1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein fimD
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
1ZE3D 4J3OD 4B0MA 1ZDXA 3RFZB 1ZDVA 3BWUD 4B0EA
chains in the Genus database with same CATH superfamily
3Q8AA 1WMHA 1R7SA 1A70A 4A20A 2WS3B 2GBMA 1RAXA 1EU4A 2JY6A 4XDCA 3RT3B 1YJ1A 5E6PA 2LGYA 4OVUA 1D3ZA 3WANA 1YQBA 2MP2A 1GC7A 1J7AA 4NJ7A 3WCQA 4FXCA 1WJ4A 2FCSA 2LJ5A 3TSSA 5D2MB 3JVZX 3LXFA 1SE3A 1QOBA 2LXAA 2ZNVC 3CSTA 2IGGA 2WHIA 3AXCA 3PHWB 3QAQA 1YJIA 2E3TA 1CQVA 2ZVOA 1TZ1A 1MJDA 4RMAA 1KLVA 4REZA 1MHHE 2FUG1 2PVOD 1UH6A 4GDKA 1L6VA 3DBSA 4DK5A 1FRDA 2KDBA 4DWFA 2L52A 2DNFA 3QJZA 4TQ1A 2GOWA 1YIWA 3AE8B 3VR8B 3ZYYX 2LVPA 1WZ0A 2JQRB 1Q1OA 5L95C 3VXWA 2K5PA 4MH0E 3GOEA 1C9FA 2KTFA 2GMIC 5JHAA 1N5WA 2KLGA 3ALBA 2MEKA 3ETRA 1E7VA 1ENFA 3N20C 3TCAA 1EO6A 4K1RB 2MA9B 3OJ4B 1ZPSA 3EC8A 2GB1A 1T0YA 1KM7A 3LB8C 5CTRC 4JPSA 3BYTB 2V3SA 2UWQA 2AL3A 5JH5C 1JCKB 2ZZPB 4LNFA 1NDDA 1Q0WB 1WJNA 1ROEA 4IG7B 1EM7A 2KX0A 3NOBA 2WXHA 4OZAA 2K8BA 4AP4C 3QHTA 4HRSA 4HKQA 2EKIA 1FFVA 2LRUA 1D5ZC 1FNUA 2L32A 2MJDA 3R7QA 3ABVB 4II2B 1R4MI 3AE5B 1FRRA 2N9EB 1VCBA 3B1LX 1WMHB 2Y5PA 4MJSA 5LNK1 4PS8A 2KJ6A 2N9XA 4W9CA 1V86A 5MPOA 2NTSA 1N5XA 4FJVB 3DWMA 1MHXA 4AWJA 2LI5A 1WYWB 4A3OA 3DBHI 3DCGA 2Z8LA 4A3PA 4W9GA 3PLUA 1IGDA 3R66C 3U52E 2XBBC 4OZBA 4AS1A 1D5MC 1WJUA 3UGBB 4ZRQA 3NZUA 2FAZA 1L0YB 2KYWA 2WDRB 5H92C 2V3PA 1KFYB 1TS4A 4MEMA 4MDKE 1Z5SB 2WNMA 3GE3C 3OJ3A 3VVWB 4NJ6A 2R61A 2KNBA 3CF6E 4GDKB 2L05A 2BTEA 1B1ZA 4WURA 5BMGA 3RYTA 4HDOA 4EEWA 4NQLB 4FHJA 2N7JA 1C4AA 4WQOB 1WZ3A 4I6NB 4OVZA 2KQ7A 2ASQA 3QK0A 2LZ6A 3V60A 1WXVA 4NJCA 4EE2A 1L6UA 2J53A 3IT4B 1PFDA 3ZNGC 4DXGA 2W3RA 2KTRB 2A5UA 2B76B 2J4XA 1AW7A 3B2FA 1GJZA 3KLSX 3UQBA 1SF0A 1E8YA 2MHJA 5BMIA 4JQWC 3TBLD 2ICIA 4JIOU 3P4PB 1XLPA 3M95A 2ZW1A 3ZQ4A 1K8RB 5C3JB 3RCZA 2L83A 2N1VA 2MJ3A 3E56A 4YL8A 1L0XB 1FFUA 2MW5A 4TQ0A 4BZAA 1WX9A 5GMVA 3QQ8B 1TYGB 1FCLA 1AN8A 1NYRA 3KWVA 2FIDA 1JW9D 4G11A 1UZXB 4RF0A 1E8WA 3Q8EA 4W9KA 2WXMA 1V81A 4PYUA 1WRIA 1FNWA 1GB4A 3DVNV 4TV3A 1XXGA 2L1AA 4ANXA 3FC4A 1ET9A 1B9RA 4HVBA 3MJWA 1LO5D 1WXAA 1L0VB 3K9OB 2K39A 2DZKA 4II3B 3R3MA 3UIPB 2PLPA 3PVLA 2TSSA 3DVGX 3K9PB 3HVZA 1OEYA 2JZZA 2NBWB 2KD0A 2J0JA 4URKA 4YWGG 4MGYE 2DZIA 2M19A 2LVOA 4JX1C 1OTRB 3JSVA 4C56C 2O6VD 4IW0A 4L1BA 1C78A 3ZXVA 4W9EA 1GNUA 3T8MA 3L54A 1FMAD 3ML8A 3OAWA 2J0KA 5FK9C 4HJKA 1SIJA 3W9CB 4M0WB 3NVVA 2KFJA 2ZPNA 1WH3A 3UINB 4ZHPA 2UU7A 2EMTA 2L0FA 3Q3MC 1PGXA 1YJJA 1HZ5A 3UIOB 2D07B 3WALA 3OG5A 5G5GA 3LJ3A 4DHZB 3N3KB 4NAWA 1P7FA 1FXIA 3HIZA 4D2KA 1DOIA 2NMQA 1ZW7A 4HLEA 3A9JA 4M02A 3BWUD 3GE8C 3TEXA 4ICVA 2BW2A 2L3ZA 2D3BA 2IPKD 2KJHB 2DX5B 3PS6A 1WX8A 1SGHA 1V9JA 3VH3B 2GBRA 3J9CA 2XK5B 1T0SC 2EKEC 4IKGA 2PPHA 2KFKA 2LGXA 3W5UB 1E5WA 3JYUA 2DAFA 4IOIE 3B0AA 2CJOA 2MBOA 2J42A 2BQQA 1I42A 4LNKA 3FILA 4WJQA 3Q14C 2WXPA 1UUPA 3C19A 2BYEA 4I6PA 4NZLB 2V4IB 2KZRA 5CHFA 1VDVA 4K3BA 4IUMB 3VTVA 4HWIB 2IY0B 3H6NA 2M0AA 2O2VB 4ARCA 3NG0A 1LXDA 2KC1A 2GBJA 5E6NA 2W9NA 4CHKA 1KLGD 1R4NB 4PK1A 1UGJA 3NJTA 2C7HA 3RI7C 2IYDB 1M4VA 4ZHOA 2OJRA 4G50A 3GS2A 1XEEA 1H4RA 1SE9A 3IXSA 4NQKE 3SEBA 3SHQA 2K6DB 1QQRA 3GZNB 1F1HA 2RMMA 3DBRB 4L2YA 1CMXB 2G1EA 3L13A 1HXYD 3QA8A 1QKZA 4XDDA 1F0ZA 3X23A 4IDIA 3FAHA 1ISNA 2RDBC 3NZ3A 5CHVC 3AE4B 5IAAC 1WXSA 1L4ZB 3H9DA 1JQ4A 4RGNA 2GI9A 3AI5A 1SJHD 2C5LC 2I1KA 3MC8A 5BYQA 2MH7A 1SE2A 2OEDA 1ZDVA 2N9LA 2C7NB 2JSVX 3OWEB 4CQNA 1JWMD 1QF6A 2AX5A 1WGDA 3Q6BA 4BAXA 5T8IA 2Z59B 5LXIB 4JE3B 3IAS1 3VTUA 2AQ2B 2WXIA 3RNAC 2CS4A 4BFRA 4FN2A 4P7IA 4N59A 1LQBA 2JX5A 4DHJD 1RFKA 3BY4B 3NVZA 4ARIA 2KN4A 3V6CB 4P6VF 1WY8A 2QILA 2HE7A 2CHZA 4RFBA 2PVGC 5BYSA 4RCOA 3ZDTA 2IGHA 2NBUA 2MQJA 2LUMA 2WLBA 1WI0A 3BINA 3RNEC 2M0XA 5DPWA 4GN1A 4AUQC 2MBHA 4X57B 5BO4B 5IA7A 4ZRIA 1WSPA 5C1ZA 1MG4A 2BBCA 4BBNC 3SD5A 1JRUA 1VZ6A 2W55A 3P1MA 1DYQA 1K52A 2JWUA 2WX0A 4A9AA 2G4SA 2WWZA 2C7MB 1HTOA 3FILB 3NVYA 1NI2A 1L4DB 2KWCA 3ZTDA 2IZVB 3PRPB 4BKGA 4WJNA 4ZYNA 2GBNA 4BVUC 3PV1A 2Y3AA 1FIQA 2KVZA 2NPTA 1AARA 1WE7A 1ZDXA 3VUXA 3ML9A 4RF1A 1WR6E 1V6EA 3EECA 4C4VB 4EZKA 1NBFC 3V05A 5IN7A 3APCA 3QC8B 3W2DA 3PLVA 5CX3A 2HD5B 1VJKA 2LXCA 1OFFA 3U7DA 4HROA 1DGJA 5J2RA 2BPSA 3PO0A 4ZDVA 2BGFA 1WXQA 2QSDA 1V1PB 4HDQA 2LHDA 2JWZA 3ZIMA 1WE6A 4WJOA 3RN9C 3L08A 2OHFA 3IHPC 2HTHA 4RNAA 3AEDB 3V61A 3PZDA 5G5HA 3TIXA 1OGWA 3KYDD 5KHOA 3U2SC 3A4RA 3VR9B 1JALA 4DQOC 1WYGA 4CYEA 3VFKA 4LLGM 1N60A 3M3JA 3MFGA 2WU2B 1YX6B 3AEBB 3AMZA 1YQ3B 3H8HA 3WAOA 4BOZB 2KOXA 3C0RB 2JYEA 2GLSA 3T3NA 2JPHA 4LNNA 4PS7A 4W9IA 1TIFA 3EHVA 3HVDA 3ZDMC 2IO3B 4K81A 1WIAA 2VH1A 3APFA 1LM8B 2D10A 3X0WA 2WXOA 2KDMA 3AEFB 5E6OA 4MGZE 4H2AA 3L4PA 3MTNB 1AYFA 3GZNI 1XF5L 3DBRI 4RGOS 1I35A 2WQYB 3H7PA 1WGGA 2KHWB 3IAM1 4QAYA 4F8CB 2SEBD 4ICUA 4PT5A 2KN5A 3RUIB 4DBGA 1G6JA 3R8BA 2M1MA 4KKJA 3ZVVA 2N7EA 2M4NA 1S3SG 2DENB 3MC0B 1C77A 2KO3A 4R3DA 1YNTE 3I3TB 2DZJA 2KQ4X 4K7WA 1ET6A 5IKCM 3HUIA 4WWMA 1Q10A 3KQ4A 3AE1B 4C00A 4FJZA 4A55A 3M63B 3ZXRA 2BWFA 4WIPA 4CO7A 1AWDA 2MP2B 5FKAC 3HM6X 1SSNA 3AE9B 1RRBA 4E3CA 2KC2A 3N1XC 3MHSD 1XCTL 2I38A 2IDYA 1E7UA 4MGKE 4W9DA 2INNE 2K3UA 2KLCA 3N32A 2LFIA 2HJ8A 3W1SC 1QT9A 2LJIA 1VR9A 1PGBA 1S1QB 2PMVA 4KSLC 5J17A 2J7QB 4LCDE 3I63C 3BVMA 3VTWA 2CU3A 5HHDG 4DDGD 4ZRKA 4OVVA 1KF6B 1CK1A 1YD8U 4WWPA 3A4SC 4KGSA 1HTQA 1P1AA 1IP9A 2E6XA 1TJEA 1SEBD 3QCAA 2IJ0A 2NCNA 1N62A 1KTKA 1EUVB 2ZCCA 2ZCBA 5HKHA 2ZEQA 2ZW0A 4M8NA 2FCMA 3PREA 1ZKHA 3N30A 4DHZE 2DLBA 2GRIA 2JF5A 4C7ZA 3VDZA 3S2AA 4HXDA 1NI3A 5JHBA 1N63A 4DXFA 2AYOB 4FA6A 3B08A 1FEHA 3Q3FA 2L0TA 1T0QC 1XCQL 3AU5A 2V0GA 3I5JC 5AUKA 1LGRA 4B0EA 1IBXA 3RNFC 2L76A 5DCNA 3JW0X 1NYQA 2IY1B 4ANUA 2XNAC 1P3QU 2JXTA 1TKYA 4MELA 2BF8B 2HDEA 1TTNA 2N1WA 4S17A 4XWTA 1K53A 2FIFA 2LVQA 1P7EA 2JT4B 3LDZE 2N0SB 4XE0A 2IO1B 1IYFA 2MSED 1E8XA 1RLFA 4MJSB 2PE6B 4NPNA 3IFWB 4C80A 3Q8FA 1XLQA 3HHMA 4N9F4 2RGFA 3U7ZA 2MCNB 4GSWA 4LK0M 1XD3B 4BKTA 4K7SA 1E9MA 1Q5WB 2PTLA 4TKNA 4KIKA 4MSMB 1C76A 2KX3A 3R2TA 2BS4B 1J0GA 2FCQA 2C60A 2Y5BB 3P4SB 3N1ZC 2KWUB 5H8YE 3N9YC 4GLSC 3ZJVA 2LGSA 2WXRA 4MM3A 4O1NA 5TSSA 2V3NA 1XQQA 4RM9A 1GPXA 2ON8A 5FR3A 3MP9A 3RNBC 1I7HA 5TR5A 2L00B 3AEEB 1C79A 4BKSA 1I4PA 4HEA1 1TGZB 5D3DA 2MBBB 4ANVA 3AULA 3KW5B 3TJPA 2RDGA 4OHJA 2IO2B 1F77A 3P4QB 4MH8A 3PTFC 2IGDA 3DHIC 4NNJB 3TUOA 3SFDB 3BK2A 2DYBA 1V49A 3DBLB 4KV2A 5IO9A 3PZ7A 2LGDA 3U4EG 2FUHB 1GB1A 2MLBA 1UELA 2CKHB 3RPFC 2QJLA 3ECIA 4AOFA 2DBYA 4EZLA 2RD0A 3KUZA 1WGKA 2WYQA 3PPAA 3SFEB 3O13A 1GUAB 3RULA 2DYOA 3NHEB 3W1YA 4GDLA 1IBXB 2KQSA 1FPYA 2ACZB 2INCC 2JRIB 4WWNA 4WAFA 1JRPA 2DZMA 1HA5A 3ZRFA 2KAJA 1SIFA 3DDCB 4ZRPA 3ZTCA 2SAKA 5FR6A 2K1FA 3Q3OC 1GG3A 2PEAA 1TS3A 1ZP0B 3ZW3A 5LXHA 2MWSB 2BS3B 4W9HA 5J18A 3T9LA 2Z0DB 3AN1A 3R2IA 2V4LA 4RGTA 1UWXA 2UYZB 4FBJB 2BYFA 5BYRA 4B0MA 4M8MA 2ZJDA 2KACA 5EE0A 1C3TA 4LDTB 1SB3C 5KHQA 4YSYB 5BMHA 2WDVB 5JXVA 4KSKC 1WFYA 1FO4A 2N7DA 3JSVB 2YVCA 3KH0A 3EFUA 1NEKB 1MVKA 3L17A 2CJNA 1V1OA 3BK1A 4A90A 3QIJA 3NVWA 3I9V1 1VLBA 3VUYA 2HJ1A 3BVGA 3NZSA 2KANA 1JWBD 3P42A 4US8A 5AZGA 1GC6A 4KIKB 4W9JA 1SBBB 1FCCC 3B2GA 3CSFA 1STEA 2PJHA 1KOTA 2IBIB 1N6ZA 3DOWA 1VZ8A 4FULA 1H8CA 4MM3B 4NAWB 4OW0A 2ZPYA 4PS3A 2R2QA 3TEWA 1EU3A 3A9JB 3AU4A 4PYZA 1T6BX 3RNGC 3VRAB 5C23A 2INPE 1XT9B 2AQ1B 1SXTA 2BB6A 3KWLA 2JU6X 4G0NB 2PW9A 3URYA 2N9KA 1PGAA 4C7YA 1C1YB 5AUIA 1C4CA 1D6EC 2QMTA 2VRRB 2MBEA 1UBIA 2KFKB 5HFYA 4M01A 3PSEB 1V80A 3IBEA 3AV8A 3BZDB 1YX5B 2QCZA 1PYWD 2K25A 2FNJB 1QLBB 2G45B 2D2QA 2ZNVB 3V62A 3Q2AC 2BWES 4HK2A 2YEPB 3EUB2 3W1SA 3N1YC 1P9DU 4L23A 4GMVA 4IWQA 4JGHB 1E90A 2M8SA 2D11A 2FBWB 1TS2A 2WXNA 4HCPB 1TT5B 1WX7A 2XN9C 2LUEA 4JLCA 4LNIA 4GDLB 1E0ZA 2H89B 1KRHA 2Z0EB 3ZKJC 3PRZA 2KVRA 3CIRB 4XYCA 4XC2A 2PIAA 1PDXA 3PGEA 1FXAA 2WXFA 1WGRA 3UQAA 3DVNU 2KK8A 1ZOYB 4YTMB 1UD7A 3RMKC 3HRDD 4MSQB 1XO3A 2BS2B 3UI3A 4Q2JA 2BKRB 1YN4A 3QWZB 1UGMA 1BUIC 1UNSA 2M17A 2REXA 2D3AA 3DBLI 3KYCD 3TEZA 2PE9A 3RD2A 1XLNA 2WDQB 3FKYA 1E7PB 1HEZE 3VAWA 1HE8A 4P16A 5D94A 2KDIA 2H88B 1YN5A 3A1QA 1HQRD 3EFCA 2R2OA 3P63A 2BYVE 1YQ4B 5IOIA 2JVCA 2NVUI 1DOYA 1RYJA 3PT2B 4YXDB 2K9XA 1R4NI 2KKCA 2V1YA 3CMMB 4EKUA 1JWAD 4I6LB 3WIMA 2I1JA 1JMLA 3CWIA 2KTRA 2IO0B 3T3OA 2LMCA 1D5XC 2CHWA 2KDEB 2NS5A 1EF1A 1Z2MA 2WP9B 1L2NA 3VHTC 3AH7A 1MG8A 3MC9A 4UDUC 2KMCA 4AJWA 3PHXB 5HG2A 1KLUD 5D3IB 4FJYA 5C2TB 4F1SA 2V9HA 2DHZA 2HTME 3APDA 3ZLZA 2D5GA 4IM2A 2VZKB 2VZKD 1N61A 5DPSA 3AB5A 1VZ7A 3RFZB 2X8XX 3O65B 3E9SA 1TBEA 5E6JA 4BBNF 3U30A 3HK0A 3UF8A 2AQ3B 2EELA 1F2RI 2J52A 3H1UA 4W9LA 5G55A 1PQSA 5JZEB 3VH4B 1KH0A 3Q69A 4NY0A 2NPTB 2LGIA 2RPVA 3AEAB 2BB5A 2WXJA 1E10A 3DPDA 4GXBA 3W5VB 2MBQA 1TZOA 1CZPA 3GB1A 3R7RA 1ZUD2 4HKZE 1XLOA 4F7ZA 4GOCA 2A4ZA 2O6VA 1K50A 1T5XD 4EZJA 1I4HA 1LFDA 4YT0B 4XGAB 2YEPF 4KZCA 2WXQA 3TEYA 4XWWA 4M0WA 1I4GA 2KT7A 1P0RA 1IGCA 3SU8X 2CU1A 4KGRA 2YLMA 1BXTA 4XX5A 2BKFA 4EOYA 4WWOA 3QX1A 2LEKA 1ESFA 3OLMD 4KKIA 4MACA 1J7BA 1VRAB 2L8JA 3P2BA 3WAPA 4N58A 3SDLC 1QOGA 2CR5A 1NVID 1TKGA 4RH6A 2I2YA 2LWPA 1T3QA 1WR1A 4GB9A 3A1QB 2KMMA 3RZWC 3BIID 2BYTA 1I4XA 2Q5WD 4K3CA 2XK5A 3ZNID 1OEYJ 4N6EB 1ZGUB 4TMAB 2MX2A 4MGIE 3NS1A 3PRMB 1SJED 1OQQA 2JRHA 3A33B 3Q3JA 2NBVB 4P1BC 4JWUC 1F52A 2Y5CA 4B9KA 1QZEA 4KZ0A 1RWSA 2LHEA 2ONQA 4YSXB 4J6IA 3L16A 1IUEA 2ZVNA 1IPGA 1BMLC 2KMAA 2BVCA 2O2VA 3H7PB 5AZHA 1UF0A 2JZPA 4FLHA 1SE4A 2KJRA 4WH4A 1RM6C 2BT6A 2LASA 5DPRA 4WJPA 5AZFA 3L0WB 1Y56A 3AECB 4US9A 4RM8A 1TY2A 3KUDB 4EFOA 4WAAA 1L7YA 3SR6A 2QHOA 4NAMA 4A6QA 5L83A 4P1CC 3ZJTA 2KXJA 1OQRA 4IC7B 3ENEA 4ACFA 4FADA 4WQMA 4J3OD 3Q3NC 1WXMA 3NRZA 1RFAA 3MHZA 2GBKA 4HPPA 3VUWA 4KDLB 2W3SA 2RPQA 2L7RA 4RGMA 4JL9A 3ZNZB 4ZYSA 3WAMA 2X38A 4LJPB 2CHXA 1J7CA 3ZO5B 1WGHA 2JXXA 4DDID 1ZXHA 3B9JA 4HPMB 1Y8RC 1YOVB 2FE8A 3DQVA 2G3QB 1BT0A 2O6VB 2G4DB 4USAA 4AQ7A 4GU2A 2WXLA 3EA6A 3AE2B 4E74A 2QEJC 3V6EB 1X1MA 4G3XB 1ZE3D 2DWQA 1D4BA 4IWOA 1VD2A 1FXTB 2QDFA 3ZRCA 2KDFB 3BYYB 3V3XA 1TY0A 4ANWA 1MPEA 3HM3A 3VRBB 1V5OA 2AL6A 1JROA 5EE9A 3WA0A 5IP4D 1MI0A 1JWSD 2MRPA 4HPLB 4GIVA 3Q8CA 2WX1A 1J19A 4HJGE 4TSSA 3EGRA 1GOZA 1TS5A 3I57A 3BVZA 1V8CA 4MT5A 3IT6B 1ACCA 5G2NA 2N9PC 3DHHC 2D3CA 3IG3A 3PZ8A 3RNCC 2DAJA 3QARA 3C8YA 2G9HD 2RDHA 1UWMA 4JWSC 3AEGB 1U4AA 1YMHE 3A9KA 2KWDA 2QC8A 1NENB 1EWCA 5D6JB 4YTNB 2W82A 2NTTA 3ZNHB 3VQIA 2AEHA 2K6QA 1I4QA 4B6WA 1E6EB 1EWYC 4OZCA 4DXAB 4YTPB 3LYYA 2EMSA 1JWUD 3KUCB 1UBQA 3AE3B 3L10B 2K22A 2JZ3B 4C4VA 1F9JA 1T0RC 3NY5A 2K0PA 4XZ4A 2OJWA 4ITKA 4FHKA 1WRDB 2J0MA 3U8ZA 3MJ5A 3NUHB 2LRWA 3AE7B 1V5TA 4TUUA 1P98A 1E8ZA 2LD9A 3M62B 4LDTD 2AWTA 5HI1A 1WF9A 1FM0D 4YSZB 1V1PA 3DVGY 3DWGC 1I4RA 1WM2A 1YN3A 4ZOHC 1MFWA 1WWTA 1WJ6A 3IVFA 2D3GA 2WU5B 4E71A 5EE1A 1DOXA 2RSUA 4KVGB 1FNVA 3P4RB 4IWPA 2QIEB 3TMPB 3ZJUA 5EDSA 1A5RA 4LTUA 3TL5A 2KWVB 4ASWC 2RR9A 1R4MB 1L5PA 2JUOA 2W54A 2JYTA 1C4PA 1WM3A 2INDC 2N4FA 3DHGC 1CJEA 1OQYA 1V2YA 1PUTA 3D32A 4KDIC 3GP7A 2VH2A 5AEKB 4KGTA 1KJTA 4S0RA 5CHWA 2C9WB 4EUTA 1ZXIA 5GXGB 4LNOA 3ZGZA 4K7UA 3ZUNA 1QILA 5D7GA 2WXKA 4DHJB 3H7SA 3DBHB 2WXGA 3AE6B 2K8HA 2NR2A 2DYMA 4BKSD 4IM0A 4B95A 2K8CA 5LLIA 1HZ6A 2OOBB 3KVFB 1F2RC 5I4DA 1QOAA 1TKEA 2B3AA 4BOSC 3NS8A 3Q8BA 3AM9A 4LJOB 2FCNA 4HCNB 5DPTA 1V97A 4GGQA 1J8CA 4AJYB 4IM3A 1M94A 1QOFA 1FD6A 2PKOA 4A8XC 1GAQB 1EF5A 2M56B 5EE3A 4W9FA 2WGSA 4M00A 1WGYA 2XEWA 3RZFA 2MJEA 3ONSA 1K51A 3A9KB 4KX6B 2WDTB 4ZRJA
chains in the Genus database with same CATH topology
3Q8AA 1R7SA 1A70A 2WS3B 1EU4A 4XDCA 1KLGD 2AQ3B 2EELA 1UGJA 1F2RI 2J52A 4XWTA 1K53A 1J7AA 1KH0A 3WCQA 3Q69A 4FXCA 1M4VA 4ZHOA 1P7EA 2N0SB 2LGIA 3GS2A 4XE0A 1XEEA 2RPVA 3IXSA 3TSSA 3AEAB 3SEBA 3LXFA 1SE3A 2BB5A 2WXJA 1E10A 1QOBA 4C80A 3Q8FA 1QQRA 3W5VB 1TZOA 1XLQA 1CZPA 3GB1A 2IGGA 2RMMA 1ZUD2 4L2YA 2G1EA 1HXYD 1QKZA 1XLOA 4HKZE 3U7ZA 4XDDA 1F0ZA 4IDIA 3FAHA 1YJIA 2E3TA 1K50A 1T5XD 1I4HA 1CQVA 4LK0M 3NZ3A 4YT0B 3AE4B 4REZA 1MHHE 1L4ZB 2FUG1 2PVOD 2YEPF 1E9MA 2WXQA 1L6VA 3TEYA 2PTLA 1JQ4A 4RGNA 1FRDA 2GI9A 1SJHD 4XWWA 1C76A 4M0WA 1I4GA 3R2TA 2BS4B 5BYQA 1IGCA 2L52A 2MH7A 4TQ1A 4KGRA 1SE2A 2OEDA 1BXTA 1ZDVA 3P4SB 2N9LA 2JSVX 3OWEB 3AE8B 4CQNA 3VR8B 3ZYYX 1JWMD 2LEKA 1ESFA 2AX5A 4KKIA 4MACA 3N9YC 5H8YE 4GLSC 3ZJVA 1J7BA 2JQRB 2WXRA 5T8IA 1VRAB 4O1NA 4JE3B 3IAS1 2AQ2B 2WXIA 5TSSA 4N58A 2V3NA 1QOGA 1GPXA 2K5PA 2ON8A 4N59A 5FR3A 3MP9A 2JX5A 1RFKA 1I7HA 1NVID 1TKGA 4RH6A 3NVZA 2I2YA 4ARIA 1T3QA 2KN4A 1C9FA 3AEEB 1C79A 4P6VF 2QILA 2KMMA 1I4PA 4HEA1 1N5WA 2MEKA 5D3DA 3BIID 3ETRA 1ENFA 2BYTA 1I4XA 2Q5WD 4RFBA 2PVGC 5BYSA 4RCOA 2IGHA 4N6EB 2RDGA 4OHJA 1F77A 3P4QB 4MH8A 1ZPSA 4TMAB 2GB1A 2IGDA 1SJED 3NS1A 2LUMA 3TUOA 1OQQA 3SFDB 3BK2A 2WLBA 3LB8C 4JWUC 2Y5CA 4JPSA 3BYTB 3PZ7A 3U4EG 1GB1A 1RWSA 2LHEA 2ONQA 3RPFC 4YSXB 1WSPA 1JCKB 2QJLA 1IUEA 2DBYA 2BBCA 1ROEA 1VZ6A 1WGKA 1BMLC 2W55A 1EM7A 3P1MA 1DYQA 1K52A 2JZPA 2JWUA 2WXHA 4OZAA 1SE4A 4A9AA 4HRSA 4HKQA 3SFEB 4WH4A 2EKIA 1RM6C 1FFVA 2BT6A 3O13A 2DYOA 3FILB 3NVYA 1D5ZC 1L4DB 1FNUA 1Y56A 2L32A 3AECB 2MJDA 4US9A 1IBXB 3ABVB 2ACZB 1TY2A 3AE5B 4WAFA 1FRRA 1JRPA 3SR6A 4NAMA 1HA5A 4A6QA 2Y3AA 1FIQA 2KAJA 1ZDXA 3ZJTA 4ZRPA 1OQRA 2SAKA 2Y5PA 1TS3A 4RF1A 5LNK1 4WQMA 4J3OD 1ZP0B 3NRZA 2BS3B 5MPOA 2NTSA 1N5XA 3DWMA 3V05A 1MHXA 3AN1A 3R2IA 3MHZA 4RGTA 1UWXA 3W2DA 2W3SA 5BYRA 4RGMA 4B0MA 2Z8LA 1VJKA 4ZYSA 1OFFA 3U52E 1IGDA 2X38A 2KACA 4HROA 4OZBA 5EE0A 4AS1A 1D5MC 1DGJA 3PO0A 4ZRQA 1WXQA 1J7CA 2QSDA 1V1PB 1L0YB 2LHDA 1ZXHA 1SB3C 4YSYB 2WDRB 5BMHA 5H92C 2WDVB 3B9JA 5JXVA 2OHFA 1FO4A 2V3PA 1KFYB 2FE8A 1TS4A 4RNAA 1NEKB 3AEDB 1MVKA 2WNMA 4USAA 4AQ7A 5G5HA 2CJNA 2WXLA 3AE2B 3EA6A 1V1OA 2QEJC 3BK1A 4A90A 3U2SC 3NVWA 3I9V1 1VLBA 2R61A 1ZE3D 2DWQA 4GDKB 3VR9B 1D4BA 3BVGA 1JALA 1JWBD 3P42A 3BYYB 4DQOC 3V3XA 4US8A 2BTEA 1WYGA 1TY0A 1B1ZA 4WURA 5BMGA 1SBBB 1MPEA 4LLGM 1N60A 1FCCC 3B2GA 3MFGA 2WU2B 3AEBB 2N7JA 1C4AA 3AMZA 1YQ3B 3H8HA 3VRBB 2JYEA 3T3NA 1JROA 1STEA 5EE9A 4OVZA 1MI0A 1VZ8A 1JWSD 4MM3B 4NAWB 4OW0A 4NJCA 3HVDA 4EE2A 3TEWA 1L6UA 2J53A 1EU3A 3Q8CA 3IT4B 1PFDA 1T6BX 3VRAB 4HJGE 4TSSA 4DXGA 2INPE 2W3RA 3EGRA 2B76B 2J4XA 2AQ1B 2WXOA 1SXTA 2KDMA 3AEFB 1GOZA 1AW7A 1TS5A 3I57A 2BB6A 3KWLA 2JU6X 3BVZA 1V8CA 2PW9A 3B2FA 3URYA 2N9KA 1PGAA 4C7YA 5AUIA 1C4CA 3KLSX 4H2AA 4MT5A 1SF0A 3L4PA 3IT6B 1ACCA 1D6EC 5BMIA 2QMTA 1AYFA 3PZ8A 5HFYA 3C8YA 1XF5L 2G9HD 2ICIA 4RGOS 3AV8A 3P4PB 1XLPA 2RDHA 2WQYB 1UWMA 3BZDB 3AEGB 4JWSC 2ZW1A 3ZQ4A 5C3JB 1YMHE 2KWDA 1PYWD 3IAM1 2L83A 1NENB 2MJ3A 2SEBD 3E56A 1EWCA 1QLBB 4PT5A 1L0XB 1FFUA 4YTNB 4TQ0A 2W82A 2NTTA 3VQIA 3R8BA 1I4QA 4KKJA 2YEPB 3EUB2 3W1SA 1TYGB 4L23A 3MC0B 1AN8A 1E6EB 1NYRA 1FCLA 3KWVA 1C77A 1EWYC 4OZCA 4R3DA 1JW9D 4YTPB 3LYYA 1YNTE 4RF0A 1JWUD 3Q8EA 2KQ4X 2FBWB 3AE3B 1ET6A 2WXMA 1WRIA 1TS2A 3HUIA 1FNWA 2WXNA 4WWMA 1GB4A 1Q10A 3KQ4A 3AE1B 2K22A 4A55A 1XXGA 2L1AA 2XN9C 3FC4A 4GDLB 1ET9A 1E0ZA 4WIPA 1B9RA 2H89B 1KRHA 2K0PA 1AWDA 4ITKA 5FKAC 3CIRB 3MJ5A 2PIAA 1LO5D 1PDXA 3NUHB 1QF6A 1SSNA 1L0VB 3AE7B 3AE9B 1FXAA 2WXFA 2PLPA 2TSSA 5HI1A 1ZOYB 1FM0D 3HVZA 4YSZB 4YTMB 1V1PA 1XCTL 2I38A 2IDYA 3HRDD 1XO3A 2BS2B 4YWGG 3DWGC 3UI3A 4Q2JA 1I4RA 1YN3A 2M19A 4JX1C 4ZOHC 2INNE 2K3UA 1YN4A 1WWTA 2LFIA 1QT9A 2WU5B 4C56C 2LJIA 1VR9A 5EE1A 1DOXA 1BUIC 1UNSA 1FNVA 4L1BA 3P4RB 2QIEB 1C78A 3ZJUA 3TEZA 1PGBA 1FMAD 4LTUA 1XLNA 5FK9C 2PMVA 2WDQB 1SIJA 3W9CB 1L5PA 2W54A 3NVVA 1E7PB 2JYTA 1HEZE 1C4PA 3BVMA 4P16A 1CJEA 2CU3A 2H88B 4ZHPA 5HHDG 1YN5A 1PUTA 1HQRD 1PGXA 3P63A 3GP7A 1YJJA 1HZ5A 1YQ4B 1KF6B 1CK1A 4KGSA 4KGTA 5G5GA 1DOYA 1P7FA 1FXIA 1RYJA 1ZXIA 5GXGB 4YXDB 2K9XA 3ZGZA 2E6XA 4D2KA 1DOIA 1TJEA 2NMQA 1QILA 5D7GA 1SEBD 2IJ0A 2WXKA 3BWUD 3TEXA 1JWAD 1N62A 2WXGA 1KTKA 3AE6B 1JMLA 3CWIA 2BW2A 3T3OA 2IPKD 2DYMA 2LMCA 1D5XC 2ZW0A 3J9CA 1HZ6A 2DLBA 2GRIA 2WP9B 4C7ZA 3AH7A 1F2RC 4UDUC 4IKGA 5HG2A 1NI3A 5I4DA 1KLUD 1N63A 1QOAA 5D3IB 3W5UB 4DXFA 1TKEA 3Q8BA 3AM9A 4IOIE 2CJOA 5C2TB 1FEHA 2J42A 1XCQL 2V0GA 1V97A 2HTME 5AUKA 2D5GA 3FILA 2VZKB 2VZKD 1N61A 1QOFA 1UUPA 2WXPA 4B0EA 1IBXA 1FD6A 2PKOA 4A8XC 4NZLB 1GAQB 1NYQA 2V4IB 3AB5A 1VDVA 1VZ7A 2M56B 2XNAC 3RFZB 5EE3A 2M0AA 2JXTA 1TKYA 4ARCA 2MJEA 3E9SA 1K51A 4KX6B 5E6JA 2HDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE3 D;  4J3O D;  4B0M A;  1ZDX A;  3RFZ B;  1ZDV A;  3BWU D;  4B0E A; 
#chains in the Genus database with same CATH topology
 3Q8A A;  1WMH A;  1R7S A;  1A70 A;  4A20 A;  2WS3 B;  2GBM A;  1RAX A;  1EU4 A;  2JY6 A;  4XDC A;  3RT3 B;  1YJ1 A;  5E6P A;  2LGY A;  4OVU A;  1D3Z A;  3WAN A;  1YQB A;  2MP2 A;  1GC7 A;  1J7A A;  4NJ7 A;  3WCQ A;  4FXC A;  1WJ4 A;  2FCS A;  2LJ5 A;  3TSS A;  5D2M B;  3JVZ X;  3LXF A;  1SE3 A;  1QOB A;  2LXA A;  2ZNV C;  3CST A;  2IGG A;  2WHI A;  3AXC A;  3PHW B;  3QAQ A;  1YJI A;  2E3T A;  1CQV A;  2ZVO A;  1TZ1 A;  1MJD A;  4RMA A;  1KLV A;  4REZ A;  1MHH E;  2FUG 1;  2PVO D;  1UH6 A;  4GDK A;  1L6V A;  3DBS A;  4DK5 A;  1FRD A;  2KDB A;  4DWF A;  2L52 A;  2DNF A;  3QJZ A;  4TQ1 A;  2GOW A;  1YIW A;  3AE8 B;  3VR8 B;  3ZYY X;  2LVP A;  1WZ0 A;  2JQR B;  1Q1O A;  5L95 C;  3VXW A;  2K5P A;  4MH0 E;  3GOE A;  1C9F A;  2KTF A;  2GMI C;  5JHA A;  1N5W A;  2KLG A;  3ALB A;  2MEK A;  3ETR A;  1E7V A;  1ENF A;  3N20 C;  3TCA A;  1EO6 A;  4K1R B;  2MA9 B;  3OJ4 B;  1ZPS A;  3EC8 A;  2GB1 A;  1T0Y A;  1KM7 A;  3LB8 C;  5CTR C;  4JPS A;  3BYT B;  2V3S A;  2UWQ A;  2AL3 A;  5JH5 C;  1JCK B;  2ZZP B;  4LNF A;  1NDD A;  1Q0W B;  1WJN A;  1ROE A;  4IG7 B;  1EM7 A;  2KX0 A;  3NOB A;  2WXH A;  4OZA A;  2K8B A;  4AP4 C;  3QHT A;  4HRS A;  4HKQ A;  2EKI A;  1FFV A;  2LRU A;  1D5Z C;  1FNU A;  2L32 A;  2MJD A;  3R7Q A;  3ABV B;  4II2 B;  1R4M I;  3AE5 B;  1FRR A;  2N9E B;  1VCB A;  3B1L X;  1WMH B;  2Y5P A;  4MJS A;  5LNK 1;  4PS8 A;  2KJ6 A;  2N9X A;  4W9C A;  1V86 A;  5MPO A;  2NTS A;  1N5X A;  4FJV B;  3DWM A;  1MHX A;  4AWJ A;  2LI5 A;  1WYW B;  4A3O A;  3DBH I;  3DCG A;  2Z8L A;  4A3P A;  4W9G A;  3PLU A;  1IGD A;  3R66 C;  3U52 E;  2XBB C;  4OZB A;  4AS1 A;  1D5M C;  1WJU A;  3UGB B;  4ZRQ A;  3NZU A;  2FAZ A;  1L0Y B;  2KYW A;  2WDR B;  5H92 C;  2V3P A;  1KFY B;  1TS4 A;  4MEM A;  4MDK E;  1Z5S B;  2WNM A;  3GE3 C;  3OJ3 A;  3VVW B;  4NJ6 A;  2R61 A;  2KNB A;  3CF6 E;  4GDK B;  2L05 A;  2BTE A;  1B1Z A;  4WUR A;  5BMG A;  3RYT A;  4HDO A;  4EEW A;  4NQL B;  4FHJ A;  2N7J A;  1C4A A;  4WQO B;  1WZ3 A;  4I6N B;  4OVZ A;  2KQ7 A;  2ASQ A;  3QK0 A;  2LZ6 A;  3V60 A;  1WXV A;  4NJC A;  4EE2 A;  1L6U A;  2J53 A;  3IT4 B;  1PFD A;  3ZNG C;  4DXG A;  2W3R A;  2KTR B;  2A5U A;  2B76 B;  2J4X A;  1AW7 A;  3B2F A;  1GJZ A;  3KLS X;  3UQB A;  1SF0 A;  1E8Y A;  2MHJ A;  5BMI A;  4JQW C;  3TBL D;  2ICI A;  4JIO U;  3P4P B;  1XLP A;  3M95 A;  2ZW1 A;  3ZQ4 A;  1K8R B;  5C3J B;  3RCZ A;  2L83 A;  2N1V A;  2MJ3 A;  3E56 A;  4YL8 A;  1L0X B;  1FFU A;  2MW5 A;  4TQ0 A;  4BZA A;  1WX9 A;  5GMV A;  3QQ8 B;  1TYG B;  1FCL A;  1AN8 A;  1NYR A;  3KWV A;  2FID A;  1JW9 D;  4G11 A;  1UZX B;  4RF0 A;  1E8W A;  3Q8E A;  4W9K A;  2WXM A;  1V81 A;  4PYU A;  1WRI A;  1FNW A;  1GB4 A;  3DVN V;  4TV3 A;  1XXG A;  2L1A A;  4ANX A;  3FC4 A;  1ET9 A;  1B9R A;  4HVB A;  3MJW A;  1LO5 D;  1WXA A;  1L0V B;  3K9O B;  2K39 A;  2DZK A;  4II3 B;  3R3M A;  3UIP B;  2PLP A;  3PVL A;  2TSS A;  3DVG X;  3K9P B;  3HVZ A;  1OEY A;  2JZZ A;  2NBW B;  2KD0 A;  2J0J A;  4URK A;  4YWG G;  4MGY E;  2DZI A;  2M19 A;  2LVO A;  4JX1 C;  1OTR B;  3JSV A;  4C56 C;  2O6V D;  4IW0 A;  4L1B A;  1C78 A;  3ZXV A;  4W9E A;  1GNU A;  3T8M A;  3L54 A;  1FMA D;  3ML8 A;  3OAW A;  2J0K A;  5FK9 C;  4HJK A;  1SIJ A;  3W9C B;  4M0W B;  3NVV A;  2KFJ A;  2ZPN A;  1WH3 A;  3UIN B;  4ZHP A;  2UU7 A;  2EMT A;  2L0F A;  3Q3M C;  1PGX A;  1YJJ A;  1HZ5 A;  3UIO B;  2D07 B;  3WAL A;  3OG5 A;  5G5G A;  3LJ3 A;  4DHZ B;  3N3K B;  4NAW A;  1P7F A;  1FXI A;  3HIZ A;  4D2K A;  1DOI A;  2NMQ A;  1ZW7 A;  4HLE A;  3A9J A;  4M02 A;  3BWU D;  3GE8 C;  3TEX A;  4ICV A;  2BW2 A;  2L3Z A;  2D3B A;  2IPK D;  2KJH B;  2DX5 B;  3PS6 A;  1WX8 A;  1SGH A;  1V9J A;  3VH3 B;  2GBR A;  3J9C A;  2XK5 B;  1T0S C;  2EKE C;  4IKG A;  2PPH A;  2KFK A;  2LGX A;  3W5U B;  1E5W A;  3JYU A;  2DAF A;  4IOI E;  3B0A A;  2CJO A;  2MBO A;  2J42 A;  2BQQ A;  1I42 A;  4LNK A;  3FIL A;  4WJQ A;  3Q14 C;  2WXP A;  1UUP A;  3C19 A;  2BYE A;  4I6P A;  4NZL B;  2V4I B;  2KZR A;  5CHF A;  1VDV A;  4K3B A;  4IUM B;  3VTV A;  4HWI B;  2IY0 B;  3H6N A;  2M0A A;  2O2V B;  4ARC A;  3NG0 A;  1LXD A;  2KC1 A;  2GBJ A;  5E6N A;  2W9N A;  4CHK A;  1KLG D;  1R4N B;  4PK1 A;  1UGJ A;  3NJT A;  2C7H A;  3RI7 C;  2IYD B;  1M4V A;  4ZHO A;  2OJR A;  4G50 A;  3GS2 A;  1XEE A;  1H4R A;  1SE9 A;  3IXS A;  4NQK E;  3SEB A;  3SHQ A;  2K6D B;  1QQR A;  3GZN B;  1F1H A;  2RMM A;  3DBR B;  4L2Y A;  1CMX B;  2G1E A;  3L13 A;  1HXY D;  3QA8 A;  1QKZ A;  4XDD A;  1F0Z A;  3X23 A;  4IDI A;  3FAH A;  1ISN A;  2RDB C;  3NZ3 A;  5CHV C;  3AE4 B;  5IAA C;  1WXS A;  1L4Z B;  3H9D A;  1JQ4 A;  4RGN A;  2GI9 A;  3AI5 A;  1SJH D;  2C5L C;  2I1K A;  3MC8 A;  5BYQ A;  2MH7 A;  1SE2 A;  2OED A;  1ZDV A;  2N9L A;  2C7N B;  2JSV X;  3OWE B;  4CQN A;  1JWM D;  1QF6 A;  2AX5 A;  1WGD A;  3Q6B A;  4BAX A;  5T8I A;  2Z59 B;  5LXI B;  4JE3 B;  3IAS 1;  3VTU A;  2AQ2 B;  2WXI A;  3RNA C;  2CS4 A;  4BFR A;  4FN2 A;  4P7I A;  4N59 A;  1LQB A;  2JX5 A;  4DHJ D;  1RFK A;  3BY4 B;  3NVZ A;  4ARI A;  2KN4 A;  3V6C B;  4P6V F;  1WY8 A;  2QIL A;  2HE7 A;  2CHZ A;  4RFB A;  2PVG C;  5BYS A;  4RCO A;  3ZDT A;  2IGH A;  2NBU A;  2MQJ A;  2LUM A;  2WLB A;  1WI0 A;  3BIN A;  3RNE C;  2M0X A;  5DPW A;  4GN1 A;  4AUQ C;  2MBH A;  4X57 B;  5BO4 B;  5IA7 A;  4ZRI A;  1WSP A;  5C1Z A;  1MG4 A;  2BBC A;  4BBN C;  3SD5 A;  1JRU A;  1VZ6 A;  2W55 A;  3P1M A;  1DYQ A;  1K52 A;  2JWU A;  2WX0 A;  4A9A A;  2G4S A;  2WWZ A;  2C7M B;  1HTO A;  3FIL B;  3NVY A;  1NI2 A;  1L4D B;  2KWC A;  3ZTD A;  2IZV B;  3PRP B;  4BKG A;  4WJN A;  4ZYN A;  2GBN A;  4BVU C;  3PV1 A;  2Y3A A;  1FIQ A;  2KVZ A;  2NPT A;  1AAR A;  1WE7 A;  1ZDX A;  3VUX A;  3ML9 A;  4RF1 A;  1WR6 E;  1V6E A;  3EEC A;  4C4V B;  4EZK A;  1NBF C;  3V05 A;  5IN7 A;  3APC A;  3QC8 B;  3W2D A;  3PLV A;  5CX3 A;  2HD5 B;  1VJK A;  2LXC A;  1OFF A;  3U7D A;  4HRO A;  1DGJ A;  5J2R A;  2BPS A;  3PO0 A;  4ZDV A;  2BGF A;  1WXQ A;  2QSD A;  1V1P B;  4HDQ A;  2LHD A;  2JWZ A;  3ZIM A;  1WE6 A;  4WJO A;  3RN9 C;  3L08 A;  2OHF A;  3IHP C;  2HTH A;  4RNA A;  3AED B;  3V61 A;  3PZD A;  5G5H A;  3TIX A;  1OGW A;  3KYD D;  5KHO A;  3U2S C;  3A4R A;  3VR9 B;  1JAL A;  4DQO C;  1WYG A;  4CYE A;  3VFK A;  4LLG M;  1N60 A;  3M3J A;  3MFG A;  2WU2 B;  1YX6 B;  3AEB B;  3AMZ A;  1YQ3 B;  3H8H A;  3WAO A;  4BOZ B;  2KOX A;  3C0R B;  2JYE A;  2GLS A;  3T3N A;  2JPH A;  4LNN A;  4PS7 A;  4W9I A;  1TIF A;  3EHV A;  3HVD A;  3ZDM C;  2IO3 B;  4K81 A;  1WIA A;  2VH1 A;  3APF A;  1LM8 B;  2D10 A;  3X0W A;  2WXO A;  2KDM A;  3AEF B;  5E6O A;  4MGZ E;  4H2A A;  3L4P A;  3MTN B;  1AYF A;  3GZN I;  1XF5 L;  3DBR I;  4RGO S;  1I35 A;  2WQY B;  3H7P A;  1WGG A;  2KHW B;  3IAM 1;  4QAY A;  4F8C B;  2SEB D;  4ICU A;  4PT5 A;  2KN5 A;  3RUI B;  4DBG A;  1G6J A;  3R8B A;  2M1M A;  4KKJ A;  3ZVV A;  2N7E A;  2M4N A;  1S3S G;  2DEN B;  3MC0 B;  1C77 A;  2KO3 A;  4R3D A;  1YNT E;  3I3T B;  2DZJ A;  2KQ4 X;  4K7W A;  1ET6 A;  5IKC M;  3HUI A;  4WWM A;  1Q10 A;  3KQ4 A;  3AE1 B;  4C00 A;  4FJZ A;  4A55 A;  3M63 B;  3ZXR A;  2BWF A;  4WIP A;  4CO7 A;  1AWD A;  2MP2 B;  5FKA C;  3HM6 X;  1SSN A;  3AE9 B;  1RRB A;  4E3C A;  2KC2 A;  3N1X C;  3MHS D;  1XCT L;  2I38 A;  2IDY A;  1E7U A;  4MGK E;  4W9D A;  2INN E;  2K3U A;  2KLC A;  3N32 A;  2LFI A;  2HJ8 A;  3W1S C;  1QT9 A;  2LJI A;  1VR9 A;  1PGB A;  1S1Q B;  2PMV A;  4KSL C;  5J17 A;  2J7Q B;  4LCD E;  3I63 C;  3BVM A;  3VTW A;  2CU3 A;  5HHD G;  4DDG D;  4ZRK A;  4OVV A;  1KF6 B;  1CK1 A;  1YD8 U;  4WWP A;  3A4S C;  4KGS A;  1HTQ A;  1P1A A;  1IP9 A;  2E6X A;  1TJE A;  1SEB D;  3QCA A;  2IJ0 A;  2NCN A;  1N62 A;  1KTK A;  1EUV B;  2ZCC A;  2ZCB A;  5HKH A;  2ZEQ A;  2ZW0 A;  4M8N A;  2FCM A;  3PRE A;  1ZKH A;  3N30 A;  4DHZ E;  2DLB A;  2GRI A;  2JF5 A;  4C7Z A;  3VDZ A;  3S2A A;  4HXD A;  1NI3 A;  5JHB A;  1N63 A;  4DXF A;  2AYO B;  4FA6 A;  3B08 A;  1FEH A;  3Q3F A;  2L0T A;  1T0Q C;  1XCQ L;  3AU5 A;  2V0G A;  3I5J C;  5AUK A;  1LGR A;  4B0E A;  1IBX A;  3RNF C;  2L76 A;  5DCN A;  3JW0 X;  1NYQ A;  2IY1 B;  4ANU A;  2XNA C;  1P3Q U;  2JXT A;  1TKY A;  4MEL A;  2BF8 B;  2HDE A;  1TTN A;  2N1W A;  4S17 A;  4XWT A;  1K53 A;  2FIF A;  2LVQ A;  1P7E A;  2JT4 B;  3LDZ E;  2N0S B;  4XE0 A;  2IO1 B;  1IYF A;  2MSE D;  1E8X A;  1RLF A;  4MJS B;  2PE6 B;  4NPN A;  3IFW B;  4C80 A;  3Q8F A;  1XLQ A;  3HHM A;  4N9F 4;  2RGF A;  3U7Z A;  2MCN B;  4GSW A;  4LK0 M;  1XD3 B;  4BKT A;  4K7S A;  1E9M A;  1Q5W B;  2PTL A;  4TKN A;  4KIK A;  4MSM B;  1C76 A;  2KX3 A;  3R2T A;  2BS4 B;  1J0G A;  2FCQ A;  2C60 A;  2Y5B B;  3P4S B;  3N1Z C;  2KWU B;  5H8Y E;  3N9Y C;  4GLS C;  3ZJV A;  2LGS A;  2WXR A;  4MM3 A;  4O1N A;  5TSS A;  2V3N A;  1XQQ A;  4RM9 A;  1GPX A;  2ON8 A;  5FR3 A;  3MP9 A;  3RNB C;  1I7H A;  5TR5 A;  2L00 B;  3AEE B;  1C79 A;  4BKS A;  1I4P A;  4HEA 1;  1TGZ B;  5D3D A;  2MBB B;  4ANV A;  3AUL A;  3KW5 B;  3TJP A;  2RDG A;  4OHJ A;  2IO2 B;  1F77 A;  3P4Q B;  4MH8 A;  3PTF C;  2IGD A;  3DHI C;  4NNJ B;  3TUO A;  3SFD B;  3BK2 A;  2DYB A;  1V49 A;  3DBL B;  4KV2 A;  5IO9 A;  3PZ7 A;  2LGD A;  3U4E G;  2FUH B;  1GB1 A;  2MLB A;  1UEL A;  2CKH B;  3RPF C;  2QJL A;  3ECI A;  4AOF A;  2DBY A;  4EZL A;  2RD0 A;  3KUZ A;  1WGK A;  2WYQ A;  3PPA A;  3SFE B;  3O13 A;  1GUA B;  3RUL A;  2DYO A;  3NHE B;  3W1Y A;  4GDL A;  1IBX B;  2KQS A;  1FPY A;  2ACZ B;  2INC C;  2JRI B;  4WWN A;  4WAF A;  1JRP A;  2DZM A;  1HA5 A;  3ZRF A;  2KAJ A;  1SIF A;  3DDC B;  4ZRP A;  3ZTC A;  2SAK A;  5FR6 A;  2K1F A;  3Q3O C;  1GG3 A;  2PEA A;  1TS3 A;  1ZP0 B;  3ZW3 A;  5LXH A;  2MWS B;  2BS3 B;  4W9H A;  5J18 A;  3T9L A;  2Z0D B;  3AN1 A;  3R2I A;  2V4L A;  4RGT A;  1UWX A;  2UYZ B;  4FBJ B;  2BYF A;  5BYR A;  4B0M A;  4M8M A;  2ZJD A;  2KAC A;  5EE0 A;  1C3T A;  4LDT B;  1SB3 C;  5KHQ A;  4YSY B;  5BMH A;  2WDV B;  5JXV A;  4KSK C;  1WFY A;  1FO4 A;  2N7D A;  3JSV B;  2YVC A;  3KH0 A;  3EFU A;  1NEK B;  1MVK A;  3L17 A;  2CJN A;  1V1O A;  3BK1 A;  4A90 A;  3QIJ A;  3NVW A;  3I9V 1;  1VLB A;  3VUY A;  2HJ1 A;  3BVG A;  3NZS A;  2KAN A;  1JWB D;  3P42 A;  4US8 A;  5AZG A;  1GC6 A;  4KIK B;  4W9J A;  1SBB B;  1FCC C;  3B2G A;  3CSF A;  1STE A;  2PJH A;  1KOT A;  2IBI B;  1N6Z A;  3DOW A;  1VZ8 A;  4FUL A;  1H8C A;  4MM3 B;  4NAW B;  4OW0 A;  2ZPY A;  4PS3 A;  2R2Q A;  3TEW A;  1EU3 A;  3A9J B;  3AU4 A;  4PYZ A;  1T6B X;  3RNG C;  3VRA B;  5C23 A;  2INP E;  1XT9 B;  2AQ1 B;  1SXT A;  2BB6 A;  3KWL A;  2JU6 X;  4G0N B;  2PW9 A;  3URY A;  2N9K A;  1PGA A;  4C7Y A;  1C1Y B;  5AUI A;  1C4C A;  1D6E C;  2QMT A;  2VRR B;  2MBE A;  1UBI A;  2KFK B;  5HFY A;  4M01 A;  3PSE B;  1V80 A;  3IBE A;  3AV8 A;  3BZD B;  1YX5 B;  2QCZ A;  1PYW D;  2K25 A;  2FNJ B;  1QLB B;  2G45 B;  2D2Q A;  2ZNV B;  3V62 A;  3Q2A C;  2BWE S;  4HK2 A;  2YEP B;  3EUB 2;  3W1S A;  3N1Y C;  1P9D U;  4L23 A;  4GMV A;  4IWQ A;  4JGH B;  1E90 A;  2M8S A;  2D11 A;  2FBW B;  1TS2 A;  2WXN A;  4HCP B;  1TT5 B;  1WX7 A;  2XN9 C;  2LUE A;  4JLC A;  4LNI A;  4GDL B;  1E0Z A;  2H89 B;  1KRH A;  2Z0E B;  3ZKJ C;  3PRZ A;  2KVR A;  3CIR B;  4XYC A;  4XC2 A;  2PIA A;  1PDX A;  3PGE A;  1FXA A;  2WXF A;  1WGR A;  3UQA A;  3DVN U;  2KK8 A;  1ZOY B;  4YTM B;  1UD7 A;  3RMK C;  3HRD D;  4MSQ B;  1XO3 A;  2BS2 B;  3UI3 A;  4Q2J A;  2BKR B;  1YN4 A;  3QWZ B;  1UGM A;  1BUI C;  1UNS A;  2M17 A;  2REX A;  2D3A A;  3DBL I;  3KYC D;  3TEZ A;  2PE9 A;  3RD2 A;  1XLN A;  2WDQ B;  3FKY A;  1E7P B;  1HEZ E;  3VAW A;  1HE8 A;  4P16 A;  5D94 A;  2KDI A;  2H88 B;  1YN5 A;  3A1Q A;  1HQR D;  3EFC A;  2R2O A;  3P63 A;  2BYV E;  1YQ4 B;  5IOI A;  2JVC A;  2NVU I;  1DOY A;  1RYJ A;  3PT2 B;  4YXD B;  2K9X A;  1R4N I;  2KKC A;  2V1Y A;  3CMM B;  4EKU A;  1JWA D;  4I6L B;  3WIM A;  2I1J A;  1JML A;  3CWI A;  2KTR A;  2IO0 B;  3T3O A;  2LMC A;  1D5X C;  2CHW A;  2KDE B;  2NS5 A;  1EF1 A;  1Z2M A;  2WP9 B;  1L2N A;  3VHT C;  3AH7 A;  1MG8 A;  3MC9 A;  4UDU C;  2KMC A;  4AJW A;  3PHX B;  5HG2 A;  1KLU D;  5D3I B;  4FJY A;  5C2T B;  4F1S A;  2V9H A;  2DHZ A;  2HTM E;  3APD A;  3ZLZ A;  2D5G A;  4IM2 A;  2VZK B;  2VZK D;  1N61 A;  5DPS A;  3AB5 A;  1VZ7 A;  3RFZ B;  2X8X X;  3O65 B;  3E9S A;  1TBE A;  5E6J A;  4BBN F;  3U30 A;  3HK0 A;  3UF8 A;  2AQ3 B;  2EEL A;  1F2R I;  2J52 A;  3H1U A;  4W9L A;  5G55 A;  1PQS A;  5JZE B;  3VH4 B;  1KH0 A;  3Q69 A;  4NY0 A;  2NPT B;  2LGI A;  2RPV A;  3AEA B;  2BB5 A;  2WXJ A;  1E10 A;  3DPD A;  4GXB A;  3W5V B;  2MBQ A;  1TZO A;  1CZP A;  3GB1 A;  3R7R A;  1ZUD 2;  4HKZ E;  1XLO A;  4F7Z A;  4GOC A;  2A4Z A;  2O6V A;  1K50 A;  1T5X D;  4EZJ A;  1I4H A;  1LFD A;  4YT0 B;  4XGA B;  2YEP F;  4KZC A;  2WXQ A;  3TEY A;  4XWW A;  4M0W A;  1I4G A;  2KT7 A;  1P0R A;  1IGC A;  3SU8 X;  2CU1 A;  4KGR A;  2YLM A;  1BXT A;  4XX5 A;  2BKF A;  4EOY A;  4WWO A;  3QX1 A;  2LEK A;  1ESF A;  3OLM D;  4KKI A;  4MAC A;  1J7B A;  1VRA B;  2L8J A;  3P2B A;  3WAP A;  4N58 A;  3SDL C;  1QOG A;  2CR5 A;  1NVI D;  1TKG A;  4RH6 A;  2I2Y A;  2LWP A;  1T3Q A;  1WR1 A;  4GB9 A;  3A1Q B;  2KMM A;  3RZW C;  3BII D;  2BYT A;  1I4X A;  2Q5W D;  4K3C A;  2XK5 A;  3ZNI D;  1OEY J;  4N6E B;  1ZGU B;  4TMA B;  2MX2 A;  4MGI E;  3NS1 A;  3PRM B;  1SJE D;  1OQQ A;  2JRH A;  3A33 B;  3Q3J A;  2NBV B;  4P1B C;  4JWU C;  1F52 A;  2Y5C A;  4B9K A;  1QZE A;  4KZ0 A;  1RWS A;  2LHE A;  2ONQ A;  4YSX B;  4J6I A;  3L16 A;  1IUE A;  2ZVN A;  1IPG A;  1BML C;  2KMA A;  2BVC A;  2O2V A;  3H7P B;  5AZH A;  1UF0 A;  2JZP A;  4FLH A;  1SE4 A;  2KJR A;  4WH4 A;  1RM6 C;  2BT6 A;  2LAS A;  5DPR A;  4WJP A;  5AZF A;  3L0W B;  1Y56 A;  3AEC B;  4US9 A;  4RM8 A;  1TY2 A;  3KUD B;  4EFO A;  4WAA A;  1L7Y A;  3SR6 A;  2QHO A;  4NAM A;  4A6Q A;  5L83 A;  4P1C C;  3ZJT A;  2KXJ A;  1OQR A;  4IC7 B;  3ENE A;  4ACF A;  4FAD A;  4WQM A;  4J3O D;  3Q3N C;  1WXM A;  3NRZ A;  1RFA A;  3MHZ A;  2GBK A;  4HPP A;  3VUW A;  4KDL B;  2W3S A;  2RPQ A;  2L7R A;  4RGM A;  4JL9 A;  3ZNZ B;  4ZYS A;  3WAM A;  2X38 A;  4LJP B;  2CHX A;  1J7C A;  3ZO5 B;  1WGH A;  2JXX A;  4DDI D;  1ZXH A;  3B9J A;  4HPM B;  1Y8R C;  1YOV B;  2FE8 A;  3DQV A;  2G3Q B;  1BT0 A;  2O6V B;  2G4D B;  4USA A;  4AQ7 A;  4GU2 A;  2WXL A;  3EA6 A;  3AE2 B;  4E74 A;  2QEJ C;  3V6E B;  1X1M A;  4G3X B;  1ZE3 D;  2DWQ A;  1D4B A;  4IWO A;  1VD2 A;  1FXT B;  2QDF A;  3ZRC A;  2KDF B;  3BYY B;  3V3X A;  1TY0 A;  4ANW A;  1MPE A;  3HM3 A;  3VRB B;  1V5O A;  2AL6 A;  1JRO A;  5EE9 A;  3WA0 A;  5IP4 D;  1MI0 A;  1JWS D;  2MRP A;  4HPL B;  4GIV A;  3Q8C A;  2WX1 A;  1J19 A;  4HJG E;  4TSS A;  3EGR A;  1GOZ A;  1TS5 A;  3I57 A;  3BVZ A;  1V8C A;  4MT5 A;  3IT6 B;  1ACC A;  5G2N A;  2N9P C;  3DHH C;  2D3C A;  3IG3 A;  3PZ8 A;  3RNC C;  2DAJ A;  3QAR A;  3C8Y A;  2G9H D;  2RDH A;  1UWM A;  4JWS C;  3AEG B;  1U4A A;  1YMH E;  3A9K A;  2KWD A;  2QC8 A;  1NEN B;  1EWC A;  5D6J B;  4YTN B;  2W82 A;  2NTT A;  3ZNH B;  3VQI A;  2AEH A;  2K6Q A;  1I4Q A;  4B6W A;  1E6E B;  1EWY C;  4OZC A;  4DXA B;  4YTP B;  3LYY A;  2EMS A;  1JWU D;  3KUC B;  1UBQ A;  3AE3 B;  3L10 B;  2K22 A;  2JZ3 B;  4C4V A;  1F9J A;  1T0R C;  3NY5 A;  2K0P A;  4XZ4 A;  2OJW A;  4ITK A;  4FHK A;  1WRD B;  2J0M A;  3U8Z A;  3MJ5 A;  3NUH B;  2LRW A;  3AE7 B;  1V5T A;  4TUU A;  1P98 A;  1E8Z A;  2LD9 A;  3M62 B;  4LDT D;  2AWT A;  5HI1 A;  1WF9 A;  1FM0 D;  4YSZ B;  1V1P A;  3DVG Y;  3DWG C;  1I4R A;  1WM2 A;  1YN3 A;  4ZOH C;  1MFW A;  1WWT A;  1WJ6 A;  3IVF A;  2D3G A;  2WU5 B;  4E71 A;  5EE1 A;  1DOX A;  2RSU A;  4KVG B;  1FNV A;  3P4R B;  4IWP A;  2QIE B;  3TMP B;  3ZJU A;  5EDS A;  1A5R A;  4LTU A;  3TL5 A;  2KWV B;  4ASW C;  2RR9 A;  1R4M B;  1L5P A;  2JUO A;  2W54 A;  2JYT A;  1C4P A;  1WM3 A;  2IND C;  2N4F A;  3DHG C;  1CJE A;  1OQY A;  1V2Y A;  1PUT A;  3D32 A;  4KDI C;  3GP7 A;  2VH2 A;  5AEK B;  4KGT A;  1KJT A;  4S0R A;  5CHW A;  2C9W B;  4EUT A;  1ZXI A;  5GXG B;  4LNO A;  3ZGZ A;  4K7U A;  3ZUN A;  1QIL A;  5D7G A;  2WXK A;  4DHJ B;  3H7S A;  3DBH B;  2WXG A;  3AE6 B;  2K8H A;  2NR2 A;  2DYM A;  4BKS D;  4IM0 A;  4B95 A;  2K8C A;  5LLI A;  1HZ6 A;  2OOB B;  3KVF B;  1F2R C;  5I4D A;  1QOA A;  1TKE A;  2B3A A;  4BOS C;  3NS8 A;  3Q8B A;  3AM9 A;  4LJO B;  2FCN A;  4HCN B;  5DPT A;  1V97 A;  4GGQ A;  1J8C A;  4AJY B;  4IM3 A;  1M94 A;  1QOF A;  1FD6 A;  2PKO A;  4A8X C;  1GAQ B;  1EF5 A;  2M56 B;  5EE3 A;  4W9F A;  2WGS A;  4M00 A;  1WGY A;  2XEW A;  3RZF A;  2MJE A;  3ONS A;  1K51 A;  3A9K B;  4KX6 B;  2WDT B;  4ZRJ A; 
#chains in the Genus database with same CATH homology
 3Q8A A;  1R7S A;  1A70 A;  2WS3 B;  1EU4 A;  4XDC A;  1KLG D;  2AQ3 B;  2EEL A;  1UGJ A;  1F2R I;  2J52 A;  4XWT A;  1K53 A;  1J7A A;  1KH0 A;  3WCQ A;  3Q69 A;  4FXC A;  1M4V A;  4ZHO A;  1P7E A;  2N0S B;  2LGI A;  3GS2 A;  4XE0 A;  1XEE A;  2RPV A;  3IXS A;  3TSS A;  3AEA B;  3SEB A;  3LXF A;  1SE3 A;  2BB5 A;  2WXJ A;  1E10 A;  1QOB A;  4C80 A;  3Q8F A;  1QQR A;  3W5V B;  1TZO A;  1XLQ A;  1CZP A;  3GB1 A;  2IGG A;  2RMM A;  1ZUD 2;  4L2Y A;  2G1E A;  1HXY D;  1QKZ A;  1XLO A;  4HKZ E;  3U7Z A;  4XDD A;  1F0Z A;  4IDI A;  3FAH A;  1YJI A;  2E3T A;  1K50 A;  1T5X D;  1I4H A;  1CQV A;  4LK0 M;  3NZ3 A;  4YT0 B;  3AE4 B;  4REZ A;  1MHH E;  1L4Z B;  2FUG 1;  2PVO D;  2YEP F;  1E9M A;  2WXQ A;  1L6V A;  3TEY A;  2PTL A;  1JQ4 A;  4RGN A;  1FRD A;  2GI9 A;  1SJH D;  4XWW A;  1C76 A;  4M0W A;  1I4G A;  3R2T A;  2BS4 B;  5BYQ A;  1IGC A;  2L52 A;  2MH7 A;  4TQ1 A;  4KGR A;  1SE2 A;  2OED A;  1BXT A;  1ZDV A;  3P4S B;  2N9L A;  2JSV X;  3OWE B;  3AE8 B;  4CQN A;  3VR8 B;  3ZYY X;  1JWM D;  2LEK A;  1ESF A;  2AX5 A;  4KKI A;  4MAC A;  3N9Y C;  5H8Y E;  4GLS C;  3ZJV A;  1J7B A;  2JQR B;  2WXR A;  5T8I A;  1VRA B;  4O1N A;  4JE3 B;  3IAS 1;  2AQ2 B;  2WXI A;  5TSS A;  4N58 A;  2V3N A;  1QOG A;  1GPX A;  2K5P A;  2ON8 A;  4N59 A;  5FR3 A;  3MP9 A;  2JX5 A;  1RFK A;  1I7H A;  1NVI D;  1TKG A;  4RH6 A;  3NVZ A;  2I2Y A;  4ARI A;  1T3Q A;  2KN4 A;  1C9F A;  3AEE B;  1C79 A;  4P6V F;  2QIL A;  2KMM A;  1I4P A;  4HEA 1;  1N5W A;  2MEK A;  5D3D A;  3BII D;  3ETR A;  1ENF A;  2BYT A;  1I4X A;  2Q5W D;  4RFB A;  2PVG C;  5BYS A;  4RCO A;  2IGH A;  4N6E B;  2RDG A;  4OHJ A;  1F77 A;  3P4Q B;  4MH8 A;  1ZPS A;  4TMA B;  2GB1 A;  2IGD A;  1SJE D;  3NS1 A;  2LUM A;  3TUO A;  1OQQ A;  3SFD B;  3BK2 A;  2WLB A;  3LB8 C;  4JWU C;  2Y5C A;  4JPS A;  3BYT B;  3PZ7 A;  3U4E G;  1GB1 A;  1RWS A;  2LHE A;  2ONQ A;  3RPF C;  4YSX B;  1WSP A;  1JCK B;  2QJL A;  1IUE A;  2DBY A;  2BBC A;  1ROE A;  1VZ6 A;  1WGK A;  1BML C;  2W55 A;  1EM7 A;  3P1M A;  1DYQ A;  1K52 A;  2JZP A;  2JWU A;  2WXH A;  4OZA A;  1SE4 A;  4A9A A;  4HRS A;  4HKQ A;  3SFE B;  4WH4 A;  2EKI A;  1RM6 C;  1FFV A;  2BT6 A;  3O13 A;  2DYO A;  3FIL B;  3NVY A;  1D5Z C;  1L4D B;  1FNU A;  1Y56 A;  2L32 A;  3AEC B;  2MJD A;  4US9 A;  1IBX B;  3ABV B;  2ACZ B;  1TY2 A;  3AE5 B;  4WAF A;  1FRR A;  1JRP A;  3SR6 A;  4NAM A;  1HA5 A;  4A6Q A;  2Y3A A;  1FIQ A;  2KAJ A;  1ZDX A;  3ZJT A;  4ZRP A;  1OQR A;  2SAK A;  2Y5P A;  1TS3 A;  4RF1 A;  5LNK 1;  4WQM A;  4J3O D;  1ZP0 B;  3NRZ A;  2BS3 B;  5MPO A;  2NTS A;  1N5X A;  3DWM A;  3V05 A;  1MHX A;  3AN1 A;  3R2I A;  3MHZ A;  4RGT A;  1UWX A;  3W2D A;  2W3S A;  5BYR A;  4RGM A;  4B0M A;  2Z8L A;  1VJK A;  4ZYS A;  1OFF A;  3U52 E;  1IGD A;  2X38 A;  2KAC A;  4HRO A;  4OZB A;  5EE0 A;  4AS1 A;  1D5M C;  1DGJ A;  3PO0 A;  4ZRQ A;  1WXQ A;  1J7C A;  2QSD A;  1V1P B;  1L0Y B;  2LHD A;  1ZXH A;  1SB3 C;  4YSY B;  2WDR B;  5BMH A;  5H92 C;  2WDV B;  3B9J A;  5JXV A;  2OHF A;  1FO4 A;  2V3P A;  1KFY B;  2FE8 A;  1TS4 A;  4RNA A;  1NEK B;  3AED B;  1MVK A;  2WNM A;  4USA A;  4AQ7 A;  5G5H A;  2CJN A;  2WXL A;  3AE2 B;  3EA6 A;  1V1O A;  2QEJ C;  3BK1 A;  4A90 A;  3U2S C;  3NVW A;  3I9V 1;  1VLB A;  2R61 A;  1ZE3 D;  2DWQ A;  4GDK B;  3VR9 B;  1D4B A;  3BVG A;  1JAL A;  1JWB D;  3P42 A;  3BYY B;  4DQO C;  3V3X A;  4US8 A;  2BTE A;  1WYG A;  1TY0 A;  1B1Z A;  4WUR A;  5BMG A;  1SBB B;  1MPE A;  4LLG M;  1N60 A;  1FCC C;  3B2G A;  3MFG A;  2WU2 B;  3AEB B;  2N7J A;  1C4A A;  3AMZ A;  1YQ3 B;  3H8H A;  3VRB B;  2JYE A;  3T3N A;  1JRO A;  1STE A;  5EE9 A;  4OVZ A;  1MI0 A;  1VZ8 A;  1JWS D;  4MM3 B;  4NAW B;  4OW0 A;  4NJC A;  3HVD A;  4EE2 A;  3TEW A;  1L6U A;  2J53 A;  1EU3 A;  3Q8C A;  3IT4 B;  1PFD A;  1T6B X;  3VRA B;  4HJG E;  4TSS A;  4DXG A;  2INP E;  2W3R A;  3EGR A;  2B76 B;  2J4X A;  2AQ1 B;  2WXO A;  1SXT A;  2KDM A;  3AEF B;  1GOZ A;  1AW7 A;  1TS5 A;  3I57 A;  2BB6 A;  3KWL A;  2JU6 X;  3BVZ A;  1V8C A;  2PW9 A;  3B2F A;  3URY A;  2N9K A;  1PGA A;  4C7Y A;  5AUI A;  1C4C A;  3KLS X;  4H2A A;  4MT5 A;  1SF0 A;  3L4P A;  3IT6 B;  1ACC A;  1D6E C;  5BMI A;  2QMT A;  1AYF A;  3PZ8 A;  5HFY A;  3C8Y A;  1XF5 L;  2G9H D;  2ICI A;  4RGO S;  3AV8 A;  3P4P B;  1XLP A;  2RDH A;  2WQY B;  1UWM A;  3BZD B;  3AEG B;  4JWS C;  2ZW1 A;  3ZQ4 A;  5C3J B;  1YMH E;  2KWD A;  1PYW D;  3IAM 1;  2L83 A;  1NEN B;  2MJ3 A;  2SEB D;  3E56 A;  1EWC A;  1QLB B;  4PT5 A;  1L0X B;  1FFU A;  4YTN B;  4TQ0 A;  2W82 A;  2NTT A;  3VQI A;  3R8B A;  1I4Q A;  4KKJ A;  2YEP B;  3EUB 2;  3W1S A;  1TYG B;  4L23 A;  3MC0 B;  1AN8 A;  1E6E B;  1NYR A;  1FCL A;  3KWV A;  1C77 A;  1EWY C;  4OZC A;  4R3D A;  1JW9 D;  4YTP B;  3LYY A;  1YNT E;  4RF0 A;  1JWU D;  3Q8E A;  2KQ4 X;  2FBW B;  3AE3 B;  1ET6 A;  2WXM A;  1WRI A;  1TS2 A;  3HUI A;  1FNW A;  2WXN A;  4WWM A;  1GB4 A;  1Q10 A;  3KQ4 A;  3AE1 B;  2K22 A;  4A55 A;  1XXG A;  2L1A A;  2XN9 C;  3FC4 A;  4GDL B;  1ET9 A;  1E0Z A;  4WIP A;  1B9R A;  2H89 B;  1KRH A;  2K0P A;  1AWD A;  4ITK A;  5FKA C;  3CIR B;  3MJ5 A;  2PIA A;  1LO5 D;  1PDX A;  3NUH B;  1QF6 A;  1SSN A;  1L0V B;  3AE7 B;  3AE9 B;  1FXA A;  2WXF A;  2PLP A;  2TSS A;  5HI1 A;  1ZOY B;  1FM0 D;  3HVZ A;  4YSZ B;  4YTM B;  1V1P A;  1XCT L;  2I38 A;  2IDY A;  3HRD D;  1XO3 A;  2BS2 B;  4YWG G;  3DWG C;  3UI3 A;  4Q2J A;  1I4R A;  1YN3 A;  2M19 A;  4JX1 C;  4ZOH C;  2INN E;  2K3U A;  1YN4 A;  1WWT A;  2LFI A;  1QT9 A;  2WU5 B;  4C56 C;  2LJI A;  1VR9 A;  5EE1 A;  1DOX A;  1BUI C;  1UNS A;  1FNV A;  4L1B A;  3P4R B;  2QIE B;  1C78 A;  3ZJU A;  3TEZ A;  1PGB A;  1FMA D;  4LTU A;  1XLN A;  5FK9 C;  2PMV A;  2WDQ B;  1SIJ A;  3W9C B;  1L5P A;  2W54 A;  3NVV A;  1E7P B;  2JYT A;  1HEZ E;  1C4P A;  3BVM A;  4P16 A;  1CJE A;  2CU3 A;  2H88 B;  4ZHP A;  5HHD G;  1YN5 A;  1PUT A;  1HQR D;  1PGX A;  3P63 A;  3GP7 A;  1YJJ A;  1HZ5 A;  1YQ4 B;  1KF6 B;  1CK1 A;  4KGS A;  4KGT A;  5G5G A;  1DOY A;  1P7F A;  1FXI A;  1RYJ A;  1ZXI A;  5GXG B;  4YXD B;  2K9X A;  3ZGZ A;  2E6X A;  4D2K A;  1DOI A;  1TJE A;  2NMQ A;  1QIL A;  5D7G A;  1SEB D;  2IJ0 A;  2WXK A;  3BWU D;  3TEX A;  1JWA D;  1N62 A;  2WXG A;  1KTK A;  3AE6 B;  1JML A;  3CWI A;  2BW2 A;  3T3O A;  2IPK D;  2DYM A;  2LMC A;  1D5X C;  2ZW0 A;  3J9C A;  1HZ6 A;  2DLB A;  2GRI A;  2WP9 B;  4C7Z A;  3AH7 A;  1F2R C;  4UDU C;  4IKG A;  5HG2 A;  1NI3 A;  5I4D A;  1KLU D;  1N63 A;  1QOA A;  5D3I B;  3W5U B;  4DXF A;  1TKE A;  3Q8B A;  3AM9 A;  4IOI E;  2CJO A;  5C2T B;  1FEH A;  2J42 A;  1XCQ L;  2V0G A;  1V97 A;  2HTM E;  5AUK A;  2D5G A;  3FIL A;  2VZK B;  2VZK D;  1N61 A;  1QOF A;  1UUP A;  2WXP A;  4B0E A;  1IBX A;  1FD6 A;  2PKO A;  4A8X C;  4NZL B;  1GAQ B;  1NYQ A;  2V4I B;  3AB5 A;  1VDV A;  1VZ7 A;  2M56 B;  2XNA C;  3RFZ B;  5EE3 A;  2M0A A;  2JXT A;  1TKY A;  4ARC A;  2MJE A;  3E9S A;  1K51 A;  4KX6 B;  5E6J A;  2HDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...