1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
b'GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein fimD
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
1ZDVA 3BWUD 3RFZB 1ZDXA 4B0MA 4J3OD 1ZE3D 4B0EA
chains in the Genus database with same CATH superfamily
1VZ6A 3ZNID 1WH3A 2IZVB 3RZWC 1WM2A 2DZMA 2D2QA 4FBJB 1KFYB 3W1SC 1L0XB 4LNFA 2D07B 2RR9A 4DDID 4K3CA 4OVZA 3AB5A 2LVQA 2ZCBA 2FCQA 4XWWA 4DXGA 3SR6A 2WHIA 4OZBA 2WXPA 1MPEA 3L16A 3RCZA 1MG4A 4N6EB 3DVGY 3Q3JA 4KKIA 4YSYB 3ABVB 1V5TA 2O2VA 3EHVA 2GRIA 2D11A 2FUHB 2I1JA 3AM9A 4MGYE 1WSPA 2CU3A 2ICIA 2ZCCA 1RFAA 4WAAA 2IGHA 1MHXA 2QC8A 4PYUA 4HPLB 2LGXA 3ZGZA 1L2NA 3KW5B 4RM8A 1C1YB 3GE8C 1E8YA 2M8SA 3A33B 2ZNVC 4ANXA 4USAA 1JRPA 4YTPB 2PIAA 2DYBA 2KAJA 2JXTA 5E6PA 2REXA 5DPRA 1FXAA 1EF1A 1RRBA 3Q8AA 3A9JA 2KT7A 1ZE3D 3BK1A 3R66C 3T8MA 2Z59B 3A4SC 4NNJB 3S2AA 5EE3A 3DBHB 1CJEA 4EFOA 4KKJA 3Q6BA 4M8NA 3MC0B 3BYYB 3W9CB 1T0RC 2NMQA 2UYZB 4C80A 4JLCA 2JYEA 3NG0A 1DOXA 4LLGM 4B0MA 1UELA 4A90A 2R2OA 3APDA 1SSNA 1EUVB 2LWPA 2LEKA 1HZ6A 4HK2A 2JRIB 3X0WA 1I7HA 3TBLD 4ICUA 2JRHA 4TSSA 1IGDA 2X38A 4RH6A 4IWPA 2JQRB 1E7UA 3VHTC 4MT5A 3N1YC 4KIKB 2QIEB 2IO0B 1XLNA 4A20A 2A5UA 2L00B 3I3TB 2C60A 4P7IA 2LMCA 3NVVA 1H8CA 1C77A 2IYDB 1WXVA 2WXQA 3VDZA 3V05A 5BYRA 3Q8CA 3NS8A 4WH4A 1I4RA 3DBSA 2W3RA 2ZPYA 3ZIMA 3DHGC 4YWGG 2G4SA 3VUYA 1MFWA 4J6IA 4GMVA 4BOSC 2G9HD 1N6ZA 3W1YA 3ZTCA 1UBQA 2WXRA 4LJOB 2KJHB 1WFYA 3V61A 1FFVA 4A3PA 1AN8A 2KK8A 2BS3B 4MSMB 2KXJA 4JIOU 2INNE 2JZPA 4JL9A 3BVZA 1PGBA 3PZ7A 4ZOHC 3T9LA 4DQOC 5FR6A 3NVYA 1Q1OA 3GS2A 1KLVA 2V4LA 4HCPB 3N9YC 1A5RA 2WDRB 1I4QA 1V81A 4D2KA 1XO3A 2KMCA 1KRHA 4QAYA 4HEA1 4JGHB 2KACA 2IO2B 3IVFA 1NYQA 1WXMA 1HZ5A 4ZYSA 4US9A 5BYQA 4AUQC 3PRZA 5HG2A 2L1AA 1JRUA 2ACZB 3TJPA 2INCC 2UU7A 1VLBA 4G3XB 4W9GA 2BYEA 3GZNI 4ARIA 1FNWA 2K22A 1FMAD 2BW2A 3R2TA 3ZYYX 3PSEB 3DBHI 2NCNA 5C3JB 2BYFA 3KUZA 3SU8X 3PHXB 3TCAA 2LZ6A 4IOIE 4NQLB 1T3QA 4K81A 2ONQA 3FAHA 3BZDB 2GBKA 1SB3C 1MG8A 2BBCA 1E7VA 2LUEA 2N9KA 4HLEA 1WRDB 4KDIC 2MBBB 4MGKE 3URYA 2E3TA 4M8MA 3A9KA 1ZXIA 4AWJA 2ZNVB 4PS3A 4BBNF 2W3SA 3QJZA 4XE0A 1ZPSA 1V97A 2XNAC 4W9EA 4XGAB 2IDYA 2X8XX 3AE5B 3DBRI 1E8WA 3VH3B 3WCQA 3FKYA 1WWTA 2MW5A 4DHZB 2MP2B 1FEHA 3AU5A 4HPMB 3AE9B 1E8XA 1JQ4A 2OEDA 5HHDG 2LRWA 5JHAA 4BKSD 4HROA 3PRMB 2G3QB 2K0PA 1R7SA 3CIRB 1C76A 1KJTA 1N5WA 3IT6B 3RNFC 1YQ4B 1V9JA 4YXDB 4HVBA 2VRRB 5G55A 2H89B 1WMHA 4FADA 2V3NA 4JWUC 2KN5A 4XDCA 1FD6A 5BO4B 2KZRA 3QCAA 1QKZA 1L0VB 1GNUA 3PGEA 3EECA 1TJEA 1XXGA 4WURA 1YX6B 1WJNA 4EKUA 2V3SA 1WF9A 2CS4A 4X57B 3DVGX 3U52E 3VUWA 3P4PB 3P42A 4S17A 4RF0A 1K51A 1H4RA 2WLBA 2WXKA 3C8YA 1Y8RC 2PEAA 2WXJA 1Q5WB 4CO7A 2LGSA 1N61A 2R61A 3BVGA 1L5PA 1B9RA 1ET6A 1FCCC 1JWSD 4WWOA 3ZNGC 3P4QB 1YNTE 2KWDA 1D6EC 3QC8B 2K8CA 2OHFA 1TYGB 4PS8A 1QOFA 1P9DU 3I57A 2QEJC 3GOEA 2LVOA 4B95A 2K39A 1N62A 4MDKE 4GGQA 3ZJVA 2KX3A 4L1BA 3IT4B 3AMZA 5CHFA 2L76A 2RSUA 4DHZE 2WDTB 2PVOD 3N20C 2N1VA 3QHTA 2O2VB 1WZ3A 3A1QB 4C4VA 2M0AA 2KDMA 1E0ZA 2W82A 2NTTA 2K1FA 2LUMA 2V9HA 3HM6X 4IWOA 3RYTA 4KGRA 2WXLA 3ZW3A 2W55A 1KLUD 1TY2A 5H92C 1TS4A 2K8HA 1NI2A 4FHKA 4IDIA 1WXQA 3Q3FA 4RNAA 1Z2MA 3U4EG 4BKGA 4IUMB 1D5MC 4GDKA 3NOBA 1SGHA 1T0YA 4MH0E 3AEFB 3TEYA 4IWQA 1UWXA 2FIDA 1WXAA 2NPTB 3WIMA 3WA0A 1LQBA 4C7YA 1TKEA 2GBNA 4AS1A 3GP7A 1NYRA 5DPTA 4IKGA 3A9JB 1P98A 1WI0A 3NJTA 1WIAA 4MGIE 5E6JA 5L95C 1TKYA 4O1NA 2KQ4X 2N9PC 3E9SA 2JPHA 4W9FA 1DYQA 2BWFA 1PUTA 1OQQA 2L7RA 2ZZPB 3R2IA 2KWCA 3Q69A 5CTRC 1FIQA 4GN1A 3VFKA 4DXAB 1TKGA 1V5OA 4FJVB 1JW9D 1EU3A 4CQNA 1D3ZA 1V1OA 2KO3A 5AZHA 3UIPB 5AZGA 1IPGA 3PHWB 1IYFA 2ZVNA 4ASWC 5GMVA 2GLSA 2HE7A 4YT0B 3Q2AC 3DBLI 4K7WA 3ZDMC 4YSZB 1VCBA 2DHZA 2FAZA 5H8YE 2PTLA 3O65B 3ZNHB 3L10B 2Z0EB 2LJ5A 2HJ1A 2BQQA 4K7UA 3RZFA 2L05A 3RNAC 3JSVA 2EMTA 2B76B 2M17A 2N9XA 3PTFC 1XT9B 3RT3B 4GLSC 2HTHA 5KHQA 2JZ3B 4RCOA 2DX5B 2KVZA 4NZLB 1C4AA 3V3XA 5BMIA 3T3NA 1HEZE 4OW0A 2PJHA 2MBOA 2BWES 1YMHE 3ZRFA 2INDC 1FO4A 1YD8U 1KLGD 2N7JA 1I42A 5HI1A 4WWPA 4E71A 3TEWA 4H2AA 1WR6E 2KYWA 3R7RA 3BY4B 3P2BA 4GDLB 1CMXB 1XCQL 3KWVA 1HXYD 5D94A 3LJ3A 2KJ6A 2RDGA 4DHJD 2J0JA 1ZDVA 5E6OA 1P7FA 4XYCA 2DYMA 1KH0A 3QK0A 2ZEQA 3ML8A 2QHOA 4RM9A 1GUAB 2FCNA 1XCTL 3MJWA 2MCNB 4TKNA 4ZRIA 4KX6B 2ASQA 1SIFA 2DENB 4HWIB 3P1MA 3DWGC 4ZDVA 4RFBA 3SD5A 4KSKC 3PT2B 2N7EA 2I38A 2KTRA 3B2FA 2DAFA 2DWQA 3NHEB 3ML9A 5BYSA 5JHBA 1OQRA 2SAKA 3ZXVA 4A9AA 2M0XA 5DPWA 4HKZE 4ZRJA 1UNSA 1E10A 4FXCA 2LGIA 3DVNV 1OQYA 1GAQB 2BVCA 4XZ4A 3O13A 3GZNB 2L0FA 3BINA 2KX0A 3A9KB 1FFUA 5BMGA 1JALA 1T0SC 3DHIC 4UDUC 1GJZA 2PLPA 2KQ7A 5IN7A 4NAWA 1GB4A 2J42A 4IG7B 2BB6A 4RGMA 4F8CB 1ZGUB 3KVFB 5AUKA 1T6BX 3VTWA 1HE8A 1OGWA 1UH6A 1YOVB 5DPSA 3RMKC 1YJ1A 3AE8B 1YN4A 3QWZB 1VZ7A 3AEDB 3P4SB 3AULA 1XLQA 3JYUA 4EZLA 3N30A 3OWEB 4IC7B 4LTUA 2M56B 4MACA 1K52A 3RNBC 1VZ8A 1KM7A 1K8RB 2LGDA 2KHWB 4WQMA 1WMHB 2MLBA 3EFCA 1C79A 1K50A 3DBRB 3Q8FA 1VD2A 1ZXHA 4MJSA 1IGCA 4EUTA 5CX3A 2IY0B 2LVPA 4NJ6A 2NBVB 4WQOB 3P4RB 2M19A 1DGJA 2WX1A 3NS1A 5EDSA 1SEBD 2JXXA 3OJ3A 4WAFA 3KUCB 1V2YA 2HJ8A 2EKIA 2MJDA 3Q3NC 1OEYJ 2BPSA 1E5WA 2WYQA 4HDOA 3ZRCA 3H9DA 2GBRA 2KWUB 5JH5C 3SFEB 4NPNA 1X1MA 4BKTA 4EZJA 3L0WB 3N1XC 1L6VA 4XX5A 1QT9A 1SBBB 4AQ7A 1FCLA 2KMAA 2MQJA 3DOWA 5J17A 3PRPB 1RFKA 4JQWC 4M0WA 4OZAA 2INPE 1PYWD 2J7QB 1S1QB 3OAWA 1WGDA 3KQ4A 1IUEA 4C4VB 1CK1A 4RGOS 2KFJA 4YTNB 4P16A 2W9NA 1WR1A 3AECB 3ONSA 4RMAA 1JCKB 2V1YA 1TTNA 4FJYA 3EC8A 1LGRA 2JVCA 1UBIA 3ZLZA 1YN3A 1VJKA 4GDKB 2AWTA 1WZ0A 4KVGB 2CHXA 3FC4A 5MPOA 1SJED 4NAMA 1E6EB 3HM3A 1YIWA 2RPVA 3MJ5A 5IP4D 2BTEA 3UQBA 3WAPA 3NZ3A 3WAMA 2OOBB 3CSTA 1EU4A 2ON8A 2KLCA 2JWZA 1OFFA 3FILA 1WXSA 5EE0A 4WIPA 2RMMA 4AJWA 2J4XA 3WALA 2MBEA 2BYTA 1C3TA 5KHOA 4DBGA 4G0NB 4OZCA 1I4XA 2WXGA 2LHDA 2KTFA 3MHZA 2CHWA 2FIFA 3TEXA 2DZIA 3VTUA 2FNJB 2JUOA 5IAAC 3HIZA 2J0KA 3X23A 3APFA 3L08A 2Y5CA 1PGXA 1M4VA 2YVCA 2MEKA 2L32A 5JZEB 4N9F4 1WJUA 3B1LX 4BVUC 3GB1A 4HJGE 1F9JA 2KLGA 2WX0A 2LXAA 4FHJA 4ZRQA 2MWSB 3VRAB 1TT5B 3TUOA 1XD3B 4B6WA 1ZW7A 1ROEA 2AEHA 2PMVA 5IOIA 3VTVA 5C1ZA 2IGGA 1XF5L 1YJJA 5CHVC 4WJOA 1FRRA 2C9WB 3JSVB 1UGJA 4JPSA 1I35A 2AX5A 3AE2B 4KZ0A 3Q3MC 3DVNU 4MM3B 1XEEA 1FM0D 3TEZA 1NI3A 2CU1A 3PLUA 3V62A 3C0RB 3U7ZA 2J52A 1AYFA 3H7SA 2KKCA 3W5VB 2KC1A 1VDVA 2ZW1A 2V3PA 2UWQA 2PE6B 2CKHB 3UF8A 2MJEA 2BT6A 1JWUD 3DBLB 1XLOA 2WXFA 2NS5A 1RM6C 4MEMA 1SE4A 2WU2B 2GBMA 3SEBA 4AP4C 2BGFA 4Q2JA 3IHPC 3QQ8B 1JWMD 1K53A 4BZAA 3C19A 1DOIA 4FULA 3VR9B 2CJNA 3W5UB 2MH7A 3AE1B 4XDDA 3QIJA 3RI7C 3RUIB 4KGSA 5HFYA 2LRUA 3CSFA 2ZVOA 3VRBB 5CHWA 2KANA 2OJRA 3LXFA 3VUXA 3RNEC 5J18A 4K7SA 2D3CA 3B2GA 2WQYB 3M63B 3L4PA 2JY6A 1EWYC 3CWIA 4AOFA 2NBUA 4F7ZA 2YEPB 1RLFA 1ESFA 2RDBC 3EA6A 3V6CB 3TL5A 2D3GA 1JWBD 3A4RA 3ALBA 4TMAB 2CR5A 2B3AA 1UUPA 3K9OB 1WGYA 2QCZA 2O6VA 2KTRB 3RNGC 1R4MI 2V4IB 2KD0A 1IBXA 5EE9A 2RD0A 1JMLA 3HHMA 4URKA 3ENEA 3AU4A 1QOAA 2ZPNA 2KMMA 2K6DB 4ANUA 2NBWB 4REZA 2HTME 1D5ZC 4W9IA 2LGYA 3N1ZC 3BIID 3HK0A 1WGKA 1G6JA 1XQQA 3Q8BA 1T5XD 3BYTB 5FKAC 4LNNA 5DCNA 4NAWB 4HXDA 2K5PA 3U8ZA 3DWMA 2L8JA 1EF5A 1L7YA 1V80A 1HTQA 1PQSA 4EEWA 1GB1A 2GBJA 3B9JA 4HDQA 2XBBC 2KWVB 3NVWA 1WJ4A 3IAM1 4WJNA 1FRDA 1V8CA 4B9KA 2JZZA 4M01A 3T3OA 3OJ4B 2AL3A 2WXHA 1UWMA 4ZRKA 4S0RA 2GB1A 1HQRD 4GXBA 4N58A 2BF8B 2KNBA 3MC8A 3ZUNA 4M00A 1KOTA 2BKFA 1F2RI 1S3SG 2G45B 4KV2A 3VR8B 3TSSA 1QOGA 2BYVE 2AQ3B 2XK5A 1L4DB 3VQIA 1MHHE 1D5XC 5D3IB 3ETRA 3ZJUA 4IM3A 1J7AA 4XC2A 3I63C 1N60A 3EGRA 5BMHA 1QF6A 1OTRB 1A70A 3E56A 1NENB 1AW7A 1E8ZA 3GE3C 1V49A 1WE7A 4LNIA 3PS6A 3H6NA 4MH8A 1Q0WB 3NZSA 2WS3B 3H1UA 2MJ3A 1UZXB 3IFWB 4ZRPA 1C4CA 4P1CC 3L13A 2AQ2B 2LXCA 2MSED 1N5XA 2LASA 5D7GA 4WJPA 2CHZA 1Z5SB 2JF5A 2R2QA 2GI9A 4A55A 5AZFA 2N9EB 1ZKHA 3TIXA 3BK2A 4DHJB 1J7BA 3SDLC 2V0GA 2DZKA 1FPYA 2KFKA 3HVDA 4DK5A 5G5GA 4TV3A 4MELA 1P3QU 5LXIB 2C7MB 3RFZB 2NTSA 3R3MA 3ZVVA 2KDEB 2HDEA 2KQSA 5LXHA 3N32A 4TQ0A 4JE3B 1E7PB 4LK0M 1I4HA 4W9JA 4OVUA 1FNUA 4GB9A 3BVMA 5L83A 2L3ZA 2WDQB 3NVZA 3WANA 2MRPA 5J2RA 4US8A 2LFIA 4JWSC 1EO6A 5D3DA 1SIJA 3FILB 3A1QA 2AQ1B 1WGHA 4OVVA 3B08A 3IBEA 1N63A 3W2DA 1SJHD 2KDFB 2XEWA 1BMLC 1QOBA 2FBWB 4TUUA 3ZQ4A 1ACCA 3R8BA 1PFDA 1NVID 2K6QA 1WYGA 1J8CA 1F52A 4II3B 5HKHA 2NVUI 2QMTA 2IY1B 1MJDA 1SF0A 2G1EA 3EFUA 3U30A 3UI3A 4L2YA 2EMSA 2NPTA 1WRIA 4E3CA 3VH4B 3P63A 3RULA 3OLMD 2DNFA 1LO5D 2FCSA 3MP9A 3ZKJC 2QSDA 1MI0A 1ET9A 1BT0A 2QDFA 3L54A 2W54A 1SE9A 1ZP0B 4I6LB 5LLIA 2AL6A 5D6JB 4DDGD 1VRAB 4RGNA 1TY0A 2FCMA 3I9V1 2PPHA 1BUIC 4A8XC 1F2RC 4LNKA 2D5GA 2GOWA 4IW0A 2KOXA 1SXTA 3HUIA 2C7NB 3ZJTA 2JYTA 1Q10A 3ZNZB 2GMIC 3AH7A 4ITKA 5C23A 2L83A 4ZHPA 2N9LA 4FA6A 1KF6B 3PREA 1UD7A 4W9KA 3RN9C 2BS2B 1MVKA 3QARA 1TZOA 1SE3A 1UF0A 2Y3AA 3ZXRA 1ZOYB 3LB8C 3N3KB 1FXIA 2QILA 3KYCD 3UQAA 2WP9B 3CF6E 4B0EA 4ARCA 1BXTA 2VH1A 2J0MA 3LYYA 1LFDA 4HJKA 3B0AA 3L17A 1V1PA 4LDTB 1CQVA 4EOYA 2N0SB 5T8IA 1WYWB 3HRDD 2LI5A 4XWTA 3H7PA 4LDTD 2KVRA 2BB5A 2L0TA 2BKRB 3JVZX 4R3DA 3PVLA 2K25A 4DXFA 4F1SA 3NRZA 5G5HA 4PK1A 1J7CA 2Y5PA 1WM3A 2O6VB 1NEKB 1T0QC 5TR5A 2JU6X 2KN4A 4BOZB 1P7EA 2KJRA 4GDLA 1IBXB 1AWDA 1YJIA 2O6VD 3U7DA 1HTOA 1WX9A 4DWFA 1WGGA 4BBNC 2YEPF 2MBHA 2EKEC 2H88B 1C78A 3ECIA 1HA5A 3KH0A 1TZ1A 4K3BA 2D10A 4YTMB 1R4NB 3M62B 2Z8LA 3M3JA 2WU5B 1F77A 2WNMA 1U4AA 1R4MB 3UINB 5FK9C 2QJLA 2RPQA 4HKQA 2DYOA 1YN5A 1V86A 2PKOA 4RF1A 1L0YB 1EM7A 1NDDA 1QLBB 4II2B 4GOCA 3AEGB 5FR3A 2FUG1 2ZJDA 2DZJA 3RPFC 2Q5WD 4W9LA 2TSSA 4WWMA 4MGZE 3U2SC 3MHSD 2LJIA 1QQRA 4KSLC 1YQBA 4ICVA 3R7QA 3BWUD 2MBQA 5IO9A 1JWAD 1RWSA 3KYDD 4CYEA 1XLPA 3SHQA 1LM8B 2L52A 1WX7A 4G11A 2JT4B 3DCGA 1QZEA 2XK5B 2RDHA 2IO3B 2WXMA 1YQ3B 4AJYB 3AV8A 3MC9A 4P6VF 4WJQA 4N59A 4M02A 1GG3A 2Z0DB 3DQVA 4C7ZA 4FLHA 3Q8EA 2WDVB 3LDZE 3PZ8A 5E6NA 3CMMB 4P1BC 1ZDXA 1J19A 2PE9A 4NY0A 3APCA 4CHKA 2G4DB 4NQKE 4KIKA 2WXIA 3TMPB 2PW9A 1ISNA 4PT5A 5GXGB 3V60A 2MX2A 3IG3A 2XN9C 1YX5B 4FJZA 1GOZA 3DHHC 3WAOA 3NZUA 1F0ZA 1ZUD2 2I1KA 3KLSX 1TBEA 4LCDE 1IP9A 2PVGC 4ANVA 2OJWA 2KFKB 3Q3OC 1WJ6A 2MHJA 2D3AA 1V6EA 5C2TB 3K9PB 1TGZB 4YL8A 3AE4B 4C00A 4G50A 3IAS1 1JROA 1D4BA 2HD5B 3AE7B 5I4DA 2IO1B 3ZTDA 2C5LC 3M95A 1TS2A 3PPAA 2AYOB 1R4NI 3RNCC 1M94A 2WXNA 3H8HA 4GSWA 2KDBA 3AEAB 1WE6A 4MSQB 2DAJA 4HPPA 1AARA 4FN2A 3PZDA 3KWLA 1GC7A 1FNVA 2WXOA 3AEBB 5D2MB 1UGMA 2M1MA 3VVWB 2N1WA 4KGTA 5AEKB 2KC2A 5TSSA 3D32A 4RGTA 1GC6A 4W9DA 4BAXA 3DPDA 4KDLB 3UIOB 5G2NA 4PS7A 1Y56A 2RGFA 3W1SA 1WGRA 1ENFA 4ANWA 1P0RA 2MA9B 3KUDB 5AUIA 4HRSA 4YSXB 4LNOA 3QX1A 1E90A 2JWUA 1P1AA 4NJ7A 1L6UA 3Q14C 3UGBB 3VAWA 2VH2A 4NJCA 4L23A 4GU2A 4PYZA 1NBFC 2K8BA 1F1HA 4EZKA 1TS3A 1TS5A 2WGSA 3J9CA 1OEYA 2IGDA 1VR9A 1I4GA 4GIVA 2C7HA 2J53A 2CJOA 3QA8A 4E74A 3NUHB 3AE6B 3V6EB 1KTKA 4WWNA 1C4PA 2N4FA 2NR2A 3ZO5B 3AEEB 3ZDTA 4C56C 3SFDB 2WWZA 5JXVA 1WY8A 4W9CA 4IM2A 1E9MA 2K9XA 2EELA 3RD2A 3AN1A 2DLBA 3AE3B 1TIFA 4I6NB 4BFRA 3MTNB 2M4NA 1RYJA 4J3OD 1STEA 3AXCA 4MJSB 2N7DA 1WX8A 3HVZA 3QAQA 4ZHOA 2MP2A 4ZYNA 2FE8A 2IBIB 4BKSA 2A4ZA 2ZW0A 3AI5A 4TQ1A 1B1ZA 1RAXA 2BS4B 1J0GA 5EE1A 1L4ZB 3EUB2 4K1RB 2D3BA 4IM0A 1PDXA 1LXDA 1QILA 1FXTB 2I2YA 1I4PA 1EWCA 1CZPA 4KZCA 5IA7A 1DOYA 1PGAA 2Y5BB 1C9FA 3OG5A 2E6XA 2LD9A 4A3OA 4MM3A 4W9HA 4EE2A 4HCNB 2VZKB 4LJPB 3NY5A 2DBYA 1V1PB 3JW0X 2YLMA 3PO0A 3DDCB 2LHEA 2JSVX 4A6QA 2SEBD 3PLVA 5IKCM 2VZKD 1GPXA 2K3UA 5LNK1 4ACFA 3H7PB 4JX1C 2KDIA 3MFGA 4M0WB 4I6PA 3I5JC 2IJ0A 2JX5A 1SE2A 3IXSA 2IPKD 4OHJA 3VXWA 3PV1A
chains in the Genus database with same CATH topology
4IDIA 1VZ6A 2L32A 1WXQA 2BS2B 1MVKA 4RNAA 1TZOA 3GB1A 3U4EG 4HJGE 1D5MC 1SE3A 2Y3AA 1KFYB 1ZOYB 3LB8C 4ZRQA 1FXIA 3AEFB 1L0XB 2QILA 3TEYA 1UWXA 3VRAB 3TUOA 4OVZA 3AB5A 1TKEA 4C7YA 1ROEA 4AS1A 3GP7A 1NYRA 4IKGA 2WP9B 4XWWA 2PMVA 4DXGA 3SR6A 4OZBA 4B0EA 2IGGA 2WXPA 1MPEA 1XF5L 4ARCA 1BXTA 1YJJA 4N6EB 1FRRA 3LYYA 5E6JA 1UGJA 4JPSA 2AX5A 3AE2B 1V1PA 4KKIA 4YSYB 1CQVA 1TKYA 4O1NA 2KQ4X 3ABVB 3E9SA 1XEEA 4MM3B 1FM0D 2GRIA 2N0SB 3TEZA 1DYQA 1NI3A 5T8IA 3HRDD 3AM9A 3U7ZA 4XWTA 1PUTA 1OQQA 1WSPA 2CU3A 2J52A 1AYFA 2ICIA 3R2IA 2IGHA 3Q69A 1FIQA 3W5VB 2BB5A 1MHXA 1TKGA 4R3DA 1VDVA 2ZW1A 2V3PA 1JW9D 1EU3A 3ZGZA 4DXFA 2MJEA 2BT6A 1JWUD 3NRZA 4CQNA 5G5HA 1V1OA 1J7CA 1XLOA 2WXFA 4USAA 1JRPA 1RM6C 4YTPB 1SE4A 2PIAA 2WU2B 2Y5PA 3SEBA 1NEKB 2KAJA 2JXTA 2JU6X 4Q2JA 4YT0B 2KN4A 1P7EA 1IBXB 1FXAA 1JWMD 1AWDA 1K53A 4YSZB 1DOIA 1YJIA 3Q8AA 3VR9B 2CJNA 3W5UB 2MH7A 5H8YE 2PTLA 3AE1B 4XDDA 1ZE3D 3BK1A 4KGSA 5HFYA 2YEPF 2H88B 3VRBB 3LXFA 1C78A 3B2GA 2B76B 1HA5A 2WQYB 5EE3A 5H92C 1CJEA 4KKJA 4YTMB 3L4PA 1EWYC 3MC0B 3BYYB 2Z8LA 3W9CB 4GLSC 2WU5B 2NMQA 3CWIA 4RCOA 4C80A 2JYEA 4NZLB 2YEPB 1C4AA 3V3XA 1DOXA 4LLGM 4B0MA 1ESFA 1F77A 5BMIA 2WNMA 3T3NA 3EA6A 1HEZE 4OW0A 5FK9C 2QJLA 4A90A 1SSNA 4HKQA 2DYOA 1YN5A 2LEKA 2PKOA 1JWBD 1HZ6A 4RF1A 1L0YB 4TMAB 1YMHE 1FO4A 1EM7A 1I7HA 1QLBB 1KLGD 2N7JA 1UUPA 5HI1A 4TSSA 3AEGB 1IGDA 2X38A 4RH6A 2JQRB 5FR3A 2V4IB 2FUG1 3RPFC 2Q5WD 1IBXA 5EE9A 1JMLA 2TSSA 4MT5A 4WWMA 2QIEB 3TEWA 3U2SC 4H2AA 2LJIA 1QOAA 1QQRA 1XLNA 2KMMA 4REZA 2HTME 1D5ZC 3BWUD 4GDLB 1XCQL 3KWVA 2LMCA 3NVVA 1JWAD 1RWSA 1C77A 1HXYD 3BIID 2WXQA 1WGKA 2RDGA 1XLPA 3V05A 5BYRA 3Q8CA 4WH4A 3Q8BA 1I4RA 1ZDVA 2L52A 2W3RA 1P7FA 1T5XD 3BYTB 2DYMA 5FKAC 1KH0A 4YWGG 2RDHA 2WXMA 1YQ3B 1XCTL 3AV8A 4NAWB 2K5PA 2G9HD 2WXRA 3DWMA 4P6VF 4KX6B 4N59A 4C7ZA 1FFVA 1AN8A 3P1MA 2BS3B 3DWGC 3Q8EA 1GB1A 2WDVB 4RFBA 3PZ8A 2INNE 3B9JA 2JZPA 3BVZA 1PGBA 3PZ7A 4ZOHC 1ZDXA 2I38A 4DQOC 3NVYA 3B2FA 3GS2A 3NVWA 3IAM1 3N9YC 2DWQA 1FRDA 1V8CA 1I4QA 2WDRB 5BYSA 1OQRA 1XO3A 4D2KA 2SAKA 4A9AA 2WXIA 3T3OA 2WXHA 1UWMA 2GB1A 1KRHA 4HKZE 1UNSA 1HQRD 2PW9A 4FXCA 4HEA1 1E10A 2LGIA 2KACA 4N58A 4PT5A 5GXGB 1GAQB 1NYQA 3O13A 2XN9C 1HZ5A 1GOZA 1F2RI 4ZYSA 4US9A 5BYQA 1F0ZA 1ZUD2 1FFUA 3KLSX 5HG2A 5BMGA 3VR8B 1JALA 3TSSA 1QOGA 2L1AA 2PVGC 4UDUC 2ACZB 2AQ3B 2PLPA 3VQIA 1L4DB 1MHHE 1D5XC 1VLBA 5D3IB 1GB4A 2J42A 3ETRA 3ZJUA 1J7AA 2BB6A 5C2TB 4RGMA 1N60A 5AUKA 1T6BX 3EGRA 5BMHA 1QF6A 3AE4B 4ARIA 1A70A 1FNWA 1NENB 2K22A 3E56A 1FMAD 3IAS1 2BW2A 1JROA 1D4BA 3R2TA 3AE7B 1AW7A 5I4DA 3ZYYX 4MH8A 1TS2A 3AE8B 1YN4A 2WXNA 3H8HA 5C3JB 2WS3B 2MJ3A 4ZRPA 1VZ7A 1C4CA 3AEAB 4IOIE 2AQ2B 3AEDB 1T3QA 3P4SB 1N5XA 1XLQA 5D7GA 2ONQA 3KWLA 1FNVA 2WXOA 3AEBB 3FAHA 3BZDB 1SB3C 3OWEB 2BBCA 2GI9A 4KGTA 4A55A 4LTUA 2M56B 2N9KA 1K52A 4MACA 1VZ8A 3BK2A 4WQMA 5TSSA 4RGTA 3URYA 1C79A 2E3TA 1J7BA 1K50A 1ZXIA 2V0GA 3Q8FA 1ZXHA 2W3SA 1IGCA 4XE0A 1ZPSA 1V97A 2XNAC 3HVDA 5G5GA 1Y56A 3W1SA 2IDYA 3RFZB 2NTSA 1ENFA 3P4RB 2M19A 3AE5B 1DGJA 5AUIA 4HRSA 4YSXB 3WCQA 3NS1A 1SEBD 2JWUA 4WAFA 1WWTA 1L6UA 2HDEA 4TQ0A 1FEHA 2EKIA 4JE3B 4NJCA 2MJDA 1E7PB 4L23A 4LK0M 1I4HA 3AE9B 1JQ4A 1FNUA 2OEDA 5HHDG 1TS3A 1TS5A 3BVMA 3J9CA 2IGDA 1VR9A 1I4GA 2WDQB 4HROA 3NVZA 2J53A 3SFEB 2CJOA 2K0PA 1R7SA 3NUHB 4US8A 1L6VA 3AE6B 1QT9A 3CIRB 1C76A 1N5WA 1SBBB 2LFIA 1KTKA 3IT6B 1C4PA 4JWSC 4AQ7A 1FCLA 1YQ4B 5D3DA 1SIJA 3FILB 4YXDB 2H89B 2AQ1B 3AEEB 4C56C 3W2DA 1N63A 2V3NA 1SJHD 3SFDB 4JWUC 4XDCA 1RFKA 1FD6A 4M0WA 4OZAA 5JXVA 2INPE 1PYWD 1BMLC 1QKZA 1L0VB 1QOBA 2FBWB 3KQ4A 1IUEA 1E9MA 2K9XA 2EELA 1CK1A 4RGOS 3AN1A 3ZQ4A 2DLBA 1ACCA 3AE3B 3R8BA 1TJEA 1PFDA 1XXGA 4YTNB 1NVID 4P16A 4WURA 3AECB 1RYJA 4J3OD 1STEA 1JCKB 1WYGA 3HVZA 3U52E 3P4PB 3P42A 4RF0A 4ZHOA 2QMTA 1K51A 2FE8A 1SF0A 2G1EA 3UI3A 2WLBA 2WXKA 3C8YA 2ZW0A 4L2YA 4TQ1A 1B1ZA 2BS4B 5EE1A 2WXJA 1YN3A 1VJKA 1L4ZB 3EUB2 4GDKB 1N61A 2R61A 3BVGA 1WRIA 1L5PA 3FC4A 5MPOA 1SJED 1B9RA 1ET6A 1FCCC 1JWSD 4NAMA 3P4QB 1YNTE 1E6EB 1PDXA 2KWDA 3P63A 1QILA 1D6EC 1LO5D 2OHFA 2RPVA 1TYGB 3MJ5A 3MP9A 2I2YA 2BTEA 1I4PA 1EWCA 1CZPA 2QSDA 1MI0A 1ET9A 3NZ3A 1QOFA 1DOYA 3I57A 1PGAA 2QEJC 1EU4A 1C9FA 2ON8A 2E6XA 1OFFA 3FILA 1N62A 5EE0A 4WIPA 4EE2A 2RMMA 3ZJVA 2J4XA 4L1BA 3IT4B 2W54A 3AMZA 1ZP0B 2VZKB 2BYTA 1VRAB 2DBYA 4RGNA 1TY0A 1V1PB 4OZCA 1I4XA 3I9V1 3PO0A 2PVOD 1BUIC 2WXGA 2LHDA 2LHEA 4A8XC 1F2RC 2JSVX 3MHZA 2SEBD 4A6QA 2D5GA 2M0AA 2VZKD 1GPXA 1SXTA 3HUIA 2KDMA 3TEXA 3ZJTA 2K3UA 5LNK1 2JYTA 1E0ZA 1Q10A 2W82A 2NTTA 4JX1C 2LUMA 3MFGA 3AH7A 4ITKA 4KGRA 2WXLA 2W55A 1KLUD 1TY2A 2L83A 4ZHPA 2IJ0A 2Y5CA 1PGXA 2JX5A 1SE2A 2N9LA 1M4VA 1TS4A 2IPKD 3IXSA 4OHJA 1KF6B 2MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDV A;  3BWU D;  3RFZ B;  1ZDX A;  4B0M A;  4J3O D;  1ZE3 D;  4B0E A; 
#chains in the Genus database with same CATH topology
 1VZ6 A;  3ZNI D;  1WH3 A;  2IZV B;  3RZW C;  1WM2 A;  2DZM A;  2D2Q A;  4FBJ B;  1KFY B;  3W1S C;  1L0X B;  4LNF A;  2D07 B;  2RR9 A;  4DDI D;  4K3C A;  4OVZ A;  3AB5 A;  2LVQ A;  2ZCB A;  2FCQ A;  4XWW A;  4DXG A;  3SR6 A;  2WHI A;  4OZB A;  2WXP A;  1MPE A;  3L16 A;  3RCZ A;  1MG4 A;  4N6E B;  3DVG Y;  3Q3J A;  4KKI A;  4YSY B;  3ABV B;  1V5T A;  2O2V A;  3EHV A;  2GRI A;  2D11 A;  2FUH B;  2I1J A;  3AM9 A;  4MGY E;  1WSP A;  2CU3 A;  2ICI A;  2ZCC A;  1RFA A;  4WAA A;  2IGH A;  1MHX A;  2QC8 A;  4PYU A;  4HPL B;  2LGX A;  3ZGZ A;  1L2N A;  3KW5 B;  4RM8 A;  1C1Y B;  3GE8 C;  1E8Y A;  2M8S A;  3A33 B;  2ZNV C;  4ANX A;  4USA A;  1JRP A;  4YTP B;  2PIA A;  2DYB A;  2KAJ A;  2JXT A;  5E6P A;  2REX A;  5DPR A;  1FXA A;  1EF1 A;  1RRB A;  3Q8A A;  3A9J A;  2KT7 A;  1ZE3 D;  3BK1 A;  3R66 C;  3T8M A;  2Z59 B;  3A4S C;  4NNJ B;  3S2A A;  5EE3 A;  3DBH B;  1CJE A;  4EFO A;  4KKJ A;  3Q6B A;  4M8N A;  3MC0 B;  3BYY B;  3W9C B;  1T0R C;  2NMQ A;  2UYZ B;  4C80 A;  4JLC A;  2JYE A;  3NG0 A;  1DOX A;  4LLG M;  4B0M A;  1UEL A;  4A90 A;  2R2O A;  3APD A;  1SSN A;  1EUV B;  2LWP A;  2LEK A;  1HZ6 A;  4HK2 A;  2JRI B;  3X0W A;  1I7H A;  3TBL D;  4ICU A;  2JRH A;  4TSS A;  1IGD A;  2X38 A;  4RH6 A;  4IWP A;  2JQR B;  1E7U A;  3VHT C;  4MT5 A;  3N1Y C;  4KIK B;  2QIE B;  2IO0 B;  1XLN A;  4A20 A;  2A5U A;  2L00 B;  3I3T B;  2C60 A;  4P7I A;  2LMC A;  3NVV A;  1H8C A;  1C77 A;  2IYD B;  1WXV A;  2WXQ A;  3VDZ A;  3V05 A;  5BYR A;  3Q8C A;  3NS8 A;  4WH4 A;  1I4R A;  3DBS A;  2W3R A;  2ZPY A;  3ZIM A;  3DHG C;  4YWG G;  2G4S A;  3VUY A;  1MFW A;  4J6I A;  4GMV A;  4BOS C;  2G9H D;  1N6Z A;  3W1Y A;  3ZTC A;  1UBQ A;  2WXR A;  4LJO B;  2KJH B;  1WFY A;  3V61 A;  1FFV A;  4A3P A;  1AN8 A;  2KK8 A;  2BS3 B;  4MSM B;  2KXJ A;  4JIO U;  2INN E;  2JZP A;  4JL9 A;  3BVZ A;  1PGB A;  3PZ7 A;  4ZOH C;  3T9L A;  4DQO C;  5FR6 A;  3NVY A;  1Q1O A;  3GS2 A;  1KLV A;  2V4L A;  4HCP B;  3N9Y C;  1A5R A;  2WDR B;  1I4Q A;  1V81 A;  4D2K A;  1XO3 A;  2KMC A;  1KRH A;  4QAY A;  4HEA 1;  4JGH B;  2KAC A;  2IO2 B;  3IVF A;  1NYQ A;  1WXM A;  1HZ5 A;  4ZYS A;  4US9 A;  5BYQ A;  4AUQ C;  3PRZ A;  5HG2 A;  2L1A A;  1JRU A;  2ACZ B;  3TJP A;  2INC C;  2UU7 A;  1VLB A;  4G3X B;  4W9G A;  2BYE A;  3GZN I;  4ARI A;  1FNW A;  2K22 A;  1FMA D;  2BW2 A;  3R2T A;  3ZYY X;  3PSE B;  3DBH I;  2NCN A;  5C3J B;  2BYF A;  3KUZ A;  3SU8 X;  3PHX B;  3TCA A;  2LZ6 A;  4IOI E;  4NQL B;  1T3Q A;  4K81 A;  2ONQ A;  3FAH A;  3BZD B;  2GBK A;  1SB3 C;  1MG8 A;  2BBC A;  1E7V A;  2LUE A;  2N9K A;  4HLE A;  1WRD B;  4KDI C;  2MBB B;  4MGK E;  3URY A;  2E3T A;  4M8M A;  3A9K A;  1ZXI A;  4AWJ A;  2ZNV B;  4PS3 A;  4BBN F;  2W3S A;  3QJZ A;  4XE0 A;  1ZPS A;  1V97 A;  2XNA C;  4W9E A;  4XGA B;  2IDY A;  2X8X X;  3AE5 B;  3DBR I;  1E8W A;  3VH3 B;  3WCQ A;  3FKY A;  1WWT A;  2MW5 A;  4DHZ B;  2MP2 B;  1FEH A;  3AU5 A;  4HPM B;  3AE9 B;  1E8X A;  1JQ4 A;  2OED A;  5HHD G;  2LRW A;  5JHA A;  4BKS D;  4HRO A;  3PRM B;  2G3Q B;  2K0P A;  1R7S A;  3CIR B;  1C76 A;  1KJT A;  1N5W A;  3IT6 B;  3RNF C;  1YQ4 B;  1V9J A;  4YXD B;  4HVB A;  2VRR B;  5G55 A;  2H89 B;  1WMH A;  4FAD A;  2V3N A;  4JWU C;  2KN5 A;  4XDC A;  1FD6 A;  5BO4 B;  2KZR A;  3QCA A;  1QKZ A;  1L0V B;  1GNU A;  3PGE A;  3EEC A;  1TJE A;  1XXG A;  4WUR A;  1YX6 B;  1WJN A;  4EKU A;  2V3S A;  1WF9 A;  2CS4 A;  4X57 B;  3DVG X;  3U52 E;  3VUW A;  3P4P B;  3P42 A;  4S17 A;  4RF0 A;  1K51 A;  1H4R A;  2WLB A;  2WXK A;  3C8Y A;  1Y8R C;  2PEA A;  2WXJ A;  1Q5W B;  4CO7 A;  2LGS A;  1N61 A;  2R61 A;  3BVG A;  1L5P A;  1B9R A;  1ET6 A;  1FCC C;  1JWS D;  4WWO A;  3ZNG C;  3P4Q B;  1YNT E;  2KWD A;  1D6E C;  3QC8 B;  2K8C A;  2OHF A;  1TYG B;  4PS8 A;  1QOF A;  1P9D U;  3I57 A;  2QEJ C;  3GOE A;  2LVO A;  4B95 A;  2K39 A;  1N62 A;  4MDK E;  4GGQ A;  3ZJV A;  2KX3 A;  4L1B A;  3IT4 B;  3AMZ A;  5CHF A;  2L76 A;  2RSU A;  4DHZ E;  2WDT B;  2PVO D;  3N20 C;  2N1V A;  3QHT A;  2O2V B;  1WZ3 A;  3A1Q B;  4C4V A;  2M0A A;  2KDM A;  1E0Z A;  2W82 A;  2NTT A;  2K1F A;  2LUM A;  2V9H A;  3HM6 X;  4IWO A;  3RYT A;  4KGR A;  2WXL A;  3ZW3 A;  2W55 A;  1KLU D;  1TY2 A;  5H92 C;  1TS4 A;  2K8H A;  1NI2 A;  4FHK A;  4IDI A;  1WXQ A;  3Q3F A;  4RNA A;  1Z2M A;  3U4E G;  4BKG A;  4IUM B;  1D5M C;  4GDK A;  3NOB A;  1SGH A;  1T0Y A;  4MH0 E;  3AEF B;  3TEY A;  4IWQ A;  1UWX A;  2FID A;  1WXA A;  2NPT B;  3WIM A;  3WA0 A;  1LQB A;  4C7Y A;  1TKE A;  2GBN A;  4AS1 A;  3GP7 A;  1NYR A;  5DPT A;  4IKG A;  3A9J B;  1P98 A;  1WI0 A;  3NJT A;  1WIA A;  4MGI E;  5E6J A;  5L95 C;  1TKY A;  4O1N A;  2KQ4 X;  2N9P C;  3E9S A;  2JPH A;  4W9F A;  1DYQ A;  2BWF A;  1PUT A;  1OQQ A;  2L7R A;  2ZZP B;  3R2I A;  2KWC A;  3Q69 A;  5CTR C;  1FIQ A;  4GN1 A;  3VFK A;  4DXA B;  1TKG A;  1V5O A;  4FJV B;  1JW9 D;  1EU3 A;  4CQN A;  1D3Z A;  1V1O A;  2KO3 A;  5AZH A;  3UIP B;  5AZG A;  1IPG A;  3PHW B;  1IYF A;  2ZVN A;  4ASW C;  5GMV A;  2GLS A;  2HE7 A;  4YT0 B;  3Q2A C;  3DBL I;  4K7W A;  3ZDM C;  4YSZ B;  1VCB A;  2DHZ A;  2FAZ A;  5H8Y E;  2PTL A;  3O65 B;  3ZNH B;  3L10 B;  2Z0E B;  2LJ5 A;  2HJ1 A;  2BQQ A;  4K7U A;  3RZF A;  2L05 A;  3RNA C;  3JSV A;  2EMT A;  2B76 B;  2M17 A;  2N9X A;  3PTF C;  1XT9 B;  3RT3 B;  4GLS C;  2HTH A;  5KHQ A;  2JZ3 B;  4RCO A;  2DX5 B;  2KVZ A;  4NZL B;  1C4A A;  3V3X A;  5BMI A;  3T3N A;  1HEZ E;  4OW0 A;  2PJH A;  2MBO A;  2BWE S;  1YMH E;  3ZRF A;  2IND C;  1FO4 A;  1YD8 U;  1KLG D;  2N7J A;  1I42 A;  5HI1 A;  4WWP A;  4E71 A;  3TEW A;  4H2A A;  1WR6 E;  2KYW A;  3R7R A;  3BY4 B;  3P2B A;  4GDL B;  1CMX B;  1XCQ L;  3KWV A;  1HXY D;  5D94 A;  3LJ3 A;  2KJ6 A;  2RDG A;  4DHJ D;  2J0J A;  1ZDV A;  5E6O A;  1P7F A;  4XYC A;  2DYM A;  1KH0 A;  3QK0 A;  2ZEQ A;  3ML8 A;  2QHO A;  4RM9 A;  1GUA B;  2FCN A;  1XCT L;  3MJW A;  2MCN B;  4TKN A;  4ZRI A;  4KX6 B;  2ASQ A;  1SIF A;  2DEN B;  4HWI B;  3P1M A;  3DWG C;  4ZDV A;  4RFB A;  3SD5 A;  4KSK C;  3PT2 B;  2N7E A;  2I38 A;  2KTR A;  3B2F A;  2DAF A;  2DWQ A;  3NHE B;  3ML9 A;  5BYS A;  5JHB A;  1OQR A;  2SAK A;  3ZXV A;  4A9A A;  2M0X A;  5DPW A;  4HKZ E;  4ZRJ A;  1UNS A;  1E10 A;  4FXC A;  2LGI A;  3DVN V;  1OQY A;  1GAQ B;  2BVC A;  4XZ4 A;  3O13 A;  3GZN B;  2L0F A;  3BIN A;  2KX0 A;  3A9K B;  1FFU A;  5BMG A;  1JAL A;  1T0S C;  3DHI C;  4UDU C;  1GJZ A;  2PLP A;  2KQ7 A;  5IN7 A;  4NAW A;  1GB4 A;  2J42 A;  4IG7 B;  2BB6 A;  4RGM A;  4F8C B;  1ZGU B;  3KVF B;  5AUK A;  1T6B X;  3VTW A;  1HE8 A;  1OGW A;  1UH6 A;  1YOV B;  5DPS A;  3RMK C;  1YJ1 A;  3AE8 B;  1YN4 A;  3QWZ B;  1VZ7 A;  3AED B;  3P4S B;  3AUL A;  1XLQ A;  3JYU A;  4EZL A;  3N30 A;  3OWE B;  4IC7 B;  4LTU A;  2M56 B;  4MAC A;  1K52 A;  3RNB C;  1VZ8 A;  1KM7 A;  1K8R B;  2LGD A;  2KHW B;  4WQM A;  1WMH B;  2MLB A;  3EFC A;  1C79 A;  1K50 A;  3DBR B;  3Q8F A;  1VD2 A;  1ZXH A;  4MJS A;  1IGC A;  4EUT A;  5CX3 A;  2IY0 B;  2LVP A;  4NJ6 A;  2NBV B;  4WQO B;  3P4R B;  2M19 A;  1DGJ A;  2WX1 A;  3NS1 A;  5EDS A;  1SEB D;  2JXX A;  3OJ3 A;  4WAF A;  3KUC B;  1V2Y A;  2HJ8 A;  2EKI A;  2MJD A;  3Q3N C;  1OEY J;  2BPS A;  1E5W A;  2WYQ A;  4HDO A;  3ZRC A;  3H9D A;  2GBR A;  2KWU B;  5JH5 C;  3SFE B;  4NPN A;  1X1M A;  4BKT A;  4EZJ A;  3L0W B;  3N1X C;  1L6V A;  4XX5 A;  1QT9 A;  1SBB B;  4AQ7 A;  1FCL A;  2KMA A;  2MQJ A;  3DOW A;  5J17 A;  3PRP B;  1RFK A;  4JQW C;  4M0W A;  4OZA A;  2INP E;  1PYW D;  2J7Q B;  1S1Q B;  3OAW A;  1WGD A;  3KQ4 A;  1IUE A;  4C4V B;  1CK1 A;  4RGO S;  2KFJ A;  4YTN B;  4P16 A;  2W9N A;  1WR1 A;  3AEC B;  3ONS A;  4RMA A;  1JCK B;  2V1Y A;  1TTN A;  4FJY A;  3EC8 A;  1LGR A;  2JVC A;  1UBI A;  3ZLZ A;  1YN3 A;  1VJK A;  4GDK B;  2AWT A;  1WZ0 A;  4KVG B;  2CHX A;  3FC4 A;  5MPO A;  1SJE D;  4NAM A;  1E6E B;  3HM3 A;  1YIW A;  2RPV A;  3MJ5 A;  5IP4 D;  2BTE A;  3UQB A;  3WAP A;  3NZ3 A;  3WAM A;  2OOB B;  3CST A;  1EU4 A;  2ON8 A;  2KLC A;  2JWZ A;  1OFF A;  3FIL A;  1WXS A;  5EE0 A;  4WIP A;  2RMM A;  4AJW A;  2J4X A;  3WAL A;  2MBE A;  2BYT A;  1C3T A;  5KHO A;  4DBG A;  4G0N B;  4OZC A;  1I4X A;  2WXG A;  2LHD A;  2KTF A;  3MHZ A;  2CHW A;  2FIF A;  3TEX A;  2DZI A;  3VTU A;  2FNJ B;  2JUO A;  5IAA C;  3HIZ A;  2J0K A;  3X23 A;  3APF A;  3L08 A;  2Y5C A;  1PGX A;  1M4V A;  2YVC A;  2MEK A;  2L32 A;  5JZE B;  4N9F 4;  1WJU A;  3B1L X;  4BVU C;  3GB1 A;  4HJG E;  1F9J A;  2KLG A;  2WX0 A;  2LXA A;  4FHJ A;  4ZRQ A;  2MWS B;  3VRA B;  1TT5 B;  3TUO A;  1XD3 B;  4B6W A;  1ZW7 A;  1ROE A;  2AEH A;  2PMV A;  5IOI A;  3VTV A;  5C1Z A;  2IGG A;  1XF5 L;  1YJJ A;  5CHV C;  4WJO A;  1FRR A;  2C9W B;  3JSV B;  1UGJ A;  4JPS A;  1I35 A;  2AX5 A;  3AE2 B;  4KZ0 A;  3Q3M C;  3DVN U;  4MM3 B;  1XEE A;  1FM0 D;  3TEZ A;  1NI3 A;  2CU1 A;  3PLU A;  3V62 A;  3C0R B;  3U7Z A;  2J52 A;  1AYF A;  3H7S A;  2KKC A;  3W5V B;  2KC1 A;  1VDV A;  2ZW1 A;  2V3P A;  2UWQ A;  2PE6 B;  2CKH B;  3UF8 A;  2MJE A;  2BT6 A;  1JWU D;  3DBL B;  1XLO A;  2WXF A;  2NS5 A;  1RM6 C;  4MEM A;  1SE4 A;  2WU2 B;  2GBM A;  3SEB A;  4AP4 C;  2BGF A;  4Q2J A;  3IHP C;  3QQ8 B;  1JWM D;  1K53 A;  4BZA A;  3C19 A;  1DOI A;  4FUL A;  3VR9 B;  2CJN A;  3W5U B;  2MH7 A;  3AE1 B;  4XDD A;  3QIJ A;  3RI7 C;  3RUI B;  4KGS A;  5HFY A;  2LRU A;  3CSF A;  2ZVO A;  3VRB B;  5CHW A;  2KAN A;  2OJR A;  3LXF A;  3VUX A;  3RNE C;  5J18 A;  4K7S A;  2D3C A;  3B2G A;  2WQY B;  3M63 B;  3L4P A;  2JY6 A;  1EWY C;  3CWI A;  4AOF A;  2NBU A;  4F7Z A;  2YEP B;  1RLF A;  1ESF A;  2RDB C;  3EA6 A;  3V6C B;  3TL5 A;  2D3G A;  1JWB D;  3A4R A;  3ALB A;  4TMA B;  2CR5 A;  2B3A A;  1UUP A;  3K9O B;  1WGY A;  2QCZ A;  2O6V A;  2KTR B;  3RNG C;  1R4M I;  2V4I B;  2KD0 A;  1IBX A;  5EE9 A;  2RD0 A;  1JML A;  3HHM A;  4URK A;  3ENE A;  3AU4 A;  1QOA A;  2ZPN A;  2KMM A;  2K6D B;  4ANU A;  2NBW B;  4REZ A;  2HTM E;  1D5Z C;  4W9I A;  2LGY A;  3N1Z C;  3BII D;  3HK0 A;  1WGK A;  1G6J A;  1XQQ A;  3Q8B A;  1T5X D;  3BYT B;  5FKA C;  4LNN A;  5DCN A;  4NAW B;  4HXD A;  2K5P A;  3U8Z A;  3DWM A;  2L8J A;  1EF5 A;  1L7Y A;  1V80 A;  1HTQ A;  1PQS A;  4EEW A;  1GB1 A;  2GBJ A;  3B9J A;  4HDQ A;  2XBB C;  2KWV B;  3NVW A;  1WJ4 A;  3IAM 1;  4WJN A;  1FRD A;  1V8C A;  4B9K A;  2JZZ A;  4M01 A;  3T3O A;  3OJ4 B;  2AL3 A;  2WXH A;  1UWM A;  4ZRK A;  4S0R A;  2GB1 A;  1HQR D;  4GXB A;  4N58 A;  2BF8 B;  2KNB A;  3MC8 A;  3ZUN A;  4M00 A;  1KOT A;  2BKF A;  1F2R I;  1S3S G;  2G45 B;  4KV2 A;  3VR8 B;  3TSS A;  1QOG A;  2BYV E;  2AQ3 B;  2XK5 A;  1L4D B;  3VQI A;  1MHH E;  1D5X C;  5D3I B;  3ETR A;  3ZJU A;  4IM3 A;  1J7A A;  4XC2 A;  3I63 C;  1N60 A;  3EGR A;  5BMH A;  1QF6 A;  1OTR B;  1A70 A;  3E56 A;  1NEN B;  1AW7 A;  1E8Z A;  3GE3 C;  1V49 A;  1WE7 A;  4LNI A;  3PS6 A;  3H6N A;  4MH8 A;  1Q0W B;  3NZS A;  2WS3 B;  3H1U A;  2MJ3 A;  1UZX B;  3IFW B;  4ZRP A;  1C4C A;  4P1C C;  3L13 A;  2AQ2 B;  2LXC A;  2MSE D;  1N5X A;  2LAS A;  5D7G A;  4WJP A;  2CHZ A;  1Z5S B;  2JF5 A;  2R2Q A;  2GI9 A;  4A55 A;  5AZF A;  2N9E B;  1ZKH A;  3TIX A;  3BK2 A;  4DHJ B;  1J7B A;  3SDL C;  2V0G A;  2DZK A;  1FPY A;  2KFK A;  3HVD A;  4DK5 A;  5G5G A;  4TV3 A;  4MEL A;  1P3Q U;  5LXI B;  2C7M B;  3RFZ B;  2NTS A;  3R3M A;  3ZVV A;  2KDE B;  2HDE A;  2KQS A;  5LXH A;  3N32 A;  4TQ0 A;  4JE3 B;  1E7P B;  4LK0 M;  1I4H A;  4W9J A;  4OVU A;  1FNU A;  4GB9 A;  3BVM A;  5L83 A;  2L3Z A;  2WDQ B;  3NVZ A;  3WAN A;  2MRP A;  5J2R A;  4US8 A;  2LFI A;  4JWS C;  1EO6 A;  5D3D A;  1SIJ A;  3FIL B;  3A1Q A;  2AQ1 B;  1WGH A;  4OVV A;  3B08 A;  3IBE A;  1N63 A;  3W2D A;  1SJH D;  2KDF B;  2XEW A;  1BML C;  1QOB A;  2FBW B;  4TUU A;  3ZQ4 A;  1ACC A;  3R8B A;  1PFD A;  1NVI D;  2K6Q A;  1WYG A;  1J8C A;  1F52 A;  4II3 B;  5HKH A;  2NVU I;  2QMT A;  2IY1 B;  1MJD A;  1SF0 A;  2G1E A;  3EFU A;  3U30 A;  3UI3 A;  4L2Y A;  2EMS A;  2NPT A;  1WRI A;  4E3C A;  3VH4 B;  3P63 A;  3RUL A;  3OLM D;  2DNF A;  1LO5 D;  2FCS A;  3MP9 A;  3ZKJ C;  2QSD A;  1MI0 A;  1ET9 A;  1BT0 A;  2QDF A;  3L54 A;  2W54 A;  1SE9 A;  1ZP0 B;  4I6L B;  5LLI A;  2AL6 A;  5D6J B;  4DDG D;  1VRA B;  4RGN A;  1TY0 A;  2FCM A;  3I9V 1;  2PPH A;  1BUI C;  4A8X C;  1F2R C;  4LNK A;  2D5G A;  2GOW A;  4IW0 A;  2KOX A;  1SXT A;  3HUI A;  2C7N B;  3ZJT A;  2JYT A;  1Q10 A;  3ZNZ B;  2GMI C;  3AH7 A;  4ITK A;  5C23 A;  2L83 A;  4ZHP A;  2N9L A;  4FA6 A;  1KF6 B;  3PRE A;  1UD7 A;  4W9K A;  3RN9 C;  2BS2 B;  1MVK A;  3QAR A;  1TZO A;  1SE3 A;  1UF0 A;  2Y3A A;  3ZXR A;  1ZOY B;  3LB8 C;  3N3K B;  1FXI A;  2QIL A;  3KYC D;  3UQA A;  2WP9 B;  3CF6 E;  4B0E A;  4ARC A;  1BXT A;  2VH1 A;  2J0M A;  3LYY A;  1LFD A;  4HJK A;  3B0A A;  3L17 A;  1V1P A;  4LDT B;  1CQV A;  4EOY A;  2N0S B;  5T8I A;  1WYW B;  3HRD D;  2LI5 A;  4XWT A;  3H7P A;  4LDT D;  2KVR A;  2BB5 A;  2L0T A;  2BKR B;  3JVZ X;  4R3D A;  3PVL A;  2K25 A;  4DXF A;  4F1S A;  3NRZ A;  5G5H A;  4PK1 A;  1J7C A;  2Y5P A;  1WM3 A;  2O6V B;  1NEK B;  1T0Q C;  5TR5 A;  2JU6 X;  2KN4 A;  4BOZ B;  1P7E A;  2KJR A;  4GDL A;  1IBX B;  1AWD A;  1YJI A;  2O6V D;  3U7D A;  1HTO A;  1WX9 A;  4DWF A;  1WGG A;  4BBN C;  2YEP F;  2MBH A;  2EKE C;  2H88 B;  1C78 A;  3ECI A;  1HA5 A;  3KH0 A;  1TZ1 A;  4K3B A;  2D10 A;  4YTM B;  1R4N B;  3M62 B;  2Z8L A;  3M3J A;  2WU5 B;  1F77 A;  2WNM A;  1U4A A;  1R4M B;  3UIN B;  5FK9 C;  2QJL A;  2RPQ A;  4HKQ A;  2DYO A;  1YN5 A;  1V86 A;  2PKO A;  4RF1 A;  1L0Y B;  1EM7 A;  1NDD A;  1QLB B;  4II2 B;  4GOC A;  3AEG B;  5FR3 A;  2FUG 1;  2ZJD A;  2DZJ A;  3RPF C;  2Q5W D;  4W9L A;  2TSS A;  4WWM A;  4MGZ E;  3U2S C;  3MHS D;  2LJI A;  1QQR A;  4KSL C;  1YQB A;  4ICV A;  3R7Q A;  3BWU D;  2MBQ A;  5IO9 A;  1JWA D;  1RWS A;  3KYD D;  4CYE A;  1XLP A;  3SHQ A;  1LM8 B;  2L52 A;  1WX7 A;  4G11 A;  2JT4 B;  3DCG A;  1QZE A;  2XK5 B;  2RDH A;  2IO3 B;  2WXM A;  1YQ3 B;  4AJY B;  3AV8 A;  3MC9 A;  4P6V F;  4WJQ A;  4N59 A;  4M02 A;  1GG3 A;  2Z0D B;  3DQV A;  4C7Z A;  4FLH A;  3Q8E A;  2WDV B;  3LDZ E;  3PZ8 A;  5E6N A;  3CMM B;  4P1B C;  1ZDX A;  1J19 A;  2PE9 A;  4NY0 A;  3APC A;  4CHK A;  2G4D B;  4NQK E;  4KIK A;  2WXI A;  3TMP B;  2PW9 A;  1ISN A;  4PT5 A;  5GXG B;  3V60 A;  2MX2 A;  3IG3 A;  2XN9 C;  1YX5 B;  4FJZ A;  1GOZ A;  3DHH C;  3WAO A;  3NZU A;  1F0Z A;  1ZUD 2;  2I1K A;  3KLS X;  1TBE A;  4LCD E;  1IP9 A;  2PVG C;  4ANV A;  2OJW A;  2KFK B;  3Q3O C;  1WJ6 A;  2MHJ A;  2D3A A;  1V6E A;  5C2T B;  3K9P B;  1TGZ B;  4YL8 A;  3AE4 B;  4C00 A;  4G50 A;  3IAS 1;  1JRO A;  1D4B A;  2HD5 B;  3AE7 B;  5I4D A;  2IO1 B;  3ZTD A;  2C5L C;  3M95 A;  1TS2 A;  3PPA A;  2AYO B;  1R4N I;  3RNC C;  1M94 A;  2WXN A;  3H8H A;  4GSW A;  2KDB A;  3AEA B;  1WE6 A;  4MSQ B;  2DAJ A;  4HPP A;  1AAR A;  4FN2 A;  3PZD A;  3KWL A;  1GC7 A;  1FNV A;  2WXO A;  3AEB B;  5D2M B;  1UGM A;  2M1M A;  3VVW B;  2N1W A;  4KGT A;  5AEK B;  2KC2 A;  5TSS A;  3D32 A;  4RGT A;  1GC6 A;  4W9D A;  4BAX A;  3DPD A;  4KDL B;  3UIO B;  5G2N A;  4PS7 A;  1Y56 A;  2RGF A;  3W1S A;  1WGR A;  1ENF A;  4ANW A;  1P0R A;  2MA9 B;  3KUD B;  5AUI A;  4HRS A;  4YSX B;  4LNO A;  3QX1 A;  1E90 A;  2JWU A;  1P1A A;  4NJ7 A;  1L6U A;  3Q14 C;  3UGB B;  3VAW A;  2VH2 A;  4NJC A;  4L23 A;  4GU2 A;  4PYZ A;  1NBF C;  2K8B A;  1F1H A;  4EZK A;  1TS3 A;  1TS5 A;  2WGS A;  3J9C A;  1OEY A;  2IGD A;  1VR9 A;  1I4G A;  4GIV A;  2C7H A;  2J53 A;  2CJO A;  3QA8 A;  4E74 A;  3NUH B;  3AE6 B;  3V6E B;  1KTK A;  4WWN A;  1C4P A;  2N4F A;  2NR2 A;  3ZO5 B;  3AEE B;  3ZDT A;  4C56 C;  3SFD B;  2WWZ A;  5JXV A;  1WY8 A;  4W9C A;  4IM2 A;  1E9M A;  2K9X A;  2EEL A;  3RD2 A;  3AN1 A;  2DLB A;  3AE3 B;  1TIF A;  4I6N B;  4BFR A;  3MTN B;  2M4N A;  1RYJ A;  4J3O D;  1STE A;  3AXC A;  4MJS B;  2N7D A;  1WX8 A;  3HVZ A;  3QAQ A;  4ZHO A;  2MP2 A;  4ZYN A;  2FE8 A;  2IBI B;  4BKS A;  2A4Z A;  2ZW0 A;  3AI5 A;  4TQ1 A;  1B1Z A;  1RAX A;  2BS4 B;  1J0G A;  5EE1 A;  1L4Z B;  3EUB 2;  4K1R B;  2D3B A;  4IM0 A;  1PDX A;  1LXD A;  1QIL A;  1FXT B;  2I2Y A;  1I4P A;  1EWC A;  1CZP A;  4KZC A;  5IA7 A;  1DOY A;  1PGA A;  2Y5B B;  1C9F A;  3OG5 A;  2E6X A;  2LD9 A;  4A3O A;  4MM3 A;  4W9H A;  4EE2 A;  4HCN B;  2VZK B;  4LJP B;  3NY5 A;  2DBY A;  1V1P B;  3JW0 X;  2YLM A;  3PO0 A;  3DDC B;  2LHE A;  2JSV X;  4A6Q A;  2SEB D;  3PLV A;  5IKC M;  2VZK D;  1GPX A;  2K3U A;  5LNK 1;  4ACF A;  3H7P B;  4JX1 C;  2KDI A;  3MFG A;  4M0W B;  4I6P A;  3I5J C;  2IJ0 A;  2JX5 A;  1SE2 A;  3IXS A;  2IPK D;  4OHJ A;  3VXW A;  3PV1 A; 
#chains in the Genus database with same CATH homology
 4IDI A;  1VZ6 A;  2L32 A;  1WXQ A;  2BS2 B;  1MVK A;  4RNA A;  1TZO A;  3GB1 A;  3U4E G;  4HJG E;  1D5M C;  1SE3 A;  2Y3A A;  1KFY B;  1ZOY B;  3LB8 C;  4ZRQ A;  1FXI A;  3AEF B;  1L0X B;  2QIL A;  3TEY A;  1UWX A;  3VRA B;  3TUO A;  4OVZ A;  3AB5 A;  1TKE A;  4C7Y A;  1ROE A;  4AS1 A;  3GP7 A;  1NYR A;  4IKG A;  2WP9 B;  4XWW A;  2PMV A;  4DXG A;  3SR6 A;  4OZB A;  4B0E A;  2IGG A;  2WXP A;  1MPE A;  1XF5 L;  4ARC A;  1BXT A;  1YJJ A;  4N6E B;  1FRR A;  3LYY A;  5E6J A;  1UGJ A;  4JPS A;  2AX5 A;  3AE2 B;  1V1P A;  4KKI A;  4YSY B;  1CQV A;  1TKY A;  4O1N A;  2KQ4 X;  3ABV B;  3E9S A;  1XEE A;  4MM3 B;  1FM0 D;  2GRI A;  2N0S B;  3TEZ A;  1DYQ A;  1NI3 A;  5T8I A;  3HRD D;  3AM9 A;  3U7Z A;  4XWT A;  1PUT A;  1OQQ A;  1WSP A;  2CU3 A;  2J52 A;  1AYF A;  2ICI A;  3R2I A;  2IGH A;  3Q69 A;  1FIQ A;  3W5V B;  2BB5 A;  1MHX A;  1TKG A;  4R3D A;  1VDV A;  2ZW1 A;  2V3P A;  1JW9 D;  1EU3 A;  3ZGZ A;  4DXF A;  2MJE A;  2BT6 A;  1JWU D;  3NRZ A;  4CQN A;  5G5H A;  1V1O A;  1J7C A;  1XLO A;  2WXF A;  4USA A;  1JRP A;  1RM6 C;  4YTP B;  1SE4 A;  2PIA A;  2WU2 B;  2Y5P A;  3SEB A;  1NEK B;  2KAJ A;  2JXT A;  2JU6 X;  4Q2J A;  4YT0 B;  2KN4 A;  1P7E A;  1IBX B;  1FXA A;  1JWM D;  1AWD A;  1K53 A;  4YSZ B;  1DOI A;  1YJI A;  3Q8A A;  3VR9 B;  2CJN A;  3W5U B;  2MH7 A;  5H8Y E;  2PTL A;  3AE1 B;  4XDD A;  1ZE3 D;  3BK1 A;  4KGS A;  5HFY A;  2YEP F;  2H88 B;  3VRB B;  3LXF A;  1C78 A;  3B2G A;  2B76 B;  1HA5 A;  2WQY B;  5EE3 A;  5H92 C;  1CJE A;  4KKJ A;  4YTM B;  3L4P A;  1EWY C;  3MC0 B;  3BYY B;  2Z8L A;  3W9C B;  4GLS C;  2WU5 B;  2NMQ A;  3CWI A;  4RCO A;  4C80 A;  2JYE A;  4NZL B;  2YEP B;  1C4A A;  3V3X A;  1DOX A;  4LLG M;  4B0M A;  1ESF A;  1F77 A;  5BMI A;  2WNM A;  3T3N A;  3EA6 A;  1HEZ E;  4OW0 A;  5FK9 C;  2QJL A;  4A90 A;  1SSN A;  4HKQ A;  2DYO A;  1YN5 A;  2LEK A;  2PKO A;  1JWB D;  1HZ6 A;  4RF1 A;  1L0Y B;  4TMA B;  1YMH E;  1FO4 A;  1EM7 A;  1I7H A;  1QLB B;  1KLG D;  2N7J A;  1UUP A;  5HI1 A;  4TSS A;  3AEG B;  1IGD A;  2X38 A;  4RH6 A;  2JQR B;  5FR3 A;  2V4I B;  2FUG 1;  3RPF C;  2Q5W D;  1IBX A;  5EE9 A;  1JML A;  2TSS A;  4MT5 A;  4WWM A;  2QIE B;  3TEW A;  3U2S C;  4H2A A;  2LJI A;  1QOA A;  1QQR A;  1XLN A;  2KMM A;  4REZ A;  2HTM E;  1D5Z C;  3BWU D;  4GDL B;  1XCQ L;  3KWV A;  2LMC A;  3NVV A;  1JWA D;  1RWS A;  1C77 A;  1HXY D;  3BII D;  2WXQ A;  1WGK A;  2RDG A;  1XLP A;  3V05 A;  5BYR A;  3Q8C A;  4WH4 A;  3Q8B A;  1I4R A;  1ZDV A;  2L52 A;  2W3R A;  1P7F A;  1T5X D;  3BYT B;  2DYM A;  5FKA C;  1KH0 A;  4YWG G;  2RDH A;  2WXM A;  1YQ3 B;  1XCT L;  3AV8 A;  4NAW B;  2K5P A;  2G9H D;  2WXR A;  3DWM A;  4P6V F;  4KX6 B;  4N59 A;  4C7Z A;  1FFV A;  1AN8 A;  3P1M A;  2BS3 B;  3DWG C;  3Q8E A;  1GB1 A;  2WDV B;  4RFB A;  3PZ8 A;  2INN E;  3B9J A;  2JZP A;  3BVZ A;  1PGB A;  3PZ7 A;  4ZOH C;  1ZDX A;  2I38 A;  4DQO C;  3NVY A;  3B2F A;  3GS2 A;  3NVW A;  3IAM 1;  3N9Y C;  2DWQ A;  1FRD A;  1V8C A;  1I4Q A;  2WDR B;  5BYS A;  1OQR A;  1XO3 A;  4D2K A;  2SAK A;  4A9A A;  2WXI A;  3T3O A;  2WXH A;  1UWM A;  2GB1 A;  1KRH A;  4HKZ E;  1UNS A;  1HQR D;  2PW9 A;  4FXC A;  4HEA 1;  1E10 A;  2LGI A;  2KAC A;  4N58 A;  4PT5 A;  5GXG B;  1GAQ B;  1NYQ A;  3O13 A;  2XN9 C;  1HZ5 A;  1GOZ A;  1F2R I;  4ZYS A;  4US9 A;  5BYQ A;  1F0Z A;  1ZUD 2;  1FFU A;  3KLS X;  5HG2 A;  5BMG A;  3VR8 B;  1JAL A;  3TSS A;  1QOG A;  2L1A A;  2PVG C;  4UDU C;  2ACZ B;  2AQ3 B;  2PLP A;  3VQI A;  1L4D B;  1MHH E;  1D5X C;  1VLB A;  5D3I B;  1GB4 A;  2J42 A;  3ETR A;  3ZJU A;  1J7A A;  2BB6 A;  5C2T B;  4RGM A;  1N60 A;  5AUK A;  1T6B X;  3EGR A;  5BMH A;  1QF6 A;  3AE4 B;  4ARI A;  1A70 A;  1FNW A;  1NEN B;  2K22 A;  3E56 A;  1FMA D;  3IAS 1;  2BW2 A;  1JRO A;  1D4B A;  3R2T A;  3AE7 B;  1AW7 A;  5I4D A;  3ZYY X;  4MH8 A;  1TS2 A;  3AE8 B;  1YN4 A;  2WXN A;  3H8H A;  5C3J B;  2WS3 B;  2MJ3 A;  4ZRP A;  1VZ7 A;  1C4C A;  3AEA B;  4IOI E;  2AQ2 B;  3AED B;  1T3Q A;  3P4S B;  1N5X A;  1XLQ A;  5D7G A;  2ONQ A;  3KWL A;  1FNV A;  2WXO A;  3AEB B;  3FAH A;  3BZD B;  1SB3 C;  3OWE B;  2BBC A;  2GI9 A;  4KGT A;  4A55 A;  4LTU A;  2M56 B;  2N9K A;  1K52 A;  4MAC A;  1VZ8 A;  3BK2 A;  4WQM A;  5TSS A;  4RGT A;  3URY A;  1C79 A;  2E3T A;  1J7B A;  1K50 A;  1ZXI A;  2V0G A;  3Q8F A;  1ZXH A;  2W3S A;  1IGC A;  4XE0 A;  1ZPS A;  1V97 A;  2XNA C;  3HVD A;  5G5G A;  1Y56 A;  3W1S A;  2IDY A;  3RFZ B;  2NTS A;  1ENF A;  3P4R B;  2M19 A;  3AE5 B;  1DGJ A;  5AUI A;  4HRS A;  4YSX B;  3WCQ A;  3NS1 A;  1SEB D;  2JWU A;  4WAF A;  1WWT A;  1L6U A;  2HDE A;  4TQ0 A;  1FEH A;  2EKI A;  4JE3 B;  4NJC A;  2MJD A;  1E7P B;  4L23 A;  4LK0 M;  1I4H A;  3AE9 B;  1JQ4 A;  1FNU A;  2OED A;  5HHD G;  1TS3 A;  1TS5 A;  3BVM A;  3J9C A;  2IGD A;  1VR9 A;  1I4G A;  2WDQ B;  4HRO A;  3NVZ A;  2J53 A;  3SFE B;  2CJO A;  2K0P A;  1R7S A;  3NUH B;  4US8 A;  1L6V A;  3AE6 B;  1QT9 A;  3CIR B;  1C76 A;  1N5W A;  1SBB B;  2LFI A;  1KTK A;  3IT6 B;  1C4P A;  4JWS C;  4AQ7 A;  1FCL A;  1YQ4 B;  5D3D A;  1SIJ A;  3FIL B;  4YXD B;  2H89 B;  2AQ1 B;  3AEE B;  4C56 C;  3W2D A;  1N63 A;  2V3N A;  1SJH D;  3SFD B;  4JWU C;  4XDC A;  1RFK A;  1FD6 A;  4M0W A;  4OZA A;  5JXV A;  2INP E;  1PYW D;  1BML C;  1QKZ A;  1L0V B;  1QOB A;  2FBW B;  3KQ4 A;  1IUE A;  1E9M A;  2K9X A;  2EEL A;  1CK1 A;  4RGO S;  3AN1 A;  3ZQ4 A;  2DLB A;  1ACC A;  3AE3 B;  3R8B A;  1TJE A;  1PFD A;  1XXG A;  4YTN B;  1NVI D;  4P16 A;  4WUR A;  3AEC B;  1RYJ A;  4J3O D;  1STE A;  1JCK B;  1WYG A;  3HVZ A;  3U52 E;  3P4P B;  3P42 A;  4RF0 A;  4ZHO A;  2QMT A;  1K51 A;  2FE8 A;  1SF0 A;  2G1E A;  3UI3 A;  2WLB A;  2WXK A;  3C8Y A;  2ZW0 A;  4L2Y A;  4TQ1 A;  1B1Z A;  2BS4 B;  5EE1 A;  2WXJ A;  1YN3 A;  1VJK A;  1L4Z B;  3EUB 2;  4GDK B;  1N61 A;  2R61 A;  3BVG A;  1WRI A;  1L5P A;  3FC4 A;  5MPO A;  1SJE D;  1B9R A;  1ET6 A;  1FCC C;  1JWS D;  4NAM A;  3P4Q B;  1YNT E;  1E6E B;  1PDX A;  2KWD A;  3P63 A;  1QIL A;  1D6E C;  1LO5 D;  2OHF A;  2RPV A;  1TYG B;  3MJ5 A;  3MP9 A;  2I2Y A;  2BTE A;  1I4P A;  1EWC A;  1CZP A;  2QSD A;  1MI0 A;  1ET9 A;  3NZ3 A;  1QOF A;  1DOY A;  3I57 A;  1PGA A;  2QEJ C;  1EU4 A;  1C9F A;  2ON8 A;  2E6X A;  1OFF A;  3FIL A;  1N62 A;  5EE0 A;  4WIP A;  4EE2 A;  2RMM A;  3ZJV A;  2J4X A;  4L1B A;  3IT4 B;  2W54 A;  3AMZ A;  1ZP0 B;  2VZK B;  2BYT A;  1VRA B;  2DBY A;  4RGN A;  1TY0 A;  1V1P B;  4OZC A;  1I4X A;  3I9V 1;  3PO0 A;  2PVO D;  1BUI C;  2WXG A;  2LHD A;  2LHE A;  4A8X C;  1F2R C;  2JSV X;  3MHZ A;  2SEB D;  4A6Q A;  2D5G A;  2M0A A;  2VZK D;  1GPX A;  1SXT A;  3HUI A;  2KDM A;  3TEX A;  3ZJT A;  2K3U A;  5LNK 1;  2JYT A;  1E0Z A;  1Q10 A;  2W82 A;  2NTT A;  4JX1 C;  2LUM A;  3MFG A;  3AH7 A;  4ITK A;  4KGR A;  2WXL A;  2W55 A;  1KLU D;  1TY2 A;  2L83 A;  4ZHP A;  2IJ0 A;  2Y5C A;  1PGX A;  2JX5 A;  1SE2 A;  2N9L A;  1M4V A;  1TS4 A;  2IPK D;  3IXS A;  4OHJ A;  1KF6 B;  2MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...