1ZCJA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
459
structure length
459
Chain Sequence
SGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of MFE-1: the 1.9A Crystal Structure of the Dehydrogenase Part of Rat Peroxisomal MFE-1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peroxisomal bifunctional enzyme
total genus 181
structure length 459
sequence length 459
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1zcjA03
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1zcjA04
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zcjA02
1J49A 2Y93A 1NP3A 4FW8A 5L40A 1YBAA 3GZ4A 1QYCA 4K1LA 1MP0A 1SB9A 4GX5A 3ST7A 1SEVA 2G76A 3WGGA 5JY6A 1E3EA 1XGKA 4DLLA 3LC1O 5JBIA 5AQ1A 1R16A 4R16A 1TT5B 2UV8A 3VTZA 2DUUA 2PA3A 4J1TA 2VNSA 4U8GA 1ISIA 4A73A 4WGGA 1BXGB 3VPSA 3BXXA 2FOIA 1VPDA 2P9GA 4Y67A 1YOVA 3ETEA 4Y8VA 1V35A 4R1NA 5CDUA 3C7DB 1EMDA 2HKIA 1P0FA 4YVFA 2QW8A 1M2WA 2Q1TA 2DQ4A 3ZV4A 4P38A 4D0RA 4BO8A 5TT1A 3I4FA 3NDJA 4H15A 4GVLA 1DLJA 1WPQA 3QY9A 3PXXA 3GY0A 1CQIA 2WDZA 1NX6A 1ARZA 5TS3A 1ISHA 4J7CA 3QLJA 2OO5A 2O3TA 1G6KA 4ZQFA 4KDEA 2X58A 1F14A 4KOAA 4OYRA 1XU7A 4IS2A 4M55A 3I9MA 4BNYA 2DAPA 3JQ7A 3PWKA 1VL0A 4QUKA 3AK4A 2XOXA 4F6LA 4IJWA 2Y1CA 4OH1A 5JAQA 1O95A 1GEGA 3DQPA 3WICA 3B6ZA 5FI3A 1GEEA 1D3AA 4OL9A 3GNQA 4MP6A 1ZXLA 2Q4BA 4R3NA 4GVXA 2I5PO 1Z45A 4FD3A 2NUAA 3RUCA 4WCFB 3N74A 4TQGA 3M6IA 4ND2A 4CM4B 4J1SA 4B7XA 1HSOA 3HWRA 1ZJZA 4J91A 4AJNA 3HZZA 4MVJG 1LLCA 1YB5A 1GQQA 2AQKA 2Z95A 3PDUA 3HB4X 1EEHA 2BH9A 1R0KA 4R1UA 4TKLA 3UICA 1X15A 5G0SA 3KHUA 5JC1A 2OORA 2OXIA 7MDHA 4QFDA 2YHIB 3U4CA 2AE1A 4M8SA 1U2DA 1PQPA 4A03A 3ROKA 3AOGA 2DFDA 2VNAA 4CM8B 2ZK7A 4Q3BA 2GRAA 4UVIA 2BMAA 3BHJA 1MB4A 1LDGA 2EWMA 2ZQZA 3CH6A 4BB6A 3P5SA 2X6TA 2TMGA 1I32A 3ZWAA 3EC7A 4CMBA 4D41A 3C8MA 4YJDA 5DOZA 1TT5A 3BTOA 1I01A 1JKJA 3RC2A 1LDYA 5G4KB 5DBIA 5KJEA 3SLGA 1ADFA 4YT8A 1C0KA 3HJAA 1UXJA 3OQ6A 4YJFB 2I76A 1ZSNA 4Q3CA 5F21A 3FR8A 3HDYA 4Q39A 2Y1OA 3L0DA 4I9NA 3CZRA 5B12A 4F3YA 2ZTVA 1SZJG 1PS0A 1TEHA 1XSEA 4J4HA 3KXDA 1FMCA 2J8ZA 2NV6A 5I7VA 1OAAA 2X0IA 5FYDA 3DFZA 4IZIA 1PQWA 2HUNA 2W2KB 1SNYA 3W6UA 4XQ9A 2EGHA 3CZMA 4BGVA 2QYTA 1B16A 2GSDA 3UW3A 5KVCA 3QWFA 5I8WA 5K6AA 1JKIA 2D8AA 2PZMA 4CL8A 5CP8A 4HFMA 4YDRA 3JQ7B 3DMTC 3D3WB 3CUKA 2LDXA 1Z7BA 2E82A 1XR3A 1CF2O 4L0QA 1LLQA 2POQX 5U9CA 2WD7B 5AXAA 3CTVA 1X1TA 3IJRA 3RKRA 1QKIA 4J2HA 4NJMB 1J0XO 2Y1DA 1WP4A 4PG6A 4Z0TA 1MG5A 1LQTA 1NTOA 4JJIA 3H9GA 4NBWA 5FEUA 3L07A 4XJSA 4N5LA 5L7WA 4XYBA 1O94A 3K6JA 5H83A 4CM4A 5JNLA 4WASA 2J3KA 1X7GA 3I9LA 2EKPA 1I3MA 3G1UA 1J6UA 4KTTE 2I67A 2YV3A 4OAQA 3RFTA 4LSWA 3DWFA 1NWHA 5DBFA 1CETA 4KUGA 2FZWA 3K2EA 2XF8A 4PLCA 2I65A 3K30A 4CMGA 2C54A 3B1KA 1IPFA 2OBNA 4HKTA 3U4IA 4J1NA 2BFPA 4GMGA 1KETA 4BO2A 4CM8A 4DRYA 4E2YA 1DHTA 1DIRA 3D4OA 1HE5A 1QR6A 4M86A 1KVUA 3PHHA 1S6YA 2JCYA 3SJ7A 5KOIA 2YDXA 1PJLA 1KY4A 4J4TA 2NTJA 4RQUA 4YAJA 3VH3A 2RH8A 2UVDA 1XHLA 1PGQA 4DTIA 3KV3O 2Y68A 4II2A 4YJGA 1RKXA 1UAYA 5CEEA 1GL3A 5A3VA 3ROPA 2O3UA 1NVTA 3KEOA 3C7AA 3DHEA 4FCCA 1LSUA 1MGOA 2PFGA 3ZN2A 3ZU5A 1M6WA 3DAFA 4IINA 5HS6A 5TIIA 2FSSA 4J3FA 4XRGA 4CR7A 3KRTA 2AQHA 3I3OA 4P22A 1X1EA 4XKJA 2FP4A 4DYDA 1P1RA 4TRJA 4DIOA 3FWZA 3HSKA 1VSVA 5F1OA 3LK7A 4IPTA 3IKVA 1EUCA 2D4AA 4PFJA 3HADA 4WEOA 1GYPA 4AJJA 4CLRB 3D5QA 3BMOA 1NNUA 1WDLA 4I9HA 4R41A 4U6QA 4NHEA 5HBRA 3WGIA 4ZICA 2PZKA 4BO7A 2NVWA 4MINA 2EXXA 5C5IA 3S2GA 1GR0A 3FRJA 1AUPA 3IKTA 5L45A 3W4KA 2X8LA 3DMYA 1EDZA 1EVYA 1DHRA 2YJZA 4P4LA 2O3JA 4NK4A 5IFLA 3ZNQA 1Z73A 4IQ8A 5KKAA 5EJ2A 3GFGA 1PL6A 4ND4A 1YBVA 1ZEJA 3O8QA 1T2AA 1ZBQA 4UEOA 3DBLB 4CQMB 1HE3A 4U0JA 1B8UA 3VH4A 4DGSA 4WCDA 4R69A 3PQEA 1B8PA 1LNQA 3Q2IA 4MVJE 4L9RA 4FBGA 2JD1A 4PLPA 2CDAA 1XELA 5B4TA 2YQ4A 4RF4A 1I2BA 2E6UX 5KVQA 3MJVA 3JD4A 1GAEO 4TROA 4WLNA 2NQ8A 3UCEA 1SOWA 3RC7A 1NAIA 3H3FA 1ZH8A 1HDRA 1W4ZA 1CWUA 4XJTA 3KLPX 4FFNA 5L53A 3CKYA 3MJCA 2ZB7A 4XCVA 4NR0A 1IB6A 5A02A 4DXHA 4D3FA 1TB4A 4DLBA 1UP7A 4OMUA 3PK0A 4ID9A 1HTBA 1L7EA 1E3IA 4BKRA 1U7HA 4B79A 2A35A 1Y8QA 2X4GA 4H3VA 3AUTA 1XIVA 1L1FA 1JQBA 1HZZA 4XB1A 1D4FA 3JYPA 1Q0HA 3OF2A 1WZEA 3JQ9A 4MKZA 3PHGA 2X86A 1UUFA 1U3VA 3QVXA 2HJRA 1ISGA 4GLOA 4Y98A 3F46A 3IDSA 3DBHB 4D3DA 2V6MA 2DPHA 1ISFA 1PWZA 1UP4A 1W0CA 2GLXA 3E1KA 4YQZA 3RIHA 2XPCA 4UVDA 2OBYA 4XEHA 2VUTA 5JW6A 1T1RA 1Z75A 3GVPA 3F5SA 4QO8A 3OETA 2YW9A 5HA5A 4XZ3A 4FJ0A 2WSBA 3NEPX 4MDHA 3KEQA 1P31A 4FQ8A 3LDHA 5L7TA 2VYVD 4RZHA 2RIRA 3ZWVA 3MWDB 3DC2A 4WEQA 4BNKA 3M2TA 2UAGA 1NR7A 3MTJA 5TJHA 4S3MA 3LU1A 4DMMA 3SXPA 3F4BA 3FWNA 2QIOA 4FGSA 4RZIA 5B4VA 4XX0A 3RBXA 4YT4A 1XCBA 3NJ4A 3L77A 2OZPA 4TZTA 3BZUA 4BOYA 1PS9A 1DC6A 3U0BA 3U49A 2Y0EA 4R9SA 3HUDA 3JQCA 3NAQA 3RU7A 4O59O 1H6BA 4L4SA 4P4NA 4PLVA 5CG1A 2NWQA 3CXRA 2YHUA 4CUJA 4HWKA 3T4XA 1T4BA 2PH3A 3KTDA 1SPXA 2E49A 1UXIA 4J49A 3KYCA 5A9TA 5EQDA 4RLSA 5K0ZA 1T1SA 3ONDA 3LYLA 1U3WA 2NQTA 4OXYA 2PV7A 5K9ZA 1GV1A 1BXGA 4CUKA 1JKFA 2C7VA 2RBEA 4R4JA 4YAIA 1NHGA 5ILGA 2FSVA 1K3TA 1WDMA 4FR5A 4BKUA 4BKPA 3AI1A 1PIWA 4YTEA 2P68A 1KS9A 3OBBA 2Z1NA 3H9JA 3VH2A 2E48A 3DEYX 1SEPA 3U9LA 1DFGA 3QE3A 3E8XA 3CTMA 3D4NA 4MIOA 2PLAA 3JQAB 2RHRA 3EDMA 2DKNA 4BNLA 4BMNA 4C7KA 2YY7A 1X14A 2VRCD 2WE7A 4DL9A 1ZW1A 1PX0A 1WVGA 2CVQA 2ZJ1A 5T67A 4OSPA 2Q1UA 2SCUA 1M75A 3WBFA 1RJWA 3PDJA 5BSFA 2PH5A 1LU9A 1QV7A 3OQ1A 3ZV6A 4IDBA 3LF1A 4FS3A 1GZ6A 4DYVA 1I2CA 2DBZA 1UDCA 9LDTA 3RUIA 2EJWA 1KVQA 4IJKA 2J6IA 5G4KA 4DBVO 1I3LA 1OMOA 4BGUA 4RF5A 5T8KC 3S55A 4YJFA 4GPD1 3K73O 1WMBA 3DB2A 3OA2A 4LRSB 2R00C 4MOWA 4CLXA 2OP0A 4QO7A 4CL3A 4Q3EA 1LSSA 2P9CA 4KUEA 4MVJH 1T26A 5ER9A 4IDAA 1DRWA 4AJ2A 5JYDA 4XDZA 4PZEA 3TSCA 3ADPA 5A03A 3WLEA 1ONNA 2PK3A 3DXFA 4XB2A 5AXDA 2ZYGA 1JWBB 4G65A 2R00A 2IZ1A 1C3VA 3FNGA 2BFAA 1LEHA 1QXSA 1UDAA 4R01A 1DJQA 4JP2A 2XXJA 1XG5A 4CQMD 1E7MA 5TT0A 4GAEA 3W4JA 3C24A 2PD6A 2Y67A 3D3WA 2Y66A 3EMKA 3H65A 2X5JO 2JFHA 5JC8A 5DCYA 4K26A 5G2OA 4NJOA 5L4LA 2I6TA 1V0JA 3O03A 3AWDA 1EE9A 1YE3A 4ZQHA 1DXYA 3L4BC 4MPDA 1PJ2A 4DC0A 4IXWA 4D44A 4PLGA 1NHWA 1UXGA 2Y1GA 3X2FA 5I7FA 4EBFA 1NM5A 2D5CA 3DOJA 5F5LA 5L3ZA 3PJDA 3FNEA 1HSZA 4FJ2A 2PKRA 3H4VA 3NTRA 5G0TA 1V9LA 2IEDA 4FC7A 4XDYA 1GQYA 1EK6A 4PG4A 4U5QA 3FSRA 4XIYA 2GNAA 5KWEA 2AMFA 3VZQA 3JYOA 3WXBA 3DBRB 2ZB8A 4BB5A 5IAAA 1QP8A 1I3KA 1LDNA 3JQ8B 4EEZA 4HXYA 1LXCA 4NZ9A 3H2ZA 1HWYA 5C7LO 4FOOA 3PP8A 3PGXA 1V3UA 3V1YA 3GVHA 3W8EA 4WLOA 3ZH2A 5A4DA 4LCJA 3W6ZA 2G5CA 2FY8A 4YJGB 2XAAA 3B20A 4BNXA 2J3IA 5BQFA 5JDCA 5T57A 3ORFA 1L7DA 2BFOA 2ZTUA 2AG8A 9LDBA 2FHSA 3PQFA 3DMTA 3M1LA 3RC1A 4FIZA 5CAEA 4K6FA 3QWIA 2IZ0A 4ZVVA 3QJ5A 4BL5A 1P33A 1XU9A 2VOEA 3FCOA 3ONFA 3E5RA 3M2PA 2P91A 4CJXA 1SMKA 1YONA 5JE8A 5AXBA 4PLZA 1ZMTA 4RO0A 1J4AA 1LUAA 2O3QA 5C3MA 1YGYA 2C29D 2O23A 3U09A 2ILTA 1IE3A 1UDBA 4OKNA 4RVHA 1TI7A 5GMOA 3EGOA 3F47A 1AN9A 4GLLA 1FXSA 3MZ0A 4E3ZA 4JBIA 1UH5A 5I8ZA 1R4MB 3RFVA 1ZXBA 4MP3A 3JQBA 5T5QA 5F3RA 3OIGA 4CMCA 3C1TA 4HX5A 1E77A 3E9QA 3GLQA 3HHPA 4AFNA 2GR9A 3I9KA 3MJ4A 5KNLA 2PNFA 3G17A 3KYDB 3GR6A 4ITUA 4AJLA 2ZCUA 4AJ4A 2NVBA 1CYDA 1ZFNA 4J43A 1PTJA 5DF1A 5IDWA 2QHXA 1B0AA 4BMSA 3PLRA 3PZRA 1GQ2A 1ULSA 1Y1PA 3OA0A 2VZ0A 4IDDA 3CINA 3GT0A 3JQ9C 1BDBA 3OJEA 5JDIA 5G0VA 4NIMA 3VPFA 4JIGA 1P1JA 3ANNA 3JD2A 3RAJA 3BA1A 3KSUA 1UR5A 5I7SA 3R3SA 3E6AA 3UFXA 4NNJA 2PKQO 2VRBA 4I5EA 3F1LA 2X0RA 2W90A 3BMOB 3LT4A 3ZV5A 4LN1A 2PGDA 1A72A 1R6DA 3GZNA 4BNWA 4B4UA 3WGHA 1JA9A 3T4EA 3C85A 3WGYA 2GUGA 4CLDA 3UH1A 4E5YA 1QSGA 3RKUA 3AUAA 3U4HA 5KIAA 3RJ9A 3EW7A 2C5AA 1BHSA 3E5MA 3FBTA 1E1LA 4Z3DA 5JS6A 4Y9DA 4J4BA 4Z0HO 1FJHA 2Y0CA 3DBLA 1NAHA 3OJLA 5ICSA 3WNVA 5DCWA 3QA9A 4R51A 3QHAA 4RVGA 1TVEA 3KYBA 1SCUA 3NDRA 1GPDG 5JMPA 4YXFA 4B3HA 1MUUA 1Y8QB 3H9EO 4HFRA 4D0SA 5IZ4A 3UAGA 3PFWO 3I9JA 1HF3A 2CSUA 1YWGO 4KDFA 4DWVA 2EW8A 3CEAA 4RF3A 1P0CA 4MKXA 3I52A 5CG2A 2FPIA 4R1TA 5AVOA 2W2LA 3TNLA 4P8RA 3I9NA 1U2GA 3UF0A 1JAYA 1LDMA 3RI3A 3ICCA 1LA2A 1ZIDA 2YFQA 3IL2A 2BLLA 3HDJA 3DOCA 2AG5A 4RDHA 5IXSA 5DCUA 3BMQB 1X7DA 3EUWA 1IY8A 1Y8RB 4XYEA 3EAGA 1P45A 3WDSA 4PG8A 4MKRA 1PR3A 1GUFA 4NK5A 4W7IA 3F5QA 4CM9D 3TZCA 2GZ3A 2ZTMA 4FJ1A 1I30A 5HRUA 4KZPA 2VHXA 4UUPA 1QYDA 3PWSA 2VYND 4MVJA 4OSOA 2CVOA 1NYTA 4JX8A 5THKA 1I24A 1EUZA 1SO8A 2JCXA 2P9EA 3HQ4O 3VVCA 1LBEA 2FPPA 1M67A 1RM3A 2DBRA 2Y0DA 3VDQA 3ZI0A 1PEDA 4DUPA 1U1IA 1BGVA 2PR2A 4D7AA 1UZLA 4JN6B 5FI5A 3GRKA 3C1OA 3ADOA 2YFHA 2DVMA 2C2YA 2JAPA 3WG9A 2CFCA 1LRKA 4E2XA 4E5PA 5A5FA 2HSDA 2NM0A 3D0OA 5IZCC 4I8XA 4XR9A 1T25A 4Y6RA 1O5IA 4YWJA 4F46A 3GG2A 3IAHA 2WYUA 3BTSA 3V8BA 3TZ6A 5A9SB 2D1YA 2IXBA 3JQ6A 3QVSA 1IYZA 3QVWA 1NQOA 7ADHA 1TA4A 2F00A 2C59A 3ZHYA 3EZYA 4OO3A 5JYEA 3WS7A 4Z9FA 1DRUA 1DJNA 3JYNA 2CY0A 4YR9A 3VPXA 1ZK4A 5C7OO 1H5QA 2B0JA 2EEZA 3HN7A 4BNHA 4E2ZA 2OMEA 1U9JA 1HE2A 1KVSA 1P1KA 3T7EA 1RM0A 4CR6A 1U8XX 2FMUA 3T7CA 1MFZA 2W98A 2WYWA 2VWPA 3V1TC 3IUSA 4BNTA 1DFHA 1TXGA 1P77A 3GC6A 2D5AA 3NYWA 4J7XA 4BKOA 2Z5LA 3INTA 3PLNA 4QECA 3VTFA 4CMKA 4INAA 1E7QA 4HV4A 1KOLA 1I3NA 5CDTA 3TDKA 1KEUA 4BO5A 3GFBA 1R4NB 2J3JA 2WEKA 5G4LA 1J5PA 1H6AA 4IJUA 3JV7A 3A9WA 2DM6A 1HZJA 3WMWA 2HMSA 4D45A 5KVVA 3TWOA 3FHLA 2FRDA 4L8VA 3MTGA 4RPHA 2A94A 4GH5A 4J6FA 4I5GA 1M76A 1R15A 3RCBA 3ZGYA 2W4QA 1Y8RA 5IDYA 1H93A 3GPIA 1U3TA 3DDNA 2CZCA 3HDHA 1C0IA 4E21A 4R1SA 3U3XA 3DZBA 1YDEA 1AGNA 3WNQA 1WZIA 2HMUA 3E9MA 4CMIA 5KJ1A 4CLEA 4E5NA 4NJMA 3ROMA 4JQCA 1YXMA 4AJIA 1WAMA 4UUMA 3VKVA 3NRCA 2IE0A 5IXYA 4U6SA 4XQGA 1Z82A 4YRAA 3I6IA 2HCTA 3KO8A 5L95A 4YYZA 1X0VA 2AE2A 4IQ0A 1Y6JA 1XA0A 5LDGA 2DUWA 3ZWBA 1OZAA 1UZNA 5C7IO 4I08A 4L73A 3GVIA 1C14A 3LVFO 3PQDA 5JDCC 4OJNA 2CMDA 2TMDA 1HDOA 3NT2A 1GZ4A 2A92A 3ZWYA 3CMCO 4U0KA 4AVYA 1DIHA 4QTZA 3PYMA 2VUSA 2G17A 3OEYA 1HLPA 1Q2XA 1U4OA 4WKGA 4IDGA 5EN4A 3HG7A 1PL8A 5U1PA 3A4VA 4RVSA 5JAIA 3I83A 4NBUA 3ZZNA 3G0OA 3QV1A 3GGGA 1EBFA 4BKQA 3IP3A 3PHIA 1GY8A 4QT0A 4EDFA 2GN8A 1PJQA 2BFMA 1VJTA 1PZEA 3AOEA 3S2FA 2IZZA 1B15A 4TZKA 2OP1A 4MVJI 3RROA 3QWAA 4IDCA 4UVGA 2BF7A 3L9WA 4Z3KA 3A1NA 1ENZA 2Q49A 4L75A 2P4HX 3JQ8A 2GDZA 3ROQA 3MEQA 5JPIA 3PRJA 3NX4A 2WTBA 1H2BA 3JD3A 3F1KA 4WK6A 1LI4A 1K2WA 1BVUA 1MXFA 5DNAA 2H63A 5TF4A 3PIIA 1BTOA 2CD9A 4O0LA 1CERA 4JBHA 4JLWA 1C0LA 1VJ0A 4R5HA 4YACA 5G0UA 4Y6PA 3RUDA 1ISMA 1YL7A 2RAFA 4B8WA 2JFGA 1NR1A 3HNPA 4R68A 4NFYA 2GF2A 1VSUA 2GZ2A 4PRLA 4KMSA 5EPOA 1JVSA 3WGQA 4D42A 4CM6A 1B3BA 4F45A 5JAZA 4TKMA 2NU6A 2PTGA 3ETGA 3FN4A 1GD1O 1PR9A 3GHYA 2VZ9A 4UAGA 3O9ZA 1I10A 1E92A 3SVTA 4N7RA 3DZHA 5ITWA 3DBRA 2VT2A 3LLSA 4JJGA 2Z1MA 1QLJA 4A5OA 1OC2A 4FOSA 2RH4A 3LC7O 4DPLA 5T8KA 2DTEA 3K5PA 4R54A 4I1IA 2YUTA 4N5NA 3RVDA 1OFGA 3F6YA 5A06A 1E3JA 3M1AA 1E5LA 3H2SA 4FGWA 2D2IA 4I5DA 1YQGA 3KZVA 1F0YA 1WDKA 2O7SA 4ZRMA 5ITVA 1H2HA 1HYEA 1D7OA 5HTOA 1BG6A 5JO9A 2AHRA 4PZCA 2EP7A 3VAZA 1DLIA 4EUHA 2EERA 1ML3A 1GUZA 4YBZA 1KBZA 4MIYA 3JQAD 4YPOA 1LDEA 3KM0A 1E7RA 1LX6A 3H3JA 1A9YA 3OMLA 3JSAA 4BNMA 1JDJA 1ZSVA 1ZEMA 2EJVA 4GQAA 5JCJA 1KC1A 2HQ1A 4M89A 4DMLA 5JY1A 3EHEA 3DR3A 4LCEA 2CF5A 1R0LA 2FZEA 1UJMA 4LISA 3S2IA 1P1HA 2O2YA 2G82A 4N5MA 1LQUA 1GADO 1A4UA 3GEMA 4ALKA 2VN8A 4HFNA 4IDFA 1BW9B 3F3SA 2P5YA 2Q2WA 4WPGA 5GZ6A 5LC1A 3RWBA 3BTVA 1EFKA 1VC2A 4PG5A 4GBJA 1YRLA 1SC6A 4OM8A 3KYDA 1QV6A 3A14A 4NMHA 3MJSA 4GX0A 1PGJA 1T24A 1QYVA 3FI9A 2GN6A 1Z74A 3WIDA 4EYEA 1DC4A 2VHVA 1K89A 1E7WA 3DZIA 3BHMA 3DL2A 4IZHA 4IQGA 2D3TA 4GKVA 1I0ZA 2EGGA 4BNGA 2ZIZA 1PJ3A 3GA0A 4GWKA 4BO0A 2HO5A 1SOVA 4J1QA 4I5FA 3ZNNA 2P4QA 5DDIP 4RDIA 4UVEA 3PHJA 1E7YA 3RBZA 3H8VA 4RQTA 1QRRA 2VWGA 3OH8A 1N1EA 3RUEA 1C1DA 5H82A 1MC4A 2JFFA 4ND3A 3KB6A 1Q7CA 3VVBA 2CDBA 4CM9A 1F8FA 6ADHA 1PJBA 3N7UA 2DC1A 1ONPA 5IN4A 3PJEA 2E4AA 4ALMA 4AJKA 2EV9A 3GRPA 1PJTA 5JSFA 1PL7A 2BGKA 1P1IA 3AY6A 1WMAA 4FFRA 2PY6A 4J2OA 4RPLA 4NH4A 4D46A 3TRIA 3AFNA 3IUPA 5AXCA 1QG6A 4Z6KA 4ZN6A 2W2LD 3MJEA 3BHIA 2BELA 2B69A 1NQTA 3QWBA 1X0XA 3VOSA 3WYBA 4HNHA 5COBA 4HBGA 2J5QA 4DIBA 5HWSA 4JXKA 1T2CA 2Q1SA 3D5TA 3GDFA 5L51A 2GYYA 1U28A 3BYZA 3PZBA 1DO8A 2FR8A 4CV1A 2Y99A 1DPGA 2J3HA 1NPTO 3GUCA 3ITDA 4IY1A 5AOVA 1BVRA 4WECA 3WQRA 4RJTA 2X7HA 3O26A 3HN2A 1A5ZA 1GU7A 1NQAO 2GPTA 2Q1WA 3WWZA 5B1YA 1OC4A 4CM7A 1UXHA 2CF6A 3K2BA 2X0NA 4TVOA 4DREA 1HYGA 3RD5A 3ZDFA 4NBTA 4B8ZA 3WYEA 3PGJA 2VHZA 4G2NA 5F5NA 4EGFA 1H6CA 5CDYA 4PN3A 4DPKA 4KQXA 3V2UA 2YV2A 2AA3A 2OOSA 3BMQA 3I1JA 3OSUA 1MXHA 5KTKA 1BXKA 5A05A 3RASA 1IL0A 2QRJA 3CSDA 5H81A 3RUHA 1C0PA 1H94A 3I4CA 4RORA 3PIDA 1EDOA 4PLHA 1R37A 5AYVA 2EG9A 4YAGA 1E6UA 3RBVA 2GCGA 1YL6A 3O8QB 2B5VA 3WGOA 3LSYA 1B3RA 1EBUA 1EK5A 2H6EA 1PZHA 2CDCA 4BMVA 3TOXA 2QRLA 2DBVO 1ZK1A 3IP1A 2AEMA 3H9QA 4XGIA 2QG4A 4GX1A 5ES3A 5T64A 1RYDA 4E4YA 2O50A 3WTCA 1C1DB 2IYOA 4CMAA 4PZDA 1UZMA 2QQ5A 3V5NA 4JROA 2JAHA 3HE3A 4JBGA 2GGSA 1Q0LA 5COAA 3K31A 1ZKMA 3IS3A 4BO3A 3TOZA 1JWAB 4BV8A 2DTXA 3TQHA 1I33A 3WJAA 4YA6A 3E82A 4JP3A 3INRA 3OICA 3FD8A 2BGLA 1XKQA 3FPLA 1Y81A 3JYQA 3WFJA 1ENYA 3GQVA 4IIVA 1DRVA 4H16A 4BO6A 3AUUA 2BHLA 3DFUA 5IZCA 1QMGA 2B4TO 5JCXA 2Y1FA 4N54A 4E31A 2C0CA 4E5MA 1LRJA 2HAEA 2ZYAA 2NU9A 4RCVA 2VT3A 4CMIB 1EFLA 3OJFA 1P1FA 2EIHA 5C37A 1ZVMA 3JD0A 3SX2A 3TF5A 3E03A 5EL0A 1NFRA 3OIDA 3JD1A 1ADGA 2ET6A 4ZQEA 3GEDA 4WNIA 1QYWA 3TZHA 4CM5A 4OGWA 3DONA 1KEVA 1DC3A 1B7GO 5EIOA 2C2XA 2VWQA 5LCXA 4QX6A 3TZKA 3ULKA 2CUKA 3E9NA 2JKVA 1C1XB 2WYVA 4FFLA 3TFOA 3MOGA 1JTVA 1PGNA 2EF1A 2V6FA 3BMNB 4UEJA 4EJMA 3GG9A 1LLUA 3AJRA 4GSLA 4B4VA 1MC5A 2ZTLA 2PZLA 1GCUA 2GO1A 4LMPA 4CODB 4ALNA 1HDCA 5TGDA 4QQRA 3WX0A 1EVJA 2PKQP 2J5RA 2QZZA 4EJ0A 4J9UE 4CM3A 2ZYDA 4HADA 4CMJA 3CE6A 3WBBA 3OECA 4GGOA 2DBQA 3JTMA 2HK9A 3BTUA 2A9FA 3JQFC 4A10A 4UUOA 1LLDA 3QQPA 4CLOA 1IUKA 2PGJA 1LTHR 1RM5A 4YQYA 1VL6A 2YHIA 2C07A 3ENKA 5CPFA 4C4OA 3K96A 3ZW9A 2X1HA 1KEPA 3V2HA 1VM6A 2IEBA 3SEFA 3GEGA 3QW2A 1YS4A 4WOJA 5J23A 2JJYA 2VCYA 2WE8A 3TPCA 4IGFA 1D1TA 1HXHA 1WWKA 4M87A 1ZK3A 4HNGA 4K6CA 5TSDA 3JQFA 5EMHA 1IZ0A 3FPCA 4J7UA 4IDEA 5L4SA 2GERA 3FTPA 3AI2A 2NSDA 1GYRA 2WJPA 1OBFO 2J5KA 3R1IA 3R0IA 5L7YA 4XGNA 2H5LA 3ASVA 1EQUA 5DP2A 3D4PA 3WTBA 4EUEA 4C7JA 5JMWA 2C82A 5JFOA 3IMFA 3MCVA 4RVDA 4E33A 3C3XA 4TMFA 1W6UA 2V6BA 2VTDA 4E32A 1Y9AA 4IGEA 1U7TA 2JCVA 2YV1A 1B26A 4BNNA 3GNSA 4K9DA 4PLWA 4E0BA 5EERA 2QX7A 4MVJM 4YAEA 4XYMA 5JCJD 4D3SA 3QVTA 5I7EA 3PJFA 3QVOA 3GOHA 3O38A 2R2GA 1Y5MA 3ONEA 4O6VA 4YJHA 5BSEA 3JQAA 3Q2KA 4PRKA 4ALIA 1B14A 4MO2A 3QSGA 4IUYA 1T4DA 5TRTA 1P3DA 3RUFA 1GTMA 4AL4A 5CDGA 3KUXA 5IDQA 2Q99A 2QYSA 3DO5A 3STHA 4W4TA 5A3JA 2D59A 4W82A 2VQ3A 2I9PA 3GMDA 3AI3A 4BNZA 2DPGA 4O63O 2Q50A 4OQYA 4LW8A 1F12A 1G0NA 4ZRNA 1U3UA 1C1XA 1F06A 1ZK0A 3E48A 4NDNE 4BNUA 3EVNA 3BMNA 4FB5A 1JVBA 3C1AA 3G1TA 3B1FA 1HT0A 4L4XA 5EINA 6LDHA 3WQSB 1WXDA 3WB9A 3QWHA 2X5KO 3EK2A 1N9GB 5HS4A 1XQ6A 1A7AA 1E3WA 4YB8A 2BI8A 1H0KA 4I9UA 3OIFA 1Y9EA 1E5QA 4IM7A 2NNLD 3JQGB 1K0UA 3L6DA 4CLOB 1GFSA 3UGKA 3GDOA 5K6AC 4PIVA 4A7PA 1E7SA 4B4OA 2UDPA 4RVFA 5LDHA 4FPXA 2VUUA 1DIBA 1O8CA 3VHRA 3VZPA 3KSDO 1E1MA 3WOHA 1Q0QA 1PJCA 3UXYA 3RJ5A 3PVZA 1D8AA 4BQPA 3GAFA 4GKBA 3S8MA 4ALJA 1Y7TA 1HETA 1AXEA 1CQJA 1ORRA 1I36A 2O2SA 4ZQBA 1Q7BA 1Q1NA 5CPBA 3EY4A 3TFQA 3GDGA 4L76A 3TL3A 3LQFA 4CLHA 4RVUA 4XWYA 1PZFA 1ZMOA 3WFIA 1AHIA 5DT9A 2CVZA 3LT0A 2PD4A 1EQ2A 3BIOA 2NLOA 1NFFA 3QRWA 1GV0A 3RU9A 1QORA 3KLMX 1I8TA 1M6HA 3UUWA 1NFQA 3MJTA 5F1KA 1ZZEA 5DBGA 5A9RA 2I3AA 2WMDA 3GNTA 3OEWA 2E37A 3CPSA 1NXQA 3DHNA 2X23A 4AJ1A 1BW9A 2QRKA 3SLKA 4CQLA 2JHFA 3KBOA 2ZQYA 5U4QA 1HDZA 4B3JA 3AM5A 3R3JA 3DOOA 3U5TA 1RWBA 4Y6SA 3UKOA 3NUGA 4BHTA 1EVIA 1H6DA 1PZGA 5BT9A 5IJZA 3NV9A 5IN5A 2VOJA 5MGBA 3D3EA 3BAZA 3DTYA 3VDRA 3DTTA 3ZWPA 1YVEI 4E6PA 2DTDA 3H7AA 1QLHA 1DAOA 1EE2A 1RM4A 3W1VA 5ENDA 1VRWA 4J90A 1LSOA 2OUIA 3OQBA 3UVEA 4WUVA 3BMCB 1E3SA 2B37A 4W99A 4CPDA 2UYYA 3Q11A 3JQGA 4QSMA 1AHHA 3ANLA 1E1KA 3AM3A 4G5HA 4O1MA 4WJZA 4ZD6A 2WD8A 3WR5A 4GSKA 1DAPA 1R66A 1OI7A 5KCZA 5ENVA 4YCAA 4BVAA 2NACA 3G3EA 3ICPA 3DZKA 3GHHA 4L4RA 5JO0A 2G0TA 4J16A 3R6DA 1YH3A 3I5MA 3ZV3A 1OOEA 1T2EA 1XQ1A 3I9OA 4XD2A 4BS9A 4E2WA 5TJ9A 3S2EA 2AQ8A 5DP1A 4DQUA 1PGPA 3PEFA 2X9NA 3TZQA 4CR8A 4WE3A 2Q46A 1K6XA 1W73A 3JQEA 3NT5A 5BR7A 3PWZA 3E18A 3OJ0A 2C20A 3SBOA 2GN4A 1YB4A 2DLDA 4IBOA 4Q3NA 4XGKA 4AJHA 3IIEA 5ICMA 2P2SA 5GY7A 1YL5A 4IXTA 4AICA 3L4BA 2OL4A 5ILOA 5MDHA 3ZWXA 1MLDA 4JNKA 1PGOA 4GI2A 2XXBA 4W7HA 1LC3A 4WLEA 3AW9A 1YB1A 1A71A 4W9NA 1ENPA 1PSDA 3JQBC 3N58A 4RLHA 4DBZA 1ID1A 1VKNA 3OFSA 2B4RO 3OHSX 1VKOA 2YDYA 4Z0PA 4J9VA 2BI7A 1GYQA 2WM3A 3AUSA 1HL3A 1V3VA 1FDSA 3AU8A 1NQ5A 3GK3A 2O7QA 3GZNB 1KYQA 4DQXA 1IOLA 2Q45A 2V7PA 5IG2A 2X9GA 5GZ3A 3ZWNA 4W9NC 1DB3A 3H5NA 4RGBA 4Z9XA 4NI5A 1FDTA 2GD1O 1IPEA 3GH3A 4JK3A 1Z7EA 1YJQA 1DIGA 4MIEA 1HEUA 4PG7A 3WSVA 3MOIA 4UVHA 2VWHA 4FN4A 5L9AA 1CJCA 4RL6A 4DC1A 4ZHSA 4PCVA 4M49A 2BGMA 5A1TA 4HUJA 1V3TA 2IODA 4MVJF 1ENOA 2AXQA 3DHYA 5EQFA 1JU9A 2B5WA 4R9RA 1EZ4A 1N2SA 3IOYA 1MG0A 3EZLA 1ADCA 4ESOA 4Q3AA 3OP4A 5A04A 1N5DA 2B35A 1HRDA 1BMDA 2VHYA 1GDHA 2VYNA 4DPMA 3LLVA 1DEHA 5CDSA 2Q4EA 2HMVA 5L4NA 5BSGA 3EYWA 4LSMA 4M54A 5JXWA 2Y1EA 4GGPA 3GUYA 2HLPA 4BNIA 1KC3A 5JLAA 3UCFA 2VTEA 4OIMA 1LDBA 1ONOA 2EKQA 2Q2QA 3ANMA 3D1LA 3KYCB 3V1UA 1A27A 3P2OA 2AEFA 2X9VA 2H1SA 1ZCJA 1X7HA 4EI2A 3NKLA 1DIAA 1PJSA 3EVTA 4N18A 3I23A 3NDIA 4AJOA 2PD3A 2HRZA 4FSHA 4JCOA 2OGUA 4W6ZA 5KVSA 1WLYA 3DZGA 3TL2A 4YT2A 1LJ8A 1FK8A 1LSJA 2FR0A 3G79A 4K28A 5FWNA 1RYEA 2DFVA 1IULA 2C5EA 3FTNA 4FDAA 1DFIA 2HMTA 4B7CA 4HP8A 1E6EA 4MVJP 2Q3EA 2VHWA 1WNTA 5JAMA 1PS8A 1A4IA 1NVGA 4ALLA 1XEAA 3VC7A 2FR1A 3DBVO 3ZHXA 1FF9A 5A9SA 2O3SA 4NQZA 2C7GA 1KEWA 4JJFA 2RCYA 2ZJ0A 3ZU3A 2GZ1A 2QZ9A 2HK7A 2GN9A 3ASUA 1KERA 2ZKLA 4EITA 2UUOA 3Q1LA 1ISJA 1JW9B 1G0OA 3ZWMA 3A06A 4KUHA 2IRWA 4KQWA 3VH1A 5BNIA 2X0JA 1IHYA 1JAXA 3NTQA 4WCFC 4CMEC 4RPJA 4CUZA 3I6QA 1VJ1A 2HJSA 4GX2A 2UUPA 3ABIA 4X54A 4ZGWA 4LK3A 3NJ8A 2F1KA 3H5AA 4B3IA 4EUFA 2DT5A 4BO9A 2I99A 4ND5A 1VI2A 5ER6A 4QEDA 3LZ6A 1EVZA 1KVRA 1VE9A 2I66A 3F4LA 4BO4A 5I9LA 3RC9A 1HDXA 4MVJD 1DOHA 1YBMA 3PYLA 4DIFA 4CV0A 1BDMA 2Q2VA 4YRDA 5BSHA 1A7KA 5TQVA 3NGXA 2YYYA 3L9XA 3AY3A 1AE1A 4WOKA 1UP6A 2OFPA 3O4RA 1UXKA 2EHDA 1B2LA 5G0WA 1NVMB 1DC5A 1U8FO 4WCFA 4CMEA 4OQZA 1NPYA 4EJ6A 1G1AA 1KVTA 3UCXA 4KP7A 3GVXA 4IS3A 1BRMA 4A26A 3ZWCA 1KY5A 1MA0A 3COSA 1N9GA 4ZA2A 1E3WB 4TRMA 4GWGA 1A9ZA 1HDGO 1BSVA 3LC2O 5CHEA 2JHGA 1R12A 3FNHA 2R6JA 1E1NA 4YJHB 5KKCA 5I9NA 2AEJA 1HE4A 1K5HA 3NTOA 4ROSA 3K92A 2W8ZA 3AOEC 1P9LA 5IDXA 4ZU3A 3WIEA 1GPJA 1XYGA 3LT2A 1LC0A 3DAPA 4J0EA 3QIVA 3H9UA 4RV9A 3WLFA 4XQCA 4FFOA 1N1GA 4DA9A 1CEQA 2VZ8A 2X5OA 5FF9A 1JN0A 1MX3A 1NPDA 3LF2A 3V2GA 2O4CA 4MJLA 4OHUA 3KETA 1CIVA 5TLSA 4TVBA 1N8KA 3FF4A 3K9QO 4URFA 3Q3CA 2NTNA 2NU8A 1K6IA 4YRBA 3GN1A 1VL8A 5I9MA 3WQQA 3GPDG 4IIUA 3FBGA 5B37A 4YEDA 4A27A 4Q9NA 4DQVA 1ZUD1 5HM8A 3SC6A 3WMXA 2IXAA 3INGA 4ND1A 2X22A 4XA8A 1T2DA 4JGBA 2G1UA 2O4UX 2W2KA 4HY3A 3GF4A 2H9IA 4NBVA 3FNFA 1U5AA 4BNFA 5JDIC 4OKIA 4PLTA 1O0SA 1N7GA 3L4SO 1Z6ZA 3QP9A 4GL4A 1R4MA 1MV8A 8ADHA 3PPIA 5KJFA 3CIFA 4E13A 1WW8A 4NG5A 4RF2A 3A28A 4R3WA 2PWZA 2HU2A 4PVCA 4BNVA 1LRLA 4HFJA 5B4UA 1DBVO 1ZK2A 1S7CA 5TNXA 3GAZA 2WWRA 2ZCVA 1YKFA 3GGOA 2HK8A 4E12A 2FN7A 1TT7A 1BXZA 3AU9A 3P2YA 1FDUA 1JLLA 1P44A 1IHXA 4KWHA 4ONEA 4PVDA 4DLAA 3GMSA 4IMRA 4DVJA 5CEFA 4WLUA 3RUAA 4MP8A 2B83A 4BGIA 1T2FA 1O9BA 2AQIA 1HYHA 1E6WA 4WNCA 1QYXA 4EW6A 3H6KA 5DZSA 3HFSA 1YJ8A 3GGPA 3PI7A 5BNTA 1HLDA 4TWRA 4WLVA 4U7WA 3GVCA 1K6JA 1Q7GA 2JD0A 3VPHA 4UUNA 2O3RA 3WGTA 4TRRA 1O6ZA 2B4QA 4Z9YA 3D7LA 3OJOA 4P4GA 4YAKA 4OOFA 2YZ7A 1ZNQO 2GASA 3ZU2A 2A4KA 2LDBA 3VZRA 8LDHA 2ZB4A 4KWIA 1GUYA 3MWEB 4CQLB 4D79A 2O48X 3B70A 2PGLA 1EUDA 1NASA 3HDQA 3JYLA 4UREA 4UEKA 3UOGA 3WSWA 1CDOA 1I5RA 2B36A 1E3LA 4OXKA 4TSKA 2WD7A 1B8VA 5GZ1A 2NU7A 2V6GA 1ZJYA 4RPGA 3VPGA 4EEXA 3JCZA 4BO1A 4E30A 3GN2A 5IF3A 3FR7A 1BWSA 5T6BA 3G49A 4PLYA 1F8GA 5ADHA 1KIFA 1SAYA 4B4WA 4PGFA 3SC4A 3AM4A 3D64A 3ZNPA 3KVOA 4M1QA 4CV3A 2CNBA 3DZJA 2EP5A 4LMRA 4GMFA 1HKUA 4XIJA 1NBOA 3U4DA 5COQA 3BMCA 3IQDB 2RHCA 1ZSYA 3KSZO 5CFZA 5FFFA 5A5EA 4BV9A 4XYLA 1AXGA 2PZJA 3B1JA 3H5RA 1ZO8A 1XDWA 4II3A 4BIIA 3Q6IA 4LVUA 4CLRA 3S1LA 4KTVE 1YQXA 4WLFA 5THQA 4FC6A 3X2EA 1M66A 3L6OO 4YT5A 2BRUA 2FPGA 1SBYA 4NU5A 4LGVA 1N92A 2ZB3A 5EESA 3CMMA 1XWFA 3Q9UA 4H7PA 2ZATA 4XQEA 4FFMA 3VKUA 3LT1A 2EKLA 5TX7A 3WJ7A 4BNJA 3ZWOA 1UAGA 3ENNA 1VLLA 4NPCA 1YQDA 1XLTA 4XRRA 2AW5A 4R5MA 4CQMA 3UN1A 1TLTA 1RPNA 3NGLA 4TRNA 4CV2A 4D43A 5KJCA 4XR4A 1N7HA 2IYPA 4LVCA 2NVUB 4J0FA 1PU2A 3OM9A 2DU8A 2JD2A 2VYVA 2IDZA 4IJVA 3ZU4A 2P5UA 1IZ9A 2BD0A 4OOEA 4Q3DA 4CMHA 2NADA 3AFMA 4ZQGA 3ZW8A 3WWYA 1D1SA 2EW2A 1Y5RA 4UULA 1PQUA 3HFGA 2HMWA 1W8DA 5TC4A 1YDWA 2BKAA 1FDVA 1DDOA 1DSSG 5CEJA 1E0DA 1P74A 1ULUA 1O89A 4B7UA 3K8ZA 4G81A 1SB8A 5KJ6A 3RQSA 4BUCA 3W8DA 1YOVB 3KOUA 1V8BA 3SJUA 4OXNA 2FWMX 4AG3A 3NT4A 3F9IA 1V6AA 3PFFA 1MFPA 3IC5A 3TN7A 3Q0EA 2YQ5A 3W4IA 1H9AA 4EZBA 2HRBA 4LRTB 4NFSA 1F17A 2VRCA 1HDYA 3ZCXA 4CM1A 1R0SA 3WGZA 3ZWWA 1ADBA 2OHXA 4XYGA 3L6EA 4A0SA 1NWCA 3VZSA 2V65A 3IJPA 2Y05A 4NFHA 3ZNOA 3TJRA 1R4NA 4AJEA 4ZJUA 1CRWG 1U4SA 3HB5X 3PTZA 4IMPA 5DULA 3ZHZA 1YO6A 3ITKA 3Q9NA 3C7CB 2JL1A 3PJGA 3DBHA 3PHLA 2D0IA 4S1VA 3ETDA 3JQDA 3W8FA 3P7MA 4ILKA 3P19A 4PLFA 1X13A 2HDHA 3UHAA 4AJPA 3U62A 4F6CA 4QFCA 4L74A 3DAGA 4O5OA 3ZHBA 3AY7A 3RSHA 5DN9A 2I3GA 4NBRA 4E5KA 1FDWA 4NU6A 5DOVA 4RPKA 3DZFA 2NTVA 1H9BA 3ON5A 5F1PA 1PJ4A 4A2CA 1I2ZA 4QXMA 4FFPA 1GZ3A 2NVUA 3PYXA 1GCOA 1U5CA 4BGEA 1PWXA 4BQRA 3RFXA 5BNFA 3WYCA
chains in the Genus database with same CATH superfamily
3A2NA 4FW8A 3RIYA 1ZGJA 1HQDA 5L40A 2VDMB 3JY6A 3G2NA 3DZDA 1AF4A 3ZTTA 2OHVA 1FDIA 1SEVA 4XUDA 1SUWA 1NXOA 2JGMA 4H1VA 3WGGA 2V74B 4CIVA 2PXHA 4BFZA 4ETMA 4DLLA 1SKYE 2PVSA 3LC1O 1I7DA 1GN9A 1V11A 3KHSA 1TT5B 1XRLA 3KSRA 4GR5A 5CH8A 1HK7A 1YACA 2JCBA 5DWDA 2BJHA 3DVSX 3FPAA 3G02A 2P41A 1BE6A 1OIXA 2VNSA 2NW6A 3PGLA 4UOQA 5DNWA 3TSZA 4A73A 1DDIA 4B73A 1BXGB 1HURA 3O9VA 2I55A 1A9XA 3BXXA 2AB0A 3ESAA 3WLRA 2IYLD 3ETEA 1EM8A 1V35A 2WJAA 5DNVA 5CITA 1XVLA 4R1NA 3GEPA 3I39X 1EMDA 2HV8A 4IV0A 2QW8A 2DQ4A 3LRXA 4QJ3A 3MQFA 5PGMA 4BO8A 1M33A 1QRTA 3F6PA 1H1DA 2NUPB 3D2AA 4I1OA 3G5MA 1AURA 4HTFA 4JLJA 4C4XA 3P9YA 3MBIA 1CQIA 1DU4A 2ST1A 1EFVA 3UJNA 2PRJA 2BSAA 5C0OE 5TS3A 3P2MA 4RY0A 2GPBA 1F14A 3EVZA 4E11A 3AEQB 3JX9A 1XU7A 1CDDA 1Y1KE 3BILA 3DT6A 4LGCA 4B6SA 4M55A 5ESRA 5D1HA 3KPYA 3R23A 1Y8ZA 2YJTD 2H5IA 4PTYA 1SD5A 2QTNA 2BTQB 3BFVA 3EHDA 5ICFA 2C2OA 5HW0A 4QUKA 4BU0A 2WJ6A 3GH1A 1YK0A 4JU9A 1VHDA 2F2TA 1WJGA 1O95A 1GEGA 3D7SA 4F97A 4TSRA 4EFKA 3MRTA 3WICA 4L5BA 2DWPA 4JV5B 4M60A 3N6VA 1P0QA 3TLEA 3ETCA 3CLUD 4RU1A 2JB9A 1ZXLA 4JL6A 3H2YA 5EFOA 4C0KA 1K5DA 1YA6A 1OXXK 4FD3A 1FP4A 2GN2A 4MWGA 2OHHA 1IG3A 3M6IA 1FRQA 3N5KA 2FFAA 4RE5A 4ZI5A 4CCYA 2E5WA 1E32A 5IARA 2Y1WA 3VYUB 2Z8XA 3HZZA 1KY3A 4L3VA 4TSFA 4UE6A 4ZOLF 4CTKA 2TYSB 4IMIB 4U2EA 2BP7B 3CYFA 3I6BA 3NANA 4C0AC 4Q3OA 1K6MA 1YB5A 2R8XA 1GQQA 1U31A 1ZHFA 3D4BA 3PDUA 3HB4X 1EEHA 4R1UA 2E9SA 1FFCA 1X15A 4AZWA 4XW2A 5I8PA 2H5JA 4RUKA 3KHUA 5JC1A 1J06A 4NCNA 5CT6A 2IWHA 5JZVA 3DKIA 4RPIA 2OXIA 1JV2B 4EA6A 5ABPA 3KAQA 4U2KA 3TZEA 3H1PA 4A03A 1IAQA 4DS3A 4OQNA 2DFDA 1TYAE 2Q9BA 1L8QA 3MT0A 4RX1A 4CM8B 1MO3A 1SCBA 3KUDA 5I45A 2WJGA 4HNVA 2GRAA 4LOKA 1MB4A 4LJLA 5JI3E 1QPZA 1O3YA 1DAEA 1GAWA 2RONA 2W8BB 3CJRA 2TMGA 3DJYA 3P5SA 5JJIA 3JPYA 2B1RA 3IVRA 1AUXA 1JDVA 4KV7A 1UQUA 4O4IF 4YQEA 2WY2D 3V32A 5DI9A 2A9PA 4D5EA 4Z4GA 1LDYA 5JPCA 1IHUA 3FCEA 2P6PA 1ADFA 4G85A 4K9PA 3C8DA 4Q1CA 2VPPA 1NI3A 2I2XB 3RADC 5I7RA 2GAAA 3AC0A 4HVTA 5TMPA 4DNPA 3O8RA 1ZHOA 4LJRA 4QPJC 2OCXA 3DOHA 4JUAA 1AM4D 1SZJG 5J2TF 2FJ0A 4ZOLA 2NV6A 4Y1GA 5BQ5A 3G2OA 3ADDA 3DFZA 4IZIA 5AK4A 2G04A 2GBPA 2HUNA 5AHXA 1NJ5A 5K3SA 5C35A 2AFRA 2R5WA 3THYA 4P0PB 1Z39A 5HRAA 4FLFA 1HNZB 2OENG 1VLQA 3CZMA 3EC2A 4REOA 1QGZA 3QITA 2F9MA 3KE9A 5KOJB 3UW3A 5KSOA 3FUTA 3N0XA 3PE3A 2YNMA 4HEQA 5I8WA 2IHVA 1O87A 2XQJA 1JKIA 3SMQA 2ZZKA 2D8AA 3A6HA 3RAFC 1GITA 2A9JA 1FX0B 4JLBA 4M0LA 2ZBRA 2NPFA 3R7FA 1YV9A 1XYVA 3E9EA 3D8UA 3DZ8A 4M88A 3O4GA 3UKDA 1PHRA 4CKEB 1Z7BA 2OC4A 4O4JB 1XR3A 4YRIA 1CTQA 5JS2A 4PZAA 2H52A 3MPOA 3PNKA 4MQMA 2FPUA 4B75A 5IAEA 4EDHA 5JEEA 2BUAA 3U4QB 4UM5A 5AXAA 5AQEA 3KB2A 4NJMB 3WNZA 1M8JA 1J0XO 1D2HA 3LLMA 3IAAA 1RZ3A 1QQAA 1WXHA 5AKYA 3FETA 1KTVA 1NTOA 2O5RA 3CKKA 4NBWA 3LUJA 1JKMA 1WO8A 3K6JA 3C6YA 1YCFA 3M3PA 3HXLA 4FHCA 3COWA 5H83A 1SHTX 4X20B 4MRRA 4CM4A 4WASA 5J3JA 1DAGA 3OSZA 3U6BA 2AL7A 3RYFB 3FUVA 4BBZA 5FBHA 2IXEA 3KJNA 1J6UA 3ZCRA 1ZR4A 1WHSB 2I67A 2YV3A 4LHXA 4AK9A 4B0PA 2ZM5A 2B3TA 1YI8A 2I7TA 4IV5A 3K2EA 4ND6A 1UC8A 5HIIA 4BVBA 2I65A 4Z7OB 4CMGA 5IBCA 2C54A 3B1KA 4C0BA 4YPVA 3KVYA 3RTCA 4HUQA 3A0RB 3ZOZA 1JP7A 2CXRA 3U4IA 1CNMA 2WWWA 4N03A 2SNIE 1ODLA 5J2UB 5I47A 4PTZA 5JYCA 2C57A 4DRYA 4XM2A 3BWBA 1UJNA 1TZMA 2XWBF 4O4JF 4UQPA 5BR4A 1MZVA 1DHTA 2MDTA 1ZCBA 3BOSA 1HE5A 5GVRA 1JECA 4ER6A 2ZSHA 4ATNA 1KVUA 3H75A 2C58A 3SJ7A 1XL0A 1B6TA 4J4TA 3I34X 2UVDA 4I2VA 5H3LA 3AERA 2VR1A 5DGIA 5HDBB 1JKJB 4EPTA 4DUZB 1S0UA 1COWD 1N7IA 3S1AA 1N5OX 1I6MA 3EOAI 4JSTA 5FJIA 1GL3A 3LY5A 2VJBA 3ROPA 4KE9A 1KZHA 1W36D 1BAPA 4F3CA 3BE4A 3SIRA 5BSKA 3T3DA 5I9IA 5IULC 5AJZA 2QORA 3C7AA 3MWKA 2ZBQA 1OLUA 2I4OA 1GLNA 1UBNA 4B32A 3R6WA 1BQEA 1MABA 2WLTA 2YN2A 3I3OA 2QGNA 3UPUA 1KK2A 1X1EA 2OMKA 1W2WB 2XRYA 4YMLA 3RVLA 2IS1A 1VHTA 1ZCZA 4JJ7A 1VIVA 1T9GR 3DWIA 3ABOB 1VSVA 4JB8A 4U2BA 2PGIA 4FDVA 2VPZA 3OOSA 4LDNA 2BOVA 3R74A 2HSEA 3U3RA 4GLFA 5CCEA 4JBWA 2EU8A 1KWKA 4OG2A 3R76A 2P30A 3RJTA 4B09A 4F1JA 3WGIA 4QRIA 1AC5A 3WLSA 1XZ8A 5JBQA 3TJZA 1SHJA 2NVWA 3TQFA 3S2GA 4PZPA 2WIDA 4OP2A 1DPFA 1QFMA 4LC9A 1AUPA 4XD7A 2HU7A 3R4CA 4ZO4A 3TSAA 3VR3A 1I0LA 5M3BA 1R0RE 3DMYA 4K5QA 4ZMSA 1RHQA 1EVYA 2YYAA 1Q44A 3GXBA 2PSHA 1D0IA 1ZS9A 4KQHA 3SDZA 3C98A 2PPLA 2YJZA 1H2ZA 1Y82A 2MMGA 1UDRA 1VI6A 3BGVA 1XCMA 4JHXA 3ZNQA 4IQ8A 1QO0D 4DV2B 1N8TA 4JU8A 2VXOA 4HNTA 1KEZA 2YZGA 2G77B 2ZDHA 3O8QA 4XVHA 1XUOA 4CQMB 4NS4A 4M1YA 5I7HA 1U11A 1EI9A 5EWJB 1IM5A 5CB8A 5A0FA 1FRVA 2CHEA 4DGSA 5IKPA 3FZGA 2ZWOA 3H13A 4KH1A 4R69A 1B8PA 2CLSA 3KUUA 3GT7A 1WW3A 3MJFA 1KYWA 3IP6A 4N65A 4UPEA 4ZV4A 2QAGA 4PLPA 5JWHA 5KINB 2J0EA 3ISJA 3CEJA 3TVTA 3V97A 3QW4B 1T0BA 1NUUA 2HWUA 4R2JA 3H87A 5AKJA 1I2BA 2YIVX 1G9XA 5EKUA 3NBZC 1OJLA 2H5EA 1PWEA 3ZJYA 3UJ9A 4CKWA 1GAEO 1J56A 4WLNA 1KRHA 4YIHA 2JJ2A 1B1CA 3PGMA 2OT3B 2NQ8A 3RC7A 3FVQA 4E1AA 5EAIA 2YN4A 3H3FA 3K0FA 1TUBB 4IVQA 4NE7A 2PSSA 1JDTA 1D0VA 4MVWA 4RSMA 1WDTA 1HDRA 2AYYA 2C9BA 2M1ZA 4XJTA 4W8HA 3OPYA 3WV5A 5L53A 3NHSA 1T36B 4MGZR 1RAFA 1NNI1 1C3LA 4DNFA 3KTAA 2A5JA 2QMHA 5J47A 3FXAA 4Y2XA 2AN9A 4NR0A 1W52X 1TK9A 1XC7A 3EQ7A 3BWYA 2B34A 4DLBA 1KZGB 1UP7A 2L18A 1BX3A 4CE6A 3PK0A 2QM0A 1HTBA 4ID9A 1L4NA 4TWZA 2NU9B 2OXCA 4F3TA 2EJUA 3DNMA 3K5HA 2A35A 3IHLA 3QE4A 4MGEA 1Y4DE 4OI1A 3L8DA 1CF4A 2ZKIA 1V1MA 3ZJUA 4NOKA 3LQYA 4K9KA 3KQUA 1JQBA 2J4CA 2XI4A 4C7BA 1ABFA 3ICOA 4BQFA 4YCCA 2CCKA 4XB1A 1D4FA 4DBLE 1S2GA 3GLIA 5FO1A 1XA4A 5LMUB 1WQ4A 2J41A 5EPEA 1AMOA 2IJGX 2AFVA 3PHGA 1GXSA 4FLEA 2OCIA 2ZJYA 3ILVA 1UUFA 5EY5B 1QFJA 3UENA 4Z5XA 5EP4A 1F1BA 4Y98A 4KE7A 1W76A 3PI6A 2C1ZA 1H5NA 1PWZA 2B94A 1UK7A 3EOBI 3GJ4A 3O92A 1Z13A 1YA8A 4YQZA 2P8SA 3RIHA 4PS1A 5E4TA 3VKWA 4X91A 5KPDA 3LUPA 3AM1A 4UEQA 4BVFA 3OJCA 4QO8A 1AOXA 2IPLA 2YFKA 1SBTA 4IP0A 4G4GA 5HA5A 5EEGA 4AY6A 2FUG6 2R6ZA 2IXGA 3X1XA 1BKYA 3L7KA 3GROA 3NAMA 4S1OA 2BFFA 2O2JA 1TCAA 3KEQA 3V8PA 5IDVA 4ZZ2A 2PQ2A 4EB3A 1X2BA 3PXDA 4DDUA 3A6GA 2YYZA 2XRFA 5I9BA 3ZLVA 2L69A 2RIRA 2ZUDA 3C16C 2OQ2A 2FX2A 1C9KA 1DX9A 3PQ5A 4L28A 3J7TA 3M2TA 2P6OA 4AN4A 5DX8A 1O6CA 5TJHA 1JH9A 2H0QA 1KK3A 1KJIA 1KI7A 3ELBA 3S2ZA 3TAUA 2R7MA 4NULA 2PGAA 4FGSA 4A6XA 2X0EA 4KKVA 3VNUA 2CK3A 1K7XB 1XCBA 2DKOA 3OQJA 2VHTA 2VNJA 4BOYA 2ZLBA 3U49A 3WL6A 4ZAXA 3AB8A 2Y0EA 4DMFA 1RYMA 3G8BA 3DL0A 3HUDA 1YCDA 3JQCA 3E7XA 1IVYA 4YMHA 4O59O 1CC1S 5JJ5A 1HBJA 2QW1A 2VHUA 3M4XA 4PLVA 4OXIA 1GDTA 3B6IA 4FZ5A 1LPPA 3T4XA 3RIMA 4X9XA 1I4OA 1UXIA 3T61A 4RLSA 2GAFA 3ONDA 4KO4S 4PYIA 2NQTA 3FYCA 2PV7A 1BXGA 3N2GB 1AS0A 2X40A 5LZ9A 4MCHA 1RPAA 1S96A 2BBOA 3C3WA 3EGCA 4BFLA 4YAIA 1FFEA 5FB3A 1NHGA 3WBJA 4FR5A 4ZAZA 2TSYB 3AI1A 2H8GA 2O52A 1PIWA 3DPIA 3M3HA 1K4MA 1YDHA 4LECA 3U1TA 3W9SA 1Y6GA 2HHJA 5K3BA 1XZEA 5I4CA 2ACWA 2Z1NA 3IKLA 5C1PA 1Q77A 2VYFA 3KWJA 5K3OA 2DY0A 1UBLS 2HHLA 3QE3A 4UXIA 2LKCA 3BCUA 3E8XA 1UT6A 3T35A 3UAOA 3UJDA 3NWJA 4R40A 2PLAA 1ZOLA 5IHPA 1VQ1A 4OHFA 4YWHA 5JSQA 1I7LA 2DKNA 2B6HA 4QGBA 4JKIA 4BNLA 2OE2A 3DAOA 3ICVA 4HX2A 5EKSA 5ILQA 5K1ZA 3NI2A 1X14A 5JH7A 1HX7A 2J4FA 4DL9A 1XRSB 1ZW1A 3N2ZB 1UBMS 2D7CA 2W4IA 3T3MB 2QN7A 4WZBA 1VRVA 2Q1UA 2SCUA 2GH1A 4TTRA 5ALDA 5KTTA 3NZEA 1QKKA 1VP3A 3TTSA 3IXQA 4FS3A 1N1DA 2VO1A 1HL7A 2XYPA 4LY9A 4EYQA 4FR2A 5BR1A 3EGWA 1E2NA 3CZ9A 1JT9A 3PPVA 4K8OA 3NHBA 1XZPA 5F5XA 3RODA 2ODEA 1GZDA 3RC3A 4I99A 1I3LA 1OMOA 1RWXA 2IT1A 1XDSA 3VUFA 4BGUA 5BV0A 1E1CB 2PL1A 3FOWA 1JR4A 1D09A 3BWVA 1IOZA 1WMBA 3SYKA 3KU1A 3TE6A 3MPUA 1CY2A 1W5SA 4RGYA 1UJCA 3VC2A 3T94A 1E79A 3EVCA 1MD9A 3MUNA 4AO6A 4MVJH 4HNAB 1M6NA 3FWHA 4C20A 1AUOA 4IDAA 3U60B 3ZGOA 2FSFA 4AJ2A 5T4EA 5JYDA 4PZEA 2BTOA 1GCIA 2FV8A 3L8GA 3EQ8A 1ONNA 2BM9A 3A58B 3DYBA 3FLBA 3LUGA 5KOJA 4G65A 2R7KA 3G9XA 1KR5A 1KEEA 3FNGA 4HQOA 3FMOB 3MNFA 5BPFA 2RHBA 4PAWA 3IBGA 2XXJA 1CUUA 3E35A 4CQMD 4MEBA 1K8ZB 3UPTA 5KTPA 4Q19A 3W4JA 1OX4B 5HJEA 4QDZA 3LW8A 3I04A 4O3FA 5IBPA 2NX2A 4K26A 3QVLA 5JC8A 2FQQA 2VH2A 1VL2A 2BFDB 4NJOA 4D6YA 2YXBA 4ZHQA 5F23A 3IIMA 4UU7A 1V0JA 4JL5A 4E88A 4QRDA 4G0YA 4MS1A 4DNXA 3OCUA 4BCBA 2R8ZA 1B6GA 2C88A 4DC0A 4ZOQI 1W0JA 4L57A 4X6XA 1UXGA 3VZCA 2EX0A 3X2FA 4OL0A 3THXB 2WHEA 4FKZA 3BPSA 1T35A 5GJWC 3G9QA 3W5HA 2OBLA 4C6HA 3ZJVA 4G3XA 4NENB 3OZ7A 3PJDA 4EELA 3FNEA 4JJZA 4RD2A 3CF2A 3NTRA 5G0TA 1V9LA 2B0CA 1YOBA 3KL2A 3MD0A 4OREX 2IELA 3FOBA 2B2NA 2FG6C 5A6VA 1EK6A 1G2PA 2QW0X 4ISBA 4QXQA 1MQAA 2JASA 1OCEA 5LQKA 5BMVB 2ECFA 2GNAA 2J31A 3QPBA 3UT6A 1IOVA 3VZQA 3WXBA 4LY3A 5IAAA 4OI2A 4H7JA 3UFBA 3ZX4A 1QP8A 2B2CA 2YHSA 4HBZA 1WUKS 3GJ3A 1GDDA 3QTBA 4HLUA 2FDXA 3QMVA 2VT6A 3G2QA 5LIPA 4FCVA 4QDUA 2RG1A 4YLYA 2V7XA 1V4VA 1N0WA 1THMA 2W2XA 3W8EA 1Z2AA 5A3RA 2WQ6A 3HLKA 5A4DA 3N8IA 5BMVF 5IPFA 3W6ZA 2FPMA 3AERB 2FY8A 4DLXA 1NUPA 4YJGB 4MWOA 2BHTA 2HWYA 4GMXA 4BNXA 3TFWA 2J3IA 4CHTA 5HUJA 4BTVA 1P7WA 1TRKA 2W2NA 3S1AB 5E0KB 3TMAA 4C87A 3ZE6A 2FHSA 4H18A 3DMTA 4ML3A 1XZFA 3RC1A 4QBKA 4NYJR 4XTRA 1UC5B 2JFVA 4QDKA 3QJ5A 5KNBA 1HDIA 3LA6A 1D2AA 1P33A 1VIYA 2QL7A 3FCOA 4LG1A 4Z7QB 3E5RA 4RD4A 1RLTA 4QYSA 4KQMA 1XQWA 1NU6A 2X1MA 4RL4A 5D86A 5C1IA 5TS2A 5KPJA 2VLBA 4DR1B 1US8A 4I1UA 2O3QA 4Z3OA 5D1NA 5C3MA 3WKCA 2Y9ZA 1YGYA 2QLJA 3LQ4A 4Q7EA 3KZCA 3RYIA 4ZU6X 1QGUB 2PM8A 3U7EB 4AURA 4EHJA 4CG1A 3UK1A 1IDN1 3NTUA 5HK8A 5FUQA 2QYHA 2OQIA 2ZUCA 3O4IA 4K0RA 4OV6B 3F6RA 4UHDA 4X8OA 4GDMA 4YUWA 5L6LB 1UH5A 3OF3A 1R4MB 4MUFA 2Q7XA 1D4ZA 3DW1X 3LL7A 3FJ1A 4OLFA 1L7RA 3JQBA 3AP3A 5F3RA 1EJBA 2GF9A 5FOTA 1KY2A 2PLRA 3GLQA 4U3JB 3D7RA 4KQGA 4N0QA 4UHCA 3QELB 5CDFE 2HIMA 4Q4HB 2WF9A 2B3DA 4AJLA 1EVLA 5BXYA 1X1CA 3NHAA 5BN3B 1TK3A 1ZFNA 1K8YB 4HL6A 5IX8A 4J43A 2JIRA 4F2PA 2QHXA 2YL2A 4OQDA 4BMSA 3PLRA 4NYIR 3ZJTA 5KNCA 2EFDB 2JFQA 4TXHA 1EK0A 2NAPA 4LOHA 3CINA 2LP4Y 2JEYA 2QPTA 1VG1A 4D8XA 5G0VA 3H0CA 3IEPA 4NIMA 3ANNA 1I1OA 3CH5A 4P34A 5LKAA 3GLFA 1DZ3A 1MJGM 1CBUA 1UR5A 5I7SA 2J6CA 3R3SA 1K9SA 2FEXA 1E4OA 3E6AA 3R3VA 3UFXA 4YRMA 1MV5A 4Q02A 1VL5A 4CKWB 3OLVA 3U9SA 3UWPA 3IAFA 4H7DA 5GV8A 3ZV5A 4B6EA 3IE1A 1E9AA 2PGDA 1A72A 1A9TA 3P9IA 3WLMA 3GZNA 5KDLA 5HK9A 1QIIA 1RYZA 4BZWA 1U8AA 3WHKA 4EQZA 4C2AA 2JPDA 1JA9A 3TLCA 2WWTA 3WGYA 2GF0A 2BEJA 3DV9A 2C5LA 3FTQA 1U0TA 4R1OA 3CG0A 1JXAA 3AUAA 1J24A 3ISTA 4JCCA 1Y1RA 3RJ9A 3TNYA 2L17A 1IQPA 2NYAA 5FTJA 2ZIUB 4IF6A 1R50A 1EQAA 3DD1A 3FBTA 2XDYA 1LB1B 4HDMB 3K0AB 3LPNA 4J4BA 4Z0HO 5A4FS 3N75A 2IY8A 2CJWA 1N2HA 1X74A 3DKKA 1PTJC 1WPXA 2FZLA 2QL6A 3F6BX 3JVDA 1VKZA 1VFPA 4I55A 4RVGA 3KYBA 1OBOA 2XIQA 2QMEA 5HIAA 4YXFA 4B3HA 1FYEA 4HFRA 2BRUC 3H2KA 4LE0A 1YVDA 4JZKA 2IF2A 1E6KA 1XAGA 5DSTA 4UM7A 5FNVB 4D0SA 1KF0A 5IZ4A 4DV6B 1B42A 4L51A 3S0JA 2QUAA 2VPWA 1JEYA 2OSBA 3ZY2A 4EG3A 3W9BA 1I94B 1CR2A 3CX6A 3MCZA 4RF3A 4RFSB 4UDOA 4CEJA 4MKXA 1UMDA 4XSGA 3O1JC 1L7BA 3K70D 2P9HA 2W2LA 3TD6A 3TNLA 2Y1LA 2RGNC 5K2MA 1U2GA 1LDMA 1JDPA 5AVXA 2Z6UA 3PQ7A 1LA2A 1ZIDA 4HQLA 1KDVA 1TUBA 1ZU5A 3EFBA 1BH2A 3G9ZA 1CJMA 4NEQA 3GJXC 4NV0A 1JIXA 1OFCX 2C2KA 3PKZA 5DBHX 1N2BA 4ZT4A 4N6OA 4YDQA 4GPIB 1JL3A 4XYEA 3A6FA 3AHIA 5IS2A 2WJJA 4JLKA 2JAUA 2C4MA 3KJHA 1JHAA 1JFRA 2O8CB 1H4VB 4P7KA 1I30A 4GP7A 5ARDA 3NVMB 1QYDA 1UKVY 2VYND 3PQ4A 4B87A 1UBHS 2ETXA 3O95A 2WWVD 4WAUA 4RCZA 3NYIA 1SO8A 4NZOA 4RK1A 4B9AA 1Q91A 7GPBA 4FK8A 2AG1A 2O9JA 3QI7A 2Y0DA 3VDQA 4DUPA 2YJ5A 1U1IA 5LR6A 2WU4A 3HKEA 4JR1A 4XX0B 1MR3F 3FFAA 4MV1A 1Z9BA 2ZEJA 3ADOA 2UUAB 3EZ2A 1J2EA 2AZ4A 4M0PA 1DGQA 2DVMA 3ZQUA 1MGPA 3WG9A 1ZVJA 5A5FA 5DX1A 4OHKA 3TLKA 4NXNB 1DIOB 4XR9A 1T25A 5EXPA 1O5IA 4ZI7F 5LWHA 1GARA 4M53A 3IAHA 3TRDA 3W2GA 4KQEA 3BE5A 5D7BA 2ZRLA 2D1YA 2NZ2A 2YZMA 2BMVA 1J8FA 3O8LA 1AK9A 3TR5A 1GLVA 2I54A 1Z17A 2XOEA 3KWLA 4AMUA 1NQOA 1Y7IA 3GP3A 2G80A 1EHCA 2F00A 3BCSA 1I3CA 1L7QA 4G5FA 4RKEA 4WKNA 4BLVA 4DR3B 5DYNA 4Z9FA 1DI0A 1DRUA 1DJNA 4RGVA 1GHTA 2C2ZA 4RVCA 1C7FA 5AKHA 3UHOA 1ZK4A 1NOIA 1IMOA 1I4LD 1U3FA 3M5DA 1H5QA 4NS1A 4RIGA 2EEZA 2WWIA 5L6MB 3R7SA 2CXQA 4IHQA 2OMEA 2VPTA 4MKFA 3AT1A 1HE2A 5EUBA 1KVSA 1P1KA 1RM0A 2XZLA 3IVAA 3O7MA 3DVAA 4N01A 2A1UB 4KL8S 2P1ZA 2F43A 4MGHA 1ZD2P 4OF4A 5ARCA 2WVHA 3HJGA 1LWOA 4BNTA 1TXGA 2HREA 4J7XA 4WWHA 5KHOC 1FQKA 3INTA 2Q4DA 1G9SA 4CMKA 3GP5A 4MA5A 3N05A 4UTZA 2EG5A 5CDTA 3V4FA 3MIZA 5ALRA 3LOPA 5ESXA 4BXOA 4BO5A 3W2FA 3GFBA 4P93A 3G2KA 1SR8A 3HGQA 1WMEA 1J5PA 1H6AA 1RXCA 5HFAA 3RVOA 4ABYA 4M37A 6CHYA 2DM6A 4WBNF 4A0FA 2G28A 3WMWA 2HMSA 2PS1A 2G71A 3EFHA 3FHLA 2ACVA 2GYVA 1HY3A 1XAJA 4U8HA 2ROQA 4XUEA 4E2FA 4RPHA 4ZFNA 1XZGA 2H51A 3SICE 2J9RA 3VHXB 4I5GA 2VEDA 4PTLA 1R15A 3RCBA 4DADA 3CX4A 4DLKA 1SFRA 5JRDS 2Z09A 1E9FA 1H93A 2HEIA 3GPIA 1RHJA 4K9LA 4DKJA 1AKRA 2JI8A 3UT5A 4QRHA 5IRCD 1AGNA 3DF7A 3WNQA 3IUYA 4IDNA 3E9MA 1PK8A 3HM2A 3HXKA 3AWIA 5EXTA 1KHHA 2GZAA 3ORYA 4UXJA 4WUTA 3ZHVA 4JEHA 3ZD9A 1QVAA 3A4LA 2PSFA 2H1LA 2PBFA 3OOJA 4I3FA 4UUMA 4DSTA 5BN1A 1RRMA 2C2GA 2D0PB 1SCDA 3OQIB 1CT9A 4LNUA 4XQGA 1Z82A 4YRAA 2ORYA 4TMZA 5BUZA 1T4CA 2HCTA 3KO8A 2ZIEA 4KI7A 5D87A 4YUXA 1X0VA 1Z6TA 2WD9A 5L95A 1KJZA 1YD7A 5FL3A 5F9MA 5LA6B 3ZDYB 3AHCA 4EW2A 5KSZA 2OD7A 2X6QA 1KAGA 2X8JB 2B2XA 3E4DA 1H69A 1QGED 3EH1A 4I08A 4Z9AA 3IUQA 3FYTA 1ZIPA 2G0NA 3LVFO 2P2CA 3LZCA 5AKXA 3X1WA 3F73A 2VDPB 4X61A 4DLUA 4AMBA 1C2TA 2WMNB 1S89A 1E98A 2COUA 1HDOA 1SC4A 3QTTA 1GGVA 1GZ4A 3ZZUA 5BWNA 2YWCA 1RWWA 3WQBA 2IUYA 1YVRA 4EYKA 5L3VA 5HQ3B 2QT0A 1HDEA 1BEZA 1TZKA 1ZIYA 2G17A 3HKDB 2NU8B 4N76A 4GOMD 3TTVA 1N25A 3B5IA 4WKGA 4XWAA 3GBSA 2UKDA 2WPDA 5JAIA 1TO6A 3KKMA 4NBUA 1GZHB 5FBQB 3GJTA 3X2SA 3G0OA 3ENZA 4EG8A 3UH0A 3M34A 3PFKA 4NENA 4B2LA 2R4QA 3PHIA 1FFXB 2GN8A 4YJ3B 1RXSA 1U1DA 2BFMA 3FWKA 1PZEA 2DKFA 1XD2B 2QGZA 4TZKA 2XIJA 3DOIA 4L2IA 4LHYA 3RROA 3KFXA 2OAP1 3PX3A 4LCBA 5ITZA 1S8NA 2AFIB 3ICWA 1XDUA 4GPEA 1DMSA 4QQKA 5E9AA 5BR8B 4X92A 1H42A 2C9ZA 2P2ZA 1IMJA 2P4HX 2Q49A 2GDZA 1RBQA 1PJAA 4W1SA 1DEAA 5FUMA 2FVYA 1MQSA 3MMZA 3SE0A 3T52A 2FE1A 2D1QA 1G4AE 5JPIA 5B7PA 2WTBA 4JGGA 4LF5B 4OP3A 1SXQA 1LI4A 1K2WA 1NW3A 4HAXA 4QQ8A 2AEEA 2JI6A 4Y2HA 5B1HA 3I3SR 121PA 1EJ0A 2AC7A 1VIAA 2RHHA 1PBTA 2OYSA 3ZEIA 5KQPA 4K9NA 2W43A 2D1RA 4HO1X 1CERA 1Z5WA 4WY2A 1NV9A 2FX3A 4JLWA 5A4KA 1C0LA 3CVJA 5DTIA 4R5HA 3UK6A 1LTKA 1YR7A 4JY7A 1EP1B 4X6LA 3HGMA 4Y6PA 1K5GA 2WG0A 3BFPA 5B53A 2JFGA 5CB0A 2XODA 3VI3B 2GF2A 1VSUA 5EPOA 3CIOA 4KMSA 1JVSA 1A5SB 1UKCA 3A31A 1C80A 5EA2A 4OSEA 4U1RA 3USES 4CM6A 3LHKA 1T6ZA 2PL3A 4EHLA 1NBEA 3K94A 1JHRA 4PZZA 1RPJA 2HWXA 2ZAOA 2VDNB 3B82A 4F04A 2G1AA 4GDFA 1I9GA 4JENA 4MB6A 3OAAD 3O9ZA 2UXDB 1I10A 1X7YA 4CF5A 2RGUA 4N7RA 5HCNA 4EKEA 5ITWA 1J9ZA 3SGLA 5B7GA 1Y5IA 3V1NA 2O57A 4A5OA 2HYDA 3MUOA 2I7XA 3AIOA 1FFBA 2RH4A 4EKNB 3LC7O 4DPLA 2ZU6A 2H08A 4I1IA 3F6YA 5A06A 5CLJA 3RNLA 1FFDA 4NZNA 3A26A 2CD7A 3NIDB 5EJEA 1UL1X 3D3JA 1GTG1 3E9DA 2D2IA 1RCTE 4IRMA 4PPFA 2GKGA 2L0XA 1CQJB 1YQ9A 1WDKA 2FP3A 4IG4A 4NYJQ 3W5IA 3WGNA 5HTOA 1JHVA 3KOOA 5JO9A 2AHRA 3HCCA 2EP7A 2IEZA 4P7FA 1JEQA 1MA3A 1DLIA 3HSSA 4P5EA 5DK4A 3BWMA 4BATA 2NSJA 2CNOA 2M32A 4INPA 4YBZA 1KBZA 4MIYA 2W93A 4YPOA 1M0WA 1LDEA 1Z29A 1MCZA 1JG7A 3C43A 3I37X 3KM0A 1LX6A 4QEZA 5FHRA 5CVTA 3JRNA 3PEEA 4MAMA 4ZYTA 3OE5A 1W5TA 3M6VA 1E2KA 1KP9A 2WIAA 3RQIA 3TXAA 1ZEMA 4KRXA 5JCJA 2ZRFA 3CCCA 2X42A 1UPUA 3GPLA 3P5BA 2CFOA 4DMLA 5BWBA 5JY1A 3EHEA 3DR3A 5CJJA 3AEYA 1CR6A 2ZIVB 4AUMA 4G9BA 3PUIA 3MT8A 1XAHA 4N40A 2FKNA 5ETJA 3SSAA 1P1HA 2E0IA 3VU0A 2O2YA 4N5MA 1LQUA 2QP3A 3K6SB 3GT4A 2VQDA 2WU8A 1IXYA 4HPWA 4IDFA 3LPLA 1BW9B 2ZBDA 4P31A 5GZ6A 4JI1B 5ALKA 3GCWA 1EFKA 3L7MA 3ZQ6A 1VC2A 1WXIA 3DV2A 4Q6BA 4BECA 1SC6A 4OM8A 1UAAA 3TG2A 5C46F 1SVSA 1BFUA 1V2GA 3AF3A 3TPFA 3EDRA 4KN8A 1PGJA 2A33A 4DLTA 3M8KA 3ED5A 3AMVA 1Z74A 2I34A 5IJWA 4HN4B 1CU1A 1T9GS 2RI6A 2VHVA 2OA0A 4ZYZA 3DZIA 1PNRA 3BHMA 4JOCA 3SBEA 4BNGA 2QM3A 4GBMA 1PJ3A 1P4RA 2RBGA 3WGVA 2C03A 4GWKA 3GA0A 2YXEA 4B35A 4DV7B 4LJ5A 5EWMA 3ZNNA 5ICGA 5ALWA 5JOQA 5FNVA 3QE2A 4JELA 1RLOA 2QI9F 3C2QA 4TKUA 1JUDA 3IJ5A 5CIQA 1E7YA 5AK0A 2IPNA 1QZ3A 1QRRA 3QUCA 1RD4A 1USKA 2GEFA 2QKYA 4XASA 5AI5A 1I6LA 2R8EA 1C1DA 2QTVB 3PC3A 4QA9A 4DCNA 2WA1A 3A6DA 2XMPA 2CDBA 4CM9A 3ESXA 1F8FA 1N5LA 3MINA 4BCCA 4PO8A 3TQQA 6ADHA 2DLNA 3N7UA 4YRCA 2V1UA 1GUBA 5DGHA 2QSJA 3PJEA 2X9LA 2TS1A 4AJKA 3FA2A 3R7LA 6ABPA 5K3FB 1L7NA 5JI2E 3R5JA 3A36A 1HMYA 4YMSA 3N7AA 1OBCA 2NYRA 2RB5A 3OU2A 1OH8A 4FFRA 4J2OA 1QLWA 3ND8A 4RY8A 3VTAA 4R84A 3G1WA 4HDNB 4NH4A 4TV9B 4D46A 3Q3VA 3AFNA 1VA5A 4HDMA 2YIJA 4M9ZA 2DXIA 2A2ZA 1NMXA 4NHOA 1D2CA 5K8JB 2B69A 1NQTA 3EZ6A 1UWCA 1WX1A 2ONYA 4L5JA 4LBWA 3VOSA 1P5ZB 2PJRA 1IBCA 2ZRAA 3CE9A 3PE4A 4G41A 4DIBA 4UE2A 5HWSA 7YASA 1T2CA 3EFOA 1WIWA 2VZEA 2Q1SA 4RMNA 2W4MA 1NKSA 4QUBA 2GYYA 4UNNA 1FS6A 3VU3A 3HHEA 1S2IA 2FR8A 4CV1A 4DJJA 4E22A 4X65B 2XA2A 1UPTA 4YCMA 5JADA 2GK6A 2IUUA 3VR5A 2DOKA 3IEIA 1KKUA 5HQTA 1GU7A 3PS9A 1NQAO 1B76A 4URVR 5J2UF 3FYUA 1A8SA 1B6SA 1OC4A 1UXHA 2CF6A 5U4XA 4MQ4A 3SK0A 2X0NA 4CM7A 4DREA 2H11A 2GHIA 5JRZA 5D85A 2IOFK 4NBTA 4B8ZA 5AW4A 1RHMA 5TE9A 3C3KA 3WYEA 1X94A 2NO9A 2VHZA 1ZNYA 2ZUBA 2C5HA 3F5MA 3JR3A 4LRXA 4PR3A 5IC5A 3V2UA 3ZGZA 1P9RA 1RCUA 3CJTA 2ZZMA 2OOSA 3H3XA 3IR6A 2GBIA 5A05A 3EXFA 1GA1A 2P2LA 3CSDA 4J7AA 4MNTA 4MPTA 4TZ0A 1XMIA 1RYHA 1EDOA 2EKZA 2Q5IA 4I6JA 3PR2B 4UNQA 5BQXA 3L0ZA 1E6UA 4CF6A 4TQ9A 2IIVA 3CNLA 3RBVA 1JFLA 5JTTA 3VA7A 3GLGA 3IR7A 5H4HA 2RK6A 3ED1A 4JLDA 3VR4A 2XADA 3V6MA 5AW2A 4HAWA 4ZO7A 1NJGA 1EBUA 1SVIA 1O7JA 1PZHA 2A1UA 2H1WA 2H6EA 3CQ9A 1I4WA 2Q0XA 2QRLA 3RU3A 3VDNB 2KHZA 3NHMA 3UWOA 2UXCB 2QG4A 1IN8A 2XGMA 5DB4A 2R1ZA 4ZWNA 5JISA 3WTCA 5LYJB 5KEIA 2IYOA 2GTPA 1BEUB 4JFRA 1HFKA 1I3OA 4K2AA 4V1CB 4JROA 4J1TC 2AT1A 1NJ8A 2JAHA 1CEYA 1XTJA 1AUVA 3QPWA 1OW3B 3ZDZB 3KSBC 2ZIWB 3K3PA 2R1UA 3IRUA 3NC0C 2ODTX 3K31A 4HDKA 4AXBA 1MX5A 3TOZA 5A4JA 2DTXA 1DMRA 3BE6A 3EBLA 1AZTA 2R1TB 3H19A 4JVMA 4LSGA 3WJAA 5MF6A 1CEEA 1XVTA 4YA6A 4R0MA 2GDJA 3MIIA 1XKQA 4ME6A 5ALYA 2XMCA 4LYHA 3O31A 1Y81A 1YULA 2HMYB 1ZD1A 4GQIA 4TLBA 1ENYA 5A5VA 4C5CA 4H16A 1WBBA 4GYJA 5FDFA 4DOMA 1AHPA 1U2EA 2P5SA 1P4GA 5EZYA 4TQUS 2DJ5A 3TPZA 3WNVA 4CFSA 2ZXEA 3DR5A 3Q88A 2A1TR 1O08A 4RCVA 3ZE1B 2AN5A 3GEBA 3DVAB 2VT3A 2NUPA 1EFLA 1OBHA 2JVJA 4M8NE 3OJFA 1P1FA 3EUAA 3GL9A 2EIHA 3FKSD 4DRZA 1HMPA 1ZVMA 3JD0A 2AVNA 1Z8HA 4DHWA 3TF5A 4QEKA 5ALUA 3HU3A 3AEQA 4AU1A 3LA8A 5CT8A 3AKYA 2JLAA 3KOWA 3O47A 2HA0A 3KQHA 2ANCA 3JD1A 2XHZA 2BTQA 4L5IA 1KO4A 3G13A 4WNIA 2I2CA 1LZKA 2REQB 5CB4A 3LGXA 1A82A 1NW6A 3VPBA 5LXTA 1KEVA 2XEDA 1B7GO 1H0RA 1P3JA 2PPVA 2C2XA 3DEZA 3OFND 3ZI7A 2ZPTX 5LCXA 3ZVRA 4CT5A 3KCNA 1SHZA 3BERA 1DDGA 3ULKA 1K7YA 3SM9A 5G1OA 3TZKA 1TAUA 3ICQB 3E7WA 4FFLA 3JWJA 3JRXA 1RRPA 3HMQA 4EJMA 5TR9A 1BROA 3H5TA 9GPBA 3T0FA 2XE6A 1NXTA 2BSQA 1LLUA 4B4VA 2DYKA 3PVSA 1FA9A 4QJ4A 3U7QB 1GCUA 2MU1A 1Z62A 2M6LA 2P75A 2DQZA 4PEVA 4FDLA 4TS1A 4J0IA 3LY9A 4TMWA 4QQRA 4YMIA 2DY1A 3QU7A 4RTRA 1KRWA 2A7XA 2GM5A 2J5RA 3QFRA 4YRLA 1N9KA 2ZYDA 2PQMA 1XMXA 2KYRA 3OECA 3O4JA 4C6TA 1JPNA 1WF3A 4BX3A 2ZT6A 3JQFC 2R6DA 4H7HA 4I6EA 1AGRA 1LLDA 1WM1A 2GLUA 5AVVA 1LTHR 1BX0A 3IESA 2YMQA 4URYR 5CPFA 3K96A 3ZW9A 2X1HA 3I92A 4XPZA 5E6RA 3V2HA 5JD6A 2LCQA 3SEFA 3QUBA 1SKAA 1YS4A 3GUUA 4EM6A 3LNTA 4BV2A 1E2DA 2F6RA 2GCOA 2WE8A 3FMPB 3NNNA 1CP3A 5IAGA 3QBJA 5C8VA 1HR0B 1HXHA 5TSDA 2QN2A 3IIJA 4HCJA 4KPUA 4J7UA 2ID4A 4IDEA 5L4SA 2FXIA 2R7AA 2X8WA 4ESEA 3FTPA 3GLGE 3AI2A 5F2EA