1ZCCA

Crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
240
structure length
240
Chain Sequence
MTKIVSHRGANRFAPENTFAAADLALQQGADYIELDVRESADGVLYVIHDETLDRTTNGTGPVGHMLSSEIDTLDAGGWFDDRFKGAIVPRLDAYLEHLRGRAGVYIELKYCDPAKVAALVRHLGMVRDTFYFSFSEEMRQGLQSIAPEFRRMMTLDIAKSPSLVGAVHHASIIEITPAQMRRPGIIEASRKAGLEIMVYYGGDDMAVHREIATSDVDYINLDRPDLFAAVRSGMAELLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit.
pubmed doi rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Hydrolase
molecule keywords glycerophosphodiester phosphodiesterase
total genus 87
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1zccA00
4R7OA 1DJXA 3QR1A 4GNKB 3H4XA 1GYMA 3NO3A 1QASA 3V16A 2F9RA 1VD6A 4QJ4B 2OOGA 4S3GA 5T91A 3V1HA 5PTDA 1PTGA 2OR2A 2ZKMX 4I9TA 2OTDA 3KS5A 1ZCCA 1V8EA 4QJ3B 3QR0A 3I10A 1DJYA 3OHMB 4RW3A 4F2TA 1DJWA 1AODA 4F2UA 6PTDA 5T9BG 2PLCA 2PTDA 4RW5A 2FJUB 1T6MA 2ISDA 4I9JA 2PZ0A 2P76A 4I8YA 4F2BA 3H4WA 4I90A 1DJGA 1YDYA 3PTDA 4RV3A 3RLGA 3V18A 3QVQA 4I9MA 4QJ5B 1O1ZA 3EA3A 3EA1A 2O55A 1PTDA 1T8QA 3L12A 4OECA 3KS6A 1DJIA 1QATA 4PTDA 5T9CE 4Q6XA 3RLHA 1DJHA 1DJZA 3EA2A 1XX1A 3CH0A 3MZ2A 7PTDA
chains in the Genus database with same CATH superfamily
5DF0A 3IUIA 1KRMA 3LI1A 3RMEA 1BYBA 2V2CA 3PJWA 4WLCA 3VOIA 1DE6A 4DPQA 1V77A 4S3KA 4Z2HA 4ERIA 4RW5A 4DLFA 3E5BA 4I90A 2QVNA 4LRSA 3VA8A 5CSYA 3NQGA 1FWAC 2XVLA 3QMSA 3W7QA 1G69A 4QROA 1XIFA 3CPGA 1XLLA 2VR2A 1RSCA 3LB0A 1Q6DA 5GJMA 5AYXA 1IWAA 3NL6A 1T96A 1A49A 4XZ9A 1Q4WA 2VENA 1GVIA 1S1PA 2WVVB 4J3SA 1V0LA 1KR0A 1CEOA 4AC7C 2RDUA 5GJNA 3DERA 3N4AA 4D6HA 5U7SA 2G4FA 3KVJA 2BVDA 4HSOA 3S5ZA 4GCXA 1TWDA 1ZJAA 2YW3A 3GNNA 3C2EA 3OLEA 1WXYA 4I6KA 2XH4A 4IQDA 3FJ4A 2X7WA 2OX1A 3R94A 4ZB0A 4PUDA 3ONCA 5L9FA 1F8IA 1OGBA 1TRIA 2V6AA 3P74A 1SSDA 3IEBA 1XISA 3TN3A 1W5MA 4W86A 4GO8A 5D2WA 4AY7A 3TMQA 3N04A 4JFSA 1F07A 3AXXA 1KM2A 2DSVA 2OKOA 3A5VA 3ITGA 5CPLA 3IJ9A 1OYCA 3T42A 2AAMA 1XX1A 4OT7A 3FAWA 4PCPA 1VP5A 3BLIA 1K8YA 3QLDA 4F2TA 5D03A 1NFGA 2ZE0A 4R85A 1XDLA 3W6MA 2PGEA 1K70A 1ITCA 4IQLA 3TIMA 1P0DA 3NPVA 3BK0A 4ORMA 4MWAB 4MJ4A 1NWUA 2CZDA 4GKLA 1N82A 2YSWA 2Z1VA 3LCGA 5FI8A 3L2IA 3IIXA 4BJHA 4O53A 1JPDX 2Y6ZA 1P6CA 2CLFA 3GNXA 1PO9A 5LHEA 5C54A 1EHNA 9XIAA 2YCKX 1MFUA 2QGHA 3BLOA 5LA2A 3WKZA 1BVNP 2Z7GA 2RAGA 3VDHA 1Q6CA 3N2OA 4PULA 4F79A 2HE5A 4O28A 5A2BA 3FEMA 2OQLA 2OXNA 3TYZA 2ZRZA 1V6WA 2ADAA 1JCMP 1P1XA 3S6TA 4HQVA 1G4TA 5E93A 3B0PA 2WWCA 1JYNA 1R0MA 2BSLA 2QJMA 5MKGB 4ZENA 4KBXA 5AKQA 2QR6A 1Y5XA 4UOJA 1SJAA 2P76A 4M0XA 1JCTA 1VBJA 4LUYA 5LYRA 3QV8A 3L5MA 3OJGA 4A29A 2JKEA 2Y89A 4E2DA 1T99A 1VIWA 2BV9A 2ZC8A 1VENA 3IIPA 3NQVA 2H9AB 4XKYB 3WNOA 2OR2A 1FDYA 3RU8X 3LRKA 3RILA 3D46A 4MZYA 4L4OA 3PK7A 3VFLA 2DZUA 2XN0A 4XTDA 3LLXA 4UTWA 4P7LA 4MWAE 4DN1A 4JN8A 3QXBA 1AL7A 4H6EA 3MUXA 2GGIA 2R1PA 1FCQA 1YE6A 4O0QA 2GSJA 3A64A 3DECA 5I3DA 1PBGA 4KEVA 5PTDA 2V5DA 3W7MA 2CLLA 3NFUA 4MKNA 2PDWA 3BLPX 1QJWA 1IEWA 1S2CA 3AOFA 2YLAA 1TVNA 4KPLA 4JIHA 2C1IA 3N11A 2HDJA 2Y62A 2YW4A 5F4XA 3F4VA 2BVTA 5IBXA 1HJXA 1CYGA 1K9DA 1CB7B 4GHRA 2J75A 8XIAA 1GYNA 1YNQA 3AYRA 3TSMA 2HISA 4Y8EA 3W74A 2V81A 1G7UA 4FS9A 1WBHA 3ZQ9A 1NDYA 1H4PA 3S6DA 4LVDA 1F05A 1L6SA 3C4UA 3C8NA 4JTLA 1XYZA 5ECVA 4GFSA 4FZIA 1UC4A 2ZZ3A 2GVJA 2Q09A 1FDJA 4AD5A 5AC7A 2X8RA 5FOOA 1K7XA 4MG4A 3QW3A 1Z32X 3R2GA 2RFGA 1S5TA 3SI9A 2ONEA 2PDBA 4QHRA 3DU0A 1XLDA 4OHQA 1QI0A 2Y2WA 2CZEA 3KTCA 3L4ZA 2DUZA 1YTEA 3UR2A 1BF6A 1YIXA 4C6NA 2AGTA 2QVHA 1OD8A 4IMFA 1HVXA 4LY4A 2GOUA 3EWDA 5HWNA 1LL6A 1Q3NA 1X38A 4DQWA 1TUFA 5EPDA 5HQMA 2WW5A 2X30A 2VEKA 4JYFA 1MFVA 1NVMA 1UKQA 3WL1A 4IL2A 1VHNA 2Z2AA 4OBRA 3CGTA 4HA0A 1MQPA 4C6EA 4IHCA 3IPWA 3VIIA 3AFBA 4AWSA 3GUGA 1US3A 2P10A 3HZ3A 1G94A 3BMVA 4HOZA 2BOEX 2V5KA 3HG5A 4M8UA 4Y9OA 1UZHA 4RX0A 2W0UA 5DRIA 1VIZA 1EC7A 1FA2A 4AZCB 3M0VA 2BVYA 3OLDA 3QRHA 3P6LA 4FPSA 1ZAHA 1O5RA 3TLQA 4POCA 3LGEA 3ANYA 3CHDA 1XCXA 4C1LA 2FZ8A 1EA9C 1FUYA 4MJ2A 1ZCCA 2PE4A 4JTFA 3ZLHA 3P0WA 2YCLB 3GE7A 1DHKA 3VD7A 2PU1A 2WC7A 4AUBA 1E51A 4N0RA 3O3RA 2OB3A 2D2HA 3UF9A 4RCXA 2GZXA 5EA9A 2I9EA 4NSBA 4O1FA 3NZQA 1KNWA 1PIGA 1PJ9A 1TA3B 3TC7A 2FHBA 1VBRA 4DBDA 2E8ZA 1XLFA 1FY6A 4CLMA 3QV7A 1LRNA 3PWGA 1MRQA 3W7LA 3LBMA 4EK7A 3VDBA 2B31A 3AHYA 3WNKA 5KETA 4KW2A 2PP3A 3L66A 5A8NA 1ZP4A 1KM1A 4L4LA 1A0EA 4E38A 3B9AA 3URNA 3TWBA 3DC8A 1WUFA 4DJDC 3UXLA 1CWYA 1I8JA 1FWEC 1VYRA 1X97A 2QHAA 5AHLA 2B0MA 5LNUA 3N18A 1S46A 2NQ9A 4BQ2A 1H7RA 1KQZA 1B3YA 1W3NA 2DH2A 3W4RA 2MANA 3PUOA 2Z27A 4US5D 3MMDA 1QHPA 2GK1A 5G2HA 4AIOA 3LHUA 1HKVA 2V30A 2X0YA 2WZHA 3GDBA 3ES7A 5CZ0A 4D6JA 2O4MA 2HROA 1F61A 1HG3A 2WSYA 5KINA 7CGTA 4XIAA 2NZLA 2VMFA 1QOQA 3W2MA 5HR7A 3BGAA 3VGGA 4HD5A 3PUDA 6ENLA 2QCCA 3CASA 3MSDA 1JDFA 1ZRQA 2ZKMX 3GVWA 4M6PA 1PYFA 5HWJA 4J7RA 4XUGA 1F8MA 2ZUSA 3RJXA 4DI9A 3WUGA 1GKRA 2DUXA 3SBFA 3W72A 1B3XA 4NG3A 1PAMA 4DNHA 1HX0A 3W2UA 4FX6M 2DGAA 4IPPA 4XZIA 1ZS2A 4RDYA 4DZ5A 2G5WA 1YW1A 3SB0A 1ZFJA 1S2AA 1IWPA 3BLKA 3EB4A 4RR4A 1SZEA 4H3DA 2E8YA 3I10A 4Q4PA 2A5HA 4RNHA 2Y7DA 3CH9A 4QX4A 4JNYA 3F03K 4Q4SA 4XVDA 1KXTA 1DEDA 2H8XA 1L2QA 5LNSA 1E73M 4Z2LA 1W1ZA 4Q32A 4D72A 3PNUA 4GH1A 4MPQA 1CLVA 3UCDA 4YIWA 1XLBA 3CV6A 4LOCA 3KUMA 3W1NA 1WDRA 2BHYA 4OGZA 3VIPA 1JAEA 1GYLA 4NZFA 2WNZA 3ZVHA 3TW6A 1LUCA 3Q58A 2GJXA 3SGGA 1FWGC 2KAUC 1XDJA 5DXXA 5KZMA 1UD8A 2HBVA 1TO3A 4OJYA 4KFNA 3FIGA 3WY1A 1RAKA 3A5FA 3QY7A 1TTQA 3CHFA 3WD0A 4K1WA 3WQEA 1PYMA 5AZ0A 4EVZA 4QGCA 4A4AA 4B5TA 3AHVA 3W6YA 1WPCA 3FX4A 3PFMA 4Y8FA 2XISA 4UTKA 2KZHA 4ZE5A 5LZLA 1MYRA 3EWZA 3BOXA 3NM3A 3G0SA 1JYVA 4NJHA 3LQLA 2FH6A 3EMCA 3URAA 2CZFA 1V5XA 5LSMA 4CN6A 4WD0A 1O5KA 3G1SA 3T05A 2WHLA 2PD5A 1J2BA 1GZ1A 4UTHA 2BXYA 1H0IA 1IZJA 1DIOA 4FLOA 3PBGA 5ABHA 1NWTA 1FTXA 3ARRA 2Z1WA 4GY7A 1MUWA 4I9MA 1TG7A 3WUFA 1MW3A 3VNIA 2NUYA 2CWNA 3WELA 3KOXA 2XFWA 3WQ5A 2OEMA 2DZTA 4WEVX 3IUHA 1S1RA 5I2UA 1ESWA 3GNRA 3W82A 1W54A 4OE7A 5IRPA 5E6YA 3OIXA 2PFHA 2PWGA 4JBRA 4MOZA 4DM2A 3LERA 4H7VA 1XIIA 1K03A 4ZO8A 4HBKA 4S3EA 1BLIA 3ZJ6A 2OGJA 4B3KA 1CI1A 3UNDA 3CMFA 1FBAA 1WZMA 2QUMA 2WMIA 2I16A 5DN1A 5AYYA 1OFAA 3C61A 3PF3A 2IXUA 3ZFHA 4DB7A 4O4VA 4IPJA 1REQB 2J8FA 4ZQRA 3I6RA 4UBPC 2QDGA 3DYPA 1WBJA 3W7HA 1PS9A 3CPUA 3LXAA 1HNYA 1XH2A 4GNJA 3BCJA 4H9UA 4JQ2A 2C1HA 2ASHA 1HKKA 3N4EA 4J3XA 1UD5A 2WLZA 1OX5A 3KAOA 3UU0A 1EP3A 1XJBA 3MUY1 3WF1A 2YIHA 4I9TA 3K13A 4QJ3B 1O6IA 2OZTA 1ZGDA 5L6UA 1OC5A 1KRAC 2OMAA 1XXXA 2VDGA 4YPJA 2XGBA 1Q8JA 2YCEA 1UKOA 2WKGA 3OA3A 3HG2A 5LXEA 2EEXA 3HM7A 1SPQA 5G2IA 2CCRA 3OTRA 4MNJA 1XYBA 3BG9A 4QAIA 2VCBA 2ZA3A 4XAPA 3GDTA 3GFZA 2C71A 4LCSA 2G37A 3KS6A 5D37A 4Z08A 1E6RA 3LM3A 2GSEA 4U28A 4AF0A 1WKEA 3MHGA 1Q2RA 1OIFA 2FLIA 2FPTA 1MQRA 3BV4A 4JKMA 8RUCA 2F6XA 3CB3A 2ZRWA 2E25A 3M9YA 1JVNA 1K9EA 4JN7A 1TIMA 1Q66A 4UIOA 2F2HA 2WKLA 3G22A 3IRDA 3A47A 3KL5A 1VGAA 1ICPA 1JEZA 4JX5A 2VC9A 1NARA 2QF7A 1XYMA 3AMKA 2UV8G 5BU6A 5F2IA 4TVCA 7PTDA 4XWUA 1SW7A 3H7RA 4CD8A 3WYZA 4ZCWA 1TCDA 4TMBA 4BF7A 3LPOA 4KIEA 5BMXA 3G3DA 3E38A 2C91A 2OCZA 4JXCA 4JTKA 3FV9A 4LYRA 1V51A 1XIJA 4GC4A 4RV8A 2HPIA 4R9XA 5B80A 3TLLA 3QY8A 4M24A 3WMBA 1P1MA 3DHPA 1UCWA 5I0DA 4FMVA 3K1GA 4MKVA 1LG2A 2FJKA 3PPHA 5BRPA 3AIQA 4LX4A 4HN8A 3OGSA 3ITVA 5HWMA 1MZHA 3I7QA 3WLJA 4WKHA 4OZOA 3BCDA 1AJ2A 4GH3A 3RHGA 1UA3A 3TJLA 4CD6A 1EPXA 5ABFA 3VGHA 1SO4A 3V5CA 1YDNA 4HMCA 4C6IA 3BLEA 4LEFA 1WCGA 5CPTA 3CH0A 1KB3A 4B3LA 1RLDA 3VCNA 3GG7A 1JCXA 4Y6GA 3W37A 2FDMA 4PUNA 2VX5A 1WDDA 4FNRA 5CEWA 4NU7A 4I3GA 3SR7A 4H9YA 3S5SA 4B16A 3PJUA 3WQ4A 3V4BA 2WANA 1RJQA 3W1LA 1XRTA 2ZXAA 4PFMA 2ACRA 3MSRA 5F7UA 1UR3M 1DPMA 1EJUC 2GWGA 3REQA 3CBWA 4D71A 4JY9A 3W0KA 1SZRA 1DJQA 5CCZA 3GAYA 4J2MA 3WLPA 1S38A 1E43A 3IV8A 5C0QA 2QCFA 2AL2A 3LBOA 1VFSA 1XUZA 3M5YA 4D9PA 3PPFA 1OGSA 3R0UA 3VDAA 2XN1A 1E6QM 4GXWA 1RA0A 5MHBA 4U4MA 3MV11 3U2OA 3H2AA 3HGOA 4LF2A 4U2ZA 3NSNA 1CDGA 3RCYA 5C7VA 4GXMA 3R12A 4D1IA 5JVLA 3AS2A 1VJIA 2FVMA 3SCSA 1JZ5A 4DIAA 1V6VA 1KO0A 3UWUA 3TYEA 3MBDA 3HQ1A 2V5JA 2EKGA 4MPKA 1TV8A 4UFJA 1Z89A 3P0XA 4L80A 5FF3A 2DZXA 3L4WA 2GLKA 1RH9A 4O1CA 4EXBA 1NOWA 5CPMA 3IK4A 3A22A 4MNMA 4J3WA 3DYOA 3B8SA 3NYZA 3TQ0A 1PDYA 5DLCA 1HJSA 4HTYA 1KFCA 3AXHA 3LHZA 5CGTA 3ANVA 4WZHA 3F4DA 4LNCA 3VUSA 1W3HA 2OGYA 4HZ8A 2PDCA 3UZZA 1GOMA 4ZR8A 1UP2A 3M5ZA 2V3FA 5TF0A 3TTSA 2BBFA 4BWLC 1BXCA 1XCFA 3OA5A 3MWCA 4LYQA 3W1XA 3W1PA 2A7RA 3R8GA 1A3HA 1UBSA 3VKKA 3ARSA 4HSNA 3OVPA 3W7KA 4H2HA 3F5KA 4FLRA 1AUSL 4Q8VA 3QR3A 4GIEA 2ZX5A 3ZR5A 5HINA 3VIGA 5CLWA 5KITA 1OYAA 2TAAA 3URBA 1ZPTA 3OGRA 4UB9A 5GNYA 4UFKA 1HZYA 1P6BA 1TQJA 3N17A 2H3DA 3GXNA 3S9YA 4O19A 2XH7A 4H19A 1FWSA 3WQFA 4ZO9A 4AXKA 4ADSA 4XBKA 2A3HA 1FFQA 5HUPA 1SZNA 3TZFA 3UXIA 4K36A 1X1ZA 4NJJA 2ZZ5A 2VDIA 3K4WA 2IW0A 3EKZA 2YKKA 5SWUA 3ERPA 5T8GA 1ZJHA 2VGGA 1VF8A 2PURA 2R24A 4W93A 4OECA 4NI3A 1Q85A 3R4IA 2YBTA 3VZXA 4AHOA 2PTXA 4E6MA 4S39A 5T91A 3TU9A 2W92A 1XBVA 3CUZA 2QCDB 2Z6IA 3H12A 2HV5A 3B8IA 3MANA 4ZQNA 4EPKA 3OVRA 1RD6A 2FGZA 1O95A 3TTEA 3QHOA 2Q8XA 3EOOA 1JPKA 4MJMA 1U83A 3ZVIA 3MDUA 4E4FA 4F0MA 3VCCA 2EPMX 1L6YA 3W7JA 3A9IA 1V6UA 1J10A 2OOFA 2DSWA 5BWAA 2PWHA 2W63A 4K38A 2PF8A 4AVFA 5M1TA 4F40A 3IIOA 4TO8A 4DWDA 3DHUA 2DDXA 2P0OA 4H8VA 5LXXA 4QFUA 4EE9A 1FWJC 3LCIA 5H6HA 3KBMA 5DMYA 3KVKA 2GSHA 2V38A 1VQTA 2HBXA 1HW6A 2DSUA 4YYCA 3M7WA 1PCKA 5AY7A 3SSJA 1ODZA 4WVXA 1NP2A 4HK6A 4IMAA 1W1B1 4YTTA 4CD4A 3H7VA 2Y63A 4L7ZA 2X42A 1EB3A 4GIYA 5D2VA 5FAJA 1WZAA 3E0LA 1B5TA 4AD2A 1Z44A 2ZADA 2IKJA 4LXFA 2B7NA 2IKGA 4JTIA 3B8VA 2PCQA 1MZRA 1X6NA 2X2GA 4R33A 2ZWZA 2G0WA 4ENLA 3PPCA 4QQ3A 1D8CA 5AN7A 1EC9A 3DFOA 1QBBA 3GVQA 3H2NA 3PWAA 2ACQA 2ACSA 2WJZA 4KETA 3CMJA 2GQ9A 4I9JA 4HK7A 1PHQA 3GDMA 4FA3A 4QS5A 3PTQA 1TPB1 2WBGA 4IOTA 4LTSA 1K9FA 1BGAA 3VK5A 1KV8A 1OK4A 3NCOA 1CXHA 3C56A 3BGGA 3K5XA 3POCA 3VMPA 1DORA 3F5LA 5K4ZA 4JL1A 4INFA 2ISVA 3QEZA 5AECA 3HG4A 3A21A 2DJLA 1OCJA 1J2WA 4YMZA 4KRUA 1MXDA 3WDRA 3SCRA 4GZJA 4F3HA 5CZTA 1MW0A 3L5LA 3PTKA 1A0CA 1BSLA 2G41A 1HO1A 5H8MA 1E1CA 3NDZA 4C7GA 1CLKA 1S5MA 4X9YA 2G97A 1FWFC 3VNZA 3WNPA 3LTPA 5XIMA 3O06A 1E4MM 2DT3A 3LSBA 4C6QA 3GNPA 1F74A 2YDRA 3EOSA 3TMLA 3TE9A 1ELSA 1AODA 3UETA 3AZTA 3QHNA 4LALA 4LW7A 4YTUA 4PTWA 3O2LA 5K2ZA 1GHRA 4NXSA 2Y8VA 1VCGA 3TKFA 1QCWA 3GZ3A 4O50A 2VWTA 4HPGA 4LJ3A 3JZUA 3VGBA 4MB4A 4LC8A 2Z1XA 1QUMA 2I9UA 2FFIA 4K68A 4NNCA 4XAFA 1OC6A 5GQBA 2JEPA 2QIWA 3RPTA 4ACZB 2QUVA 3TH6A 2Q8ZA 3WDJA 2NUWA 2Z1SA 3GAKA 2YZRA 3LZ5A 4ZMGA 4UFMA 4E8GA 4MB1A 1UZ1A 2E0PA 3VIJA 1W3IA 4JICA 1US0A 5BMWA 3P62A 9RUBA 4IIBA 2A3AA 3GQYA 1P7TB 5G1TA 3PVFA 1U1JA 2NXGA 2F9RA 4JTDA 1OZQA 2W5FA 4IH3A 2IPFA 2CW6A 3UPMA 2B7OA 1DL3A 3W7OA 1GG1A 3UY8A 1BEUA 4V33A 4Z17A 4Z2GA 1RLCL 4HMEA 1AJ0A 4IMCA 1EQPA 3BCFA 1ITUA 2HQAA 1U22A 3G1XA 8A3HA 1LQ0A 4PB4A 5BOEA 2I5QA 3CUIA 4V1XA 3CM4A 4WJEA 1RQHA 2OQYA 2B7PA 3AIWA 4DYJA 3U2EA 3B04A 1OVDA 3FLUA 3WLIA 4AWUA 2QMKA 1H7WA 4XISA 2D0FA 1FHUA 3G8EA 4RZ5A 3UR7A 2ZX9A 1LWJA 5CKSA 1R9YA 3F4CA 4CQ8A 3U8GA 4HZMA 1B9BA 1CGXA 3AS3A 4O1EA 5LNRA 1GHSA 2VFEA 1XG3A 4LQ1A 3LUTA 5MF5A 2QPSA 4LANA 5MKGA 2BASA 4ACYA 1IYXA 2FQIA 4OVXA 1KXHA 1GJWA 2WVSA 3WH5A 1ME7A 1IE7C 3FEQA 2X2YA 2VZOA 3MKVA 3GC2A 3N3TA 2ZUTA 3R5EA 2EQDA 4WCJA 1FOBA 2EGZA 3STCA 1TJ2A 1U5VA 3K2GA 4FB7A 3PUEA 1PKYA 1OCQA 4MHBA 4XKYA 3WLNA 1CXEA 7REQA 3VKAA 4EF8A 1L6GA 3U7VA 4FO4A 2OLAA 3RJYA 4Q4OA 2PSNA 4C1KA 3THDA 3HOJA 2J7DA 1XPGA 4HT3A 3OQ8A 1NEYA 2SFPA 4KRZA 4J35A 4QISA 1S5WA 1NOFA 1VCFA 4S3BA 2OEKA 3M0ZA 2YYTA 4HJFA 4DRSA 1XKYA 4A6GA 1W5PA 2A3CA 5FAGA 3LXCA 2ZZ4A 3G1AA 4X60A 4G6CA 4R27A 2GVLA 3KE0A 4HU0A 1ODUA 2P8CA 4FEZA 4GK8A 2WQPA 3CQJA 1QMLA 2FZDA 3NQEA 2DORA 4JEQA 1UPPA 1BXBA 3T9PA 3ABSA 2AMXA 1UP0A 5M5DA 1ZBVA 4ZO6A 4M6QA 4MB5A 2PTWA 3CUGA 1UOKA 4XZBA 3NAVA 2PRMA 1KW1A 4MFEA 3LD5A 3VKBA 4JHOA 4HZ7A 2PDUA 4HA1A 2E09A 4Q8MA 4DLMA 3D5HA 2PWDA 3LHYA 5IDIA 3NWRA 1SJBA 5H91A 4UR8A 4WOZA 4JN6A 3W1AA 2VZUA 1QWKA 1RY0A 2NLYA 1DJHA 4PB3A 2G3FA 1JPHA 3QBUA 3S1XA 4X2RA 2UBPC 3KBWA 4H9XA 2CLMA 4KEMA 3EX4A 2UWFA 2XHYA 3CWOX 4TXEA 1XIBA 3VABA 1FKXA 3W1RA 2XSAA 4AU0A 4HMDA 2E4TA 1Q45A 1J5TA 2GVEA 1KFJA 3N29A 2QJNA 4JDBA 2D20A 1MUCA 4EAMA 1TR1A 3NO3A 5E5CA 3KRBA 2J8TA 3AWOA 1C8YA 3KS5A 4HK5A 4N4QA 4IG2A 5HNUA 1ZAJA 4RPPA 5LIWX 1POJA 1RV8A 1VHCA 1UWTA 4H6QA 3MT1A 4XSMA 2DT2A 3Q45A 2ZRVA 2DW6A 3TZNA 4OWGA 5LIXX 3WD1A 3PBUA 5BNKA 2OSYA 1G5AA 4L6DA 1TZZA 4CEUC 1J79A 4GI6A 1EP1A 3E2RA 4UQ9A 3LCFA 2IPWA 3M7SA 5IBXC 3ECQA 5C70A 1XL9A 4PUMA 4R88A 1NDWA 4V1YA 4DO7A 1XH1A 4CKQA 1Z7AA 4RE0A 4GGBA 3QPEA 4PMUA 2YCLA 1VBHA 5EFDA 4XAYA 4AISA 2VJXA 2P3EA 3WZ0E 1TA3A 2DFAA 1F6YA 3VKJA 1ECQA 3AMCA 2DVTA 4PMNA 4Q8NA 1Q6RA 2ZYFA 4LAZA 4AB4A 4G8TA 5DMNA 1H49A 3GS6A 3CXOA 1JCNA 1QNPA 1UWUA 1IEQA 5EGRA 2Y5SA 2CZ5A 1RD5A 4Z1AA 1Q6FA 2WM1A 3LI0A 5A2CA 4UR7A 3U5YA 4GQGA 2VKZG 1TZ7A 3V16A 4X9SA 4OBSA 4KKXA 1CGUA 2MNRA 1CXKA 1HN1A 2VEFA 4V27A 1EGVA 1MO0A 1XD0A 2Q8LA 3N6HA 1JQVA 4HN4A 3ENLA 3WBWA 1CIUA 1W2VA 3TR9A 5FF0A 3P5YA 4CD7A 3H7UA 1MW1A 4AWTA 1Y5WA 1X1NA 3SQSA 2NQJA 1LP6A 3WLQA 4PC8A 3QYQA 4A22A 1AFSA 1GVOA 3QMTA 1B31A 2WMKA 4GZ7A 2Q71A 3BSHA 2OPJA 4DF0A 1A5UA 2WQDA 4A8LA 2P5NA 4JFWA 3BARA 2YL8A 3QJAA 2RUSA 4AZBA 2VRJA 4UC5A 3SUSA 3GNOA 4Z1BA 3SGZA 3ARYA 1VJSA 3UWEA 1H60A 1MMFA 4N02A 4D8LA 1FWDC 4GY1A 1S2UA 1BRLB 5EMLA 3GKAA 3HB9A 1XRSA 1LYXA 1H61A 5FSEC 3LPPA 3R11A 4S3DA 1IT0A 1A80A 1IEVA 5D04C 1EX5A 1FVPA 1E9IA 1RBAA 2Z6JA 4JQ1A 1DJGA 4ZSUA 2PA6A 4GJ1A 1I45A 2J7GA 1PX4A 2XH2A 2WNNA 2F6KA 1ICSA 4G7FA 1ISYA 3U9IA 4AZHA 1UWRA 3WJSA 2VURA 4TX8A 1XLJA 3BANA 1GCYA 5T9BG 3U57A 3QGVA 3UJSA 4P2VA 3LPFA 1OADA 3IV3A 2A3EA 2PWEA 1Q6QA 1R2TA 1OK6A 3UWYA 3TAKA 5BU9A 2BFGA 1LUCB 1V03A 2GJXB 5KZEA 4XD3A 3KOWA 2XSBA 3W23A 1G9HA 3P14A 1O60A 2QCGA 3HV8A 1BWVA 3W7PA 3HPSA 3THQA 3NPXA 3O7UA 3ARWA 3PZ9A 3CZKA 3VOGA 1WAUA 3GH7A 1KM3A 3ATZA 3TQPA 3EXTA 4DZIA 3QLLA 3FHQA 4NI8A 2C1GA 4CGTA 2FHCA 3T81A 4OOUA 4PMVA 5G4EA 1O5QA 1WXZA 1QOXA 2YYUA 1JNEA 1CCWB 4DELA 4YWSA 4TTUA 3PY2A 1SMDA 2VRQA 3BGJA 3P3BA 3DG6A 3UBPC 3V7PA 1YE4A 1GTEA 1C7TA 4B2DD 3LG3A 2CBJA 4NASA 1QO2A 3AXIA 4C6PA 1R6WA 3KX6A 2R94A 4Q33A 1KBLA 1W32A 1QPKA 2IKHA 1JRBA 3A4WA 3UR8A 3V35A 5D32A 4JIQA 3L12A 4GZIA 3SRHA 4JTAA 3QYSA 3T55A 3TJIA 4BS0A 1HTIA 2PDNA 1ICQA 1A0DA 2UY3A 1ONEA 3MI3A 2C0HA 3WMCA 1S39A 1D9EA 1EBGA 2QJHA 2PRHA 3W70A 3AMLA 4NZ5A 3WLKX 1PV8A 2PD9A 1PL9A 1B57A 2Y70A 5D9NA 1I2QA 4HJWA 3WCZA 5JBDA 1LJYA 4L64A 3TSDA 2CU0A 3LENA 5A95A 4MJZA 2QQ6A 4EXQA 4S2CA 4IM4A 3VD9A 4KRTA 1KTBA 3I7SA 3CL7A 2D73A 2REQB 1E9LA 3WLOA 4XIMA 3ELFA 4QLJA 2YXGA 4Z2IA 2WMIB 4B9ZA 4NX0A 6PTDA 1DQXA 4K8EA 2JK2A 3HPAA 2WAGA 4PFHA 1HJUA 4GUGA 1ZZMA 3W01A 4NVTA 3AROA 3WDPP 4UTUA 3N2MA 1REQA 4FX8A 3GFYA 3AHTA 3J7HA 4L4PA 3ARQA 2W79A 4WGHA 3B8TA 2VDHA 3IVUA 3S47A 1JAKA 2QAPA 3KXQA 3AYSA 2J8GA 2NQZA 1WKFA 3TW7A 1DXIA 3N34A 1OD0A 2A1YA 3LN3A 4W9TA 4K8HA 2AMGA 3OZYA 3W1UA 2NV1A 1PZ2A 3H54A 1YBQA 4W87A 2Y7EA 4CD5A 1V6YA 1THFD 3WQ6A 1TMHA 4LVFA 3I6TA 5GNZA 4GQRA 4X0VA 4HYVA 1ZL1A 3ARTA 1BAGA 4Z1YA 3QMRA 5A5WA 2ISSA 3CWNA 3SCNA 1E0TA 3EOEA 2JKPA 1V6XA 1PTAA 1GVFA 3TTYA 3V1PA 2XFYA 4HA4A 2PGRA 4GVFA 3QV9A 1TQXA 4NAFA 3E2QA 2CITA 4DZHA 4B4HA 3AO0A 1XLKA 5XINA 2AKMA 4JFUA 4QLLA 1U1HA 4WK9A 3O8AA 3QF0A 3VVGA 3WQGA 2OWCA 1N7KA 2PC8A 2J79A 5C9RA 1ONRA 3B8DA 4KESA 1YXYA 2FB3A 3VMNA 5JH1A 3OBEA 2IPJA 4C5ZA 1SO3A 2WVUA 3MP3A 3NXLA 4HNTA 3BOLA 1V6TA 1X98A 1XI3A 2E6FA 1BG4A 1TPVA 4J28A 1Q6LA 2VZTA 4AYSA 4JIRA 4REQA 2ZUWA 3S1VA 3R8HA 5HQLA 1FWWA 2IUZA 4JKKA 1QI2A 3S5OA 4DZAA 1ISZA 3VU2A 4DJED 1IZCA 2Y8UA 2V8ZA 1KFWA 3JUGA 4EOUA 3DHDA 3CHCA 3BW4A 3U7BA 2PDMA 3KDOA 2O4QA 2OYMA 4XX6A 2WZMA 4F9JA 5I3JA 4M1RA 1BYDA 7TAAA 4O18A 4Q4KA 4L9YA 5CPOA 4MYAA 1GOXA 1ZBCA 5IHSA 3VAVA 1EUNA 2BHUA 5BW6A 3G0XA 4H8UA 3B0VC 3GC4A 1F2JA 1R3YA 1ZAIA 4TUFA 3LHTA 1EBHA 1EF3A 1GQKA 3RK8A 3OQEA 1NJJA 1GOQA 4DVOA 4ERGA 4LUSA 4WDTA 1IXQA 2EPHA 2Q6ZA 4M56A 1YHTA 3FAXA 3KM8A 4ECLA 2GJRA 3MA8A 3EEGA 4LNYA 2GGEA 4DF1A 2P50A 1E6XM 2PF0A 4BF5A 2GWNA 1WKYA 3NO5A 4KERA 3BWWA 4H7ZA 2JQXA 3JVAA 4DJFD 3QH2A 1FH8A 2PAJA 4R7OA 5EMYA 4IX2A 3V0SA 4UCFA 1XG4A 1CGVA 5GPRA 4BFAA 4UQCA 2OEJA 1K7FA 3REQB 1WYIA 1TV4A 4EAYA 4FF5A 3M6YA 3RX4A 4F8XA 4LU0A 3FY1A 2QDEA 2XVGA 5DMMA 1H5VA 3Q94A 1YX1A 4WOQA 1EIXA 4MADA 3GG8A 5BOOA 4KT2A 3OIHA 1CGTA 1VLWA 2G50A 3H8AA 2XVNA 2ZDRA 1VEPA 4HCDA 4JTSA 2ZE3A 2PLJA 1XSIA 5D4YA 1GT8A 3QZEA 4XVEA 1AJZA 4AXNA 4DX3A 4DJDD 4WSHA 3W7CA 1JGIA 1YYAA 2VFFA 1Q6OA 3NG3A 3G0UA 1QW8A 3H23A 3L7RA 1DTUA 3UFYA 3ITOA 4EWJA 1DKWA 3STFA 4TX6A 3W71A 3RR4A 3RMJA 1XGZA 3F2CA 3PFRA 5T9CE 4ZSTA 3TTQA 2GQAA 3ZJ8A 1E4NA 2BLEA 5I3KA 4RZBA 4TVUA 5F4WA 1E55A 3QTPA 1TZ9A 3A4XA 1H7PA 2EPNA 2X40A 2PDIA 2INEA 4UR9A 3WLSA 3UY7A 2PP0A 3SUUA 2CBIA 1B3WA 1QOPA 3W7NA 1KLYA 1H7NA 1Y8BA 3NGJA 1H11A 4QCEA 4H7CA 4PYSA 1GVSA 2JIEA 1VKFA 4PR4A 5C2XA 4RXGA 4ZFCA 4GUHA 1H5YA 4FK9A 4DWSB 1R3VA 2QXWA 1F4AA 1QDSA 3ALFA 3S5YA 1UR1A 4O16A 3SCPA 4Q4MA 1TPDA 2QCEA 4ORIA 1UH4A 3R0DA 4GJJA 3JU2A 1HO4A 2PRLA 3ZOAA 1JUBA 4J1OA 2WCAA 4W4QA 3S4TA 4P61A 3CC1A 5K9XA 3PAJA 5CAKA 3POHA 3MU7A 3SM0A 4EANA 3C0QA 4PL1A 1BTCA 4U3AA 1Q5MA 1FHLA 5F4SA 4AZIA 2D2OA 5LA0A 2O9OA 3NL2A 3QVQA 3R43A 2YFNA 5K4XA 2VR4A 4N9CA 4JY8A 4UTMA 1JNDA 1I0DA 5AHEA 4ZQCA 1A5KC 3LXBA 4IMGA 3UZWA 3ICJA 4CU7A 4IFRA 1ZBWA 2EBNA 1VB9A 3CHVA 1U1UA 3WBYA 4JDYA 4LY8A 2FPVA 4JNMA 2XPKA 1ONWA 3IVSA 1LL7A 1OCNA 2DU2A 1XINA 3TAOA 1XIEA 3R13A 1KCLA 1XP3A 4YJ5A 2DSKA 1VFOA 3NQBA 1A53A 1YNPA 3MYPA 3GY1A 5HJLA 3IJQA 2AQOA 2J7HA 2R91A 3CQHA 3WNNA 3DKLA 4HHLA 1Q7MA 4FNUA 1T6MA 3W28A 3DFYA 3E3HA 2CC0A 4XZLX 4EKJA 3M4HA 7TIMA 1WO2A 1VEOA 2DZSA 2VD8A 2NUXA 3MSGA 4CNPA 1RHCA 3KTSA 4QITA 3CUFA 3BSGA 3NDYA 1UUOA 3P61A 2XUCA 2A7PA 3TWAA 2PZNA 4IFOA 3TUUA 1VH7A 4B4FA 1OFOA 1XQKA 1GQIA 1GZGA 1QNVA 1LF1A 5EBUA 1H51A 1SO6A 4ZGYA 1TMQA 4M81A 5HMSA 4MSSA 3UVAA 2QLYA 1BVZA 3CWHA 4JZ5A 1C29A 1NDVA 4MNLA 4PMYA 3RF9A 1T41A 3UCQA 1H09A 3IVTA 3E2SA 4BQ5A 2HVMA 3UR5A 3EGJA 3K8KA 1OG6A 3BO9A 3VGDA 3IJLA 4QG6A 3NJ3A 2E9BA 5FEXA 4MAVA 3E2VA 3TXVA 3EDJA 1FWRA 3WBEA 3H2FA 5C9UA 3TFXA 1DXFA 1O5XA 3RPMA 5HPCA 3V3WA 4GBUA 4J2PA 4JYDA 1RZMA 3N2BA 4WIWA 4M1BA 2NVAA 1ZP3A 2C6QA 3PAOA 2DPEA 1TIWA 1NIUA 2ZCGA 4GQQA 3HQPA 3LK6A 4FXSA 1YDOA 4QNWA 3IIVA 2W67A 1O4UA 3GXPA 3N13A 1RP8A 2FTYA 4IIDA 5DRCA 3QR0A 1O12A 2DZWA 3VIHA 3U4FA 2UY2A 3QSRA 3GDKA 4W8BA 2OZ3A 3TC6A 2BZNA 4XBSA 1FH9A 3ME3A 2Y5JA 6XIMA 2KX9A 5RUBA 2V68A 4CN1A 1E1CB 4BKNA 4GG9A 3WK2A 4K39A 4FX7A 1UWSA 6REQA 2QJGA 3FVMA 3L0GA 3QY6A 2AOSA 2ZVIA 4BQ3A 2E1WA 2Z1BA 3DC0A 4GUFA 2ZA2A 3FJNA 2BDQA 2FTWA 2JF7A 4I7WA 3F5JA 4NF7A 5DXYA 1K7EA 5BOFA 4CCCA 4GD0A 3TA9A 4JTQA 2Q01A 2WPBA 4M6VA 4U3CA 3U4AA 5EY5A 3N1AA 4PUEA 5JQ9A 3F2BA 1H63A 2CPUA 3VM7A 4YTSA 3T0AA 2R1KA 2QMJA 4GYFA 1IZKA 4J40A 4AX7A 3GHSA 3KL3A 1KGUA 2J7FA 2PDHA 4ACZA 1O1HA 1YTDA 3QOMA 4N2YA 2WSRA 1MRAA 3YPIA 1XYFA 3ITCA 1VRXA 3SRDA 1W1A1 4HB7A 4MMWA 5M03A 4JCLA 5KTLA 5CGMA 4NXKA 4U31A 3G2GA 1ZJBA 4CEXC 3ITYA 1TTJA 2I5GA 5DBUA 3SJNA 1AZ2A 4RDVA 3KOZA 4Q8UA 3S2NA 4YYFA 1Q63A 2HZGA 3GLCA 4JEJA 4A21A 4GRSA 5LHFA 3OYXA 3VXGA 3HG3A 4JTTA 4XV0A 6A3HA 3WBXA 4LUTB 3E0FA 4IXHA 3H21A 2AQVA 1DJNA 1BHGA 1E1FA 1B30A 2J25A 5I3IA 3MJMA 2GUUA 2D22A 3HURA 2GFTA 5I23A 4CNSA 3QN3A 3EYPA 4XBJA 3WF3A 4HNVA 3I68A 2ODOA 1AQMA 3CV1A 4W7VA 3EPNA 5FIPA 3T44A 1SVDA 2FIQA 2V82A 4K6AA 1W5NA 3KBNA 4JTUA 2W61A 5C9XA 1IEXA 2WOQA 4O10A 1KRCC 1W6TA 3W00A 4PEEA 3TDFA 3W25A 2ZUNA 3NQFA 1DJWA 2ABAA 1XGEA 3TTOA 1OFPA 4O0KA 3S5NA 3DESA 3GZAA 4WUIA 3EKLA 1WOBA 3WH8A 1R86A 1A5NC 1EJ7L 1P0BA 3WQOA 3CQIA 1JUKA 3NQDA 5LIKX 2XZ7A 4CQAA 3TN4A 1JZ7A 3MWAA 2CEQA 2P88A 2A3BA 7REQB 1EJSC 3DDMA 2HMCA 3DXIA 4D6GA 2YA1A 4BI7A 2D24A 2BGQA 5FACA 3XISA 3ATYA 1EGZA 3ORWA 4KWWA 4O57A 2EPLX 3WF0A 2OO6A 3FNDA 5KMYA 3BLDA 3FGCB 3EWWA 2YPIA 3KW3A 3UG8A 3SEPA 3F1QA 4PUWA 3GNDA 5CSUA 1JPMA 2J6VA 3RYSA 2FVLA 3HFYA 3TV8A 5I78A 2QV5A 2AAAA 2DV0A 4MAZA 2R14A 4P8WA 3RLVA 3OVQA 1IV8A 1LLZA 5C5YA 2OWXA 2XG9A 3G77A 4NAEB 4LV9A 4LWWA 4F9DA 2NV9A 2HJPA 2RDXA 4GABA 3DYMA 4EIVA 3NYDA 5AZ1A 4ERAA 3BZJA 3E0VA 3LPGA 4CQ9A 4NNAA 3HIJA 4L56A 1TJ0A 3WLTA 3FN9A 3M64A 5AC8A 3W83A 2WMGA 1VYSX 1ZSXA 1OX4B 3WIJA 1KM5A 4I5RA 4QJ5B 4IP5A 1OB0A 1Q7QA 3SO7A 4H9ZA 3WJXA 2WWDA 4C6MA 3JS3A 1VFFA 3MTWA 4X2PA 5D30A 4LBUA 3EDDA 4RDZA 4ZB2A 3TONA 4X0NA 4PN2A 3TOPA 2ZFAA 4AZ5A 2XH0A 3B0YA 3R6IA 4ROPA 4OUEA 5BCAA 1AH0A 3LCWA 1VEMA 3U2CA 1YPIA 3AIBA 3WMSA 5JMUA 4QE5A 5IDZA 4ZTYA 1G1YA 4NZJA 3JW7A 1QNQA 1UKPA 3UCCA 4QE4A 2NX1A 4QXIA 3EDFA 4DXVA 3IS4A 5KEZA 1KCZA 3L23A 4Q8QA 1C8VA 2PDQA 1ISWA 2TRSA 1EL3A 5B7ZA 1V8EA 1VR6A 1BSIA 3PJTA 4LSBA 5E0KA 3NIYA 3CYJA 9CGTA 4C65A 3SFKA 2FTPA 3PR2A 4DO6A 1JG9A 3SY1A 1BKHA 3KFTA 1U5HA 1R85A 3OOQA 3ITLA 2LLEA 4PSRA 2XFRA 4QM1A 1JFXA 4E2VA 3CL6A 1DJZA 1GJUA 2ZUVA 3W29A 1H1YA 4RNIA 2WCSA 3BAYA 1HKMA 5FSDC 3G1DA 3TA6A 1XYLA 2QGYA 3BQ6A 4IG2B 3KHJA 3GHUA 4IMEA 3HJEA 4GA8A 3EPOA 4AC1X 4DYKA 1F73A 3BAKA 3NQCA 3QZAA 3RLHA 4AQLA 1PIIA 3MI2A 3AS1A 3OB8A 4A8IA 1RBLA 4KWOA 1ADDA 3LZ3A 1M7OA 2VT0A 4WDUA 2Z0IA 4W7UA 4OBTA 1D2KA 1J0HA 4HHHA 2C14A 2FH8A 3KBJA 3P7YA 4A35A 4O54A 2ANUA 3AHZA 4CCDA 3DOPA 3IANA 1WNOA 2YZ5A 2ZTJA 5LNVA 3MZNA 1UWIA 3L65A 4GINA 3GU9A 4A8NA 3T6CA 2NVDA 2GPTA 3K1DA 1TJ1A 2XZ9A 4E8CA 1B0IA 2PB1A 4BR1A 2RJHA 5FF4A 1H7OA 1S3HA 4I5XA 1ZNNA 4V2XA 2V3DA 1EEXA 3RCNA 1WA3A 1DWGM 1XCWA 5FL1A 3M0LA 4GNKB 4J3TA 4K7VA 4UWMA 4Z0SA 3MMWA 3W86A 8CGTA 2EHHA 2HK0A 2ZC1A 4B15A 1JDCA 1V3LA 3RLGA 3LSCA 1YNYA 2QNEA 1ALDA 1M53A 3SUTA 1E9ZB 1R2RA 1MNZA 2ALRA 2Y61A 3ZMRA 2ZZ6A 4RXFA 3B0UX 2WLYA 2ISWA 3RIKA 4V15A 3GRIA 4N6EA 2GJNA 2WVTA 3GR7A 3L4YA 4HMNA 1LOSA 3CZ8A 2DQWA 4UTJA 3RPDA 3TFCA 3ZJKA 2PTDA 3OHIA 2TODA 1D3HA 1OT2A 5C2GA 3TOYA 3MBFA 1W5QA 1A47A 3CO8A 4HHMA 1W3LA 3C8FA 4NQ1A 4KMQA 3EA3A 3N3MA 3FSUA 1M9HA 1X8FA 1M7XA 2ZDSA 4FOUA 3AUOA 3GBDA 4IP4A 2FZ9A 4ATLA 4GYKA 3N4FA 3WK3A 4QTGA 1BF2A 4UTTC 3WF2A 4XD4A 3GD6A 1B4EA 2J13A 2O0TA 1LLOA 3NZ1A 2E77A 4ZTXA 3MCOA 5E6ZA 3HF3A 2W27A 3W2JA 1HKWA 1UIPA 4LYKA 3PTMA 1DE5A 1E4LA 2INZA 1XHGA 3QKZA 1J93A 4LPCA 2PS2A 3EX2A 2CNCA 1FWHC 3O6CA 5A6JA 1DOSA 4PRWA 4PCTA 4LBSA 3M16A 5HPOA 2NXIA 3M0HA 3OZOA 1C3FA 3B4UA 1ITXA 4NYUA 1J11A 1YXDA 3VC6A 4MWAC 4CQCA 1T5AA 1YKWA 4FI4A 1BFNA 1PSCA 1ECEA 5A6KA 3ES8A 3PPGA 3HJZA 4LFYA 4LB4A 1EFZA 3EBVA 3IAPA 1OM0A 1WQ5A 1M03A 1C90A 2WVVA 3ID7A 4JYEA 4MUZA 2FJUB 4IIHA 2PWUA 3GUWA 3NL5A 4W8AA 2I14A 4TIMA 2V63A 2V3GA 1K6AA 4LCQA 1VC4A 1SFTA 3S1UA 3N2TA 2PLMA 3BQ5A 2OZ8A 4B3ZA 3P82A 4GUIA 1X7IA 2XVKA 5CLTA 2GVYA 3VM5A 2HSAA 3WSUA 4BQ4A 5LGZA 1K3UA 4L4MA 3KBVA 4MDOA 2WJDA 4C90A 1EC8A 4Q7NA 3H4WA 5DY2A 4O17A 1EOMA 4HNNA 1AQ0A 4HA3A 1UBPC 1P48A 3UESA 1DJXA 1KKRA 2YA2A 2NSXA 1UROA 3AALA 1GTHA 5HJXA 1FWBC 1G4EA 2DH3A 1HGWA 2QCHA 4ZVJA 1OIMA 7ODCA 4XD5A 4XZWA 3FDGA 4H04A 4KH2A 4N42A 2QF8A 4YL2A 4EF9A 1JYXA 3B06A 2PC4A 4H00A 4C6FA 1JPIA 3FW6A 3LEPA 5CXPA 4I7UA 3W85A 3GXMA 1R9ZA 3W3OA 2P8BA 2Y85A 1CGWA 2HXTA 2RGMA 1W3JA 1C91A 3CTLA 4H6KA 5AC6A 4MWAA 1LQ2A 3HPXA 1SQ7A 3B97A 4Y90A 1DIEA 5TAOA 4XAZA 4DUOA 5D09A 4A3YA 1KRBC 1UKSA 1F4HA 1H1NA 1PKMA 5EMUA 1L2UA 4JTRA 4AZ6A 4ZA0A 1E5NA 5JH2A 2DEPA 4Z2JA 1DP0A 4JCMA 2F61A 4K37A 1AW2A 5FJUA 4EPDC 1LT8A 1JYWA 3N6JA 1SZFA 1OFEA 2DZPA 2CKSA 3WMLA 2C18A 2RKXA 4L61A 1EYWA 1QWGA 4B5VA 4H9VA 5LIYX 3EWXA 2YL6A 2HEJA 1G0CA 1HT6A 3BMWA 5B7YA 1NY1A 1R3TA 2E7FA 3LRMA 1Z9AA 1X39A 3GXFA 2C15A 1SFJA 2ZX8A 4YHEA 4NUWA 1DJIA 1JCYA 3VC5A 1LCOA 1V3MA 5FEPA 3BVJA 2G3JA 4IUOA 3V1HA 2PLKA 1CPUA 1XFCA 4V28A 3CUJA 3EWYA 1I0BA 1W9XA 2PU0A 3BE7A 1D7FA 1RK5A 1TRDA 2Y88A 3BG5A 3Q4DA 1OFDA 3FA3A 3IJDA 1OFQA 3LOTA 1LBFA 3T08A 2HRWA 2AKZA 1M41A 3OU8A 3LGDA 3MPGA 2GQ3A 2VZVA 4J4KA 4HGXA 3QFEA 3CAWA 1HL2A 3V5OA 4PA8A 4GYJA 1PX8A 2IQTA 2UY4A 1R30A 3LLFA 4NKCA 4DPPA 2G96A 4FNTA 5HNNA 3NZPA 3F2DA 4GI4A 5F1UA 3WDQA 3AAMA 4H2CA 1AQFA 4MKSA 1KV5A 2VEMA 4UXDA 1IQ8A 4E4UA 3N6QA 1PZ1A 3AHXA 3AYTA 4W88A 1GQLA 1OJXA 3ALGA 3OPSA 3C0LA 2VM8A 2B7QA 3GHRA 3HMJG 3MB9A 4FR1A 4I7VA 4XD6A 3C52A 3E02A 1OCBA 1ZBKA 1UC5A 1K77A 4UFIA 4Q4RA 1ZLPA 3LMZA 4Y9AA 2BVWA 2YB1A 2VP8A 3UWZA 3S1GA 4PTNA 4M7SA 3E12A 4M6UA 2OELA 1ENUA 2ZRYA 3LV6A 4GY0A 1JGMA 3E49A 3EX1A 1TPWA 3L21A 2PPGA 3P80A 1AH4A 2FMOA 3UA4A 5DELA 3ITXA 6CGTA 4JFTA 5AFDA 2D69A 3WFZA 2VCCA 1JULA 3HQNA 5CPSA 1GVEA 2GDQA 4DXKA 1UQZA 4D8AA 1Q7ZA 1JCLA 1GYMA 2YXXA 3PZIA 2JGYA 1W9PA 1TPUA 4XTIA 4QDWA 5EB8A 4WRHA 1B4KA 3ANUA 3OHMB 1XF0A 3F7JA 4YVVA 2GJPA 3DI1A 4GPNA 3HBLA 5F2LA 5E0CA 1TKKA 5D2YA 1HL9A 4UOZA 1YADA 1KGWA 2FMNA 3VKDA 2A79A 4ZBCA 4IMDA 1TWZA 4JPGA 3W24A 2RGLA 3VD4A 1AW5A 1O68A 2E28A 2PGWA 3UGVA 4AW7A 1DQWA 2J27A 1TPH1 1ONXA 3NSXA 1M3UA 1ZTVA 4RJEA 4J3ZA 2E67A 3KLKA 3NL3A 3VNDA 2PDGA 1PIFA 4O8RA 1UMLA 1RVKA 4ZB5A 5JUVA 1LG1A 3PZUA 4GKTA 1JF6A 2E40A 1VBUA 4EX4A 3BAJA 2PMQA 3M5XA 5BWFA 3HGJA 3MUCA 4B2DA 1I4NA 1SU5A 3L0NA 1LL4A 3UZYA 5JBEA 1EDQA 3WQDA 3LNPA 1W9UA 1PZ0A 2CHOA 1CXIA 4OV9A 2VOMA 1M04A 3M44A 4QDPA 1MSSA 3THCA 3ARVA 2NLIA 4AZCA 1A4LA 3HMCA 3BSMA 2R1MA 3OZPA 1MW2A 3GFXA 1KFBA 2TYSA 1UD2A 1NTHA 1ZCOA 2PTZA 2BHZA 1NQ6A 2GYIA 1NF0A 3ZM8A 2X0SA 4HPJA 4N4PA 1GGOA 1CGYA 5EU9A 3IJ8A 1T40A 4ICMA 4URIA 2Y8KA 2Y1HA 5C8BB 4AEFA 3RXZA 2RJGA 2GGGA 1YDYA 3PBYA 1GQNA 2ZUUA 3FKRA 3SN4A 4WQ6A 5HNRA 2QAFA 2FDSA 1XDMA 4UQEA 3VDCA 3WF4A 1E15A 1Q13A 3DGBA 3UYCA 5EMMA 2ZZ2A 1Y0EA 3UWQA 3HU7A 1KBJA 4D6CA 2P1FA 1PVNA 1MUMA 1UH2A 3MP4A 3TNOA 4S3JA 4UZUA 2PGFA 2PCEA 2P0IA 3TX9A 1KWGA 1EXPA 3NQAA 1K4GA 3VINA 1XGDA 5J5RA 2PUZA 1K6WA 3ABXA 1BYAA 4NNBA 4GUJA 4GBDA 5DY3A 1Z42A 2GK1B 5ABEA 1A5MC 4KCUA 5HATA 5BRQA 3IAQA 4QDMA 3UJEA 3GSMA 2QEZA 3U5UA 4B5WA 4M5PA 1AH3A 3FXGA 3PUGA 4U5IA 4A2SA 2OTDA 3A3XA 2IS7A 3ITTA 2J77A 1P0NA 3EX3A 4AWEA 5JXQA 5E9XA 1N8FA 4O0ZA 1VFTA 5D05A 4NJIA 1TTPA 3KEHA 3E74A 5DFAA 2WNWA 2ZQ0A 4NP7A 3RX2A 4K8GA 1J4EA 3O16A 1LWHA 4RE4A 3W7IA 2DZBA 3W7RA 3PZTA 3RITA 2QIIA 4US6A 4G56A 3T8LA 4D8ZA 1NWRA 3R7MA 2D0HA 5E1QA 4PODA 4D6EA 1W8SA 4DWSA 4F0RA 4PBEA 1W91A 2DP3A 3SCTA 3O05A 2DZVA 1XWYA 5BXSA 1S3TC 2NX3A 4XO7A 1JUEA 1RBOB 1CT5A 1DBTA 5CQ1A 1R47A 1JXJA 5U4NA 1IT8A 4E3VA 2WPGA 1OSEA 1UR4A 1E0VA 3CEPA 4IISA 2YJQA 1MEWA 4LVGA 4QNEA 1NOUA 4YWIA 4Q22A 1IIGA 2QCLA 2FGLA 4LVBA 5BROA 3PSWA 3RN6A 3KTXA 4M51A 4IGNA 3GBEA 1E6SM 4YNGA 1RQEA 3APYA 3VNKA 1QPOA 5FESA 3GH4A 4CUCA 3KP1A 3BZGA 5IFTA 2C79A 3QTGA 2NQLA 2OG9A 1UW9A 1FP9A 4PCSA 1GUVA 2Y7GA 1F6KA 3NGFA 4JX4A 4X22A 2WO5A 4GFIA 4H4IA 5AVNA 4L9XA 3APTA 3ZR4A 2J4GA 4PMJA 5D8WA 4LRTA 3RR1A 3L4TA 3NM1A 3LX9A 1ADOA 4KGJA 4FLQA 2PP1A 4E0CA 1ME9A 2D3LA 5EBAA 4IJRA 3W1TA 5CZJA 2XVPA 1XYCA 3AXMA 4L6OA 5H1WA 4RDWA 2FGBA 1R8LA 5ENLA 3WX7A 2WSQA 1HP5A 2V5CA 1V4YA 1GZJA 1O7AA 3A4JA 4H83A 5AOUA 3H22A 1A5BA 5DCBA 4N6FA 4DBSA 3WLHA 4FIQA 5CG7A 4ADTA 2Z2BA 3N25A 4BCEA 1MDRA 3TYUA 2OJPA 3W1MA 1Q4NX 3B9NA 2W4XA 4DO5A 3RFAA 4DI8A 3BH4A 1EWDA 3B4YA 3APGA 3RO8A 3B9DA 4DEFA 3C2FA 4H1ZA 4AYGA 2VFHA 2IPGA 2CERA 1XYAA 2O7QA 1V7YA 3EDKA 3QHMA 1CX9A 1KD0A 3PBVA 3KZPA 3AIRA 3C2VA 3M07A 2CLIA 4NIRA 1V93A 2GQ8A 1WP6A 1TUXA 1RP9A 4AVOA 2P3ZA 3OGVA 2G3MA 1E0WA 3BTNA 4ICCX 4NZ4A 5IFPA 5I6SA 3W87A 1WDQA 5CBBA 5F2GA 1F7BA 4PUUA 4UMAA 3ZVHB 1ML1A 3H55A 1MEIA 3N9RA 1KM4A 2XSXA 4GLEA 1M5WA 3FYOA 4ZEPA 3WO8A 1K02A 5FF7A 5FF2A 1XC6A 2QZRA 1NFPA 1LOQA 5JIPA 3L2LA 1XPYA 3W53A 1SW3A 5AYBA 3O9NA 1XLMA 3BW2A 4JOMA 2JALA 3VNMA 5D38A 2CZVA 2I7GA 2R8WA 1BD0A 3CAVA 4HOWA 2BODX 4TOQA 3QQ1A 3M1ZA 2RH9A 1J18A 3IJIA 2E6YA 3BJFA 3QM3A 4RW3A 1YPFA 3CUHA 4W8LA 3FCPA 2G3NA 5A8OA 5I07A 4MZ1A 3S3GA 3GXTA 4ATDA 3N15A 3MKCA 4MY9A 2J74A 1HL8A 1DWHM 3PNZA 4FOJA 3SN0A 6REQB 2J66A 4WDWA 3WD3A 3DZ1A 3P84A 4PUJA 1RXOB 1TJRA 4Q3MA 3PS7A 5I03A 3M6DA 4EP8C 4KWSA 1IXNA 1VJZA 3SIMA 1QFEA 1R3WA 5FJOA 2J24A 1DIKA 3Q67A 5CPQA 4YTQA 1GEQA 1HKJA 2H6RA 4R9OA 2O56A 1OWQA 3KHDA 4MGGA 4R7JA 2I56A 1EP2A 4MTVA 3PZVA 1QNSA 2CKRA 4S3FA 4S3AA 1ZALA 4PMOA 1JJKA 4IQJA 4NYYA 3TQKA 2VO5A 4NILA 1E1EA 5IOBA 2O55A 4TVDA 2F7FA 1GOIA 4QJ1A 4MB3A 3IARA 2ZXDA 1NELA 1B9ZA 3WN6A 3DAQA 4BA0A 4G5DA 1W0MA 4M3PA 2E6AA 5AC5A 5E9AA 3NXFA 3UGRA 5BZAA 2VFDA 4IIGA 3GTFA 4OQVA 1UWAA 3N19B 1XLGA 1J0KA 2C0AA 5TNVA 2PEVA 5D8ZA 5CC3A 4MLJA 5FJTA 1H0GA 4Y2WA 2HS8A 1XH0A 4J9JA 4HVXA 2QCMA 4ZXLA 5IXEA 5HMDA 3LA4A 4CQBA 2WJEA 2W91A 3KOYA 4H41A 3VOJA 2EJ1A 1KM6A 4C1NB 3U0HA 3UJ2A 4LUTA 1Y5VA 3CU2A 4BK9A 4JTGA 3EXRA 5HNTA 2PBOA 2CHRA 5EYWA 3GTNA 3QFWA 5KSWA 3DBNA 5FA5A 1V3JA 3EMQA 2FB2A 3N9SA 1UZDA 3WJZA 3Q2DA 5C2CA 4ML9A 4IXXA 3M47A 3A24A 2EAWA 5FKYA 1SUXA 3RRAA 1W37A 3AU2A 3TJXA 4RE3A 2OKTA 1E71M 2DY3A 3CMGA 3MW7A 4O4WA 1ZQ5A 1YEYA 1SMAA 1AA1B 1W9VA 3INPA 3A12A 1CZ1A 1QNOA 2VC7A 4C6DA 1B3OA 3ONBA 5J8LA 4EPBC 3NQ2A 2BG5A 3GG0A 1HGYA 4AH7A 1PUDA 3GXIA 3WH9A 3A23A 2EG8A 1G6CA 3CQ0A 1JR1A 3W38A 3V0TA 2R6OA 1QR7A 4B5UA 1H41A 4FOKA 3WH6A 3SN1A 2ZBTA 1T8XA 3WLMA 3L4UA 2VQTA 4L1XA 3NA8A 3VIMA 3K4DA 4ZOCA 1UH3A 3GH5A 3MY9A 1IR2A 3UJFA 1PKLA 3V36A 3FGCA 1PZ3A 2AL2B 1U5JA 3MUAA 3ZT6A 1MQQA 4IL0A 4S2BA 3WG6A 1VBGA 1UMYA 3PULA 1PTDA 1T8QA 2Z4GA 4PL2A 5D33A 4ZQOA 1KQYA 3MCNA 4MLRA 3T2OA 5CJ5A 2YCJA 3TYCA 3LCHA 4ASTA 4MM1A 1YMYA 5M3WA 3BLLA 4LAKA 1W56A 3BURA 1FWTA 4UTIA 5AC4A 4C6CA 3KDNA 4FR6A 2C19A 2O92A 3NZGA 5BRBA 4Z1DA 2ALDA 3SJ3A 4BI5A 1MWOA 2HWGA 4ALDA 3OVGA 2WNQA 4JTCA 1JXKA 1L9WA 4GYPA 4F0LA 2OLSA 1DJYA 1JQXA 1C9DA 3S8HA 3A3HA 4IPIA 1OX4A 4PMZA 2DT1A 4ATWA 2XU2A 1GWJA 4WY0A 2E5BA 2BMBA 2E1DA 2EG6A 1DTNA 1OZMA 4LS1A 3VE9A 1DYSA 4O52A 3O6YX 2Z28A 1WXJA 2CETA 4M19A 3O6DA 3PWIA 2BS9A 3EOUA 5D9OA 3KCLA 3G18A 1WB0A 4XZNX 1HKIA 4JS3A 4L9ZA 2VFGA 1GKQA 2GUYA 2W3ZA 4ZO7A 2DJXA 4PMQA 5DBTA 3GYCA 3U6WA 3RDKA 1ISXA 4B91A 1CBGA 3ZXWA 4O14A 1K9TA 2V69A 2QS8A 4MWAD 2Z2UA 1TELA 1SW0A 1XW8A 1FP8A 4DHGA 1V0KA 1GPFA 4PTDA 2JF6A 2VZSA 5JU6A 3G6MA 2Z7KA 4P5UA 1X1OA 2WHMA 3VTRA 3WJWA 4F66A 5CSRA 1TWSA 4C6OA 5GVJA 3S2LA 1E56A 5G4HC 2ZVRA 3MYOA 4PCFA 1QBAA 2RDTA 1LOLA 3USZA 4XQ6A 3MO7A 4OOZA 1VPYA 1UOZA 3MHUA 4FXRA 3VILA 4BHYA 2I57A 1DVJA 4KS0A 3ARXA 1M1BA 1BWLA 1FH7A 2IQDA 4FXJA 1UB3A 4XUYA 3AJXA 1KCXA 2OT1A 2VUNA 1XS2A 4HU8A 4Y7EA 1TTIA 3VOHA 3KCJA 1JF5A 4AEOA 2Y0FA 3BAXA 1UIOA 1DWFM 4PUKA 4MY8A 2BNJA 2WC3A 3W7EA 3MCMA 5E70A 3G5EA 2OX4A 4O1BA 1H50A 1RPKA 1VCVA 1NSJA 2Z00A 4D6DA 1UR2A 4K3ZA 4PSPA 4F2UA 2H3BA 4FXFA 4YLWA 1W1PA 4N9DA 1BVWA 2D2GA 2X1SA 5BXTA 3N12A 4JL2A 3B8UA 2A3LA 4GE8A 1JI2A 2GDVA 1XLEA 1JZ4A 5CBIA 3KRUA 3P60A 3IUDA 1QPQA 1C92A 3C86A 1XV8A 4G7EA 2XINA 1WKDA 3PM6A 5FJJA 3W26A 1Q8AA 4IGMA 1W17A 2QPUA 3DFHA 4A3HA 1UQYA 1CNVA 1OINA 1EO5A 4GX9A 4H8HA 1TWWA 4OUIA 1N2VA 3SRFA 1EUAA 1M6JA 5I09A 1U2YA 1F3XA 4LCRA 1GVRA 4ADUA 3D6NA 3E0WA 2D1ZA 2AL1A 4K1GA 2X1TA 2J47A 3I3EA 1LT7A 4YVXA 1RJRA 3KOFA 5I00A 4XB3A 2VCAA 3UEQA 3VPLA 4NJKA 5G4WA 3P2VA 4GVGA 1Y7VA 2CXGA 3B9EA 3EZ4A 1RPXA 4S3GA 3GTXA 2CBVA 3CT2A 2HE8A 3H2MA 3T2PA 1K8ZA 3QC0A 1XKJA 3TYBA 2C8NA 1E70M 1C7SA 4J27A 4LBRA 4HHPA 4JIEA 3DFTA 3SRKA 2PDLA 4WXYA 4GNVA 3C2RA 4W5ZA 2XIQA 4PTVA 1DHPA 2V2DA 2FKPA 1A5CA 3FJLA 1TV7A 3RM8A 5CH9A 1CLXA 3NSMA 3URQA 3M43A 2YA0A 3OODA 2FPYA 3B03A 3VX0A 3IGXA 1XQLA 4E2OA 2HPMA 1V02E 5REQB 4I6VA 5FD0A 3WDIA 3WUBA 3FDKA 3L4XA 3WBAA 1ISVA 2QCDA 1S5VA 1BTMA 2WKJA 2B4GA 4E2BA 3TR2A 3VZYA 2FZBA 1D7KA 4ROQA 3S42A 3ARZA 3LU2A 3GDLA 2O9TA 1IGSA 5EMJA 2TSYA 4WGXA 1ZENA 4PB5A 3IRSA 2VR5A 2CFFA 1R7AA 2FYMA 5EKYA 3SZ8A 1WDWA 2O7SA 2WMHA 4QAWA 2QPXA 4IZGA 3HPFA 3TSBA 1HP4A 2JE8A 1PX3A 3W73A 4M29A 2CLPA 3PBWA 2W66A 3SQLA 3DEQA 4AD1A 2Y7FA 3FHAA 4HZ6A 4P7OA 3EA2A 5HJYA 1P43A 5D9MA 1KBIA 3I4KA 3ZLFA 4JGDA 4ZOBA 3ZZ1A 4UNIA 1NWSA 3GU2A 1OYBA 3USBA 1AG1O 1EH9A 1W5OA 4NZ1A 1ADSA 4UTLA 3NEVA 1POKA 3NQMA 4X61A 1AQHA 1FRBA 2D23A 2BTMA 4X63A 4G1NA 1UR8A 3PHAA 1EWEA 2E68A 4DY1A 3AIVA 4BWLA 1A5AA 2F8QA 4GO9A 3FYPA 1B2YA 5BXRA 1QPRA 3ZO9A 5F1VA 2ZXQA 3I3BA 3ZSSA 3PANA 1GONA 4DAIA 1RQBA 1I2RA 2IXVA 1V0NA 4AIBA 4P7NA 1RA5A 4HTBA 1A3WA 5C6MA 5CJMA 1F76A 3FYYA 1PEZA 4C6BA 1UD6A 3R8RA 1Z69A 2OVLA 4QSFA 4AMCA 3JRKA 1P7TA 5D2XA 2XIIA 2XWDA 1EQCA 3CLMA 1AD1A 1OFBA 4DJFA 4C91A 3AJ7A 4DBWA 4FAMA 3DFNA 1FXQA 1RJPA 1I1WA 2YBVA 1TX0A 4YCPA 4GXPA 1PCWA 1J5SA 2J62A 3FXYA 8XIMA 1VAHA 1GNXA 2Q3OA 4A3RA 2BXZA 5AB3A 4LH8A 1JDAA 5FEWA 1VFMA 4RL3A 4WDXA 3NDOA 2YDSA 4QRNA 1S2TA 1SZGA 3VGFA 2UY5A 3LS9A 3IGHX 2W6RA 2HS6A 4RE2A 1EX1A 2WHJA 1NDZA 1PWLA 3BG3A 1NQKA 4H6RA 2X1UA 4FNQA 4I8YA 3B9OA 1MXGA 4HU4A 2QUNA 3MV01 3VDGA 1TFVA 1E0UA 1F5ZA 3RLUA 2CIPA 1SJDA 3L5AA 4Z1CA 5M17A 3WK1A 2JIWA 4P8XA 4HU3A 4JNZA 2PDPA 1HVQA 4ML4A 1LRQA 1W2PA 1GW1A 2DVUA 3ZSTA 1OF6A 1ITQA 3H6OA 3BAIA 3NPWA 3B8WA 3NNTA 4NZ3A 3LCXA 5FCZA 4AZGA 1AL8A 1EOKA 2VTFA 5E0FA 3SGUA 3FFSA 4UFLA 3ZYZA 3B0XA 3VMOA 3CAKA 1UR9A 2TPSA 2POTA 4QP0A 1JFHA 1LQAA 1QTWA 1WV2A 4TU1A 1G4PA 4PGLA 5G5IA 2ZIDA 3RX3A 4HPXA 1SJCA 3HA1A 4KGLA 4WR3A 1N8IA 4U2YA 2X41A 1GKPA 3E9AA 4CN4A 4NT0A 4IQEA 4E4PA 1LZOA 3HPZA 3SAZA 1TPEA 2CHNA 3MC5A 4PCNA 3GDRA 1KKOA 1DWIM 4WX2A 4CNNA 4EXAA 4L1WA 2C13A 1B90A 3A3WA 2NWRA 3OP2A 3PB0A 1K8XA 4B9YA 1WDPA 3WENA 1W8GA 1TE6A 1RCXB 2PI6A 5XIAA 1QI3A 3G1VA 3W9ZA 4XKMA 5I24A 4AY1A 1MEHA 1CB2A 5A6TC 1FHVA 3LQGA 2QUUA 3GG1A 3EWBX 2ZICA 3GIYA 3AZSA 2AGKA 1IGWA 1KBBA 1EJXC 4LS0A 4B5NA 2YB4A 3LLDA 3E0IA 4DBEA 2A21A 2NQ5A 1JL8A 1Z6KA 3SURA 3CZJA 2YOCA 2ZXBA 3W76A 3OEXA 4FHAA 2VGIA 3PTDA 4DAFA 4J5NA 4NRSA 1SO5A 3AZRA 2FZMA 3R58A 2OZ0A 3TVAA 2A85A 1QI5A 5HOSA 4D6FA 5FL0A 2PDXA 2YDAA 3NVTA 1R3SA 1DXEA 3ISIX 4JIIX 1HQTA 2L5HA 2E9LA 4A2RA 1XBXA 1IF2A 4RK8A 1R9XA 2WMJA 4GZEA 1KA9F 4OFCA 3QV6A 2Z1KA 3UXKA 5DEZA 3SY5A 1TVPA 3OG2A 1G67A 2HXUA 4AVNA 1EGMA 4KCVA 3OBAA 2BOGX 1E6PA 2C16A 4AG0A 1H1ZA 1P6WA 3CEUA 4C60A 4MFDA 1KBKA 1F6PA 4EWND 3PJXA 1QRQA 1UPMB 5J5DA 4G2DA 5K9DA 1I9CB 5HDRA 3NR0A 1SSGA 2ZRUA 4IFKA 3VE7A 4AIEA 3H26A 3O07A 2G3IA 4MDPA 3WLLA 3D0CA 5A8MA 3QPYA 3T0BA 2ZRXA 3WEZA 2XIMA 3SCUA 3BICA 2VD9A 4IICA 3WK0A 1MDLA 4K2SA 3C0JA 2ZUMA 3ZS4A 1Q2SA 4F4RA 3BLFA 3FK4A 3D47A 3UZ5A 4R3UA 1RUSA 1TJPA 1OABA 4PTXA 4PMRA 2OYLA 3STPA 2YX0A 4MZ8A 4M82A 1C9WA 4NZCA 3L68A 5C9WA 3T0CA 2DUAA 3JR2A 4HPNA 3T4WA 3GTIA 2C3ZA 4JQ3A 5K7JA 2WCGA 4GX8A 4PEKA 1MXSA 3GHTA 4R53A 1HIZA 2JBMA 4O12A 4ICNA 9XIMA 3MMUA 4QE1A 1QK2A 3SY8A 3P93A 4IP7A 1TWIA 2F6UA 4D1JA 3R25A 1GVYA 3C5QA 3HO8A 5TIMA 5CSSA 2WZIA 3W7DA 3AIUA 1VPQA 2QCNA 3UPWA 3B40A 2DIJA 4ZQMA 3GB6A 3IGSA 3TNBA 4UQBA 2JFEX 5A6LA 3B05A 3MSYA 1DWJM 5HUOA 2VXNA 2EXOA 2VX6A 5DO8A 1K1DA 2PZ0A 3IWPA 3NOYA 1XSKA 1V3KA 1XLAA 3DFPA 4Y9PA 1XIGA 1EZWA 1BG9A 1A50A 4QEHA 2DSZA 2NW0A 3SDOA 4LVAA 3VNYA 2O9RA 3LRLA 3LM7A 3VI2A 3ZT7A 4B90A 4CNOA 1EJTC 3MVIA 2J78A 1E40A 5I06A 1BGGA 1PDZA 3TW9A 2VNCA 4WSJA 3CQKA 4QLKA 3OG3A 2J9ZA 3S46A 1Z8AA 1ZUAX 4FP1A 5ABTA 3GTHA 2DZAA 3EWCA 3G1YA 3BW3A 4JHMA 4O1DA 4FF7A 1US2A 2INFA 2HNHA 5IHRA 1Y65A 1UJQA 1KGXA 3T8QA 2ICSA 2ZOXA 4UMBA 4Y9MA 4Z42C 1GJPA 4JTEA 1PKNA 1HJWA 3WQCA 1QK0A 1E0XA 1RALA 1UJPA 2A6LA 2QYGA 1KR1A 4ZL1A 1ME8A 1W1YA 3GVVA 4P7RA 3ABRA 1A5LC 1PTGA 2QJJA 5C9ZA 3T07A 5A69A 4UNKA 3CYVA 3GW0A 4JX6A 4DJEC 3LY0A 4IPNB 4ILSA 1KC7A 1G7VA 5AHIA 3CB8A 3R89A 2WJFA 3UERA 1P4CA 3G1FA 1VD6A 1GEHA 3AYVA 2VFIA 4HYWA 4C5YA 3S9IA 4R5EA 3GVRA 2XJ7A 1TSIA 2YGYA 3IJ7A 2ZZ1A 2R9RA 2XFFA 3GC5A 5A6AA 2JGQA 1BWKA 4HIBA 3EKGA 2NWSA 5C71A 1V02A 1RVGA 2XDFA 1MNSA 1LM1A 3S9ZA 1UYQA 5EFFA 1WDSA 3ABOA 1EEPA 1ZJIA 3DGRA 4IIFA 1JD7A 3NVDA 5C55A 1BXNA 3EA1A 1I2OA 3UA3A 4C6LA 5LGXA 2V9DA 3D3FA 1J12A 2QDHA 4AHPA 1H3GA 3U2ZA 3QOKA 4ZOAA 2BWGA 1UUMA 3NQ8A 1EDTA 2H8ZA 2ISFA 3R0KA 6ALDA 3QSTA 1O1ZA 5M2FX 4S1FA 4LAUA 2EG7A 1OFRA 1NF7A 3W84A 2QKFA 3F4WA 3ABQA 3STGA 3PZGA 5HULA 3TQVA 3M5VA 5DT7A 1U33A 1YTKA 3ZWTA 1LLWA 3OYZA 1WUEA 3EAUA 2NSOA 4O15A 4ZXOA 1EJWC 3RG6A 4CVUA 5FJPA 3NURA 4LAOA 3COTA 4IX0A 4WJXA 1BRLA 1W9DM 4I9AA 2BXVA 2VELA 2OQHA 2CLOA 1XIMA 3T0DA 3S2JA 4DYEA 3CPRA 2ATSA 1O66A 4KFOA 1AW1A 3LGGA 4MUPA 3FJ6A 4U10A 1YDVA 1OHLA 4YTRA 4GIAA 5CJNA 1BYCA 5FJIA 3BOFA 3TEVA 4DNMA 1C8QA 3UVIA 1W3TA 3GX9A 4LGXA 2F84A 4NJGA 2XN2A 1OT1A 1JCJA 1N55A 2I5IA 3WLRA 4OTKA 3MZ2A 1UWQA 2PTYA 2OODA 2YL5A 4W89A 1XR2A 1B54A 2VRKA 1J6OA 1KTNA 1GQJA 4PRTA 3VYLA 4IJBA 4F48A 1P5BA 3VD3A 1QVBA 1IXOA 4GQBA 5ECUA 4RLIA 3SCWA 3CHEA 4IUGA 3MI6A 2NT0A 4A3UA 4C7FA 7XIMA 3GR4A 2BP1A 3S1WA 1BQGA 1EF2A 3OO2A 3GR8A 5LA1A 5T26A 4A3QA 3OW1A 3CK5A 2CLKA 4HOXA 3CTTA 1T7LA 4U33A 3T4CA 1XBZA 1J6PA 1A5SA 1HF6A 4B92A 4Q8TA 2PDKA 1KCKA 1YRRA 3K8MA 2VC5A 2WSKA 3MKKA 3MMTA 2X1RA 3FVDA 1SR0A 3K4AA 4BEUA 4ZFMA 1R5YA 3VGEA 1AD4A 2TMDA 4GACA 3PBMA 2CBUA 3NO1A 4GI8A 4YU1A 2OT0A 1J0ZA 6XIAA 1YXCA 2ZX7A 3C3NA 4TV5A 1GORA 4KCWA 4KWVA 1YBQB 3N9KA 2CXEA 4L5ZA 4JFVA 4K7YA 4DBUA 4Q8WA 4HNUA 4O11A 5A8QA 2QUTA 4I5UA 4QG8A 3KVMA 3G6LA 1MI3A 4UTWC 1EJVC 5AHFA 1IR1A 4M7TA 3GM8A 2X09A 4LUJA 4XO6A 1K8CA 1VFUA 4WKAA 4AD4A 1TE1A 3HV9A 5EMKA 2BB0A 4YVPA 1I2NA 3QZ6A 2YL9A 3I3DA 4WY0F 3SUVA 4DWSD 1X6UA 5I3FA 3THAA 4RUBA 5DMLA 4UCGA 1FHDA 3UT0A 2REQA 5HA7A 2GGHA 3TJ4A 3EXSA 5BXPA 1HUVA 1YLVA 4KEUA 2XIOA 1I6NA 5IM51 5AYZA 3L2MA 4RZ6A 3ZIZA 5DANA 3TK7A 2XM1A 3SECA 3UPBA 1D3GA 4XZHA 2ISDA 1SM9A 2CLHA 1TX2A 1BQCA 2VQUA 3WFLA 3M0XA 1IEIA 4AFYA 5JIWA 5D02A 2YFOA 4NX5A 3CV2A 4REQB 2E9MA 5GNXA 3VZZA 4GOAA 2YCIX 2H9AA 2E5CA 2IQ0A 3RCMA 1L6WA 5A6BA 4C1NA 3W88A 1I60A 2OSXA 3W2KA 3DCPA 2G95A 1AVAA 2FZNA 4H8NA 4JR5A 3WJYA 4LAMA 1HJVA 3S0CA 3PN8A 4ZQPA 4NY2A 3EEZA 3VX1A 1FX6A 4AIUA 2NT1A 3T0TA 3LHWA 7ENLA 2HTMA 3IIZA 3ZLGA 2V3EA 3BUVA 1TV3A 1PPIA 4RPQA 3H2OA 2V67A 5ABGA 3UXDA 1EDGA 3TYDA 3SQMA 3W75A 4TQTA 1KFLA 4ES4A 4KEZA 1JZ2A 3UQNA 2ZX6A 4O13A 3O0KA 3S83A 5I77A 1TYGA 4GCAA 3TROA 2NQHA 4LUSB 1XICA 4NAFB 4IT1A 4J3UA 3WNLA 2NV2A 1UD4A 1LROA 4JTHA 1JRCA 2A2IA 3W2NA 4JAWA 4GC3A 2XTKA 1V0MA 3CL8A 2X16A 4E5TA 4A8RA 5LNWA 4C7DA 4X3ZA 5CG0A 2ABBA 1TR9A 1RR2A 1K4HA 1SR9A 1XFBA 3JZEA 4TX9A 4FSAA 3EPMA 3QGAC 2JKAA 2WV8A 1QW9A 3VIFA 2DQXA 3EB3A 5HMFA 3PG8A 4Q7IA 1JDEA 2FFCA 3DG3A 2WB5A 4AHQA 3CZGA 3FOKA 5DT5A 4W85A 4PTMA 1QAPA 2GDUA 3HGSA 4CNUA 1F3TA 3SUWA 1EPVA 5HAOA 3R10A 4JIPA 4G9PA 1FKWA 4C6KA 2MUCA 3P8IA 1KFEA 5J04A 2QDDA 4HKPA 5F2MA 5LKYA 1OC7A 1EO7A 4DUXA 3WFAA 4RNJA 3ARUA 1J0JA 1U30A 3II1A 2G8ZA 2PLCA 3H70A 4Q8PA 1LORA 1KXVA 1AMKA 4AD3A 1I2PA 4DUWA 1E9YB 3ARPA 1XRVA 3NZRA 3P81A 1YQ2A 3O0FA 1W1IE 3LTSA 3FA5A 4XK2A 4W7WA 4WY0B 2ON3A 3P8JA 1G4SA 3WNMA 4RKAA 3E96A 2HK1A 1YPXA 4CU6A 2HNEA 1ZB5A 3C2YA 3VNJA 3V5FA 1NH6A 2E5DA 4ZOEA 3W81A 2G4JA 5I02A 5A8PA 2J9YA 4QQUA 1J01A 2Y4SA 3DI0A 4CU8A 2HVNA 2A6NA 4HNLA 3PP7A 4F0KA 3RU6A 1OG0A 2BOFX 4CQDA 1OGGA 4A05A 1XIHA 3RAOA 1TB3A 2POZA 1C8XA 3CO4A 1CECA 4DF2A 2J7CA 1NFBA 1E3ZA 5CBJA 3V18A 4D2JA 3QC3A 1RCQA 1QATA 1AK5A 1L8PA 1QXLA 3AMGA 4PBGA 3MQTA 3CV7A 4FLSA 4JQAA 6TIMA 1R87A 2YR1A 3IACA 4FNPA 4DJFC 4UUIA 3P67A 1H7XA 1FQ0A 2XM2A 3GO2A 1TMLA 4BZYA 1JIBA 1DQUA 2GOKA 2OLHA 5G2WA 5DCDA 4OIFA 1JZ6A 3VOCA 2OWWA 2W62A 5AHNA 3T7VA 1PHWA 4QIUA 5I3HA 4C6JA 1FCBA 3HFTA 1LRTA 1GW9A 1UZ4A 3GIQA 1RY8A 3CAQA 4P8UA 4HNOA 3TC3A 1TV5A 2BGSA 2PDJA 1HFBA 1GPWA 3GKFA 1XSJA 3G24A 3TN5A 3LV5A 1CENA 2OYKA 3G1RA 4Y9NA 3WQWA 2I17A 2DT0A 4XG1A 5A6BD 3OLIA 3PZMA 1TVLA 5TQLA 3SSZA 4LF1A 1J0IA 3CT7A 3PZNA 3KBSA 3S2CA 3H4XA 4G7EB 2VVNA 1PE1A 3UZXA 1XRFA 2ZTKA 1R3QA 2ATMA 1Q6GA 3H53A 5HQEA 1AMYA 3AUJA 3D3AA 3GWQA 4IGHA 3QPZA 5AVHA 3O1NA 2Q3RA 4Q6XA 4N9EA 4MIMA 5CZKA 5A94A 1XUUA 4AMAA 4HCLA 3MUIA 5A1AA 1EXBA 4IIEA 1F9CA 1UR0A 4Q7BA 1E6NA 3RRXA 3M0KA 3A4AA 5JBFA 1LTDA 4LYPA 2Y5EA 4R7WA 3DH7A 4WF7A 1EJRC 1VZWA 3AWNA 2YLLA 4DO4A 4AZ7A 3KCOA 3R79A 5I79A 3TN6A 1CXFA 2EO7A 3UP8A 2V5BA 3SFWA 1M65A 1R38A 3EDEA 4UOQA 3QW4B 1M01A 2XYLA 1GOOA 3R1ZA 1LDCA 2XIBA 3BPWA 3E5PA 3UW6A 1XIDA 1A3XA 1ZU8A 1XLHA 3L4VA 4HCHA 1JI1A 3DENA 4S23A 4XAGA 2IMRA 3WL0A 2BY3A 5CAHA 2J88A 4EPEC 3NQ7A 1LWIA 3A6OA 1X6LA 3GU1A 1JZ3A 2CYGA 6TAAA 1OEPA 3FA4A 3RNDA 3U48A 1C93A 4RV3A 4PH6A 2GUBA 3NEHA 3VD5A 4IWWA 3U3HA 3AU6A 2NXHA 2P53A 3M41A 3SW6A 4BEQA 3DFQA 3C3UA 3UWWA 2ZWYA 4IJCA 5REQA 1FWIC 2X1IA 4YS1A 1VS1A 1XLIA 2DIEA 3UJRA 3CUXA 2AQWA 5C7HA 3QGKC 3H2EA 2XIJA 5K9CA 2A4AA 2C7FA 1D8WA 2J7BA 3C0SA 4YN5A 1ZHAA 1BPLB 4YCOA 3RO6A 5I7GA 3G3MA 4WXZA 3WUEA 4UQDA 4US5A 3KWSA 4QJ4B 2WC4A 4GVHA 3K46A 5CZSA 3FKKA 1V08A 1QHOA 3PC0A 5G1YA 3STEA 1SGJA 1UD3A 2F38A 3AC0A 4FNSA 1M7JA 2OSWA 5GJPA 4FALA 5A6MA 3H2CA 2OFJA 3UG5A 3T40A 3CNYA 4FIRA 1IXPA 2YBUA 4WSKA 3I6EA 2OOGA 4G1KA 4MVAA 1SFSA 2PWFA 4TMCA 2QJIA 4GQ0A 4UTFA 3W22A 4ZE4A 2VUYA 3ZJ7A 4EACA 5BYWA 4PMDA 1NM9A 4QG9A 3AIEA 2E6DA 4NHVA 3MHFA 4N9BA 4MY1A 1HXJA 5EL1A 3AMDA 4NRRA 3S6OA 1S2VA 1F3WA 1GOWA 3TP4A 1HJQA 4HYRA 1AZ1A 1UKTA 3PZOA 3NPUA 2QV4A 2XGZA 1GK8A 3RM4A 4D6IA 4B5XA 3RUBL 1E5JA 1SFLA 5CGQA 3OLGA 4H9TA 1P0KA 3QKEA 3K8LA 1OF8A 1RCOB 2E3ZA 5DX7A 4QEEA 2EKCA 3M46A 1XLCA 3KVLA 1E3XA 4UMCA 3L67A 4YXGA 3G1HA 3UG3A 2A7NA 3DKJA 4N7QA 1N8WA 7A3HA 3WH7A 1X96A 4PRRA 1B3ZA 1S2WA 2Z25A 4JD4A 5G1MA 2DVXA 4BF9A 2VWSA 1J9YA 3HTWA 2VEGA 2DW7A 3IK2A 4L65A 3THUA 4Z0JA 2WK2A 2J7EA 1UUQA 4LUIA 4CNTA 2Z29A 3BV7A 3O6AA 3MUZ1 4M80A 1VYPX 5TBOA 1J96A 4GISA