1ZD9A

Structure of human adp-ribosylation factor-like 10b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
SKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human ADP-ribosylation factor-like 10B
rcsb
molecule keywords ADP-ribosylation factor-like 10B
molecule tags Transport protein
source organism Homo sapiens
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zd9A00
5EJEA 4YONB 1GL9B 4OHXA 4UJ3A 3S1AB 2ODWA 2QORA 2GJ8A 1M6NA 1E0KA 1IHUA 1D2EA 1P7CA 2QQEA 2VO1A 4MKGA 2RGGA 3O47A 3AGQA 5FUVA 4C30A 4ARZB 5CIQA 1FP7A 2WSSD 1R5BA 2AK2A 5L3SB 2PEZA 2OCAA 4DWJA 1GL6A 4GBMA 1DO0A 1YZTA 2PLFA 2YVUA 4BFTA 4B3BA 1IXZA 2DCUA 1T5IA 2IYXA 4HDQB 4QNMA 2OBLA 3BE4A 3LBIA 1FUKA 3RRNA 5JS7A 1VIAA 4LCBA 4D4LA 1N6RA 4D26A 2GBLC 3TNFA 3UMRA 4TLEA 2GZDA 4P33A 2WKQA 1GAJA 4KODA 1VDZA 4PQFA 1GDDA 3U4QB 4Q01A 3GP8A 2PZGA 1JPJA 4MGIR 1SVMA 1RYFA 2R8RA 3GJ5A 3IIMA 5F2EA 3QY0A 1XDBA 3Q85A 3TE6A 1S0UA 5L8VA 4QBGB 1XEXA 4NCHA 2IF0A 2O0KA 4WXRA 4DRZA 4PPQA 5LD2C 1UAAA 1NJGA 2H17A 3HWSA 2AR7A 5CIWA 1ZVQA 5KPDA 4LJ6A 3EPHA 3W6NA 3RRMA 2MSDB 2GCOA 3NDBB 3IO3A 1K5DA 1Z0JA 2ZEJA 4A0RA 3DZDA 4BLSA 2XTZA 1LY1A 1EFUA 3L2OB 2E1RA 4BFZA 4V0LA 2J0SA 3HJNA 5J4LA 3AQ4A 3VU9B 4TYYA 3MWYW 4FN5A 4DCNA 1T3LA 1XBTA 3K0CC 5E4FA 4DDTA 3LRPA 2CE2X 3M0EA 2EFDB 4N0EA 2FE4A 4RD6A 4QOSA 5CDFE 3TQCA 3ND9A 4R2IA 3M1IA 1RPZA 3UATA 3JZMA 3O8BA 3LD9A 3C7KA 2FPMA 3K9LA 4LC1A 4OHWA 3AF1A 4D6PA 3QEOA 2W6IA 1AM4D 1T6NA 4A92A 4DXAA 2PEYA 2F55A 3N2IA 3AKYA 2QSYA 1HQYE 1UKEA 2WICA 2WAXA 2N1BA 3B13B 1HA3A 3HP1A 4CT5A 2G1JA 5F3WB 621PA 1SVOA 4CDGA 4WXPA 3QI2A 1XCPA 4NYIR 2F9LA 1HE8B 2R65A 2O8FB 4YMVA 4PHGA 1R8QA 1Q1ZA 4I99A 1S2MA 2GCPA 4QGFA 5AJZA 2JA1A 2YZ2A 4B3CA 4W9MC 1N5IA 1JBKA 4KFSA 5JBQA 2JLWA 1ZD1A 4BLOA 2BM1A 4DLYA 2C98A 4HEJA 1MABA 1Z22A 2VP9A 1G20E 2ODBA 3K0FB 4GNKA 2J87A 4QG7A 5FPTA 4OQNA 3V00A 2FV8A 3RS5A 2XJ4A 1KI6B 2YNMA 2V7QA 3EASA 1J90A 2XOKA 3JVVA 4MYCA 4LHYA 4KFTA 4PO1A 3VQTA 2R6FA 3RC8A 5IK2A 2QAJA 1VHLA 2F3TA 4V0OA 4EJSA 1JAIA 2BV3A 3ND8A 1VG0B 1S1MA 3A6PC 1SHZA 1J2JA 4ACAA 4RKFA 3BH6A 5DO9A 4K81B 2YOFA 4EPYA 1P6XA 3PCRB 5C1BA 1U9IA 3IHWA 4G5GA 3G0HA 1RRFA 2XXAB 1KO1A 2AXPA 4FCVA 3ZGXA 1VPLA 2R6CA 4E09A 4TL8A 5FBRB 3ADBA 1YQTA 3QBTA 2D7DA 2A2ZA 4GP6A 3AB3A 5CB8A 2QE7D 1FMLA 2W2XA 4LY6A 3BH7A 1BMFA 1OJLA 2FDCA 1FTSA 1ZINA 3CW2A 2X8AA 4K46A 4NDZA 3CNNA 5GJWC 3NIBA 1P3JA 5D3MA 3BK7A 3TH5A 2ZE5A 1N5KA 3QBVA 3SBEA 1CEEA 2W83A 3W9YA 5B57C 1SVSA 1SGWA 4JVLA 2W0MA 1OH7A 1II0A 1SQ5A 1T9HA 3OZXA 2CEAA 2PCLA 1Z0AA 2ZJYA 3AUXA 3TAHA 1FUUA 1SXJB 1GOTA 5FBLB 2BBTA 1LNZA 2OFWA 3K0AB 4RCYA 2GBLA 3DMDA 2JJ1D 1WE2A 2X77A 4IOJA 2NPIA 1CJTC 4A8JA 3QUSA 4DLXA 3WYAA 2IYSA 4MRVA 1E2NA 2DPXA 3HYTA 1XTKA 3THXA 1Z0DA 4PSAA 4NBSA 2IYLD 5BN5A 2CJWB 5HE8A 4JVSB 5JMTA 4HUQA 1OH6A 3TAUA 1JALA 2D2EA 1CS4C 1O3YA 2FFQA 1E98A 3L82B 5FBQB 5FUYA 5LB4A 2NQ2C 2ODEA 1J7KA 1I4LD 4IKEA 4E22A 1XNJA 5HE9A 3IIKA 1F2UB 3HU2A 2VP0A 3MJHA 3M4YA 2GESA 1KHTA 4X8OA 4C0KA 2ZU0C 1KKLA 1KGDA 1Z47A 2OE2A 4NYJR 1X8KA 2ATXA 3K0CA 5HR5A 1M2OB 2QMOA 1KO7A 1D9XA 2XX3A 1T5LA 2BBWA 2Q3MA 3ECCA 4N0DA 3U61B 2W0SA 3GLFE 4UQOA 4CEIA 2B8TA 3LVQE 3CPJB 2G83A 1BIFA 2ANCA 2ZS9A 3RABA 1EWRA 1U8ZA 4OL0A 5H70A 1NSFA 5FUXA 2GKSA 1OB2A 4RD2A 1KJYA 3GLIE 2VL7A 3CLVA 3RAPR 4DIDA 2GJAA 2BCGY 1F48A 1UDWA 2F1HA 4FXPA 4C0LA 1VTKA 4ASUA 3EPJA 2ZITA 5JWRA 2BM0A 3QXJA 4TL7A 5G40A 1YKSA 1QF9A 4Q1DA 1TF5A 2H5EA 3BOSA 2JGNA 1E2KA 1GFIA 1VG1A 3Q3JB 1S9DA 3IGFA 4MRPA 5DLQC 3TGPA 1J8YF 4GL2A 1N6KA 3L0SA 3IDQA 4EPRA 3PEWA 3I3SR 1KI8A 2DYKA 2OEPA 4IEIA 1DVRA 1QRAA 3MWJA 1IQPA 1L7VC 1M34E 1HQCA 3A58B 4DLUA 1XEWY 3SOPA 3KXLA 3LO5A 4IVRA 4HAYA 1TU3A 2A9KA 1XP8A 2YJTD 5FH9A 4D82A 1WP9A 2CVHA 3T15A 2ZI6A 2YV5A 3W90A 3D31A 2BHRA 3VNUA 2R62A 5AR1A 4TZ6A 2A78A 3ASYA 4IW3B 1GL7A 4FMBB 2AKYA 3FPAA 4C9BA 1X8JA 5F9FA 4CEJB 5CJPA 4MKFA 4PZZA 3EAQA 1G7CA 5A5GA 3WBJA 4MUBA 1B0UA 1HYQA 1KK1A 2HUPA 1CR1A 1W36C 4HB3A 2WPDA 1ZUIA 2HCJB 5EZ6B 1ZYUA 1QHXA 2QEQA 3TRFA 4TLAA 1W0KA 3U3JA 1R7RA 1TL7C 4RY2A 1GP2A 5J40A 1GRNA 5HCNA 3P4YA 1CBUA 1KOFA 5H8WA 2AD1A 4OQXA 2ZRCA 4ESHA 1NP6A 1WA5A 2FH5B 4BQSA 1US8B 1IN5A 2V6IA 5GVRA 3W3ZB 1VYVA 4CRWB 2O8EA 1JEDA 2QY9A 2HJGA 4QC2A 3QG5A 3VTKA 2EYUA 4AKEA 1E9CA 3E70C 3PEYA 2RGNC 3EIQA 2NGRA 1OW3B 4WA7A 5FOWA 4DJTA 1AK2A 2EYQA 2ZI7A 5EXXA 3IQWA 3DKVA 3HPRA 5JHHB 4OI0A 2GK6A 1KDPA 2XEXA 2ZRBA 4BFYA 2WMOB 1JR3E 3MD0A 3UK6A 2JLQA 1H8HA 1UM8A 1YZKA 4LX0A 2WAYA 2IWRA 2W6ID 2F1RA 3LQRA 2REBA 1YU9A 2F1IA 3RRZA 1VCOA 2RHDA 1JECA 4F93B 1KNXA 3VFDA 4B6EA 4TYQA 1E96A 3GLHE 4FMCF 3CZQA 3KKNA 4UNNA 1LF0A 2IA5A 1TU4A 1GUAA 4KCGA 4R71A 1KI4A 3QF7A 4TWZA 3TSOA 3RWMB 2F43B 1AZSC 3OHMA 1H8EA 3C16C 4M9QA 1IN4A 3WYFA 2WMNB 1ZRHA 4Q19A 4EAQA 1W4BA 3CZPA 4M9SA 5AWFC 2MSEB 2BMJA 3SZRA 5JJKA 3AF2A 2GXUA 5DI3A 1KSJA 3T1QA 4EPVA 1CR0A 4EQ6B 4RZ2A 2IHYA 1S3GA 3T06B 1NN5A 1F60A 3I32A 1R4AA 4CEHA 4LHWA 1AJEA 4EKDA 2V7QD 3K9GA 4M1WA 3W8NA 1ZIPA 2AWNA 2XOKD 4U7DA 3A1WA 2QROA 3CF2A 4UXJA 4O25A 1G3QA 2QT0A 4RZUA 5IK2D 3GPLA 2GEDA 2C9OA 2V54A 2MSCB 3A4MA 4US0R 1AS0A 4YMWA 1TF2A 4QKQA 1TQ2A 1G5RA 3Q5EA 5LD2B 2REXB 1UKYA 2J46A 2JDIA 1ZNWA 3WXMA 4NPHA 2O8CA 3CB4A 3BRWD 4KVAA 1R0XA 1XF9A 2AXNA 2P67A 2ODNA 2NO9A 1GZSA 1U99A 3LAWA 4FW9A 2ZUCA 3IKJA 3MRSA 1XU4A 4OK3A 1SVWA 1IY2A 2Y8EA 3BERA 3EG5A 4A6PA 4HAUA 3U6BA 2ZI9A 3AM1A 4JLMA 1BMFD 5FTNA 4OI1A 1I2DA 1KZ7B 3QJYA 1VG9B 1HEIA 4A2PA 5FOTA 1Z6YA 3KJGA 3I61A 2OAP1 2OILA 1IONA 4NMMA 1G3RA 2D3WA 1FQKA 1IOZA 3QIAA 3I92A 2OHFA 3FOZA 2BDTA 4YMTA 1E1QA 4URUR 3DEFA 4UXHA 3CRMA 1NY5A 1R0YA 2BKUA 1N25A 5CK4A 3B9PA 4Q4LA 3ASZA 5SZIA 1CJUC 3I8SA 1JXMA 1AN0A 1PZNA 4B3GA 4B35A 3C4JA 4CF7A 4QGGA 3PENA 4OBEA 821PA 3VNVA 2X2EA 1OKKA 2BEKA 2O0JA 3GEHA 4G01B 4Q4AB 1G21E 3S1AA 4GOJA 2CBZA 3X1XA 3GLFA 2Q9CA 1TQ6A 2ZRFA 4NYMQ 2ZVPX 3B9QA 2RGNA 1OYWA 4BWYA 4A2WA 5JRZA 1G64A 1M74A 4ARZA 2RCNA 4Z51A 3SS8A 3BB3A 1GVNB 4ABYA 2WWIA 3P32A 4QNRA 5DE3A 2QG6A 3EZ9A 4IEEA 4Q21A 4ZDJA 2JLXA 2OCBA 1T0JB 1E2GA 5AJVB 4A6XA 1NN0A 2ZRHA 5SZKB 1TMKA 1W46A 4CZ2A 2CE7A 3V4FA 1SXJC 4C3ZA 4CGZA 3FB4A 4F38A 4AC9A 3VHLB 1KO4A 1UJ2A 4BRUA 3U4QA 1WDTA 4HDOB 2WBLC 4IJMA 1UBGA 1XJCA 1Z83A 4WAUA 2VLIA 4RD4A 4B3FX 1XPUA 4IOLA 2WJIA 1D2NA 2GJKA 3A1TA 3DVLA 4Q7KA 5FFMA 4PHFA 1RRPA 2XZLA 5FR1A 3X1ZA 3U7GA 3ZLJA 3QF4B 4ASUD 5HPYB 1I2MA 3NTUA 5KDOA 5GADl 1W0JA 3VKHA 2IYWA 1LW7A 4YDHB 1G19A 1OXVA 2GHIA 1KK0A 3VU9A 2HLDD 2X19A 1W47A 3Q7PA 1ZM7A 4URWR 1HE1C 1W7AA 4MQBA 3B1XA 4BFXA 4DB4A 1W4CA 4K8OA 2BEJA 1COWD 4Q03A 4I1SA 4J0QA 3SC3A 1E9AA 3KXIA 4LZZA 1E94E 1TQDA 2ZYWX 1WF3A 1XRJA 4XSHA 1U2RA 3LY5A 2E9SA 4JIMA 3TW4A 3TKLA 2QPAA 4KO8A 4OK6A 1M7GA 1E32A 4GRAA 1KDOA 1GIAA 2GEVA 3OIWA 3RANA 1E2HA 5J5CA 2IUSA 2ZQ5A 4UNSA 2PL3A 2O8FA 2ZR7A 3L0OA 2AFHE 2NG1A 2ZM5A 2PBRA 2WKRA 1N5LA 3RNLA 4BLQA 2MMGA 2ZRLA 521PA 2HT1A 2KE5A 4BFUA 2IHBA 4JLPA 2RGBA 4ZKEA 2Q3HA 3MJRA 4AKHA 1HTWA 2LKCA 4A0GA 4WW0A 3KKOA 2VHCA 4AY2A 2BWJA 1XXHE 5FOSA 5FTKA 3C41J 3K0FA 3ZS9A 2WPDD 4L9SA 1E99A 2QMEA 3BB1A 4GP7A 1AGRA 3IPXA 5GJCA 2QMUA 4RD3A 1KI6A 1G9XA 4C2TA 2IYTA 1W0KD 2IT1A 2PH1A 4XTCS 4L9WA 5CJ2A 2VH5R 4BGDA 4YQFA 2QENA 4JS0A 5D3QA 1U8AA 3LX5A 1OFUX 2RGEA 1G8GA 3GCGA 1PUJA 1DAEA 1CJMA 1T91A 1QG2A 1JR3A 2WM9B 3UPUA 3C5HA 3EZ2A 3EZ6A 1DADA 1C9KA 2QMHA 3AEZA 3N70A 2FFBA 3FHOA 5KYKA 4DB2A 1GWNA 2X1VA 4TYWA 3PEUA 1NLYA 2AL7A 3IILA 3PFIA 4XIGS 3NEJA 5FL7A 2OCPA 2JLYA 3QQ5A 3QPVA 5GJBA 1CU1A 3WNBA 3AUYA 2FN4A 2VRWA 3I4LA 3F8TA 3QKRB 4KYUA 1DAMA 3OFNA 4RD0A 5EXTA 3W5JA 5C46F 2ZSBA 1H8HD 3T1OA 2QZ4A 4O3MA 2H16A 4AG5A 5FPKA 1E9DA 3OIYA 1AIPA 1F2TA 3THYB 1QDEA 1SXJA 1L8QA 2FFHA 3K0AA 4MYUA 2IXEA 4GZMA 4B33A 1WCV1 4LOAA 2F7SA 4PR0A 2NMVA 4Q9HA 4YMSA 1UADA 2YWHA 1P5ZB 1H8ED 2LKDA 2WZQA 2ZSAA 5EXSA 4B44A 3R7WB 2ZI5A 3DDCA 1QHNA 3SDZA 4PPFA 1DO2A 3SJZA 2AD5A 4FCWA 1OT3A 5BYKA 4TLDA 3DOEA 2G6BA 4LHXA 4V0ME 4HLDA 1G291 2G0TA 4Q9IA 2BMDA 4A82A 1U90A 1JEEA 2VP5A 2RGCA 3AVUA 1P73A 4L15A 1E69A 2JCSA 4DCSA 2Z6VA 5CM8B 1KSHA 4DT1B 2WJYA 3KUCA 4JL5A 3AH8A 2ZRAA 1UBFA 3O8CA 4XVQA 1F6BA 4DLSA 4UNRA 1E1RD 5J47A 2WTUA 1G17A 3KJIA 2WWXA 2JDID 1N6NA 4QBIA 2RB4A 1M8PA 1SVKA 2R6GA 3LXXA 2ZVQX 2B92A 4PX9A 5B64A 3G82C 4JLJA 4BZXA 1S8FA 5FI0B 4TMWA 2JLZA 5CLQA 2W2VA 4FIDA 4OYHA 4PQRA 1U98A 4M1TA 5G41A 1ZC4A 1ZNYA 4C7OA 1OIVA 2A5FA 4QFMA 4OHYA 2AFIE 3K09C 1ESMA 3TUIC 1GTVA 1N6IA 2EU8A 1L4YA 2FZ4A 3PXGA 2XNSA 5TY0A 2AWOA 4G3XA 3TBKA 4HB4A 4P4UA 5E95A 4XOIA 1M1YE 1ZCBA 3LLMA 4WZAE 3T34A 2AX4A 5JFGA 3AKEA 5FPHA 1KJZA 1Q1EA 1V5WA 1YZGA 5CYOA 4LBYA 4X8MA 1KY2A 1E1QD 4M0LA 3CBQA 5TV2A 4JL6A 2RGXA 3U3KA 2I1QA 1W36D 4PFSA 1XFAA 4KSBA 5E3HA 4UNPA 1EFCA 4LPSA 5J4KA 4QM7A 1NBME 3R9WA 2HJVA 4HLUA 2EFCB 1N2CE 2HEIA 1S4QA 4AKGA 4C4PA 5EUMA 3THWB 4PAQA 1FOEB 2NO7A 3PR1A 1Q0UA 1XD8A 1QBKC 4TL9A 4HLQB 3U60B 3PUWA 1HH4A 4IOMA 1OFIA 3GJ0A 3KKPA 1OKKD 2J0UB 5L3VA 2UZIR 4ZIRB 1UKZA 4JMPA 4LJ9A 1W49A 3L0PA 4MDEA 1KMHA 2FZLA 2VEDA 1P9NA 1Z29A 2QM8A 3CPEA 1Q1QA 1O87A 1TX4B 3H84A 3I72A 4HATA 3Q5DA 2CL6X 1NVXQ 4CEJA 2ZUBA 2GNOA 1ONBA 5JWHA 3RWOA 1NIJA 4DIEA 3DL0A 2I3BA 1VECA 4RFVA 3HDTA 4PC6A 4PPNA 1II8A 1PLLA 2QP4A 2XAUA 4LHVA 1OFHA 2RHMA 3KKMA 4OHVA 2IF2A 2BIFA 2BVNA 4DC9A 2P6UA 4GPTA 3NHBA 4LV8B 4OI4A 3MMPA 4D4KA 4DDWA 2BCJQ 1NLZA 4A0HA 3SJCA 2OBNA 5BWMA 2PZEA 4MRSA 2N46A 1LB1B 2FU5C 4TQAA 1G7TA 3U2QA 3ZZTA 2IC5A 5EP1A 5C4MA 1R2QA 2ZU6A 3FWYA 3SHWA 1WRBA 2V1XA 4LBZA 5DHAA 3IIJA 4MYHA 4NTZA 5BN3A 3A8TA 2IEYA 4PAMA 1G4AE 1TTTA 2P0EA 1NKTA 1XX6A 2FFAA 3K70C 5JI3E 2PCJA 1XWIA 1W4RA 5UKDA 1W0JD 2J7PA 4M1KA 3EIHA 3RYTC 3UWKA 2EW1A 1UKVY 4PSKA 5FR2A 3EPKA 4DEXA 3ZH9B 4GFDA 4G5SA 3LH5A 1E0SA 3RSLA 2PX3A 2QSZA 4MH0R 2KBEA 4C0SA 1KAGA 3AP3A 1FX0A 3ZYCA 1W48A 3DHWC 4JBYA 5TDHA 2QU8A 2E87A 4QHTA 3KQHA 2GETA 5JRJA 2OFOA 2WJVA 1GSIA 5EUQB 3TK1A 3QPWA 5TVKA 5JS8A 2ZS8A 2FF7A 2V4ZA 4Q48A 3C15C 3AV0B 2ZXUA 1PVOA 1XXHA 4PSVA 1ZAKA 4QGHA 1Z08A 2Z83A 4EPXA 4IFBA 1D5CA 3BWDD 2I1VB 1AGPA 3GFPA 4NHOA 5AUOB 5HTKA 2QI9C 1Z2AA 1Z6GA 4AG6A 4DDUA 5F9HA 1T3HA 3T61A 2W6JA 4Q1EA 3U7EB 1BO6A 2UVQA 3B5JA 4JZKA 4Q7MB 1NI3A 2QM7A 1I4DD 1W5TA 1G8FA 4EQ6A 5JJLA 5TARA 3QVVA 4ZDIA 2B8WA 3K0SA 2J41A 1VYUA 2VSXA 3KTAB 3LXRA 2FOLA 2EFHB 1U94A 4AK9A 2QT1A 3NHAA 4KBGA 1Q12A 1XJQA 3ZVLA 1Z8FA 2R2AA 2HDNB 4D25A 4UXIA 1NRJB 2GJSA 1JPNA 4OQLA 2CLDX 1JR3D 4AI6A 2DY1A 4HAXA 4LPKA 2IS1A 1NLFA 4NU0A 1CULC 3AGPA 4RSGA 1GRQA 3ZJYA 3A1VA 1E4VA 5KNBA 4PO8A 5FI1B 2C96A 3FKQA 4LJYA 3BJIC 3EPLA 4TMZA 3PVSA 4FMDB 5FL7D 4GOKA 5EE5B 1G7SA 1QHHB 3FDIA 4FWIB 1C4OA 4UNQA 3P27A 1XEWX 4PANA 1E9BA 3OFND 4GT1A 4RJLA 4BEBA 3KZ1E 1WXQA 1DAIA 1V43A 2MMCA 3GJ6A 4BECA 4US1R 4DCVA 4LJ4A 2D7CA 2J3EA 1KDTA 1Q3TA 2ZS7A 4TTQA 4V0MA 4XSGA 5J4YA 2VTKA 4LDJA 2J7KA 5GVSA 1SXJD 5E7JA 4ZDKA 4HAWA 1RE0A 2DWOA 4PC3A 1RYHA 4JLVA 3BD9A 1T4GA 1BYIA 3LNCA 4ZCMA 5AJXA 1VIYA 1OXTA 3RSOA 4DUGA 2IXFA 2Q9AA 3BFVA 2G3YA 3TSZA 1DARA 2XZOA 4FI3C 2QRNA 4NYMR 1XD2A 4Q4AA 2JEOA 1P2TA 2A5YB 3EWSA 3R8CA 4HZUB 1KK2A 2C9CA 2WKPA 3RHFA 2HLDA 3EC2A 4AIIA 4P4SB 1LF5A 2CVFA 3AVYA 4NZYA 5CM9C 5KSPA 2V6JA 2WWHA 3QVUA 2V3CC 1TEVA 1COWA 3NBYC 4DSUA 4QRHA 5AJWA 4GSYA 1BYUA 4L4UA 2BJWA 4POAA 3IEVA 1ZM4A 3ZZ0A 3EW9A 5EE1A 4LV5B 4NCKA 2ZUDA 4PPGA 1QVAA 4KYIB 2ZI4A 2ZRIA 3NBZC 5FPSA 5HCIA 2DWPA 3B1YA 1P4SA 4LJ7A 4G5RA 2H7VA 3MUFA 3QKSB 4Q1AA 4JJKA 4MRNA 3EC1A 1NBMA 3KXKA 4IDOA 4JSTA 4B73A 1JB1A 2GAOA 3B85A 2O8BA 3W5IA 4Z1MD 2DBYA 3CPHA 2IBMA 3ADDA 3W6PA 2VF7A 3D3QA 3QF4A 4TMTA 3GMTA 4PZYA 4DSNA 2ZYTX 4Q00A 4XVUA 1Z06A 1IXRC 2IUUA 4QJ5A 1LS1A 3EA0A 1Z6TA 4H1VA 4P4TA 1Z0IA 1R8SA 4XH9B 1OXUA 1RKBA 2JLRA 3D8BA 1G16A 2EVWX 1AQYA 4JLDA 2REOA 4ZDWA 2ZETA 3TUJC 2OAQ1 4IRUB 4WZ6A 1D9ZA 1ANKA 3TMKA 2H1LA 2FNAA 2HF9A 3OEHD 4M2LA 3ZS8A 2GVZC 4NP6A 3REFA 3CX6A 1I4TD 2B6HA 4LK2A 4CYMA 3CRW1 4AYTA 3CIOA 1W5SA 4P31A 4M1MA 1PV4A 1A7JA 2O52A 2K5UA 3GLGB 3J81k 1KIMA 3WHKA 5CYPA 8OHMA 1SKYB 3GQBA 2DWQA 2ONKA 3FFBA 3GFOA 5K8TA 2IYZA 2YYZA 2CNWD 4Q02A 3N5CA 1ZMXA 3ADKA 4F7WA 1UFQA 3DM5A 3A37A 4AYWA 2XJ9A 1GKYA 4ZI3A 3R20A 1AZTA 1DEKA 5DYGA 5DI9A 3CRQA 1D8TA 1G7RA 4KLZA 2KWIA 1NMZA 4LV6A 4TT3A 3ZZUA 1U0JA 1KAOA 1KI2A 1VG8A 4HAVA 2YOHA 4A4DA 3UG6A 4BFVA 1BS1A 1AA9A 2NPFA 2J1LA 4KXFB 2H18A 1VMAA 3H4MA 4V03A 4EJSB 5JEEA 5KSOA 1XPOA 3MLEA 3NXSA 3UMFA 1G8PA 4ZV4A 4X8HA 1QHIA 2IWHA 4B6FA 3WHLA 1GG2A 1N3BA 1MO5A 3GJ7A 4IFEA 3FGNA 4U5XA 4P3YA 4D80A 4CW7A 2ZJ8A 1JAHA 3TIFA 4C0JA 3NWJA 4Q66C 4NH0A 1SXJE 1OH8A 2NO6A 2QAGC 4B43A 4HSEA 2BC9A 2J7PD 3O8RA 5FOXA 3A4LA 4N1AA 2CDNA 5L3QB 2CHQA 3ZVRA 2ZTSA 3VHXA 3I5XA 1D2MA 3GEEA 1E1RA 1N6OA 1QZXA 5CITA 4B2IA 2PZFA 3A4NA 3QKRA 2FG5A 2ZJ5A 2D06A 4OJKA 5FTJA 1N6HA 2ZE7A 2ZPTX 3ZIAA 3B1VA 1J99A 2F3RA 3KB2A 3DKPA 2JLUA 2D62A 4KITB 2A5JA 4TMVA 4BFWA 5KDDA 4F91B 2Z4RA 1VYTA 4RCZA 3THXB 3PIRA 2FJUA 4XTRA 3MFYA 3TSWA 1WBDA 4II7A 3LWNA 4HUQB 5DYIA 3JVUA 2VP4A 4TQUS 3VR5A 3QXXA 3B78A 2GXSA 4LJ8A 1Z28A 4Y0VA 2DR3A 3B6EA 1CR4A 2W6JD 3R7WA 3WMGA 2GCNA 4PHTA 4S2EA 1XTRA 1AS2A 3QKTA 2J0QA 1P60A 5DGXA 3OIUA 2H57A 1ZBDA 4ZKDA 2GF9A 4QBFA 5JSZB 5IDVA 1ZNXA 5AJYA 1SHKA 2QP3A 1R6BX 4XD7A 2QTVB 2Z43A 3SFVA 4M9XA 2P6RA 3CH4B 4W5WA 4B74A 5C2JB 2GZAA 4D4JA 4KLNA 2EWVA 3KJHA 4EUNA 4JKYA 3RDPA 2KJQA 1G3UA 3SN6A 1KO8A 3WNDA 3QSYA 4M22A 3ZD7A 2OFXA 3LBNA 4JBWA 3NG1A 4A15A 3PG5A 5L3RA 3K70B 3ICEA 3U44B 3KQLA 4GDFA 4BZQA 4E03A 3EZ7A 1E9EA 3KUDA 3BFXA 1SVLA 1E79D 4LGMA 4QXAA 5JHGB 4URZR 3H86A 4KAXA 4PHHA 5L3SA 3Q7QA 4M21A 1P62B 3AP2A 1ZM3A 3CUEF 1Z0KA 3U6KA 1R5NA 1XZPA 1BH2A 1EX6A 1E0JA 4JVNA 4JBXA 3TVDA 2DFTA 4MYTA 4MGYR 2NOAA 2PMDA 3SI7A 3GJ3A 3L8YA 2VSOA 3RVBA 4DCUA 4BASA 2HYDA 5M04A 3AVQA 2QP9X 5IHPA 3QEJA 4JT4A 4OKSA 1NVWQ 2WJJA 3A1UA 3LW8A 3VR3A 1SULA 1R0WA 2JJ2D 3W3AA 1RIFA 1UBCA 4TMXA 4Y0AA 2Q0HA 4DUGD 3FMFA 1XTIA 4WZBE 2ATVA 1OV4A 3F0TA 2WWYA 3AKDA 3CO5A 4PXAA 4M1OA 3WMFA 4KHZA 2HT6A 1S9HA 2GXQA 4B3XA 1OHHA 3I1FA 2IK8A 4CIDA 1MKYA 3SHFA 3CX7A 1MRNA 1G8HA 2IUTA 1FNNA 1J70A 3T12A 1L2TA 2YOGA 3BGWA 2C5LA 1J8MF 1OXSC 221PA 3DZ8A 5KHOC 2VP2A 1CF4A 4ERNA 1E2DA 1YRAA 3SQWA 4S35A 2Z4SA 1MT0A 3CR8A 1Z6AA 3SYLA 1DE0A 3SYKA 3B2EA 4DHEA 2WIBA 1KMQA 5DIFA 2GDJA 3R8FA 1BKDR 2ASEA 3RS7A 2Z5FA 2QPOA 1IXSB 4MKIA 3TUZC 1E2MA 5AUNB 3NH6A 4BUJA 3H0KA 2YWGA 1NBMD 3HU3A 2GXAA 1A5TA 2O8EB 1NKSA 3NBXX 3MWKA 5IF9A 2W58A 2PJRA 4D0LB 4PAOA 1P9WA 3F5FA 3VR1A 5BXQC 4RD1A 2RH5A 3VR6A 2ZIAA 2R6AA 2VHTA 1CRQA 5EE9A 3GEIA 3IPYA 3B8HA 1E2JA 2FX3A 1ZW6A 5AUQA 1OPXA 1OB5A 4DCTA 4LYHA 4W5JA 4Q1BA 1AQUA 4O2RA 5IT5A 4KV9A 5KU1A 3IUYA 5A0FA 2V9PA 4M4SA 3EX7C 2IYQA 3FMPB 1YZUA 4QGAA 4Z8YA 2BBSA 4PC1A 2BOVA 3CF6R 1KZGB 1P61B 2GZHA 2XNDA 1CKEA 3K1JA 4IDPA 1NVVQ 2OXRA 4GMDA 1IY1A 3RS0A 2XXAA 1WQ1R 2QA5A 4TQ9A 1G3MA 3EA5A 1P2VA 4XWKA 3C8UA 5EXPA 4RFSB 3RS4A 1JQLB 2EWWA 2ORWA 4B2PA 3OF5A 4G5QA 5FL3A 3WRXC 4B2LA 2YINC 2ONJA 3VR4A 4C0HA 2JAQA 2YWEA 5B58C 1P72A 3LQQA 5BW8A 1OYYA 1GKUB 4YMUA 1YVDA 1IN6A 4KI0A 4R98A 3ZVNA 2RAPA 5C4GB 1E2PA 4JSYA 1Y63A 2WJHA 3BH0A 4TT3D 4LSGA 2UKDA 5IRCD 2OM2A 4F92B 4V0NA 4LYAA 1EG7A 2FWRA 3KTAA 4HUTA 3C14C 4YXWA 2EFGA 4NCIA 2BKEA 4Q7LA 3HU1A 1CR2A 5K8LA 1YR6A 3BAFA 5FBWB 2C95A 4BZPA 1HT2E 2CJWA 4JKIA 3GD7A 721PA 1CTQA 1NMXA 2HV8A 1PJRA 2WHXA 3QPUA 1R5OA 2CXXA 1CJKC 3T5GA 2DHRA 3KX2A 3W8RA 4B32A 1F2UA 3LBHA 4BPBA 1AKEA 2FPKA 4RKEA 1D6JA 1KYIA 3WRYC 4MA4A 4B47A 4HZIA 1Z63A 1W1WA 1Z2CA 1JR6A 2BMFA 1E2LA 2C78A 4AURA 2IL1A 4IVQA 3ZDQA 2QN6A 3WBKA 4BFSA 4BEJA 3I8XA 2AK3A 3B82A 4TN1A 3MG9A 3L8ZA 2GK7A 2Z0MA 2FEOA 4EPWA 4GOXA 3ZIAD 3AVPA 1XMVA 1MV5A 2W2TA 4EJSC 1E2QA 4GZLA 5JI2E 1T0HB 1X8LA 2VHJA 4PZLA 2FSFA 1DAHA 1E2EA 1VHTA 5EQTA 4KBFA 1NMYA 1BOFA 4TLBA 5DH9A 1XMJA 4JL8A 4Z1MA 5JLJA 2PT7A 1MO6A 1U9IC 1II9A 2BJVA 2NTYC 4MGKR 2JATA 4HYYA 1XB2A 5HKKA 3P26A 3GLFB 4PQYA 4DLVA 5CK5A 3ETLA 1X1RA 2JIZD 1UBEA 4HZUA 1LTQA 4QHSA 3OEED 4W7SA 4GI7A 3TR0A 1S1CA 3QNUA 4DLTA 3CNOA 1E2IA 5FOUA 5E7MA 2H92A 2CLSA 4P4SA 4XD7D 1E0AA 1XTJA 4KFRA 1FP6A 2RMKA 1X6VA 3GLIB 1G1MA 1NN3A 4Q47A 3SE0A 3OEHA 4JVMA 3WMEA 3VKGA 3FKSD 3IBGA 3PUZA 1XZQA 2IS4A 1PLKA 1ETUA 3H2YA 1TNDA 3NEYA 3P20A 4A8JC 4PO9A 4URVR 4O0MA 4YC7A 1Z07A 2QAGB 2VP6A 3K8YA 4OI2A 4IDNA 2IYVA 5J4VA 1RC8A 1JJ7A 1QVRA 1TEXA 1IY0A 3QKSA 4Q4JB 4O2LA 4B3DA 2JASA 1ZU5A 4WIAA 1KDRA 2CNWA 2P5SA 3UANA 2XTNA 2GF0A 3W34A 2UZ3A 1IJFA 1G8YA 1Q1BA 3VR2A 4TYNA 4WVFA 2ZSFA 2G1KA 1EFHA 1ZIOA 3K9NA 1PLJA 1TUIA 2D4HA 1A2BA 2QUZA 2XTMA 3IEUA 3PUXA 2A5GA 3KJEA 3KFVA 3CNLA 4XWAA 2WIAA 3L43A 2IYRA 4QHYA 5LBIA 3AVVA 1CLUA 4EPTA 1NIPA 2IS6A 1A1VA 4IHQA 2QGZA 3CM0A 3LV8A 5JECA 1ZCAA 4H9GA 4FWTA 1SKQA 1U0HC 1ZU4A 3KQUA 4NKRA 1KI9A 1US8A 4X8LA 2GA8A 3DO6A 3QOFA 2WWGA 2IEZA 4ZCLA 1K8RA 1KI7A 1W2GA 3X1WA 2ZRKA 1DAKA 2C04A 3SQXA 1GNPA 1VCIA 3SJBA 3SU8A 3AVXA 4LYFA 2C99A 2ZREA 1N6LA 2AN9A 1OHHD 4HAZA 4Q4HB 2PMKA 4QM6A 5DHFA 2FSHA 5CLLA 2P6NA 3BC1A 3GLGA 1VCMA 1CIPA 2OESA 2YHSA 2CL0X 2FMXA 2QL6A 2ANBA 2VSFA 2WJGA 2KB0A 1Z6XA 3FE2A 1K6MA 2B7BA 3X1DA 1YZNA 1VKJA 1EWQA 3E1SA 1NL3A 1FMJA 3EZFA 1ZD9A 4B75A 2OG2A 4NL4H 3VAAA 3NKVA 3UIEA 3AKCA 4M8NE 1FZQA 1XCMA 2ZROA 3KQKA 2NZJA 4LC0A 3B60A 3EWAA 4OHZA 5G3ZA 2F43A 1R10A 4LI0A 3U3RA 1G18A 4AD8A 4Q18A 3KKQA 3K09A 5TB5A 3FHTA 4EFMA 3QXSA 3OIVA 3OE7A 4RVCA 1L4UA 3G5UA 4Z8XA 3TW8B 1NY6A 5LPNA 5KNCA 2HYIC 4TTPA 4QJ4A 1OE0A 2J45A 3VMFA 3GLHB 2QGNA 1ZUNB 2Q9BA 1X3SA 3FMOB 3V9PA 3BFKA 5L3QA 5HZKA 3QE0A 4NONA 1YR8A 1Z3IX 2C2HA 1KTVA 5KTYA 2OT3B 1RJ9B 1JQJC 3E2IA 3CF0A 4CVNA 4TZ0A 5ANRB 2JLVA 2KI5A 2ZJAA 1F2TB 3CR7A 2XNDD 3E5HA 1DTSA 1MR3F 1CXZA 4IXNA 4OK5A 5B30A 3R9XA 4ILEA 2O8DB 1GM5A 2WV9A 3LA6A 1E79A 3VKWA 1YR7A 3KDSE 4C0AC 3FHCB 5AK0A 2VBCA 2XZPA 1XTSA 4N3NA 5LDDC 1K5GA 2WWFA 2LCFA 1XJ0A 3AF3A 3KFXA 1B23P 1NSTA 1UEJA 1W44A 2WVJA 3GFTA 3K53A 3MAAC 1IJEA 4RZXA 4TSFA 1DOAA 3Q8XB 3OAAA 2ZJOA 4V0KA 1XEFA 2ZRNA 3O8DA 4G1UC 5KDLA 2CK3D 2R9VA 4UJ5A 1A4RA 2R44A 4A2QA 1M7BA 1EXMA 3CX8A 2QBYB 2NZ8A 3SR0A 2ERXA 2FA9A 5JSZA 4IDHA 3PJRA 3PV0A 4KSCA 2JJ2A 4YXWD 4ZCIA 4NCNA 3DPUA 1NJFA 5B2ZA 3T35A 3TJZA 3CWZA 4LBWA 4ZI2A 5E7IA 2C77A 2FGKA 1NN1A 4OQFA 3AVTA 3CKLA 3BB4A 3SYNA 4BRWA 4QJ3A 2PJZA 4LUCA 4B71A 1E9SA 3QKUA 3TQFA 4BLTA 2WWWA 1OFTA 4LJ5A 3SEAA 3BORA 3U44A 4C7OB 2VF8A 4TL6A 5JCPA 4URYR 1NVUQ 3PUYA 2WOOA 4AWXA 4XVRA 1G3IA 3AF4A 4B34A 4FMDF 1EESA 2TMKA 4GMXA 5GJVC 4ESVA 5EP3A 1Q44A 2NO1A 3LLUA 1UF9A 3CRVA 3BBPA 2IX3A 2OCYC 4ACBA 4DSTA 4I4LA 1W4AA 1ZC3A 2G88A 2CHVA 1EGAA 1IBRA 2ZYUX 1MO3A 2KSQA 3MCAA 2J0VA 3AF0A 4Z54A 1XEXB 5JZVA 1OXXK 1JI0A 4FD2A 2DFLA 2EQBA 3ZD6A 1G6OA 4E5UA 1KJWA 3QXCA 2W00A 3BXZA 3B1WA 1TAGA 5A4JA 3X1YA 4DZZA 2GCOB 3NC1C 1DG1G 2ERYA 3UXMA 5CB6A 1HURA 1KO5A 2C9YA 4WBSA 5HKKD 5C18A 1E4YA 4AYXA 4BLPA 2H8KA 1KMHB 1T3SA 1NG1A 4D81A 3A1SA 1SZPA 4CT4B 2QNRA 3NH9A 5HZHA 2G77B 1RZ3A 2ZAOA 3F3YA 1N0WA 2V55B 5FTLA 4AKIA 1U8YA 2L0XA 4Q9LA 1MRSA 3RLFA 3AVOA 1TADA 3C5CA 4Q1CA 2A30A 1RRCA 4M9ZA 3HPQA 3RS3A 1II8B 1ZJ6A 2IYYA 5FTMA 2XB4A 5JWOA 1YE8A 5BYJA 3UWOA 2B21A 1MOZA 1ZM2A 3I73A 3WYGA 4FMCB 1CJVC 4MGZR 1TUEA 2CCGA 1U0LA 2X2FA 3N2EA 121PA 2C03A 4BE7B 3T1TA 1OH5A 1E3MA 3LFUA 3GJ8A 2VHUA 3LW7A 4XJXA 4Q9JA 4P32A 3P4XA 4NYIQ 5CDFA 5J4HA 4Q5IA 5DN6A 4DLZA 5DNYB 1QG4A 1YZLA 3MWLA 2VIIA 4OQMA 3FMIA 2D2FA 1MABB 3TR5A 1WB9A 2DFNA 5BN4A 2NO0A 4A36A 3X2SA 1EFRA 2V1UA 3DOFA 3CONA 4MDFA 4ZO4A 2ZJBA 2A5DA 3K9HA 2XB2A 2P3SA 4B76A 1XMSA 5K8IA 2OV2A 1KK3A 2O5VA 3T5DA 3U7FB 3VX3A 4F4JA 2LWIA 1G5PA 1GNQA 1GITA 4TYPA 4DLRA 1ZP6A 1QHSA 1Q3HA 1FX0B 2ZR0A 4ZPXA 1QHGA 4LHZA 2XSZA 3LVRE 4PC7A 4BLRA 2XITA 5KPJA 3HR7A 1LV7A 3AVWA 3RC3A 3RS2A 2IXGA 1S96A 1FFHA 1H65A 1NVVR 4LWZA 3U5ZB 1XXHB 4C0BA 4EIWA 2J5XA 1ELOA 2OZEA 3LDAA 2OSBA 2VA8A 1XD9A 2YC2C 2ZI3A 2ZE8A 3RRYA 1OSNA 4TTRA 4C2UA 4RFSA 3ZVMA 1MH1A 2FSIA 4W5HA 1CRPA 2C8VA 2SHKA 5D3MB 2BBOA 1WMSA 2P2LA 4JLBA 4MITA 5SZJA 3SFZA 4DSOA 4US2R 4D0GA 1X1SA 4JT2A 4NE2A 1E6CA 3FFAA 1N6PA 5KOYA 1OIXA 2CCKA 4R9UC 1AKYA 3L0IB 4JLAA 4JYBA 1DBSA 3TLXA 4A8JB 1XMIA 3THYA 1AS3A 5DISB 2PLRA 1QHYA 2Q6TA 2ZYVX 5KUTA 1JJVA 2N42A 1GRRA 5ELXA 2QRZA 5G3YA 3T1VA 4U00A 2I4IA 1F5NA 1NF3A 3PQCA 1EFTA 1RW4A 2RGAA 4F4IA 1ZNZA 1G5TA 3OE7D 4B48A 2ZANA 4R7ZA 1JNYA 4JJZA 1SVIA 3EARA 2QTFA 5F98A 2JIZA 1G41A 3QXHA 4MRRA 4NCJA 1KNQA 2GWHA 3OEEA 2WSSA 2ZRDA 4JLKA 2G0NA 2ZSEA 5KSYA 1YR9A 1RVDA 1KY3A 1FL9A 2A7QA 2YWFA 1UEIA 5KSZA 3ONWA 1G6HA 1S3SA 3M6AA 4NYJQ 5FUWA 4LYJA 4EFNA 4D4MA 3FKSA 4DT1A 4EFLA 2QTHA 1C1YA 1R0ZA 3QENA 3ZQJA 5JCZA 3QG1A 4MKHA 1KSFX 4CEIB 2WOJA 4ON9A 3B1ZA 5JEDA 3FTQA 3WNCA 3GJ4A 4QL3A 2GTPA 1M7HA 3I62A 1GNRA 2J9RA 2KBFA 4I1VA 4TMKA 1TPZA 6Q21A 1IM2A 421PA 3NVAA 1OF1A 3SBDA 1W2HA 1ZM9A 1UDXA 4FCTA 2P5TB 5LB2A 3HYRA 3KL4A 2BMEA 2IW3A 4QBHA 1XD2B 3AP1A 3R9IA 4A1FA 1DG3A 4HB0A 3D6TB 1MO4A 3DM9B 3WY9A 4L8GA 4LJAA 4I1OA 3GJXC 4TSFD 3U3MA 1T8TA 3OAAD 1WBBA 1GKIA 4Q1FA 4JYCA 5G53C 4G0NA 2GVDC 2GJ9A 2B7CA 2NIPA 4I1UA 3GLIA 3CWQA 3THWA 3I5YA 1KI3A 1T8UA 2VPPA 1Y3AA 3MSXA 4DEYA 1XPRA 3DMNA 1E9RA 4R2HA 2ORIA 4XWOA 3CRRA 2ZRJA 4KVGA 1LVGA 2IYUA 4YLGA 2ZE6A 2OUKA 1FTNA 2J0UA 4G5OA 1NG9A 2Q3FA 5K8UA 4ZIRA 4OJQA 3THOA 4KFUA 3K70D 1FQJA 3U7HB 2FGJA 2QAGA 3IO5A 3FVQA 1Q57A 4FINA 1N0UA 1X86B 2PX0A 3JZAA 1VCNA 4Q4JA 4DLWA 2O8BB 2QPTA 1P9RA 3NDPA 4H1UA 5FPYA 1N5JA 5FOVA 1Z5ZA 3MGCA 1RRGA 2WSMA 2FEMA 3OESA 2VYFA 1HUQA 2O0HA 3IHLA 2RGDA 3BS4A 3NBFA 1DPFA 2ECKA 1XCGB 2CCJA 3KQNA 3GLGE 2GAAA 2XGJA 1SKYE 3EXAA 2YKGA 4E07A 4D2IA 4TLCA 5EZ5A 4YDSA 2DFKB 5H68A 1PUIA 1DAFA 4LRWA 1FNMA 1UPTA 2VQSA 3FYHA 2OLJA 5H1YA 1P2SA 4IVPA 4M53A 2G9NA 1TQ4A 3P1JA 4DKXA 4KU4A 1YJ5A 5BQ5A 1G4UR 3LX8A 2YC4C 3K0EA 4IDQA 2QE7A 4C0QC 2FSGA 4KJZA 5EE3A 4DBLC 1FW6A 4Q4HA 3IBYA 1FPMA 3A36A 1OLOA 3NC0C 4I81A 1JXOA 4DDVA 3VX4A 1A82A 3PITA 4HB2A 5P21A 2ORVA 1P75A 1DS6A 1KI1A 1YHNA 2A3RA 3PEVA 1ZD8A 5KO2A 3CH5A 5JJIA 2JJ8A 1LS6A 5KNDA 2OBMA 4JLNA 1N0VC 2EFEB 2OLKA 2JJ1A 1GILA 4HLUC 2ZRGA 4Q9KA 2HCBA 1DELA 1EK0A 3SJAA 1ESNA 1EX7A 1Z0FA 1RFLA 3ZQ6A 3UG7A 2F9MA 3PUVA 3IQXA 2JLSA 5DN6D 3W6OA 1HV8A 5DI3B 1IN8A 2ZJZA 5TXGA 4DVGA 2CHGA 2HF8A 2V8OA 3U3OA 2FPLA 2ZAMA 4CEHB 2ZSDA 5AUPB 1EFRD 2CK3A 2CMKA 2J59A 3BIFA 2ZJ2A 3GLHA 4LBVA 3HR8A 1ODFA 5SZHB 1KSGA 1KKMA 4UKDA 4M1YA 1Q21A 3V4RA 2VHQA 1Q20A 2IS2A 2ZR9A 4MUAA 2R6DA 4HI0E 4HDCA 4U02A 4A9AA 1IAQA 3EIEA 3WP1B 4URXR 2XSZD 4ITRC 1RJ9A 2F6RA 2ZRMA 2O8CB 4WOPA 4M1SA 1DAGA 4A0FA 1E9FA 2OO7A 4PTLA 2AKAB 4F4CA 5FBVB 4PC2A 2RKOA 1P2UA 2ZRPA 4Q7JB 1HY3A 2HXYA 2QQ0A 3KB1A 2F1JA 5EP4A 4V02A 3UMSA 2O8DA 2CL7X 3B7GA 2HXSA 1TF7A 4RZ3A 5TMPA 1Q22A 2DB3A 1HT1E 1A2KC 1NNEA 1QHHA 1YRBA 4L16A 1LFDB 3WP0A 4D0NA 1OIWA 3D7MA 3TVTA 3ADCA 5EE0A 3REGA 4IXMA 4P0TA 2AHOA 2GRJA 2GEUA 3UKDA 1YZQA 1W36B 2CLCX 4HLCA 1IN7A 5EP2A 1U81A 2P65A 2PT5A 3H1TA 5DSZA 3SNHA 2QBYA 1E2FA 3ICQB 1CP2A 2OXCA 2Q21A 1F3OA 1XTQA 4EDHA 2GILA 3Q72A 2D74A 4JLOA 4L5BA 4IOKA 1ZUHA 3Q9LA
chains in the Genus database with same CATH superfamily
3VYTB 3AWIA 3FWKA 4EOGA 2WIFA 3R5TA 2H1WA 5CU7A 4B6OA 5HUQA 1L0BA 4G0XA 4Q4DA 5DEIA 1YQDA 3A6GA 4LYDA 2QORA 3JQ6A 3AFIA 4R31A 1SQ6A 3WYBA 2CYAA 4YLEA 2QQEA 4P4GA 5IMSA 3LGXA 1RWPA 3QFCA 3NHPA 1FP7A 2B8EA 2WSSD 3ZE8A 4ECEA 1JIUA 4JXKA 5BN1A 1R5BA 2AK2A 2PEZA 4MUGA 4F5DA 1MT3A 1NVEA 1CQXA 4YRFA 1A76A 3IT3A 2BI8A 2HCRA 3HWX1 2WTXA 4G0ZA 2X14A 4RL6A 1T15A 4BLWA 4FM9A 4P35A 2BPOA 5I9SA 3X3HA 2AUMA 2HDHA 1HDRA 4H3HB 3SKVA 2MYPA 3UJ3X 4E5KA 1H3FA 4S3MA 1FUKA 5JS7A 1VIAA 5ALRA 1Z62A 5D8DA 1SPBS 2GBLC 3WFIA 3TNFA 4B81A 5HJ2A 1R16A 1GAJA 3IH5A 5FV7A 2VSQA 4S12A 1VDZA 4KQGA 4KX3A 2YASA 1A3CA 1ND5A 3GZJA 2XCUA 3UJ9A 2C5HA 1DJOA 3L93A 1V5FA 4BMPB 5LOVB 2CXHA 5TPWA 4BO0A 1IWOA 3Q85A 2P3QA 1S0UA 1RZVA 1UKBA 3KQPA 4DR5B 1HYEA 2ACVA 1DRVA 2O0KA 3CU5A 4NCHA 3GGPA 5AKJA 3ZWXA 1NJGA 1U02A 1U2GC 4K9NA 1RLOA 1F4LA 1JZQA 2X15A 2G63A 4H0CA 5LKAA 2ZB2A 4L8YA 3QX8A 3GV0A 4B84A 1OU0A 2PUDA 2MSKA 2MSDB 1D8AA 1TVCA 4Z4GA 3SZMA 1OC2A 2B5WA 2DQYA 3DZDA 4BLSA 1YA6A 1ID8A 3LBAA 3CF4A 1EFUA 1RQGA 4BFZA 1URPA 2PH3A 4IMJB 3TM5A 1L5VA 5J4LA 1ILEA 2BFEA 4B2YA 1GZ5A 4OXXA 5HJEA 3S2YA 1OZGA 4N0EA 3T7EA 2XDYA 5CH8A 1KFKB 3KR2A 3ND9A 4R2IA 3TJMA 3JZMA 3O2JA 1JIKA 3QP9A 2D1YA 3I39X 3K9LA 2QVZX 4OHWA 4PLYA 1QWSA 2HN9A 2PJUA 4RY9A 2P1DA 4A92A 3AUJB 4LMRA 2PEYA 4DXAA 4F06A 5KU7A 1PJQA 4K6HA 3FA2A 5JE8A 2WD7A 1AHPA 2QSYA 2VHVA 1EIZA 3T9EA 5CX1B 1UKEA 1USWA 2N1BA 2JKYA 1ODSA 1U9YA 2FUG1 3FNRA 3EFOB 3WWDA 4CTOA 4ZI7A 1T8RA 2AZTA 2G1JA 2J5BA 1I7NA 4YT4A 3SX0A 4YAFA 5F3WB 4G0UA 1IOWA 2BM8A 2WSIA 1CNMA 1QM5A 4TSKA 1HE8B 4GPEA 4TV9A 5BV0A 1RJGA 4OLFA 2JLAA 4PHGA 4F3KA 1MC8A 2FPSA 2GK4A 4ZT5A 3TTTA 1U1FA 3SK0A 3WRYA 3EXFB 1NUTA 4B3CA 1JBKA 1GGHA 2ZDQA 3IRUA 4GQBA 1DSSG 4CF5A 3OQIB 1QCCA 1EXNA 2BM1A 4M8IA 1M2NA 3A4YA 3FNFA 4HEJA 5E0OA 4WPGA 3INRA 3AC0A 1KXZA 2J87A 3UAOA 4AFNA 5ERXA 1JYFA 3QV1A 3OKAA 2GAJA 3DLHA 1CUCA 3MZ0A 5A4FS 4KFTA 4PO1A 1LZLA 2FN7A 3G0OA 3OP4A 2GEFA 4Q3BA 2WHRA 4XYEA 1V6CA 1K8QA 4ZJPA 3MTGA 2F3TA 4V0OA 5B3KA 1JAIA 1EVJA 1W19A 4RK0A 4XYMA 1D7AA 2JAOA 1PFKA 3JAKA 3KG2A 4PRKA 4B8WA 3K15A 4DC0A 4XQCA 4C22A 4Q9DA 2RARA 5DX1A 3WLLA 3DMRA 2XH8A 3L79A 2AEEA 4MQLA 5B1DA 3HCOA 3PL1A 1HETA 2YOFA 1GAWA 1P6XA 1JEYA 3IXLA 4IHAA 1OI4A 1KAHA 2WNHA 2Z5GA 4M0CA 3BRWA 2QUKA 3NX4A 4G5GA 3O82A 4AY4A 1RRFA 2JFXA 2XXAB 4K7JA 1PD0A 4FCVA 1AUPA 3OQNA 4L8LA 1NVBA 3COYA 5DLEA 3A05A 1GAXA 2HNBA 2D7DA 4F3TA 9GPBA 4YRGA 1H2XA 1XV5A 3A6HA 4ND3A 3QEKA 1NI4B 2VJMB 4JI5B 2AG8A 3BH7A 3KYCA 4D8VA 4EABA 1NONA 3PIDA 3S1LA 1FTSA 4FFRA 1U5BB 3FCSB 4G41A 3NIBA 1OCEA 2RKBA 2GN8A 1N5KA 2ZE5A 3QBVA 4I4IA 3SBEA 4BNMA 1T2DA 1H23A 4EAAA 1P31A 3EXIA 1L6RA 1XQ6A 1YQUA 3PHGA 3H1FA 1II0A 5CW1A 2ZWPA 5HNKA 1Z0AA 3GNLA 1F2VA 2GSWA 5KNDD 5FBLB 1CYEA 4D9KA 2OFWA 4RCYA 1SHTX 3F3MA 2GBLA 4DLPA 2LXNA 1WE2A 4I9UA 4V3BA 1QCDA 5EIWA 1LTKA 3SHOA 2IYSA 3OQBA 3HYTA 3V8RA 1QGOA 2G5GX 5EA2A 1DPGA 2A94A 3E9CA 4YJFA 2IYLD 1NQVA 5AH0A 2OD2A 5HIMA 1T4DA 3ZHTA 4JVSB 4D9CA 4HUQA 1FU4A 3TAUA 2VF4X 3DNPA 1ISFA 1O3YA 3L82B 4TQGA 4X00A 5F1OA 2PY6A 2ODEA 1J7KA 5IANA 2VQ3A 4PIPA 2VC2B 4D44A 4MUXA 4FDAA 2H2DA 4B83A 3HVHA 4F12A 3OM1A 4F4FA 1QANA 3KLNA 4RQAA 2GESA 4E1AA 4E31A 1KHTA 5E3IA 5D5PA 2I7TA 4ZVMA 3CA8A 1W76A 2PMBA 2ZU0C 2PQ2A 3R9KA 4C0KA 3VSAA 2AQ8A 1KGDA 3L4BA 1JF8A 4HX2A 2OE2A 4BJHB 1NXSA 2EJVA 2ZYIA 2J9ZB 1MCZA 2QMOA 4XRRA 1KO7A 1EFAA 1MIOA 1VLJA 4MUJA 4X1KB 2Q3MA 2X6QA 1K0FA 2WMYA 4M0PA 1AVTA 4RVGA 5FKJA 5EESA 4E7PA 4EL5A 1HZJA 5ULLA 3TLGB 3ZEAA 4YUYA 2QHXA 5LXTB 1YV9A 2HTEA 1BIFA 2ANCA 2WVHA 2P4UA 1PEKE 2Q4OA 4UU1A 5HP4A 4E1BA 3D0RA 1O0BA 4A8HA 3QNWA 4L3WA 5NLLA 5I4KA 5FUXA 1TC1A 2GKSA 2XYHA 3OZSA 3HJTA 4JJ8A 2RBGA 4WV3A 4RD2A 1KJYA 4P5PA 4AZ0A 2ZJ1A 3I0ZA 3JTEA 5E6SB 3WBFA 4DIDA 2GFIA 1I7DA 4JFRA 3TYXA 4C4SA 4F6LA 1W59A 1PHRA 1NF9A 1XCBA 1EUZA 3B1FA 4ASUA 4K3UA 2GZMA 1ECCA 5G40A 4TL7A 3BOSA 2H5EA 3SMQA 1YJQA 1RKQA 2JGNA 4MRPA 3O6VA 2DERA 3RVQA 2JI4A 5BWCA 3AI2A 3VNRA 1QO9A 1TRHA 4JKOA 1JFFB 2JIBA 1C5KA 3A7EA 3L0SA 4BU1A 1SCDA 3LC1O 2Y1GA 4MWSA 4EPRA 4ZYLA 4ID3A 2OEPA 1GKLA 1IRXA 2I7XA 3AEYA 3GFVA 3Q6MA 4IEIA 1E1MA 4RF3A 2PVCA 4CKEA 3M5CA 1DVRA 1U3TA 2KS6A 3MWJA 2A58A 1VHJA 5DFAA 3SF0A 1QBGA 1L7VC 1XO1A 5BV8A 2NVOA 4Z9AA 4EY8A 2R7KA 5IJZA 3FI9A 3OM8A 2GFQA 3IXMA 4RTPA 4HAYA 2FLWA 2A9KA 3DBLB 3WAKA 2XEDA 3B6MA 3G79A 1WP9A 4M9RA 1KDZA 1U4NA 3D31A 3LLCA 2R62A 5E8RA 1A27A 4R3UC 5AR1A 2H08A 3Q3CA 5MGNA 4YEDA 3WLMA 1QH8A 2EX0A 4DCJA 1L1EA 4S0XA 2XVAA 2AKYA 3FPAA 1MBZA 2NZVG 2QTCA 3OX4A 1PG0A 4D6YA 1DIOB 3ZHYA 4CEJB 2CDCA 4DMKA 2GM9A 4MKFA 1U2SA 5AIAA 2MDTA 1XALA 3T5AA 2EFJA 3GRRA 2VRNA 4FX5A 4ZOBA 3B8EA 4QOEA 5DN9A 4AX4A 1ECLA 1U0GA 1W1IA 1EJ2A 3OJ0A 2DFPA 2P4SA 3V8NA 3WBJA 2X42A 3USZA 4DIBA 1TJ4A 1MVLA 1C7IA 4MVJA 5DHUA 3AU8A 4G1FA 3IOYA 1VJTA 1VI2A 3QEMA 1ZUIA 3PJDA 1ZYUA 4GPD1 1LWOA 1KH3A 1IUPA 1QWOA 3GFQA 3MJCA 1R7RA 2VSYA 1YIOA 4LNHA 5K2MA 2A14A 4PG6A 2KM1A 3WLTA 6YASA 1KOFA 5B7NA 1TFRA 3LF2A 5AKEA 3BL5A 4ZXFA 2FH5B 4AWBA 2V6IA 3VUEA 1P1FA 4WERA 5BN3B 5GVRA 2O8EA 1CUAA 4W8HA 4ZHQA 1FPQA 3JR3A 1YFLA 3ORRA 4DV4B 1ZHFA 2Y4NA 2R5FA 1BCSB 4AKEA 4C06A 3AHFA 3CLKA 3EIQA 1TJPB 5K3FB 3VO9A 3A3PA 1TIKA 3FDXA 3IQWA 3PEFA 5CURA 5FUMA 4BVGA 4EUFA 3TZEA 5JHHB 4MQFB 4HWPA 1LPPA 2JD0A 4BNDA 2UUCB 5JCXA 4GKKB 3BXPA 4AECA 4LZJA 4ZQBA 4F4DA 2RE8A 5HMMA 4IV5A 4CV2A 4ARUA 3T1NA 4WLOA 1ZGCA 1BWPA 5AOAA 3RT1A 4D97A 1L3IA 2WAYA 2W6ID 3GL9A 1XCOA 1WV0A 3UT5A 4DA4A 1FMFA 2O8VA 4OU4A 2RHDA 5MN5A 1POWA 2X3UA 1E96A 1X9HA 4B6GA 3IE2A 1CB0A 4F1JA 1LF0A 2IA5A 1GUAA 3QUTA 4KCGA 3CKKA 4TWZA 4XPIB 3HVKA 3WKDA 1EDOA 4R71A 5F23A 3TSOA 3AHDA 4FLFA 3RWMB 2WF9A 5A03A 3AEKA 1H8EA 3K8ZA 4TV9F 2GPBA 1KP3A 2G09A 5EIOA 4LOHA 5BNWA 2CD9A 2XB6A 2MSEB 5I9LA 3WK5A 1G2IA 3AF2A 1XYGA 1G6Q1 4BMZA 1CR0A 1D4AA 3JD0A 2Z4TA 4RZ2A 5G0VA 1IZZA 2QE6A 3AX6A 5FO1A 4NBTA 2HDWA 2IHYA 3T06B 4NZNA 2OORA 4WCFB 4OMFG 4CEHA 3A3OA 4PYLA 1JG6A 5TGZA 5J59A 3NFRA 4ZQGA 4XGRA 4UXJA 2P0AA 4YA6A 5KYWB 4RZUA 1G3QA 2UZ1B 1XF1A 2V54A 4CIAA 2MSCB 3A4MA 3UTCA 4QKQA 1E6MA 1ESDA 1VE1A 1G5RA 2AMFA 3WB0A 1J25A 2I62A 1PE0A 3HK2A 2J46A 1GZ7A 1ZNWA 1YBFA 3QMVA 1JHVA 4J0FA 4NPHA 3CB4A 1EK5A 3G1TA 5HDBB 5BO5A 2AXNA 3CXUA 1I7LA 2P67A 2JK1A 4RK4A 1WS6A 1NBIA 2NO9A 3E9RA 3LAWA 1VKOA 5LQRA 2PJDA 2Z9BA 2ZUCA 3OHPA 1F51E 3ETDA 1NXWA 3MRSA 4FW9A 4KXWA 1YAJA 1TCVA 2NZ2A 2QZ9A 2A9JA 3GEPA 4YRJA 4A27A 2GPNA 4A6PA 3U6BA 3K5HA 7REQA 2PSHA 2ZI9A 4L0QA 4JLMA 1ODKA 4FS8A 1TCUA 1I2DA 3CX4A 3V1YA 3QJYA 4J2TA 4B0PA 2OAP1 3WA6A 1H2EA 1JBQA 1Z88A 2DCMA 2QN3A 4X24A 1DAOA 1IOZA 1FQKA 3GA0A 3K3PA 4XCQA 4BNHA 5I7UA 1MAVA 5JAOA 3DLPX 2ZWMA 3HKEA 1DDIA 3KOZA 4QJIA 1WSWA 5FPQA 4UXHA 3F98A 3G5LA 3ORFA 4G26A 1NY5A 2EW2A 1AKUA 1A98A 5AFSA 4Q4LA 4GMKA 2O2HA 4R51A 3A1CA 3D7NA 4K2AA 2FRDA 3HKDB 3V1KA 4B3GA 4H18A 4V2UA 4ZT3A 3PENA 1GV0A 1MX3A 1WZEA 3TXAA 5JW6A 2X2EA 1SHJA 3GEHA 4G01B 3TO5A 5EPOA 1WHSB 1G21E 1FTWA 3CZCA 1Z6PA 2JF0A 4P9NA 4PCLA 2G5PA 4Y9TA 2PUWA 1T9AA 2NXWA 1NQXA 4NYMQ 3U0BA 3P2OA 4F0JA 3DHEA 4BWYA 1ZX1A 5JRZA 2NYVA 4ANFA 3ZY4A 2GASA 2NX2A 3SS8A 4N0PA 3BB3A 3DAGA 3QFFA 2FZWA 2JH8A 4MW6A 4AQ7A 3H04A 3I2FA 1DHRA 1ESEA 4G9EA 3P32A 4D46A 1VZ3A 3G9XA 2ZIZA 5FBHA 1TAHA 2AIRA 2EJBA 4FDMA 3E4DA 4KQJA 1GA4A 2I6UA 4PLHA 1E2GA 1QONA 2RAFA 3MCTA 4G0PA 3CUVA 4ALJA 2AJ8A 3BIJA 1NN0A 2ZRHA 5SZKB 3RC9A 3SF8B 4A6XA 4JUDX 3V4FA 5ITZB 4OHMA 5ADWA 2H2AA 2GN2A 4F7DA 3BK1A 3IIIA 4LTMA 4KR9A 5TVGA 3FB4A 5KKNB 2ZDHA 4GKAA 4FYPA 3VHLB 1KO4A 4BRUA 5JSQA 1WDTA 2WBLC 2ES4A 1KFCB 1P0QA 2GF2A 2OO5A 2XQIA 5AVQA 4EVQA 4N5MA 2YIDA 1BJKA 1RBQA 3OICA 2E49A 4KIGA 3ZUPA 1VSQA 3ZHVA 3IDOA 4AUKA 4E12A 1W581 1XPUA 4LTDA 1N5OX 1EQ2A 2GJKA 1XZKA 1QV7A 2P2NA 4CG3A 2XZLA 3WMXA 3Q2IA 3ZWWA 2D0OB 2GJ4A 5ALOA 1W75A 4EKNB 3NTUA 5KDOA 3VKHA 2YVQA 4RPJA 1RLIA 4YDHB 4L8FA 3KQWA 3R6GA 2X3FA 2EKBA 4DDMA 3FPBA 2P77A 1VSVA 2X9GA 3ZGOA 4UBMA 5EJ7A 1R4NB 1WCIB 4EZEA 3R5XA 2X19A 1QGAA 3ELUA 1DRJA 3CEJA 4URWR 5BT8A 1ZSVA 3I42A 2HQOA 1IOVA 2JAPA 2R1VB 1TDJA 3B1XA 3QMMA 2ZSUA 3ZJUA 3BXFA 1E9AA 2HLPA 1Z2PX 4RS3A 4LZZA 4IGIA 4KWEA 1BDHA 1TQDA 5EKUA 5I01A 2FEKA 4XSHA 1TKAA 3RVDA 1U2RA 3NNNA 2E9SA 1TCBA 4JIMA 4CTJA 3DG9A 1E32A 1J23A 1KDOA 1GIAA 5DM4A 3RF6A 1EVLA 1OAKA 2GEVA 3OIWA 7REQB 1E2HA 5JPCA 4GG1A 4ZFNA 4DILA 2OA0A 3VAZA 1ZICA 3AR7A 5AHWA 1ZGAA 1Z5GA 4Z49A 4MCIA 3U09A 1OC4A 1TTQB 2NG1A 3QKIA 2WKRA 1KRXA 1DTEA 1N5LA 2X8BA 2QRMA 1RZRA 2VJPA 1K7CA 3EXFA 1L4NA 4I6JA 4ZKEA 3KVNA 1HTWA 3BTOA 2AJTA 3OQIA 5FCDA 4A0GA 2VHCA 2UYOA 3LYHA 3QFRA 4AY2A 5GM1A 1JR2A 3FUVA 1XXHE 3WDSA 1MDBA 4DG5A 4BEJA 4GP7A 4X1YB 5EWMB 3MGKA 1QIDA 1T10A 3HV2A 4KB5A 3ACBA 1G9XA 4C2TA 1QKKA 1W0KD 2PH1A 3I52A 4BGDA 2PD6A 5G0UA 4YQFA 2NSJA 2ZYRA 1PFQA 2CZQA 4FQ5A 2VAPA 3GCGA 3HY4A 5EPEA 3CSSA 1DAEA 3H8SA 4EX7A 4BO7A 1KEZA 1TYCA 4R8VA 1N92A 3UHJA 4Q4CA 5T6MA 3G8BA 4DYVA 4CI9A 3NB0A 2WILA 5L4NA 5AKYA 4CQMD 4ZHQF 4YQEA 1C9KA 5J2TB 3WLIA 4CETA 3FHOA 4CLXA 1BGWA 3BWMA 3WWZA 4ZTBA 4QQKA 3DFFA 4GWLA 5BNFA 4XIGS 5JZSA 2WQ7A 1JFSA 3SLRA 5FL7A 3GG2A 3LDGA 5GJBA 3QPVA 2GERA 5DNEA 4KO1S 2VJMA 4L85A 1EBFA 1U5BA 4Q9AA 4YRBA 2VNAA 5AVSA 3PR3A 4GEKA 3UENA 3AL2A 1QYCA 5CXXA 2QZ4A 3T1OA 2R47A 4DM7A 1O96B 3GAZA 5KREA 4X7RA 2XUKA 4UEJA 4HRXA 3RGGA 3UYLA 1UUFA 4TRNA 1AIPA 1F2TA 2PA3A 2R8OA 4FZVA 1YKFA 1CUSA 1XZGA 3KZNA 1K8YB 2XHEA 1TK2A 4B33A 4DNPA 2FEPA 2VWHA 4HS4A 4Z0TA 3ZJTA 4IG4A 1PT9A 3BIOA 4KQEA 4DUZB 2YWHA 5COBA 1WX1A 1P5ZB 1KF0A 3NT4A 4AF8A 4DM4A 3B51X 2QVLA 2EZ8A 1WZUA 1T0PA 5KEIA 3NTVA 3P4UA 4OB8A 1DQRA 1JAZA 2YHIB 4XGQA 4YO8A 1QX3A 1HXHA 5SY4A 3FCAA 3SJZA 3DOEA 5LLDA 4LHXA 3JQEA 1H5UA 3CLTC 3C3BA 1JW9B 4Q9IA 3LLVA 4BNVA 4A82A 1RRVA 1U90A 1JEEA 4EGFA 3A9TA 1RQPA 1E69A 5JHGB 2WLSA 2K6GA 2VCEA 4LVCA 3CZ9A 3RVMA 3WKBA 1BHO1 1OX5A 1B8NA 1Y8AA 2BKXA 2WR8A 3DZFA 4BNGA 1DTWB 2WINI 4PS0A 2YS7A 4RDIA 5KOJB 3O8CA 4DLSA 1E1RD 4P84A 1G17A 2C0QA 3KJIA 4RZSA 2ZZNA 3OTQA 1QFSA 2BT4A 3W1EA 1N6NA 4QBIA 2C42A 4YAOA 1B2RA 2JFQA 3LTNC 1M8PA 1SVKA 1DC5A 2BHLA 2R6GA 4LYEA 2WT4A 4Z3OA 4BZXA 1JP7A 1PR5A 1S8FA 1EXDA 5LXTA 5E4YA 4MWCA 5H82A 3W8FA 3ESRA 5HG0A 4DCPA 2OK8A 4GIBA 5I8PA 3IAAA 4TMFA 1P6QA 1OIVA 1WW3A 4QFMA 1ZWLA 1PUXA 2NVBA 4KXYA 5B6IA 3KPUA 4NFHA 3C48A 3TUIC 1EFKA 4BKQA 3H2IA 1N6IA 3VOSA 2EU8A 1L4YA 1IUOA 2CF5A 2VPYA 5B3JC 2JGJA 2QX6A 5E6SA 3E35A 4G3XA 3TBKA 4HB4A 3NCTA 4P4UA 3KJFA 3DV2A 2HRQA 4QRIA 4WCFC 3OVMA 3T34A 2AX4A 1PQUA 2EIXA 3WK4A 4J9VA 1V5WA 1UFOA 1TKBA 2Y27A 4LBYA 3QW2A 3RJTA 3U3KA 3FCEA 4M0LA 4ZOAA 2RGXA 3DTVD 4NJEB 1W36D 1FFWA 4C4YA 5K3DA 1UBHS 1JFFA 3DEIA 4UMFA 1LFAA 1HNNA 3VSCA 1GTSA 3QJ5A 2EARA 4HLUA 4UCQA 3ZW8A 1ZN7A 5H9WA 2W2PA 3ZK8A 1T2FA 4PCAA 1Y3DE 4HNGA 2P9CA 3ZDDA 1TK9A 3DL7A 3IC5A 3PR1A 5KYTA 1M8GA 1QBKC 3DMGA 5HIAA 1M2JA 3GQVA 2LW7A 1OFIA 2DQ4A 2OCXA 2V98A 1DV2A 1LQ2A 1OKKD 1DU4A 1OMOA 1KOLA 4YUWA 3DP7A 1AV7A 4YO7A 2GB4A 2X0KA 1W49A 4LJ9A 4AS2A 2F3PA 4NDAA 4YAGA 1NOJA 2C4MA 4M0KA 4MDEA 1KMHA 3E3AA 3ZN2A 1HE3A 4Y7CA 4G65A 2MSWA 1TX4B 1MHPA 2JBAB 2OD7A 4F96A 2CL6X 2WM2A 3WOHA 4WBNA 1NVXQ 3M70A 3ZYZA 4CEJA 1XAHA 1ONBA 1NIJA 4JYMA 4PLFA 2V8BA 4ZO7A 4RADA 4ZQIA 1IQRA 1OGIA 3HDTA 4LGVA 4MYRA 3THSA 3W9SA 1FDOA 4BS9A 4PPNA 1OBHA 4LJKA 4EG3A 3STUA 4LHVA 4IZ6A 1BS9A 4M0DA 4PNPA 3H8VA 2OLEA 4BE4A 4Z7JA 5JASA 3BMXA 2MIIA 2I71A 4OHVA 4R01A 2BVNA 4BL5A 2NU8B 5I7FA 3KJQA 4OA5A 3SQNA 1U9JA 4LV8B 3JQ9C 4N40A 4YK7A 2IPLA 4DDWA 5EI5A 1NLZA 1IJKA 1VE5A 1KPIA 1CQIB 1P33A 1P5FA 5FYQA 1AKVA 3M6IA 3A6FA 3LWDA 2C7RA 4G24A 5BWMA 1N77A 3IT0A 1BMDA 2FU5C 4GSKA 3V4OA 3HUDA 1NWHA 3ZZTA 5LOVF 4GBGA 4DFDA 3UK1A 2VJNA 3K8QA 3D3KA 2XKJE 3Q3GE 1GEEA 4KQMA 2H2WA 2PS1A 5DHAA 5BN3A 4DR4B 2PHZA 2IEYA 1GA6A 4MVJM 4RMGA 1XX6A 2FFAA 4KQFA 4HH3C 3K70C 4B46A 7ADHA 1BCSA 4HYTA 4ZAZA 2IHNA 1X1EA 4GXQA 1W0JD 1T13A 3F4LA 3LWZA 4D4IA 3EIHA 5K3FA 2KQUA 1XA0A 3A7DA 4IPTA 2PV0A 4PSKA 5CPFA 1NLUA 4K86A 1T2NA 4MQFA 3FXAA 4BB6A 1BD3A 1WWKA 4QUEA 2EBHX 1U2QA 2RFLA 3ZH9B 4C6HA 3LH5A 4CPDA 4NBUA 2Q4TA 8MHTA 4FJ0A 4MH0R 4I5DA 3OF3A 1S2IA 4N3CA 3AP3A 2AFHA 3DHWC 1ZVMA 1VYHA 4QHTA 1ACLA 1RWVA 2W6NA 3E82A 1Y9DA 4NZ9A 3KQHA 5GINE 2OFOA 3UGKA 1GSIA 5EUQB 3QPWA 1B00A 4WA8A 2ZS8A 3EIOA 1J2RA 3LL4A 3V8PA 4Q48A 4CFSA 1DINA 1ECJA 1KETA 1YZHA 4I5EA 1HC7A 4EMTA 4BMYA 2ZXUA 3RB8A 1ZAKA 3EIXA 3JYNA 4QGHA 3INTA 1NM5C 3HEBA 4WZZA 3OMLA 1NOKA 4WJZA 2Z83A 3IDFA 4XPIA 4NHOA 3H4VA 5AUOB 5HTKA 1Z2AA 1PT6A 4CMGA 3M81A 4QYTA 4AG6A 2Q27A 1GZUA 4QVGA 3V4LA 4YX9A 2VQEB 2QZJA 2OGTA 3EVZA 4Q1EA 5DTEA 1NW3A 3GFBA 2FPIB 4JZKA 4ZO6A 5CA0A 1YRWA 1WHTB 3FR7A 5EGSA 3VR6H 3FPFA 1I4DD 3B48A 1YH3A 4INZA 2IZOA 1R0BA 1TEZA 1JWAB 1NMEA 2B8WA 3IQDB 2Y67A 4C7VA 4AZTA 4C07A 3E61A 2ARKA 4A1OA 1SIWA 5E2BA 1YTUA 3W7VA 3F2VA 2F59A 3NHAA 4KBGA 3LCRA 2YMLA 3DKRA 2DPLA 3ZDCA 3R3WA 2UZ1A 3LP6A 4D25A 4CKCA 1JH9A 5ITVA 2XYRA 1GAEO 2GJSA 1EWKA 5SY6A 1XNQB 4EWLA 3EVNA 4MV9A 3RRJA 4DVJA 2WYWA 3ZQ4A 4R1QA 1UEXC 2FK7A 5F5LA 3KCQA 1VMKA 3L8MA 1NLFA 3GELA 1DKLA 4D9IA 4DN6A 1ICIA 4OB7A 3UBMA 4EECA 5JNWA 1N5RA 1E4VA 1DEAA 1KH2A 1JGTA 3FYCA 3IJRA 3PPWA 1F38A 3GJZA 4GPAA 4BVHA 4Z4EA 2VBIA 1HEYA 4LJYA 1H66A 3FLEA 1J33A 4FKMA 2QWXA 1NRXA 2YTZA 3N0RA 3KK0A 3O03A 2PT6A 4PWZA 1QHHB 3BF8A 2FRXA 4BNTA 2FF5A 3D6UA 2L18A 2DPYA 4D8YA 5ES4B 4C0XA 1AKRA 5IJ0B 3LKZA 1JA0A 1UAGA 1SQFA 1NDQA 5T67A 4G2NA 4RSMA 1WXQA 2YY6A 3QK7A 5EMLA 2FN8A 3B5EA 3KKLA 2MMCA 2G4CA 3S27A 3WG9A 1C9YA 2WP0A 5AW7A 1TMYA 2WQ6A 1DQSA 1GPYA 1I0ZA 4LJ4A 1PJ3A 2BZ0A 5KMGB 1KDTA 1K98A 4V0MA 2Z9CA 1PNVA 1TMOA 2I5PO 2J7KA 2QL7A 4QXPA 5AHOA 5GVSA 1SXJD 4JCOA 4P4LA 8AT1A 4IIJA 3ROZA 1RE0A 2BR4A 2G36A 1RR6A 3QLUC 1B4DA 2R1TB 4LF5B 4L7VA 3KL2A 3BD9A 4O2BA 4DCGA 3GDFA 3S8EA 1BYIA 4KGZA 3KBBA 4J4HA 3SDSA 4CDMA 4D45A 4MV0A 2OGSA 5AJXA 2PH7A 2FLKA 1Q19A 1Z3CA 3MJEA 3BFVA 4ZOLB 2G3YA 1N9KA 1DARA 2ZT7A 4MLCA 3GRVA 1EQUA 1N7HA 1XD2A 3O4FA 3SQLA 1P2TA 4EM6A 2Y0DA 3DBVO 4HZUB 4I36A 4AMVA 1PGPA 4I9GA 5EGNA 2AA3A 3RHFA 2ZBVA 2HLDA 4GP9A 4DCCA 2FVYA 3SXUB 5LYJB 2QRHA 1IBMB 1UDBA 2HO5A 2Z2YA 4OY3A 3DJFA 4F5WA 4CUJA 1V16B 1LI4A 2B25A 4L8WB 4OHFA 1L5NA 2FSSA 5CLGA 1CUEA 5AJWA 3MGAA 1QFXA 2YRXA 2FDXA 1CB7A 4E2ZA 3RUAA 3SF8A 3L6CA 5HQJA 2AHRA 2ZUDA 3QVOA 1QVAA 2RK4A 5ITZA 3MINB 5HCIA 5TGTA 1ZH4A 1X70A 4B4UA 1GFWA 1ZHHA 3PNYA 4NFYA 2VDLB 5F7ZA 5LXTF 1P9OA 3KYBA 2Z6UA 1NUUA 1BVHA 2DP4E 4JJKA 4RVSA 1YZFA 4I5IA 1O6CA 3IA7A 2OP1A 1YQXA 2INGX 1GAQA 3GCXA 4L6IA 4C87A 1N2CA 3KXKA 4XB6B 2Q50A 4JUBA 1WVMA 3D3WA 2FPOA 2GAOA 3I09A 5B1SA 5KYYB 4OHUA 2JHFA 2IBMA 1OILA 2FQXA 1QUEA 2C3YA 2IU6A 4G97A 3KT8A 1GLGA 5FUBA 2X86A 4PX5A 4R81A 1VPVA 2E48A 3TCNA 4EGQA 4HR7A 4FNAA 4A91A 3KSDO 3EA0A 2AW5A 4TGLA 1P3DA 1Z6TA 4KRGA 5ALMA 4P4TA 1WKBA 1NP7A 1HRKA 1Z0UA 1XC7A 3HXTA 1RKBA 1S7GA 3D8BA 1YT5A 1MF7A 1WKCA 1YJ8A 2EVWX 2ZBFA 4H27A 4EI9A 2X6TA 4XUCA 3EY4A 2XT9A 3URKA 2HQ1A 3T3DA 2A4KA 2GNAA 1JV2B 1D9ZA 3E58A 5K51A 2R1VA 1MJHA 1VRVA 2H1LA 1RBMA 2HF9A 5ECWA 4M2LA 4EI7A 3AIOA 2IHTA 2JGDB 1QB7A 2HV9A 3NRBA 4NP6A 3SC6A 2B6HA 2LTAA 1PKXA 3DE3X 3CRW1 3IODA 1BHJA 4NJMB 2Q2VA 1YULA 4C4OA 1C7RA 5C7OO 3TMAA 2W5UA 1FU7A 4JYPA 1DBWA 1MC4A 3A6LA 3H9CA 4XQ0A 2O52A 4QO7A 3KPJA 1T36B 1D1PA 2H4XA 3JQAB 3KJXA 3MTEA 3ORSA 4RKYA 3GNTA 3GQBA 5CYPA 5ILQA 1K1EA 3Q3EA 3FGPA 4WBNF 2ONKA 3OFJA 5BR8B 1TUBA 1C0EA 4Q02A 3U62A 2WUVA 2Z8XA 3MK31 2Q0QA 3DM5A 3PWZA 5DLPA 4AYWA 3H9JA 1GKYA 3USES 1M2WA 2QLFA 1AZTA 4EG0A 1N8NA 3NGLA 3CRQA 2ET6A 4OO3A 1CUYA 1E1YA 2KWIA 3B1KA 4L6CA 4LV6A 5TPZD 4BMVA 1KAOA 1KI2A 4FYKA 3V1UA 2YOHA 4RQTA 4E6PA 5EMNA 5C4IA 3IOMA 1BMTA 2B2XA 2NPFA 3P71T 1B0ZA 4WVLA 4R7GA 4DPLA 1TYZA 3D2CA 1A8UA 2XUJA 2Y93A 4IM7A 3VSBA 5I4CA 5KWEA 4RE5A 3NXSA 3RGWS 3SZGA 3TFQA 4UHDA 2IWHA 1QHIA 4N7BA 3IVRA 3ZHRA 4CF6A 2ZCUA 3K9CA 4N3GA 1AK9A 2QL5A 3ISTA 4O33A 2OBXA 4NZOA 4L5IA 1IZ8A 1Z8NA 3PB3A 3ZBPA 4D9GA 3CCBA 4BVBA 5I7RA 4YUZA 1T0BA 5CT4A 3L7YA 4C0JA 4Y7DA 4NH0A 1SXJE 5BSFA 4H15A 4U63A 2C2WA 5J2TA 1OH8A 4OP1A 1VXOA 1J09A 2BC9A 4UHKA 4WRRA 2NV2B 3I34X 3UXHA 1GGEA 2IFTA 3A4LA 4MW2A 2CDNA 5L3QB 2CHQA 2XWBF 5K5EA 3ZVRA 4MJLA 3O4HA 2FSPA 4FGLA 4RIEA 1T2CA 2JGRA 2PSDA 4QUKA 1PU2A 4S0ZA 4KDCA 1Z82A 2PZFA 1B73A 4CLRB 3I30X 2IIPA 1XUOA 2ZBGA 2VXBA 3BKXA 4K1LA 5FTJA 1UPXA 4NC9A 1ZLYA 2DECA 2ZE7A 5DGDA 4C1BA 2ZPTX 4G36A 5AESA 2VWGA 2K7FA 2H1FA 3HJGA 1FP4B 3V2HA 4CM8B 1UT5A 1AQIA 1PZGA 3R0IA 4BFWA 1DT5A 5KDDA 2Z4RA 4RCZA 3K4QA 3MJFA 5DM60 4XTRA 3MFYA 4Y2GA 2I2FA 3LWNA 1KZ1A 3JVUA 4DJDC 3M33A 5BYBA 3QXXA 2YJ4A 3ILXA 1Z28A 3H7IA 3T9CA 5GGXA 2X5JO 5F2NA 3B6EA 1CR4A 5LR6A 5DDIP 4I55B 4I1PA 1H3EA 3GDOA 3SSOA 2YHIA 4GRIA 3LDUA 3WMGA 3FUCA 4EB8A 5CCBA 2EC5A 3QKTA 1KEEA 2XZDA 3V1LA 3OIUA 4ZKDA 5JCJA 2ODTX 3LCVB 2A67A 2OD9A 3CTPA 5IDVA 4MR7B 4ZYTA 1BGVA 3U4MA 1L8OA 2AMYA 2R4TA 1LD3A 1Y9ZA 5DXJA 3CH4B 3F9IA 2H0RA 3EH1A 4RH3A 2E5LB 3NC4A 2V0NA 2GEBA 1DTWA 2IEBA 3KJHA 1PW7A 4L5YA 2KJQA 1A9OA 3SN6A 5A5FA 4FC6A 2WZCA 1YZ3A 2Q5FA 4DKJA 5ARCA 5MN4A 4XQEA 5FF9A 1Y6JA 5C8XA 1IB6A 2CN1A 2QRUA 2AH5A 3LBNA 3NG1A 4JBWA 5L3RA 4A15A 2P41A 6ABPA 1CQWA 1TA9A 3AKZA 4IZIA 4U4AA 3U44B 3KYDB 3WK8A 4BZQA 2QOEA 3RU7A 3EZ7A 1E9EA 3KUDA 3WV4A 2WWTA 1O97D 3BWEA 3H42B 1TZBA 3UJPA 2PKEA 3NFYA 4JXJA 2PA0A 2QTAA 4KAXA 4QXAA 4CMEC 5L3SA 4BNZA 2E5WA 4EO4A 1EXVA 1WF6A 4G86A 4M21A 3S6JA 1P62B 3GRUA 3IT2A 3MNFA 3AP2A 1C7JA 1YO6A 2BP7B 1PW5A 1Z0KA 2WF5A 2DHCA 3U6KA 3MWFA 1R5NA 2B83A 4DEVA 1C8LA 1N2BA 4PLGA 1W25A 2PLWA 2DFTA 4MUFA 4MGYR 3SI7A 1TJ3A 2Y76A 3GJ3A 3M4XA 1DDGA 5IJAA 5JY1A 5GPBA 2HYDA 1Z4NA 4MWBA 5M04A 2ZULA 2NSYA 2JCGA 2PUHA 3IYLW 3QEJA 4BP1A 3WZMA 5TS2A 4IIJF 3ZWQA 1UZLA 3JRWA 3LW8A 3VR3A 2AE2A 1FYWA 3ACCA 1R0WA 2HPVA 2ZBQA 3MJTA 5HF6A 3WDKA 2POCA 5AXBA 1MJNA 4D6XA 3VH3A 1SQ0A 1XVTA 3YASA 4DNOA 4Y0AA 2Q0HA 2O2ZA 3T4PA 4DUGD 2PTGA 4NNJA 1OV4A 5IJWA 4FX2A 4G25A 3EYAA 4KXQA 2GN9A 3R44A 3U4AA 5BSVA 2WKSA 2C82A 1WUIS 4FFMA 3QLJA 2HT6A 2HHAA 4GLBA 3I1FA 4CIDA 4GVLA 3SHFA 5BVGB 5K8CA 3LE8A 2EGGA 4N65A 5GZ3A 7AT1A 2PUAA 2EV9A 2JBAA 3F9RA 5B2EA 1YGYA 5FI5A 4RACA 1K88A