZJ6A 4B3ZA 3FLUA 4H6EA 2NWSA 1LT7A 1ALDA 1XLAA 4KEZA 3VKCA 1DWGM 3TDFA 4IPJA 1YRRA 1WUFA 4UTWA 3TK7A 1ITXA 1TX2A 3ITCA 3WNNA 4KFPA 4D6IA 1XIBA 2ZTKA 4GGHA 3GS6A 4DPQA 1OCBA 3MO4A 2CBJA 1NJJA 1E9YB 1FWNA 2VKZG 1LRNA 1RBOB 2FQIA 4O1BA 4M51A 6TAAA 1SO4A 2QVNA 3WH7A 5J5DA 4GHRA 2OGYA 4IL0A 1GORA 1PYMA 3IAPA 4J3XA 5D2XA 2GSJA 1OK4A 3PNUA 3CBWA 3B97A 1XIHA 4MF4A 4LF2A 1IWBA 2EPHA 4KWOA 2PF8A 1H7RA 3MUZ1 1RAKA 3B8SA 3E12A 1ZAJA 4O10A 3CMGA 1TPVA 4RL3A 2XIOA 4H83A 1UROA 5HANA 3DENA 9CGTA 3NURA 5MKGB 4XBSA 1GJUA 1UD8A 1JYVA 3SRFA 1E43A 2PTYA 1NQ6A 4Q8PA 5EU9A 3UA3A 3N4EA 1OFOA 4DBEA 1NARA 1UZ1A 4AZ7A 3V0TA 3AO0A 4QCFA 2WZMA 1WKDA 2VENA 4CGTA 4KMQA 3TN5A 1Y8BA 1W54A 4PR4A 2GZXA 4D1IA 1AL8A 1LDCA 4G56A 2DU2A 5DT5A 5HMDA 3UZWA 2CZ5A 4XUYA 1EOMA 1UMYA 2E8YA 4UTFA 1E56A 1O4UA 1SR0A 3VI2A 1CDGA 1F2JA 4K6AA 1VBGA 2X1IA 3E3HA 3GH7A 3H54A 2ZADA 3PBYA 1J2WA 4I90A 3TZNA 1O5QA 2POTA 3L67A 4Y9MA 3B8WA 3AZSA 5DCDA 1XCXA 3WL0A 3S6TA 3IARA 3FIGA 4GX9A 3UP8A 4QS5A 4BF7A 2TMDA 4X9YA 1DIDA 1Z44A 3QR3A 2CLEA 2LLEA 3UBPC 1G9HA 5HNRA 4EP8C 2NX3A 5HINA 1CGUA 3GFYA 4KRUA 1GZ1A 2OX1A 1PEZA 5MF5A 3ECQA 4EVZA 2YJQA 6XIAA 1EKOA 4GZIA 3M0HA 1XLDA 1ZALA 2OZTA 3OODA 1KXQA 1W3HA 4UMAA 4GISA 2YCLA 1H0IA 1HVXA 3S2NA 3FVMA 3UR8A 4DXKA 1SVDA 4Y96A 1F61A 1PDYA 3VFLA 1YDNA 2Z2UA 3QHOA 2FH6A 5LKYA 1AJ2A 4JKLA 6ENLA 2VMFA 4OV4A 3PWIA 2NQ9A 2FHFA 3SY5A 3F2CA 1D7KA 4A8RA 2GLKA 3EA1A 1QDSA 3ID7A 4O4VA 2OZ3A 4HA0A 5A6BA 4MY1A 5IFPA 3L2MA 3RU6A 1BVZA 4L9ZA 4XAFA 2DSKA 3VAVA 3VCNA 1VRXA 3N2TA 2D3NA 3B9DA 4ICCX 2DEPA 9XIMA 3A5VA 2H9AB 5I00A 3UA4A 3JUGA 1XIGA 4FNSA 1ITUA 2Z6IA 3G3MA 4WD0A 3ALFA 3QVQA 3R58A 4I5XA 1MW0A 5AC6A 2TAAA 2A4AA 1G67A 4PCSA 3MUY1 1J93A 1IWAA 4GYFA 1OZMA 2DT3A 4GE8A 3GB6A 2YL5A 3GK0A 2E5CA 3A64A 4JTAA 1KGWA 4D72A 1O5KA 4DJDC 3UG5A 1AK5A 1FX6A 2HE8A 4BEUA 1TZ9A 2INEA 2J7FA 1BWLA 4LEQA 1E1CB 2G3FA 3CC1A 1KA9F 3NGFA 3H2CA 3IJ9A 3CZJA 3IV8A 4H9TA 3D5HA 3GU1A 3AWOA 3WLQA 3EX2A 3NQFA 3AROA 3EOOA 4D9PA 4DZ5A 3VIKA 3W26A 1TRDA 3CMFA 4LALA 1ONWA 4I3GA 1RP9A 3AISA 3OA3A 3RMJA 3LUTA 3B03A 3HFTA 1VF8A 1RJPA 5H8MA 1O7AA 4H2HA 1PV8A 4H9YA 4KPLA 2R1NA 4NG3A 1XP3A 3G1YA 5CPNA 5TQLA 4O1AA 2XZ7A 1J0JA 3N73A 1CEOA 3WYZA 1KKOA 1WAUA 1W3JA 4ATWA 3EGJA 3CO4A 4M7SA 1N8WA 2WC4A 2WJDA 4QS6A 2O7SA 3GAYA 3IWPA 3TVAA 5E1QA 3SO7A 5C9XA 3CTTA 3Q94A 4KCTA 4KQNA 3U7VA 1JPKA 2GPTA 4JCMA 1ZRQA 1W3NA 3KZSA 3MSGA 3FKRA 4UTWC 2PU0A 5I3DA 3OG3A 1F3TA 2JKAA 4KCWA 3CB3A 1H63A 1QHZA 1R30A 3W2KA 4HVXA 4EXAA 5GQBA 4AWUA 3GDLA 3WMLA 4JQ1A 3AYVA 4K38A 4NASA 4XZMX 4JTRA 1W0MA 2NUYA 1UKOA 2B0MA 2Y70A 1ZP4A 5IXEA 1DL3A 2Y7FA 5KZDA 5CZTA 4D1JA 1GHRA 2ZZ4A 3HMJG 3FS2A 4FR6A 3BG3A 2OB3A 1C3FA 3W7RA 2R91A 3W25A 2OO0A 4EAMA 2C19A 1TPWA 3DG3A 1EDQA 4FALA 1OQFA 3PJTA 2H90A 1VFLA 5F1VA 3WF1A 1JRBA 5ABEA 4GMEA 4GUIA 3G1DA 3W2UA 4I7UA 2ZXAA 1F7BA 2B7NA 4MJ2A 1K9FA 5FEWA 2VEPA 1L6SA 5ABTA 3AJXA 3QY7A 3I3EA 4YTTA 1T7LA 4UB9A 4Y9OA 1PBGA 4FK9A 5K9CA 3B40A 1F76A 4KIEA 1GYNA 3IV3A 4MMWA 3V5CA 4UQ9A 1RCQA 4JZ5A 3ABOA 2R1LA 1R3QA 3GHTA 5A94A 1JF6A 1CGYA 2WZEA 3QMTA 3E49A 5I23A 4DY1A 2RAGA 4AY8A 3MV01 3SUUA 4CEXC 5LHFA 4WEVX 3ZM8A 5D2WA 2CLOA 4H7CA 3BE7A 4ADTA 4C5YA 2QGHA 2L5HA 1FWSA 1TV4A 2E1DA 3L0NA 3V4BA 4S1FA 1CZ1A 1TRIA 4DHGA 1D3HA 5REQB 3BMWA 4QM1A 2Z26A 1XG3A 4O0QA 4DELA 1GQJA 3T0CA 2PDWA 1DJXA 4CVUA 3W88A 2WCAA 3TQKA 1VFUA 2V0TA 1YDVA 4PMZA 3RLUA 2RFGA 2Z27A 3BGGA 4UTIA 2KAUC 5BWAA 3VIMA 1P0BA 2CU0A 4E38A 2A7PA 3TAKA 4WDWA 4QR6A 2WVTA 4MNLA 2GUBA 1EP1A 1Z9AA 4GVGA 2YIHA 2R1PA 4AB4A 1RSCA 3LRKA 1SO5A 1EYEA 2XVKA 3E0IA 1POJA 1Q65A 1JPHA 4GYKA 2VQTA 2YA0A 3BOLA 3AWNA 4NZ4A 3TCEA 1RPKA 2HXTA 1BPLB 5A6MA 3B4YA 2D22A 4KRTA 5SWUA 3R8HA 1HKWA 4HMCA 3BQ5A 1SJDA 2YKKA 4RDVA 2ZRYA 1OT1A 5LA2A 1HL8A 2PDXA 4L4MA 3N13A 3VCRA 4M0XA 2BS9A 3LRLA 3QBUA 1PB0A 3VIHA 1NWSA 5K4ZA 5HATA 4AWSA 2WZHA 3SSZA 3RPTA 1M5WA 3DFTA 3NA8A 1UH3A 3FDKA 2GJXA 1YTDA 3KOZA 1A80A 4L64A 2QUNA 2DZXA 2VC7A 3ABQA 2E4TA 5JUVA 1ME8A 1VFTA 3SI9A 4WJEA 3WQWA 5HJLA 4W8AA 4LV4A 1FFQA 2B4GA 5D02A 2WPGA 2GGIA 1MXDA 2QMJA 3ZLFA 4XZWA 1QHPA 1P7TB 2HISA 2ALRA 2QAPA 2J74A 3AAMA 1HQTA 1SJAA 4XZBA 2OEJA 1ODUA 2J8FA 3TCSA 3ZS4A 4QG9A 4YL2A 2A5HA 1E40A 4U5KA 1XSKA 1IXQA 1VBJA 3RN6A 3K8LA 2DGAA 4RW3A 3V35A 2A79A 2WM1A 3SW6A 1UZ4A 3GNNA 3TXVA 3AYSA 2GVYA 2OVLA 2VZUA 3L0KA 5I3GA 3RHGA 3OQ8A 4HA4A 1XM3A 5G1YA 5C2GA 1QASA 2QEZA 1JPDX 3RNDA 3GVWA 3CQ0A 3Q4DA 2XUCA 3CPRA 1TTJA 3DC0A 2HQAA 4G6CA 5LA0A 3GDBA 4O14A 3CB8A 3VMPA 4JHZA 2BTMA 3UR5A 4KETA 4F4RA 1CXKA 3UXKA 4MNMA 3BV7A 2CESA 3MJMA 1NTHA 2PDLA 3IVTA 3WF0A 5DCEA 4KCUA 4C6NA 4MVAA 3VD5A 3S1XA 1WBJA 5HQEA 5JQ9A 3SCRA 3P84A 3FK4A 3CEPA 5XIAA 3N2MA 3N6HA 1UD4A 2DZBA 2QCDB 1OF6A 4GKLA 1TR9A 4S38A 4A8LA 3R5EA 4MIMA 4HPGA 5CSSA 2E67A 1S2WA 3WD4A 5FF4A 1XRTA 4S3KA 4LBRA 1LLWA 1X1ZA 2O56A 2G95A 1JZ3A 5K2ZA 4CN4A 3UYIA 4JS3A 1RUSA 3IGXA 2NLYA 4H19A 2Y85A 4CNNA 3SJ3A 4QHRA 1QW9A 2NUXA 2QV5A 1BD0A 1JFHA 3N3TA 2XU2A 1KFJA 3W23A 4S3FA 1AG1O 4RZBA 3AS0A 1CPUA 3TX9A 2J9YA 2VUYA 4H41A 2VWTA 4TTGA 1SJBA 4O18A 5EMMA 3FAXA 4CU6A 1J0YA 1KTNA 3FEQA 1FWDC 3GTXA 3ARQA 1E0UA 1QAPA 1V8EA 3TQ0A 3VD7A 3LV6A 1WP6A 4XIAA 2Y88A 2W9MA 3QY8A 3LY0A 4B5TA 3TW6A 4YTRA 2ZZ3A 4KRZA 4JNZA 4AC7C 4PH6A 4N0RA 2F84A 3L12A 3ZVHA 2WVSA 4XKYB 4Y9PA 5FJRA 2AL2A 1GZGA 3WDQA 4DF1A 2WZIA 3L5LA 3W82A 1ZBVA 1I2QA 3ZJKA 4TX6A 4ZR8A 1UJQA 4J3WA 3S1UA 1X6LA 1OFBA 5FF2A 1BG9A 5FKYA 3LCWA 3URBA 1EGMA 3AMCA 1A49A 1Q6EA 4C60A 1EXPA 2AMGA 2ABBA 3UJEA 2XDFA 4NXSA 1B3YA 3W0KA 3EXTA 3L5AA 1VS1A 4AHPA 4RX0A 1JPMA 1EYWA 5H8PA 1CX9A 4A22A 3TYEA 1TX0A 4YS1A 1CXHA 1WXJA 4GXMA 1XC6A 3S9ZA 5M3WA 2JQXA 4W7WA 2P3ZA 1K77A 5I2UA 4LUTA 3U57A 3AXHA 3PY2A 1UJPA 1L8PA 1Q4WA 1ZL1A 2OEMA 3QHNA 2WC3A 2OFJA 4RNHA 4GC4A 3ZLHA 3PTDA 4WSKA 3QGKC 4GIEA 3ZXWA 4AEOA 5BRQA 3VOJA 2G97A 4EWJA 3B05A 1SO6A 2A7RA 4C7GA 3DC8A 4QJ1A 2ZZ2A 1JPIA 2DJXA 3LPGA 3W74A 3TC6A 4HKPA 4ZODA 1FHLA 4JFUA 3RPDA 4DF2A 5G4WA 3HOJA 3TFCA 3IUDA 1FBAA 3UJ2A 3WKZA 3AXKA 3NL2A 2YL8A 2C3ZA 3QRHA 3G6LA 1KW1A 3QQWA 5FJTA 3FDGA 1GVQA 2CC0A 4YN5A 3CWNA 2QVHA 2Q3OA 4UXDA 1W1A1 4WKHA 4HZ6A 3VC6A 1DXIA 2AKMA 4DM1A 4EANA 3M47A 3HPAA 1R47A 5FSEC 1MUMA 5GNXA 1Q6GA 3VKKA 3K1DA 3VX1A 2QW5A 4AD4A 2P88A 1SW3A 3S46A 3PZIA 1Y5VA 4CD5A 3AS1A 5CZ0A 4Q7NA 2WJZA 3GTHA 4MNJA 3SCPA 2W0UA 4IP7A 2OU4A 3KE0A 3EPNA 3R6IA 4Z0SA 2HS6A 2CLFA 2GQAA 2VQUA 5T9BG 3N14A 1FCUA 3OA5A 4Q8QA 5FF7A 3L4XA 3VGFA 1I2RA 2PWEA 4QFUA 1M7PA 4NL1A 3ARTA 3C6CA 2ZUTA 1W1TA 2ACQA 4F0RA 3N9SA 3RM4A 1FXQA 2CZFA 3NM1A 2X16A 4LBSA 4G5DA 3NQAA 3QR0A 5CPSA 3P3BA 1LUCA 1VBHA 4U2ZA 1R8LA 3LU2A 3WSUA 1G94A 1UQYA 4ZA0A 4UQBA 3SCNA 3U3HA 3LM3A 2JEPA 2A3EA 4JHOA 4K68A 4LW7A 1LQ2A 3R10A 2VX4A 4NIRA 1JQVA 3H2EA 2OT1A 3ZWTA 1TPUA 3F7JA 1XISA 3TROA 1QUMA 3EOUA 4RZ5A 4JNMA 4RE4A 4KEMA 2YBVA 4LYPA 4EE9A 3JZEA 5IHSA 1V93A 5CZKA 3HB9A 3WJZA 4WDUA 1QPKA 2VEKA 3UPWA 3TW9A 2VFFA 3QM3A 2P0OA 3N11A 1V6VA 3CL7A 3TWBA 2PWVA 4HA1A 2HBVA 1UHVA 4V15A 2QPXA 3N2CA 1W1B1 3SCTA 1VEOA 2QHAA 3W2JA 1K03A 4GKTA 5FA5A 5CJMA 1YXDA 4HYVA 7PTDA 4HPNA 1I2NA 3S4TA 5C5YA 1YIXA 1H7WA 3W7EA 1G4TA 2FHBA 1FCBA 3NO1A 3ME3A 3GYEA 1J5TA 1RQEA 1Z3NA 2BMBA 2FYMA 3EWYA 1RALA 1QJWA 1MUWA 3O0FA 2PDNA 4ICMA 3GXTA 4GPNA 5AC8A 3LQLA 1BGAA 3WX7A 4DYKA 4E2DA 2DP3A 1EH9A 3WQ5A 2CZDA 4HK7A 1YNPA 5I3KA 3QTPA 1R3SA 4OZOA 2V9DA 1NY1A 1M68A 3C3UA 3GNXA 2BWGA 3C61A 4OHQA 4W7VA 2I16A 1PYFA 3MT1A 3LSCA 1CNVA 4ZMGA 3QN3A 1A53A 3W1RA 3WQ6A 2NQLA 1TYGA 3N4FA 1FWFC 1C7SA 4X2RA 3AMLA 1UC5A 3T9PA 4P7QA 3GNOA 4JTKA 1KV8A 1PAMA 4WDXA 3NM3A 3A3HA 4CCZA 2V5JA 3IGUA 3H2NA 2PZ0A 2QLYA 1IR2A 3LZ3A 3F5JA 4ZEPA 5C6MA 3TZFA 1Z69A 4QE1A 5D9MA 2GUUA 1TB3A 1BVNP 1QI0A 4DWSA 2QCNA 2R82A 3S0CA 1S5VA 2HXUA 3LK6A 2EG6A 1ZGDA 4E3TA 2V82A 1C9DA 1L2UA 4ZL1A 1VENA 1GVFA 5EBAA 4UQAA 2Y5EA 4NNCA 4Y7EA 4LSBA 1RJRA 1UUMA 4PUEA 3WH5A 3WLKX 1RZMA 1QWGA 1RQHA 2BXVA 2Z25A 4I9AA 3VOCA 3TNOA 3UGRA 5CAKA 1C8XA 1PS9A 2WNQA 4F2UA 4C6PA 3ORWA 3DHUA 2EXOA 3TKFA 1P0DA 1H50A 3AALA 1HKKA 1ESWA 3R8RA 2O92A 1J18A 3I6TA 2DT2A 4AW7A 2YLAA 3VM5A 4FF5A 4Q3MA 4PBGA 3EPOA 3WK1A 3IRDA 2Y8VA 3SRHA 2WWDA 3GQYA 1VHNA 3W71A 1TVPA 4DO4A 2QJNA 2H3BA 2J9ZA 2DUXA 3BOFA 3IIZA 5TBOA 1NF0A 1KR1A 4LY4A 4NSBA 4GIRA 3GHRA 3UZXA 2ZTJA 3WLPA 5LNSA 3W29A 4IPLA 4LF1A 1WDSA 1VHCA 4HN8A 1EJTC 2EAWA 2ZA3A 5G5IA 2WNZA 2WMJA 1PDZA 1V3MA 4NX0A 2D2GA 4O1CA 1EA9C 1K1DA 2WM0A 3NPVA 1ZS2A 2Q8ZA 2WMKA 1X98A 2BVYA 1LWIA 1THFD 4JYDA 1H7PA 4AF0A 2YFOA 3VA8A 3W3OA 4ZBCA 2WMGA 2D24A 4F48A 4L7ZA 1QBBA 3UZZA 3H21A 4WY0F 4DI9A 1MQPA 3KAOA 1VR6A 2QCHA 1XGDA 3VDGA 1R9YA 2OSXA 2G3MA 1R2RA 3VOHA 1E6XM 6XIMA 1MDRA 3L2IA 4LNCA 4QDMA 5DMNA 1XCWA 4IJCA 4Z2HA 4GQRA 1VJSA 1R5YA 3TQVA 4IFRA 2EEXA 3WLMA 4GG9A 5K9DA 3V5FA 5K4XA 4HOWA 3PTMA 1M7OA 1N2VA 3P67A 3QXBA 3I4EA 4RE0A 4I9JA 4JTJA 4I5RA 1UOKA 4UOJA 3W7KA 4HOZA 3GR8A 3K13A 4IMAA 5DQPA 4GD0A 1JDCA 2WXDM 3HJZA 3N1AA 3BOXA 1MUCA 1R86A 4M6PA 1D7FA 1MYRA 3XISA 3ITTA 4YHGA 2FFCA 3C2RA 1B4KA 2VRKA 4UFKA 1WO2A 1ELSA 2Z1SA 4AZBA 1JZ5A 3PZQA 1XBXA 1XFBA 5D4YA 2BVDA 3M07A 2RJGA 3H22A 1A0DA 1BRLB 2FB3A 4HNNA 4L6HA 4AAJA 4NAEA 3GC5A 2QNEA 3S2JA 1G4PA 1VCVA 2CHRA 1ZLPA 4FXFA 3U4FA 3V7PA 3GG1A 3FVDA 3ALGA 1K4GA 4JFTA 2FVLA 4FXJA 4URIA 3G1SA 1IWPA 2ZVIA 4UCFA 5CC5A 4PA8A 4L4PA 2R14A 1HIZA 2J7CA 3GM8A 1EBGA 2XHYA 3IUIA 3HG5A 3ANVA 3DKLA 3L4VA 4IIGA 1XX1A 3P0XA 1S2VA 4IUGA 2YCLB 3I3DA 3QPEA 1JZ2A 2C1IA 4AUBA 3P8IA 3W1AA 5DXXA 1CTNA 4QDWA 1FWBC 1MRQA 2A3CA 4UCGA 3L66A 1RHCA 2C91A 1XKJA 3FJLA 3OLDA 4AX6A 1QO5A 1UWTA 3BK0A 1DJZA 1QI4A 3VGEA 2I7GA 3SCOA 2PDGA 4O0KA 3BW2A 2O0TA 3HGRA 4BQ5A 2GL5A 3N19B 1X97A 3OVGA 4ACYA 4BF5A 3PZVA 3F4DA 1P6WA 5I3FA 1KXHA 3DFSA 1DWAM 4B4HA 1OX4A 1V3HA 3FAWA 2X05A 3CIVA 3G0SA 4XTDA 3GVQA 3ATYA 4J27A 3CHVA 2X30A 4K8EA 5AY7A 3D47A 2C15A 2VEGA 2IKGA 4GVHA 1KO0A 4YJ5A 2FVMA 4W4QA 2D3LA 1N7KA 3TYAA 1P0KA 4PTMA 2H3DA 7REQA 4I5UA 2C7FA 5KSWA 3CHFA 4QJ3B 3WMCA 2NVDA 3BV4A 3ITYA 2J78A 4IF2A 3WF2A 2OLSA 4XAYA 1ZJAA 1DWFM 4DJFA 1JCNA 2Q8LA 1MW2A 3NSXA 3OZYA 4O8AA 5F2GA 4LAZA 1QK0A 3F5LA 1JR1A 1UWRA 3ZSTA 5JIWA 4GI6A 3ARXA 3MQTA 3QFEA 4GBDA 5EPDA 2HSAA 2J7GA 4PBEA 3T42A 1ADOA 1BYBA 3M0ZA 3LENA 3KEHA 4XO6A 2XN2A 1QNRA 5BXTA 1NWTA 1U33A 1ZP3A 2CHNA 1JAKA 1KRMA 3UQNA 1J8VA 2GDVA 4RXFA 3PUEA 3A9IA 1H11A 4TX9A 4IISA 2A3BA 2FTWA 3GTNA 4L61A 5A3HA 3ENLA 3I6RA 3T05A 2HK0A 4JIRA 2X1UA 2PURA 2CLLA 1A5LC 2CZVA 3S1WA 1QNVA 4ZQPA 3I3BA 4IGSA 1VFHA 3OHIA 4P7LA 4WZHA 3W2NA 4ONVA 4PTXA 2X0HA 5AKQA 3HZ3A 2ZXDA 2XYLA 3LCXA 2NXIA 3PF3A 3NL3A 2XISA 1SZEA 3T2QA 2XG9A 2XGBA 5IBXA 2QIWA 4U31A 3BTNA 2DPEA 1OFPA 2X1RA 1RVKA 3KFTA 5DMMA 3CAKA 3EDEA 1SGJA 4OIFA 1H5YA 1MEHA 3FJ4A 1VJZA 4PFMA 2E9MA 3EDFA 1IEXA 3LPPA 3C0SA 4IJBA 3VNDA 3NO3A 4MYAA 1UQZA 3T0AA 4N4QA 1ZPTA 1EC7A 2OLHA 1IGSA 3GHSA 3ONCA 1XXXA 3TJLA 3C0LA 4UFMA 1X6NA 3EWCA 1D8CA 2BB0A 3UPBA 2XVLA 4AX7A 5CXPA 3M5ZA 3CWHA 3BAJA 3R4IA 1SSDA 1RCXB 2YDSA 4J9JA 5HJYA 1KM6A 4D6GA 4OTKA 1TTIA 3IJLA 2PRLA 3VABA 3DDMA 1BYDA 2YLLA 3GFXA 1FWJC 2V67A 3N2OA 4Q4MA 3UWQA 3G18A 3S1GA 3W6YA 4C5ZA 4UNIA 1KBLA 2HNHA 3W75A 1XYAA 1JGIA 2Y24A 3PZMA 4QAWA 4TO8A 5BNKA 2OTDA 5FACA 2WYSA 2W6RA 1A0EA 2GWNA 3NNTA 2P8BA 1KM5A 1VCFA 3G5EA 3ZR6A 3Q58A 2DZWA 4YTUA 1M7XA 3BLIA 4CNPA 1OF8A 4H9ZA 3SJNA 2AAAA 1E0VA 5HXMA 3LS9A 3CL6A 4L5ZA 4CLMA 3H7UA 1W9UA 5A6LA 3GY1A 1FCVA 5CGMA 3VUPA 1GG1A 3N29A 3W76A 4HU8A 1E1EA 4DUWA 3TONA 4LVAA 1E0TA 3W7QA 4N02A 2WHMA 1KFLA 3TH6A 4K2SA 5A8PA 1G4SA 5DLCA 4J28A 2CITA 3K2GA 3WLOA 1H2JA 2VGFA 4UFHA 3E02A 1RJQA 4LYQA 3W7PA 3V75A 3IAQA 4ROPA 2WHLA 2D23A 4ZSUA 1Q4NX 3TW7A 1JVNA 4US5D 1REQA 1GPFA 4OOZA 3T1GA 4J3SA 2V5CA 1D3CA 4IGMA 4YHEA 2QJIA 1LYXA 5D9PA 2DZSA 4JFVA 5EFFA 4LRTA 5LXXA 3TYCA 3CPUA 1ICSA 3KTSA 4B5NA 4ZQNA 1TJ0A 2OO6A 4MY8A 2NX1A 4J40A 3VNKA 1XIIA 5AB3A 3VGGA 1V4YA 2VCBA 3ITVA 3V36A 3N17A 4UQDA 3W53A 2E40A 1A50A 2G50A 1GT8A 5HR7A 3KCLA 3FA3A 3CASA 1ONRA 3WLRA 4FLRA 3O15A 1Z8AA 3WO8A 4LWWA 4YNGA 3LD5A 3O3RA 5D9OA 4ZXOA 1A5KC 2X2GA 2CIPA 2FPTA 3PK7A 3RLGA 1MWOA 4ZTXA 1JZ8A 4I9MA 1EHNA 4MPKA 1LLZA 3M46A 2QV4A 3KLLA 3DFYA 4ORMA 2F6UA 2GJXB 4A3QA 4RR4A 4F0SA 3SQLA 1JYNA 6CGTA 1A5AA 3VIFA 1AMKA 5EMJA 4HSHA 1US2A 1SZGA 4B90A 3A23A 1DXEA 4KCVA 1WUEA 4XD5A 3W84A 4DJFC 3A6OA 3GKAA 1K8ZA 1M41A 4P8XA 4HYRA 1TMHA 1Q3NA 3R1ZA 5IHRA 3EEGA 2VEIA 1KM1A 4XWUA 1YNQA 1QOQA 3AHZA 3NYDA 4DZHA 3F1QA 4LX4A 4JNYA 3MKKA 4EXBA 1KCKA 1LBLA 3ES8A 1GONA 5BU9A 3IIXA 2P8CA 2NT1A 3DYMA 4PUJA 2P76A 3HMCA 3TN6A 2NUWA 2ZC1A 3DUGA 1L6WA 3GVRA 3RCNA 3T07A 3QOKA 2KX9A 5GNZA 2PCQA 5K3VA 2GGEA 3ZT7A 3VZXA 4WGXA 4DO7A 1F07A 1RPXA 4GJJA 5GVJA 1R3VA 2IPGA 5CPLA 2BY1A 4YTQA 1RBLA 4JY9A 1KWGA 5HDRA 3DI0A 5IBXC 2J75A 4JAWA 3VIOA 3EMZA 3OTRA 1Z32X 5M17A 5JBEA 4XSLA 3CZLA 1PKLA 1RVGA 2ACRA 1AUSL 4UWMA 3SCQA 5G4HC 3W02A 3TN3A 5A8OA 1LF1A 3W7GA 4CD7A 2C71A 5CC6A 3UG4A 3LXBA 3MP3A 3MVTA 8RUCA 3TJXA 1R3WA 5CSUA 1MDLA 3WLNA 4PMUA 2UZ9A 3UGVA 3CH0A 3SB0A 3GR4A 2CHOA 5M5DA 2DZVA 4S3CA 4XVDA 5AZ1A 1S3TC 1UWSA 2F7FA 3VD4A 3G1FA 3ANYA 4GNVA 3XINA 2CWNA 2BHZA 4S3AA 1VFSA 3TJ4A 1B3OA 2PWFA 5HR6A 1GHSA 1E5NA 3S3GA 5C9WA 1EJWC 3LNPA 5FD0A 4AZHA 1UA7A 3I6EA 1W32A 2W63A 2GGHA 5FSDC 4UTKA 2J24A 3T4WA 2B7OA 4XZ9A 1F3WA 3BW4A 5LSMA 4PMYA 1BVWA 1WZMA 2QT3A 5D09A 2ON3A 4KWVA 3DX5A 2R1KA 2DVUA 3YPIA 1HVQA 2NXHA 2RKXA 4NNAA 5A8GA 5AHNA 1K6WA 4Q4SA 1JIBA 3SCWA 4NJGA 1LQAA 3QKZA 2J9XA 3FX4A 4HNVA 3H26A 1W2PA 2PLMA 4PGLA 2GQ9A 4O17A 5H91A 4XZIA 3RF9A 3P80A 3RILA 2YYTA 3OGRA 4LAMA 4FNUA 2CZEA 1FDJA 1B9BA 4KEUA 4N6FA 5AZ0A 3UXLA 4PEEA 2AL2B 1HF6A 2NSOA 1G7UA 3MKCA 2OEKA 3EX1A 1O94A 3KP0A 4PMRA 1K7FA 1NDZA 3MCMA 4M24A 5DBTA 4MJZA 3GH4A 4GA8A 3UZ5A 5HUPA 4R88A 1MNSA 3SIMA 3MU7A 3ARZA 4X0NA 3MP5A 3KL3A 2QCEA 2Y89A 2WCSA 1UUOA 4LRSA 1KXTA 3WDIA 4JIEA 3PB0A 3COTA 1ZJBA 3DG6A 1ZAIA 3BCDA 4TVDA 2Z7GA 4DWSD 2XFWA 5EMLA 4S2BA 1IGWA 3ZJ8A 3TYBA 3E2RA 3LGDA 3WNKA 2VOTA 3PFMA 3BMVA 3P6LA 4O8RA 3H4WA 1GQLA 1GOKA 3DI1A 4RNFA 4QG6A 3TR9A 2NV2A 2FLIA 3LQGA 1K9EA 1UIOA 2GUYA 1AODA 5GNYA 3T40A 3N04A 3QFWA 4J3ZA 4H4IA 2V3GA 2GK1B 5CBJA 3N2BA 2ZRZA 3FJ6A 1F3EA 4GUJA 3WEZA 2ISVA 5FL1A 4V33A 3TTSA 4BR1A 3W7CA 1V0LA 1WBHA 3LHUA 3D46A 2G4JA 1QNOA 3SUSA 3H2MA 3O07A 1C8VA 1XHGA 3UWEA 3ZJ7A 2V8ZA 3NQEA 4NZCA 2C18A 2EO7A 1UKTA 2OR2A 1EL3A 1V0KA 3UEQA 4MSSA 1XPGA 4WJXA 3JR2A 4A3RA 4IQLA 3K46A 3O6YX 5FI8A 2FIQA 1EX5A 1U2YA 1SZFA 2C13A 3CO8A 1YMYA 1I9CB 3KVJA 4W86A 1SFJA 3RCMA 1EF2A 3RMEA 2Z00A 4PL1A 4A05A 3FYPA 4ZFCA 4WQ6A 4V2XA 3W1TA 3GVGA 3VPLA 1TZZA 2CWXA 3LTPA 1GKPA 4K7VA 3NR0A 2OYKA 4DZAA 3O0KA 1VLWA 4PE8A 2WSRA 3O7UA 1OABA 4J3UA 3R8GA 3L4TA 4GUHA 5H6HA 4B5SA 4I7WA 4GY7A 1D9EA 4GOAA 4PCPA 1A47A 3EOLA 1O6IA 1KQYA 2F38A 3BZJA 3LMZA 5DY3A 4JTTA 2JGQA 3SSJA 1QATA 4GRSA 3B8VA 3F4VA 4D6HA 5A69A 3L9CA 2BP1A 1IEQA 1I75A 1VZWA 4OWGA 3A3WA 1LUCB 3WNPA 2PD9A 2Y7EA 4WY0A 4OJYA 2GYIA 1H62A 3B9NA 1XH2A 2X2YA 4QE4A 4M7TA 1E3ZA 1O1HA 1HO1A 3RU8X 1H60A 1YQ2A 4A3UA 3NZRA 1QNPA 5FEZA 3AFBA 3GDTA 4PEKA 4MADA 1BG4A 3DBNA 4JICA 2W92A 1KRAC 3NZQA 3LBCA 2A6LA 3TC7A 1M9HA 4Q7BA 1JD7A 2YPIA 2OWCA 2OWWA 3IVSA 3B9OA 5G4EA 3KP1A 3LCLA 1E15A 2NT0A 4UFIA 3BL3A 4GH1A 3NL6A 5A2BA 4HJFA 2ABAA 3S2CA 5FF3A 1VYPX 2HJPA 1U1HA 2W27A 4Z17A 1O5RA 1ZJHA 1RP8A 5AN7A 3MO7A 1GQIA 3NZPA 2EJAA 3BZGA 4P7RA 3BANA 1Y5XA 3BLLA 3WLLA 1J9YA 1KC7A 1VRDA 1OYAA 3AZTA 1DE6A 3FJNA 1KM2A 1KCLA 3W72A 4Z1DA 3CAVA 2BGSA 4HN4A 3PSWA 4WUIA 4GX8A 1H7NA 1O1ZA 2CCRA 6ALDA 3EB3A 1O66A 5TD4A 1L6FA 4UFLA 1TFVA 4O4WA 1TO3A 4W5UA 4UZUA 5D04C 3TMQA 1W1IE 2PDJA 1OM0A 3MMTA 5FAGA 4E3VA 4D6FA 3HIJA 5EMUA 4MAVA 4DLFA 2YBTA 3GH5A 3QQ0A 3BO9A 1U30A 3WBWA 4B3KA 3S5SA 4UNKA 2VCAA 5JMUA 2GSHA 3NEHA 4ATLA 3W38A 2JIEA 3HG2A 4CU8A 4E4FA 3Q67A 1ZSXA 3HM7A 3B8DA 2DIJA 3HGSA 4JIHA 3RX4A 2A3HA 2EGZA 2VGIA 1Q2SA 4P8UA 4H8VA 5CPOA 2DV0A 1XYFA 1TV7A 3KBSA 5CBIA 4PSRA 3NJ3A 2XIBA 1M3UA 1EUNA 1X8FA 1KRBC 1KGUA 2W66A 4DWSB 3C0QA 4JX4A 4IPPA 2FB2A 4REQA 3VFCA 1JUEA 3CUZA 2BHUA 1TPH1 3VC5A 3UNTA 1CI1A 1GUVA 1SSGA 3U4AA 1W9XA 2AQVA 4P2VA 1EZ2A 4DJFD 3B0PA 4QE5A 2ZVRA 3WQOA 1V51A 3TU9A 3CL8A 1WAWA 3L2LA 1FP9A 3WQ4A 3WZ0E 3POCA 3LXAA 1RBAA 4A3YA 4B5WA 3AHYA 1AQFA