1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane usher protein fimD
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
3RFZB 4B0MA 4J3OD 1ZE3D 3BWUD 1ZDXA 4B0EA 1ZDVA
chains in the Genus database with same CATH superfamily
4ARIA 2HTHA 3W2DA 1KLVA 3HVZA 2GI9A 4RGTA 3V6EB 1YJJA 4P1CC 5D7GA 4WQOB 1P7EA 4FN2A 5DPSA 2JYTA 2KKCA 2DZJA 2KXJA 4HJKA 3U52E 3KH0A 1FMAD 3Q3FA 1QLBB 5LNK1 2DAFA 3OJ4B 4ITKA 3DWMA 1FD6A 4A90A 2I38A 3AE5B 1XD3B 2KWUB 1E0ZA 3AN1A 1X1MA 2WQYB 3KUDB 2R2OA 3ZJTA 2REXA 1WGHA 2G3QB 5HKHA 1SBBB 3QIJA 2DYBA 3ZYYX 4YSZB 1LGRA 3HHMA 4US9A 3ZNZB 1UBIA 3BYYB 2GRIA 4GB9A 4TV3A 3ZTCA 4M00A 3BY4B 4AJYB 1JWBD 3BZDB 2BBCA 3RNBC 4W9IA 3LB8C 1SE9A 1LFDA 1TKYA 1DGJA 3VUYA 2ON8A 1SF0A 4HPPA 3GZNB 3AE4B 3PHWB 4KSLC 5EE0A 1L6VA 3ZJUA 4GN1A 3V05A 2IO2B 1WM3A 2BT6A 2J7QB 1WYWB 4A6QA 3UINB 5JH5C 3DDCB 1GUAB 4ZOHC 1VRAB 1VCBA 3ZNID 2WXJA 4BAXA 3VHTC 1FNUA 4ACFA 2Z0DB 2C7MB 3TCAA 2DAJA 2QJLA 1FNVA 1QOBA 4K7UA 1DOIA 4MM3B 5IKCM 4FADA 3MHZA 2L05A 4W9EA 3DCGA 3VAWA 3DBLB 1HTQA 2N9KA 1WXSA 2FIFA 1V9JA 4BOSC 2VZKD 2VRRB 4AWJA 2L52A 1VR9A 4EEWA 4CQNA 4CO7A 2W9NA 4ARCA 1IGCA 4WWNA 3T3OA 1L2NA 3H7PA 2OEDA 1QQRA 3ZNGC 2ACZB 3B1LX 4K3BA 1A70A 1FXIA 3V61A 4YSXB 1TS4A 2KDEB 5EE3A 1ZP0B 3BYTB 3HRDD 5AUIA 2WX0A 4WAAA 4X57B 1ET9A 3L10B 2EMTA 3ZKJC 4C4VB 1V5OA 2WXOA 2HE7A 1YN5A 4RH6A 2MBOA 1KLGD 1WZ0A 1GNUA 3HM6X 3N32A 2DENB 2KWVB 4DDGD 2W82A 1MG8A 3AE1B 1JWAD 3JW0X 4LJOB 3TMPB 2D2QA 1E7PB 2FAZA 2NMQA 1KFYB 2M0AA 5TR5A 4DHZE 2N1WA 1R7SA 4PK1A 3RT3B 3V62A 1P3QU 4MSQB 1E6EB 2N4FA 2WXGA 2KDMA 1JW9D 5L95C 1ZDXA 2GB1A 1VZ8A 3Q3NC 2WXIA 4II3B 1F77A 3ZTDA 1CMXB 1TY0A 3DQVA 4I6PA 3GE8C 1V2YA 4ZRQA 2M8SA 1YMHE 3PLUA 2WXKA 1L4ZB 2J0MA 1SSNA 2W55A 4REZA 3U7ZA 1TZOA 3IXSA 2IY0B 5T8IA 2M19A 2R2QA 2BW2A 2KOXA 1QOAA 3EGRA 3SR6A 2AQ3B 4HCPB 1WMHA 1WWTA 3J9CA 4ZYSA 3B2GA 1OFFA 2LGXA 1JCKB 3GZNI 2RDBC 4WJPA 4WH4A 3BIID 1WGGA 3P42A 4W9FA 2KFKB 1C79A 3FC4A 2QEJC 1NENB 1Q5WB 2KK8A 1WX8A 1R4NI 1J8CA 1C4CA 4DWFA 1N61A 1HA5A 2PJHA 3DOWA 4MELA 4W9GA 3BK2A 4M02A 2K3UA 4WJNA 2IGDA 2KLCA 4F7ZA 2QIEB 1BXTA 5D3IB 4WAFA 1TS2A 4LJPB 4LCDE 1LO5D 5HHDG 3Q3OC 1G6JA 2KWCA 3P4QB 2QC8A 1OEYJ 2IZVB 1ET6A 2JZ3B 1MHXA 2WGSA 2O6VD 4AJWA 1E10A 2JT4B 2RPVA 2FCQA 2N9EB 4KGSA 2PW9A 5BO4B 4KIKB 1EO6A 2N0SB 4WWOA 1P7FA 4KIKA 1E8WA 1CK1A 4HPMB 3DPDA 2WNMA 4OZBA 4GU2A 3UQAA 4JIOU 4C80A 1XLPA 1T6BX 1H4RA 4MT5A 2LZ6A 3EHVA 4N6EB 1E90A 2WDTB 1VJKA 1L0XB 3AM9A 1F0ZA 3A9KA 1FEHA 4GOCA 5KHOA 3UGBB 4XDDA 2Y5BB 3JSVB 2LVOA 3T9LA 2KDFB 5FR3A 2D5GA 4KGRA 1E9MA 1WJUA 2BTEA 3IFWB 2K6DB 1JRPA 1N6ZA 2Y5PA 3EFCA 2MA9B 3ZRFA 4KZ0A 2D10A 2JYEA 3P4SB 2QSDA 1BT0A 4FBJB 3PSEB 3AMZA 2LGDA 4MGKE 2LHDA 1V86A 4IW0A 1ACCA 1E7VA 2WDRB 1C76A 3ZLZA 1OQYA 2VH1A 4IOIE 4OZCA 1XCQL 1P98A 1J7AA 2KACA 3O65B 2K0PA 2MCNB 5FKAC 3KVFB 2ONQA 2D3AA 3VTWA 4IC7B 5IO9A 3N1XC 1SIFA 3SHQA 2AL6A 2NTTA 2LWPA 3QA8A 2VH2A 5LXIB 1K53A 1EF1A 3AU4A 1NI2A 4HCNB 3FAHA 1FIQA 1UGJA 4GGQA 4KDLB 4G11A 3EUB2 4KVGB 4EZJA 1N60A 3NUHB 2W3RA 1I4XA 3AE3B 1NI3A 1UNSA 4LLGM 4LDTB 5JZEB 1WGRA 1RAXA 2JZPA 4K7SA 1DOYA 3A33B 4II2B 3VUWA 3QWZB 2KJRA 1J19A 3W5UB 5AUKA 2RDGA 1WJ4A 3QJZA 2JXTA 1PGXA 2KC1A 1FFVA 4FJYA 2IYDB 2ZVNA 5EE1A 4YWGG 1P1AA 1FCCC 2KD0A 2KX0A 1T0RC 1ZDVA 1NBFC 3AV8A 4HK2A 5CHFA 3BVMA 5BYSA 4A3OA 2M1MA 1JWMD 2V3PA 5GMVA 4OW0A 3VH4B 1J7BA 3TL5A 4LNIA 1MI0A 1PQSA 4MH0E 2MP2A 2JY6A 1WRDB 4BKTA 2K39A 4CYEA 3DBLI 3HIZA 2K22A 2INDC 4NJCA 4C4VA 3TEYA 1WYGA 1ZOYB 3SFDB 5BYQA 1D5XC 1YOVB 5LXHA 2GOWA 3P63A 3NS8A 3ENEA 2KMMA 2BVCA 2J53A 5DCNA 3PZDA 1EM7A 2MBQA 3V6CB 3PS6A 5EDSA 3CSTA 3Q8BA 4B95A 3TEZA 3V3XA 5C23A 2I2YA 1SE3A 1NVID 2D11A 1PGBA 3UIPB 2L0TA 2MJEA 5E6JA 4NY0A 3HUIA 1WXMA 4LNFA 1C77A 4A3PA 2CS4A 2LUMA 4OVUA 4FXCA 3GP7A 1GC6A 3ZDMC 1J7CA 3AE6B 4JQWC 5AZGA 3URYA 2M56B 1WZ3A 4DDID 1KTKA 2X8XX 1YJIA 3VRBB 1EU3A 1IPGA 1GC7A 4HDOA 1T0QC 2FNJB 3FILA 3PRZA 1C9FA 3U4EG 3AEBB 3TJPA 3WAMA 3VH3B 2WS3B 4W9LA 4O1NA 2SEBD 5CHVC 3PREA 3L4PA 4E71A 4GDKB 2QILA 1TGZB 2FBWB 1WX7A 2WXPA 1MG4A 2JXXA 3RI7C 2G4SA 1TJEA 5HG2A 3Q3JA 4Q2JA 2CU1A 3K9OB 1XLNA 2MP2B 2NPTB 2LI5A 4KSKC 4K81A 2G1EA 4DHZB 2LFIA 5BMHA 3AEDB 3UF8A 3ETRA 2UYZB 1SEBD 2J52A 4F8CB 3VR8B 2ICIA 4GDLB 4A8XC 3MFGA 3NRZA 1XT9B 4B0MA 3DBHI 2O6VB 1STEA 1Z2MA 3S2AA 3E56A 4A9AA 1AN8A 1KLUD 3TEWA 1KH0A 4S0RA 4YT0B 1HTOA 1U4AA 2WWZA 3PTFC 4LNKA 2QHOA 4FHKA 1RYJA 1OEYA 2DBYA 2YEPF 3ZW3A 4EZKA 2KTFA 1WE6A 2KNBA 3W5VB 1YN3A 4ANVA 2DX5B 2BYFA 1SE2A 3QX1A 2UU7A 2B76B 4FHJA 2L1AA 2W3SA 3Q8AA 1H8CA 4HEA1 3I5JC 5C3JB 4G3XB 5EE9A 4WWPA 2WXFA 2IGGA 1ZE3D 2VZKB 1YX5B 3IVFA 4HXDA 4OVZA 2N1VA 1SJHD 1EU4A 4MJSB 1UZXB 1UWMA 2HJ1A 1WSPA 2MSED 3TEXA 4KDIC 4J3OD 1AWDA 2JRIB 2NTSA 2H88B 2JWZA 1SB3C 1IGDA 3IAM1 3NHEB 4NJ7A 2J0JA 1V1PB 3OWEB 3E9SA 4YXDB 1RFKA 3PZ7A 2JX5A 1R4NB 4ZHPA 3IHPC 4BBNF 1K52A 2NBVB 2RMMA 5FR6A 3T3NA 1IYFA 1QOFA 1MPEA 1K8RB 1JMLA 2YVCA 1MVKA 3KWLA 4KZCA 3PRPB 1Z5SB 3A9KB 4MGIE 3FKYA 4W9HA 3M62B 3PGEA 1BMLC 1WF9A 2N9XA 2N9LA 4HDQA 2WX1A 3WAPA 3KW5B 2AQ2B 5G5HA 2IPKD 3KWVA 1OQQA 1QKZA 4LDTD 1CZPA 1GAQB 3PLVA 2O6VA 2JPHA 3P2BA 1CQVA 3LJ3A 2H89B 4J6IA 4IM2A 2J4XA 2KX3A 4M8NA 4NZLB 3MC0B 1F9JA 2V4LA 2YLMA 3WIMA 4PT5A 2Y5CA 5IAAC 1QOGA 2LRWA 3DBHB 3ZJVA 2SAKA 1C4PA 1UF0A 2IBIB 5LLIA 3I57A 3Q8FA 3D32A 1WIAA 4RM9A 3P4RB 2RGFA 3PT2B 2BB6A 1ZKHA 3UIOB 2AYOB 1ROEA 1YIWA 3ZNHB 2K25A 4DXFA 3A9JA 1FFUA 4GDLA 1QT9A 2C60A 4XDCA 1YN4A 1ENFA 2L83A 1R4MB 2JVCA 4DXGA 2FCNA 2G9HD 3ML8A 1KF6B 2AQ1B 1YNTE 4KV2A 1XO3A 2LXCA 3QCAA 2PVGC 2M0XA 1OQRA 3MC9A 2IY1B 3X0WA 2V3NA 1WXQA 4XC2A 4AQ7A 2CU3A 3U2SC 5AZFA 4I6LB 4D2KA 4NAMA 2WU5B 3AE9B 2WYQA 4HRSA 1VLBA 3P1MA 3KQ4A 3I9V1 2BYEA 3H9DA 3GOEA 1WJ6A 4W9KA 4HLEA 3H8HA 2RD0A 4L2YA 4ICVA 1B9RA 4P1BC 3PPAA 2FCSA 3CWIA 1KM7A 3AEFB 2ZNVC 3SU8X 2EKIA 1Q0WB 1IBXA 2DWQA 1XQQA 3N3KB 3NVVA 4KKJA 4N58A 3Q2AC 4A55A 1IP9A 1FXAA 2KDIA 2AWTA 3HM3A 3RNAC 3WA0A 2ZVOA 3ALBA 1I4PA 3U8ZA 5IN7A 1BUIC 3DBRB 2D3BA 4IKGA 1HXYD 1JWSD 3M3JA 3LDZE 1JQ4A 3AEEB 1GB1A 1UGMA 1LQBA 1C3TA 1FXTB 2EKEC 3DHIC 2LHEA 2KFJA 1V1OA 3LXFA 3KUZA 1FRRA 2BWES 2XK5A 4NJ6A 3DBSA 3BWUD 3RNEC 2D3CA 4ANUA 2DNFA 1J0GA 2PTLA 2LVQA 3P4PB 2MJDA 4MSMB 2MBHA 4HJGE 2OJWA 4WURA 4AP4C 2ZZPB 1TS3A 4PS3A 3W1YA 2WXQA 1IBXB 1EWCA 2JQRB 1RFAA 3RNGC 3NOBA 4A20A 2DZKA 4IG7B 1VDVA 4M01A 1YX6B 1P0RA 2BGFA 2C7NB 2MX2A 2IO0B 5I4DA 5G5GA 3NS1A 2JWUA 5HFYA 4DBGA 3WALA 2K6QA 2BB5A 4BVUC 1MJDA 1R4MI 1JWUD 4TUUA 2I1JA 2Z8LA 3OAWA 4YSYB 2KVZA 3R66C 1LXDA 1GPXA 1QILA 2BS4B 4PS8A 3ZO5B 2RSUA 1ZXIA 2PIAA 1WGYA 1E8ZA 1SGHA 3TIXA 3A1QA 2BS2B 5TSSA 3V60A 1Q1OA 2L32A 3OG5A 1D5ZC 1E8YA 3MJ5A 4ZDVA 1V1PA 4LK0M 1K50A 4OHJA 3B0AA 3R7QA 1D6EC 1E7UA 3WAOA 1P9DU 2KTRB 5E6NA 3DWGC 2LMCA 2ZEQA 3VVWB 4C7YA 2PLPA 4LNNA 2WP9B 1AW7A 1S1QB 3VUXA 3ZXRA 4ZRIA 3I3TB 4H2AA 2WXMA 4MGYE 3R2TA 2R61A 2BS3B 1HEZE 1OTRB 1JALA 3PO0A 2I1KA 2QCZA 3GE3C 4BBNC 1PUTA 2BYVE 2L7RA 3O13A 2O2VA 3APDA 5FK9C 3Q6BA 3KLSX 2OOBB 1YQ4B 4W9DA 2INCC 2MBBB 4BKSD 1T0YA 3AULA 3NVZA 2HJ8A 4B9KA 4R3DA 2KJHB 2FIDA 2D07B 5H92C 4B6WA 1OGWA 3Q69A 4JE3B 3MC8A 2BKFA 3LYYA 3RN9C 2K8CA 2MW5A 3GS2A 4YTPB 3NZ3A 3C8YA 4RCOA 3PHXB 3WANA 2KVRA 1WRIA 1K51A 1MFWA 3RD2A 1F1HA 2C7HA 3B08A 4RMAA 5J2RA 3VR9B 1UUPA 2PVOD 2A5UA 4B0EA 4ZRJA 1RLFA 4AS1A 2EMSA 1SE4A 3EECA 4LTUA 2KYWA 1WJNA 2J0KA 1T3QA 1WM2A 2LVPA 2PKOA 4E3CA 2KDBA 2V9HA 4N9F4 4BKSA 4IM3A 3RNCC 5G55A 4RM8A 2WLBA 1IUEA 4JWSC 2HD5B 5KHQA 1FPYA 4HROA 5AEKB 4G50A 2YEPB 4WIPA 2UWQA 1T0SC 2INNE 1F52A 4S17A 2ZPYA 4FJVB 1HZ6A 3TUOA 1XLOA 5D3DA 4XWTA 2MRPA 3Q8EA 2KT7A 4RNAA 3DVNV 4HPLB 3L13A 2B3AA 2MLBA 1UELA 3DBRI 2LD9A 2FE8A 2KLGA 2GLSA 2XK5B 2DHZA 2DYOA 3W1SC 4WQMA 2AEHA 3EFUA 2LJIA 4JX1C 1ZUD2 3B9JA 4GIVA 1PGAA 2LGIA 4K1RB 3OLMD 3H6NA 4RGNA 1WE7A 4W9JA 2LGSA 3APFA 3QC8B 1N5XA 3CSFA 5J17A 3SDLC 3ABVB 1D5MC 3A4SC 2MWSB 1WFYA 4ANWA 3VQIA 4L1BA 2PEAA 3DVNU 2CR5A 2BPSA 3WCQA 2L0FA 4RFBA 3N20C 3FILB 3AI5A 2CKHB 1ESFA 2KAJA 1TY2A 4XX5A 4MEMA 2KO3A 1QZEA 3N30A 4ZHOA 4KX6B 2CJOA 3AECB 2BQQA 1WXAA 3APCA 4M0WA 2ZW1A 4EOYA 2CJNA 4RGMA 2M17A 2WDVB 2KZRA 3CMMB 4GMVA 2LASA 2PPHA 1YJ1A 1LM8B 2IO3B 4TQ1A 4QAYA 4NAWA 4URKA 2WXHA 3KYCD 3U7DA 2PE9A 1B1ZA 1ZW7A 2NPTA 3CF6E 1EWYC 4KKIA 4C7ZA 2CHWA 3QARA 5L83A 1WR1A 1EUVB 4BFRA 1WXVA 2L00B 3UQBA 5IOIA 2V4IB 3VDZA 2KN4A 4GDKA 3MP9A 1ZPSA 2PMVA 3RULA 1V6EA 1TZ1A 5AZHA 2V0GA 1WH3A 3KYDD 4MH8A 4WWMA 1FNWA 2N9PC 4IM0A 4MGZE 4JLCA 4RF1A 3H7PB 1L0YB 2N7DA 2E3TA 2V1YA 4JL9A 4GSWA 2RR9A 1M4VA 2NS5A 1D4BA 3VRAB 1V97A 2HDEA 2L3ZA 4IWPA 4OZAA 4P6VF 3L17A 1HZ5A 4XYCA 2ZCCA 3Q3MC 2DZMA 1FM0D 1GOZA 4ICUA 1XXGA 1KJTA 4JWUC 3IBEA 3NZSA 2K1FA 2K8HA 2MQJA 2NVUI 4N59A 4ZRPA 4AUQC 4ASWC 4M0WB 4TMAB 3MTNB 1V80A 3OJ3A 1XCTL 2IJ0A 2LUEA 4PYUA 3VTUA 3JSVA 1FRDA 2E6XA 4PS7A 2C9WB 2WHIA 3ZDTA 1TIFA 1QF6A 5C2TB 1DOXA 5CTRC 1WI0A 2LJ5A 3RUIB 1L5PA 3AXCA 3BVGA 4XWWA 2N7JA 2AX5A 4YTNB 4KGTA 1MHHE 1DYQA 1M94A 2C5LC 3JYUA 2WXNA 2M4NA 4CHKA 2LRUA 2XN9C 3SEBA 1VZ7A 2DZIA 4FULA 3TSSA 1I42A 1CJEA 5D2MB 3ZRCA 1WGKA 2WXRA 4NQKE 2XNAC 1E5WA 3NZUA 5BMIA 2K9XA 3QHTA 2INPE 2K5PA 2WXLA 5DPTA 2FUHB 3A9JB 2MHJA 2BKRB 3RPFC 2KN5A 3RFZB 4P16A 4M8MA 2JU6X 3ZQ4A 4EKUA 3RCZA 1XF5L 4F1SA 1PYWD 2G4DB 2MH7A 2G45B 3U30A 4C56C 3ZUNA 4IUMB 4BKGA 3NJTA 1TS5A 2BWFA 1JROA 2XBBC 1NDDA 1ZXHA 3W9CB 1N5WA 1YQBA 3PV1A 1F2RC 2ZNVB 4GXBA 4FA6A 4XE0A 1FO4A 3PZ8A 3NG0A 4EZLA 4ANXA 1KOTA 2ZW0A 1A5RA 2ZPNA 2GMIC 5BYRA 2GBRA 1I4GA 2GBKA 1L6UA 1TYGB 1C4AA 3SD5A 4MACA 3IT6B 4EFOA 3NVYA 2FCMA 4DQOC 3IAS1 1UBQA 3RYTA 3ML9A 4JPSA 2RPQA 4HWIB 5H8YE 3EC8A 2NBWB 2DLBA 2L76A 1UWXA 1VZ6A 3AB5A 3UI3A 2JRHA 2QDFA 1WY8A 5CHWA 5D6JB 2TSSA 5J18A 1XEEA 3NVWA 4IWQA 1FCLA 1N62A 4DHJB 2NCNA 3C0RB 4US8A 4L23A 2K8BA 3BVZA 3H1UA 4ZYNA 4PYZA 5D94A 3BINA 5G2NA 1RRBA 4NPNA 3IT4B 2WDQB 4FLHA 5JHAA 1AARA 3R3MA 2DYMA 4WJQA 2J42A 2GBMA 4TSSA 4YTMB 3DHHC 3L16A 1TKEA 2LXAA 2RDHA 2GBJA 5JXVA 3VTVA 1TT5B 2HTME 3PRMB 1WR6E 3X23A 2CHXA 2KFKA 1I4RA 4ZRKA 4TQ0A 1SJED 3JVZX 3TBLD 5C1ZA 3DVGX 4GLSC 2KMCA 1JRUA 1Y56A 2OHFA 4NQLB 4WJOA 5DPRA 2N7EA 2JSVX 1UD7A 2Q5WD 3ECIA 4XZ4A 1I4QA 1YQ3B 3VFKA 5CX3A 3AE8B 2PE6B 1NYQA 4RF0A 5MPOA 4DXAB 2AL3A 3BK1A 3PVLA 1I4HA 2KMAA 4MJSA 1V8CA 3ZVVA 1L0VB 5JHBA 2W54A 1N63A 5IP4D 3M95A 2EELA 4MDKE 1S3SG 1GJZA 5HI1A 3I63C 2L8JA 5IA7A 2V3SA 4USAA 3R2IA 1WX9A 3QAQA 2BYTA 5GXGB 3KUCB 1NEKB 4LNOA 4AOFA 3RZFA 3A1QB 1V5TA 1I7HA 1ISNA 4BOZB 2Z59B 3ONSA 1C78A 3M63B 4HKQA 4JGHB 2KHWB 2A4ZA 1RM6C 2BF8B 1AYFA 4FJZA 4OVVA 2JZZA 2X38A 3IG3A 3RMKC 3H7SA 3Q14C 2KJ6A 2D3GA 5E6OA 4XGAB 1PDXA 2ZCBA 4C00A 2MEKA 3AEAB 2KQ7A 4E74A 4P7IA 1F2RI 1WGDA 3AH7A 1TTNA 4DHJD 1L7YA 3QK0A 5E6PA 1YD8U 2IGHA 3AE7B 3T8MA 1D3ZA 1GG3A 4W9CA 4IDIA 3NY5A 2FUG1 3AEGB 3Q8CA 2O2VB 1UH6A 1EF5A 1ZGUB 3DHGC 2Z0EB 2ASQA 3R7RA 3AE2B 1V81A 3HVDA 5BMGA 2IDYA 1PFDA 3MHSD 2KTRA 4NNJB 1L4DB 3VXWA 4HKZE 3SFEB 4MM3A 2LEKA 4K7WA 1HQRD 1KRHA 1TBEA 2IO1B 3R8BA 4HVBA 4I6NB 1GB4A 1NYRA 1Q10A 3RZWC 4K3CA 3HK0A 3B2FA 1SIJA 3L08A 4RGOS 2KQSA 4DK5A 3ZGZA 1VD2A 4UDUC 1RWSA 2MJ3A 3QQ8B 1C1YB 3CIRB 2CHZA 4IWOA 2NBUA 2JUOA 4G0NB 3L54A 3N1YC 4EE2A 1V49A 3ZXVA 3GB1A 2OJRA 3A4RA 3W1SA 1WMHB 1I35A 5DPWA 3K9PB 3DVGY 3EA6A 4TKNA 3AU5A 2KC2A 4NAWB 4BZAA 2Y3AA 2WU2B 3RNFC 1SXTA 3C19A 2ZJDA 2GBNA 1HE8A 1E8XA 2KQ4X 2KANA 3ZIMA 2NR2A 2XEWA 3MJWA 2KWDA 1XLQA 2LGYA 1T5XD 1TKGA 1Y8RC 2JF5A 4YL8A 4EUTA 2MBEA 2QMTA 3N1ZC 3L0WB 3N9YC
chains in the Genus database with same CATH topology
4ARIA 4N59A 4ZRPA 3H8HA 4L2YA 2NTTA 3W2DA 3HVZA 4TMAB 1K53A 2GI9A 4RGTA 1B9RA 1YJJA 1XCTL 2IJ0A 3FAHA 5D7GA 1P7EA 1FIQA 1UGJA 2JYTA 3CWIA 3AEFB 3EUB2 2EKIA 1N60A 3NUHB 3U52E 1IBXA 2W3RA 1I4XA 1FRDA 1FMAD 2E6XA 3AE3B 1NI3A 2DWQA 1QLBB 1UNSA 5LNK1 4LLGM 3NVVA 3DWMA 4ITKA 1FD6A 2JZPA 4KKJA 4A90A 1DOYA 2I38A 1QF6A 3AE5B 4N58A 5C2TB 4A55A 1DOXA 1E0ZA 1FXAA 1L5PA 3AN1A 3W5UB 3BVGA 5AUKA 2WQYB 2RDGA 4XWWA 2JXTA 2N7JA 1PGXA 2AX5A 1FFVA 3ZJTA 4YTNB 4KGTA 1MHHE 5EE1A 4YWGG 1I4PA 1DYQA 2WXNA 1BUIC 1FCCC 1SBBB 4IKGA 1HXYD 3ZYYX 1ZDVA 2XN9C 4YSZB 3SEBA 1VZ7A 1JWSD 3AV8A 3TSSA 3BVMA 5BYSA 1CJEA 3AEEB 1GB1A 1JQ4A 4US9A 1WGKA 1JWMD 2V3PA 2WXRA 2XNAC 4OW0A 3BYYB 2GRIA 2LHEA 2K9XA 5BMIA 1J7BA 1V1OA 2INPE 3LXFA 2K5PA 2WXLA 1MI0A 1FRRA 1JWBD 3BWUD 3RPFC 3RFZB 4P16A 2JU6X 3ZQ4A 3BZDB 2BBCA 2K22A 1XF5L 3LB8C 4NJCA 3TEYA 2MH7A 1PYWD 1TKYA 1WYGA 1ZOYB 2PTLA 4C56C 3SFDB 5BYQA 1DGJA 3P4PB 2MJDA 1D5XC 2ON8A 1SF0A 1TS5A 3P63A 4HJGE 1JROA 2KMMA 4WURA 3AE4B 1TS3A 1ZXHA 3W9CB 2WXQA 1N5WA 5EE0A 1IBXB 1EWCA 2J53A 2JQRB 1EM7A 1F2RC 1FO4A 4XE0A 3PZ8A 1L6VA 2I2YA 3Q8BA 3ZJUA 3TEZA 3V3XA 1VDVA 3V05A 1SE3A 2ZW0A 2BT6A 5I4DA 1NVID 5G5GA 1PGBA 3NS1A 5BYRA 4A6QA 1I4GA 1L6UA 1TYGB 2MJEA 1C4AA 2JWUA 5E6JA 5HFYA 4ZOHC 1VRAB 3HUIA 2WXJA 4MACA 1FNUA 3IT6B 1C77A 3NVYA 2BB5A 4DQOC 1JWUD 3IAS1 2LUMA 2Z8LA 4FXCA 2QJLA 4JPSA 1FNVA 1QOBA 3GP7A 1DOIA 4YSYB 4MM3B 1J7CA 3AE6B 3MHZA 3URYA 2M56B 1GPXA 1QILA 2BS4B 1KTKA 2N9KA 5H8YE 2DLBA 2VZKD 1UWXA 1VZ6A 1YJIA 1VR9A 1ZXIA 2L52A 2PIAA 3VRBB 4CQNA 1EU3A 3AB5A 4ARCA 3UI3A 1IGCA 2BS2B 5TSSA 2L32A 3T3OA 1D5ZC 3FILA 1C9FA 3U4EG 2OEDA 3AEBB 2TSSA 3MJ5A 1XEEA 1QQRA 1V1PA 3NVWA 4LK0M 1K50A 2ACZB 1A70A 2WS3B 1FXIA 4OHJA 4YSXB 1N62A 1FCLA 4O1NA 2SEBD 1TS4A 5EE3A 1ZP0B 3BYTB 1D6EC 3HRDD 3L4PA 4GDKB 2QILA 5AUIA 4US8A 4L23A 2FBWB 3BVZA 2LMCA 1ET9A 3DWGC 4C7YA 2WXPA 2PLPA 1TJEA 5HG2A 2WXOA 2WP9B 1AW7A 1YN5A 4Q2JA 4RH6A 4H2AA 1KLGD 2WXMA 3IT4B 3R2TA 1XLNA 2WDQB 2R61A 2BS3B 1HEZE 1JALA 2DYMA 2J42A 3PO0A 4TSSA 2G1EA 1PUTA 2LFIA 3O13A 2W82A 3AE1B 3AEDB 4YTMB 5BMHA 1JWAD 1TKEA 5FK9C 2RDHA 3ETRA 3KLSX 1YQ4B 5JXVA 2HTME 1SEBD 2J52A 1E7PB 2NMQA 3VR8B 1KFYB 2M0AA 3NVZA 1I4RA 4R3DA 2ICIA 4GDLB 4A8XC 3MFGA 1R7SA 1SJED 3NRZA 4TQ0A 4B0MA 5H92C 3Q69A 4JE3B 4GLSC 1E6EB 1STEA 2WXGA 2KDMA 2OHFA 1Y56A 3LYYA 3E56A 1JW9D 4A9AA 3GS2A 4YTPB 3NZ3A 1ZDXA 1AN8A 2GB1A 1VZ8A 2JSVX 3C8YA 1KLUD 4RCOA 3TEWA 2WXIA 1KH0A 2Q5WD 4YT0B 1F77A 1I4QA 1WRIA 1YQ3B 1K51A 1TY0A 3AE8B 1RYJA 1NYQA 2DBYA 4RF0A 5MPOA 2YEPF 3BK1A 3VR9B 1UUPA 2PVOD 3W5VB 1I4HA 4ZRQA 4B0EA 1V8CA 1YN3A 1L0VB 4AS1A 1YMHE 1SE4A 2WXKA 4LTUA 2W54A 1L4ZB 1N63A 1SE2A 1SSNA 1T3QA 2EELA 2B76B 2W55A 2PKOA 4REZA 3U7ZA 1TZOA 3IXSA 5HI1A 2L1AA 2W3SA 5T8IA 2M19A 2WLBA 3Q8AA 2BW2A 4HEA1 4USAA 1IUEA 3R2IA 4JWSC 5C3JB 5EE9A 2BYTA 1QOAA 4HROA 3EGRA 5GXGB 1NEKB 2YEPB 2WXFA 2IGGA 4WIPA 1ZE3D 2AQ3B 2INNE 2VZKB 3SR6A 1HZ6A 1WWTA 3J9CA 3TUOA 4ZYSA 3B2GA 1XLOA 5D3DA 1OFFA 4OVZA 4XWTA 1JCKB 3Q8EA 4RNAA 4WH4A 3BIID 1SJHD 1I7HA 1EU4A 3P42A 1UWMA 1C78A 1WSPA 4HKQA 3TEXA 4J3OD 2FE8A 1AWDA 2NTSA 1C79A 3FC4A 2QEJC 2DYOA 2H88B 1NENB 1SB3C 1IGDA 1RM6C 4WQMA 3IAM1 1AYFA 2LJIA 4JX1C 1V1PB 3OWEB 1C4CA 3E9SA 2X38A 4YXDB 1RFKA 1N61A 1ZUD2 3PZ7A 1HA5A 3B9JA 2JX5A 3BK2A 1PGAA 4ZHPA 2K3UA 2LGIA 1PDXA 2IGDA 2MEKA 3AEAB 2QIEB 4RGNA 1K52A 1F2RI 1BXTA 3AH7A 5D3IB 4WAFA 1TS2A 1N5XA 3ABVB 1LO5D 1D5MC 5HHDG 2RMMA 3T3NA 1QOFA 2IGHA 1MPEA 3P4QB 3AE7B 1ET6A 4L1BA 1JMLA 3VQIA 1MHXA 1MVKA 3KWLA 4IDIA 1E10A 3WCQA 2FUG1 3AEGB 3Q8CA 2RPVA 4RFBA 1BMLC 3FILB 1ESFA 2KAJA 1TY2A 2N9LA 3AE2B 2AQ2B 5G5HA 2IPKD 3KWVA 4ZHOA 3HVDA 4KX6B 2CJOA 5BMGA 1OQQA 1QKZA 3AECB 4KGSA 2IDYA 1PFDA 4M0WA 2ZW1A 2PW9A 1CZPA 1GAQB 2N0SB 2CJNA 1P7FA 4RGMA 1L4DB 1CK1A 2WDVB 4HKZE 3SFEB 1CQVA 2WNMA 4OZBA 2LEKA 2H89B 1HQRD 1KRHA 4C80A 3R8BA 1XLPA 2J4XA 4TQ1A 1T6BX 4MT5A 4NZLB 4N6EB 1NYRA 1Q10A 2WXHA 1GB4A 3B2FA 1VJKA 3MC0B 1L0XB 3AM9A 1B1ZA 1SIJA 4RGOS 1F0ZA 1FEHA 4PT5A 2Y5CA 1QOGA 3ZGZA 4KKIA 1EWYC 4XDDA 3ZJVA 2SAKA 4UDUC 4C7ZA 1C4PA 1RWSA 2MJ3A 3CIRB 3I57A 3Q8FA 5FR3A 2D5GA 4KGRA 3P4RB 2BB6A 1ROEA 1E9MA 2BTEA 4EE2A 4DXFA 2V4IB 1JRPA 2KN4A 3GB1A 3MP9A 1FFUA 1ZPSA 2Y5PA 3W1SA 1QT9A 2PMVA 4XDCA 1YN4A 1ENFA 2V0GA 2L83A 4DXGA 2JYEA 3EA6A 3P4SB 2G9HD 4MH8A 2QSDA 4WWMA 1KF6B 2AQ1B 4NAWB 1YNTE 1FNWA 2WU2B 2Y3AA 3AMZA 1XO3A 1SXTA 2PVGC 1OQRA 2LHDA 4RF1A 2V3NA 1ACCA 1L0YB 2WDRB 1C76A 2E3TA 1WXQA 2KQ4X 4IOIE 4OZCA 4AQ7A 1XCQL 2CU3A 3U2SC 1M4VA 1D4BA 3VRAB 1V97A 2HDEA 4D2KA 4NAMA 2WU5B 4OZAA 3AE9B 2KWDA 1HZ5A 1XLQA 4P6VF 2KACA 1J7AA 1T5XD 4HRSA 1TKGA 2K0PA 1VLBA 1FM0D 3P1MA 3KQ4A 1GOZA 5FKAC 3I9V1 1XXGA 2ONQA 4JWUC 2QMTA 3N9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFZ B;  4B0M A;  4J3O D;  1ZE3 D;  3BWU D;  1ZDX A;  4B0E A;  1ZDV A; 
#chains in the Genus database with same CATH topology
 4ARI A;  2HTH A;  3W2D A;  1KLV A;  3HVZ A;  2GI9 A;  4RGT A;  3V6E B;  1YJJ A;  4P1C C;  5D7G A;  4WQO B;  1P7E A;  4FN2 A;  5DPS A;  2JYT A;  2KKC A;  2DZJ A;  2KXJ A;  4HJK A;  3U52 E;  3KH0 A;  1FMA D;  3Q3F A;  1QLB B;  5LNK 1;  2DAF A;  3OJ4 B;  4ITK A;  3DWM A;  1FD6 A;  4A90 A;  2I38 A;  3AE5 B;  1XD3 B;  2KWU B;  1E0Z A;  3AN1 A;  1X1M A;  2WQY B;  3KUD B;  2R2O A;  3ZJT A;  2REX A;  1WGH A;  2G3Q B;  5HKH A;  1SBB B;  3QIJ A;  2DYB A;  3ZYY X;  4YSZ B;  1LGR A;  3HHM A;  4US9 A;  3ZNZ B;  1UBI A;  3BYY B;  2GRI A;  4GB9 A;  4TV3 A;  3ZTC A;  4M00 A;  3BY4 B;  4AJY B;  1JWB D;  3BZD B;  2BBC A;  3RNB C;  4W9I A;  3LB8 C;  1SE9 A;  1LFD A;  1TKY A;  1DGJ A;  3VUY A;  2ON8 A;  1SF0 A;  4HPP A;  3GZN B;  3AE4 B;  3PHW B;  4KSL C;  5EE0 A;  1L6V A;  3ZJU A;  4GN1 A;  3V05 A;  2IO2 B;  1WM3 A;  2BT6 A;  2J7Q B;  1WYW B;  4A6Q A;  3UIN B;  5JH5 C;  3DDC B;  1GUA B;  4ZOH C;  1VRA B;  1VCB A;  3ZNI D;  2WXJ A;  4BAX A;  3VHT C;  1FNU A;  4ACF A;  2Z0D B;  2C7M B;  3TCA A;  2DAJ A;  2QJL A;  1FNV A;  1QOB A;  4K7U A;  1DOI A;  4MM3 B;  5IKC M;  4FAD A;  3MHZ A;  2L05 A;  4W9E A;  3DCG A;  3VAW A;  3DBL B;  1HTQ A;  2N9K A;  1WXS A;  2FIF A;  1V9J A;  4BOS C;  2VZK D;  2VRR B;  4AWJ A;  2L52 A;  1VR9 A;  4EEW A;  4CQN A;  4CO7 A;  2W9N A;  4ARC A;  1IGC A;  4WWN A;  3T3O A;  1L2N A;  3H7P A;  2OED A;  1QQR A;  3ZNG C;  2ACZ B;  3B1L X;  4K3B A;  1A70 A;  1FXI A;  3V61 A;  4YSX B;  1TS4 A;  2KDE B;  5EE3 A;  1ZP0 B;  3BYT B;  3HRD D;  5AUI A;  2WX0 A;  4WAA A;  4X57 B;  1ET9 A;  3L10 B;  2EMT A;  3ZKJ C;  4C4V B;  1V5O A;  2WXO A;  2HE7 A;  1YN5 A;  4RH6 A;  2MBO A;  1KLG D;  1WZ0 A;  1GNU A;  3HM6 X;  3N32 A;  2DEN B;  2KWV B;  4DDG D;  2W82 A;  1MG8 A;  3AE1 B;  1JWA D;  3JW0 X;  4LJO B;  3TMP B;  2D2Q A;  1E7P B;  2FAZ A;  2NMQ A;  1KFY B;  2M0A A;  5TR5 A;  4DHZ E;  2N1W A;  1R7S A;  4PK1 A;  3RT3 B;  3V62 A;  1P3Q U;  4MSQ B;  1E6E B;  2N4F A;  2WXG A;  2KDM A;  1JW9 D;  5L95 C;  1ZDX A;  2GB1 A;  1VZ8 A;  3Q3N C;  2WXI A;  4II3 B;  1F77 A;  3ZTD A;  1CMX B;  1TY0 A;  3DQV A;  4I6P A;  3GE8 C;  1V2Y A;  4ZRQ A;  2M8S A;  1YMH E;  3PLU A;  2WXK A;  1L4Z B;  2J0M A;  1SSN A;  2W55 A;  4REZ A;  3U7Z A;  1TZO A;  3IXS A;  2IY0 B;  5T8I A;  2M19 A;  2R2Q A;  2BW2 A;  2KOX A;  1QOA A;  3EGR A;  3SR6 A;  2AQ3 B;  4HCP B;  1WMH A;  1WWT A;  3J9C A;  4ZYS A;  3B2G A;  1OFF A;  2LGX A;  1JCK B;  3GZN I;  2RDB C;  4WJP A;  4WH4 A;  3BII D;  1WGG A;  3P42 A;  4W9F A;  2KFK B;  1C79 A;  3FC4 A;  2QEJ C;  1NEN B;  1Q5W B;  2KK8 A;  1WX8 A;  1R4N I;  1J8C A;  1C4C A;  4DWF A;  1N61 A;  1HA5 A;  2PJH A;  3DOW A;  4MEL A;  4W9G A;  3BK2 A;  4M02 A;  2K3U A;  4WJN A;  2IGD A;  2KLC A;  4F7Z A;  2QIE B;  1BXT A;  5D3I B;  4WAF A;  1TS2 A;  4LJP B;  4LCD E;  1LO5 D;  5HHD G;  3Q3O C;  1G6J A;  2KWC A;  3P4Q B;  2QC8 A;  1OEY J;  2IZV B;  1ET6 A;  2JZ3 B;  1MHX A;  2WGS A;  2O6V D;  4AJW A;  1E10 A;  2JT4 B;  2RPV A;  2FCQ A;  2N9E B;  4KGS A;  2PW9 A;  5BO4 B;  4KIK B;  1EO6 A;  2N0S B;  4WWO A;  1P7F A;  4KIK A;  1E8W A;  1CK1 A;  4HPM B;  3DPD A;  2WNM A;  4OZB A;  4GU2 A;  3UQA A;  4JIO U;  4C80 A;  1XLP A;  1T6B X;  1H4R A;  4MT5 A;  2LZ6 A;  3EHV A;  4N6E B;  1E90 A;  2WDT B;  1VJK A;  1L0X B;  3AM9 A;  1F0Z A;  3A9K A;  1FEH A;  4GOC A;  5KHO A;  3UGB B;  4XDD A;  2Y5B B;  3JSV B;  2LVO A;  3T9L A;  2KDF B;  5FR3 A;  2D5G A;  4KGR A;  1E9M A;  1WJU A;  2BTE A;  3IFW B;  2K6D B;  1JRP A;  1N6Z A;  2Y5P A;  3EFC A;  2MA9 B;  3ZRF A;  4KZ0 A;  2D10 A;  2JYE A;  3P4S B;  2QSD A;  1BT0 A;  4FBJ B;  3PSE B;  3AMZ A;  2LGD A;  4MGK E;  2LHD A;  1V86 A;  4IW0 A;  1ACC A;  1E7V A;  2WDR B;  1C76 A;  3ZLZ A;  1OQY A;  2VH1 A;  4IOI E;  4OZC A;  1XCQ L;  1P98 A;  1J7A A;  2KAC A;  3O65 B;  2K0P A;  2MCN B;  5FKA C;  3KVF B;  2ONQ A;  2D3A A;  3VTW A;  4IC7 B;  5IO9 A;  3N1X C;  1SIF A;  3SHQ A;  2AL6 A;  2NTT A;  2LWP A;  3QA8 A;  2VH2 A;  5LXI B;  1K53 A;  1EF1 A;  3AU4 A;  1NI2 A;  4HCN B;  3FAH A;  1FIQ A;  1UGJ A;  4GGQ A;  4KDL B;  4G11 A;  3EUB 2;  4KVG B;  4EZJ A;  1N60 A;  3NUH B;  2W3R A;  1I4X A;  3AE3 B;  1NI3 A;  1UNS A;  4LLG M;  4LDT B;  5JZE B;  1WGR A;  1RAX A;  2JZP A;  4K7S A;  1DOY A;  3A33 B;  4II2 B;  3VUW A;  3QWZ B;  2KJR A;  1J19 A;  3W5U B;  5AUK A;  2RDG A;  1WJ4 A;  3QJZ A;  2JXT A;  1PGX A;  2KC1 A;  1FFV A;  4FJY A;  2IYD B;  2ZVN A;  5EE1 A;  4YWG G;  1P1A A;  1FCC C;  2KD0 A;  2KX0 A;  1T0R C;  1ZDV A;  1NBF C;  3AV8 A;  4HK2 A;  5CHF A;  3BVM A;  5BYS A;  4A3O A;  2M1M A;  1JWM D;  2V3P A;  5GMV A;  4OW0 A;  3VH4 B;  1J7B A;  3TL5 A;  4LNI A;  1MI0 A;  1PQS A;  4MH0 E;  2MP2 A;  2JY6 A;  1WRD B;  4BKT A;  2K39 A;  4CYE A;  3DBL I;  3HIZ A;  2K22 A;  2IND C;  4NJC A;  4C4V A;  3TEY A;  1WYG A;  1ZOY B;  3SFD B;  5BYQ A;  1D5X C;  1YOV B;  5LXH A;  2GOW A;  3P63 A;  3NS8 A;  3ENE A;  2KMM A;  2BVC A;  2J53 A;  5DCN A;  3PZD A;  1EM7 A;  2MBQ A;  3V6C B;  3PS6 A;  5EDS A;  3CST A;  3Q8B A;  4B95 A;  3TEZ A;  3V3X A;  5C23 A;  2I2Y A;  1SE3 A;  1NVI D;  2D11 A;  1PGB A;  3UIP B;  2L0T A;  2MJE A;  5E6J A;  4NY0 A;  3HUI A;  1WXM A;  4LNF A;  1C77 A;  4A3P A;  2CS4 A;  2LUM A;  4OVU A;  4FXC A;  3GP7 A;  1GC6 A;  3ZDM C;  1J7C A;  3AE6 B;  4JQW C;  5AZG A;  3URY A;  2M56 B;  1WZ3 A;  4DDI D;  1KTK A;  2X8X X;  1YJI A;  3VRB B;  1EU3 A;  1IPG A;  1GC7 A;  4HDO A;  1T0Q C;  2FNJ B;  3FIL A;  3PRZ A;  1C9F A;  3U4E G;  3AEB B;  3TJP A;  3WAM A;  3VH3 B;  2WS3 B;  4W9L A;  4O1N A;  2SEB D;  5CHV C;  3PRE A;  3L4P A;  4E71 A;  4GDK B;  2QIL A;  1TGZ B;  2FBW B;  1WX7 A;  2WXP A;  1MG4 A;  2JXX A;  3RI7 C;  2G4S A;  1TJE A;  5HG2 A;  3Q3J A;  4Q2J A;  2CU1 A;  3K9O B;  1XLN A;  2MP2 B;  2NPT B;  2LI5 A;  4KSK C;  4K81 A;  2G1E A;  4DHZ B;  2LFI A;  5BMH A;  3AED B;  3UF8 A;  3ETR A;  2UYZ B;  1SEB D;  2J52 A;  4F8C B;  3VR8 B;  2ICI A;  4GDL B;  4A8X C;  3MFG A;  3NRZ A;  1XT9 B;  4B0M A;  3DBH I;  2O6V B;  1STE A;  1Z2M A;  3S2A A;  3E56 A;  4A9A A;  1AN8 A;  1KLU D;  3TEW A;  1KH0 A;  4S0R A;  4YT0 B;  1HTO A;  1U4A A;  2WWZ A;  3PTF C;  4LNK A;  2QHO A;  4FHK A;  1RYJ A;  1OEY A;  2DBY A;  2YEP F;  3ZW3 A;  4EZK A;  2KTF A;  1WE6 A;  2KNB A;  3W5V B;  1YN3 A;  4ANV A;  2DX5 B;  2BYF A;  1SE2 A;  3QX1 A;  2UU7 A;  2B76 B;  4FHJ A;  2L1A A;  2W3S A;  3Q8A A;  1H8C A;  4HEA 1;  3I5J C;  5C3J B;  4G3X B;  5EE9 A;  4WWP A;  2WXF A;  2IGG A;  1ZE3 D;  2VZK B;  1YX5 B;  3IVF A;  4HXD A;  4OVZ A;  2N1V A;  1SJH D;  1EU4 A;  4MJS B;  1UZX B;  1UWM A;  2HJ1 A;  1WSP A;  2MSE D;  3TEX A;  4KDI C;  4J3O D;  1AWD A;  2JRI B;  2NTS A;  2H88 B;  2JWZ A;  1SB3 C;  1IGD A;  3IAM 1;  3NHE B;  4NJ7 A;  2J0J A;  1V1P B;  3OWE B;  3E9S A;  4YXD B;  1RFK A;  3PZ7 A;  2JX5 A;  1R4N B;  4ZHP A;  3IHP C;  4BBN F;  1K52 A;  2NBV B;  2RMM A;  5FR6 A;  3T3N A;  1IYF A;  1QOF A;  1MPE A;  1K8R B;  1JML A;  2YVC A;  1MVK A;  3KWL A;  4KZC A;  3PRP B;  1Z5S B;  3A9K B;  4MGI E;  3FKY A;  4W9H A;  3M62 B;  3PGE A;  1BML C;  1WF9 A;  2N9X A;  2N9L A;  4HDQ A;  2WX1 A;  3WAP A;  3KW5 B;  2AQ2 B;  5G5H A;  2IPK D;  3KWV A;  1OQQ A;  1QKZ A;  4LDT D;  1CZP A;  1GAQ B;  3PLV A;  2O6V A;  2JPH A;  3P2B A;  1CQV A;  3LJ3 A;  2H89 B;  4J6I A;  4IM2 A;  2J4X A;  2KX3 A;  4M8N A;  4NZL B;  3MC0 B;  1F9J A;  2V4L A;  2YLM A;  3WIM A;  4PT5 A;  2Y5C A;  5IAA C;  1QOG A;  2LRW A;  3DBH B;  3ZJV A;  2SAK A;  1C4P A;  1UF0 A;  2IBI B;  5LLI A;  3I57 A;  3Q8F A;  3D32 A;  1WIA A;  4RM9 A;  3P4R B;  2RGF A;  3PT2 B;  2BB6 A;  1ZKH A;  3UIO B;  2AYO B;  1ROE A;  1YIW A;  3ZNH B;  2K25 A;  4DXF A;  3A9J A;  1FFU A;  4GDL A;  1QT9 A;  2C60 A;  4XDC A;  1YN4 A;  1ENF A;  2L83 A;  1R4M B;  2JVC A;  4DXG A;  2FCN A;  2G9H D;  3ML8 A;  1KF6 B;  2AQ1 B;  1YNT E;  4KV2 A;  1XO3 A;  2LXC A;  3QCA A;  2PVG C;  2M0X A;  1OQR A;  3MC9 A;  2IY1 B;  3X0W A;  2V3N A;  1WXQ A;  4XC2 A;  4AQ7 A;  2CU3 A;  3U2S C;  5AZF A;  4I6L B;  4D2K A;  4NAM A;  2WU5 B;  3AE9 B;  2WYQ A;  4HRS A;  1VLB A;  3P1M A;  3KQ4 A;  3I9V 1;  2BYE A;  3H9D A;  3GOE A;  1WJ6 A;  4W9K A;  4HLE A;  3H8H A;  2RD0 A;  4L2Y A;  4ICV A;  1B9R A;  4P1B C;  3PPA A;  2FCS A;  3CWI A;  1KM7 A;  3AEF B;  2ZNV C;  3SU8 X;  2EKI A;  1Q0W B;  1IBX A;  2DWQ A;  1XQQ A;  3N3K B;  3NVV A;  4KKJ A;  4N58 A;  3Q2A C;  4A55 A;  1IP9 A;  1FXA A;  2KDI A;  2AWT A;  3HM3 A;  3RNA C;  3WA0 A;  2ZVO A;  3ALB A;  1I4P A;  3U8Z A;  5IN7 A;  1BUI C;  3DBR B;  2D3B A;  4IKG A;  1HXY D;  1JWS D;  3M3J A;  3LDZ E;  1JQ4 A;  3AEE B;  1GB1 A;  1UGM A;  1LQB A;  1C3T A;  1FXT B;  2EKE C;  3DHI C;  2LHE A;  2KFJ A;  1V1O A;  3LXF A;  3KUZ A;  1FRR A;  2BWE S;  2XK5 A;  4NJ6 A;  3DBS A;  3BWU D;  3RNE C;  2D3C A;  4ANU A;  2DNF A;  1J0G A;  2PTL A;  2LVQ A;  3P4P B;  2MJD A;  4MSM B;  2MBH A;  4HJG E;  2OJW A;  4WUR A;  4AP4 C;  2ZZP B;  1TS3 A;  4PS3 A;  3W1Y A;  2WXQ A;  1IBX B;  1EWC A;  2JQR B;  1RFA A;  3RNG C;  3NOB A;  4A20 A;  2DZK A;  4IG7 B;  1VDV A;  4M01 A;  1YX6 B;  1P0R A;  2BGF A;  2C7N B;  2MX2 A;  2IO0 B;  5I4D A;  5G5G A;  3NS1 A;  2JWU A;  5HFY A;  4DBG A;  3WAL A;  2K6Q A;  2BB5 A;  4BVU C;  1MJD A;  1R4M I;  1JWU D;  4TUU A;  2I1J A;  2Z8L A;  3OAW A;  4YSY B;  2KVZ A;  3R66 C;  1LXD A;  1GPX A;  1QIL A;  2BS4 B;  4PS8 A;  3ZO5 B;  2RSU A;  1ZXI A;  2PIA A;  1WGY A;  1E8Z A;  1SGH A;  3TIX A;  3A1Q A;  2BS2 B;  5TSS A;  3V60 A;  1Q1O A;  2L32 A;  3OG5 A;  1D5Z C;  1E8Y A;  3MJ5 A;  4ZDV A;  1V1P A;  4LK0 M;  1K50 A;  4OHJ A;  3B0A A;  3R7Q A;  1D6E C;  1E7U A;  3WAO A;  1P9D U;  2KTR B;  5E6N A;  3DWG C;  2LMC A;  2ZEQ A;  3VVW B;  4C7Y A;  2PLP A;  4LNN A;  2WP9 B;  1AW7 A;  1S1Q B;  3VUX A;  3ZXR A;  4ZRI A;  3I3T B;  4H2A A;  2WXM A;  4MGY E;  3R2T A;  2R61 A;  2BS3 B;  1HEZ E;  1OTR B;  1JAL A;  3PO0 A;  2I1K A;  2QCZ A;  3GE3 C;  4BBN C;  1PUT A;  2BYV E;  2L7R A;  3O13 A;  2O2V A;  3APD A;  5FK9 C;  3Q6B A;  3KLS X;  2OOB B;  1YQ4 B;  4W9D A;  2INC C;  2MBB B;  4BKS D;  1T0Y A;  3AUL A;  3NVZ A;  2HJ8 A;  4B9K A;  4R3D A;  2KJH B;  2FID A;  2D07 B;  5H92 C;  4B6W A;  1OGW A;  3Q69 A;  4JE3 B;  3MC8 A;  2BKF A;  3LYY A;  3RN9 C;  2K8C A;  2MW5 A;  3GS2 A;  4YTP B;  3NZ3 A;  3C8Y A;  4RCO A;  3PHX B;  3WAN A;  2KVR A;  1WRI A;  1K51 A;  1MFW A;  3RD2 A;  1F1H A;  2C7H A;  3B08 A;  4RMA A;  5J2R A;  3VR9 B;  1UUP A;  2PVO D;  2A5U A;  4B0E A;  4ZRJ A;  1RLF A;  4AS1 A;  2EMS A;  1SE4 A;  3EEC A;  4LTU A;  2KYW A;  1WJN A;  2J0K A;  1T3Q A;  1WM2 A;  2LVP A;  2PKO A;  4E3C A;  2KDB A;  2V9H A;  4N9F 4;  4BKS A;  4IM3 A;  3RNC C;  5G55 A;  4RM8 A;  2WLB A;  1IUE A;  4JWS C;  2HD5 B;  5KHQ A;  1FPY A;  4HRO A;  5AEK B;  4G50 A;  2YEP B;  4WIP A;  2UWQ A;  1T0S C;  2INN E;  1F52 A;  4S17 A;  2ZPY A;  4FJV B;  1HZ6 A;  3TUO A;  1XLO A;  5D3D A;  4XWT A;  2MRP A;  3Q8E A;  2KT7 A;  4RNA A;  3DVN V;  4HPL B;  3L13 A;  2B3A A;  2MLB A;  1UEL A;  3DBR I;  2LD9 A;  2FE8 A;  2KLG A;  2GLS A;  2XK5 B;  2DHZ A;  2DYO A;  3W1S C;  4WQM A;  2AEH A;  3EFU A;  2LJI A;  4JX1 C;  1ZUD 2;  3B9J A;  4GIV A;  1PGA A;  2LGI A;  4K1R B;  3OLM D;  3H6N A;  4RGN A;  1WE7 A;  4W9J A;  2LGS A;  3APF A;  3QC8 B;  1N5X A;  3CSF A;  5J17 A;  3SDL C;  3ABV B;  1D5M C;  3A4S C;  2MWS B;  1WFY A;  4ANW A;  3VQI A;  4L1B A;  2PEA A;  3DVN U;  2CR5 A;  2BPS A;  3WCQ A;  2L0F A;  4RFB A;  3N20 C;  3FIL B;  3AI5 A;  2CKH B;  1ESF A;  2KAJ A;  1TY2 A;  4XX5 A;  4MEM A;  2KO3 A;  1QZE A;  3N30 A;  4ZHO A;  4KX6 B;  2CJO A;  3AEC B;  2BQQ A;  1WXA A;  3APC A;  4M0W A;  2ZW1 A;  4EOY A;  2CJN A;  4RGM A;  2M17 A;  2WDV B;  2KZR A;  3CMM B;  4GMV A;  2LAS A;  2PPH A;  1YJ1 A;  1LM8 B;  2IO3 B;  4TQ1 A;  4QAY A;  4NAW A;  4URK A;  2WXH A;  3KYC D;  3U7D A;  2PE9 A;  1B1Z A;  1ZW7 A;  2NPT A;  3CF6 E;  1EWY C;  4KKI A;  4C7Z A;  2CHW A;  3QAR A;  5L83 A;  1WR1 A;  1EUV B;  4BFR A;  1WXV A;  2L00 B;  3UQB A;  5IOI A;  2V4I B;  3VDZ A;  2KN4 A;  4GDK A;  3MP9 A;  1ZPS A;  2PMV A;  3RUL A;  1V6E A;  1TZ1 A;  5AZH A;  2V0G A;  1WH3 A;  3KYD D;  4MH8 A;  4WWM A;  1FNW A;  2N9P C;  4IM0 A;  4MGZ E;  4JLC A;  4RF1 A;  3H7P B;  1L0Y B;  2N7D A;  2E3T A;  2V1Y A;  4JL9 A;  4GSW A;  2RR9 A;  1M4V A;  2NS5 A;  1D4B A;  3VRA B;  1V97 A;  2HDE A;  2L3Z A;  4IWP A;  4OZA A;  4P6V F;  3L17 A;  1HZ5 A;  4XYC A;  2ZCC A;  3Q3M C;  2DZM A;  1FM0 D;  1GOZ A;  4ICU A;  1XXG A;  1KJT A;  4JWU C;  3IBE A;  3NZS A;  2K1F A;  2K8H A;  2MQJ A;  2NVU I;  4N59 A;  4ZRP A;  4AUQ C;  4ASW C;  4M0W B;  4TMA B;  3MTN B;  1V80 A;  3OJ3 A;  1XCT L;  2IJ0 A;  2LUE A;  4PYU A;  3VTU A;  3JSV A;  1FRD A;  2E6X A;  4PS7 A;  2C9W B;  2WHI A;  3ZDT A;  1TIF A;  1QF6 A;  5C2T B;  1DOX A;  5CTR C;  1WI0 A;  2LJ5 A;  3RUI B;  1L5P A;  3AXC A;  3BVG A;  4XWW A;  2N7J A;  2AX5 A;  4YTN B;  4KGT A;  1MHH E;  1DYQ A;  1M94 A;  2C5L C;  3JYU A;  2WXN A;  2M4N A;  4CHK A;  2LRU A;  2XN9 C;  3SEB A;  1VZ7 A;  2DZI A;  4FUL A;  3TSS A;  1I42 A;  1CJE A;  5D2M B;  3ZRC A;  1WGK A;  2WXR A;  4NQK E;  2XNA C;  1E5W A;  3NZU A;  5BMI A;  2K9X A;  3QHT A;  2INP E;  2K5P A;  2WXL A;  5DPT A;  2FUH B;  3A9J B;  2MHJ A;  2BKR B;  3RPF C;  2KN5 A;  3RFZ B;  4P16 A;  4M8M A;  2JU6 X;  3ZQ4 A;  4EKU A;  3RCZ A;  1XF5 L;  4F1S A;  1PYW D;  2G4D B;  2MH7 A;  2G45 B;  3U30 A;  4C56 C;  3ZUN A;  4IUM B;  4BKG A;  3NJT A;  1TS5 A;  2BWF A;  1JRO A;  2XBB C;  1NDD A;  1ZXH A;  3W9C B;  1N5W A;  1YQB A;  3PV1 A;  1F2R C;  2ZNV B;  4GXB A;  4FA6 A;  4XE0 A;  1FO4 A;  3PZ8 A;  3NG0 A;  4EZL A;  4ANX A;  1KOT A;  2ZW0 A;  1A5R A;  2ZPN A;  2GMI C;  5BYR A;  2GBR A;  1I4G A;  2GBK A;  1L6U A;  1TYG B;  1C4A A;  3SD5 A;  4MAC A;  3IT6 B;  4EFO A;  3NVY A;  2FCM A;  4DQO C;  3IAS 1;  1UBQ A;  3RYT A;  3ML9 A;  4JPS A;  2RPQ A;  4HWI B;  5H8Y E;  3EC8 A;  2NBW B;  2DLB A;  2L76 A;  1UWX A;  1VZ6 A;  3AB5 A;  3UI3 A;  2JRH A;  2QDF A;  1WY8 A;  5CHW A;  5D6J B;  2TSS A;  5J18 A;  1XEE A;  3NVW A;  4IWQ A;  1FCL A;  1N62 A;  4DHJ B;  2NCN A;  3C0R B;  4US8 A;  4L23 A;  2K8B A;  3BVZ A;  3H1U A;  4ZYN A;  4PYZ A;  5D94 A;  3BIN A;  5G2N A;  1RRB A;  4NPN A;  3IT4 B;  2WDQ B;  4FLH A;  5JHA A;  1AAR A;  3R3M A;  2DYM A;  4WJQ A;  2J42 A;  2GBM A;  4TSS A;  4YTM B;  3DHH C;  3L16 A;  1TKE A;  2LXA A;  2RDH A;  2GBJ A;  5JXV A;  3VTV A;  1TT5 B;  2HTM E;  3PRM B;  1WR6 E;  3X23 A;  2CHX A;  2KFK A;  1I4R A;  4ZRK A;  4TQ0 A;  1SJE D;  3JVZ X;  3TBL D;  5C1Z A;  3DVG X;  4GLS C;  2KMC A;  1JRU A;  1Y56 A;  2OHF A;  4NQL B;  4WJO A;  5DPR A;  2N7E A;  2JSV X;  1UD7 A;  2Q5W D;  3ECI A;  4XZ4 A;  1I4Q A;  1YQ3 B;  3VFK A;  5CX3 A;  3AE8 B;  2PE6 B;  1NYQ A;  4RF0 A;  5MPO A;  4DXA B;  2AL3 A;  3BK1 A;  3PVL A;  1I4H A;  2KMA A;  4MJS A;  1V8C A;  3ZVV A;  1L0V B;  5JHB A;  2W54 A;  1N63 A;  5IP4 D;  3M95 A;  2EEL A;  4MDK E;  1S3S G;  1GJZ A;  5HI1 A;  3I63 C;  2L8J A;  5IA7 A;  2V3S A;  4USA A;  3R2I A;  1WX9 A;  3QAQ A;  2BYT A;  5GXG B;  3KUC B;  1NEK B;  4LNO A;  4AOF A;  3RZF A;  3A1Q B;  1V5T A;  1I7H A;  1ISN A;  4BOZ B;  2Z59 B;  3ONS A;  1C78 A;  3M63 B;  4HKQ A;  4JGH B;  2KHW B;  2A4Z A;  1RM6 C;  2BF8 B;  1AYF A;  4FJZ A;  4OVV A;  2JZZ A;  2X38 A;  3IG3 A;  3RMK C;  3H7S A;  3Q14 C;  2KJ6 A;  2D3G A;  5E6O A;  4XGA B;  1PDX A;  2ZCB A;  4C00 A;  2MEK A;  3AEA B;  2KQ7 A;  4E74 A;  4P7I A;  1F2R I;  1WGD A;  3AH7 A;  1TTN A;  4DHJ D;  1L7Y A;  3QK0 A;  5E6P A;  1YD8 U;  2IGH A;  3AE7 B;  3T8M A;  1D3Z A;  1GG3 A;  4W9C A;  4IDI A;  3NY5 A;  2FUG 1;  3AEG B;  3Q8C A;  2O2V B;  1UH6 A;  1EF5 A;  1ZGU B;  3DHG C;  2Z0E B;  2ASQ A;  3R7R A;  3AE2 B;  1V81 A;  3HVD A;  5BMG A;  2IDY A;  1PFD A;  3MHS D;  2KTR A;  4NNJ B;  1L4D B;  3VXW A;  4HKZ E;  3SFE B;  4MM3 A;  2LEK A;  4K7W A;  1HQR D;  1KRH A;  1TBE A;  2IO1 B;  3R8B A;  4HVB A;  4I6N B;  1GB4 A;  1NYR A;  1Q10 A;  3RZW C;  4K3C A;  3HK0 A;  3B2F A;  1SIJ A;  3L08 A;  4RGO S;  2KQS A;  4DK5 A;  3ZGZ A;  1VD2 A;  4UDU C;  1RWS A;  2MJ3 A;  3QQ8 B;  1C1Y B;  3CIR B;  2CHZ A;  4IWO A;  2NBU A;  2JUO A;  4G0N B;  3L54 A;  3N1Y C;  4EE2 A;  1V49 A;  3ZXV A;  3GB1 A;  2OJR A;  3A4R A;  3W1S A;  1WMH B;  1I35 A;  5DPW A;  3K9P B;  3DVG Y;  3EA6 A;  4TKN A;  3AU5 A;  2KC2 A;  4NAW B;  4BZA A;  2Y3A A;  2WU2 B;  3RNF C;  1SXT A;  3C19 A;  2ZJD A;  2GBN A;  1HE8 A;  1E8X A;  2KQ4 X;  2KAN A;  3ZIM A;  2NR2 A;  2XEW A;  3MJW A;  2KWD A;  1XLQ A;  2LGY A;  1T5X D;  1TKG A;  1Y8R C;  2JF5 A;  4YL8 A;  4EUT A;  2MBE A;  2QMT A;  3N1Z C;  3L0W B;  3N9Y C; 
#chains in the Genus database with same CATH homology
 4ARI A;  4N59 A;  4ZRP A;  3H8H A;  4L2Y A;  2NTT A;  3W2D A;  3HVZ A;  4TMA B;  1K53 A;  2GI9 A;  4RGT A;  1B9R A;  1YJJ A;  1XCT L;  2IJ0 A;  3FAH A;  5D7G A;  1P7E A;  1FIQ A;  1UGJ A;  2JYT A;  3CWI A;  3AEF B;  3EUB 2;  2EKI A;  1N60 A;  3NUH B;  3U52 E;  1IBX A;  2W3R A;  1I4X A;  1FRD A;  1FMA D;  2E6X A;  3AE3 B;  1NI3 A;  2DWQ A;  1QLB B;  1UNS A;  5LNK 1;  4LLG M;  3NVV A;  3DWM A;  4ITK A;  1FD6 A;  2JZP A;  4KKJ A;  4A90 A;  1DOY A;  2I38 A;  1QF6 A;  3AE5 B;  4N58 A;  5C2T B;  4A55 A;  1DOX A;  1E0Z A;  1FXA A;  1L5P A;  3AN1 A;  3W5U B;  3BVG A;  5AUK A;  2WQY B;  2RDG A;  4XWW A;  2JXT A;  2N7J A;  1PGX A;  2AX5 A;  1FFV A;  3ZJT A;  4YTN B;  4KGT A;  1MHH E;  5EE1 A;  4YWG G;  1I4P A;  1DYQ A;  2WXN A;  1BUI C;  1FCC C;  1SBB B;  4IKG A;  1HXY D;  3ZYY X;  1ZDV A;  2XN9 C;  4YSZ B;  3SEB A;  1VZ7 A;  1JWS D;  3AV8 A;  3TSS A;  3BVM A;  5BYS A;  1CJE A;  3AEE B;  1GB1 A;  1JQ4 A;  4US9 A;  1WGK A;  1JWM D;  2V3P A;  2WXR A;  2XNA C;  4OW0 A;  3BYY B;  2GRI A;  2LHE A;  2K9X A;  5BMI A;  1J7B A;  1V1O A;  2INP E;  3LXF A;  2K5P A;  2WXL A;  1MI0 A;  1FRR A;  1JWB D;  3BWU D;  3RPF C;  3RFZ B;  4P16 A;  2JU6 X;  3ZQ4 A;  3BZD B;  2BBC A;  2K22 A;  1XF5 L;  3LB8 C;  4NJC A;  3TEY A;  2MH7 A;  1PYW D;  1TKY A;  1WYG A;  1ZOY B;  2PTL A;  4C56 C;  3SFD B;  5BYQ A;  1DGJ A;  3P4P B;  2MJD A;  1D5X C;  2ON8 A;  1SF0 A;  1TS5 A;  3P63 A;  4HJG E;  1JRO A;  2KMM A;  4WUR A;  3AE4 B;  1TS3 A;  1ZXH A;  3W9C B;  2WXQ A;  1N5W A;  5EE0 A;  1IBX B;  1EWC A;  2J53 A;  2JQR B;  1EM7 A;  1F2R C;  1FO4 A;  4XE0 A;  3PZ8 A;  1L6V A;  2I2Y A;  3Q8B A;  3ZJU A;  3TEZ A;  3V3X A;  1VDV A;  3V05 A;  1SE3 A;  2ZW0 A;  2BT6 A;  5I4D A;  1NVI D;  5G5G A;  1PGB A;  3NS1 A;  5BYR A;  4A6Q A;  1I4G A;  1L6U A;  1TYG B;  2MJE A;  1C4A A;  2JWU A;  5E6J A;  5HFY A;  4ZOH C;  1VRA B;  3HUI A;  2WXJ A;  4MAC A;  1FNU A;  3IT6 B;  1C77 A;  3NVY A;  2BB5 A;  4DQO C;  1JWU D;  3IAS 1;  2LUM A;  2Z8L A;  4FXC A;  2QJL A;  4JPS A;  1FNV A;  1QOB A;  3GP7 A;  1DOI A;  4YSY B;  4MM3 B;  1J7C A;  3AE6 B;  3MHZ A;  3URY A;  2M56 B;  1GPX A;  1QIL A;  2BS4 B;  1KTK A;  2N9K A;  5H8Y E;  2DLB A;  2VZK D;  1UWX A;  1VZ6 A;  1YJI A;  1VR9 A;  1ZXI A;  2L52 A;  2PIA A;  3VRB B;  4CQN A;  1EU3 A;  3AB5 A;  4ARC A;  3UI3 A;  1IGC A;  2BS2 B;  5TSS A;  2L32 A;  3T3O A;  1D5Z C;  3FIL A;  1C9F A;  3U4E G;  2OED A;  3AEB B;  2TSS A;  3MJ5 A;  1XEE A;  1QQR A;  1V1P A;  3NVW A;  4LK0 M;  1K50 A;  2ACZ B;  1A70 A;  2WS3 B;  1FXI A;  4OHJ A;  4YSX B;  1N62 A;  1FCL A;  4O1N A;  2SEB D;  1TS4 A;  5EE3 A;  1ZP0 B;  3BYT B;  1D6E C;  3HRD D;  3L4P A;  4GDK B;  2QIL A;  5AUI A;  4US8 A;  4L23 A;  2FBW B;  3BVZ A;  2LMC A;  1ET9 A;  3DWG C;  4C7Y A;  2WXP A;  2PLP A;  1TJE A;  5HG2 A;  2WXO A;  2WP9 B;  1AW7 A;  1YN5 A;  4Q2J A;  4RH6 A;  4H2A A;  1KLG D;  2WXM A;  3IT4 B;  3R2T A;  1XLN A;  2WDQ B;  2R61 A;  2BS3 B;  1HEZ E;  1JAL A;  2DYM A;  2J42 A;  3PO0 A;  4TSS A;  2G1E A;  1PUT A;  2LFI A;  3O13 A;  2W82 A;  3AE1 B;  3AED B;  4YTM B;  5BMH A;  1JWA D;  1TKE A;  5FK9 C;  2RDH A;  3ETR A;  3KLS X;  1YQ4 B;  5JXV A;  2HTM E;  1SEB D;  2J52 A;  1E7P B;  2NMQ A;  3VR8 B;  1KFY B;  2M0A A;  3NVZ A;  1I4R A;  4R3D A;  2ICI A;  4GDL B;  4A8X C;  3MFG A;  1R7S A;  1SJE D;  3NRZ A;  4TQ0 A;  4B0M A;  5H92 C;  3Q69 A;  4JE3 B;  4GLS C;  1E6E B;  1STE A;  2WXG A;  2KDM A;  2OHF A;  1Y56 A;  3LYY A;  3E56 A;  1JW9 D;  4A9A A;  3GS2 A;  4YTP B;  3NZ3 A;  1ZDX A;  1AN8 A;  2GB1 A;  1VZ8 A;  2JSV X;  3C8Y A;  1KLU D;  4RCO A;  3TEW A;  2WXI A;  1KH0 A;  2Q5W D;  4YT0 B;  1F77 A;  1I4Q A;  1WRI A;  1YQ3 B;  1K51 A;  1TY0 A;  3AE8 B;  1RYJ A;  1NYQ A;  2DBY A;  4RF0 A;  5MPO A;  2YEP F;  3BK1 A;  3VR9 B;  1UUP A;  2PVO D;  3W5V B;  1I4H A;  4ZRQ A;  4B0E A;  1V8C A;  1YN3 A;  1L0V B;  4AS1 A;  1YMH E;  1SE4 A;  2WXK A;  4LTU A;  2W54 A;  1L4Z B;  1N63 A;  1SE2 A;  1SSN A;  1T3Q A;  2EEL A;  2B76 B;  2W55 A;  2PKO A;  4REZ A;  3U7Z A;  1TZO A;  3IXS A;  5HI1 A;  2L1A A;  2W3S A;  5T8I A;  2M19 A;  2WLB A;  3Q8A A;  2BW2 A;  4HEA 1;  4USA A;  1IUE A;  3R2I A;  4JWS C;  5C3J B;  5EE9 A;  2BYT A;  1QOA A;  4HRO A;  3EGR A;  5GXG B;  1NEK B;  2YEP B;  2WXF A;  2IGG A;  4WIP A;  1ZE3 D;  2AQ3 B;  2INN E;  2VZK B;  3SR6 A;  1HZ6 A;  1WWT A;  3J9C A;  3TUO A;  4ZYS A;  3B2G A;  1XLO A;  5D3D A;  1OFF A;  4OVZ A;  4XWT A;  1JCK B;  3Q8E A;  4RNA A;  4WH4 A;  3BII D;  1SJH D;  1I7H A;  1EU4 A;  3P42 A;  1UWM A;  1C78 A;  1WSP A;  4HKQ A;  3TEX A;  4J3O D;  2FE8 A;  1AWD A;  2NTS A;  1C79 A;  3FC4 A;  2QEJ C;  2DYO A;  2H88 B;  1NEN B;  1SB3 C;  1IGD A;  1RM6 C;  4WQM A;  3IAM 1;  1AYF A;  2LJI A;  4JX1 C;  1V1P B;  3OWE B;  1C4C A;  3E9S A;  2X38 A;  4YXD B;  1RFK A;  1N61 A;  1ZUD 2;  3PZ7 A;  1HA5 A;  3B9J A;  2JX5 A;  3BK2 A;  1PGA A;  4ZHP A;  2K3U A;  2LGI A;  1PDX A;  2IGD A;  2MEK A;  3AEA B;  2QIE B;  4RGN A;  1K52 A;  1F2R I;  1BXT A;  3AH7 A;  5D3I B;  4WAF A;  1TS2 A;  1N5X A;  3ABV B;  1LO5 D;  1D5M C;  5HHD G;  2RMM A;  3T3N A;  1QOF A;  2IGH A;  1MPE A;  3P4Q B;  3AE7 B;  1ET6 A;  4L1B A;  1JML A;  3VQI A;  1MHX A;  1MVK A;  3KWL A;  4IDI A;  1E10 A;  3WCQ A;  2FUG 1;  3AEG B;  3Q8C A;  2RPV A;  4RFB A;  1BML C;  3FIL B;  1ESF A;  2KAJ A;  1TY2 A;  2N9L A;  3AE2 B;  2AQ2 B;  5G5H A;  2IPK D;  3KWV A;  4ZHO A;  3HVD A;  4KX6 B;  2CJO A;  5BMG A;  1OQQ A;  1QKZ A;  3AEC B;  4KGS A;  2IDY A;  1PFD A;  4M0W A;  2ZW1 A;  2PW9 A;  1CZP A;  1GAQ B;  2N0S B;  2CJN A;  1P7F A;  4RGM A;  1L4D B;  1CK1 A;  2WDV B;  4HKZ E;  3SFE B;  1CQV A;  2WNM A;  4OZB A;  2LEK A;  2H89 B;  1HQR D;  1KRH A;  4C80 A;  3R8B A;  1XLP A;  2J4X A;  4TQ1 A;  1T6B X;  4MT5 A;  4NZL B;  4N6E B;  1NYR A;  1Q10 A;  2WXH A;  1GB4 A;  3B2F A;  1VJK A;  3MC0 B;  1L0X B;  3AM9 A;  1B1Z A;  1SIJ A;  4RGO S;  1F0Z A;  1FEH A;  4PT5 A;  2Y5C A;  1QOG A;  3ZGZ A;  4KKI A;  1EWY C;  4XDD A;  3ZJV A;  2SAK A;  4UDU C;  4C7Z A;  1C4P A;  1RWS A;  2MJ3 A;  3CIR B;  3I57 A;  3Q8F A;  5FR3 A;  2D5G A;  4KGR A;  3P4R B;  2BB6 A;  1ROE A;  1E9M A;  2BTE A;  4EE2 A;  4DXF A;  2V4I B;  1JRP A;  2KN4 A;  3GB1 A;  3MP9 A;  1FFU A;  1ZPS A;  2Y5P A;  3W1S A;  1QT9 A;  2PMV A;  4XDC A;  1YN4 A;  1ENF A;  2V0G A;  2L83 A;  4DXG A;  2JYE A;  3EA6 A;  3P4S B;  2G9H D;  4MH8 A;  2QSD A;  4WWM A;  1KF6 B;  2AQ1 B;  4NAW B;  1YNT E;  1FNW A;  2WU2 B;  2Y3A A;  3AMZ A;  1XO3 A;  1SXT A;  2PVG C;  1OQR A;  2LHD A;  4RF1 A;  2V3N A;  1ACC A;  1L0Y B;  2WDR B;  1C76 A;  2E3T A;  1WXQ A;  2KQ4 X;  4IOI E;  4OZC A;  4AQ7 A;  1XCQ L;  2CU3 A;  3U2S C;  1M4V A;  1D4B A;  3VRA B;  1V97 A;  2HDE A;  4D2K A;  4NAM A;  2WU5 B;  4OZA A;  3AE9 B;  2KWD A;  1HZ5 A;  1XLQ A;  4P6V F;  2KAC A;  1J7A A;  1T5X D;  4HRS A;  1TKG A;  2K0P A;  1VLB A;  1FM0 D;  3P1M A;  3KQ4 A;  1GOZ A;  5FKA C;  3I9V 1;  1XXG A;  2ONQ A;  4JWU C;  2QMT A;  3N9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...