1ZCCA

Crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
240
structure length
240
Chain Sequence
b'MTKIVSHRGANRFAPENTFAAADLALQQGADYIELDVRESADGVLYVIHDETLDRTTNGTGPVGHMLSSEIDTLDAGGWFDDRFKGAIVPRLDAYLEHLRGRAGVYIELKYCDPAKVAALVRHLGMVRDTFYFSFSEEMRQGLQSIAPEFRRMMTLDIAKSPSLVGAVHHASIIEITPAQMRRPGIIEASRKAGLEIMVYYGGDDMAVHREIATSDVDYINLDRPDLFAAVRSGMAELLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerophosphodiester phosphodiesterase
publication title Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit.
pubmed doi rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Hydrolase
total genus 87
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1zccA00
5PTDA 1GYMA 5T91A 4I90A 5T9BG 3QR1A 3OHMB 2PZ0A 4RW3A 3L12A 3EA3A 1DJYA 4I9MA 3QR0A 7PTDA 4RW5A 4OECA 3EA2A 4Q6XA 2ISDA 2FJUB 4I9TA 1DJGA 1DJXA 3NO3A 1QATA 3EA1A 1DJWA 4PTDA 4F2BA 1V8EA 2F9RA 4GNKB 6PTDA 1XX1A 1AODA 4I9JA 4QJ4B 1PTGA 4I8YA 3KS5A 1DJZA 4QJ5B 1DJHA 2O55A 4S3GA 3RLHA 1PTDA 4QJ3B 4R7OA 2OTDA 4F2TA 3H4XA 3KS6A 2PTDA 2PLCA 1ZCCA 2OOGA 1QASA 3PTDA 2OR2A 3V1HA 3V16A 3V18A 1T6MA 1O1ZA 1YDYA 2ZKMX 4F2UA 3RLGA 3CH0A 3QVQA 3MZ2A 4RV3A 5T9CE 1VD6A 1DJIA 3H4WA 1T8QA 2P76A 3I10A
chains in the Genus database with same CATH superfamily
2JEPA 4K1WA 3M1ZA 5ABFB 4QCFA 1QO2A 3VGEA 4WOZA 1JZ8A 3NPUA 2WZEA 1GTHA 3CV1A 5DRIA 3O2LA 1H5VA 3MVTA 1MVYA 4DJED 5CPTA 1ZBKA 1TB3A 3VIKA 2WHLA 3LLDA 1GKRA 2NX3A 4Q32A 1DJGA 1LT8A 3IS4A 2IKIA 1AL8A 3UFYA 5HMEA 2J7DA 5LA0A 1V3KA 1QMLA 3FOKA 3U48A 3LBMA 1DXFA 4B90A 2FYMA 2NVCA 1FHUA 3ZLHA 1JPHA 3G0XA 4R88A 4G1NA 1MFUA 3S9IA 1ZLPA 1O60A 3L4TA 5CPSA 3CEPA 3VVGA 4UOZA 1E9LA 4GJ1A 4K38A 2P3EA 1XX1A 3LB0A 4NAEA 3V5CA 3CEUA 1O95A 1OX6A 2V3FA 4K36A 4BEQA 2OEKA 1RP8A 1GHRA 5M2FX 1JZ2A 1KBJA 3NZQA 5DXYA 3NG3A 1WQ5A 3N2BA 3VM7A 1GVRA 3N9SA 4KCUA 4HPNA 4MIMA 5XINA 5FAJA 5DMMA 2PCQA 1UPMB 3ANVA 3MUXA 4HMEA 1TPEA 2GGJA 3GHSA 3PSWA 4V1YA 4HTBA 3BTNA 3MZ2A 1XW8A 3TZFA 2RFGA 3QLLA 4P2VA 4WKHA 3APGA 1QPRA 1X1NA 1R9XA 4G7FA 1NY1A 1Z8AA 5D04C 3WBEA 3UU0A 1WUEA 1W5NA 3PZIA 3LGEA 3M0JA 2YDSA 5D9NA 1EL3A 2OSXA 4UQAA 3G1SA 3OHIA 4AUBA 4OIFA 4GI4A 3OZOA 2CU0A 1J18A 5CXPA 3ARQA 3GXTA 1XUUA 3PZVA 4EPEC 3W27A 3UJEA 4JHOA 3NDYA 3BW4A 4CUCA 2HJPA 1EJTC 4ZEPA 2HXTA 4Z2IA 4GPNA 4AX7A 4C6EA 1TJ0A 3CQKA 4JTRA 1X6UA 3CUHA 4GG9A 1FH8A 3V0SA 3HGRA 3WD3A 2XIMA 3WNLA 2BXYA 3SRKA 3MPGA 2DQXA 1V79A 1KD0A 4F2TA 2ALRA 4UQDA 4W8BA 4HZ6A 1YXCA 3NURA 4HYRA 3W25A 2HROA 3AAMA 3VNDA 1ME7A 1NEYA 3N12A 3RM9A 4DN1A 2Q8XA 1H1YA 2OR2A 2QT3A 1C7SA 1CDGA 1LROA 5LIYX 1PWLA 1SSDA 1WP6A 5AYIA 1U30A 1Q66A 4JQ4A 4H1ZA 2AQWA 4UMCA 1QI5A 1YDYA 4CD5A 2GGGA 1AFSA 3MU7A 2P3ZA 4FF5A 3OOQA 2BHZA 3TR9A 2OKOA 3U2CA 4DYJA 2BLEA 3DG3A 3BZGA 1TUXA 3L4XA 4Q22A 1UQZA 4EXAA 3WJWA 4US5D 4XX6A 3DYPA 2GJLA 1UUQA 4KPLA 1TCDA 1FHLA 2VFDA 2GQAA 4TX8A 5JH1A 2PODA 3UWEA 1JF5A 3JR2A 5CC5A 2PDKA 4JOMA 3SQLA 3WH6A 4UC5A 3NSXA 1M03A 4I7WA 4Z0SA 1E1EA 2WQPA 1OG6A 5GNXA 1LLWA 2Z0IA 3T55A 2JQXA 3NNTA 1VPXA 3UYIA 4JGDA 2FZ8A 4NI3A 4E8GA 2V8ZA 1ZP3A 3SGUA 3WO8A 1E6XM 2ZUUA 1XUZA 1BXNA 3OTRA 2YSWA 1VS1A 3SQSA 2YDRA 2FHFA 1BSIA 4WJ8A 3G6LA 1E56A 1KLZA 3TN6A 4BK9A 2VGIA 2E0PA 1K6AA 3P3BA 4LBUA 3NM1A 1YE4A 4Z1AA 3TFXA 3W88A 4H19A 1HGWA 4JIRA 1XCFA 4W7UA 1TR1A 4ZQNA 2GGEA 4EK7A 3BVJA 3W1MA 2EKGA 3LBCA 2Y5SA 3W83A 3W1NA 1EJVC 4GGBA 5LNRA 5LA1A 1Q6QA 1LRNA 2WMKA 2EKCA 2OB3A 4MKVA 4K37A 1F3XA 3BLEA 3UESA 2ABAA 4RW3A 4CU6A 5FEWA 1OK6A 5CSRA 1UR9A 2PDLA 1V0NA 2ZRZA 3IV3A 2QGHA 2G4FA 3B8WA 3ICJA 1C3FA 4U28A 2CFFA 5K9CA 1TPWA 3TCSA 2JKPA 1IR2A 3LCLA 4FXRA 4AVOA 2EPKX 3T0DA 2XZ9A 4FMVA 1B54A 4JCMA 4HA0A 4EF8A 4ERAA 1CLVA 4GVHA 4HTYA 2REQA 1TIMA 4WY0B 2PTXA 4OWGA 4UTTA 1M01A 1GK8A 2V82A 4FOUA 2O55A 1HVXA 3KOYA 4N9CA 4E5TA 2FVMA 1F74A 4KERA 3N1AA 3W3OA 4JX4A 4S3DA 2VUYA 4A22A 2GQ9A 4H2CA 2QCMA 3LBOA 5TF0A 4IQEA 4EX4A 3UWQA 2FLIA 2YCJA 4RE3A 2V9DA 2ZXAA 4MWAB 3WNOA 2NZLA 3MWCA 4NSBA 2XM1A 1G94A 2VDGA 1OEPA 3QV7A 3VOFA 3O16A 3ITLA 3E02A 3UWUA 2OZ3A 2W6RA 3UPWA 1UJQA 3KCLA 2NVAA 3GWQA 3U9IA 4AZHA 3WH8A 2HS6A 3R0UA 1AQMA 3HMJG 1F3TA 2E68A 3LV5A 1C8YA 3EDJA 3LZ3A 3VOHA 5D2WA 2QF7A 2C79A 4MWAC 5B7YA 3GY1A 1E0UA 3HIJA 4LUSB 3WMLA 1ZHAA 4CCDA 2D22A 1K9EA 4H83A 4Y8FA 1XH1A 4ICMA 2F84A 3TQVA 1A49A 4LX4A 3SB0A 3QSTA 5BCAA 1V6XA 3S2JA 3VMNA 3VD4A 1YHTA 4NYYA 2BY3A 4MHBA 4AZIA 4DY1A 4PTWA 3WNPA 4DYEA 4H9YA 4PYSA 1AMYA 4UTMA 1XIDA 3MYOA 2OYLA 5C0QA 4QQ3A 4MAZA 2D23A 5E1QA 4Y9NA 3QZEA 4Z2LA 3VMOA 3IWPA 5DXXA 1BTCA 3L65A 3OBEA 4S3KA 3KTSA 2X16A 4R34A 4ERIA 1W37A 2BVDA 1MW0A 4CD7A 3W0KA 3ITYA 2PDNA 3LPFA 1IHIA 4AF0B 4S3BA 3SY5A 5I06A 2ZFAA 4KRUA 1NP2A 3GHTA 1HKWA 2IQTA 1UKTA 3GH5A 4Q6JA 3ALFA 1H11A 5AZ1A 3SN4A 3UJFA 1B1YA 3H2OA 3VI2A 3FFSA 3ZT5A 1XSKA 4EWJA 1OFAA 3RU8X 4M56A 2IS7A 1E72M 2H8XA 1W9PA 5G4HC 4Q4PA 4P8WA 4IG2A 4FX8A 1B3YA 2NV2A 3N6QA 1QPKA 3M7WA 4OJYA 1W1IE 1VCVA 2AL2A 2P8CA 3MZNA 2X1UA 1E1CB 3H21A 2B7PA 3KCJA 2ZYFA 3E5PA 2G97A 1W1TA 4DUWA 1DIOA 4WEVX 2R1NA 1PBGA 2GJRA 3TX9A 1K9TA 4MUPA 3W7KA 3UNDA 1GVEA 1P0BA 3S5NA 3G18A 4ACYA 3JUGA 4RCXA 4Q7BA 1UD6A 3EDEA 2CZFA 1EEPA 5DMYA 1FUYA 3UWVA 4BJHA 2Z7GA 4B4HA 5F2LA 2R9RA 1R8LA 4YTUA 3CUXA 3GKFA 4OUIA 3MSGA 4CNSA 3DH7A 3AWOA 5EMLA 1QNRA 3RCYA 1W3NA 2HXUA 5D37A 2WSRA 4QDWA 1TRDA 3FIGA 3G0SA 4PFHA 2HE8A 2YZRA 4FX6M 4W7VA 1I1XA 5CZ0A 4PTMA 3NDOA 1Q4NX 3NL6A 3WJSA 1V7YA 1M9HA 5CCZA 3TNOA 2Q8LA 2EPLX 4P7LA 3RDKA 1OIMA 2J9ZA 2WMHA 4RZ6A 3T0CA 1RPXA 3FW6A 4MMWA 1ZB5A 1OC5A 2G5WA 5F1UA 4JFUA 4CEXC 1MDRA 4IGSA 2P5NA 4AHOA 5I09A 3NQBA 4J3SA 1OGSA 1WOBA 1ZSXA 2PLKA 5C54A 3SW6A 3U2EA 2G96A 2WKGA 3NQGA 2ZUSA 3IRDA 2ZRUA 3DIPA 4I5XA 1EJWC 2WPBA 4C1NA 2G50A 1VIZA 2J24A 2FQIA 2QEZA 3VIJA 4TX6A 1UWTA 4DPPA 2PU1A 1VLIA 4LS0A 1VHCA 3NQDA 1W2PA 4PMOA 2CZEA 4QSHA 3PZGA 1PYMA 3CBWA 2P76A 3ZM8A 4JY9A 1YDVA 5D9OA 3VPLA 5E9XA 1WXZA 4UQ9A 3UA4A 1MUMA 3IARA 1BYDA 5CPOA 3O07A 5CH9A 4Q4MA 2BV9A 2GDUA 3N6JA 3TN3A 2WCSA 2BZNA 3ITOA 4LAZA 3V5FA 3RILA 4OKDA 1GOIA 3B8VA 2XGIA 3VKKA 3RX2A 3LCIA 2EG7A 3A23A 3RPTA 5CG7A 4HNOA 1J79A 4JTQA 4MJMA 3WH9A 5HULA 2J4GA 4ROQA 4HB7A 1CGWA 4YJ5A 4Q8TA 2HRWA 3B0VC 2OEJA 4DWSA 2QCFA 4YVPA 1TYGA 3O0FA 1GZ1A 1A47A 3W1QA 2QUUA 2XZ7A 4UTIA 5EMKA 3WLOA 4GIRA 1VCFA 2VENA 1QHOA 4DI9A 2E40A 1JFXA 3DHPA 4NJJA 1UKPA 1V3JA 3ZVHA 1OFOA 4GCXA 5D2XA 1XSJA 4B3ZA 2YZ5A 4M5PA 3H53A 4F0SA 4JKMA 4NJIA 2CETA 5T9CE 4UBPC 5HNRA 1SU5A 3OA5A 5PTDA 2VD8A 1C8QA 2DJXA 3NYDA 3UETA 4GUJA 4DEFA 3LTYA 3U5UA 2E8YA 3PJWA 2EAWA 1TVPA 1F4AA 4HHLA 5MHBA 1W17A 1J0IA 5LXEA 1PCKA 3CZGA 2INFA 2G3IA 2WLYA 4HYWA 4PFMA 2QCHA 3GTHA 1S3HA 1P43A 1JGMA 2A2IA 2PTZA 4MGGA 1QATA 3UD6A 3VX1A 3C0QA 1BVWA 3GNXA 4PTDA 3EWXA 5JBDA 1YBQB 4CKQA 3QPZA 4FNSA 3MKVA 1KFWA 3KLKA 1J96A 1J0YA 2WVTA 2WVVA 1E9YB 3N04A 1P7TA 3AUOA 3GVRA 4AXKA 3F7JA 1I45A 2H3BA 3TJ4A 1X97A 3VGHA 1YDOA 5DCBA 3KBVA 1JAEA 5GVJA 2PS2A 1UR8A 2QKFA 1UMLA 3WFZA 4IUGA 2ZRWA 4CQ9A 1DQUA 1RBLA 3BMVA 5HUOA 3PZQA 3SGGA 1J93A 1B9BA 3A3WA 1VYSX 5LNSA 2QHAA 1PZ2A 1DOSA 3A47A 4K3ZA 3CWOX 5EPDA 3LNMA 4D6CA 4ZL1A 1BF6A 1V08A 1UKSA 2NLYA 4IPLA 3KZSA 5LXXA 5BNKA 1HW6A 2UBPC 2ZDSA 3HG5A 2PSNA 5CEWA 1E70M 1DIDA 3KRSA 4N42A 5FF7A 3A9BA 3AICA 4QP0A 3P8JA 3DUGA 3E5BA 3VD5A 3EB2A 1FWIC 4LAOA 2UY2A 1ZJAA 3PULA 3AIVA 1KRMA 1ZPTA 3CHVA 2JEQA 3PTQA 1CZ1A 2GL5A 4IFRA 1YIXA 1KNWA 3CC1A 4FB7A 2VZOA 1TVNA 3F2CA 2I1OA 4H9MA 2A7NA 1XV8A 1SVDA 1DEDA 1UZ4A 2RDWA 4FXSA 4PEEA 3PBWA 3W72A 1FWBC 3NOEA 2EJAA 3RHGA 1K8XA 2J75A 1KFEA 5CKSA 1EJSC 3RLVA 3GKAA 5FF2A 4IICA 4UCFA 1TUFA 5TQLA 3WMSA 4GYJA 1S38A 1K6WA 2XVKA 1VBGA 4H8NA 1VBHA 2YA2A 5FJPA 2FH6A 4WCJA 1SZRA 3M0IA 4M7SA 4C7FA 3VKJA 4AC7C 4PC8A 3QSRA 1PX4A 2WXDM 4LY4A 3WD0A 1DWFM 1R7OA 1B3WA 3SUTA 4LCQA 3WQGA 4G8TA 1EOMA 1L6WA 1A0EA 5IBXA 3KBSA 2CBVA 1NDZA 4HJFA 3CH0A 5CG0A 4X0VA 4H8VA 5C9XA 1Q7QA 1X96A 1V03A 1ISZA 3DFSA 3UVIA 1XYFA 2NWSA 3AJXA 3QFWA 4D8AA 3QGKC 5CZTA 1W9UA 2W4XA 1CEOA 1Q63A 3CL7A 3QLDA 3M41A 3N17A 1WZLA 2Z2BA 5FAGA 3GFZA 1P6WA 4YU1A 4JTJA 4Y9OA 4ZQCA 2VRJA 2W67A 3EX2A 2O4QA 4DJEA 4WRHA 3MUAA 4LYQA 3S5YA 3DFOA 2F9RA 3AMGA 1XLGA 2CC0A 2WAGA 4HVXA 3VGBA 1KM6A 4QLJA 2NXGA 3SJNA 4XIAA 4GVFA 2WW5A 2WJFA 3BE7A 4C6FA 4R85A 1WZAA 4Q8UA 3MUY1 1RD5A 1E9IA 1V93A 1TX2A 3TONA 1Z89A 3G22A 4LVGA 1AH4A 2VURA 4CQAA 1OJXA 2G3NA 3HG3A 2CHRA 3JZEA 1ADOA 3R89A 4LOCA 1K03A 1LP6A 2DVUA 3N34A 4MWAD 1CGYA 1EZWA 1F4HA 1A3XA 4P8UA 3GC4A 1PSCA 1J12A 2WPGA 2QV4A 3RGTA 3FJLA 3O1NA 4F2UA 2F2KA 3QW3A 2J9XA 4S2BA 3VCRA 4IIBA 1DJIA 1FWJC 5LIKX 3TTEA 1L8PA 3S83A 2GUUA 2Y5JA 1LYXA 2PZNA 1GQLA 5TAOA 3TJXA 1O5QA 2ISFA 3L12A 2BOFX 3W7JA 1GOMA 2HSAA 1CENA 3RPDA 1RK5A 1KM0A 2OELA 3AZSA 5CPLA 4AMAA 4FF7A 4C60A 2P8BA 4FZIA 3BSGA 1RP9A 3KL0A 3HQ1A 1DWAM 1P0KA 4H7VA 4FNUA 2Y7DA 4ROPA 1ENUA 4E2OA 2PB1A 4U33A 3HJZA 1WDPA 4NXKA 1UWAA 4BHYA 3CB8A 2CKSA 4DZAA 1E40A 1SZGA 4NZ4A 4XQ6A 4KCWA 1TZ9A 2D2OA 1XSIA 2ZVRA 4UTHA 3TYAA 2Q01A 3RR1A 4QISA 2V6AA 3SCTA 4PMNA 1W3IA 3QGAC 2ZC1A 4UFJA 3CLWA 1SFSA 3VZZA 3CTTA 3PP7A 1MEIA 3AHTA 1WZKA 4ZQOA 4KKXA 4IZGA 3U5YA 3D6NA 4FLSA 4GNJA 5HR7A 4BZYA 4P7RA 2DZAA 4OT7A 2W27A 1RJPA 4WKFA 1G0CA 2I5QA 1XS2A 3UA3A 1BTMA 1EC8A 1ZL1A 2HK0A 2PDJA 3WQFA 1UIOA 3PBVA 1B3ZA 1VFUA 1UBSA 2WSQA 1Z41A 3GIPA 2E5DA 4C6JA 4E2BA 1YTKA 1UP2A 1R3WA 3R6IA 4KMQA 5BRQA 3W23A 4B5WA 1WBHA 4GQGA 2Y0FA 2D2GA 4MM1A 4BWLC 2Z1BA 4Q8OA 2AKMA 1BFNA 4GUHA 3BJSA 4DELA 1X6NA 5E6ZA 3EWYA 1IXOA 5ECVA 4S3AA 3M6YA 4HT3A 4AVFA 3DOPA 4US5A 4N4PA 4BQ2A 1UOZA 4IXHA 4KFOA 1NP0A 2C7FA 3EOEA 4HSHA 1EUAA 3TTYA 2YDAA 2C16A 1NQKA 4N0RA 4GGHA 4JPGA 4ADTA 2HTMA 3ABRA 4BCEA 4GCAA 5HMSA 2MANA 1H63A 4JQ2A 4IMCA 3NXLA 3LD5A 5E70A 3NGJA 1GOOA 2OKTA 1M7OA 5HINA 3DI0A 1PHWA 2ZZ4A 4JKLA 1WXYA 1ZP4A 3W7CA 3O8AA 3NEHA 3APYA 3K8KA 4PMZA 1IE7C 3W2UA 4LC6A 3DAQA 4R5EA 1ZRQA 2X7WA 1M7JA 3UG8A 3NQ2A 1A4LA 2WB5A 3QKEA 3BSHA 2VZSA 1W1YA 2CPUA 4LQ1A 1Z69A 1E0WA 4LUTB 1FWWA 5EFDA 5BU9A 4GX9A 1OYAA 4PCSA 1WKDA 2FFCA 5FL0A 2KX9A 1PE1A 1L2QA 3H7VA 2P53A 1R9ZA 2VX5A 1RJRA 3VGDA 1V6UA 3GFYA 4HKPA 4F4RA 1UR1A 2ZXQA 1ISVA 3BH4A 3OJGA 4RZ5A 2A3HA 4QM1A 1IEWA 4I7VA 1G7UA 3SZ8A 5AC4A 3QFEA 3SUVA 4ZB0A 3U7BA 3WNNA 3EXTA 3AYSA 1VGAA 1RXOB 1T40A 1GG0A 3OYXA 1QOPA 4UZUA 3ZR4A 3D0CA 1EWDA 3M0ZA 2POTA 3PZUA 3LCXA 2NT0A 4HNNA 2XSBA 1KXVA 5A5WA 4IMAA 4NNAA 3GDBA 4H9XA 1W91A 2XFYA 1KTCA 1OWQA 3HTWA 4JYFA 4AZ7A 3WDHA 1UZHA 1TJRA 4Z2HA 3ZLGA 1S2UA 4DB7A 5DT7A 3H23A 1OY0A 1KC7A 3BICA 4GXWA 2GJPA 1TWWA 3W07A 3VIMA 4AYGA 1JDFA 1FOBA 1EWEA 2JIEA 1E6ZA 2GJNA 3MO4A 3GG7A 3BG9A 4XUGA 4O57A 3GXIA 1DPMA 3Q65A 1ZS2A 2CLEA 1B2YA 2PZ0A 4XBJA 5AB3A 3LHTA 1IV8A 4QSFA 4Z2JA 1I60A 1GOKA 1H7XA 3CZJA 3T09A 4MADA 1GOXA 2R24A 4FIQA 4OV4A 1GQKA 1HJUA 1OM0A 2ZZ1A 2DQWA 4AH7A 1HNYA 4M81A 5K7JA 1AK5A 3WLMA 1JYXA 1R3RA 1XLBA 4DZIA 1Q7ZA 1LWIA 1WAUA 4FNTA 1V51A 5BWAA 2OVLA 4NZ1A 1KGWA 2OODA 2NV1A 1TPH1 3G1YA 4W88A 4NKCA 1I6NA 4F66A 2DSVA 4PA8A 1O4UA 4PMXA 3L4UA 3ZWSA 3L23A 1RVGA 5BMWA 2PTDA 1ALDA 1E15A 5AC8A 1M7XA 1ZAJA 4R33A 1UIPA 3U57A 1M65A 1BAGA 1GEHA 2BY0A 3WDIA 4GXMA 2FZDA 3NQAA 1JF6A 3V5OA 2JF6A 4NILA 1JD7A 2J7FA 5J04A 3ZR6A 3MP3A 3CZEA 1PAMA 4NI8A 2E67A 3IUIA 4FS9A 3SIZA 3LOTA 3RLUA 3VCNA 2WMIB 4ORIA 3AHZA 1W32A 1AMKA 4N2YA 3W1UA 1SJBA 1QW9A 3WQ6A 2XU2A 2AQOA 1TZ7A 1TIWA 4PB5A 1LRQA 3KRUA 3WMBA 1VKFA 4BEUA 4WJXA 3AS3A 3LV6A 2GOKA 3MTWA 2GVYA 2R8WA 4IP5A 1KRCC 3M9YA 2CYGA 1WYIA 3QEZA 2BVWA 3W37A 3VCCA 3GC5A 1R85A 1DJWA 4JTIA 5GJPA 4O4VA 2XTKA 4MUZA 1XRSA 3W76A 1H1NA 4XO7A 1ZNNA 4V2XA 4REQB 5AYXA 1P6BA 3KWXA 2VEIA 3R0KA 4UNKA 5C71A 1UWIA 5EA9A 2GWNA 4FOJA 3VIOA 4PEKA 4NG3A 3LTPA 2Z1WA 1XQLA 4ILSA 4OBSA 4B92A 3IK2A 2DZUA 3MWAA 3OGRA 3UXDA 1KM3A 4JHMA 4PL1A 3DKLA 4NZ5A 8A3HA 2DZBA 4KRTA 3T08A 3E12A 1FWEC 3WL0A 4O1CA 4FEZA 4JL1A 1HO4A 1K7FA 3UZYA 2BXVA 4FNQA 2FDSA 4I3GA 1WOAA 1XBVA 4OUEA 3U2OA 3NZRA 1I2RA 7A3HA 1UR0A 4MY8A 3PBMA 1OD8A 3T78A 3CHFA 3V0TA 4HSOA 3F4WA 2R1PA 4FPSA 3MCMA 3VAVA 5HQLA 4P7QA 5FJTA 4XO6A 1XRFA 3CPRA 3W2KA 1OABA 5TNVA 1HGYA 2WZTA 4URIA 6XIAA 4MPKA 4DX3A 4WSHA 5HUPA 3G77A 4L9ZA 3W82A 2ESCA 4NYUA 1W9VA 3SCOA 2W62A 1FP8A 3AYRA 5FEPA 4FOKA 3W7IA 3M5ZA 1LBLA 3NJ3A 1PWMA 5G4WA 5D2TA 3NGFA 6REQB 3RX4A 2EXOA 3GDRA 1OT1A 4KEVA 2OTDA 3BDKA 3M0LA 2BGSA 4O17A 5AC5A 1HKMA 4J4KA 3RITA 4NJGA 1XLCA 3HQOA 3FSUA 4ZGYA 1D3GA 3AWNA 2HBXA 3QBUA 4HNLA 2O4MA 1N8IA 4XKYA 1GONA 2AMXA 4YWSA 3QQ1A 1UD5A 1DYSA 3KTXA 1S5TA 1RUSA 3PC0A 3XISA 3IJDA 3UPMA 4RDZA 4M19A 3ES8A 4M51A 4NZCA 4LFYA 3ZQ9A 4C6DA 3N4AA 4RPQA 1N7KA 1NF7A 1X38A 3TN5A 4BF7A 3LHYA 3DGRA 2CERA 3CAKA 3TVAA 1KM5A 1TV2A 2RH9A 3AJ7A 3A3XA 2VI0A 1Z32X 1SW7A 4M24A 2YL9A 5BRBA 5CSUA 3QRHA 4PMUA 1FDZA 2V38A 3UZXA 5HOSA 2WC4A 2YR1A 5ABFA 1IXNA 5D4YA 1RJQA 2FJUB 2DUZA 2GVJA 2I14A 3B0YA 1WA3A 3CZ8A 4V15A 5LHFA 4AWEA 4QITA 2I9EA 3VKBA 2RDTA 2YPIA 2FGBA 2XSXA 2XVPA 3B0XA 1W2VA 3AMLA 3B06A 5M17A 2OSWA 1VJZA 2DSUA 3FAWA 3S2CA 2I56A 4HIBA 1PDZA 5C2XA 4MDOA 3A4WA 4S3GA 3AU2A 3ES7A 2XHYA 4L1WA 4Y96A 3KW3A 4QIUA 5LKYA 1SFTA 3WUBA 3VGGA 5RUBA 4FR6A 2HCVA 3H4GA 3I3EA 3OIHA 4JICA 1Q6LA 1SJAA 4A3RA 3K4AA 3SRFA 1EC7A 2CXGA 5REQB 3ANUA 1VR6A 2XUCA 3C86A 4MG4A 5C2CA 2DZPA 1PDYA 3ELFA 3BC9A 5FCZA 3PAOA 1R3YA 1S2WA 4J3TA 4X61A 3IPWA 3GHRA 1HUVA 4ZXLA 3VOJA 3P2VA 2F38A 1KGUA 3LHWA 3CK5A 4F0RA 3W01A 1EP1A 4GIYA 3T42A 4ATDA 2E9LA 2ZE3A 4E2DA 5AHNA 4ZODA 3G1DA 1AL7A 2AQVA 4QROA 1JUKA 2QVNA 4MB3A 2CLIA 3OG2A 5KZMA 1QUMA 1MQQA 2VFFA 1UZDA 3WMCA 1TVLA 5I03A 4MZYA 3D3AA 1B3VA 4XZHA 1L6YA 3G1XA 4HCLA 4HOWA 5D2VA 3LGDA 4UTUA 4RE2A 3NQ8A 1VH7A 1P48A 2C3ZA 3R1ZA 1HJWA 3LTSA 5E93A 1PIGA 1QNVA 2CBIA 1SO4A 1XICA 3K4DA 4M6VA 4XD5A 4JNMA 2WBKA 2OZ0A 2J62A 4IQLA 4XAPA 4ZQPA 1ISXA 3H7UA 1T6MA 1MXGA 1CW2A 2V69A 1YX1A 1TSIA 1PV8A 5BRPA 4M6UA 1LT7A 2CESA 4MJ2A 3SCWA 3W73A 1DQWA 2VWSA 2ZX6A 4AY7A 3G0UA 3T1GA 1T0OA 2XN2A 4W84A 1D2KA 4MSSA 4MZ1A 4UTKA 3GTIA 2ZUTA 4E8CA 3REQB 3MI3A 1EF2A 1LJYA 4GXPA 4IQDA 4XZMX 2NQ9A 3DENA 3E3HA 1KM4A 5E6YA 4EKJA 3V3WA 1IEXA 1MXSA 2YGYA 1SO3A 4AIUA 2BXZA 1G5AA 4DHGA 4ZFMA 4IM4A 3CL6A 3EX1A 2WO5A 1NDWA 2QUMA 1J6OA 3QY7A 1K1DA 2DW6A 1YTDA 2HMCA 5AYBA 3MANA 1JRCA 3ECQA 3LLFA 2E25A 2D3LA 4PMRA 3E96A 3R79A 2BVYA 4ZO9A 2ZRXA 2A6NA 5AKQA 3ARSA 3JVAA 3GXPA 1UB3A 3G8EA 5KZDA 3BSMA 2NSOA 4DJDC 2ZA1A 2ZUVA 3MJYA 1E4MM 4R53A 4U4MA 1C9WA 1FKXA 3PTDA 1EP3A 4QXIA 3ORWA 3LYEA 3V1HA 3VIGA 4QBXA 1E6PA 4QCEA 1Z48A 3ABZA 3GX9A 3FJ4A 4D9PA 1GVQA 1JNDA 5K2ZA 1DIEA 1DVJA 3TFCA 1EFZA 5TIMA 4G2DA 3BWWA 1EDGA 4TMBA 2ZDRA 2SFPA 1NJJA 4M82A 4BQ3A 2Z00A 1VYRA 2ZRVA 1EHNA 1E3XA 4PUUA 1ITUA 1Y5VA 2OSYA 3ARUA 2ZUMA 1Z3NA 1TTJA 2WVUA 3IGXA 1HFBA 3KBWA 1K4GA 5I78A 2F6UA 1UA3A 3VDCA 1W3TA 3EKLA 3W9ZA 3I3DA 3UGVA 3N2TA 1SUXA 2I9UA 1Q6GA 1KV8A 5XIMA 1H60A 4NASA 2XGBA 2QPXA 5HBFA 3PUEA 2BX7A 3E0IA 4QG9A 4HSNA 1AODA 1XLFA 4GACA 1DORA 2Z1VA 4PRWA 2NUWA 3WLPA 3KCOA 1TTPA 1AUSL 4JY8A 1FWNA 3TEVA 3SN0A 5B80A 5AHFA 3WLNA 1XDJA 2XVGA 4JTTA 3WNKA 4ES4A 2F6KA 2V5DA 3TC7A 4WY0A 5CPNA 1WBJA 2IQDA 2PC4A 2UY5A 1LL6A 2WMJA 2B31A 2JK2A 2UY4A 5CJNA 3NL3A 4WF7A 1RBAA 2PDYA 1XWYA 3QJAA 4OBTA 3NQ7A 2DSKA 3NSNA 3HPFA 3WK1A 4PULA 4C6PA 4S2CA 2J74A 5FJIA 2OMAA 2AGTA 1FXQA 5D02A 2Y5EA 4LWWA 3KHDA 4MWAA 1AH3A 4P61A 1QJWA 4ZOCA 2ZUWA 2HEJA 4KEMA 5D8ZA 1V5XA 1DV7A 5HPCA 4HA3A 4O8AA 3R13A 3DDMA 4GYFA 4NRRA 3ZOAA 2CITA 2J79A 2NQJA 3L2MA 1EIXA 1FCUA 2A7PA 1Q2SA 2WNQA 4LVFA 3ATYA 3C61A 3QZAA 2C18A 2RAGA 4AB4A 3EZ4A 4O15A 3KDOA 3TW6A 1XJBA 2PWFA 2DIJA 2NQZA 5J5DA 3T40A 4JR5A 6PTDA 1F6YA 3N2CA 2WZHA 4W4QA 1CECA 2FVKA 4N6FA 3BZJA 1TE6A 9XIAA 4LUSA 2YCIX 3EX4A 3S2MA 1I2QA 2BDQA 3LG3A 4UFLA 2ZRYA 2GFTA 1OGGA 3S1WA 2QCCA 3GVQA 4L7ZA 3GAKA 3I6TA 3MVIA 3AMDA 2CLPA 4H2HA 3MDWA 3BUVA 4W7WA 4HOZA 3MB9A 4FI4A 1W5PA 1T7LA 3GDMA 4YLWA 4JDBA 4JTUA 4J7RA 5KZ6A 1GZJA 1ECEA 3GFXA 4LF2A 1NTHA 3AZTA 3P0WA 2YBTA 2WC7A 1KCZA 2PWVA 1IIHA 1OZMA 1XISA 1R86A 3LPOA 3IJ7A 4FA3A 1PKLA 3EWZA 4GVGA 2P50A 4KETA 1QOQA 1PKMA 2CW6A 3FS2A 3TLQA 4CCEA 4AF0A 5FSDC 2ATSA 3FEQA 4CNTA 4UTWC 2E09A 2WNNA 1ITXA 3EOLA 1HIZA 1X8FA 3EWWA 1ADSA 2RUSA 3S3GA 5D05A 1R3VA 2ZWZA 1BRLB 3TYEA 2WSKA 5EYWA 4LF1A 1QNOA 3O9NA 3OZYA 4XWUA 4PRTA 3ANYA 3WBXA 1RCOB 3K13A 3ARXA 3JZUA 4B91A 1HX0A 3BV7A 1G4EA 2FVLA 5L6UA 3AHVA 4J3VA 3KS6A 2FB3A 4GYPC 3QY8A 4KCVA 1JXKA 3WLTA 3PZ9A 1E1CA 3BAKA 3EEZA 4WUIA 3M0YA 5E0CA 3M43A 4E4PA 6ENLA 2R1KA 7ENLA 3ZJKA 1YTEA 3CNYA 3I6EA 3MV11 2C1GA 4JTDA 4ZOBA 3LEPA 2NQLA 6ALDA 2PD9A 4H8UA 3AYVA 5DO8A 2R91A 1SR9A 1G4PA 5C7VA 1OSEA 3DG7A 4F9DA 6XIMA 1H7RA 2NVDA 1KW1A 1RHCA 3GXNA 3MC5A 1N2VA 4GY7A 3STFA 4DBDA 2VCBA 4GH3A 3ZLFA 7PTDA 2A79A 1VFFA 3MJMA 2HVMA 1Z6KA 4PBFA 2ZUNA 2CXEA 3PZMA 2QPSA 3FY1A 4UNLA 3VGFA 4LXFA 3LY0A 1R87A 3QR3A 1ZGDA 3DU0A 1EGVA 1JPDX 1POJA 1UWRA 3NDZA 1GQNA 4XD6A 3V1PA 2YB4A 4RPPA 4MOZA 5I23A 2YCKX 5E9AA 3FAXA 2ONEA 3I6RA 2VOTA 2BSLA 1FDJA 1KRBC 4Y7EA 3VZXA 1U1JA 2QDHA 2ZTJA 3WLJA 3CIVA 5H2ZA 2PGFA 1VBJA 3AIWA 1PEZA 3ARVA 1MXDA 1BKSA 4J3UA 2D0GA 1K77A 1MYRA 4QRNA 1X1OA 3VZYA 3OVQA 1CXFA 2GYIA 1EBGA 3WLHA 3IJ8A 2OPJA 4JN6A 6A3HA 2GLKA 4DYKA 1FX6A 1Q5MA 4NHVA 1VPQA 3UZJA 4OHQA 3CTLA 1EJ7L 3A4XA 4G56A 3A3HA 1K70A 4UTFA 4CCCA 3B40A 1JCXA 3CQ0A 1AJ2A 3LENA 4BKNA 4X60A 4IL2A 4MTVA 4C1KA 5DX7A 3B9DA 3CHCA 1JJKA 3BAJA 1B31A 5TBOA 2X41A 3E0WA 1Q6CA 3DC0A 2PA6A 1D7FA 1Y65A 2A5HA 4DAIA 1CIUA 4Y9PA 1TWZA 2TYSA 1PYFA 4B5VA 2QJNA 5CLTA 5I7GA 4EXBA 5ABTA 1S1RA 3GTXA 3I7RA 5FACA 4MWAE 2VQTA 5EMJA 1H0GA 3TYUA 1DJXA 1KWGA 3ZSTA 3NR0A 3K30A 1DKWA 4C5ZA 4CQBA 1ZFJA 1JXJA 3IEBA 4Y90A 4H04A 1MW1A 4GHRA 1R7AA 1NOFA 1UP3A 4DF1A 1J10A 2E5BA 1I1WA 1O7AA 3IIVA 2VDIA 2ZICA 4KWUA 3MMDA 2JBMA 3D5HA 3IVUA 2P88A 1ZAIA 3EX3A 4HNCA 3QC0A 1C9DA 4JTAA 3GTNA 2BNJA 1Q3NA 3FK4A 3RO6A 3IGHX 1OGBA 2YA1A 4IIHA 1BLIA 2XH0A 4OE7A 3PZTA 3P8IA 4EVZA 1C7TA 4QE4A 1GOQA 3M6DA 1XGZA 4YCPA 3P14A 1SQ7A 3TH6A 5A6LA 1HTIA 3C8NA 3W26A 4WSKA 1TRIA 2QQ6A 3ITXA 3VK5A 1YPIA 2GQ3A 1UP0A 2VUNA 2WCAA 3CUIA 4NX5A 1P0NA 3LM3A 1OCQA 3VC5A 4GA8A 1BYAA 3BGAA 3V7PA 3QYSA 3BQ5A 5A6AA 1UR3M 4TQTA 1EP2A 4GFIA 2GOUA 1J11A 3B9OA 5AOUA 1H7OA 3LZ5A 3RFAA 1FH9A 1QT1A 1QVBA 3UYCA 3M44A 2VC5A 3W22A 1QPOA 2J6VA 4ICCX 1E6RA 2AL2B 4M8UA 2GJXB 5BOFA 4I9JA 1DWJM 2GK1B 2WM0A 4PCTA 1GPFA 3NYZA 2A4AA 3A5FA 1WB0A 3B8SA 4U31A 4HMDA 4S3EA 5EY5A 3KRBA 3ZFHA 4A2SA 1CGTA 3HPSA 1IT0A 1KBLA 4JTSA 1YBQA 4HHHA 9RUBA 3OZPA 3NQMA 1H5YA 4QNEA 2ZX5A 3PUGA 4LUJA 3WK3A 1GJPA 1M41A 4KWOA 3EKZA 1IXQA 3TAKA 5E09A 1AQ0A 1ZBVA 9XIMA 2B81A 4O50A 3N18A 4H9ZA 5A8QA 4UQEA 4CU8A 3AISA 4PODA 1H3GA 3QVQA 2W3ZA 3UWWA 4HHPA 3WBAA 3RXZA 2QJIA 2IPWA 5DT5A 4KBXA 3STCA 5EL1A 4FAMA 1R2RA 5T9BG 8XIAA 2BBFA 3HB9A 2DH2A 3NM3A 4HNTA 1YW1A 1QDSA 1IXPA 3QR0A 3G1FA 4CD6A 4DJDD 4MLRA 1W56A 4OECA 1TWIA 3B4UA 2WJZA 3LRMA 1TE1A 2ZZ6A 3MA8A 4J40A 1TX0A 1F8IA 2QDGA 3BAWA 4ONVA 2B0MA 5FOOA 3W85A 3D46A 3USBA 5JBFA 2QV5A 2ZXBA 4R7OA 1ZTVA 2ALDA 3EMCA 1DHKA 1JPIA 5AY7A 2C15A 1P1XA 1VQTA 2QJJA 2ZZ3A 2UWFA 2QW5A 1S5WA 2CNCA 1FA2A 2Z25A 3FHQA 2DUXA 4Z08A 4B5SA 1E4NA 4D1JA 1KFBA 4GQRA 3V4BA 2ABBA 4ML4A 4AWUA 4DO7A 5DRCA 1QW7A 3PUOA 3W02A 5EMUA 4RXGA 3IAPA 4L6HA 1MEWA 1VD6A 2IKGA 2OLAA 5HJLA 2I17A 1JCNA 4LV4A 1UMYA 1CB2A 4JX5A 1SZEA 3MW7A 3K1GA 4O53A 4B5XA 4QE1A 3C2RA 3I3BA 3MUZ1 5G5IA 2GGIA 4IOTA 4J2MA 4JD4A 4R9XA 3DHUA 2Y62A 2VDHA 2Z2AA 2Z2UA 5EGRA 5CGQA 1SPQA 4F0MA 1JPKA 1XCXA 2CLHA 2NQ5A 3FKKA 1JDDA 1TWDA 2E28A 2WLZA 2IKJA 4F2BA 1B30A 1VZWA 4TVCA 3SRDA 3PBYA 1A4MA 1BGAA 1EA9C 1REQB 1XIJA 1VFLA 3VNLA 3MT1A 4H4IA 1J5TA 3CB3A 2GZXA 2OZ8A 3P82A 3NZGA 4GUIA 1NU5A 1PTDA 4DZHA 3NUKA 4TTUA 5C6MA 3EPOA 5C9UA 4X0NA 4YTSA 4NNBA 4DM2A 1NQ6A 1EX1A 3FEMA 1VF8A 2PWHA 3H7RA 4UIOA 3T2QA 5C9WA 5AECA 4JXCA 1F05A 4PMQA 2D24A 4C90A 2G41A 1J0HA 3NQEA 4J3XA 3ZVHB 4NIRA 5JIWA 3N4FA 3HF3A 3WLQA 2X0YA 4LBSA 4NF7A 2X40A 2PGRA 5HDRA 4HZ8A 1IGSA 1HP5A 1W5QA 2QXWA 3DFQA 3N15A 3ZS4A 2DZSA 3WBWA 1XF0A 3TTQA 4ECLA 4NZ3A 1XQKA 2PE4A 4UTJA 4A8IA 4KRZA 3CPGA 1TV4A 4PTXA 3TMQA 1B90A 1NELA 4TOQA 4C6MA 1OFPA 3SCVA 2OEMA 2NX9A 1O5RA 1GKPA 2XH4A 4PRRA 3M07A 2YFNA 2YA0A 3PFRA 1RK6A 1WNOA 1FTXA 1UBPC 3UCQA 4QR6A 4UB9A 1GHSA 2HNHA 1TV7A 5TD4A 2QMJA 3HV8A 3CWNA 4X63A 3E6EA 1TG7A 3WN6A 2EO7A 4P7OA 1ISWA 2Q09A 1W0MA 4EE9A 1I0DA 4XUYA 2D0HA 4TX9A 1OC6A 3WQPA 1TTQA 1RLCL 3QKZA 1HXJA 4HPXA 3WLSA 1FWRA 3STEA 4K7YA 2WHMA 1FH7A 1YNYA 3DFTA 3SY8A 2WJEA 4C6KA 1OZQA 5C9RA 5JVLA 3IIZA 2J8GA 5FF4A 3G6MA 1S2TA 5EB8A 1XIBA 2IQ0A 4S38A 1KXQA 4IIEA 1X98A 1KR1A 2FDMA 4PUMA 4QLKA 1UC4A 4GYKA 4C7GA 3RJXA 2G3FA 1I4NA 4A8LA 4Q4RA 4XD4A 5F4SA 4NY2A 3TYZA 2Y8UA 1QR7A 4BWLA 3QV9A 3WH7A 3THCA 5M03A 4IMGA 3QY6A 2YW4A 4QS6A 1FWTA 4B5NA 5EBAA 1BGGA 1PCWA 1XLKA 1OF6A 1JCYA 3QPYA 4BQ4A 2X8RA 3F5LA 2CKRA 3DG6A 3L5MA 4KT2A 2XDFA 5EMYA 2PDBA 4US6A 4Z1BA 1QPQA 4AYSA 3ABXA 1OFDA 4DO6A 4XTIA 1JCMP 2XIIA 3TZNA 1MQPA 3FV9A 2G4JA 3URAA 3P5ZA 5T26A 2E1DA 2VMFA 3EDFA 4IQJA 4UFIA 2POZA 3KS5A 3W70A 3CMGA 4FNPA 4DBSA 3H70A 3M0XA 1W8GA 1HG3A 3K5XA 4L80A 4Q8NA 4IMDA 4JL2A 4WGXA 3PPCA 2ZX8A 3H12A 1L0PA 1YRRA 3CIXA 3MMWA 3P0XA 3TV8A 4EAYA 2V68A 2OO6A 1L2UA 5HAOA 3GSMA 1OHLA 4WXZA 4A4AA 4K8HA 2GSEA 1SFLA 4LJ3A 2A3BA 3L2IA 1S3TC 1G9HA 2V3DA 3OZMA 3QH2A 2FZMA 4LAKA 4MF4A 2DGAA 3AIQA 3ZJ6A 3BAIA 1A5AA 4K2SA 3HA1A 4A6GA 2L5HA 4AD2A 2BG5A 3KUMA 5HWNA 3EKGA 5KSWA 3QTGA 4C6BA 1W54A 1QPNA 4AU0A 3WNMA 2TODA 2VCAA 1UWQA 3GG8A 1FDYA 3LS9A 3DZ1A 4LUTA 3SCSA 2IMRA 3TYDA 3POHA 4DZ5A 3VD3A 3QHMA 5HNUA 3ARWA 3BK0A 4HZ7A 2VGBA 3U4FA 2ADAA 3GBEA 1RVKA 3A24A 2ZX9A 9CGTA 5CBBA 3BMWA 1O5XA 3TR2A 4JQ3A 1TZZA 2Y7FA 4WKAA 4D6EA 1W1B1 3TNBA 3I7QA 4U3AA 4NU7A 4XVEA 2YL5A 4WY0F 5A6SA 1JUBA 1P1MA 4WHBA 3R58A 2OWCA 2WV8A 4UZSA 1U2YA 3UY8A 2ZQ0A 4ZR8A 5C2GA 3NSMA 1O1HA 2TAAA 2VP8A 3B4YA 1CGXA 4YNGA 1F6KA 1UH2A 3NZ1A 4E0CA 1KCLA 1D3CA 3VMPA 3OLEA 2X7VA 3GXDA 2QLYA 1QO5A 5IFTA 4GWEA 4YVXA 3QHNA 1T41A 5MF5A 1H7NA 2WZIA 1G69A 2I5IA 4ML9A 2O92A 2DT3A 4PUNA 1UD4A 3ZZ1A 1WDQA 3OEXA 4MPQA 1AW5A 3UPBA 3T81A 1RQHA 1NVMA 1ITCA 1FWHC 1VBRA 2NX1A 3BOFA 3M0KA 1SW0A 3STGA 4I5RA 3B9AA 2PDGA 2YB1A 3BLIA 4D8ZA 1BWKA 2D73A 1DBTA 3TKFA 3C2YA 4LC8A 2IPJA 1EA0A 1TJ2A 2WZMA 2B4GA 3O7UA 4Q4OA 4YL2A 4QDPA 1A53A 1N55A 3DESA 5A8PA 3FXYA 5AN7A 3QGVA 2DORA 3CMJA 3K8MA 4YXGA 3HURA 2OT1A 3P61A 4C7DA 4Z42C 3W7MA 3GYCA 5CAHA 4XVDA 4AW7A 3RM4A 1G4SA 4HMCA 1KR0A 4GUGA 4UMAA 3EWDA 2AKZA 1Q8AA 3PHAA 2DFAA 2X0HA 1OD0A 3QM3A 4Q8QA 1A0DA 2LLEA 1NARA 3W84A 4ZOAA 2CIPA 2QNEA 3MHUA 2VEPA 2NXIA 3RMEA 3EOUA 3KP1A 5KMYA 3PF3A 4G7EB 4AG0A 1XIMA 1KRAC 4RZBA 1XYZA 2C1HA 1ME8A 1XFCA 4D6HA 3IIPA 3BOLA 4EANA 2VEFA 3P80A 3EA3A 3S2NA 1PVNA 4LRSA 4O52A 1EQCA 4DF2A 4QX4A 4DBUA 3UQNA 5D9PA 1G01A 3UCDA 3Q58A 2QR6A 2WMIA 5CJ5A 1EKOA 1H2JA 2E5CA 2J25A 3HGJA 3KZPA 5HANA 1DWIM 3LM7A 5ABHA 3TCEA 3WDJA 1UZ1A 1V0MA 4L64A 3KDNA 3Q2DA 2EPNA 2VC6A 2EHHA 5JMUA 2X1RA 5CLWA 1JR1A 3AQUA 3OGSA 2VNCA 3OBKA 1AQHA 3OBAA 4ZENA 4Q8PA 1LQ0A 1MFVA 3WUGA 3WLKX 3I4EA 4IP7A 3MDUA 1ZBCA 2ISSA 2IXUA 2DZTA 1SMDA 3AMCA 2ACSA 2GDQA 4A2RA 4GY1A 3WKZA 3RR4A 4BI7A 2PLJA 1TPFA 3P6LA 3AMKA 2V67A 2OJPA 1HL9A 4REQA 1DHPA 5CPMA 4ENLA 1FWFC 2C1IA 4L4OA 5A6MA 1LCOA 1LTDA 3ABQA 4PCPA 3UR5A 2QCEA 4YTTA 1FXPA 3S1GA 2OU4A 5DFAA 1JYNA 3NQCA 3TN4A 3WLLA 1PZ0A 3P74A 4NL1A 5B7ZA 3PUDA 7REQB 3H2FA 3MSDA 3LXCA 3PVFA 3BLKA 4L4PA 2VRKA 3SEPA 5I07A 1KFCA 3F4DA 3V35A 4XB3A 4LV9A 4ZQMA 4JEJA 1H41A 3IVTA 4ADSA 1T96A 2I5GA 3ISIX 1TCMA 1B9ZA 4O18A 1G67A 3QN3A 1UWSA 3KHJA 1BYBA 2CLMA 4AD5A 2DEPA 1UYQA 3H54A 5AZ0A 3BARA 3BO9A 4GZ7A 2JKEA 2YJQA 5FF3A 4R27A 2PWDA 3UJSA 3T4WA 1I2OA 3D47A 4DO5A 1POKA 3GZ3A 3ATZA 1VBUA 1ME9A 3QF0A 4M1BA 4MB1A 3IJ9A 3WLRA 3PBUA 4W93A 4PBEA 1MWOA 3BV4A 3NVTA 3R8HA 3AIUA 3ZT7A 4XTDA 1OK4A 3E2RA 1CB7B 6REQA 3E0LA 1QWKA 2J88A 4NNCA 3MHFA 3EGJA 3M0MA 4JS3A 4V27A 2EPHA 3ITVA 1F9CA 1JDCA 1UCWA 1TMHA 1BD0A 4MVAA 3WLIA 5BWFA 4RLIA 3WUFA 1MZHA 3H4WA 2C13A 3O6YX 4DNMA 4A21A 4GO9A 1WO2A 4KF1A 3BQ6A 1T8XA 4MYXA 4DUVA 2J13A 3LPPA 1CYGA 2GUBA 5MKGB 2VJXA 1THFD 4DPQA 3VM5A 3RM8A 2HVOA 3W2NA 4IGNA 2X30A 2V2DA 2FH8A 4NAFB 3SFKA 2CBUA 4EIVA 5D30A 4ATLA 1UQYA 2FMOA 5GNZA 5JUVA 3MCNA 1ODUA 4I9TA 1UHVA 3RO8A 3R8GA 2XIBA 1I9CB 3S1VA 1A5BA 2G37A 1XPGA 2PDPA 1SZNA 4ZMGA 5JQ9A 3NEVA 2XIJA 2J9YA 1BSLA 3QMTA 3VDBA 3W1TA 4MFDA 4EXQA 4F40A 1MDLA 3U8GA 4ZO7A 2VOMA 1YYAA 3R43A 3JW7A 4MDPA 4U2YA 1MW3A 4GI8A 4O10A 4HNUA 4OVXA 1HL8A 4INFA 4D6IA 3GIQA 1IWBA 1KXTA 3B9NA 2WHJA 4ZB5A 1Q85A 2H3DA 2PC8A 2YKKA 4GJJA 3IK4A 3WF3A 4C6OA 2XWEA 1V7AA 4MYAA 1R9YA 4DAFA 1A5UA 3ZWTA 5LNUA 4L4MA 5REQA 4E2VA 1JUEA 4I7UA 2KAUC 1W9XA 3SCQA 1ML1A 2Z26A 4KWWA 1VLWA 1MNSA 1EJUC 2WC3A 2FGLA 2W92A 4DNHA 1CCWB 1NM9A 5U4NA 5F4WA 4X2PA 1TQXA 4QTGA 1I8JA 1QFEA 3GK0A 4POCA 4TV6A 4PGLA 4GRSA 4PB4A 4IP4A 5HMFA 1LL7A 3QQWA 2BP1A 2YCEA 4JIIX 1OYBA 4GIAA 4N9BA 4DXVA 1EHAA 1KWKA 2BWGA 4KEZA 3LSBA 4NXSA 1R3SA 2FJKA 2YXOA 3N19B 4S39A 2Z1SA 3B8DA 1P5BA 2EBNA 2FGZA 1GYNA 3SRHA 4FXJA 3HG4A 2EG8A 1MEHA 2GSHA 2WMGA 5IDZA 3CO8A 3SBFA 2PF8A 3PANA 1ELSA 5A2AA 4IUOA 3RLHA 1YLVA 4A3HA 4KGJA 3KVLA 3H4XA 1F6PA 1J0KA 4CQDA 3A4JA 1QW8A 1UA7A 2XWDA 4H6KA 5LIWX 4MNLA 4O0KA 2R1LA 3L4VA 1TA3B 3NA8A 4JQ1A 1IZCA 2XFRA 1YXDA 4XSLA 5A2CA 2XIOA 3UGRA 3T0TA 2FMNA 3Q37A 3CQJA 1E51A 3TSMA 3W7DA 1EQPA 1GEQA 1FY6A 5ABEA 4QAWA 1K7XA 4IH3A 3NQVA 3B03A 3GNNA 3SSJA 1IIGA 1LQ2A 4GD0A 4KWVA 4CNOA 2BOEX 2DJLA 3F03K 4AC1X 1RQBA 2VR5A 1S5MA 2Z24A 4CU7A 1W9DM 1C8XA 4IT1A 5FI8A 3UWYA 5AYZA 2Y89A 3DI1A 4MNKA 1GTEA 1Q7MA 2YCLB 1CWYA 1XDLA 1J2BA 2GVEA 3KE0A 2XSAA 3TXZA 3UF9A 2DDXA 3ZXWA 4EWND 1FHVA 4Y6GA 4W85A 5I0DA 4AZCB 5DY3A 4GE8A 1V0LA 1P0EA 3NO3A 3REQA 1M1BA 4UMBA 3TW7A 1W5MA 3OODA 1ZJIA 4M0XA 1NWRA 3R5EA 1PIFA 4DJDA 3MI2A 4RNJA 3R94A 3F1QA 3ALGA 3WYZA 2VYOA 3MSRA 4S23A 4XISA 1CNVA 4RV8A 1D9EA 5LA2A 1BPLB 4CN6A 3NFUA 5A2BA 4DUOA 4DUXA 2PRMA 3THDA 3ZT6A 1JCJA 4D2JA 3ZVIA 3CO4A 5CC7A 1O6IA 1EPVA 4JTKA 5I79A 5LGZA 4GZIA 4ZSUA 1L8NA 3F4NA 3O6CA 4DBEA 4GQ0A 1UOKA 1A5MC 4Z1CA 4PMDA 5CJMA 3W2MA 1RR2A 4HK6A 3SR7A 4Z0JA 3WQVA 2DP3A 1EOKA 1E1FA 1CTNA 1QI0A 2PEVA 4E8DA 2H9AB 1DXEA 4JFSA 1AD4A 4PR4A 1XYLA 1A80A 2OFJA 3LCFA 3THAA 1OX4B 2CLLA 3DGBA 1ONXA 1UD8A 3UXIA 4CVUA 3NOYA 1GVYA 1E73M 4MAVA 4Z1YA 4I6VA 1H7WA 2FZBA 2JALA 1RPKA 3NL2A 3VOIA 4A05A 1P6CA 5KZEA 1ADDA 1X6LA 3AS0A 3TOYA 3W24A 3DECA 5HNNA 3DERA 3GD6A 3MP4A 3O0KA 1U1HA 3ZJ8A 4J3WA 1TV5A 2V2CA 5I3IA 2Y6ZA 3AXHA 3SFWA 5CBJA 1IWPA 1EBHA 3DFPA 3ZR5A 2O9RA 4QLLA 5LYRA 1ZALA 4UNIA 4UOJA 2VVSA 2OQYA 3THQA 5IRPA 1GVSA 4JFTA 1EXPA 1O94A 3S5ZA 5ABGA 2PLCA 3IIOA 4ATWA 3ID7A 3ZMRA 5I6SA 3KOFA 3LRLA 2BMBA 2QS8A 3Q67A 3GYEA 5I02A 3HO8A 3FYPA 4BQ5A 3M7SA 1YKWA 4RNHA 1Q8JA 4ZB2A 1GCYA 1K8CA 2IXVA 1V02A 3WZ0E 1XP3A 4QG8A 4LS2A 3SI9A 2CBJA 3O15A 2D2HA 2IPFA 3IJIA 3TW9A 4ZBCA 5CSSA 2E4TA 4GVIA 2CEQA 4O1AA 5DBTA 1IYXA 1OG0A 2F8QA 2E1WA 1GJWA 4FNRA 5DY2A 1O68A 3SECA 3CM4A 1FCBA 1EPXA 3IJLA 1J6PA 1JI1A 2ISDA 3BW2A 3CV7A 1DL3A 1XLMA 1RCQA 4Q3MA 2VD9A 3EA1A 3ARZA 3TYBA 4DXKA 1KM2A 2X05A 1MW2A 3EDDA 3NXFA 4RXFA 4G6CA 1TPVA 2YBUA 3HZ3A 4ZTXA 4JFVA 1KA9F 4D72A 2ANUA 3QZ6A 3NZPA 4LW7A 1TV3A 1HF6A 1UUMA 4UWMA 4AFYA 4QJ3B 3CASA 4CNPA 3GHUA 3BL3A 3EB4A 2PUZA 2QYGA 2VFHA 2Y2WA 3H2MA 3NL5A 2YIHA 4Q4KA 1U83A 3EOSA 4W86A 1VJSA 3HMCA 3WQWA 5K9DA 4JEQA 5KTLA 3KWSA 1G7VA 3DBPA 3GR4A 1YE6A 1K9FA 1UC5A 4CEUC 3GNPA 4OU1A 1Z7AA 1C8VA 1TO3A 1UROA 2W66A 3MBDA 3MKKA 1R38A 2FFIA 1NAL1 2QPUA 3AOFA 3VX0A 2Q8ZA 4P8VA 4UTWA 2YYUA 2VX6A 4WD0A 4J2PA 3IJQA 3K8LA 4B3LA 1AH0A 1LM1A 4G1KA 5A8GA 1XRTA 3EDKA 2ZZ5A 1O12A 3GNOA 3O63A 3UCCA 2KZHA 4A3YA 4J5NA 3DN5A 1ZAHA 4GZJA 3SAZA 3CHEA 2G8ZA 1OFQA 3QXBA 3NCOA 4DRSA 5D38A 5ECUA 3R25A 1JNEA 1PUDA 3KBMA 3OVPA 3FJ6A 1A3HA 5A94A 3DEQA 1CX9A 4WZHA 1N8FA 4LB3A 4GYPA 1L6SA 3WD2A 1HT6A 4QJ4B 1CPUA 3K2GA 1VP5A 2A3EA 2XIQA 2ZA2A 3BLPX 4HN4A 2A0NA 1A50A 2HPMA 1OF8A 2ATMA 3IGUA 1YMYA 2ZZ7A 1B5TA 1BRLA 6TIMA 2FTPA 4LCSA 3S5SA 3W86A 1HKVA 4PUJA 1W6TA 3PN8A 5FSEC 4HU3A 2FZNA 1XM3A 4RDWA 3RJYA 4H7CA 4FR1A 4EAMA 4W9TA 1V3IA 5L9FA 4R3UA 3V18A 3T2PA 3SCNA 2QUVA 4N02A 4CN4A 2ASHA 3TYCA 3GNRA 1H62A 5BROA 4PUEA 3B04A 2IKHA 1JCLA 1B3XA 5FJRA 2HNEA 1TKKA 3I10A 3W7PA 4Q4SA 5GPRA 4ASTA 1XBZA 2ZOXA 4GFSA 1BXBA 4FP1A 4BF5A 3HOJA 3TE9A 3A9IA 2PDMA 1FHDA 4V33A 1H7PA 4J27A 4N7QA 1K3UA 3LLXA 3W7EA 2VVNA 3UJ2A 1PKYA 1PXGA 3MUIA 1VPYA 1J0JA 2XISA 1HL2A 3EA2A 4AY1A 4XZIA 3SURA 3GUGA 1CLKA 4CN1A 1J5SA 3RMJA 1I2PA 3WQCA 3AALA 2IPGA 4HPHA 4IX0A 3OLIA 2F2HA 4LRTA 4JTFA 1U33A 3S46A 1EC9A 2QF8A 2XGZA 1VYPX 3SADA 4ZXOA 3B3DA 4JCLA 3E9AA 1K4HA 4GI9A 5HR6A 4F8XA 4JIEA 3UZZA 4YWIA 4RE0A 2ZTKA 1HKIA 1KFJA 3HFYA 4B9YA 4KH2A 4ERGA 1H49A 1ZJHA 3N2OA 4BI6A 3NIYA 2ICSA 4TVDA 1US2A 3KVJA 1OX5A 3L5AA 1PIIA 2CLOA 2E3ZA 4WDWA 2PRHA 4JN8A 1KKOA 4RK8A 1A5CA 2BY2A 3GU1A 2BB0A 3N11A 4H3DA 1DJQA 3DC8A 3P60A 2WCGA 2BFGA 2Z27A 4R7WA 1VRXA 3PJTA 4OZOA 1MSSA 4JYEA 3C0LA 1S5VA 2C71A 1EB3A 3CJPA 4I90A 4H9TA 1F07A 2J77A 4HQVA 4AAJA 1S46A 4K6AA 3BURA 4XAZA 3ZO9A 2NXHA 1PHQA 2VFGA 4YVVA 3BW3A 1V02E 1WDDA 2VZUA 4HK5A 4F0HA 1E6QM 2QCDB 1S5NA 4HU4A 2E6AA 4ZVJA 1WDWA 5A6BD 2VT0A 4O16A 3SQMA 2YXXA 5H6HA 3UJRA 3VIIA 2V2HA 5H8MA 3VNJA 3T9PA 4AD3A 1E5NA 1KXHA 2Q3RA 3UVAA 1KTBA 4LS1A 5CZJA 2PF0A 4X3ZA 1Q13A 3PB2A 4AQLA 4W5UA 3T2OA 3WFAA 4HCHA 4UQCA 1XD0A 1AJ0A 1Y5XA 3JRKA 4RUBA 1WV2A 1F7BA 1F3WA 4QDMA 7TAAA 3N2MA 1G1YA 4NQ1A 3GDTA 1W1A1 4IFKB 4HGXA 3L0NA 2FTWA 1ZENA 1K8YA 3EX6A 5C9ZA 4S3FA 1QBBA 3URBA 3W1PA 2EGZA 2GWGA 4OOZA 2Y8KA 3GU2A 3KBJA 3B8TA 2Y70A 1UR2A 4EP8C 5DQPA 2V5LA 2X2YA 4LEFA 2R14A 1A5KC 3AC0A 2YL6A 3E1F1 3L66A 5EFFA 3TSBA 2TRSA 2RHGA 2HBVA 4WVXA 3VIFA 4U5IA 4D71A 4GLEA 4JNZA 4KGLA 2WJDA 4KESA 5HMDA 4IIDA 1UH4A 3OHMB 2J7GA 4IGHA 4Q7NA 5FL1A 1EYEA 3L4ZA 2FPTA 3FJNA 4XKMA 4DBWA 3N3TA 1XKYA 1ITQA 1AQFA 1UWUA 4MLJA 2JKAA 1M6JA 4FXFA 3H24A 4M6QA 1XG4A 4RNFA 5AHLA 2W91A 4CGTA 4QQUA 1KTNA 1FWAC 4BY3A 4B9ZA 2HV5A 4DO4A 2DH3A 1FRBA 4UTLA 3ABOA 3P93A 4Q33A 4LNCA 2VX7A 3PM6A 2BY1A 1B0IA 1MNZA 2E7FA 3C4UA 1GQIA 4PMYA 3VA8A 4JZ5A 3AS2A 1AJZA 4JBRA 1W3JA 2HVNA 3FKRA 5CSYA 4JIPA 4XZBA 1RH9A 4JAWA 1V6TA 1XCWA 2QMKA 1K8ZA 3WH5A 2GJXA 5C5YA 5DCEA 2YLLA 2VO5A 4LAMA 2GK1A 3EYPA 3R0DA 2CZ5A 2ZXDA 5G4EA 3QW4B 3T44A 1E55A 4LUIA 3CIWA 1BHGA 3H8AA 4CNNA 3P84A 5FKYA 1Z9AA 2XN0A 1LLZA 1SZFA 5HQMA 2W61A 5F2MA 3ARPA 3PWAA 4W8LA 4YPJA 1VIWA 4K39A 5D32A 4NRSA 2X2GA 4AEFA 4QG6A 4GISA 1SFJA 4JKKA 1J01A 3WENA 5CBIA 2FZ9A 4DXXA 1LUCB 1IEVA 3RNDA 4F3HA 1LDCA 4CNUA 1WKFA 1XIFA 3GDLA 2Q02A 3BLFA 8XIMA 3LUTA 1KLYA 2I7GA 2JE8A 2QJGA 2OXNA 3LXBA 1NWUA 1K7EA 1Z44A 3WDQA 4ZTYA 3N29A 1Q45A 4PE8A 3W75A 3WJZA 1PTAA 5I3HA 5C7HA 3DFYA 3HFTA 4MZ8A 3F4VA 2XFWA 5AYYA 2Y4SA 5H8PA 5G1TA 5AHEA 1VFOA 4ZE5A 3FA5A 5A69A 4WIWA 4JIQA 1P4CA 5G2HA 1F2JA 1QTWA 4TMCA 2Q6ZA 5LGXA 5HQEA 1MUWA 1RV8A 1KBIA 4XG1A 1Q6RA 3I4KA 1A5OC 2OOGA 3IGSA 4JTCA 1NOUA 2BASA 2Q71A 4JX6A 4LBRA 1PPIA 5F7UA 3LDVA 3ITTA 1EXBA 2QAFA 3V16A 1ODZA 5I3KA 3N4EA 2C14A 4L9YA 3W7GA 2PP0A 3TK7A 5E5CA 3RAOA 1GVOA 3SDOA 4QHRA 4WX2A 2GVGA 3WBYA 3T8QA 2Z6IA 1NDYA 4LALA 1UD3A 3NQ6A 1N8WA 4X9SA 3GB6A 3AHXA 3DCPA 1ICQA 4ZCWA 3AU6A 3CAVA 3PNZA 3L0GA 5CC6A 3VIHA 1H4PA 2ZCGA 3PBGA 3ARRA 2CLFA 2XPKA 5D8WA 3CQIA 3WUEA 3UERA 1TQJA 5AC6A 3PY2A 4IMEA 3ZJ7A 3COTA 4O1FA 3GR7A 1FP9A 3G1HA 2JIWA 4ACZB 4RDYA 1PX3A 1FKWA 3TWBA 1H1ZA 3KOXA 4FX7A 1V6WA 1Q4WA 1LL4A 2C8NA 2WNWA 1JI2A 3PTMA 4YCOA 3TJLA 4K8GA 3L67A 2P0OA 5IHRA 3VDAA 4IX2A 1VEOA 1O66A 1F76A 5HJXA 3VUSA 4IPJA 2Z1XA 2HE5A 5EBUA 4UUIA 3WDPP 1VFSA 1REQA 4Z2GA 2VL4A 3G2GA 4BI5A 1TJ1A 4E3VA 3RRAA 3WJYA 2VWTA 3H2EA 1J9YA 4MJZA 3GH7A 1M68A 1V6VA 3DYMA 4QEEA 4D1IA 3ZIZA 2VTFA 3AZRA 1C29A 3AXMA 1W1PA 4UR8A 2PPGA 1W3HA 4AD1A 1KO0A 4E3TA 1AA1B 4MKSA 4IFOA 4JN7A 2NLIA 1JQXA 2D3NA 2PDCA 2W9MA 1NFBA 1W1VA 5K4ZA 4EF9A 2PCEA 4HOXA 5JU6A 2GPTA 3R4IA 3FGCB 1IGWA 3VKDA 4L65A 3H55A 1RD6A 4CQCA 1PO9A 3OB8A 3GIYA 3WEZA 2RJHA 4TXEA 2XH2A 2G3MA 4YMZA 1LOLA 3U0HA 3E0VA 4D6DA 1U5HA 2XINA 3BLOA 3VD7A 1GKQA 4KW2A 3T0AA 4K7VA 2A85A 1KQZA 3SUUA 1DJZA 3GTFA 1TPDA 3U3HA 2P0IA 3LGGA 3XIMA 1OCBA 2WOQA 3L21A 4LH8A 2NWRA 1V3MA 2XH7A 1US3A 5I00A 2DT2A 3DX5A 1LBFA 1OFRA 3B05A 4E6MA 4QS5A 5FJUA 5HA7A 3UZWA 2WSPA 2WWCA 3H26A 3S4TA 4D6GA 3LCHA 1XYAA 3F5JA 3DKJA 4HHMA 4PCFA 1XYCA 3SM0A 1OINA 5IOBA 5HNTA 3TXVA 1OBAA 4RV3A 7TIMA 4PMVA 2ON3A 2J78A 2Z29A 3M16A 2VGGA 1CXEA 2D2JA 3HQNA 1CBGA 3OG3A 5GQBA 1RZMA 4X22A 5FA5A 1JGIA 1B3OA 4S3CA 3W1XA 1JFHA 2DZWA 2OO0A 3LK6A 3VE9A 4DJFC 3CYJA 3APTA 2Y63A 5I3DA 2ZE0A 3VYLA 1H09A 3N2XA 5HATA 3LSCA 3K4WA 3CAQA 1N82A 5AC7A 3LU2A 2A21A 2ZVIA 4W89A 1FFQA 3TTSA 3L4YA 3L2LA 3VO0A 4J1OA 1AW2A 4HPJA 4GZEA 1CXHA 3Q45A 1ZUAX 2WKJA 2QCLA 4P7NA 1HP4A 4EPBC 4JDYA 4AWSA 1KB3A 1IZJA 5BXTA 2QVHA 1XC6A 1PKNA 2YW3A 3U6WA 1IEIA 1PJ9A 2XVNA 1CLXA 3G8RA 1Q6OA 4ADUA 3W7LA 1Y8BA 3WF0A 3XINA 3GUWA 2XFFA 4FSAA 1RALA 4LCRA 1GT8A 1YNQA 3EMQA 3LN3A 3UY7A 1MMFA 3GW3A 3OLGA 2C0AA 1TTIA 3TQ0A 3L9CA 3QMRA 1E0TA 4GK8A 1BWVA 3GC2A 5D9MA 5JH2A 3QTPA 3L68A 4X2RA 1FWCC 2VX4A 1C93A 4NX0A 4HCDA 2PTYA 4G9PA 2FHBA 5BW6A 1G6CA 1Q6FA 1RBOB 3FYYA 3OYZA 1IZKA 1I2NA 4LPCA 4IGMA 1LQAA 5IFPA 3IJ6A 4V28A 1E9ZB 1V77A 2PAJA 3MMUA 3DBNA 1XKJA 2ZC8A 4XBSA 3WK0A 3HPXA 4CD4A 3WELA 2WKLA 3LPGA 1R2TA 1LWHA 3OW1A 2WVSA 1KBKA 2RKXA 4C6CA 3G1VA 5CZKA 1RSCA 8RUCA 4NAEB 2WBGA 2WYSA 3PG9A 1TFVA 1VENA 4BFAA 3O05A 5CGMA 2PDQA 1VCGA 4JHZA 2PU0A 3I65A 2XN1A 5SWUA 2HQAA 4GJIA 2VEGA 3I7SA 1PTGA 3QYQA 2ZIDA 4ZQRA 4HNVA 4O1BA 3TLLA 2O9OA 2CLKA 3NVDA 5DEZA 1BEUA 2QUNA 2P10A 5T8GA 2WM1A 1TMQA 1JDEA 2DVXA 3PWGA 4JQAA 4LT9A 3W7QA 2PWEA 5AFDA 5JIPA 4L56A 3AS1A 3C0SA 5CZSA 2D69A 3OLDA 4AD4A 4DWDA 2VCCA 2OWWA 2PBOA 1W3LA 3YPIA 1Y5WA 3UEQA 4HMNA 2VZTA 4UFMA 5H91A 2JFEX 4IPIA 2GDVA 2ISVA 4ZO6A 1JYWA 2Y1HA 4ICNA 3TWAA 3F5KA 4LVAA 3AXIA 3R8RA 3GU9A 1ICPA 3P81A 2XJ7A 4HPGA 3QV8A 1B4KA 2PFHA 2B7OA 5ENLA 8CGTA 4RW5A 1K02A 1EO7A 3KL5A 4A3UA 2ACRA 2J27A 1ZJBA 2YDQA 1SYTA 4B5TA 1R6WA 1RCXB 3WJXA 1S1PA 3PSVA 3C2FA 3NPXA 4AXNA 1QHZA 3L7RA 2PGWA 3BLLA 3NPVA 5I2UA 1US0A 1PZ3A 4WK9A 5D03A 3A5VA 2W79A 5DANA 2A3LA 4M80A 2ODOA 1YQ2A 3KLLA 1XIHA 4ZSTA 3M5XA 4PN2A 5A8MA 3W1AA 4ORMA 3T8LA 2CHOA 4JTEA 4ZZ9A 3AXXA 4LANA 5D2YA 3SUSA 4WOQA 5D33A 3UBPC 1SR0A 1ZBWA 1H50A 3NWRA 1Z42A 1E0XA 3QPEA 3GR8A 3QOKA 3VU2A 1EGMA 1JG9A 1RY8A 4EOUA 2V63A 2OX1A 3MHGA 5IXEA 2E6YA 3W1RA 3HM7A 1XPYA 3BGGA 4O54A 4MJ4A 1GYMA 1MRQA 3KL3A 2QAPA 1AZ1A 2A6LA 5JXQA 1YPXA 5I3JA 3VOGA 1LLOA 2CWXA 1UG6A 3EWUA 4XD3A 2QZRA 4G7EA 4L61A 1SO6A 3NO5A 3EMZA 3CWHA 2J7CA 4XZNX 3M0VA 4XAYA 1ICSA 2YLAA 2HDJA 1UJPA 3PK7A 3PS7A 1XLHA 2BS9A 5AHMA 1BWLA 2Y24A 3M4HA 1XLJA 3U7VA 1BVNP 2PDXA 1HKKA 4LY8A 1EDQA 4IXXA 2WNZA 1GOWA 4Z1DA 4H00A 1D8WA 1IEQA 2GGHA 1R46A 2PTWA 2V5BA 3T4CA 3C6CA 1A3WA 1TWSA 2BGNE 2VFEA 3MV01 4I8YA 3MS8A 1QHPA 1LRTA 4H6EA 5BYWA 1SMAA 4LNYA 1B4EA 2G95A 5DMNA 1EEXA 2EG6A 3WQEA 5G1YA 2J47A 4N6EA 7CGTA 2C91A 4C5YA 4N4QA 3HN3A 1JAKA 3T7VA 4WSJA 1QCWA 4NJHA 1V3LA 2D20A 2RGMA 1R2SA 2WQDA 4OFCA 4B4FA 2V5JA 4AY8A 1CXIA 3W7RA 1PX8A 4O13A 4NT0A 2QDEA 3GXMA 4UFKA 2HZGA 1RQEA 3WFLA 2HS8A 2XYLA 3FDGA 1GWJA 2X1IA 1NFPA 1XLEA 4H41A 2ISWA 3PJXA 3ERPA 3VD9A 4Z2KA 1QI4A 4GI6A 2PRLA 2DIKA 1HN1A 1A5NC 3ITCA 3URQA 4I9MA 3PWIA 4GO8A 5EU9A 1AD1A 4HP5A 4FLRA 4LVDA 3ENLA 4MNMA 1FWGC 2REQB 1QI3A 4CQ8A 4DI8A 1XGEA 4CLMA 4Z17A 7REQA 1QOXA 1JPMA 3LXAA 2AAAA 2J7EA 3Q4DA 2CCRA 4RNIA 4KWSA 4JFWA 2TMDA 4XSMA 3N13A 4FIRA 1LG1A 1KKRA 1WAWA 1TJPA 2G0WA 3C2OA 5FJJA 2Y61A 1J2WA 3WEOA 4RZ4A 3R7MA 2R6OA 4AD0A 4IHCA 3MCOA 4NZJA 1GJUA 4K68A 4PSPA 1DQXA 2DU2A 2FTYA 3T07A 2PDWA 4TR9A 3IUHA 1UKOA 3VTRA 2BVTA 3MSYA 1ECQA 3AHYA 3I68A 4B2DD 1M04A 4YIWA 2EEXA 4UTTC 1C91A 1QASA 2DT1A 1WE5A 1QI2A 3BXWA 4HBKA 3L5LA 4YHEA 5DF0A 4K1GA 4H6QA 1PB0A 5GJMA 2VZVA 1CXKA 1HJVA 5XIAA 3TP4A 2DPEA 3M0HA 1SO5A 4GUFA 3CGTA 4GQQA 3A12A 2PP3A 2PDFA 4MY1A 3RX3A 5H1WA 3CMFA 3GNDA 1CI1A 2DW7A 3BCJA 4AIEA 3GM8A 4UR7A 2A3AA 1UW9A 2X42A 3QR1A 1QXLA 4XZWA 4KFNA 3TIMA 1FFRA 5HK4A 1EIBA 2PLMA 4GQBA 3A64A 2P1FA 1OADA 4S1FA 4F0LA 4R9OA 1GG1A 1JZ3A 4GNVA 5HWJA 3ABSA 3UG3A 3F4CA 1YDNA 8TIMA 4LTSA 5MKGA 3ARYA 4LGXA 4YTRA 1PZ1A 2NSXA 3CUFA 2DIEA 6CGTA 1W5OA 1KM1A 4NAFA 3M46A 3W1LA 2QJMA 1DTNA 1IF2A 1QU4A 1T5AA 5A6BA 3VDHA 3V75A 1XG3A 1X39A 2OX4A 2VKZG 4L6DA 4QJ5B 1XBYA 1EO5A 5BXRA 3CV6A 2J66A 1ONEA 2OCZA 2CWNA 3VC6A 4OQVA 1HJXA 1IQ8A 3RK8A 1VAHA 3LHZA 4O1EA 5BOOA 1ZCCA 4LYKA 2WK2A 4RE4A 3TA9A 4B5UA 3N14A 1SJCA 4DIAA 3B0PA 1CGVA 4LAUA 1VC4A 4M29A 5A6KA 1VRDA 3DHDA 3A6OA 1QAPA 1AVAA 2ZBTA 2ZKMX 3LERA 3EXRA 2PBGA 1LG2A 4ZFCA 4IMFA 1M5WA 4IISA 1LOQA 3WQDA 1GQJA 2HWGA 4IJCA 4KCTA 2VEMA 4IG2B 3MYPA 5HXMA 3HPZA 2EQDA 2AGKA 2FB2A 4M7TA 1I0BA 3O6DA 3QMSA 1W31A 1XFBA 3UXAA 4RR4A 4AWTA 3RYSA 3IIXA 2UZ9A 4RX0A 1JZ7A 4XIMA 4UOQA 3NPWA 1QNPA 3PZNA 4O0QA 3HQPA 1S2VA 2DZXA 3EPNA 4IL0A 4S3JA 1R47A 4XZ9A 4A8NA 7XIMA 1BKHA 3UNTA 5IHSA 3A13A 2INEA 5DBUA 1E43A 4TV5A 4L1GA 3PPHA 4XAFA 3AROA 1JYVA 1W1ZA 2OWXA 2OYMA 2RDUA 4DJFD 1UPPA 4JTHA 1QK0A 5FESA 3U2ZA 1X7IA 4W8AA 3UXKA 4PUDA 1DE5A 3LCGA 3W53A 1R30A 3GLCA 1FBAA 1ESWA 4QNWA 5BOEA 3STPA 3S1XA 1VFHA 2PDIA 3RLGA 3C52A 1T99A 2A3CA 3SCPA 1TA3A 4HZMA 3VKAA 4QEHA 1XL9A 1ONWA 4PL2A 3GVGA 4F48A 4ZO8A 1NFGA 2EPMX 3CL8A 1X8CA 1EF3A 3VUPA 3FCPA 1TR9A 2V3EA 4I9AA 5GNYA 4WGHA 3GE7A 1U5VA 1WPCA 1MQRA 2E8ZA 3G3DA 5D09A 2Y88A 4PUKA 1XD1A 4KS0A 1VJIA 2NW0A 5AHIA 3N6HA 3VINA 4C6NA 3UG5A 4Q4QA 2W5FA 4UR9A 1FWDC 5F2GA 3NO1A 2YCLA 1GVFA 3FLUA 3LNPA 1KQYA 3PB0A 2H90A 3AIRA 4L1XA 4IIGA 4I8DA 4JTGA 3VFCA 4DVOA 2OT0A 1U1UA 4C1NB 1WDRA 1MI3A 2F6XA 4AZCA 1B57A 4JYDA 2OQHA 2VC9A 1QNSA 2Z28A 2Z4GA 1ISYA 4TIMA 3WG6A 4C6QA 5KETA 5FJOA 3GVWA 4B3KA 4XK2A 1R3QA 4GC3A 1TV8A 1OB0A 2YL8A 4WXYA 5LNVA 2Y85A 3RUBL 2PDHA 1HJSA 3OVGA 1XH0A 2CHNA 1FCVA 1SGJA 5KITA 1NH6A 4W87A 3V0UA 4N9DA 4WR3A 1O1ZA 2RGLA 3PZOA 4TTGA 1OCJA 5I5RA 1QK2A 2GVLA 3SGZA 3LQLA 4HD5A 2DZVA 3VABA 5C55A 2OGJA 4GBUA 3M47A 5J8LA 4A29A 3T05A 1KBBA 5LIUX 4IIFA 5CPQA 3OO2A 5A8NA 3BAXA 3PAJA 4E38A 1EDTA 3TJIA 2H9AA 5M5DA 3UP8A 3UR8A 3KBNA 4MFEA 4V1XA 4U5KA 3QV6A 3ZSSA 1BXCA 5K3VA 3GAYA 1UD2A 3CYVA 3MUCA 3WF4A 1OX4A 5A8OA 1JD9A 4DWSB 3K1DA 4QJ1A 4NUWA 3E0FA 4AZ5A 3WX7A 3IRSA 3WQ4A 5LNWA 2FPVA 1BQCA 3ONCA 3C56A 5BZAA 4CCZA 1DXIA 4J28A 3PR2A 1JQVA 4H7ZA 3LI1A 1XIIA 3FN9A 4DLFA 4PZVA 4HJWA 3C2VA 4ALDA 3A22A 2ACUA 4DWSC 1S2CA 1JZ4A 1UASA 3F2DA 1IT8A 3CZKA 3BJTA 1HO1A 3URNA 3OP2A 3BMXA 4CVWA 4GKLA 4B15A 4PMJA 4FALA 5A6JA 2C6QA 3EEGA 5LZLA 4WDXA 5LIXX 4LSBA 4Q7IA 1T8QA 3K46A 4XZLX 3A4AA 4NZFA 3S1UA 3KVKA 1OC7A 5T91A 5DCDA 1RA5A 4U10A 4PB3A 3LHVA 2VRQA 3SY1A 3OPSA 5AVHA 2ACQA 1MO0A 4L6OA 1BQGA 3WD1A 4C91A 1MZRA 5A1AA 3KRZA 1IT7A 1TPB1 2TSYA 3RN6A 2WVVB 1KGXA 1P7TB 4BF9A 2MNRA 1H51A 2VM8A 3W00A 4FHAA 5EMMA 3KXQA 4UCGA 3PJUA 2PP1A 2TPSA 1BF2A 4GNKB 1JZ6A 1XLDA 5FF0A 2R1MA 2BHYA 2VELA 3BAYA 1GZGA 1JRBA 4KEUA 3CXOA 4XAGA 2QULA 3C5QA 3BLDA 2VR4A 3W81A 2YFOA 1BG4A 3CLMA 3S42A 3EPMA 3SSZA 2E6FA 3B8IA 3L0KA 2Y7EA 3G5EA 4GC4A 4H6RA 1M7PA 1SM9A 2J8TA 3SUWA 3CUZA 4GX8A 1DWGM 1EUNA 4H9UA 4MKNA 4EPDC 3S2LA 4RJEA 3IVSA 1WDSA 1JCTA 3VOCA 1WKYA 3HGSA 4AEEA 3AXKA 3VIPA 1GNXA 3GDKA 3NAVA 1EYWA 1VHNA 3KEHA 4P5UA 4Y9MA 4GMEA 3FA4A 1FVPA 3B8UA 4A35A 2DT0A 4TUFA 4AHPA 3N9KA 3G1RA 1OIFA 3WIJA 4U3CA 3CUJA 1JL8A 1WX0A 3FX4A 3UT0A 3LCWA 3WQ5A 1TELA 5CAKA 2BOGX 4AIBA 4PH6A 4Q8VA 3GW0A 2QIIA 1GW1A 1KV5A 3UW6A 3E38A 3GG0A 3SCRA 1IWAA 1GORA 1A5LC 5CC3A 3PPFA 3KM8A 3T0BA 3W29A 3C0JA 4C65A 4PSRA 1JIBA 3AIEA 2RJGA 1GUVA 3TSDA 4BA0A 1HZYA 2FKPA 1J0ZA 3W7OA 4CD8A 2OGYA 1Q6DA 3INPA 3USZA 4O19A 1XGDA 3RPMA 5GJNA 3T6CA 4GOAA 4O8RA 4J35A 4AZBA 1WCGA 4YHGA 3OIXA 5BXPA 3A21A 5CQ1A 1LORA 1XR2A 3W2JA 4GH1A 3OQ8A 2RDXA 3C3UA 2IW0A 5E0KA 1XIEA 3HU7A 3FNDA 1QWGA 3GO2A 3RG6A 1F3EA 1XYMA 5C8BB 1Y7VA 1GPWA 2V3GA 1SJDA 3RCNA 3GVVA 4FO4A 3GG1A 4O14A 1Q65A 5J5RA 4GKTA 1I75A 1F61A 3THUA 5DELA 1LF1A 4AISA 4R7JA 2C0HA 5IBXC 4WQ6A 3W7NA 1DJNA 2O7QA 3O3RA 5C70A 1HQTA 4WJEA 2PI6A 3CHDA 4ZE4A 5DMLA 3HV9A 3WF2A 3TQPA 1S2AA 1EX5A 4YYCA 3GBDA 1GW9A 4AIOA 4RKAA 4AVNA 1NDVA 3WD4A 3VNMA 4I5UA 2OYKA 4C6LA 2J6XA 3E49A 2DSZA 3CPUA 1V6YA 3WQ8A 4DM1A 1XI3A 1DJHA 4LVBA 5JBEA 3BGJA 4YS1A 2EPOA 4DJEC 1F8MA 3EOOA 4MB4A 3W4RA 4UXDA 2H8ZA 3M64A 5AVNA 5A95A 1TREA 1XLAA 2OOFA 4Y8EA 2V5KA 5U7SA 3ME3A 2PWUA 1E5JA 4J3ZA 4I6KA 3CH9A 2I16A 4HK7A 5K4XA 3TROA 1D3HA 1XRVA 3W71A 1G4TA 2WHKA 3CQHA 5H8UA 2QGYA 3VKCA 4C6IA 4HN8A 3W87A 3HBLA 1XLLA 2GSJA 2R94A 3QQ0A 3DHFA 4GINA 3WCZA 1DTUA 4D6JA 1RLDA 4WLCA 1CT5A 1R5YA 3MO7A 1V0KA 1KFLA 3H2NA 3NQFA 3S9YA 3ZYZA 1DE6A 1OFBA 4F9JA 2QCNA 4AZ6A 1DJYA 1D7KA 1WXJA 1OVDA 2Z6JA 2BTMA 1RY0A 3L4WA 3ONBA 2QIWA 4EACA 3WDRA 2GQ8A 1NIUA 2INZA 1DWHM 1X1ZA 3W6LA 1E4LA 1UR4A 3D3FA 3E74A 4LUYA 1XH2A 2UY3A 4FLOA 4QE5A 2AL1A 2YX0A 4OOUA 3ITGA 4KIEA 3VNYA 4HU8A 3TC3A 1TPC1 1M53A 2OQLA 2JF7A 2QCDA 4IJRA 1NWSA 3BG5A 3P67A 2PGEA 3FSTA 2DSWA 3KFTA 2NV9A 5HJYA 3SO7A 2VR2A 3TOPA 4F0KA 5HWMA 1NWTA 4LYRA 5HPOA 4N9EA 3AYTA 3R12A 1K9DA 4QAIA 3F2BA 3N25A 3H2CA 1SW3A 1ZY9A 1CGUA 2OLHA 1O5KA 3GXFA 3W28A 1HKJA 4M3PA 4HA1A 3CZLA 2Y7GA 2HPIA 2VGFA 2G3JA 1E0VA 2QCGA 4AEOA 4IFKA 3DYOA 3LMYA 1VEPA