1ZD9A

Structure of human adp-ribosylation factor-like 10b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
b'SKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like 10B
publication title Structure of human ADP-ribosylation factor-like 10B
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zd9A00
3A58B 3F5FA 4PPFA 4QGFA 3ADKA 1M7BA 3TSWA 2EYQA 1MO3A 2HUPA 1C1YA 521PA 3FMFA 3K9NA 1HT2E 1BO6A 1MRNA 3MCAA 3VX3A 4BEJA 2ZI9A 2PJRA 4IDHA 4C3ZA 4DLSA 4YMUA 2O8CA 5DI3B 2Q9BA 1SXJB 4RY2A 5JCZA 2WOOA 4ZDKA 3MD0A 2WSSD 3KXLA 1G5TA 3U60B 1W4RA 3WYFA 3V4RA 3UMSA 4Y0AA 1YVDA 5ELXA 4ACAA 1XEXB 1Q1EA 2XNDA 2NPIA 1E2JA 2FSHA 2VBCA 4D4LA 2G88A 2HV8A 4C0QC 2GCOA 3W8RA 3GFTA 1SZPA 5E4FA 2O8BA 4YXWD 5L8VA 3DO6A 5CM8B 1N5JA 4Q4AB 1KMHA 3NC1C 3NG1A 1YR9A 4L8GA 3NH9A 1GAJA 3EC2A 2RGNA 1BH2A 4O0MA 3K0SA 3IQWA 1P6XA 1W2HA 1RRPA 4NTZA 3ECCA 3T1OA 1A2BA 3U5ZB 1TNDA 1OYYA 1QHHB 1E2GA 2GJ9A 1JXMA 3B78A 2Z43A 4KCGA 4U7DA 4UKDA 2OFWA 1N6HA 2GCPA 3T12A 4TMWA 1FQJA 1W36C 2GVZC 1OW3B 3EASA 1R5OA 4ILEA 1DELA 2KBEA 1XD2A 1YHNA 2VLIA 4BFSA 4AKHA 4Q1CA 3AM1A 2V6JA 2ZI6A 4LHZA 1AKEA 1E2MA 4XVUA 2FDCA 3ZVNA 3VR1A 4US2R 3OFND 4TMKA 3FWYA 3EZ6A 4EIWA 1ZD9A 2C9OA 1E2EA 4AG5A 4OI2A 1IN8A 2OSBA 4C0LA 3IPYA 3AF3A 3KJGA 3F8TA 3PITA 1TU3A 3CNOA 1Z0FA 3I62A 2YOHA 4WA7A 3NTUA 2J0QA 3QENA 4ZDWA 1P9NA 4HDQB 5EE9A 2XX3A 4AWXA 1VG0B 1KNXA 5KNCA 4UXIA 4C2UA 2YHSA 1AIPA 1FP7A 3TW8B 1KDRA 2AX4A 4QC2A 1NRJB 5DH9A 4OK6A 2BCGY 2Q6TA 2F43B 3ZYCA 1U8AA 3OAAA 4A36A 1UF9A 2NO9A 5CIQA 2AKAB 4GOKA 3MG9A 1GIAA 2GK7A 1R8SA 1WMSA 1EESA 4BQSA 3SHWA 3GEIA 2X2FA 4E07A 2J0UB 4GZLA 1CU1A 2E1RA 2VP9A 2ZYWX 3BB1A 5CK4A 5EE3A 3PXGA 1DAGA 4A6PA 3U7GA 5FL7A 1SVLA 3GD7A 1Z6YA 5F9FA 4KFUA 1E99A 2MMGA 1QF9A 3LA6A 1E9DA 5CITA 4JVSB 2BMJA 1X8JA 2ZS8A 4V0MA 5DIFA 3P27A 5TDHA 1UJ2A 4PAOA 4JIMA 2GJSA 5EXTA 3L8ZA 2XZLA 1RYHA 1YKSA 2OO7A 1Z6AA 1E0KA 3IILA 3HU3A 2ZSBA 4RD3A 4LI0A 1EFRA 4JSYA 1BYUA 4M1KA 5DN6D 2ERYA 1COWD 2B8TA 1SQ5A 5CK5A 1G8PA 4MGKR 3KKQA 5FPTA 4MUAA 5J4HA 3BB3A 4QGHA 2YOFA 3EPJA 4V0NA 1NF3A 4CVNA 3AP1A 3IHLA 4LJ4A 5C4GB 5BW8A 3AB3A 1M2OB 3A4MA 4KVAA 4URZR 5DE3A 4LC0A 5FR1A 4BLSA 3PEUA 1R0WA 3CO5A 2NZ8A 1TQ2A 2QRNA 3W5JA 2WM9B 4CEIB 3AVXA 2QT1A 2LWIA 2IF2A 3IPXA 4TMVA 4UXJA 3I61A 1ZC4A 5KYKA 1G7SA 1Z29A 1VMAA 1KKMA 2ZPTX 4KSCA 2GBLA 3EA5A 1NKSA 4FCTA 4AK9A 2N42A 4BLOA 2X19A 4D0GA 2F9LA 3OEHA 2R65A 4OJKA 4EPWA 1RPZA 3CX6A 1WP9A 1N5KA 3RRMA 1PLKA 3KX2A 1E79D 2CCJA 2JLYA 4I1VA 2D2EA 2GJAA 4JT4A 3AKDA 4Q1BA 4MYUA 3I32A 2DFNA 4LPSA 3KJHA 2KI5A 1G7CA 3WRXC 1US8B 4O2RA 1WDTA 5J47A 1TQDA 1U0LA 5LDDC 1GP2A 3L43A 4DHEA 1E3MA 2JLVA 1GWNA 5FBVB 3KTAB 1N6RA 2REBA 3RANA 4F4CA 1T0JB 2F1RA 1Z63A 1KO1A 2CMKA 3PVSA 2QAJA 2W6ID 2D2FA 1G8GA 4NYMQ 4RVCA 4HB0A 3WMGA 1JEDA 1YE8A 2R6AA 4H1UA 3TNFA 1E9SA 2Q3FA 2UZIR 4OQXA 4WAUA 5AJXA 2VA8A 2ZI3A 4E5UA 1OKKA 1MO5A 2FGJA 3ZZ0A 4BZPA 3OEEA 3NHAA 1TMKA 1DAIA 3LBIA 3TLXA 4DUGA 3LH5A 1A4RA 2AWNA 2PL3A 3HPRA 4FD2A 3BH0A 2G0NA 3I73A 4NH0A 2VIIA 2PLRA 2VP0A 4HDOB 3CLVA 4ZPXA 4HAZA 3FFAA 5FI0B 4L9WA 5TB5A 1RJ9B 3X1XA 3IIJA 3HP1A 3LV8A 4AURA 1E6CA 4ERNA 2AK2A 4HAYA 1E0SA 4LDJA 3FE2A 5AK0A 4NBSA 4MKIA 3DDCA 3I1FA 1E2NA 2KE5A 1Z2AA 1US8A 2ZRAA 2QMUA 1KSFX 5L3QB 4DDWA 2VRWA 3M4YA 4A15A 1KAOA 2CNWA 1KAGA 1MO6A 3SQXA 4M1SA 4A2QA 1UKVY 2CDNA 2DWOA 2V1XA 3QPUA 5GJVC 3TUJC 4CGZA 3AVTA 1UEJA 2A3RA 3U44B 1VTKA 4PHFA 2B92A 3IIMA 4JVMA 2AK3A 4PC6A 2QP4A 4BFYA 4EFLA 1E9FA 1VG9B 3ZD6A 4IJMA 1XPOA 1WXQA 2JLZA 3ZS9A 2F1HA 4LY6A 2V4ZA 2ONJA 5F9HA 1OFHA 1OFUX 1HA3A 2V7QD 3TAHA 1F3OA 3LWNA 4NKRA 2W00A 2IYRA 3RHFA 3CR8A 5KHOC 4Q9LA 3K0EA 3K70B 4EPXA 1OH6A 1SXJE 1T3SA 4PXAA 4B2IA 1RZ3A 1GFIA 3I4LA 3EA0A 3FKSA 3GJ0A 4AYTA 2IK8A 2REXB 4IDQA 4B34A 1G1MA 1XXHB 1VKJA 3KB1A 2ZEJA 2O8EB 1QHGA 3GJ7A 1OXVA 2FG5A 2YNMA 2D7CA 3DL0A 1PZNA 4GL2A 3C4JA 1P2SA 4LHXA 2D06A 3W90A 1R0XA 4TMZA 1S3GA 2LKCA 1FW6A 3GLHB 4HYYA 5IDVA 3CH4B 5DI9A 1LF5A 3KKPA 3Q7QA 2W83A 4XJXA 2H8KA 1TF7A 4LC1A 1RFLA 4P33A 4Q19A 4DLWA 2ZM5A 3LVQE 3QJYA 3KKOA 4D80A 1TF5A 2A5DA 1RRCA 4Q7LA 2ZANA 1XEWX 4JVLA 5G3ZA 3EG5A 1JECA 3GFOA 4DEYA 1TEVA 1MO4A 2P67A 3BWDD 1WBDA 4IHQA 4I4LA 3L8YA 3LXXA 5CJ2A 1ZM4A 2C5LA 1TTTA 1U99A 3Q72A 2ZYUX 3W3AA 1H8ED 3QQ5A 3W6PA 2QQ0A 3M6AA 2QSZA 5CLLA 2QN6A 4RCZA 1KDOA 1E96A 1J90A 3FFBA 4HZUA 4JLAA 4CEHA 1T9HA 4NPHA 2RGAA 4FXPA 3GJ4A 2GXAA 1UADA 2XITA 5KSZA 2GBLC 4Z8YA 1Z5ZA 3CUEF 3VX4A 4RFSB 2D7DA 1YRAA 5CYPA 1Z3IX 3C5HA 3KQNA 4TN1A 3FKQA 1PUJA 1GKUB 4URXR 3U3JA 5KNBA 1GOTA 3QKSA 2EQBA 2AR7A 1CR4A 3WNCA 1SKQA 2GXQA 3K9LA 2VQSA 1DAKA 1N3BA 4PR0A 1ZUNB 3TK1A 4YMSA 2NO0A 1OXSC 2D3WA 4YLGA 1CJUC 1IXZA 2B7BA 1RE0A 2CLSA 1T3HA 3UMRA 1AS0A 4FMCF 3PIRA 1CBUA 2GEDA 2X2EA 5HZHA 2JAQA 4FINA 1LS6A 2ZSAA 1XCMA 3V4FA 1P72A 1W4AA 5JLJA 2AHOA 2FZLA 2HJGA 1OYWA 5AUNB 5B64A 2O52A 4DB2A 5TVKA 3ZVLA 1S9DA 3GLGA 3DKVA 2FSIA 2QROA 2ZE6A 2QGNA 2BM0A 3HR7A 3MWLA 4TTPA 4NL4H 2VP6A 5C2JB 2Q21A 4MYTA 1EFHA 3UG7A 1Z8FA 5FTLA 2C77A 4JKYA 4ARZA 1N25A 1ZNWA 3L0OA 3RRNA 5JECA 1OH5A 1OHHA 2DWQA 4R98A 5JFGA 1XZPA 2QL6A 2RCNA 3FB4A 1YQTA 3GJ6A 4G5GA 3AUYA 1DARA 4EJSA 1JR6A 2NGRA 1G8YA 3EZ2A 3U3OA 5L3SB 1SVKA 1V43A 5J4LA 2OBNA 2GNOA 3VNVA 2QBYB 1ZINA 5J40A 1XZQA 3QPWA 3TSOA 1K5DA 2C98A 4LBVA 3NEYA 1CLUA 4Q9HA 1XP8A 2FPLA 3RS2A 4B6EA 1M6NA 2N1BA 2OAP1 4ZCMA 4NYJQ 4PQYA 3TKLA 2IT1A 1KSGA 4DKXA 4DEXA 1A82A 1II9A 3U3RA 3L0IB 1F48A 2YV5A 3SR0A 1V5WA 5FTKA 3WMFA 1KI6A 2IXGA 2GK6A 4RKEA 1CR1A 5DHAA 4B33A 1NJFA 2ODNA 3FGNA 1W36B 5FTJA 2JLWA 4DT1A 3PG5A 4FMBB 2VTKA 2ZU0C 4PO1A 2NIPA 2RGGA 3BERA 2OESA 4Q48A 4C0BA 1G3MA 2CK3D 1QHNA 2ZR9A 2ORWA 1YRBA 1R7RA 2QPAA 2Z83A 2OLJA 4IOJA 1FL9A 3EIHA 4P4SA 4TL7A 3OIYA 1FX0B 2NO6A 2OAQ1 2WJIA 2ZR7A 2IXEA 3CX8A 3P32A 5TMPA 1H8HA 1MH1A 1W1WA 1GG2A 2G3YA 1AKYA 3ZLJA 4X8LA 1E1RD 1CF4A 4C7OB 1KJYA 5FI1B 2IL1A 1ZCBA 5HE8A 5FOXA 2Z5FA 4R9UC 1DTSA 2QPTA 3K9GA 2XB4A 1Q21A 4Q5IA 4QXAA 4A6XA 3QF7A 5BWMA 2FPMA 2QBYA 3UWKA 2BM1A 3QI2A 1YZUA 3TR0A 1WF3A 2C95A 2W6JA 4HB3A 3VR4A 4EDHA 4LJAA 2ZRDA 5SZKB 1Z6GA 1Z6XA 5DO9A 2ATXA 4KV9A 3NDBB 2ZREA 1NY6A 1OFIA 4H9GA 3SOPA 3Q5DA 3RSLA 1XPUA 2ZJOA 2V1UA 4NDZA 3W6NA 4HUQA 1VIAA 1U9IC 3QF4B 1FOEB 2WMOB 3IBYA 3TVTA 1J2JA 2WJHA 4OHXA 1KO8A 4US0R 4U5XA 4QFMA 2WJYA 1YZQA 2FJUA 2OCYC 4RD1A 3E2IA 2R9VA 4HAVA 3ADCA 3X1YA 4JYCA 1XTRA 4CIDA 2FPKA 3KL4A 3BJIC 3B60A 1QHYA 1FMJA 1Y63A 2FE4A 4B71A 4WIAA 2Y8EA 1SXJD 4PC1A 2LKDA 4RCYA 3W9YA 3I5YA 2DCUA 4GDFA 1AA9A 4NP6A 3FOZA 2CCKA 3AVPA 3TQFA 2J0SA 4UNNA 3GLFB 4KBGA 2GDJA 5L3RA 5GVSA 3CPHA 4RZXA 1Z2CA 2ZI4A 1IXSB 1DOAA 1DG3A 1ODFA 3BFXA 3ZQ6A 2HLDD 4Q7KA 2QE7A 2ZR0A 4WVFA 4A4DA 4CEJB 1T91A 4IVQA 2NG1A 4HDCA 2CE7A 3BGWA 3NEJA 3FDIA 3VR6A 1P7CA 3N5CA 3NH6A 4LYJA 2F6RA 5JEDA 1VYTA 3BFVA 2CE2X 3I8SA 3UIEA 2YWGA 1HTWA 3WHKA 2Z0MA 1N0WA 1KTVA 4LPKA 1XMVA 4TTRA 1NLZA 3FHCB 1XD8A 3MMPA 5EXSA 5KOYA 1Q1BA 2XSZD 5EXXA 1XXHE 3JZAA 3GLIA 1OJLA 1P73A 1E0JA 4HUTA 2FEOA 2QNRA 2EWWA 2WKRA 3KUDA 1ZU5A 3PUXA 2DHRA 3K0AA 1ETUA 1JJ7A 2BOVA 5JCPA 1E32A 3BBPA 4ZIRA 1KO4A 2XNSA 3BD9A 3THYA 3BRWD 2OT3B 4C9BA 3TW4A 2O8CB 1Z6TA 5UKDA 3GLHE 1FNMA 3BFKA 1XTJA 3MSXA 1SVMA 3AVOA 5HR5A 5EUMA 3KQHA 4Q1AA 3DZDA 4YMTA 4KAXA 3SI7A 1LS1A 4BRUA 3CZQA 3OESA 4P31A 4EJSC 2VEDA 4CF7A 2WWGA 2GCOB 2IYQA 1QDEA 1ZUIA 2NO1A 4ON9A 3AVQA 1KI3A 4PZYA 2JJ8A 2O8BB 3GMTA 2QTVB 1WCV1 4QRHA 2GRJA 1KMHB 2WWWA 4LCBA 3VNUA 2O8DA 3VMFA 4S2EA 3ND8A 2QP3A 4C0SA 2VL7A 3VU9B 2JA1A 4FCVA 4F4JA 5FOVA 3L0PA 5HKKA 3OF5A 1KZ7B 1H65A 4N0EA 4TQUS 5K8IA 3ZS8A 1R2QA 2H1LA 2JATA 5G53C 1KY2A 1ONBA 4GMXA 5JHGB 1CJVC 1DAHA 1XJQA 2ZE7A 2CLDX 1HQCA 4Z8XA 4BUJA 2XTMA 1CIPA 1W2GA 2G1KA 1QHXA 3EARA 3TIFA 4JLPA 4BEBA 2F55A 1E2IA 2DR3A 1XD2B 3OEHD 3TQCA 4P4UA 4LYHA 3EIQA 1Z22A 5EZ5A 3EXAA 2IYYA 1IN7A 3PUZA 1OF1A 2A30A 1G20E 1XMIA 3V00A 4E09A 2ZRCA 1WBBA 2KSQA 5CLQA 4BFZA 1TQ4A 4TYWA 4GT1A 3ASYA 3T1VA 2ZJ5A 1CJKC 3W6OA 1T5LA 2F3RA 4M9XA 2JLQA 1ZMXA 3A37A 1JALA 3SFZA 5HTKA 2A5YB 4LHWA 1ESMA 2XOKD 5AUOB 1KI9A 4I1OA 3LO5A 3K1JA 3HWSA 5EXPA 1AQYA 1JAHA 2PJZA 1GDDA 1XEWY 3C7KA 3ND9A 4HB2A 5DYGA 1G3IA 3UWOA 3I72A 1QG2A 3Q7PA 3VU9A 2YZ2A 1Q0UA 1GVNB 1L4YA 1RKBA 3KFVA 1JJVA 3L0SA 2JLSA 4PPNA 2RB4A 4M1WA 4TYYA 2UZ3A 1EX7A 4Q1FA 3OEED 4BZQA 2WJJA 1E98A 1LW7A 1E4YA 4TYNA 1P62B 2ZJAA 4MKFA 2PX0A 2GF9A 1ZJ6A 2NQ2C 3CB4A 3QBVA 1YZTA 3K8YA 4B47A 1U2RA 5E7IA 1TPZA 4Z54A 3O47A 1JPJA 3ADBA 1D9ZA 1KKLA 1JAIA 4TLEA 4OK5A 4RD4A 4OHWA 2A2ZA 1EK0A 3L82B 4LGMA 1LVGA 2ZRPA 1HT1E 3UKDA 2BBSA 2CXXA 4PZZA 1N6NA 4FI3C 2ECKA 1UKZA 2IS6A 4HAXA 1G8FA 4F4IA 2ZYTX 2CVHA 4YMVA 3S1AA 3CPEA 4IVRA 1UPTA 1ZM7A 2X77A 4BZXA 4LHVA 2BBWA 3KQUA 1XEFA 4B76A 3CKLA 2CNWD 3QVUA 2WPDA 2ZRHA 1DG1G 4QHSA 3ZVRA 2G83A 4GI7A 3LLMA 4H1VA 4A0HA 1NP6A 1Z0JA 3MGCA 4ZDIA 3QEJA 2G6BA 4UJ5A 3VQTA 3P1JA 4TTQA 4CT5A 1G9XA 4BFWA 4JLDA 5FPHA 6Q21A 1VCNA 4PHTA 1BMFA 1FNNA 2RGEA 5JEEA 2WIAA 3LXRA 3AF4A 2WOJA 1FZQA 2Z4RA 1N6OA 3DKPA 2YC4C 5IRCD 4BLPA 4QGGA 5F98A 3C14C 2H92A 4II7A 3TAUA 4PPQA 3QXJA 3LBHA 5F3WB 1KDTA 1F2UA 3SZRA 1S1MA 3FKSD 4RD6A 4RKFA 1N6LA 2GTPA 3A1WA 3GEHA 2BIFA 4OK3A 4US1R 5JJKA 4A1FA 1II0A 3NBYC 1Q57A 2VSOA 1QZXA 3A1SA 4OQFA 4QBGB 4Z1MD 4HLDA 4BFTA 2WHXA 2H7VA 2CL7X 4M53A 2ODEA 3LRPA 2VH5R 1D9XA 1F2TA 4NYMR 2QQEA 2V9PA 1AK2A 1G4AE 3DM9B 1G5PA 4M0LA 1P4SA 1NBME 3OZXA 2IHBA 3LX5A 4P4TA 2DB3A 4A0GA 3NIBA 1R6BX 4JLKA 1JR3A 1KO5A 2V8OA 5L3VA 3K0CA 4EQ6A 3N2EA 4HB4A 3DOEA 2BCJQ 2AD1A 2A5FA 3BE4A 2JJ1D 1W0KA 4D4JA 3X1WA 3FHTA 2CJWA 2VO1A 4KYIB 1CJMA 4Q7JB 4IDNA 3N2IA 4IRUB 3D6TB 3VR2A 4Q4HA 2FWRA 1SKYB 2HCBA 4QHYA 3AVYA 2IUSA 3D3QA 1VCIA 1GNRA 2N46A 3SC3A 3WBJA 2W2VA 5D3QA 1KK2A 3CRRA 4TLCA 4XD7A 3EX7C 5FUXA 3BIFA 1B23P 1GM5A 2C9YA 2QA5A 3G5UA 3QKRA 1SHKA 2ZIAA 1CULC 3B9QA 1ZBDA 1VPLA 4HI0E 4NCNA 2OM2A 2ATVA 4KBFA 5JSZA 4P32A 3K70D 2H57A 4LV8B 1NSFA 4HLQB 1KZGB 2RKOA 1EFUA 2Q9CA 4KI0A 2VP4A 5D3MA 4QNRA 4HAUA 3CIOA 1E94E 3WYAA 3GLFE 1PJRA 2BMEA 3M1IA 3NVAA 2Q3MA 1G16A 1R8QA 2OXRA 3EIEA 3FYHA 2O0JA 1VCOA 1KJWA 4JJZA 1OXUA 4GP7A 2RGBA 3LW8A 3B9PA 4D2IA 1E1QD 1VCMA 3W3ZB 3LY5A 3T61A 3B85A 3ETLA 4OQLA 5AJVB 2HF8A 2D74A 3ZH9B 8OHMA 2F1JA 5G3YA 4C0JA 4CDGA 3A1VA 1PLLA 4IXMA 3SBEA 1OH8A 2G1JA 1J99A 3MLEA 2QP9X 3QG5A 3PEWA 4AG6A 2R62A 4DLTA 1DAFA 3VR3A 4NCIA 1WB9A 3NWJA 4QBFA 1BIFA 2JDID 4X8HA 2PEZA 2UVQA 4OQNA 2B6HA 3CF0A 3HU2A 4JL6A 1NVVR 4K81B 4UNRA 4C4PA 5HZKA 4MRPA 3TBKA 1GKYA 2ZJYA 2WMNB 3ZIAD 5C4MA 5HCIA 1U8ZA 2XJ4A 2RGNC 1C4OA 2AFIE 2ASEA 2AWOA 4XWAA 1SVOA 1KGDA 3E1SA 3E5HA 2QZ4A 3B8HA 3IDQA 4Q03A 2WSSA 1XD9A 5DSZA 3SFVA 3TUIC 4WXPA 4HLCA 2J7KA 4TT3D 1KSJA 1R0YA 2OUKA 4X8OA 1XPRA 5AJZA 4A2PA 3O8RA 1ELOA 1G291 1GRQA 2ZSFA 2DFKB 2FEMA 4FCWA 4B3XA 4AKEA 4PQFA 3GQBA 1HY3A 2ZSEA 1NG9A 1E2KA 1UEIA 4MH0R 1XFAA 5E7JA 4GSYA 4DCUA 1KI1A 3PENA 4MKHA 1XU4A 1QVAA 5HPYB 1AS2A 2B8WA 1KK1A 1QG4A 1P3JA 3A1TA 4MRRA 4TWZA 3K0FA 1G3UA 3QG1A 5H68A 1K8RA 3LW7A 4ZKEA 4CYMA 1MABA 3EZ9A 3P20A 4TQ9A 4B3DA 1LB1B 1RIFA 1W0JD 2OLKA 1FQKA 1OXXK 4R2HA 4W5JA 4BASA 4QBHA 2IYXA 2MSDB 2RHDA 4G5SA 2HXSA 2BDTA 2ZJBA 2G77B 4D0LB 1E9RA 4G3XA 4YDHB 2CHVA 1OXTA 4P3YA 3R9WA 1OIWA 2HCJB 4EAQA 3KJIA 1NN1A 1IN4A 4TMTA 3OFNA 3QSYA 1AGPA 5JZVA 2CEAA 1XBTA 3KXIA 1AS3A 2O0KA 3WY9A 1GTVA 4B73A 5JJLA 5FFMA 4KLZA 2WWHA 3SQWA 4UNQA 4QOSA 1X86B 4Z51A 3IEUA 3CBQA 4IEIA 4HZUB 4CEHB 4I81A 3ICEA 1NNEA 4QKQA 1VYVA 2GEUA 3PV0A 1N5LA 1ZM3A 5EJEA 2IUTA 4UNPA 4XH9B 1BOFA 4PPGA 2IWRA 2OHFA 3HYTA 3PFIA 5FBLB 5K8UA 2DY1A 4ZCIA 4CW7A 2WKPA 1U0HC 3J81k 1ZD1A 5AWFC 3QKSB 1E2FA 1W49A 2BC9A 4W5HA 3EWAA 4MKGA 4QJ3A 2QTHA 4AKIA 2CVFA 2RAPA 5EZ6B 1KY3A 4TLDA 5K8LA 4EPRA 3I3SR 1D5CA 2ZITA 4PAMA 3THWA 3ONWA 1R0ZA 4HATA 4DLYA 4E22A 5K8TA 3C41J 4B48A 2JLXA 4B74A 3MRSA 1W5SA 3LX8A 5KO2A 2ZVQX 1DS6A 1MT0A 2IEYA 5JHHB 4B3FX 1DVRA 2V54A 2KJQA 3OE7D 4PHGA 1G18A 1W36D 3KFXA 4ASUD 4V0ME 1HE8B 1W48A 5FBWB 2YWHA 3UXMA 2FA9A 4EPTA 1ZM2A 3RABA 3EW9A 3SJCA 3RYTC 2IS4A 4Q01A 3HR8A 3GLGB 1Q12A 2CL6X 2MSCB 2B7CA 5LB4A 5DN6A 1P9RA 3RSOA 4PO8A 5AJYA 1DEKA 4B6FA 5BN4A 1COWA 2P5SA 2ZSDA 5J5CA 2WWIA 1SVSA 3CRW1 3RRYA 2IYLD 2GVDC 4ZO4A 4TSFD 4NU0A 4ARZB 2YOGA 3AF0A 5DLQC 3I92A 1ZD8A 4IKEA 2E87A 1VHLA 3WP1B 4EJSB 2BBOA 1PVOA 1JI0A 1F6BA 1HE1C 4Q02A 2C8VA 1NSTA 2B21A 4LHYA 5EE0A 3WNBA 2REOA 2JJ2D 5FOSA 3BOSA 3THXA 4BE7B 3BC1A 5FUYA 3AGPA 2CLCX 4IEEA 3T35A 3ASZA 2Z6VA 2OV2A 1OPXA 4MA4A 4W5WA 3X2SA 1GSIA 1NBMD 5SZHB 3B5JA 3NDPA 2XGJA 4M9QA 2ZRFA 3IIKA 1L4UA 4LOAA 3GJ8A 2J9RA 4JLVA 2CCGA 1KI6B 1RYFA 2DPXA 1E2LA 4IDPA 2QSYA 1ZIOA 1E79A 3AP3A 4DT1B 5CB8A 3FMOB 1VIYA 2CHQA 5FUWA 3SEAA 2JLRA 4S35A 1ZP6A 2ZI7A 3GPLA 3TJZA 1T0HB 721PA 4C0AC 4CRWB 2NZJA 4I1UA 4Q21A 4P4SB 3SJBA 4D81A 2RHMA 2VSFA 5F2EA 1NIPA 1SVIA 2A7QA 4DBLC 1OLOA 2H16A 4K46A 1Z0KA 4JSTA 4M9SA 3QEOA 2RH5A 3G0HA 4O2LA 1UBEA 1II8A 2W6IA 3BXZA 4LRWA 4BFVA 4DLXA 4M22A 3AGQA 1ZU4A 3QUSA 5CB6A 4V02A 1KK0A 3SDZA 1SKYE 1IQPA 3KKNA 4DCNA 3VKHA 2ZYVX 2C04A 2GWHA 3UPUA 5IK2D 3C5CA 121PA 2BV3A 2QPOA 3LVRE 1HQYE 2QM8A 2R44A 4QG7A 1CKEA 1P2UA 4GMDA 5TY0A 821PA 2XZOA 4DSUA 1N6IA 3L2OB 2O0HA 4JBYA 2ZAOA 2XTZA 4GNKA 4XOIA 2J7PD 4HUQB 1XWIA 1Z0IA 5LBIA 1FP6A 2V6IA 2IYVA 5GJBA 5FPKA 1E9EA 2ZQ5A 1HEIA 4JKIA 1NIJA 4EFMA 5KNDA 3REGA 1Z08A 1FUKA 1J8MF 2IF0A 1XTQA 1E2DA 1G64A 3AKEA 4GOJA 5JS7A 3R8FA 5JWOA 3Q5EA 1KHTA 4OYHA 2H17A 4DDVA 4ZKDA 4ZI3A 3BK7A 4GZMA 2XXAA 1UFQA 2OE2A 2VP2A 1ZCAA 3LAWA 4HLUA 2FFHA 4XWOA 1TUIA 2FFAA 2ZRNA 1L2TA 2V3CC 1XNJA 2OCBA 4V0LA 3CRMA 2XNDD 3LQRA 1ZRHA 2QU8A 1S4QA 1Z0AA 3RDPA 4NYIR 3UATA 3PQCA 1YZNA 1KDPA 2FZ4A 4O3MA 2V7QA 4UJ3A 1M1YE 4JLNA 2QAGA 3IGFA 4HZIA 4IFBA 2L0XA 5H1YA 1DO2A 1JB1A 3IO3A 4DCSA 1D2EA 1OE0A 2GZHA 4NCKA 2IW3A 3VHXA 2J1LA 4RZUA 1E69A 1ZIPA 2QMEA 2VPPA 5G41A 1SULA 4UXHA 4ACBA 1LV7A 3RS5A 2ZUBA 3SBDA 2QTFA 1NJGA 2PH1A 4TLBA 1J8YF 2RGCA 4A9AA 3PCRB 1JPNA 2IX3A 3W8NA 3GLIB 3T1TA 1Q3HA 3CX7A 3LQQA 4RJLA 5E3HA 2ZTSA 4IDOA 3PEVA 3K53A 2C2HA 3K0AB 2QY9A 1YU9A 5H70A 4BFXA 4MDFA 3GJ3A 1ZM9A 3AKCA 1K5GA 2QMHA 4ZIRB 1ANKA 4PC2A 1DADA 4PHHA 3THYB 1GRNA 4KU4A 3ZJYA 3RLFA 1G3QA 2VP5A 2IYWA 1EFCA 2J5XA 4JMPA 4RZ2A 2WAYA 2QT0A 5EP3A 4NE2A 4WBSA 3WXMA 2EW1A 3X1DA 4GRAA 2IHYA 2OCAA 2OEPA 4MDEA 1A7JA 3E70C 3IUYA 3R9XA 3R20A 4KFSA 1KJZA 2ZE5A 2IC5A 3MJRA 3MWJA 4XTCS 1LNZA 2DWPA 2FH5B 3IHWA 3OAAD 4M1YA 1IONA 4PSKA 5E95A 1H8EA 2WKQA 3ZDQA 3U2QA 5EUQB 2R2AA 3U3MA 1P75A 3DVLA 3ZGXA 2EFHB 1G21E 2ZAMA 4K8OA 5JRZA 1FPMA 2PZGA 1RC8A 5FL7D 1X3SA 1G19A 5DYIA 2O8DB 1XMJA 2YYZA 1CR0A 3AP2A 3IBGA 4JBWA 3TE6A 2W58A 4Q4JA 1HV8A 1NN0A 4FMDB 4F7WA 2JIZA 2ZUCA 1CP2A 4X8MA 1EGAA 1WRBA 1LF0A 3AF2A 4AC9A 2P2LA 2G0TA 2I4IA 2YVUA 3C15C 3SJAA 1WQ1R 1XCPA 3CF2A 1RRGA 1AN0A 4I1SA 1IN5A 2PCJA 2WV9A 3VKGA 1IXRC 2J45A 4AYXA 2O8FA 1EFRD 4IOMA 1VDZA 4KFTA 3GFPA 2PT7A 4RD0A 5TV2A 1S8FA 5B57C 4L5BA 2Z4SA 5FTMA 1E9BA 4TZ0A 4DSOA 1I2DA 2FSGA 5DGXA 4EPVA 4JJKA 2IXFA 1EWQA 4ESHA 1IN6A 1EG7A 1W0KD 3KXKA 3CWQA 1CEEA 4EPYA 1GNPA 4PSAA 3SU8A 5JBQA 4HAWA 2AXPA 2H5EA 2XB2A 4XVQA 4WZBE 3AQ4A 4BGDA 4MYHA 1XTKA 2WIBA 1XJCA 4JL5A 3GLGE 5LB2A 3DOFA 1I4DD 4DLVA 1NI3A 2WZQA 5JS8A 4BFUA 3TSZA 4DIEA 4PAQA 2IUUA 2VYFA 1BYIA 4IOKA 2JEOA 4RD2A 1R5BA 2F3TA 2QENA 5JMTA 4MUBA 3B13B 1Z06A 1NVXQ 4HSEA 5DNYB 4U00A 3IQXA 2EYUA 3AH8A 3FHOA 3LFUA 4PO9A 4W7SA 3NBZC 1OV4A 3IKJA 1FUUA 2F7SA 2I1VB 4A8JA 4JLJA 2WTUA 4LK2A 3NHBA 1LFDB 4TL8A 1WE2A 2OBLA 3S1AB 3ZZTA 2ONKA 3H2YA 3WNDA 1OIXA 5BYKA 4D0NA 1D2MA 2BEJA 4Q9JA 5M04A 4HLUC 2VSXA 2SHKA 3U6BA 2WVJA 3PJRA 3M0EA 5FH9A 3DMNA 1U0JA 1DAMA 2HF9A 2GA8A 4R71A 3SNHA 1NN3A 3TMKA 1KI4A 3Q9LA 1TAGA 3WBKA 1CXZA 1CRQA 3THOA 4BLTA 1KNQA 1VHTA 2CK3A 2R6FA 2AN9A 1NKTA 2YJTD 3QXHA 1X8KA 3R7WA 1BS1A 1T5IA 2QAGC 4Q18A 3CWZA 5CIWA 2ODWA 1IOZA 3O8DA 1OFTA 4M1OA 4QJ5A 5G40A 3MAAC 3CZPA 1S1CA 3AVVA 2ZROA 2BBTA 3U4QA 4ZCLA 1OKKD 5IF9A 2VHUA 1XF9A 1E1RA 2PLFA 3B1VA 2ZVPX 3EWSA 1JNYA 1T3LA 4DUGD 2C9CA 2FV8A 3CONA 3LLUA 1E4VA 3DEFA 1F2UB 4XTRA 4Y0VA 1GRRA 4NMMA 2FNAA 3RS4A 1P2VA 3FTQA 4LBYA 4M21A 2H18A 1DBSA 5CYOA 1NY5A 3AEZA 4NZYA 4AD8A 3CM0A 2R6DA 5IHPA 2BKUA 2EU8A 2OXCA 3TVDA 1F2TB 3NKVA 3BAFA 4OJQA 4DCTA 4URYR 2IYUA 4QM7A 5H8WA 2GXSA 4JT2A 5BXQC 5J4YA 4LJ5A 1XMSA 3GEEA 4EQ6B 1FFHA 3SS8A 3B82A 4W9MC 3QIAA 4LZZA 3H84A 1JQLB 2BEKA 1QRAA 1UAAA 2AFHE 2A5GA 4G5OA 4G1UC 3A4LA 2CJWB 5CDFA 1G6HA 2WWFA 3K9HA 2ORVA 1J70A 4Q4HB 3FMPB 3OIWA 2J46A 5DHFA 1KSHA 1EWRA 2ZI5A 1AZSC 1NG1A 4C0KA 4MQBA 5DI3A 4DJTA 1SXJA 4DIDA 3O8BA 4B35A 1Z0DA 3QKRB 5C18A 3PUWA 3P4YA 2FGKA 2V55B 4DLUA 1TADA 4WXRA 1A1VA 5JSZB 1GL7A 2CL0X 1XEXA 2Q9AA 3EAQA 1TEXA 5J4VA 3A6PC 1S9HA 2J41A 4CZ2A 5D3MB 2I1QA 1W4CA 2HLDA 1UM8A 3RWOA 3KQLA 4LJ7A 3QOFA 1G7RA 4Q4AA 4MRVA 4C0HA 2QMOA 3T34A 1XDBA 2WJVA 4I99A 3I8XA 3SHFA 3H4MA 4B3BA 5EP2A 3V9PA 4ZDJA 1MOZA 4U02A 3T15A 5JJIA 1QHHA 3QVVA 4IW3B 4Q4LA 3H0KA 4Q47A 2BJVA 3K09A 5B58C 3WYGA 1N5IA 2BWJA 2EVWX 2XSZA 3SJZA 2A9KA 4OI1A 4Q1DA 2QEQA 1L7VC 4RFVA 1E2PA 3H1TA 3VKWA 1G7TA 1X6VA 4AY2A 3GLIE 5KTYA 1CTQA 4OL0A 3U6KA 2MSEB 4JBXA 2PEYA 3ICQB 2VF7A 2R6GA 3P4XA 2YWEA 1E0AA 1OIVA 4LJ9A 4CT4B 4JLOA 1Q1QA 1E9CA 4WZAE 4B44A 1VYUA 1YR6A 4POAA 4QL3A 4L9SA 1XRJA 1N0VC 4EUNA 2GZAA 5CM9C 2AL7A 2JLUA 4M8NE 4GFDA 5FL3A 2OCPA 2ZRKA 2AD5A 2GJ8A 2ZRIA 1N6KA 3KJEA 4QNMA 2ZXUA 4OHYA 4N0DA 4QHTA 4V03A 1Z07A 2BMDA 2F43A 4PX9A 3TR5A 1ZC3A 1TF2A 1GUAA 3BORA 4A8JC 1RW4A 2IS2A 1L8QA 1DPFA 1DO0A 3K0FB 5KPDA 1MABB 1W4BA 5DISB 1JBKA 2OFOA 2J0UA 2VHQA 5IT5A 4Q9IA 2E9SA 3CRQA 3FPAA 4Q00A 3QKTA 1W5TA 3RC3A 4BPBA 5FTNA 4G01B 1TQ6A 1U8YA 4KITB 3QY0A 1VECA 1LTQA 1U98A 4LJ8A 1E9AA 4URWR 3T5DA 4A2WA 3CW2A 1G8HA 4TQAA 1O3YA 1U94A 3PUYA 4XIGS 3MFYA 2PCLA 1F60A 5KDDA 3F0TA 4PFSA 1W47A 4FW9A 3WMEA 5AUPB 3A36A 4O25A 4KODA 3AKYA 3UANA 3IEVA 1IY1A 1I4TD 1CJTC 2XOKA 3RS7A 1M74A 3DMDA 2GCNA 4QM6A 1OT3A 2JGNA 2XJ9A 1X8LA 1EX6A 3CF6R 1W46A 1OHHD 3N70A 3ZZUA 4YXWA 3KB2A 4KVGA 3U61B 1RVDA 1Z28A 2QRZA 4N3NA 4Q9KA 1W7AA 1ZNXA 2GHIA 5KPJA 4PSVA 1P60A 2JCSA 2OG2A 5FOUA 2PT5A 2NMVA 3RVBA 4CEIA 2JASA 1FTNA 2W2TA 3BH6A 4M4SA 5B2ZA 4BLQA 2XEXA 1U90A 1PUIA 1GL6A 1TUEA 3THWB 1AJEA 2YKGA 3CNNA 4DVGA 5KU1A 4GOXA 4KYUA 1UBGA 4N1AA 3B7GA 5EP1A 2IWHA 5BN3A 5LD2B 4DDTA 1KI2A 2HXYA 2DYKA 4DLZA 2YINC 2K5UA 2J3EA 3HJNA 5AR1A 1D8TA 5FR2A 4TL6A 2A78A 3FMIA 3B1XA 1Z47A 3B1WA 1NVUQ 3VHLB 1SXJC 4E03A 3EPLA 1KO7A 1R5NA 1PLJA 3PR1A 3EZFA 5GADl 3I5XA 2NOAA 4NCHA 2FFBA 4A0FA 2GJKA 1NL3A 4FWIB 1EXMA 4KHZA 4XVRA 3KTAA 1AGRA 5A0FA 3TRFA 3ZQJA 1XB2A 1NN5A 4OHVA 3P26A 2IYSA 1UKYA 1H8HD 4DC9A 3R8CA 1XTIA 3B1YA 3HU1A 4IFEA 2QORA 2QGZA 3U3KA 3ADDA 2R8RA 3VAAA 1KK3A 4PZLA 5CDFE 1NMYA 3KDSE 4G5RA 1G3RA 4D82A 5EP4A 3UG6A 5EE1A 1YJ5A 4EKDA 2BVNA 3THXB 1NMXA 1XTSA 4OBEA 1OB5A 3PEYA 3NC0C 1RRFA 4DLRA 3EPHA 2W6JD 3VR5A 4XSHA 2GF0A 2CHGA 4PC3A 3K09C 4LWZA 4F38A 4AYWA 2AKYA 2AXNA 3K0CC 3AVUA 2DBYA 1NVVQ 1B0UA 2C03A 2C99A 1S0UA 3PUVA 2ZRMA 4LX0A 2P6NA 4V0KA 4Z1MA 1IJFA 1RJ9A 4M1MA 5E7MA 5LPNA 4D4KA 3Q3JB 4LSGA 2TMKA 5HE9A 3D8BA 2ZS7A 3RC8A 4XSGA 3GJ5A 5BQ5A 2FSFA 1MKYA 4R7ZA 5JRJA 5KSPA 1E2QA 4Q7MB 5L3QA 3HPQA 2ODBA 4IXNA 1N0UA 2GXUA 2C96A 2WJGA 3WHLA 3B1ZA 4MGYR 1VG8A 1UDWA 5A4JA 1IY2A 4M2LA 3U44A 4B3GA 2YC2C 4TYPA 3JZMA 2JJ1A 2W0SA 1G4UR 1JR3E 1U9IA 4NYJR 4B3CA 2ZJ2A 3LDAA 2ZRGA 3JVVA 2UKDA 5GJWC 4QBIA 1II8B 4ITRC 1P9WA 2Q3HA 3QNUA 4D6PA 3Q8XB 1A5TA 4WW0A 1I4LD 4JLMA 1IY0A 4KXFB 2EWVA 2QE7D 2IYZA 5ANRB 2VHCA 4D4MA 1D6JA 2EFGA 4F93B 1EFTA 4D26A 4YMWA 4OHZA 4KLNA 2VF8A 4G0NA 5JI3E 1X1RA 1K6MA 5FBRB 2VHTA 2FFQA 5GVRA 3A1UA 4M9ZA 2J87A 4JS0A 1QBKC 3QXSA 1AM4D 2FF7A 1UKEA 4BWYA 1YR7A 1NVWQ 1W44A 1P5ZB 3A4NA 5CJPA 5TXGA 1XXHA 5A5GA 5KSOA 3OHMA 4B43A 3ZVMA 2O8EA 1P61B 5SZJA 4BECA 1E1QA 3ZD7A 3AVWA 3MUFA 1KOFA 2JIZD 2PBRA 2ZRLA 4JVNA 3CH5A 1JQJC 2WSMA 4NCJA 5JWRA 4L16A 4ESVA 1ZNYA 1SHZA 5EQTA 3QE0A 4OQMA 3GLHA 3F3YA 5BN5A 3LBNA 4C30A 4LYAA 5FOWA 2FN4A 2W0MA 3CPJB 1IJEA 2XXAB 1HYQA 1AZTA 4B2PA 1OSNA 3KKMA 2VHJA 2JDIA 2HJVA 1QHIA 1GNQA 4GBMA 4JLBA 1ZW6A 4Q66C 3GCGA 1UBFA 1T8UA 3MWYW 1DAEA 3QKUA 2GILA 5KDLA 2WAXA 1Q1ZA 3ZIAA 4MGZR 4GP6A 4ZV4A 4LV5B 5AJWA 3VTKA 1R4AA 1GITA 3BS4A 3SYKA 1UBCA 621PA 5SZIA 2QAGB 4TT3A 5FOTA 1QVRA 2RGDA 5HKKD 1S3SA 2P0EA 4TYQA 1MRSA 2GESA 1HUQA 5GJCA 4D25A 2OFXA 3X1ZA 4FMDF 3DPUA 2GEVA 1Y3AA 2RGXA 3B2EA 3D7MA 1JEEA 3GP8A 2LCFA 5JI2E 4TL9A 4RFSA 4TZ6A 3TUZC 4GPTA 2ZJZA 3MJHA 3SN6A 4AI6A 3TGPA 4URUR 4B75A 3R9IA 2IBMA 3CNLA 4DZZA 2QG6A 2OBMA 2BKEA 4JZKA 2X1VA 1W0JA 4UNSA 4OKSA 2C78A 2NPFA 2HYDA 1SVWA 2ZS9A 4QJ4A 4LUCA 2NTYC 3GJXC 3UK6A 1TL7C 1VG1A 3U7HB 4MYCA 4MGIR 2BJWA 2KWIA 4BLRA 1KYIA 3BB4A 3LD9A 4RZ3A 4UQOA 3AV0B 1G17A 2IS1A 1DE0A 3KUCA 3W5IA 421PA 4AIIA 4DSNA 4KFRA 3C8UA 1ZUHA 2IA5A 2O5VA 2J0VA 1E2HA 4V0OA 2A5JA 1YR8A 1Q22A 4B32A 1XCGB 4PC7A 5KDOA 2EFEB 2P5TB 4NHOA 1PV4A 2GAAA 3Q85A 3RS3A 4JYBA 1LY1A 1XX6A 3T1QA 1BKDR 3W34A 3T5GA 3H86A 3B6EA 4P0TA 4A92A 1T8TA 3RAPR 1Q44A 4NONA 2ZRBA 3DM5A 4KSBA 2P6UA 4YONB 1GILA 2GETA 5LD2C 4DDUA 4YC7A 4PQRA 3DZ8A 1MR3F 5L3SA 1A2KC 2Q0HA 3WRYC 1MV5A 3FVQA 4LYFA 1S2MA 4EFNA 1OB2A 1KI8A 2ZU6A 1P2TA 3NBFA 3QPVA 3CR7A 4Q4JB 4KJZA 2ANCA 1J7KA 4L4UA 4TLAA 4WZ6A 5J4KA 4AKGA 1D2NA 1M8PA 2PZEA 4FN5A 3RRZA 4B2LA 1S96A 1YZLA 3HDTA 2D62A 1FMLA 4G5QA 4LV6A 3U7FB 2ZJ8A 1AQUA 3SE0A 4YQFA 2PMKA 1N6PA 1FTSA 4OI4A 2G9NA 3U7EB 1CR2A 3DHWC 1ZYUA 4FWTA 3MWKA 1HURA 3RNLA 4A82A 4ZI2A 2O8FB 1M7GA 4M1TA 5FUVA 2WPDD 3OE7A 1NMZA 1G6OA 3VFDA 1ESNA 3BH7A 4ASUA 2ZE8A 2WWYA 1T6NA 3OIUA 3HYRA 2HDNB 2PZFA 4KO8A 5B30A 4FIDA 3O8CA 3NXSA 1GL9B 4FMCB 1G41A 2HEIA 1O87A 2HYIC 2EFCB 4RSGA 1Q20A 3K70C 1BMFD 3UMFA 1IBRA 1FX0A 2GAOA 2GZDA 1I2MA 2ORIA 4A0RA 1N2CE 4C2TA 2HT1A 2F1IA 1GZSA 3C16C 4IOLA 4LBZA 3SYLA 2XAUA 4TSFA 2OZEA 3T06B 4DSTA 1XJ0A 4XWKA 4F92B 1CS4C 2MMCA 4C7OA 2F9MA 1TU4A 2P65A 4L15A 2HT6A 3AF1A 4MRNA 2P6RA 1M34E 2JJ2A 3QBTA 3KZ1E 2XZPA 2BHRA 2I3BA 3IO5A 1Z83A 2DFTA 3RS0A 4Q1EA 1T4GA 5AUQA 5FPSA 2QUZA 4A8JB 2DFLA 2IYTA 3G82C 5FPYA 1NBMA 1WA5A 2BMFA 1IHUA 2OILA 3AUXA 2WICA 4LJ6A 5C46F 1NLYA 1YZGA 2CBZA 5C1BA 4DB4A 1U81A 1NLFA 3QF4A 4NYIQ 2NO7A 1KMQA 5BYJA 1R10A 3QXCA 1JR3D 3REFA 2XTNA 2FU5C 1JXOA 3JVUA 1SGWA 2X8AA 3OIVA 1IM2A 2KBFA 1Q3TA 4IVPA 2QM7A 2P3SA 1G5RA 4ABYA 1X1SA 221PA 3R7WB 1HH4A 3A8TA 4LBWA 1KIMA 3QXXA 5P21A 3EC1A 2PX3A 4TMXA 4XD7D 4YDSA 4HEJA 1M7HA 3SYNA 2W2XA 3U4QB 2PMDA 3RWMB 2KB0A 4DWJA 2WBLC 1ZAKA 2ANBA 5FBQB 3GLFA 1IAQA 1YZKA 1F5NA 3D31A 3LNCA 3NBXX 4MRSA 4QGAA 2J59A 2D4HA 2YWFA 3TH5A 5KUTA 1UDXA 4DXAA 2EFDB 2ZETA 1ZVQA 4JL8A 4BRWA 5EE5B 4URVR 1TX4B 1QHSA 4CEJA 2ZUDA 2IEZA 5IK2A 2QI9C 4F91B 2RMKA 2ERXA 2FMXA 4PANA 4MITA 1C9KA 5JWHA 1KI7A 5TARA 2FX3A 4DCVA 3WP0A 3CRVA 2ZRJA 2GKSA 4R2IA 4J0QA 2WWXA 3EPKA 2FOLA 4PTLA 3EZ7A 2J7PA 4WOPA 5KSYA 1GKIA 4LJYA 5HCNA 3KQKA 2R6CA 4DRZA 4OI0A 1OH7A 1CRPA 1ZNZA
chains in the Genus database with same CATH superfamily
2MWMA 4PPFA 4QGFA 1R4MB 2EYQA 3KELA 3KDAA 3KU4A 3VGPA 4XDHA 1MO3A 3CLHA 4UUOA 2ZYDA 1PQYA 1XAHA 3K9NA 1HT2E 2FZEA 3BHIA 2NT3A 4AM8A 3MCAA 4A23A 2FLKA 4IDHA 3GWZA 2D8AA 4LRXA 4YAOA 5DI3B 2NUTA 1MPXA 4DCMA 3RAFC 1DDGA 3OOYA 2X0KA 3N6RA 3K6JA 3U60B 1EK1A 3Q0IA 3K9FC 3WYFA 3HXLA 5AVKA 3V4RA 1EB8A 4RH3A 4CLOB 4D8TA 4ACAA 1XEXB 4NQRA 1Q1EA 1N36B 2BR3A 5HF8A 1VQ1A 3HKEB 2C7QA 2VBCA 1M75A 2EZ8A 2FPGA 3GFTA 3H8SA 3HY4A 5CM8B 2AYZA 1KMHA 4OQPA 3LG2A 3WV5A 4L8GA 4JFRA 3OPMA 2AZXA 3UB3A 4HEA6 3U7RA 2OECA 1BH2A 3TSAA 4LZNA 1L1QA 3IQWA 2ZUTA 1P6XA 2G09A 2OHIA 2P2SA 3CF4A 5G2OA 5M2QA 5A5VA 1A2BA 1TNDA 4LMBA 5ICGA 4LRQA 1H3EA 2PZLA 1O5TA 1XLTC 2FXVA 2R751 2OYSA 2PD3A 3CISA 2BMWA 4FUTA 4U7HA 4GICA 4XCVA 3IAM1 5ETJA 2OFWA 3T12A 4TMWA 2NUAB 4UULA 3W9SA 1KERA 2W2LD 5I45A 1L8LA 3EASA 1R5OA 3AILA 5EMMA 2V9ZA 4M89A 2KBEA 3VO2A 8AT1A 6LDHA 2FXIA 1QGUA 2VLIA 5HKAA 4RV5A 5CBKA 1UZNA 3SYMA 1DQNA 2ZI6A 1JTVA 2IUFA 1AKEA 1G38A 2ZIZA 2FDCA 3CEMA 1IM5A 2HA5A 3ZGZA 3BL5A 3FWYA 4MP6A 1C7EA 2C9OA 4EIWA 2A1IA 2PRJA 2XWSA 4JD5A 3KJGA 5F9MA 2CLMB 1W29A 5HSGA 1T4MA 4BV2A 1MDFA 2NTNA 4CFZA 1LI4A 2JBAB 2QYSA 1QGAA 2XWQA 2IP4A 3MJVA 1LI5A 4P3XA 4CMJA 5IG2A 4HWTA 1Y7PA 2HSZA 1EJ0A 4MS4A 1WLSA 1JQKA 3GEMA 5HKLA 1YDEA 1CY2A 2GX6A 4C2UA 4Y9UA 1FP7A 4K9OA 4QC2A 1ZIXA 1DRKA 4MS1B 3GCZA 4ZCSA 4OK6A 1ZR4A 2Q6TA 1WUKS 3ZYCA 1OD6A 4D45A 5IWAB 2J8ZA 4GYJA 1K3FA 3RSCA 3PT9A 3DLTA 1KDVA 3O90A 2AKAB 2J9YB 4EYKA 2BPOA 2D5BA 2WU0A 4GWLA 5ICCA 1S3FA 1WMSA 3D4OA 3Q41A 3ESRA 1ZD3A 4DMRA 3HSSA 3VO9A 1TTPB 1RTTA 3PL5A 2WF9A 2E1RA 1SKUA 2W5UA 4KHPB 2BP7B 1IEWA 5F9FA 4TGLA 4KFUA 3UGQA 2MMGA 3F2VA 1E9DA 1Y7IA 4PLYA 4JVSB 4PYJA 3WLHA 1QGYA 4C4AA 2WJZB 1LJUA 4DUZB 3RKRA 1HLDA 4OUDB 2O2JA 1RWWA 3FPKA 3WB2A 5JZMA 2B99A 5ICMA 2X8LA 4YX9A 2IH4A 3O1JC 3O4FA 1XYYA 3R2JA 1YDHA 2JVKA 2AMJA 3HKCA 5C5DA 2OHVA 2V0NA 5ITZA 3IAHA 4DS3A 1UXJA 1YKSA 4KKXB 2F8SA 1SOVA 3GEGA 4ZZ0A 1E0KA 3AONB 3HU3A 3EYAA 1VPVA 5HJEA 5C8DA 3RVDA 1KWKA 1BYUA 3OCXA 5COAA 3MBOA 3ZHUA 1GCGA 2ZUFA 5HFJA 5AOCA 2ERYA 5KBYA 1COWD 4PG4A 4WESB 1OI7A 2YVLA 2B8TA 4GIBA 2XHEA 3L6UA 1X7ZA 2Q5HA 4IV0A 1HORA 4AJ1A 3KOWA 4AB1A 1N2SA 3S8EA 4MUAA 1BROA 1KRHA 4G37A 3BB3A 4TROA 5AM0A 4QQ8A 1IK6A 3WWDA 3BZUA 4YACA 4YJ2B 4CVNA 3I2IA 4IQGA 2DQ4A 2Q62A 4LJ4A 2JGLA 1M2OB 1TM5E 3A4MA 1QO0A 4URZR 5DE3A 3S6JA 4BLSA 1SURA 4R54A 3T4XA 1SU4A 4DNPA 4PM4A 3MTEA 3OCYA 1K2VN 2R5NA 1JDUA 4NDAA 1TQ2A 3FI0A 3PA8A 4R9VA 5IJ0A 2WM9B 3AVXA 1B3RA 2LWIA 2QT1A 2IF2A 2LZ0A 2YV3A 3H99A 3IURA 4MQ6A 4OPMA 2VK2A 1ZZGA 2Q8NA 4AY6A 3U39A 2HNBA 2HNKA 2WFZA 3AHJA 1F6WA 1ZD2P 3HLYA 5EHZA 2VYVD 4I6EA 2ZPTX 3U9TA 5IC6A 1YBVA 2ZWVA 4ETWA 3THSA 5ALFA 4LOLA 2F9LA 2FFRA 2R00A 3D43A 3R41A 3O9MA 4QUJA 1WP9A 1YIAA 3GUUA 4XOUA 5IYZF 3V8VA 1TI7A 5FPPA 1P2FA 4G0VA 2OQIA 3G0BA 1E79D 2V6FA 3QVXA 5EWLA 1SK9A 4HHEA 1TRHA 3CUSA 3HB5X 4HH4A 1HDRA 4Q1BA 3QUCA 2XA9A 4CM7A 3GZJA 3A14A 5ILOA 4EY3A 4H7KA 5KNCH 2VCHA 4G5YA 1U0LA 3HUEA 3U4GA 1PP4A 2JLVA 3KTAB 1AKQA 3V5NA 5KI6A 3EXFB 5CHEA 5ESDA 5T6BA 1T0JB 1D7AA 2F1RA 2P0AA 1EP9A 1EE9A 2YN0A 3FDJA 5LJLA 1GUDA 4ZYZA 1DIBA 2DULA 1UOPA 1KZHA 2IGTA 1QV7A 2D2FA 2O20A 1G8GA 4YRJA 2DKFA 3GU3A 1YO6A 1CUFA 4D43A 3O3OB 4HB0A 1P44A 1FZTA 3Q7TA 4J4BA 2R6AA 4I6GA 1ZK2A 2TSYB 5THQA 4WAUA 4LWPA 1ONOA 5ALKA 2ZK7A 2ZI3A 4BZPA 4R8KA 4ZOCA 5DHPA 1TMKA 3EFOA 2ZWMA 3RUCA 4YAWA 3NFRA 5FWXB 4RTJA 3AY3A 4DUGA 4F5EA 5BMVF 1UZAA 3VA7A 1VHQA 3BH0A 5D3ZA 1MQAA 2VIIA 1VB3A 2HMWA 1PYOA 3EVNA 1OWOA 2BFOA 1L4GA 5FI0B 3TBFA 2C83A 4L9WA 2I6QA 4L7VA 3L7LA 1IIRA 1D04A 5HYVA 2BKAA 4S04A 1ODSA 4GQBA 2V65A 4Z9FA 2WQZA 1E6CA 4E7OA 4ERNA 3ROFA 3O8QA 1EWTA 1W5FA 2GCGA 3OX2A 1E0SA 1Q1NA 3FE2A 1CZUA 3R3HA 1U2TA 4LDJA 1ND6A 4NBSA 5AK0A 1P9LA 1ZWLA 2JRCA 3DDCA 4R8RA 1QYWA 1US8A 2XYHA 3I6BA 4PW0A 4DDWA 3R0QA 2VA9A 1MJNA 3F96A 4QQFA 5HIMA 4A15A 3CLRD 3FNRA 4AJIA 3AI7A 3H5RA 1UKVY 3NKFA 1SHUX 4MKXA 1QRUA 1L7NA 4CR8A 1TLLA 4CCYB 5ARCA 3U44B 2A3RA 2IHKA 4LI3X 1I1QB 4LJLA 1NULA 3DVQX 4OYYA 4PHFA 3WGUA 4BNXA 5I7RA 2B92A 4DCPA 3LIIA 1QH8B 5JD3A 3AYXB 3AUFA 3DCYA 1Q7BA 4W6ZA 4BKOA 3ZD6A 3I9JA 4IJMA 3QJGA 2VDVE 4ZI7B 2JLZA 2V4ZA 4B46A 1LNSA 3U4MA 5F9HA 4NG4A 1I1NA 3ZDEA 3EGEA 1YGPA 3TAHA 3LT2A 2OXEA 2W00A 4MTLA 2AS0A 2WR8A 3V3TA 4Q9LA 5BORA 3CSUA 1OH6A 3DFFA 3UKJA 4MI9A 4FYMA 1H2AS 2CUZA 4PXAA 1GL3A 2OB2A 4V0RA 1SEPA 3N07A 3GQVA 2JVJA 2OLEA 3E6AA 4FDUA 4YRFA 2X15A 1XN4A 1HGXA 2OCIA 4TRRA 1B0AA 1G1MA 2KPOA 3JQ8B 3MJSA 4UCQA 3IQIX 5FNVF 3VBEA 1KYVA 2FOXA 1I3MA 4PG5A 5A9SB 1IMJA 4IX9A 4F86A 4YCNA 4KUGA 1YUBA 1JKJA 3D7LA 1KVUA 1UEXC 3KPWA 4NJMA 1FTQA 5BW8A 3HL4A 3D3EA 3GVIA 3HJCA 4H3VA 2NNWB 3PPIA 5BQXA 1CETA 2R1TB 1XAGA 4V2IA 4LHXA 1Q0PA 2DT8A 2UYGA 2D06A 1KQOA 3LYAA 1R0XA 2OWEA 2BFCA 2EZ4A 4HQ6A 5KTRA 4XFDA 4LKRA 1FW6A 3GLHB 2XMRA 5IDVA 3BGDA 1RBMA 2XE6A 2F4NA 1OA0A 3IHTA 3K2EA 1ZK0A 3VAZA 3Q7QA 2W83A 4KWTA 4WH0A 4XJXA 2J48A 1GZHB 3HB4X 3K1AA 5AVSA 3H8WA 3N53A 4YRCA 1LDBA 2HGSA 4A5OA 4AO6A 1BQEA 4YT4A 2ZM5A 1TF5A 4OF4A 4KBYA 3ZHBA 3OY7A 2AX3A 5IABA 2JGIA 3E9ZA 3HFRA 4BU1A 3QSGA 3G9QA 4IYRA 2ZANA 4JVLA 4LX8A 3NBKA 4EI8A 1JEQB 2D1QA 2O1WA 1E4EA 2VRBA 2HM7A 4MMZB 2BLLA 3RB8A 1SBIA 3K5HA 3Q10A 1QQAA 1MO4A 4I5FA 2A35A 2PRKA 3BWDD 1YBMA 1MRZA 1DV1A 3LXXA 2FSPA 2QW1A 1ADBA 1DRJA 2C5LA 2NV2B 3EH2A 1I14A 4LQ4A 3WGYA 1TTTA 3B9BA 5IM4F 3PNSA 1HKUA 3PNYA 4JWTA 3DOCA 4RTSA 3K31A 1E96A 3E7PA 1Y4SA 4JLAA 2Y2UA 4CEHA 1JQBA 1P18A 1T9HA 3AM3A 3RUAA 2GXAA 5ALZA 3FTFA 2XITA 4PYMA 3GUZA 4K87A 2W22A 3MA0A 4R9RA 3T1QA 1G8MA 3DV0B 3OLQA 3VX4A 5DTJA 3B9RA 2D7DA 1BWQA 2P75A 5J2TA 3KTOA 2OUIA 4PBTA 1Z3IX 5CYPA 1T36A 4HT3B 3H13A 3SVLA 4P3OA 2H3EA 4TN1A 1PUJA 5KNBA 4V2UA 2F3PA 4GKAA 4NV3A 3QIVA 3U3JA 3U4AA 1G20B 4EYGA 1IUPA 1LEHA 4B1FA 3O94A 1UP7A 2GXQA 3O7WA 1MHTA 3A06A 3LUBA 5ALWA 2JFHA 4MW2A 1N3BA 4RTRA 1MOQA 1ZUNB 3MINA 1RRVA 3TK1A 2EQ5A 3PWZA 2NO0A 4GYWA 4N5NA 2D3WA 4DEVA 2P2YA 2WM8A 4ILKA 2HA2A 4BKRA 5FV4A 4IMIB 3COWA 3UMRA 1AS0A 2X5OA 3BE8A 5AT1A 3PIRA 1CBUA 3IMKA 3OF2A 3W1EA 2GT1A 1JJBA 1LS6A 5LP6F 3EWIA 3RK1A 3V4FA 1OAAA 1XCMA 3SR4A 5CCXA 3HXQA 2VRNA 5FULA 2E7ZA 5KYUA 5AUNB 2X6QA 3AJEA 2Z1NA 3QLUC 3HBJA 5B64A 2W6ZA 3GLGA 1S9DA 1GPKA 3DKVA 4YCAA 1FUIA 2CGEA 4YROA 2QGNA 1I6WA 3T54A 1A7UA 3LBFA 3MWLA 4M9CA 1MA3A 1I3KA 5AI4A 3USES 1KYYA 3GA5A 5C9ZA 5F5NA 1MX1A 3DBLB 3EMDA 4BVLA 5FTLA 1YFKA 3DDOA 4RGBA 1R6DA 1ZNWA 2FW9A 3NVMB 3AVUA 4YRRA 2CDBA 1PX0A 3D8TA 4R98A 4X92A 1JR6A 1ZMTA 1YQTA 3Q4GA 5DXAA 4AMBA 1WB4A 3VYUB 1QHFA 3U3OA 4ZV7A 1J23A 1SVKA 4IIVA 4KZPA 5L3SB 5EJ7A 3NAZA 1RYBA 4Z4FA 3FOWA 4R0NA 3V33A 2NVBA 5MF6A 1ZINA 2I7VA 1IOWA 4WNCA 4CDNA 3RTDA 5K3FA 1XP8A 1IUOA 3R3ZA 4B6EA 2N1BA 1F2VA 1JEJA 4L02A 4RTQA 3FX2A 4M46A 1FVOA 2PH5A 3FPGA 1KSGA 5L7WA 4D6YA 2DQYA 1UOQA 4P4GA 4RGQA 2F17A 3U3RA 5A06A 1W85A 2AH5A 2P9ZA 1XRPA 2RCYA 3G1WA 5AI0A 3S1SA 1F48A 5JFOA 4J7CA 1BQ3A 2FLWA 4HF7A 2HAEA 4EG0A 1KJ8A 3OO1A 1CR1A 4U0KA 2NW6A 1PL8A 4MQ4A 5C8YA 1NW5A 4GGPA 3VC1A 3BCSA 4BGEA 1W36B 2PPVA 1X7GA 5I7HA 3KQMA 1CW2B 2ZU0C 4PO1A 4C7JA 1EFPB 3BERA 4PCLA 2P9CA 3N2GB 4JCOA 1T29A 2PS3A 3HYSA 4JYMA 4RJKA 3PXCX 3PXUA 3UGTA 4FFRA 2EERA 2ORWA 3FN4A 1SD1A 3F9CA 1QGED 2GTIA 4P4SA 3FZQA 3TOVA 3EIHA 4G2NA 2FPIA 2YMLA 4UHHA 4D0GA 2NO6A 3BCHA 3KSUA 1TT7A 3IA7A 3OM9A 3EVDA 3CX8A 1C3OB 4MRAA 2PVSA 1NVAA 3F71A 4KWEA 3LWZA 1UDCA 1L5NA 3HDHA 4JJFA 1DDOA 1P17A 1MAUA 5CIYA 4B5KA 2XYGA 3E9NA 4QQKA 4BX3A 1KJYA 4DYHA 2FPXA 4RELA 4UUMA 4N01A 5FOXA 2Z5FA 2JGDB 1VL2A 2HDOA 5ALUA 2HJWA 1M5RA 2PAAA 1WX1A 4NOJA 4R16A 3K9GA 4JN6B 2XB4A 2DTXA 4ND2A 4Q5IA 4L6AA 2PNJA 2QYOA 5F51A 1DIGA 2QBYA 4GPIB 4I1IA 2BM1A 3RV4A 5E0OA 4CMIA 1Z37A 1PBTA 2C95A 3WLEA 1D8AA 1CZKA 1NBHA 2Y92A 3MGKA 4MQFB 3ZJ4A 4LJAA 5SZKB 4CKBA 3FNFA 4CM1A 2I91A 2DBZA 2ATXA 1OX4A 1N5OX 3ESQA 4KV9A 5REQB 4CL0A 1PGOA 2XWBF 3F6YA 4P7GA 4NICA 4XJVA 5ERGB 3RSLA 5TMEA 2PV7A 4QGBA 4Y9SA 2MINA 2ZJOA 4QDKA 3CVVA 4NDZA 4HUQA 1J0AA 4R1PA 1U9IC 1IWPB 3S2ZA 1NUSA 1UANA 1FSFA 4JLWA 4R68A 4DR7B 1J2JA 1ECLA 4OCZA 4RF3A 4AWAA 1S2GA 1KO8A 3LXUX 4FDMA 4U5XA 4US0R 2WJYA 3SDSA 4RF5A 3RFTA 4DC1A 2IHNA 5AM5A 4RD1A 1C50A 3BQMB 2R9VA 1YU6A 2GJ4A 3E2IA 3RJ5A 3GCXA 1JHRA 4EM6A 1XTRA 2I66A 3ADOA 5CVVA 4ZYUA 4FBMA 4KJXA 4L4XA 2AZ4A 2E5WA 3GDHA 3M83A 4L8WB 1PD1A 4OXQA 1CB0A 2FZCA 3ENVA 1TFRA 3AXSA 3T1HB 4I3HA 3VBCA 1PNQA 4WIAA 2Y8EA 1RI3A 5TGZA 1N7JA 2DCUA 3BYZA 1AA9A 4YRKA 4NP6A 1QLJA 4EWLA 1KMCA 1FJHA 1N8NA 3TQFA 4XWTA 3L6CA 2MHCA 4ENWA 3MWGA 3UWPA 5BW5A 5GVSA 4RZXA 3MTBA 1C14A 1DOAA 2SKDA 3EVBA 3HDYA 2HK8A 3H4VA 4RADA 5AKEA 2AI3A 3OKPA 2UUPA 3CX3A 4WVFA 3T3NA 4TKVB 3UYLA 4LZOA 5CW1A 3GK3A 2W48A 4Q37A 1IN1A 4EJMA 4EYEA 3GC6A 4ZVSA 1MDBA 1TECE 3H7AA 5CT5A 4JI1B 2FR1A 4P84A 4Z4IA 3UAZA 2XI4A 1P7CA 1SRRA 1OTHA 3ZLVA 4DXHA 4X1YA 1BXRB 1OI2A 3MCTA 1VSQA 1EM6A 2O3UA 2RAFA 4C3VA 4X6LA 3WA7A 3R9WA 3BFVA 4GEGA 3I8SA 2IBTA 3HFJA 3ZV5A 2YWGA 3FCOA 3D3KA 4HBZA 5I8WA 3FHCB 1JFVA 1XD8A 3RYHB 1COZA 2XSZD 1NVEA 4DYVA 4I4NA 1S8AA 1PL0A 4LE2A 1F8YA 2VHVA 3GLIA 1E0JA 4WOBA 1FDIA 2QNRA 2EWWA 5JD6A 2OC9A 4N3AA 1JFTA 3P0FA 1P74A 4ZARA 3IVAA 1JJ7A 1J49A 4AZSA 1E32A 4U5QA 3BBPA 1YR3A 4N0MA 4ZJZA 5T8KA 1U7XA 2C00A 1JXAA 4WZAA 3THYA 3TIIA 1TJPB 3BRWD 3QI7A 4C4ZA 3TW4A 5EXEA 2JJYA 2NUTB 3QOWA 4C9BA 5UKDA 1N9GA 3GLHE 4IUYA 4QEZA 1SVMA 4NX2A 5HR5A 2XNKA 1JHZA 4ZEXA 4YMTA 2G72A 4DIFA 1P91A 4S0ZA 4P31A 3DCNA 5BNWA 4RHCA 4K05A 4AY4A 1SCDA 4II3A 4CF7A 2FPGB 1D2RA 2NO1A 3CG4A 1K1EA 1PFGA 3O0DA 1KI3A 4OA8A 1YD7A 4RM3A 5FI5A 1TCAA 3LNTA 4DTCA 3F4KA 4QRHA 1WCV1 1KMHB 1V3VA 2NZVG 2WWWA 2B1QA 3A6JA 3EJWA 4YGYA 1NJSA 3LF2A 3ZBQA 4QSMA 2LDBA 1G42A 1JLMA 4J0HA 4CM5A 4ZMRA 1POWA 2BRUC 1Q7RA 2H9IA 3WX0A 1KQFA 1HRDA 4FYKA 2JFNA 1P6UA 5FYDA 1KY2A 3HMQA 3KKEA 4GMXA 5CPBA 2UYYA 4ZT4A 1ZI8A 4B8ZA 3WGVA 1DAHA 3KETA 2JEZA 1XJQA 3OQMA 4R5MA 2OVBA 2XTMA 3ED1A 1QCZA 3NR2A 4G25A 2K7FA 4FFNA 2O2XA 4FOLA 1Y5MA 4HVLA 4H3KB 4WJLA 1QHXA 3EARA 4JQOA 3W5CA 3TIFA 2DR3A 3RH0A 1QGUB 2RHGB 3IBSA 4ER6A 3HJHA 3DE2X 1IG0A 1QE0A 3OLZA 4P4UA 4XUEA 5C34B 3TQCA 2BONA 4E1BA 2YJ4A 3CBGA 3EXAA 2IYYA 1QQ6A 3KT0A 1WXXA 1G20E 3V00A 3RGGA 4E09A 1ZH4A 3RJ9A 4NVRA 1CS0A 4Q4CA 5IBCA 4GT1A 1LK7A 3R7LA 4N9QA 1IM8A 4ETNA 1TRKA 1QDLB 4PCAA 1HXHA 3EC7A 3I39X 4E2FA 2V5AA 1JALA 2ZIFA 4ZEWA 3I9V1 3SFZA 4UPEA 1J2TA 1FEZA 1RI4A 1ZG3A 3N0WA 4HRYA 1BU5A 3ZE1B 1HT3A 3F4LA 5BRAA 1X77A 4MS4B 1GRVA 1T0IA 1T9DA 3BSSA 3K1JA 4Y30A 1KQGA 2L2QA 1DIOB 1DI0A 5TPZD 2XE8A 1GDDA 1XEWY 2C07A 3KHSA 4M7PA 1VA5A 3ND9A 4KKVA 1EUCA 4HPJB 1GSAA 2ZIEA 2J9FA 3RI3A 5IBQA 3VU9A 3AR6A 5HMLA 2CFRA 4FZ5A 5D1HA 4B6RA 1BC5A 1L4YA 3KFVA 3OQIA 4JHLA 4EHFA 5FLYA 1GYPA 3MOGA 5GM1A 3JPWA 2WYUA 4BQPA 5AVUA 3ZE2B 4ZYYA 4Q1FA 3OEED 2GFQA 1RLJA 3P0RA 2WJJA 4X7BA 3V6LA 2R7AA 1LW7A 4F85A 1E4YA 2B5WA 4TYNA 1U7PA 3L7KA 5BWLA 5IT0A 3GNTA 5DXJA 2J6HA 1DIAA 2NQ2C 3CB4A 4XVHA 4J4TA 4B47A 4L6IA 2EKQA 3S27A 1M8JA 1D9ZA 1SUPA 3KHTA 1SMKA 4S2UA 5FA8A 2XB9A 4TLEA 3VMMA 4F04A 3THWA 4QSHA 3RAEC 3N39C 1J8QA 1Y6ZA 1NQWA 1EK0A 3DD1A 4PLZA 1NYTA 2GAIA 1QIEA 1NW4A 2CXXA 2QXUA 1J9ZA 3HKCB 1UKZA 3NM4A 5IPFA 4HAXA 1CE8A 4BRZA 5ITZB 1E0DA 2CVHA 3GFRA 4X3OA 4AZ0A 3C3MA 1USVA 3S1AA 1ZM7A 3DEKA 5G4KA 2W42A 4LHVA 2BGJA 1XEFA 3FGPA 4HQ0A 3CGWA 4I4CA 1N57A 3JSAA 1GZ5A 1ZVVA 1ECBA 1T2DA 3VYSB 1DNPA 4KQ9A 1DG1G 4PGMA 4F2PA 3UAOA 4CM9A 3PFWO 3NATA 1W93A 3F2IA 2ARKA 4GLLA 3ZVRA 2ACVA 4HLNA 3Q8KA 4GG1A 1WXFA 2VBGA 1TMGE 2V5UA 3NANA 1HL3A 1X7ZB 4A0HA 1Z0JA 5HJ2A 4F3YA 3VQTA 4EMTA 4WX2B 2A6PA 4BFWA 5B6IA 4JLDA 4RWEA 5I9IA 4YRTA 1L5OA 3QH4A 4HGRA 3P97A 2RGEA 3BMQB 4Q9DA 3MN1A 3TAXA 3SFTA 1FZQA 1X1AA 2XXJA 4MPDA 3VVBA 3RU3A 5IJ0B 4R2XA 4QGGA 3D7KA 1HDEA 3TAUA 3VR5D 4PPQA 3QXJA 1NMEA 2EW8A 4KO2S 1Q6YA 4D4GA 1P7YA 3KZVA 5CA0A 1LLCA 3Q8MA 1U2GC 2VLBA 3FKSD 1AXEA 1YFJA 2FB9A 5KYYA 3A1WA 3CXUA 3FG9A 3PC3A 4OK3A 1EE1A 1SG0A 3LOPA 1GA1A 1QZXA 1Z5GA 3M70A 5G0UA 4MUYA 3EVZA 3RTAA 3HL0A 4XWWA 2JHFA 3FI9A 2C7VA 3FNBA 2BFFA 3QMWA 2X8JA 2GPBA 4XGQA 1U2DC 2HA6A 2GN0A 4WNAA 1ADYA 1PR1A 4TXNA 4WDQA 5EWLB 1T5DX 5HEKA 1F2TA 4INZA 2LE0A 1T10A 3Q2KA 2HH9A 4U7JA 1G5PA 4F5DA 1YTLA 2IHBA 4HPWA 1WU8A 5AKGA 1JA1A 5JOQA 1R6BX 5L3VA 1EGQA 3D1VA 5F21A 1OTYA 4ZI7F 2AG5A 4HB4A 2O7VA 2M6LA 4UHBA 1FJXA 2AD1A 3R3JA 2FN8A 1XPJA 1IIBA 5IJZA 4W7IA 2DQSA 3FHTA 4OYRA 2CJWA 1XRMA 2XIJA 3NFYA 4O4IA 4QPZA 3ZWOA 4C08A 3D1LA 4IDNA 3IAXA 5IZCC 2XODA 4FFBA 4Q4HA 3UJCA 2FWRA 3JWEA 2KYRA 2XNJA 3MGBA 3C1OA 2IUSA 2WE8A 4UDOA 3ZXUB 3TL2A 2W2VA 5D3QA 4TLCA 1G2OA 3G0GA 4XD7A 3W2HA 5A02A 1QF6A 3AG6A 3BIFA 3USZA 1O4VA 4AMYA 1JHXA 2G9RA 1RC0A 4ZGGA 2QTGA 3H1AA 4IJKA 4X0EA 2PSFA 5C1OA 3B9QA 4J1NA 3EY4A 4EQZA 2R8PA 3W3AD 1M1XB 3JR7A 2GD1O 3MC1A 4KBFA 3ANTA 2HW8A 3G0DA 4LV8B 2A0UA 3EFOB 4F7DA 4HADA 4HLQB 1KZGB 1P9OA 2J3MA 1JHVA 2Q9CA 1Q0RA 2VP4A 1DKLA 3ET5A 3U4DA 1EVYA 4FNAA 3SZUA 3CIOA 3WWYA 1RT9A 3WYAA 3VU8A 3PDWA 1LD3A 3DYBA 2Q2VA 2R7MA 3UV3A 3NVAA 2IHTA 2QJRA 4DQXA 3EIEA 2OHHA 2A0KA 3OJEA 1Y6QA 2WNHA 2O0JA 2PR7A 4QTUB 1B41A 2RGBA 1T0UA 2ZVJA 1M54A 2NQTA 3O8QB 4TV9A 3UXYA 2DH5A 2J33A 3VZRA 1K7SN 3T9AA 4TVSA 2D74A 1L6RA 1P0PA 1Q11A 3ZH9B 8OHMA 2F1JA 4OXIA 4DHWA 4YUWA 4CDGA 3A1VA 4G0OA 2JBHA 4ZFNA 2OGZA 3QTBA 3WIEA 3K15A 2XIQA 2AJ8A 3HDQA 3OZBA 2BFWA 4GM1A 2QP9X 1ZA2A 3DVRX 2WIDA 2YY5A 1I4OA 2QVXX 2R62A 3HO6A 3TB6A 4BUZA 5IULC 1H2ZA 4WLFA 4DLTA 3MJFA 3EDYA 3OOJA 4NCIA 3VR3A 4RMHA 4X8HA 3DONA 1JRLA 5DNVA 3TRKA 2PEZA 3CF0A 1ETHA 1NVVR 2C82A 5AKHA 4C4PA 3ZYZA 1YS1X 3TBKA 1GKYA 2ODPA 3T94A 3A1DA 5C4MA 1FVFA 2XJ4A 5G1OA 5BUCA 1R88A 3FUTA 3KXDA 4QOIA 1LGYA 1W5BA 1SVOA 4XWAA 3PI7A 1KGDA 2YRWA 2X0FA 3B8HA 3IDQA 4G8CA 3IR6A 4P5DA 3SFVA 4WWHA 2OC4A 3DXZA 3A10A 3SC6A 3PNKA 4TT3D 3K0KA 5GZ3A 1QFSA 3O8RA 2CJFA 4Q4DA 1GRQA 4B3XA 4GPAA 2UZ1A 5H9WA 4ND8A 1HY3A 2GUWA 1MPTA 4D96A 3IAEA 5E7JA 4KXVA 1V8DA 2MDTA 1ISPA 5IN5A 3CT6A 1V3QE 5HPYB 1WUJS 1JKJB 2B8WA 2IP2A 3FDFA 2H4FA 4G0YA 3AR8A 1X1EA 1WSWA 3C24A 3K0FA 3QG1A 1AQ6A 1Y81A 1KIFA 4XYGA 4DE5A 5ARDA 3EZ9A 3HXOA 2I29A 4TQ9A 5ABPA 1YZ3A 2WVAA 2YFQA 4MR7B 1H1DA 3I28A 3TOXA 2BFCB 4W5JA 3T9BA 4QBHA 2H1HA 2MSDB 4BLWA 2OM6A 2Z8XA 1LDYA 1LJ8A 3GLUA 4Y1GA 2HXSA 4G0ZA 4U7WA 4WFJA 2OXTA 4IGAA 3GGSA 3K1AB 1FRZA 4YDHB 3RUHA 2CHVA 2Q0XA 2X5NA 3AW9A 3KQQA 3O83A 1J0DA 4EAQA 4YP0A 1TGVA 3KJIA 4F4UA 4RULA 1E2BA 4AF8A 3B3QA 3LKBA 1XMXA 3ONVA 4TMTA 3L6BA 3MUOA 1A50B 1I13A 1V1RA 3OFNA 4PTZA 1E4EB 3U19A 1AGPA 2OV3A 2C2GA 3NTOA 4MW5A 4OJTA 3VPCA 4BU0A 2GZRA 3NRCA 1UOOA 3KXIA 4NFLA 1AS3A 2VK1A 3NPAA 4CIVA 3HSYA 4BNDA 3ECSA 4KP7A 5HK9A 2W11A 1RM0A 4HDSA 2OKGA 3U49A 3NUQA 4F72A 1SXGA 4GX5A 3GEBA 4RCVA 4YR9A 3DZIA 4IVNA 1B2RA 1FU7A 5JJLA 1QVZA 3NV9A 4KLZA 4UNQA 4ZVRA 4QOSA 1B1AA 3WTBA 2VZ9A 4ARBA 1YS6A 5FOQA 4IEIA 2Q3EA 3QFCA 4CEHB 3ICEA 4TLLB 2GEUA 3B6ZA 1T2FA 4QECA 3JVEA 4CMKA 3SMQA 3H05A 4QJBA 2HY7A 2IUTA 4UNPA 1OLSA 4PPGA 5LCXA 4WNYA 1CDOA 5ALJA 3ZXXA 1C9NA 5FIUA 2X42A 1N32B 2R1VA 2BH2A 4AT1A 3BE5A 2BFBA 4FHCA 1T36B 4LZPA 1I7QB 3ODPA 4S3MA 5AWFC 5BO5A 1O6FA 2I4MA 1JDPA 2GUGA 1VI5A 2QTHA 2CVFA 3D8SA 2W6MA 4NCXA 5AKKA 4F9TA 1A4XA 2AV6A 2I33A 2ZITA 3QVLA 2QVGA 3MINB 4PAMA 3E4DA 1PS8A 4UCFA 1LC0A 1LTKA 1R0ZA 4ZVOA 4LISA 3SZLA 4CV2A 4E22A 3HI4A 1B93A 3AFNA 3IL2A 4KWHA 2G0AA 1VJ1A 1GT6A 3N76A 2I1LA 2IEYA 3D4LA 3I9MA 3EZLA 1DQSA 1YJXA 3JTMA 2KJQA 1R6VA 4I9NA 3ZE7A 4CXMA 1W36D 4RPHA 1GYQA 4IUCS 1JKXA 1HE8B 1YRHA 3RU2A 3QHQA 2QLJA 5FBWB 1MN6A 2FA9A 4OQQA 4CQMA 4CR7A 1L7BA 5KYUB 5LZ9A 2Y0DA 3SJCA 3RYTC 4Q01A 3GLGB 2I5PO 4JI0B 1Q12A 2BELA 2CL6X 2MSCB 3CKMA 2VNKA 4NQZA 4D02A 3E8XA 5DNCA 3H42B 1P9RA 5P8WA 5LQAA 3PD0A 2UXBB 1G21A 4IWYA 2LCQA 1UODA 4DC0A 1TVEA 2VSYA 3TD2A 4IKOA 4DJEC 1YJBA 2ZSDA 3V2IA 1HRKA 4ZO4A 4FYWA 5JNVA 1UAGA 2ORED 2RFLA 1KXJA 4Z7QB 5DNDA 2W8ZA 1T34A 4O5AA 2J3HA 1L8OA 3FY4A 3NHFA 4TWIA 4GQAA 2R00C 1JI0A 1F6BA 1IHXA 1O1YA 2DBRA 1NSTA 2B21A 2VVTA 5IKPA 2EIHA 4N03A 2REOA 2KLHA 3NQ41 3QELA 3ZZMA 2CV0A 3RTEA 9ABPA 3BC1A 3CO0S 3P9IA 1WD7A 5IBPA 2VBFA 3PICA 4B6OA 1XDUA 4DNQA 4DQLA 5HGJA 3G8CA 3ZWWA 5C37A 1Y5IA 5K3FB 1U8EA 3DOHA 5AICA 2YIMA 2AEJA 3EBPA 3DAPA 3AERA 3CSSA 2C3MA 3TG2A 3SPXA 2ZQZA 3RS9A 4NBRA 3BBLA 1KQPA 1W85B 1ORVA 4M9QA 4LE0A 2ZRFA 1I2CA 4LFCB 3ZD9A 5KC9A 1OY1A 2J9RA 5DF1A 3JWJA 1Z8NA 1XR3A 4EHNA 3FGZA 5C8YB 2QSYA 1ZIOA 3FJYA 3KTFA 3FVVA 1GJRA 4OJMX 1TM1E 2VWHA 1YB7A 4LF7B 2R79A 5CB8A 1I5OA 1TFUA 4FLEA 2X0NA 4JU9A 4S35A 4BVAA 3V7YA 4LFBB 3UMMA 1RAAA 3RVPA 4C0AC 4X97A 4QTYA 1JA9A 4P4SB 3SJBA 1KYWA 2FPIB 3G3EA 1BD4A 3SBXA 2VSFA 3V1UA 5F2EA 1SVIA 2DQZA 3RF7A 1D0SA 2P8JA 2XCTB 2QXYA 2H16A 4KIUA 4BN5A 5HWSA 2XECA 3FWHA 2RH5A 3OFSA 2JHGA 4ZC8A 3BXZA 2B4QA 4FOOA 4OLFA 4C7KA 3EVEA 3PFGA 4LRSB 1ZXBA 2C4TA 3AGQA 3R40A 1DHRA 5LYYA 1DWUA 3SDZA 2Q8PA 3KKNA 1WBJB 3LLCA 1U1GA 4FLMA 4QBTA 2Y1EA 1E6EA 2C04A 1ECPA 4JJGA 4JB0A 3BRCA 1Z74A 3RUPA 2LGJA 3WLOA 2C5BA 3M9WA 4U8HA 4CMIB 5BRJA 121PA 4W1RA 3HEBA 3STTA 2BV3A 2IHJA 2QV0A 3LVRE 4M86A 4CKBB 3HFSA 1HQYE 1NVTA 3IOMA 5G02A 3JVIA 1OX4B 4GMDA 3QBDA 1L5YA 1W9MA 4D97A 3BXGA 4DVJA 821PA 4DSUA 2XZOA 2BH9A 4JBYA 3C3KA 1QK4A 2MINB 1W2WB 2FFJA 4HUQB 1X7WA 2QU7A 4UZSA 4GZ3A 4EP1A 2CXNA 4U39A 4OVKA 4BJ6A 1FP6A 5MGBA 1YK0A 4NATA 1AQNA 2IYVA 3PHHA 3M82A 3KQVA 2IYPA 2CZQA 1HEIA 1ZMBA 5KMGA 2GDZA 2C0PA 4LXIA 3REGA 4OUKX 3NBMA 2IF0A 3FYSA 2GA9A 2V6MA 1T1IA 1JSLA 3R8FA 2Q50A 4OL9A 4OYHA 3DLAA 1I9CA 3O2QB 4L78A 3SQDA 4ZI3A 2Z2IA 4GZMA 3CW9A 5F78A 4MIYA 4MAFA 3WZLA 3LAWA 4UOZA 1M2JA 2ZBGA 3HYLA 3ORFA 3IAS6 3WYDA 4M0FA 4WSOA 4JJ6A 2ZRNA 3BL8A 4IIYA 1PI3A 5JC8A 5K3SA 1IZ8A 4NESA 5AVQA 4BP1A 1KY4A 3LUJA 1PR3A 2WAOA 3TOSA 4DJAA 2XT6A 3BT7A 1XQ6A 2NO4A 3ZW7A 3RDPA 1I3LA 5D84A 3DZFA 2IZZA 4NYIR 5J5VA 3VU0A 4C2BA 2NP7A 3TTYA 1MFPA 1KDPA 1S2DA 4F3NA 4R9SA 1E6MA 4EGJA 2W6PA 2QAGA 3IGFA 4HZIA 1W30A 5CFPA 1EXVA 3KD3A 2ZQYA 3QM1A 2IXDA 3HP4A 1DO2A 1JB1A 2R1ZA 4IHAA 4RETA 1GTJ1 2O6HA 3D6NB 2GZHA 2PM8A 2IW3A 2VSNA 3C3XA 1S4MA 4NCKA 4U1RA 2XNHA 3ZEAA 5KC8A 4X1YB 2H2GA 1ULUA 2VPPA 3N2YA 1LW6E 5DGHA 2ZUBA