1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane usher protein fimD
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
3BWUD 4B0MA 1ZE3D 1ZDXA 3RFZB 4B0EA 1ZDVA 4J3OD
chains in the Genus database with same CATH superfamily
3QARA 2WU5B 3HK0A 5DPRA 2BF8B 4HDOA 1QKZA 1RFKA 1VR9A 3ML8A 3E56A 3MTNB 3QWZB 4N59A 3KUDB 4A6QA 3W5UB 4WWMA 5J2RA 4K3BA 2LGYA 2KMAA 3EUB2 3QA8A 4WAAA 2NBVB 2KHWB 3Q3JA 2KX3A 1WYWB 2JZ3B 1FD6A 1PGAA 1SBBB 1EU4A 3GE8C 3B0AA 3MHZA 3A1QA 1NI3A 1QOGA 3B2FA 1C76A 4NJCA 1SE3A 2FCQA 5D2MB 2RR9A 1R4MI 1I4PA 4OW0A 1KLVA 2XK5B 2BKFA 2MBHA 5G2NA 4FULA 2FIFA 3ZGZA 3Q8AA 4KKIA 3WAPA 3DBSA 1AWDA 1F77A 2NS5A 1TYGB 2KX0A 4LNKA 4M00A 2ZZPB 4JPSA 2KTRA 1Y8RC 2WDTB 4KVGB 3L13A 2JRHA 2OEDA 4L2YA 1GPXA 1UGJA 4BKSD 4TQ0A 1XCQL 3MFGA 4W9HA 1GNUA 1V5TA 1WX8A 5G5GA 3ZKJC 3AN1A 4HKQA 3Q8EA 4XZ4A 3C8YA 2K6QA 1MFWA 1Z5SB 4RGOS 3UIPB 3PSEB 3DVNU 4RGMA 5GMVA 1FNWA 3C0RB 2BKRB 3IT6B 2KDIA 5CHWA 2INNE 2BS3B 4KSLC 4P7IA 3RFZB 2BBCA 1WWTA 2BPSA 4RGNA 1P7EA 3BVZA 2MRPA 1FFVA 2PIAA 1SSNA 4J6IA 4II3B 2KJRA 2GB1A 5JZEB 2MCNB 1DYQA 2IY1B 1WGYA 2JZZA 1FNUA 1PQSA 1WXAA 4P1BC 1MG4A 1D3ZA 3JSVA 2B76B 1EF1A 4AWJA 1XLNA 3IFWB 1BUIC 1I4HA 5IAAC 1C79A 3TUOA 2KKCA 1RWSA 3PT2B 2BWFA 1VZ6A 3H8HA 2KAJA 4OVUA 4F1SA 2GBJA 4ZHOA 4NJ6A 3PLVA 4US8A 4DQOC 3TCAA 2Y5PA 3ABVB 1PDXA 1TTNA 1M94A 4JIOU 3QC8B 2KVZA 1HTQA 5HI1A 4BOSC 3NVWA 2ZCCA 3A9JB 4HPLB 2Y3AA 5JXVA 3E9SA 1V80A 1T3QA 1QLBB 2ZCBA 3RNBC 5LXIB 2BB6A 3P63A 2CHXA 4HRSA 1MJDA 2JYTA 2QMTA 4ZRJA 1F1HA 1IGDA 1R4NB 4BZAA 2KZRA 5AZFA 2L05A 5H92C 2DX5B 4C80A 2KTRB 4WJPA 3M3JA 4IWOA 2PTLA 2LZ6A 2XEWA 5JHBA 1P98A 4DHJB 4XE0A 3Q2AC 3TL5A 2BWES 1ZP0B 3VXWA 2X38A 2WU2B 3L08A 3QQ8B 4IM2A 4KIKA 3T9LA 4KDIC 3MJWA 2N1VA 3BVMA 2EKEC 3GS2A 3NZUA 3NY5A 1Y56A 2LXAA 3DCGA 2DYOA 4A90A 3ONSA 1KFYB 1T0RC 4A9AA 2MX2A 4MGIE 1L4ZB 2OOBB 1IYFA 3NS8A 3S2AA 2W82A 2DHZA 2W3SA 3U52E 4HPPA 3HVDA 1ZKHA 2ZNVB 3U7DA 4MGYE 1QQRA 4GLSC 2KWCA 3AE6B 2KWDA 3QAQA 3R3MA 4RM8A 4C00A 4BKGA 5C23A 2VZKB 4ZRPA 2D07B 1R4NI 5AUIA 2GBMA 2DYBA 1YX6B 4MM3A 3Q6BA 3ALBA 2Y5CA 3UGBB 3AE7B 3P1MA 4NQLB 3VQIA 1RAXA 1YMHE 3PRPB 5BYQA 1YN5A 1EWCA 1JRPA 1ZDVA 3K9PB 4FA6A 3GOEA 2LMCA 3B2GA 1YJIA 4HVBA 1XO3A 1OTRB 4L23A 4IOIE 1JWSD 3NS1A 3VH3B 4G0NB 3DVNV 1XF5L 1KH0A 2CHWA 3AH7A 1XLPA 2N9XA 1TKGA 2ZPNA 4PT5A 2AEHA 1YQ3B 1PYWD 3H6NA 3SDLC 3HM6X 1WXQA 4ZDVA 2M8SA 5IP4D 2JQRB 4PS7A 2NBWB 3CSTA 1WI0A 2PW9A 2O2VB 2W55A 2KANA 1ZXHA 3APDA 5DPSA 1WX7A 3P4SB 4GXBA 5AZGA 3SD5A 3I3TB 3MJ5A 1SIJA 2MBOA 4D2KA 4RCOA 3EECA 1NI2A 1V1PA 2KOXA 1UBIA 1F2RI 1N63A 1N5WA 2BYTA 4DXGA 2IO0B 3BVGA 2QC8A 1TBEA 2BGFA 1GOZA 2V3SA 1C1YB 3UIOB 3IBEA 3I5JC 3BK2A 2K0PA 2JPHA 3P2BA 2JX5A 2VH2A 3QX1A 1LO5D 4GSWA 3JYUA 2FCSA 3DHHC 4N9F4 3DBLI 2CHZA 1L4DB 3J9CA 4WQMA 4LDTD 1E8ZA 1L0YB 2KDFB 3AEFB 4BKSA 5DPWA 1E7UA 3NJTA 3VDZA 4GDKB 1VZ7A 3FKYA 2BVCA 3ZW3A 4XWWA 2KWUB 2LUEA 4AJYB 1TZ1A 1T5XD 1CMXB 2BS4B 4WWNA 3BZDB 2INPE 5FK9C 1YIWA 4ANWA 2M0AA 4EZJA 2N1WA 1XLOA 5CHFA 1N61A 1EUVB 1ESFA 1P9DU 3BK1A 4WURA 5BMHA 2WXMA 3ZQ4A 4B0EA 5C1ZA 4WIPA 4YTNB 3PZDA 1K51A 4ZRKA 3ZJVA 2KDBA 2PVGC 3P4RB 4XGAB 2RMMA 4ACFA 4HCNB 3W1SA 1MPEA 2KQSA 3VHTC 2BQQA 1PFDA 4FBJB 3AI5A 3V61A 4EUTA 4C7ZA 1TS3A 1SJED 2WXQA 3BY4B 4NZLB 1JRUA 1U4AA 3CIRB 2MSED 4HPMB 3K9OB 3V60A 4DHZB 1JMLA 1S1QB 4AS1A 2N0SB 2TSSA 4MDKE 1I4RA 3ECIA 1K53A 3A9JA 2K3UA 2WDRB 3AE8B 2GBNA 3RN9C 4TQ1A 5L95C 4A8XC 4GDLB 4MH8A 3VAWA 4LK0M 2H88B 4BBNC 2QIEB 1VCBA 1F9JA 3VRAB 3X0WA 1WE7A 3QJZA 4FLHA 3DBRB 2Z8LA 1GC7A 2WXIA 3EC8A 1EU3A 2WXOA 3Q8CA 2WXFA 1HEZE 2LRWA 4LNNA 2CR5A 4W9CA 4F8CB 3EGRA 4CQNA 3TEYA 3ZO5B 1MVKA 3AEEB 1K8RB 3NZ3A 4ANXA 1WXVA 2INCC 1SXTA 1K50A 4FN2A 2KC2A 3A4RA 2NMQA 2HJ8A 1BT0A 3U30A 4GMVA 4ZRQA 1TS5A 2MQJA 3W5VB 2AQ3B 4A20A 1YJ1A 5CTRC 1WGDA 3WAOA 2AL6A 4MEMA 4FHJA 2I1JA 2N7JA 3OJ3A 3PGEA 2V9HA 3Q3MC 1YN4A 1E6EB 3M95A 2LI5A 5TSSA 4C7YA 1MHHE 4JQWC 3VTWA 1IP9A 2ACZB 4FHKA 1UWMA 1NYRA 3SR6A 2G4SA 4I6LB 1TY2A 2ZJDA 3N32A 5CX3A 4GU2A 1ET6A 4REZA 1SGHA 3SHQA 2IBIB 3H7PB 1N60A 4AJWA 4P6VF 4CHKA 5T8IA 4ITKA 1V5OA 3BIID 1JCKB 3SFDB 4BKTA 3OJ4B 2IYDB 1J7CA 4HDQA 1KOTA 2KVRA 1TKYA 4KZCA 1WRDB 2G3QB 2FUG1 4K1RB 3PHXB 2IO2B 3N20C 4AQ7A 1WF9A 2C60A 2HDEA 5LLIA 2GRIA 5GXGB 3H7SA 3V3XA 4NAWA 2DZKA 3NVYA 1UUPA 3CSFA 1E5WA 4RFBA 4TUUA 4EE2A 4YT0B 1WFYA 1E90A 5LXHA 4II2B 5E6NA 3ZIMA 2DNFA 1OQRA 2BYFA 3VR8B 2JUOA 2LRUA 4B6WA 4K7WA 3HHMA 2PJHA 2WXKA 4MT5A 5EDSA 2O6VB 2RSUA 1ZGUB 1VLBA 4RMAA 1EO6A 3L17A 1AN8A 2IJ0A 1TY0A 3PS6A 3I9V1 3KYCD 3NZSA 4ARCA 1B1ZA 2CKHB 2EMSA 4FJZA 4RM9A 3GZNI 4MJSA 4IW0A 2MJEA 4KKJA 1WM3A 1GB1A 2V0GA 4US9A 2KJHB 2R61A 3WANA 2R2OA 2K8HA 3DWMA 3ZNGC 3ZVVA 2J4XA 3I57A 3KUCB 4TSSA 2M4NA 2LGXA 1SE9A 5IN7A 3NUHB 1J7BA 4CYEA 2WXNA 2B3AA 4RNAA 1IGCA 1OEYA 3AE5B 4G11A 3MC8A 2EKIA 2L0FA 2YLMA 1OQQA 3I63C 1R7SA 2MLBA 4WJOA 3AEBB 3PV1A 4I6PA 2KK8A 2KLCA 1ISNA 3ZDMC 2QCZA 5AEKB 3Q3NC 3L10B 2MWSB 1RFAA 2ONQA 1H8CA 1QF6A 2YEPF 2MBEA 1KRHA 1FXIA 4IWPA 4XYCA 1PGBA 1A70A 1FFUA 3AECB 2AL3A 2W3RA 4YL8A 1XXGA 2HE7A 1WJ4A 3DOWA 2FUHB 3VFKA 2R2QA 4XX5A 2FNJB 4LNOA 1WZ0A 2XBBC 1WIAA 3DHGC 2GMIC 2IGDA 2D3BA 3LB8C 3APFA 2WS3B 1NDDA 2WX1A 3PREA 4HJKA 1L0VB 4GDLA 1KF6B 3EFCA 1C4AA 3AU4A 3DWGC 2CU1A 1ZOYB 4E71A 2JU6X 3DDCB 1WH3A 5J18A 2PE6B 1WMHB 4YWGG 3ZNZB 2WLBA 1C3TA 3ZRCA 3QHTA 2C5LC 1SF0A 2CJNA 1OQYA 2V4IB 1TS4A 4MJSB 3DVGX 1F52A 1GJZA 1BMLC 3RZFA 1YD8U 5HKHA 2WXLA 3AE1B 5IOIA 1J19A 4ZYNA 3X23A 3HUIA 3H9DA 4ASWC 2Q5WD 3CMMB 4GDKA 5TR5A 3W1YA 5BYSA 2V4LA 3V6CB 3IAS1 3KUZA 3LDZE 3KVFB 1UNSA 4XDCA 4GB9A 4ICVA 1D4BA 3FILA 1HQRD 5D3DA 4IG7B 2NVUI 3DVGY 4LCDE 2AQ1B 4BFRA 2JY6A 2WDVB 2LXCA 5EE3A 2BW2A 3U7ZA 1V8CA 2L83A 5IO9A 2M19A 1JROA 2XN9C 2QILA 4G50A 3FAHA 2LD9A 2CS4A 3EHVA 1MHXA 2M0XA 3PRMB 4TMAB 1ZUD2 4M8NA 5E6JA 2KQ7A 1T0SC 1JWBD 2WQYB 2NR2A 5BO4B 4P1CC 3Q3OC 3AV8A 5G55A 4FXCA 4LNFA 2J0MA 3RNEC 3GE3C 1VDVA 4DDID 1L0XB 4HJGE 1X1MA 4OVVA 4TV3A 4URKA 4EZLA 1KTKA 2MJ3A 4YTPB 4NNJB 2BS2B 4JWUC 2C7MB 2J0KA 3AE3B 2YEPB 1Q0WB 1J7AA 4W9EA 1FCLA 2NBUA 2M1MA 4IDIA 1DGJA 1FM0D 1I35A 2LVOA 3JSVB 2GBKA 4ZOHC 1V1PB 1LXDA 3WALA 2QDFA 4Q2JA 1F2RC 4IC7B 4EZKA 4N58A 2MH7A 2ZPYA 3PZ8A 4NAMA 2WXRA 2NPTB 5FR6A 4BBNF 2EELA 5FKAC 1C4CA 3JVZX 4A55A 1N6ZA 2G4DB 3MP9A 5BMGA 1F0ZA 2VRRB 4GN1A 3URYA 2ZW1A 2BYVE 4W9GA 3N3KB 4KGSA 2L00B 1HZ6A 3BYTB 1E0ZA 3DBLB 3VVWB 1J8CA 2IO3B 1WRIA 4K7SA 5L83A 3VTVA 2PMVA 1EF5A 4JE3B 2K1FA 4YSXB 2K6DB 1N62A 5IKCM 1SE2A 2GLSA 2LWPA 1FO4A 1WGKA 4HKZE 1M4VA 3L0WB 1EM7A 4MSMB 1SE4A 1YNTE 2FE8A 2KJ6A 4YSYB 2IO1B 2KNBA 1RYJA 2D10A 1CQVA 1TJEA 1E8XA 2WP9B 5E6PA 1GC6A 4PS8A 5DPTA 2O6VA 3ZXVA 4M0WB 4WJNA 4ANUA 3TEZA 2K22A 1WGGA 3T8MA 2MW5A 2OJWA 3TBLD 3ETRA 1D5XC 4KGTA 5CHVC 3KWVA 1ZPSA 2ZVOA 4C4VA 2Y5BB 4JLCA 3KQ4A 2N9PC 2H89B 4R3DA 3ZTCA 1E8YA 4W9JA 4HCPB 3ZNID 3R8BA 2J53A 1V97A 4OZBA 2K8BA 3VUWA 2L76A 3ZJUA 2C9WB 1VD2A 3U4EG 2INDC 3IT4B 3TEXA 5DCNA 2ON8A 3RUIB 1JWAD 2AX5A 4DBGA 4EOYA 3KH0A 2L0TA 4PS3A 4RF0A 2Z0EB 1ROEA 1P7FA 3VR9B 3Q8BA 2HTME 2GBRA 1IBXA 3M62B 3TMPB 4FJVB 1C78A 2DLBA 1YQ4B 1UZXB 2IGGA 3IHPC 3IVFA 4XWTA 1E10A 4RH6A 1UH6A 2ASQA 2VZKD 3TJPA 3GZNB 4MH0E 2J7QB 4MGZE 4KSKC 2KFJA 4M8MA 1FEHA 3SU8X 3AEGB 1L7YA 4EKUA 3N9YC 1QOAA 2WXJA 2MP2A 1CZPA 3DBHB 4W9IA 3ZJTA 4WQOB 3RULA 5J17A 4DWFA 1IUEA 3KWLA 1L5PA 2OHFA 5FR3A 1UELA 2LGDA 1TKEA 2N9EB 2DYMA 1CK1A 2I38A 2LFIA 3N1XC 1DOYA 3HIZA 2GI9A 4ICUA 4KZ0A 2HTHA 3PHWB 2KACA 4C4VB 1V49A 4EEWA 3LYYA 4S0RA 1FRRA 1L6VA 4CO7A 1KLGD 4IWQA 1FMAD 1E7VA 2REXA 4ZRIA 4P16A 3V05A 1STEA 2MA9B 2V1YA 4ZHPA 2K39A 3AULA 2PVOD 1WSPA 4F7ZA 1E9MA 2L8JA 3PVLA 2BTEA 1JW9D 3UINB 1JWMD 3Q3FA 2KQ4X 1XT9B 3TIXA 1UF0A 2L1AA 2AQ2B 2UU7A 3AXCA 3VH4B 4MELA 4XC2A 4AUQC 1Q1OA 3QIJA 2N7EA 5EE1A 4GOCA 5BYRA 1V6EA 2ZEQA 4E3CA 3AMZA 2BYEA 3PZ7A 4K7UA 4HK2A 4GGQA 3PO0A 1SB3C 2ZNVC 5AUKA 2MBBB 2HJ1A 4LDTB 1MI0A 3RPFC 2KXJA 3VUYA 2I2YA 1R4MB 1VZ8A 1Q10A 1TS2A 1TGZB 2GOWA 1WZ3A 1V86A 4OHJA 4HXDA 4W9LA 1P3QU 1HZ5A 3BINA 3HM3A 1PGXA 3RNCC 4W9DA 2E3TA 3HVZA 4W9FA 3W1SC 3OG5A 2RGFA 2L3ZA 4KX6B 3U2SC 3WAMA 1LQBA 1H4RA 2MP2B 4OZCA 1XLQA 1Z2MA 2FCNA 4H2AA 2FCMA 1WYGA 1VJKA 3NRZA 3ZTDA 2KO3A 1KM7A 5BMIA 5G5HA 2WDQB 1V2YA 2PE9A 3A9KA 1WX9A 2KWVB 4IKGA 2J52A 1AYFA 1Q5WB 2ZW0A 3UI3A 4JGHB 4DXFA 2IGHA 1VRAB 3RT3B 1L6UA 1D5ZC 4FADA 3T3OA 4NJ7A 1DOXA 2NPTA 3PRZA 4LLGM 4BOZB 1OEYJ 4ZYSA 2JXTA 2LVPA 1JWUD 2JZPA 2N4FA 2KN5A 4NAWB 1ZDXA 4DHJD 2DZIA 2BB5A 1I7HA 5D3IB 1J0GA 4L1BA 1WGRA 2KDMA 3P4PB 4KV2A 3DHIC 4GIVA 4J3OD 2WYQA 2DENB 4KDLB 1YJJA 2MBQA 4WH4A 2WXHA 4LTUA 1ENFA 3UF8A 3CF6E 1V1OA 3EA6A 1LM8B 3A33B 1SEBD 4WAFA 4KIKB 2J42A 4N6EB 1C77A 1C9FA 3TEWA 1A5RA 2KD0A 2QJLA 1KJTA 4PK1A 3O13A 5C3JB 5JHAA 1WR1A 2L52A 4LJPB 3RMKC 4BAXA 4BVUC 1WMHA 3IXSA 2MHJA 4PYZA 2SAKA 1GB4A 2CU3A 2JXXA 3PLUA 2A5UA 2WHIA 1I4GA 2KYWA 1N5XA 4M01A 1P1AA 2OJRA 3Q8FA 1V81A 1D6EC 1K52A 2VH1A 1GG3A 1XD3B 1OGWA 1BXTA 2ICIA 4QAYA 3JW0X 1WGHA 4M02A 1JALA 4WWPA 3BWUD 4ARIA 1C4PA 4LNIA 2KMCA 2FAZA 2JF5A 3KYDD 1SIFA 4AOFA 2NTSA 3CWIA 1E7PB 2LUMA 1QOFA 1FPYA 4EFOA 3ZXRA 1FRDA 1MG8A 3W9CB 1FCCC 1YN3A 2I1KA 4NY0A 1RRBA 3L54A 2WXGA 1UD7A 3V62A 2LGSA 4X57B 4I6NB 4UDUC 1NBFC 3N1YC 2C7HA 4W9KA 1TT5B 4B0MA 2AYOB 3ZNHB 1L2NA 3Q69A 1WXMA 2JWZA 3W2DA 2LGIA 3LXFA 5D94A 3NVZA 2JT4B 1E8WA 2IY0B 2KMMA 1HE8A 2NTTA 4HEA1 4WWOA 2K8CA 3R7QA 1LFDA 2DZMA 2CJOA 1SJHD 5IA7A 3SFEB 1KLUD 3IG3A 3DBRI 2IDYA 5HG2A 3WCQA 4YXDB 3A1QB 1B9RA 4YTMB 3PPAA 3PTFC 2LJIA 1P0RA 1FIQA 2YVCA 2JVCA 4KGRA 3R7RA 3MC0B 3ML9A 2BT6A 4S17A 3OWEB 2N9LA 4WJQA 2PLPA 2D2QA 1T6BX 1WR6E 3RNGC 2K9XA 2KDEB 4RF1A 2WNMA 2K25A 1EWYC 2HD5B 1FXAA 4XDDA 5MPOA 1UWXA 3LJ3A 2DAJA 2LEKA 3IAM1 2JRIB 2DWQA 4DXAB 4G3XB 5EE0A 3EFUA 2MJDA 3MC9A 2UWQA 2WGSA 1UBQA 4K81A 2G9HD 4FJYA 5H8YE 5EE9A 3FC4A 1HXYD 2W54A 1I4XA 3R2TA 2PPHA 3RI7C 3NVVA 4RGTA 3VUXA 2D3GA 4C56C 3ZDTA 1TZOA 1I42A 3RZWC 1PUTA 3C19A 5C2TB 2KN4A 4OVZA 2RD0A 4HLEA 1RLFA 2XNAC 2RPQA 1TIFA 1ACCA 3ZYYX 2QSDA 1T0YA 1OFFA 4IM0A 1XCTL 2KC1A 3AU5A 1QT9A 2NCNA 2G1EA 2D3CA 3DPDA 5KHQA 1WJ6A 5D7GA 2RDHA 3M63B 2Z59B 4YSZB 1D5MC 4NQKE 2AWTA 2IZVB 3ZUNA 2D11A 3U8ZA 4M0WA 5JH5C 1YX5B 2KFKA 3A9KB 3APCA 1WY8A 3KLSX 3NG0A 3AEDB 3T3NA 2IPKD 3RD2A 3UQAA 4NPNA 2JWUA 3QK0A 1XQQA 4JWSC 3A4SC 2J0JA 1GAQB 2RPVA 2V3NA 4AP4C 3D32A 2FIDA 3L4PA 3ENEA 2DAFA 3RYTA 2A4ZA 2WX0A 2ZVNA 3AE2B 2WWZA 1V9JA 5LNK1 3N30A 1S3SG 2K5PA 3RCZA 3NOBA 2N9KA 4A3OA 5AZHA 4JX1C 1YOVB 2WXPA 1ET9A 3R2IA 1UGMA 3DBHI 5E6OA 4O1NA 4TKNA 2L32A 4IUMB 3RNFC 1WE6A 2LHEA 1QILA 2PKOA 3GP7A 1I4QA 3H7PA 3H1UA 5D6JB 4B95A 4DHZE 3AE9B 2G45B 2LVQA 1T0QC 2LJ5A 1AARA 3VTUA 2PEAA 4USAA 1JQ4A 1CJEA 3HRDD 4MM3B 1XEEA 3WA0A 2E6XA 2KT7A 1NEKB 4DDGD 3Q14C 3B1LX 3MHSD 4E74A 2DBYA 3ZLZA 2KFKB 1YQBA 3SEBA 5HHDG 1ZXIA 4A3PA 3DQVA 2W9NA 2N7DA 1FNVA 2FBWB 1RM6C 3AM9A 1HTOA 5KHOA 4JL9A 3P4QB 3RNAC 3N1ZC 5I4DA 2SEBD 4OZAA 3WIMA 1DOIA 2DZJA 3KW5B 1WXSA 2JSVX 2X8XX 1LGRA 1WJUA 3NHEB 1QOBA 3UQBA 3ZRFA 3OLMD 1GUAB 3R66C 1WJNA 3B08A 1QZEA 1NVID 2MEKA 4K3CA 2LHDA 4MACA 1WM2A 2D5GA 3AB5A 1AW7A 2M56B 1IPGA 1HA5A 4HROA 1G6JA 2O2VA 2Z0DB 3P42A 2M17A 2V3PA 2L7RA 3TSSA 2RDGA 1NYQA 2UYZB 3FILB 3OAWA 4MGKE 2RDBC 2KLGA 1ZE3D 4MSQB 4HWIB 2XK5A 3BYYB 3O65B 1IBXB 4DK5A 3L16A 3QCAA 4LJOB 2KTFA 2EMTA 4PYUA 2QEJC 3B9JA 1NENB 3GB1A 1ZW7A 2O6VD 3AE4B 3VRBB 2QHOA 4IM3A 1FXTB 3V6EB 2LASA 2C7NB 4ANVA 3AEAB 2JYEA 2D3AA 4B9KA 5HFYA
chains in the Genus database with same CATH topology
1K51A 5E6JA 4WH4A 3ZJVA 2WXHA 2WU5B 1JWBD 2WQYB 4LTUA 1ENFA 2PVGC 1V1OA 3P4RB 3AV8A 1QKZA 1RFKA 1VR9A 4FXCA 3E56A 3EA6A 2RMMA 1SEBD 4WAFA 3W1SA 2J42A 4N6EB 1C77A 1C9FA 1MPEA 3TEWA 1VDVA 4N59A 1PFDA 2QJLA 1L0XB 4HJGE 4C7ZA 3O13A 1TS3A 4A6QA 1SJED 1KTKA 2MJ3A 4WWMA 3W5UB 2WXQA 5C3JB 4YTPB 2BS2B 4JWUC 4NZLB 2L52A 3EUB2 3CIRB 3AE3B 2YEPB 1J7AA 3IXSA 1FCLA 1JMLA 1FD6A 1PGAA 1SBBB 1EU4A 2SAKA 1GB4A 4IDIA 1DGJA 1FM0D 2CU3A 4AS1A 3MHZA 2N0SB 2TSSA 1I4RA 1NI3A 1I4GA 1K53A 1QOGA 1C76A 1V1PB 3B2FA 4ZOHC 2K3UA 2WDRB 3AE8B 1F2RC 4Q2JA 1N5XA 4N58A 4TQ1A 4NJCA 4A8XC 1SE3A 2MH7A 4GDLB 4MH8A 3PZ8A 3Q8FA 4LK0M 4NAMA 2H88B 2WXRA 1D6EC 1I4PA 2QIEB 1K52A 4OW0A 3VRAB 1BXTA 2EELA 2ICIA 5FKAC 1C4CA 1JALA 2Z8LA 3BWUD 4ARIA 4A55A 3ZGZA 1C4PA 2WXIA 3Q8AA 3MP9A 1EU3A 2WXOA 3Q8CA 4KKIA 5BMGA 1F0ZA 2WXFA 1AWDA 1F77A 1HEZE 1TYGB 2NTSA 3CWIA 1E7PB 2LUMA 1QOFA 3URYA 1FRDA 2ZW1A 4JPSA 3EGRA 3W9CB 1FCCC 1YN3A 4KGSA 1HZ6A 4CQNA 3BYTB 3TEYA 2OEDA 4L2YA 1E0ZA 1GPXA 1MVKA 1UGJA 3AEEB 2WXGA 1WRIA 3NZ3A 4TQ0A 1XCQL 3MFGA 4UDUC 2PMVA 1SXTA 4JE3B 1K50A 4YSXB 5G5GA 3AN1A 1N62A 1SE2A 4HKQA 3Q8EA 3C8YA 1FO4A 1WGKA 4HKZE 4RGOS 4B0MA 2NMQA 1M4VA 1EM7A 3Q69A 4RGMA 3W2DA 4ZRQA 1SE4A 1TS5A 1YNTE 2FE8A 1FNWA 2LGIA 3LXFA 4YSYB 3IT6B 3W5VB 3NVZA 2AQ3B 1RYJA 2INNE 1CQVA 1TJEA 2BS3B 2WP9B 2KMMA 2NTTA 4HEA1 3RFZB 2BBCA 1WWTA 4RGNA 1P7EA 2CJOA 3BVZA 1SJHD 2N7JA 3SFEB 1FFVA 3TEZA 2K22A 1KLUD 2PIAA 1SSNA 2IDYA 1YN4A 1E6EB 2GB1A 5HG2A 3WCQA 4YXDB 5TSSA 4C7YA 1MHHE 1DYQA 3ETRA 1B9RA 4YTMB 1D5XC 2ACZB 4KGTA 1FNUA 4TMAB 3KWVA 1ZPSA 2LJIA 1UWMA 1NYRA 1FIQA 3SR6A 1TY2A 3KQ4A 4KGRA 2H89B 2B76B 1ET6A 4R3DA 3MC0B 1XLNA 4REZA 1BUIC 1I4HA 2BT6A 1C79A 3R8BA 2J53A 3OWEB 3TUOA 1V97A 2N9LA 4OZBA 2PLPA 1RWSA 1N60A 1T6BX 3ZJUA 1VZ6A 4P6VF 3U4EG 5T8IA 2K9XA 4ITKA 3BIID 3IT4B 4RF1A 3TEXA 1JCKB 2WNMA 3SFDB 3H8HA 2KAJA 1EWYC 1FXAA 4XDDA 1J7CA 5MPOA 1UWXA 4ZHOA 2ON8A 4US8A 4DQOC 2Y5PA 3ABVB 2LEKA 3IAM1 1TKYA 2DWQA 1JWAD 5EE0A 1PDXA 2AX5A 2MJDA 2FUG1 2G9HD 5H8YE 5EE9A 4AQ7A 3FC4A 1HXYD 2W54A 1I4XA 3R2TA 5HI1A 2HDEA 4RF0A 2GRIA 1ROEA 1P7FA 3NVWA 3Q8BA 5GXGB 3VR9B 3NVVA 4RGTA 2HTME 3V3XA 2Y3AA 5JXVA 1IBXA 4C56C 3NVYA 1UUPA 3E9SA 4RFBA 4EE2A 1C78A 1T3QA 1TZOA 1QLBB 2DLBA 1YQ4B 4YT0B 2IGGA 4XWTA 1E10A 4RH6A 1PUTA 2VZKD 5C2TB 2KN4A 2BB6A 3P63A 4HRSA 4OVZA 2JYTA 2QMTA 1IGDA 1OQRA 3VR8B 2XNAC 1FEHA 1ACCA 5H92C 3AEGB 4C80A 3ZYYX 2QSDA 3N9YC 1QOAA 2WXJA 2WXKA 2PTLA 4MT5A 1CZPA 1OFFA 1XCTL 1QT9A 1VLBA 4XE0A 3ZJTA 1AN8A 2G1EA 1ZP0B 2IJ0A 1TY0A 1IUEA 2WU2B 2X38A 1L5PA 2RDHA 3KWLA 3I9V1 5D7GA 2OHFA 5FR3A 4YSZB 1D5MC 1TKEA 3BVMA 4ARCA 1B1ZA 2DYMA 3GS2A 1CK1A 2I38A 4M0WA 2LFIA 1DOYA 2MJEA 4KKJA 1Y56A 1GB1A 2V0GA 2GI9A 2DYOA 3KLSX 4A90A 3AEDB 1KFYB 4US9A 2R61A 4A9AA 3T3NA 1L4ZB 2KACA 2IPKD 3LYYA 2JWUA 2W82A 3DWMA 2J4XA 2W3SA 3I57A 4TSSA 1FRRA 3HVDA 4JWSC 3U52E 1L6VA 1GAQB 2RPVA 2V3NA 1KLGD 3NUHB 3L4PA 1J7BA 1QQRA 4GLSC 1FMAD 2WXNA 3AE6B 2KWDA 3AE2B 4P16A 4RNAA 3V05A 1STEA 1IGCA 5LNK1 2K5PA 3AE5B 2VZKB 4ZHPA 4ZRPA 2PVOD 1WSPA 2N9KA 1E9MA 2BTEA 4JX1C 1JW9D 5AUIA 1JWMD 2WXPA 2EKIA 2KQ4X 1ET9A 3R2IA 2L1AA 2AQ2B 2Y5CA 3AE7B 3P1MA 4O1NA 3VQIA 1OQQA 1YMHE 2L32A 5BYQA 1YN5A 1R7SA 1EWCA 1JRPA 2LHEA 1ZDVA 3AEBB 1QILA 2PKOA 5EE1A 2LMCA 3B2GA 3GP7A 5BYRA 1I4QA 1YJIA 1XO3A 2ONQA 3AMZA 3PZ7A 4L23A 4IOIE 2YEPF 1QF6A 1KRHA 1FXIA 3PO0A 1JWSD 3AE9B 3NS1A 1SB3C 5AUKA 1PGBA 1A70A 1FFUA 3AECB 2W3RA 1XF5L 1KH0A 1XXGA 3AH7A 4USAA 1XLPA 1JQ4A 1TKGA 1CJEA 1MI0A 3HRDD 3RPFC 4PT5A 2I2YA 4MM3B 1VZ8A 1XEEA 1YQ3B 1Q10A 1TS2A 2E6XA 1PYWD 1NEKB 1WXQA 2DBYA 2IGDA 4OHJA 2JQRB 3SEBA 5HHDG 1HZ5A 3LB8C 1ZXIA 2WS3B 2PW9A 1PGXA 2W55A 1ZXHA 1L0VB 2E3TA 1KF6B 1FNVA 1C4AA 2FBWB 3P4SB 3DWGC 3HVZA 1RM6C 3MJ5A 1ZOYB 3AM9A 2JU6X 1SIJA 4D2KA 4RCOA 3P4QB 4YWGG 2WLBA 4KX6B 5I4DA 2SEBD 4OZAA 1V1PA 3U2SC 4OZCA 1F2RI 1N63A 1SF0A 1N5WA 2BYTA 1DOIA 4DXGA 2CJNA 1XLQA 2V4IB 3BVGA 1TS4A 2JSVX 4H2AA 1WYGA 1BMLC 1QOBA 1GOZA 1VJKA 2WXLA 3NRZA 3AE1B 3BK2A 2K0PA 5BMIA 2MEKA 1NVID 3HUIA 5G5HA 2WDQB 2JX5A 2LHDA 2Q5WD 4MACA 1LO5D 2D5GA 3AB5A 1AW7A 2M56B 1HA5A 4HROA 5BYSA 3P42A 4IKGA 2J52A 1AYFA 1L4DB 2ZW0A 2V3PA 3J9CA 3UI3A 4WQMA 2RDGA 3IAS1 1L0YB 3TSSA 4DXFA 1NYQA 2IGHA 1VRAB 3AEFB 3FILB 1L6UA 1D5ZC 1DOXA 3T3OA 4GDKB 1VZ7A 1UNSA 4XDCA 4LLGM 1D4BA 1ZE3D 3FILA 4XWWA 1HQRD 5D3DA 4ZYSA 2JXTA 1JWUD 1T5XD 2AQ1B 3BYYB 2JZPA 2BS4B 4NAWB 1IBXB 1ZDXA 2WDVB 5EE3A 2BW2A 3BZDB 2BB5A 1I7HA 2INPE 5D3IB 3U7ZA 1V8CA 2L83A 4L1BA 5FK9C 2M19A 2KDMA 2QEJC 2M0AA 1JROA 2XN9C 1XLOA 3B9JA 2QILA 3P4PB 1NENB 1N61A 1ESFA 3GB1A 3BK1A 4WURA 5BMHA 2WXMA 3AE4B 3FAHA 3VRBB 3ZQ4A 4B0EA 4J3OD 4WIPA 4YTNB 1YJJA 1MHXA 3AEAB 2JYEA 5HFYA 1ZUD2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWU D;  4B0M A;  1ZE3 D;  1ZDX A;  3RFZ B;  4B0E A;  1ZDV A;  4J3O D; 
#chains in the Genus database with same CATH topology
 3QAR A;  2WU5 B;  3HK0 A;  5DPR A;  2BF8 B;  4HDO A;  1QKZ A;  1RFK A;  1VR9 A;  3ML8 A;  3E56 A;  3MTN B;  3QWZ B;  4N59 A;  3KUD B;  4A6Q A;  3W5U B;  4WWM A;  5J2R A;  4K3B A;  2LGY A;  2KMA A;  3EUB 2;  3QA8 A;  4WAA A;  2NBV B;  2KHW B;  3Q3J A;  2KX3 A;  1WYW B;  2JZ3 B;  1FD6 A;  1PGA A;  1SBB B;  1EU4 A;  3GE8 C;  3B0A A;  3MHZ A;  3A1Q A;  1NI3 A;  1QOG A;  3B2F A;  1C76 A;  4NJC A;  1SE3 A;  2FCQ A;  5D2M B;  2RR9 A;  1R4M I;  1I4P A;  4OW0 A;  1KLV A;  2XK5 B;  2BKF A;  2MBH A;  5G2N A;  4FUL A;  2FIF A;  3ZGZ A;  3Q8A A;  4KKI A;  3WAP A;  3DBS A;  1AWD A;  1F77 A;  2NS5 A;  1TYG B;  2KX0 A;  4LNK A;  4M00 A;  2ZZP B;  4JPS A;  2KTR A;  1Y8R C;  2WDT B;  4KVG B;  3L13 A;  2JRH A;  2OED A;  4L2Y A;  1GPX A;  1UGJ A;  4BKS D;  4TQ0 A;  1XCQ L;  3MFG A;  4W9H A;  1GNU A;  1V5T A;  1WX8 A;  5G5G A;  3ZKJ C;  3AN1 A;  4HKQ A;  3Q8E A;  4XZ4 A;  3C8Y A;  2K6Q A;  1MFW A;  1Z5S B;  4RGO S;  3UIP B;  3PSE B;  3DVN U;  4RGM A;  5GMV A;  1FNW A;  3C0R B;  2BKR B;  3IT6 B;  2KDI A;  5CHW A;  2INN E;  2BS3 B;  4KSL C;  4P7I A;  3RFZ B;  2BBC A;  1WWT A;  2BPS A;  4RGN A;  1P7E A;  3BVZ A;  2MRP A;  1FFV A;  2PIA A;  1SSN A;  4J6I A;  4II3 B;  2KJR A;  2GB1 A;  5JZE B;  2MCN B;  1DYQ A;  2IY1 B;  1WGY A;  2JZZ A;  1FNU A;  1PQS A;  1WXA A;  4P1B C;  1MG4 A;  1D3Z A;  3JSV A;  2B76 B;  1EF1 A;  4AWJ A;  1XLN A;  3IFW B;  1BUI C;  1I4H A;  5IAA C;  1C79 A;  3TUO A;  2KKC A;  1RWS A;  3PT2 B;  2BWF A;  1VZ6 A;  3H8H A;  2KAJ A;  4OVU A;  4F1S A;  2GBJ A;  4ZHO A;  4NJ6 A;  3PLV A;  4US8 A;  4DQO C;  3TCA A;  2Y5P A;  3ABV B;  1PDX A;  1TTN A;  1M94 A;  4JIO U;  3QC8 B;  2KVZ A;  1HTQ A;  5HI1 A;  4BOS C;  3NVW A;  2ZCC A;  3A9J B;  4HPL B;  2Y3A A;  5JXV A;  3E9S A;  1V80 A;  1T3Q A;  1QLB B;  2ZCB A;  3RNB C;  5LXI B;  2BB6 A;  3P63 A;  2CHX A;  4HRS A;  1MJD A;  2JYT A;  2QMT A;  4ZRJ A;  1F1H A;  1IGD A;  1R4N B;  4BZA A;  2KZR A;  5AZF A;  2L05 A;  5H92 C;  2DX5 B;  4C80 A;  2KTR B;  4WJP A;  3M3J A;  4IWO A;  2PTL A;  2LZ6 A;  2XEW A;  5JHB A;  1P98 A;  4DHJ B;  4XE0 A;  3Q2A C;  3TL5 A;  2BWE S;  1ZP0 B;  3VXW A;  2X38 A;  2WU2 B;  3L08 A;  3QQ8 B;  4IM2 A;  4KIK A;  3T9L A;  4KDI C;  3MJW A;  2N1V A;  3BVM A;  2EKE C;  3GS2 A;  3NZU A;  3NY5 A;  1Y56 A;  2LXA A;  3DCG A;  2DYO A;  4A90 A;  3ONS A;  1KFY B;  1T0R C;  4A9A A;  2MX2 A;  4MGI E;  1L4Z B;  2OOB B;  1IYF A;  3NS8 A;  3S2A A;  2W82 A;  2DHZ A;  2W3S A;  3U52 E;  4HPP A;  3HVD A;  1ZKH A;  2ZNV B;  3U7D A;  4MGY E;  1QQR A;  4GLS C;  2KWC A;  3AE6 B;  2KWD A;  3QAQ A;  3R3M A;  4RM8 A;  4C00 A;  4BKG A;  5C23 A;  2VZK B;  4ZRP A;  2D07 B;  1R4N I;  5AUI A;  2GBM A;  2DYB A;  1YX6 B;  4MM3 A;  3Q6B A;  3ALB A;  2Y5C A;  3UGB B;  3AE7 B;  3P1M A;  4NQL B;  3VQI A;  1RAX A;  1YMH E;  3PRP B;  5BYQ A;  1YN5 A;  1EWC A;  1JRP A;  1ZDV A;  3K9P B;  4FA6 A;  3GOE A;  2LMC A;  3B2G A;  1YJI A;  4HVB A;  1XO3 A;  1OTR B;  4L23 A;  4IOI E;  1JWS D;  3NS1 A;  3VH3 B;  4G0N B;  3DVN V;  1XF5 L;  1KH0 A;  2CHW A;  3AH7 A;  1XLP A;  2N9X A;  1TKG A;  2ZPN A;  4PT5 A;  2AEH A;  1YQ3 B;  1PYW D;  3H6N A;  3SDL C;  3HM6 X;  1WXQ A;  4ZDV A;  2M8S A;  5IP4 D;  2JQR B;  4PS7 A;  2NBW B;  3CST A;  1WI0 A;  2PW9 A;  2O2V B;  2W55 A;  2KAN A;  1ZXH A;  3APD A;  5DPS A;  1WX7 A;  3P4S B;  4GXB A;  5AZG A;  3SD5 A;  3I3T B;  3MJ5 A;  1SIJ A;  2MBO A;  4D2K A;  4RCO A;  3EEC A;  1NI2 A;  1V1P A;  2KOX A;  1UBI A;  1F2R I;  1N63 A;  1N5W A;  2BYT A;  4DXG A;  2IO0 B;  3BVG A;  2QC8 A;  1TBE A;  2BGF A;  1GOZ A;  2V3S A;  1C1Y B;  3UIO B;  3IBE A;  3I5J C;  3BK2 A;  2K0P A;  2JPH A;  3P2B A;  2JX5 A;  2VH2 A;  3QX1 A;  1LO5 D;  4GSW A;  3JYU A;  2FCS A;  3DHH C;  4N9F 4;  3DBL I;  2CHZ A;  1L4D B;  3J9C A;  4WQM A;  4LDT D;  1E8Z A;  1L0Y B;  2KDF B;  3AEF B;  4BKS A;  5DPW A;  1E7U A;  3NJT A;  3VDZ A;  4GDK B;  1VZ7 A;  3FKY A;  2BVC A;  3ZW3 A;  4XWW A;  2KWU B;  2LUE A;  4AJY B;  1TZ1 A;  1T5X D;  1CMX B;  2BS4 B;  4WWN A;  3BZD B;  2INP E;  5FK9 C;  1YIW A;  4ANW A;  2M0A A;  4EZJ A;  2N1W A;  1XLO A;  5CHF A;  1N61 A;  1EUV B;  1ESF A;  1P9D U;  3BK1 A;  4WUR A;  5BMH A;  2WXM A;  3ZQ4 A;  4B0E A;  5C1Z A;  4WIP A;  4YTN B;  3PZD A;  1K51 A;  4ZRK A;  3ZJV A;  2KDB A;  2PVG C;  3P4R B;  4XGA B;  2RMM A;  4ACF A;  4HCN B;  3W1S A;  1MPE A;  2KQS A;  3VHT C;  2BQQ A;  1PFD A;  4FBJ B;  3AI5 A;  3V61 A;  4EUT A;  4C7Z A;  1TS3 A;  1SJE D;  2WXQ A;  3BY4 B;  4NZL B;  1JRU A;  1U4A A;  3CIR B;  2MSE D;  4HPM B;  3K9O B;  3V60 A;  4DHZ B;  1JML A;  1S1Q B;  4AS1 A;  2N0S B;  2TSS A;  4MDK E;  1I4R A;  3ECI A;  1K53 A;  3A9J A;  2K3U A;  2WDR B;  3AE8 B;  2GBN A;  3RN9 C;  4TQ1 A;  5L95 C;  4A8X C;  4GDL B;  4MH8 A;  3VAW A;  4LK0 M;  2H88 B;  4BBN C;  2QIE B;  1VCB A;  1F9J A;  3VRA B;  3X0W A;  1WE7 A;  3QJZ A;  4FLH A;  3DBR B;  2Z8L A;  1GC7 A;  2WXI A;  3EC8 A;  1EU3 A;  2WXO A;  3Q8C A;  2WXF A;  1HEZ E;  2LRW A;  4LNN A;  2CR5 A;  4W9C A;  4F8C B;  3EGR A;  4CQN A;  3TEY A;  3ZO5 B;  1MVK A;  3AEE B;  1K8R B;  3NZ3 A;  4ANX A;  1WXV A;  2INC C;  1SXT A;  1K50 A;  4FN2 A;  2KC2 A;  3A4R A;  2NMQ A;  2HJ8 A;  1BT0 A;  3U30 A;  4GMV A;  4ZRQ A;  1TS5 A;  2MQJ A;  3W5V B;  2AQ3 B;  4A20 A;  1YJ1 A;  5CTR C;  1WGD A;  3WAO A;  2AL6 A;  4MEM A;  4FHJ A;  2I1J A;  2N7J A;  3OJ3 A;  3PGE A;  2V9H A;  3Q3M C;  1YN4 A;  1E6E B;  3M95 A;  2LI5 A;  5TSS A;  4C7Y A;  1MHH E;  4JQW C;  3VTW A;  1IP9 A;  2ACZ B;  4FHK A;  1UWM A;  1NYR A;  3SR6 A;  2G4S A;  4I6L B;  1TY2 A;  2ZJD A;  3N32 A;  5CX3 A;  4GU2 A;  1ET6 A;  4REZ A;  1SGH A;  3SHQ A;  2IBI B;  3H7P B;  1N60 A;  4AJW A;  4P6V F;  4CHK A;  5T8I A;  4ITK A;  1V5O A;  3BII D;  1JCK B;  3SFD B;  4BKT A;  3OJ4 B;  2IYD B;  1J7C A;  4HDQ A;  1KOT A;  2KVR A;  1TKY A;  4KZC A;  1WRD B;  2G3Q B;  2FUG 1;  4K1R B;  3PHX B;  2IO2 B;  3N20 C;  4AQ7 A;  1WF9 A;  2C60 A;  2HDE A;  5LLI A;  2GRI A;  5GXG B;  3H7S A;  3V3X A;  4NAW A;  2DZK A;  3NVY A;  1UUP A;  3CSF A;  1E5W A;  4RFB A;  4TUU A;  4EE2 A;  4YT0 B;  1WFY A;  1E90 A;  5LXH A;  4II2 B;  5E6N A;  3ZIM A;  2DNF A;  1OQR A;  2BYF A;  3VR8 B;  2JUO A;  2LRU A;  4B6W A;  4K7W A;  3HHM A;  2PJH A;  2WXK A;  4MT5 A;  5EDS A;  2O6V B;  2RSU A;  1ZGU B;  1VLB A;  4RMA A;  1EO6 A;  3L17 A;  1AN8 A;  2IJ0 A;  1TY0 A;  3PS6 A;  3I9V 1;  3KYC D;  3NZS A;  4ARC A;  1B1Z A;  2CKH B;  2EMS A;  4FJZ A;  4RM9 A;  3GZN I;  4MJS A;  4IW0 A;  2MJE A;  4KKJ A;  1WM3 A;  1GB1 A;  2V0G A;  4US9 A;  2KJH B;  2R61 A;  3WAN A;  2R2O A;  2K8H A;  3DWM A;  3ZNG C;  3ZVV A;  2J4X A;  3I57 A;  3KUC B;  4TSS A;  2M4N A;  2LGX A;  1SE9 A;  5IN7 A;  3NUH B;  1J7B A;  4CYE A;  2WXN A;  2B3A A;  4RNA A;  1IGC A;  1OEY A;  3AE5 B;  4G11 A;  3MC8 A;  2EKI A;  2L0F A;  2YLM A;  1OQQ A;  3I63 C;  1R7S A;  2MLB A;  4WJO A;  3AEB B;  3PV1 A;  4I6P A;  2KK8 A;  2KLC A;  1ISN A;  3ZDM C;  2QCZ A;  5AEK B;  3Q3N C;  3L10 B;  2MWS B;  1RFA A;  2ONQ A;  1H8C A;  1QF6 A;  2YEP F;  2MBE A;  1KRH A;  1FXI A;  4IWP A;  4XYC A;  1PGB A;  1A70 A;  1FFU A;  3AEC B;  2AL3 A;  2W3R A;  4YL8 A;  1XXG A;  2HE7 A;  1WJ4 A;  3DOW A;  2FUH B;  3VFK A;  2R2Q A;  4XX5 A;  2FNJ B;  4LNO A;  1WZ0 A;  2XBB C;  1WIA A;  3DHG C;  2GMI C;  2IGD A;  2D3B A;  3LB8 C;  3APF A;  2WS3 B;  1NDD A;  2WX1 A;  3PRE A;  4HJK A;  1L0V B;  4GDL A;  1KF6 B;  3EFC A;  1C4A A;  3AU4 A;  3DWG C;  2CU1 A;  1ZOY B;  4E71 A;  2JU6 X;  3DDC B;  1WH3 A;  5J18 A;  2PE6 B;  1WMH B;  4YWG G;  3ZNZ B;  2WLB A;  1C3T A;  3ZRC A;  3QHT A;  2C5L C;  1SF0 A;  2CJN A;  1OQY A;  2V4I B;  1TS4 A;  4MJS B;  3DVG X;  1F52 A;  1GJZ A;  1BML C;  3RZF A;  1YD8 U;  5HKH A;  2WXL A;  3AE1 B;  5IOI A;  1J19 A;  4ZYN A;  3X23 A;  3HUI A;  3H9D A;  4ASW C;  2Q5W D;  3CMM B;  4GDK A;  5TR5 A;  3W1Y A;  5BYS A;  2V4L A;  3V6C B;  3IAS 1;  3KUZ A;  3LDZ E;  3KVF B;  1UNS A;  4XDC A;  4GB9 A;  4ICV A;  1D4B A;  3FIL A;  1HQR D;  5D3D A;  4IG7 B;  2NVU I;  3DVG Y;  4LCD E;  2AQ1 B;  4BFR A;  2JY6 A;  2WDV B;  2LXC A;  5EE3 A;  2BW2 A;  3U7Z A;  1V8C A;  2L83 A;  5IO9 A;  2M19 A;  1JRO A;  2XN9 C;  2QIL A;  4G50 A;  3FAH A;  2LD9 A;  2CS4 A;  3EHV A;  1MHX A;  2M0X A;  3PRM B;  4TMA B;  1ZUD 2;  4M8N A;  5E6J A;  2KQ7 A;  1T0S C;  1JWB D;  2WQY B;  2NR2 A;  5BO4 B;  4P1C C;  3Q3O C;  3AV8 A;  5G55 A;  4FXC A;  4LNF A;  2J0M A;  3RNE C;  3GE3 C;  1VDV A;  4DDI D;  1L0X B;  4HJG E;  1X1M A;  4OVV A;  4TV3 A;  4URK A;  4EZL A;  1KTK A;  2MJ3 A;  4YTP B;  4NNJ B;  2BS2 B;  4JWU C;  2C7M B;  2J0K A;  3AE3 B;  2YEP B;  1Q0W B;  1J7A A;  4W9E A;  1FCL A;  2NBU A;  2M1M A;  4IDI A;  1DGJ A;  1FM0 D;  1I35 A;  2LVO A;  3JSV B;  2GBK A;  4ZOH C;  1V1P B;  1LXD A;  3WAL A;  2QDF A;  4Q2J A;  1F2R C;  4IC7 B;  4EZK A;  4N58 A;  2MH7 A;  2ZPY A;  3PZ8 A;  4NAM A;  2WXR A;  2NPT B;  5FR6 A;  4BBN F;  2EEL A;  5FKA C;  1C4C A;  3JVZ X;  4A55 A;  1N6Z A;  2G4D B;  3MP9 A;  5BMG A;  1F0Z A;  2VRR B;  4GN1 A;  3URY A;  2ZW1 A;  2BYV E;  4W9G A;  3N3K B;  4KGS A;  2L00 B;  1HZ6 A;  3BYT B;  1E0Z A;  3DBL B;  3VVW B;  1J8C A;  2IO3 B;  1WRI A;  4K7S A;  5L83 A;  3VTV A;  2PMV A;  1EF5 A;  4JE3 B;  2K1F A;  4YSX B;  2K6D B;  1N62 A;  5IKC M;  1SE2 A;  2GLS A;  2LWP A;  1FO4 A;  1WGK A;  4HKZ E;  1M4V A;  3L0W B;  1EM7 A;  4MSM B;  1SE4 A;  1YNT E;  2FE8 A;  2KJ6 A;  4YSY B;  2IO1 B;  2KNB A;  1RYJ A;  2D10 A;  1CQV A;  1TJE A;  1E8X A;  2WP9 B;  5E6P A;  1GC6 A;  4PS8 A;  5DPT A;  2O6V A;  3ZXV A;  4M0W B;  4WJN A;  4ANU A;  3TEZ A;  2K22 A;  1WGG A;  3T8M A;  2MW5 A;  2OJW A;  3TBL D;  3ETR A;  1D5X C;  4KGT A;  5CHV C;  3KWV A;  1ZPS A;  2ZVO A;  4C4V A;  2Y5B B;  4JLC A;  3KQ4 A;  2N9P C;  2H89 B;  4R3D A;  3ZTC A;  1E8Y A;  4W9J A;  4HCP B;  3ZNI D;  3R8B A;  2J53 A;  1V97 A;  4OZB A;  2K8B A;  3VUW A;  2L76 A;  3ZJU A;  2C9W B;  1VD2 A;  3U4E G;  2IND C;  3IT4 B;  3TEX A;  5DCN A;  2ON8 A;  3RUI B;  1JWA D;  2AX5 A;  4DBG A;  4EOY A;  3KH0 A;  2L0T A;  4PS3 A;  4RF0 A;  2Z0E B;  1ROE A;  1P7F A;  3VR9 B;  3Q8B A;  2HTM E;  2GBR A;  1IBX A;  3M62 B;  3TMP B;  4FJV B;  1C78 A;  2DLB A;  1YQ4 B;  1UZX B;  2IGG A;  3IHP C;  3IVF A;  4XWT A;  1E10 A;  4RH6 A;  1UH6 A;  2ASQ A;  2VZK D;  3TJP A;  3GZN B;  4MH0 E;  2J7Q B;  4MGZ E;  4KSK C;  2KFJ A;  4M8M A;  1FEH A;  3SU8 X;  3AEG B;  1L7Y A;  4EKU A;  3N9Y C;  1QOA A;  2WXJ A;  2MP2 A;  1CZP A;  3DBH B;  4W9I A;  3ZJT A;  4WQO B;  3RUL A;  5J17 A;  4DWF A;  1IUE A;  3KWL A;  1L5P A;  2OHF A;  5FR3 A;  1UEL A;  2LGD A;  1TKE A;  2N9E B;  2DYM A;  1CK1 A;  2I38 A;  2LFI A;  3N1X C;  1DOY A;  3HIZ A;  2GI9 A;  4ICU A;  4KZ0 A;  2HTH A;  3PHW B;  2KAC A;  4C4V B;  1V49 A;  4EEW A;  3LYY A;  4S0R A;  1FRR A;  1L6V A;  4CO7 A;  1KLG D;  4IWQ A;  1FMA D;  1E7V A;  2REX A;  4ZRI A;  4P16 A;  3V05 A;  1STE A;  2MA9 B;  2V1Y A;  4ZHP A;  2K39 A;  3AUL A;  2PVO D;  1WSP A;  4F7Z A;  1E9M A;  2L8J A;  3PVL A;  2BTE A;  1JW9 D;  3UIN B;  1JWM D;  3Q3F A;  2KQ4 X;  1XT9 B;  3TIX A;  1UF0 A;  2L1A A;  2AQ2 B;  2UU7 A;  3AXC A;  3VH4 B;  4MEL A;  4XC2 A;  4AUQ C;  1Q1O A;  3QIJ A;  2N7E A;  5EE1 A;  4GOC A;  5BYR A;  1V6E A;  2ZEQ A;  4E3C A;  3AMZ A;  2BYE A;  3PZ7 A;  4K7U A;  4HK2 A;  4GGQ A;  3PO0 A;  1SB3 C;  2ZNV C;  5AUK A;  2MBB B;  2HJ1 A;  4LDT B;  1MI0 A;  3RPF C;  2KXJ A;  3VUY A;  2I2Y A;  1R4M B;  1VZ8 A;  1Q10 A;  1TS2 A;  1TGZ B;  2GOW A;  1WZ3 A;  1V86 A;  4OHJ A;  4HXD A;  4W9L A;  1P3Q U;  1HZ5 A;  3BIN A;  3HM3 A;  1PGX A;  3RNC C;  4W9D A;  2E3T A;  3HVZ A;  4W9F A;  3W1S C;  3OG5 A;  2RGF A;  2L3Z A;  4KX6 B;  3U2S C;  3WAM A;  1LQB A;  1H4R A;  2MP2 B;  4OZC A;  1XLQ A;  1Z2M A;  2FCN A;  4H2A A;  2FCM A;  1WYG A;  1VJK A;  3NRZ A;  3ZTD A;  2KO3 A;  1KM7 A;  5BMI A;  5G5H A;  2WDQ B;  1V2Y A;  2PE9 A;  3A9K A;  1WX9 A;  2KWV B;  4IKG A;  2J52 A;  1AYF A;  1Q5W B;  2ZW0 A;  3UI3 A;  4JGH B;  4DXF A;  2IGH A;  1VRA B;  3RT3 B;  1L6U A;  1D5Z C;  4FAD A;  3T3O A;  4NJ7 A;  1DOX A;  2NPT A;  3PRZ A;  4LLG M;  4BOZ B;  1OEY J;  4ZYS A;  2JXT A;  2LVP A;  1JWU D;  2JZP A;  2N4F A;  2KN5 A;  4NAW B;  1ZDX A;  4DHJ D;  2DZI A;  2BB5 A;  1I7H A;  5D3I B;  1J0G A;  4L1B A;  1WGR A;  2KDM A;  3P4P B;  4KV2 A;  3DHI C;  4GIV A;  4J3O D;  2WYQ A;  2DEN B;  4KDL B;  1YJJ A;  2MBQ A;  4WH4 A;  2WXH A;  4LTU A;  1ENF A;  3UF8 A;  3CF6 E;  1V1O A;  3EA6 A;  1LM8 B;  3A33 B;  1SEB D;  4WAF A;  4KIK B;  2J42 A;  4N6E B;  1C77 A;  1C9F A;  3TEW A;  1A5R A;  2KD0 A;  2QJL A;  1KJT A;  4PK1 A;  3O13 A;  5C3J B;  5JHA A;  1WR1 A;  2L52 A;  4LJP B;  3RMK C;  4BAX A;  4BVU C;  1WMH A;  3IXS A;  2MHJ A;  4PYZ A;  2SAK A;  1GB4 A;  2CU3 A;  2JXX A;  3PLU A;  2A5U A;  2WHI A;  1I4G A;  2KYW A;  1N5X A;  4M01 A;  1P1A A;  2OJR A;  3Q8F A;  1V81 A;  1D6E C;  1K52 A;  2VH1 A;  1GG3 A;  1XD3 B;  1OGW A;  1BXT A;  2ICI A;  4QAY A;  3JW0 X;  1WGH A;  4M02 A;  1JAL A;  4WWP A;  3BWU D;  4ARI A;  1C4P A;  4LNI A;  2KMC A;  2FAZ A;  2JF5 A;  3KYD D;  1SIF A;  4AOF A;  2NTS A;  3CWI A;  1E7P B;  2LUM A;  1QOF A;  1FPY A;  4EFO A;  3ZXR A;  1FRD A;  1MG8 A;  3W9C B;  1FCC C;  1YN3 A;  2I1K A;  4NY0 A;  1RRB A;  3L54 A;  2WXG A;  1UD7 A;  3V62 A;  2LGS A;  4X57 B;  4I6N B;  4UDU C;  1NBF C;  3N1Y C;  2C7H A;  4W9K A;  1TT5 B;  4B0M A;  2AYO B;  3ZNH B;  1L2N A;  3Q69 A;  1WXM A;  2JWZ A;  3W2D A;  2LGI A;  3LXF A;  5D94 A;  3NVZ A;  2JT4 B;  1E8W A;  2IY0 B;  2KMM A;  1HE8 A;  2NTT A;  4HEA 1;  4WWO A;  2K8C A;  3R7Q A;  1LFD A;  2DZM A;  2CJO A;  1SJH D;  5IA7 A;  3SFE B;  1KLU D;  3IG3 A;  3DBR I;  2IDY A;  5HG2 A;  3WCQ A;  4YXD B;  3A1Q B;  1B9R A;  4YTM B;  3PPA A;  3PTF C;  2LJI A;  1P0R A;  1FIQ A;  2YVC A;  2JVC A;  4KGR A;  3R7R A;  3MC0 B;  3ML9 A;  2BT6 A;  4S17 A;  3OWE B;  2N9L A;  4WJQ A;  2PLP A;  2D2Q A;  1T6B X;  1WR6 E;  3RNG C;  2K9X A;  2KDE B;  4RF1 A;  2WNM A;  2K25 A;  1EWY C;  2HD5 B;  1FXA A;  4XDD A;  5MPO A;  1UWX A;  3LJ3 A;  2DAJ A;  2LEK A;  3IAM 1;  2JRI B;  2DWQ A;  4DXA B;  4G3X B;  5EE0 A;  3EFU A;  2MJD A;  3MC9 A;  2UWQ A;  2WGS A;  1UBQ A;  4K81 A;  2G9H D;  4FJY A;  5H8Y E;  5EE9 A;  3FC4 A;  1HXY D;  2W54 A;  1I4X A;  3R2T A;  2PPH A;  3RI7 C;  3NVV A;  4RGT A;  3VUX A;  2D3G A;  4C56 C;  3ZDT A;  1TZO A;  1I42 A;  3RZW C;  1PUT A;  3C19 A;  5C2T B;  2KN4 A;  4OVZ A;  2RD0 A;  4HLE A;  1RLF A;  2XNA C;  2RPQ A;  1TIF A;  1ACC A;  3ZYY X;  2QSD A;  1T0Y A;  1OFF A;  4IM0 A;  1XCT L;  2KC1 A;  3AU5 A;  1QT9 A;  2NCN A;  2G1E A;  2D3C A;  3DPD A;  5KHQ A;  1WJ6 A;  5D7G A;  2RDH A;  3M63 B;  2Z59 B;  4YSZ B;  1D5M C;  4NQK E;  2AWT A;  2IZV B;  3ZUN A;  2D11 A;  3U8Z A;  4M0W A;  5JH5 C;  1YX5 B;  2KFK A;  3A9K B;  3APC A;  1WY8 A;  3KLS X;  3NG0 A;  3AED B;  3T3N A;  2IPK D;  3RD2 A;  3UQA A;  4NPN A;  2JWU A;  3QK0 A;  1XQQ A;  4JWS C;  3A4S C;  2J0J A;  1GAQ B;  2RPV A;  2V3N A;  4AP4 C;  3D32 A;  2FID A;  3L4P A;  3ENE A;  2DAF A;  3RYT A;  2A4Z A;  2WX0 A;  2ZVN A;  3AE2 B;  2WWZ A;  1V9J A;  5LNK 1;  3N30 A;  1S3S G;  2K5P A;  3RCZ A;  3NOB A;  2N9K A;  4A3O A;  5AZH A;  4JX1 C;  1YOV B;  2WXP A;  1ET9 A;  3R2I A;  1UGM A;  3DBH I;  5E6O A;  4O1N A;  4TKN A;  2L32 A;  4IUM B;  3RNF C;  1WE6 A;  2LHE A;  1QIL A;  2PKO A;  3GP7 A;  1I4Q A;  3H7P A;  3H1U A;  5D6J B;  4B95 A;  4DHZ E;  3AE9 B;  2G45 B;  2LVQ A;  1T0Q C;  2LJ5 A;  1AAR A;  3VTU A;  2PEA A;  4USA A;  1JQ4 A;  1CJE A;  3HRD D;  4MM3 B;  1XEE A;  3WA0 A;  2E6X A;  2KT7 A;  1NEK B;  4DDG D;  3Q14 C;  3B1L X;  3MHS D;  4E74 A;  2DBY A;  3ZLZ A;  2KFK B;  1YQB A;  3SEB A;  5HHD G;  1ZXI A;  4A3P A;  3DQV A;  2W9N A;  2N7D A;  1FNV A;  2FBW B;  1RM6 C;  3AM9 A;  1HTO A;  5KHO A;  4JL9 A;  3P4Q B;  3RNA C;  3N1Z C;  5I4D A;  2SEB D;  4OZA A;  3WIM A;  1DOI A;  2DZJ A;  3KW5 B;  1WXS A;  2JSV X;  2X8X X;  1LGR A;  1WJU A;  3NHE B;  1QOB A;  3UQB A;  3ZRF A;  3OLM D;  1GUA B;  3R66 C;  1WJN A;  3B08 A;  1QZE A;  1NVI D;  2MEK A;  4K3C A;  2LHD A;  4MAC A;  1WM2 A;  2D5G A;  3AB5 A;  1AW7 A;  2M56 B;  1IPG A;  1HA5 A;  4HRO A;  1G6J A;  2O2V A;  2Z0D B;  3P42 A;  2M17 A;  2V3P A;  2L7R A;  3TSS A;  2RDG A;  1NYQ A;  2UYZ B;  3FIL B;  3OAW A;  4MGK E;  2RDB C;  2KLG A;  1ZE3 D;  4MSQ B;  4HWI B;  2XK5 A;  3BYY B;  3O65 B;  1IBX B;  4DK5 A;  3L16 A;  3QCA A;  4LJO B;  2KTF A;  2EMT A;  4PYU A;  2QEJ C;  3B9J A;  1NEN B;  3GB1 A;  1ZW7 A;  2O6V D;  3AE4 B;  3VRB B;  2QHO A;  4IM3 A;  1FXT B;  3V6E B;  2LAS A;  2C7N B;  4ANV A;  3AEA B;  2JYE A;  2D3A A;  4B9K A;  5HFY A; 
#chains in the Genus database with same CATH homology
 1K51 A;  5E6J A;  4WH4 A;  3ZJV A;  2WXH A;  2WU5 B;  1JWB D;  2WQY B;  4LTU A;  1ENF A;  2PVG C;  1V1O A;  3P4R B;  3AV8 A;  1QKZ A;  1RFK A;  1VR9 A;  4FXC A;  3E56 A;  3EA6 A;  2RMM A;  1SEB D;  4WAF A;  3W1S A;  2J42 A;  4N6E B;  1C77 A;  1C9F A;  1MPE A;  3TEW A;  1VDV A;  4N59 A;  1PFD A;  2QJL A;  1L0X B;  4HJG E;  4C7Z A;  3O13 A;  1TS3 A;  4A6Q A;  1SJE D;  1KTK A;  2MJ3 A;  4WWM A;  3W5U B;  2WXQ A;  5C3J B;  4YTP B;  2BS2 B;  4JWU C;  4NZL B;  2L52 A;  3EUB 2;  3CIR B;  3AE3 B;  2YEP B;  1J7A A;  3IXS A;  1FCL A;  1JML A;  1FD6 A;  1PGA A;  1SBB B;  1EU4 A;  2SAK A;  1GB4 A;  4IDI A;  1DGJ A;  1FM0 D;  2CU3 A;  4AS1 A;  3MHZ A;  2N0S B;  2TSS A;  1I4R A;  1NI3 A;  1I4G A;  1K53 A;  1QOG A;  1C76 A;  1V1P B;  3B2F A;  4ZOH C;  2K3U A;  2WDR B;  3AE8 B;  1F2R C;  4Q2J A;  1N5X A;  4N58 A;  4TQ1 A;  4NJC A;  4A8X C;  1SE3 A;  2MH7 A;  4GDL B;  4MH8 A;  3PZ8 A;  3Q8F A;  4LK0 M;  4NAM A;  2H88 B;  2WXR A;  1D6E C;  1I4P A;  2QIE B;  1K52 A;  4OW0 A;  3VRA B;  1BXT A;  2EEL A;  2ICI A;  5FKA C;  1C4C A;  1JAL A;  2Z8L A;  3BWU D;  4ARI A;  4A55 A;  3ZGZ A;  1C4P A;  2WXI A;  3Q8A A;  3MP9 A;  1EU3 A;  2WXO A;  3Q8C A;  4KKI A;  5BMG A;  1F0Z A;  2WXF A;  1AWD A;  1F77 A;  1HEZ E;  1TYG B;  2NTS A;  3CWI A;  1E7P B;  2LUM A;  1QOF A;  3URY A;  1FRD A;  2ZW1 A;  4JPS A;  3EGR A;  3W9C B;  1FCC C;  1YN3 A;  4KGS A;  1HZ6 A;  4CQN A;  3BYT B;  3TEY A;  2OED A;  4L2Y A;  1E0Z A;  1GPX A;  1MVK A;  1UGJ A;  3AEE B;  2WXG A;  1WRI A;  3NZ3 A;  4TQ0 A;  1XCQ L;  3MFG A;  4UDU C;  2PMV A;  1SXT A;  4JE3 B;  1K50 A;  4YSX B;  5G5G A;  3AN1 A;  1N62 A;  1SE2 A;  4HKQ A;  3Q8E A;  3C8Y A;  1FO4 A;  1WGK A;  4HKZ E;  4RGO S;  4B0M A;  2NMQ A;  1M4V A;  1EM7 A;  3Q69 A;  4RGM A;  3W2D A;  4ZRQ A;  1SE4 A;  1TS5 A;  1YNT E;  2FE8 A;  1FNW A;  2LGI A;  3LXF A;  4YSY B;  3IT6 B;  3W5V B;  3NVZ A;  2AQ3 B;  1RYJ A;  2INN E;  1CQV A;  1TJE A;  2BS3 B;  2WP9 B;  2KMM A;  2NTT A;  4HEA 1;  3RFZ B;  2BBC A;  1WWT A;  4RGN A;  1P7E A;  2CJO A;  3BVZ A;  1SJH D;  2N7J A;  3SFE B;  1FFV A;  3TEZ A;  2K22 A;  1KLU D;  2PIA A;  1SSN A;  2IDY A;  1YN4 A;  1E6E B;  2GB1 A;  5HG2 A;  3WCQ A;  4YXD B;  5TSS A;  4C7Y A;  1MHH E;  1DYQ A;  3ETR A;  1B9R A;  4YTM B;  1D5X C;  2ACZ B;  4KGT A;  1FNU A;  4TMA B;  3KWV A;  1ZPS A;  2LJI A;  1UWM A;  1NYR A;  1FIQ A;  3SR6 A;  1TY2 A;  3KQ4 A;  4KGR A;  2H89 B;  2B76 B;  1ET6 A;  4R3D A;  3MC0 B;  1XLN A;  4REZ A;  1BUI C;  1I4H A;  2BT6 A;  1C79 A;  3R8B A;  2J53 A;  3OWE B;  3TUO A;  1V97 A;  2N9L A;  4OZB A;  2PLP A;  1RWS A;  1N60 A;  1T6B X;  3ZJU A;  1VZ6 A;  4P6V F;  3U4E G;  5T8I A;  2K9X A;  4ITK A;  3BII D;  3IT4 B;  4RF1 A;  3TEX A;  1JCK B;  2WNM A;  3SFD B;  3H8H A;  2KAJ A;  1EWY C;  1FXA A;  4XDD A;  1J7C A;  5MPO A;  1UWX A;  4ZHO A;  2ON8 A;  4US8 A;  4DQO C;  2Y5P A;  3ABV B;  2LEK A;  3IAM 1;  1TKY A;  2DWQ A;  1JWA D;  5EE0 A;  1PDX A;  2AX5 A;  2MJD A;  2FUG 1;  2G9H D;  5H8Y E;  5EE9 A;  4AQ7 A;  3FC4 A;  1HXY D;  2W54 A;  1I4X A;  3R2T A;  5HI1 A;  2HDE A;  4RF0 A;  2GRI A;  1ROE A;  1P7F A;  3NVW A;  3Q8B A;  5GXG B;  3VR9 B;  3NVV A;  4RGT A;  2HTM E;  3V3X A;  2Y3A A;  5JXV A;  1IBX A;  4C56 C;  3NVY A;  1UUP A;  3E9S A;  4RFB A;  4EE2 A;  1C78 A;  1T3Q A;  1TZO A;  1QLB B;  2DLB A;  1YQ4 B;  4YT0 B;  2IGG A;  4XWT A;  1E10 A;  4RH6 A;  1PUT A;  2VZK D;  5C2T B;  2KN4 A;  2BB6 A;  3P63 A;  4HRS A;  4OVZ A;  2JYT A;  2QMT A;  1IGD A;  1OQR A;  3VR8 B;  2XNA C;  1FEH A;  1ACC A;  5H92 C;  3AEG B;  4C80 A;  3ZYY X;  2QSD A;  3N9Y C;  1QOA A;  2WXJ A;  2WXK A;  2PTL A;  4MT5 A;  1CZP A;  1OFF A;  1XCT L;  1QT9 A;  1VLB A;  4XE0 A;  3ZJT A;  1AN8 A;  2G1E A;  1ZP0 B;  2IJ0 A;  1TY0 A;  1IUE A;  2WU2 B;  2X38 A;  1L5P A;  2RDH A;  3KWL A;  3I9V 1;  5D7G A;  2OHF A;  5FR3 A;  4YSZ B;  1D5M C;  1TKE A;  3BVM A;  4ARC A;  1B1Z A;  2DYM A;  3GS2 A;  1CK1 A;  2I38 A;  4M0W A;  2LFI A;  1DOY A;  2MJE A;  4KKJ A;  1Y56 A;  1GB1 A;  2V0G A;  2GI9 A;  2DYO A;  3KLS X;  4A90 A;  3AED B;  1KFY B;  4US9 A;  2R61 A;  4A9A A;  3T3N A;  1L4Z B;  2KAC A;  2IPK D;  3LYY A;  2JWU A;  2W82 A;  3DWM A;  2J4X A;  2W3S A;  3I57 A;  4TSS A;  1FRR A;  3HVD A;  4JWS C;  3U52 E;  1L6V A;  1GAQ B;  2RPV A;  2V3N A;  1KLG D;  3NUH B;  3L4P A;  1J7B A;  1QQR A;  4GLS C;  1FMA D;  2WXN A;  3AE6 B;  2KWD A;  3AE2 B;  4P16 A;  4RNA A;  3V05 A;  1STE A;  1IGC A;  5LNK 1;  2K5P A;  3AE5 B;  2VZK B;  4ZHP A;  4ZRP A;  2PVO D;  1WSP A;  2N9K A;  1E9M A;  2BTE A;  4JX1 C;  1JW9 D;  5AUI A;  1JWM D;  2WXP A;  2EKI A;  2KQ4 X;  1ET9 A;  3R2I A;  2L1A A;  2AQ2 B;  2Y5C A;  3AE7 B;  3P1M A;  4O1N A;  3VQI A;  1OQQ A;  1YMH E;  2L32 A;  5BYQ A;  1YN5 A;  1R7S A;  1EWC A;  1JRP A;  2LHE A;  1ZDV A;  3AEB B;  1QIL A;  2PKO A;  5EE1 A;  2LMC A;  3B2G A;  3GP7 A;  5BYR A;  1I4Q A;  1YJI A;  1XO3 A;  2ONQ A;  3AMZ A;  3PZ7 A;  4L23 A;  4IOI E;  2YEP F;  1QF6 A;  1KRH A;  1FXI A;  3PO0 A;  1JWS D;  3AE9 B;  3NS1 A;  1SB3 C;  5AUK A;  1PGB A;  1A70 A;  1FFU A;  3AEC B;  2W3R A;  1XF5 L;  1KH0 A;  1XXG A;  3AH7 A;  4USA A;  1XLP A;  1JQ4 A;  1TKG A;  1CJE A;  1MI0 A;  3HRD D;  3RPF C;  4PT5 A;  2I2Y A;  4MM3 B;  1VZ8 A;  1XEE A;  1YQ3 B;  1Q10 A;  1TS2 A;  2E6X A;  1PYW D;  1NEK B;  1WXQ A;  2DBY A;  2IGD A;  4OHJ A;  2JQR B;  3SEB A;  5HHD G;  1HZ5 A;  3LB8 C;  1ZXI A;  2WS3 B;  2PW9 A;  1PGX A;  2W55 A;  1ZXH A;  1L0V B;  2E3T A;  1KF6 B;  1FNV A;  1C4A A;  2FBW B;  3P4S B;  3DWG C;  3HVZ A;  1RM6 C;  3MJ5 A;  1ZOY B;  3AM9 A;  2JU6 X;  1SIJ A;  4D2K A;  4RCO A;  3P4Q B;  4YWG G;  2WLB A;  4KX6 B;  5I4D A;  2SEB D;  4OZA A;  1V1P A;  3U2S C;  4OZC A;  1F2R I;  1N63 A;  1SF0 A;  1N5W A;  2BYT A;  1DOI A;  4DXG A;  2CJN A;  1XLQ A;  2V4I B;  3BVG A;  1TS4 A;  2JSV X;  4H2A A;  1WYG A;  1BML C;  1QOB A;  1GOZ A;  1VJK A;  2WXL A;  3NRZ A;  3AE1 B;  3BK2 A;  2K0P A;  5BMI A;  2MEK A;  1NVI D;  3HUI A;  5G5H A;  2WDQ B;  2JX5 A;  2LHD A;  2Q5W D;  4MAC A;  1LO5 D;  2D5G A;  3AB5 A;  1AW7 A;  2M56 B;  1HA5 A;  4HRO A;  5BYS A;  3P42 A;  4IKG A;  2J52 A;  1AYF A;  1L4D B;  2ZW0 A;  2V3P A;  3J9C A;  3UI3 A;  4WQM A;  2RDG A;  3IAS 1;  1L0Y B;  3TSS A;  4DXF A;  1NYQ A;  2IGH A;  1VRA B;  3AEF B;  3FIL B;  1L6U A;  1D5Z C;  1DOX A;  3T3O A;  4GDK B;  1VZ7 A;  1UNS A;  4XDC A;  4LLG M;  1D4B A;  1ZE3 D;  3FIL A;  4XWW A;  1HQR D;  5D3D A;  4ZYS A;  2JXT A;  1JWU D;  1T5X D;  2AQ1 B;  3BYY B;  2JZP A;  2BS4 B;  4NAW B;  1IBX B;  1ZDX A;  2WDV B;  5EE3 A;  2BW2 A;  3BZD B;  2BB5 A;  1I7H A;  2INP E;  5D3I B;  3U7Z A;  1V8C A;  2L83 A;  4L1B A;  5FK9 C;  2M19 A;  2KDM A;  2QEJ C;  2M0A A;  1JRO A;  2XN9 C;  1XLO A;  3B9J A;  2QIL A;  3P4P B;  1NEN B;  1N61 A;  1ESF A;  3GB1 A;  3BK1 A;  4WUR A;  5BMH A;  2WXM A;  3AE4 B;  3FAH A;  3VRB B;  3ZQ4 A;  4B0E A;  4J3O D;  4WIP A;  4YTN B;  1YJJ A;  1MHX A;  3AEA B;  2JYE A;  5HFY A;  1ZUD 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...