1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein fimD
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
1ZE3D 4B0MA 1ZDVA 1ZDXA 3RFZB 4B0EA 4J3OD 3BWUD
chains in the Genus database with same CATH superfamily
2RD0A 5MPOA 1WSPA 3WA0A 4XZ4A 4ZHPA 3ZYYX 2GRIA 3H7PB 1V2YA 4DDID 4BKTA 3EGRA 1WWTA 3WAPA 3AXCA 4O1NA 3DBRB 1I7HA 3I9V1 3VVWB 1IGDA 3MTNB 4JPSA 5D94A 4MGIE 4M0WB 2DAFA 4MEMA 1PQSA 2JT4B 5LNK1 2KDMA 2ONQA 2PJHA 2VH2A 4HLEA 3J9CA 3P4RB 3AM9A 5JHAA 1FFVA 5EE0A 2KFKB 1PGXA 3AMZA 2KT7A 4OVVA 2K0PA 2I1KA 5IAAC 1V5OA 4II3B 1TKGA 2N9XA 4NQKE 3KH0A 1WXVA 4MM3B 2V4IB 4K3CA 2PLPA 1V5TA 2D07B 3BY4B 4A6QA 5JZEB 5CX3A 4MJSB 3VR8B 3P42A 1J8CA 1WE7A 3T9LA 3R7QA 1WR6E 2KACA 2PW9A 4IDIA 1N5XA 1JMLA 3AU5A 1XLNA 3IAS1 4AWJA 3DHGC 1UUPA 3JVZX 2KYWA 3PREA 4W9KA 2GBJA 1XLPA 2WXIA 4ZYSA 2DLBA 1WGYA 2BVCA 2H89B 2W54A 4ICVA 4GXBA 2MRPA 1MHXA 2M8SA 2Z0EB 1YJJA 1AW7A 1IBXB 1MPEA 3PPAA 3M62B 3LB8C 4DHJB 4YTPB 1EWCA 5BMIA 3AE4B 5G55A 3U7ZA 3HHMA 1OEYA 1Q5WB 2O2VA 4OZBA 5AUIA 1QOGA 2GOWA 2JYTA 4KX6B 2YEPB 1C79A 4EZKA 4IM2A 5AZGA 1YJIA 2VZKB 4W9IA 4OZAA 4LJOB 2KOXA 4NNJB 3PHXB 2GBMA 2JXXA 2QMTA 1IP9A 3AE8B 3LJ3A 2R61A 5AZHA 2V0GA 1FNVA 1WJ4A 5G5HA 3N32A 4ARCA 1I4HA 2K39A 3CIRB 4ZRPA 1XLQA 2CHZA 4W9DA 5H8YE 2WXRA 2MEKA 4PYZA 3VRBB 3WANA 3TIXA 1ESFA 2CHWA 2RSUA 1JCKB 1FMAD 1P7FA 2W55A 1LQBA 1QKZA 3ZTCA 4WWMA 2JU6X 1WZ3A 1FCLA 3SHQA 4WJQA 1V49A 2KAJA 4RM8A 3O13A 1WMHA 3ABVB 3Q8BA 2WXPA 2WXLA 1E8ZA 2JRHA 4FLHA 2LGDA 3QJZA 4K7UA 1UELA 2INNE 3QHTA 2ZJDA 3V3XA 2PVGC 5FKAC 5E6JA 2V3PA 2Z59B 4W9LA 5CHWA 2BS4B 4K1RB 1ACCA 2LGYA 2CS4A 2J7QB 3WAOA 1SE9A 4YSYB 1I35A 3QCAA 2WXFA 1E7PB 1LGRA 2DYBA 2MJEA 2K6DB 4YSXB 3UF8A 1KJTA 2J0JA 1TJEA 4LNIA 3EFUA 2IYDB 1K52A 2XK5B 1S3SG 2WXJA 2QILA 4M8NA 4ZRIA 4A55A 2KWCA 1SJHD 1F9JA 1LXDA 1XCQL 1XLOA 4AP4C 1VRAB 5HI1A 3OLMD 2WU5B 4BOZB 1A5RA 4RH6A 5J2RA 1L5PA 2KANA 5E6OA 2ASQA 4WWPA 2IGHA 1FM0D 5LXHA 3ZRFA 2KJRA 4LDTB 1OQQA 5TR5A 3X0WA 5CHFA 4DWFA 3ZXRA 3VH3B 1ZW7A 1NBFC 3GZNB 2TSSA 2FUG1 2E6XA 3V60A 5JXVA 3VFKA 1PYWD 4RF0A 2MX2A 3DBHI 1WX7A 1L6UA 1E8XA 2J0KA 2XNAC 2N1WA 1WXQA 1J7CA 3PZDA 4DK5A 4HDOA 1RRBA 1SIFA 3APFA 3PS6A 1FNWA 5I4DA 1VD2A 2HJ8A 3PT2B 2GLSA 4YWGG 4YXDB 4MGYE 3VDZA 3JSVB 3BZDB 3ZO5B 1F1HA 2IO3B 3QA8A 2D3AA 4MSQB 1FO4A 2DENB 3BWUD 3UINB 1TY2A 2OOBB 2IPKD 3M3JA 4A3PA 1TYGB 2KC2A 4TKNA 1QOAA 4REZA 1WYGA 4HCNB 3GS2A 1V6EA 2NS5A 2L8JA 3PV1A 4FJZA 5C23A 4RMAA 4ZYNA 3MHZA 3RT3B 2LXAA 1Z2MA 1L7YA 4FA6A 3ZUNA 1CMXB 2N9LA 1B1ZA 1EF5A 4AUQC 2AYOB 2JPHA 4HPPA 4LK0M 1JW9D 1E6EB 4OVUA 1M94A 4LJPB 2L32A 3ENEA 4FXCA 1QF6A 1LO5D 2MW5A 3GB1A 1G6JA 1JWMD 1D3ZA 1AWDA 2JX5A 3KQ4A 2YVCA 1EUVB 3UI3A 2IGGA 4KKIA 2CU3A 1YIWA 3AE5B 4DHZE 1GG3A 1RFAA 1KFYB 4NJ6A 1Q10A 1P0RA 5J17A 2LVQA 1YOVB 1E5WA 1VZ8A 2B3AA 2ZVOA 3A1QA 4XX5A 3NY5A 3SFEB 4WJNA 5C1ZA 2ZVNA 4OHJA 4JGHB 1EU3A 4WIPA 4US9A 1WGDA 3DVNU 4RFBA 2CR5A 2BF8B 4GMVA 1IPGA 2KFJA 3W1YA 4BFRA 1HE8A 3PZ8A 1WH3A 1WR1A 4AS1A 2BW2A 3RUIB 2WX1A 3IFWB 3TBLD 3B2GA 3Q3JA 3A9JA 3BYYB 4FADA 2KKCA 3DBLB 3RCZA 1QT9A 1A70A 1WJNA 1NDDA 2EELA 2O6VB 3CSFA 3QC8B 2K9XA 4L2YA 1WM3A 1JRPA 2CJOA 4K3BA 3NS8A 4NZLB 3MJWA 4HPMB 4UDUC 1RAXA 2HJ1A 1T6BX 2NCNA 2MQJA 4H2AA 4DQOC 4JQWC 4US8A 3CF6E 4F8CB 2ZEQA 4A8XC 4XGAB 1EF1A 2C7HA 3HRDD 5CTRC 3NRZA 3A4SC 4RNAA 3TEZA 2JSVX 3NVYA 5HG2A 2JF5A 4EKUA 3PZ7A 2K3UA 3MJ5A 4EZJA 3FAHA 3O65B 2V3NA 2KLCA 3VUYA 4HJGE 2FBWB 5IOIA 4ITKA 4EUTA 2INDC 3RPFC 4HCPB 1F77A 1E0ZA 3C0RB 1TS3A 1JWBD 1TS4A 4XE0A 1KRHA 3V62A 3I3TB 4WAFA 4JE3B 1L0YB 5HKHA 2QEJC 4C7ZA 5T8IA 3QQ8B 2MP2A 1L4DB 3CSTA 2RDBC 4WJPA 3VH4B 3NVWA 5AUKA 1L0VB 4DHZB 1WRIA 1UNSA 1BMLC 2KX3A 1JWUD 1YN3A 3B08A 1I4PA 3VTUA 1V8CA 2LHEA 5L83A 1J19A 4W9CA 1VZ7A 1WFYA 2BB6A 4PS8A 2G3QB 1R4MB 2N7JA 1CZPA 3HIZA 3AEFB 3RI7C 4MELA 1Q0WB 2Z0DB 1V86A 1MG4A 2WP9B 1TZ1A 1EWYC 3IVFA 4NAWA 1WE6A 2JY6A 2WS3B 1T5XD 1GC7A 4L23A 2AX5A 2W82A 3IAM1 1T0SC 3T3OA 1ENFA 1HA5A 5H92C 4PT5A 2DZMA 2WU2B 1FCCC 2V1YA 1HTQA 3Q8AA 2CHXA 4TSSA 3RNFC 4C4VB 1BUIC 1OGWA 1E7VA 2OJWA 4EOYA 4AOFA 1QOFA 3DBRI 2JZPA 1J0GA 1XXGA 1TZOA 2ICIA 2WLBA 2HD5B 2SEBD 4MSMB 2IY1B 3RD2A 1T0QC 4NAMA 2KQSA 1LM8B 3SFDB 1WJ6A 2AQ1B 2KWUB 3Q69A 5LXIB 2OEDA 2EMTA 4JL9A 2MJ3A 1MHHE 3AECB 4ZRQA 1U4AA 3MHSD 1E10A 5IN7A 3A9KB 4URKA 1N5WA 1L6VA 1YD8U 4MDKE 1UGJA 4JIOU 2GBKA 3HK0A 3CMMB 5KHQA 4WURA 1C9FA 3VTVA 1NYQA 1KTKA 2PTLA 3PRMB 4NY0A 3PLVA 2X38A 3ML8A 1TGZB 2KTFA 4XWTA 2PMVA 3W5VB 3UIPB 2L0TA 2GI9A 2NTSA 4GSWA 1SF0A 1GPXA 3QAQA 3B0AA 2KLGA 3EHVA 4GDLB 1KLUD 3M63B 1Y56A 2N9KA 2KDFB 1UH6A 2DNFA 1QOBA 3AE6B 4RGMA 1FRRA 3AE7B 4M8MA 1AN8A 4RGOS 2K6QA 4YTMB 4B6WA 4GLSC 2DHZA 1JRUA 5GXGB 2G1EA 4N58A 5BYSA 1Z5SB 1T0YA 3P2BA 3P4QB 2C5LC 2KN5A 3H9DA 5EE1A 4G11A 5EE9A 5E6PA 2IZVB 1C76A 2NTTA 1QLBB 2Y5CA 3ZDTA 4E3CA 5EDSA 1STEA 1FXAA 1LFDA 4TQ0A 1M4VA 1OEYJ 2QSDA 1WM2A 4ANXA 3EA6A 2WXMA 4B0MA 2M17A 3RNGC 1BT0A 1WX8A 1N61A 3BYTB 2ZNVB 3DHIC 3DVGX 2M4NA 5BMGA 2D11A 3P4SB 1X1MA 5C3JB 4OZCA 5CHVC 3IBEA 4FN2A 4W9GA 3ZNGC 1GJZA 2NVUI 4HK2A 2WNMA 4WWOA 3BVMA 1DOXA 1ZDVA 3IT6B 1J7AA 2KO3A 2KC1A 4LLGM 4FJVB 2XEWA 1E8WA 3JW0X 3T8MA 2AL6A 3LYYA 2Y3AA 2MH7A 3JSVA 5BYQA 5IA7A 3N1ZC 2DYMA 3ZIMA 5FR6A 3OG5A 3BVZA 5D7GA 3FILA 2JVCA 4XC2A 2RDGA 3RN9C 3C19A 2JWUA 1FXIA 4FHKA 2D3BA 2E3TA 4A90A 3W1SC 2BB5A 5EE3A 4PK1A 3U4EG 4RGTA 4EEWA 1F2RC 1UWXA 1V1PA 4NQLB 3FC4A 1ZKHA 2V9HA 2VRRB 4GDKB 2BPSA 4C56C 1XF5L 1I4RA 1SE3A 2LEKA 1WZ0A 3TMPB 3GZNI 5HFYA 4N9F4 1WYWB 1C77A 1F52A 5KHOA 3U52E 2KHWB 1SEBD 4EE2A 3MC9A 1PGBA 2KTRA 3PGEA 2G45B 3NVZA 4ACFA 3H1UA 2D3CA 4Q2JA 3Q14C 4LNNA 3W1SA 3KLSX 3NJTA 5JHBA 3PTFC 4YT0B 3DBHB 2J0MA 4RGNA 4ANVA 1WMHB 1ISNA 3AE3B 1NI2A 2K22A 4KSLC 3DBSA 4AQ7A 1YX5B 1C1YB 2KXJA 3DVGY 3UIOB 2PE9A 4P7IA 3AE9B 3WAMA 1TKEA 3B2FA 1TIFA 3N20C 2L0FA 4BKGA 2N9EB 2YEPF 4KGTA 4KSKC 2R2OA 3MC0B 2MLBA 4HWIB 2C7NB 1YQ3B 1FRDA 2KWDA 3GP7A 3ZVVA 4XDDA 4IWQA 1SGHA 3KW5B 2RR9A 2LVPA 3RNCC 2WDRB 3I57A 1SIJA 1HXYD 3BIID 4KDLB 4JLCA 1KLVA 5LLIA 1CK1A 2AQ2B 2KVRA 4LCDE 4C00A 2O6VA 1XT9B 5DCNA 2KDIA 1ZUD2 3ZXVA 3V05A 3L08A 1V1OA 1H8CA 4S17A 4BKSA 2KMMA 2LGIA 4IKGA 2LRWA 3RNAC 3MFGA 2IY0B 2WYQA 4CO7A 3V6CB 2MWSB 5IO9A 5IKCM 1EU4A 3T3NA 2IBIB 2QCZA 2M0AA 1JWAD 3ETRA 3TJPA 4HRSA 2C60A 1N6ZA 2EKIA 4KGRA 5E6NA 1TKYA 2UYZB 3PRZA 1XO3A 1VCBA 3ZQ4A 4WH4A 4KKJA 1R4NB 1F2RI 4ANUA 4DHJD 3RMKC 2BYFA 1L2NA 2PPHA 2FE8A 2NBWB 3CWIA 2GB1A 4S0RA 4HVBA 3C8YA 2DX5B 1IUEA 3P4PB 2C7MB 2G4SA 4IWOA 3NHEB 4YTNB 3VAWA 1PDXA 4A3OA 2KVZA 2RGFA 1P1AA 2BKFA 4MGZE 5FK9C 4ZHOA 4AJYB 3NUHB 1DYQA 4LTUA 2KDEB 2J4XA 4C80A 3OWEB 2ZW1A 4ZDVA 3WALA 3IG3A 4L1BA 5BO4B 2KJHB 1P98A 2QJLA 3AE2B 2NPTA 2JWZA 4B95A 2MJDA 1YQBA 4GN1A 3Q2AC 4BAXA 1KF6B 2DZJA 3N30A 2UU7A 5L95C 1SB3C 2A5UA 1QZEA 2BGFA 3NS1A 4A9AA 1GOZA 2RPVA 1PGAA 4B9KA 3WIMA 2L1AA 3E56A 1KH0A 1VJKA 4YL8A 1PFDA 2GBNA 3U7DA 2SAKA 1SSNA 3DCGA 2KN4A 4NJCA 4KIKB 1UBQA 4BBNF 2INCC 5TSSA 1GB1A 3H7PA 4R3DA 1ZXHA 4YSZB 1KOTA 4DXFA 4KGSA 3U8ZA 1CJEA 1RFKA 4CHKA 2HDEA 1MG8A 2KK8A 3SU8X 3A1QB 5BMHA 2JQRB 1OQYA 3URYA 4M0WA 2WXGA 3ML9A 5DPTA 3ZDMC 1IGCA 3R66C 2FCNA 3NZUA 4X57B 1DOYA 4ASWC 1TY0A 4RF1A 4LDTD 1E7UA 4IOIE 1NENB 2EKEC 2KFKA 3ZLZA 3GE3C 3KWLA 4E74A 1HQRD 2L52A 2LGXA 4CYEA 1T0RC 1EM7A 1BXTA 2FIDA 1F0ZA 2PKOA 2ZPNA 1TS5A 4IW0A 2QIEB 4MM3A 2NBUA 3WCQA 2AQ3B 3A9JB 2FUHB 1N60A 1R4MI 2WQYB 2LUEA 4MJSA 2RPQA 3RULA 1K51A 2Y5BB 2CU1A 3AEGB 2NMQA 1YNTE 4ANWA 4M00A 2J52A 2XN9C 1E9MA 2DZKA 2AWTA 3AN1A 3E9SA 3R7RA 4LNOA 3TEYA 2K8HA 3KWVA 1IBXA 4HPLB 4IG7B 2PVOD 2LJ5A 3HM3A 3VHTC 2KX0A 5DPSA 3KVFB 4KVGB 1K8RB 4D2KA 4E71A 5GMVA 3I63C 3TEWA 3IXSA 2D10A 3KUCB 4JWUC 1I42A 1OTRB 1P7EA 3EUB2 2CKHB 1SXTA 3AULA 3QARA 1GB4A 2M56B 2W3SA 3MC8A 3DDCB 2B76B 1MI0A 2VH1A 2REXA 2KQ4X 2K8BA 1MJDA 1JALA 4WJOA 2MP2B 1RLFA 4FHJA 4I6LB 2X8XX 1VLBA 2GMIC 1UD7A 1WJUA 4HXDA 2FNJB 1ZDXA 1WRDB 3N1YC 3ZJUA 3VXWA 3OJ3A 3W2DA 2WGSA 2ZCBA 3A33B 1ZOYB 2L7RA 2G9HD 3Q8FA 4HEA1 1RWSA 2LZ6A 2K25A 3H7SA 1FFUA 1WGGA 1P3QU 1K53A 3APDA 1C4PA 2Q5WD 4IM3A 3AEEB 1WXAA 2IO2B 2Y5PA 1YN5A 2WDQB 3NOBA 2WXNA 3UGBB 1NI3A 2N0SB 4KZ0A 3DWMA 3OJ4B 4P6VF 1T3QA 5D2MB 3VTWA 3MP9A 1I4XA 4NAWB 3NVVA 2XK5A 4F7ZA 2LRUA 3RNEC 2DAJA 2HE7A 3KUDB 1C4CA 4ZRJA 1J7BA 2IJ0A 2NR2A 2LVOA 1ET9A 2EMSA 1SBBB 2ZCCA 3S2AA 3K9OB 3UQAA 1PUTA 2HTHA 4BBNC 4TQ1A 2V4LA 3QX1A 1C3TA 3LDZE 4JWSC 1UF0A 2ZW0A 1E8YA 1UBIA 2O6VD 3R3MA 2BQQA 1WXMA 2KMCA 3QWZB 4QAYA 4GDKA 3Q3FA 4HKQA 1ZPSA 1FNUA 4DXAB 2QHOA 4BKSD 2OHFA 2KQ7A 2JXTA 3AB5A 1KM7A 2G4DB 2JZZA 3AEBB 2KWVB 4OW0A 4J6IA 2M0XA 4HROA 3VQIA 4MACA 4W9JA 1UWMA 2LGSA 3N9YC 4N59A 4A20A 4IM0A 1AYFA 1NYRA 3N1XC 5C2TB 2MA9B 3ZNZB 3PRPB 3OAWA 1C4AA 1AARA 3Q8CA 3NZ3A 3R2TA 1EO6A 3HM6X 4ICUA 3SEBA 4ZOHC 4EFOA 2MSED 4KDIC 2LFIA 3B9JA 1R7SA 4IC7B 4M01A 2WHIA 3BK1A 1GC6A 1TTNA 2N7EA 4FBJB 4P1BC 1FXTB 1D6EC 4XDCA 2KMAA 1ZE3D 3A4RA 3RFZB 2Z8LA 3M95A 4K7SA 3GOEA 4C7YA 1L4ZB 2J53A 2L3ZA 4G3XB 3TEXA 4FJYA 4JX1C 1YX6B 3ZJTA 4HDQA 2I38A 4MGKE 3VRAB 3IT4B 2O2VB 3RZFA 2M1MA 1V97A 3L10B 1XCTL 3TL5A 2AL3A 3ZKJC 1FPYA 2BWES 1WGKA 4CQNA 2FIFA 4P16A 2OJRA 3PLUA 1CQVA 1RYJA 4OVZA 2J42A 5G5GA 4I6PA 1RM6C 4GOCA 1H4RA 1FD6A 1HZ6A 3ECIA 4RM9A 2IGDA 2BKRB 2KJ6A 4W9HA 4K81A 2MBQA 2K1FA 3BK2A 3ZTDA 4IWPA 3PVLA 2WWZA 4GGQA 3X23A 2M19A 2BS2B 2IO0B 1GNUA 2N7DA 3IHPC 4M02A 1QQRA 2FCQA 1QILA 3LXFA 3V61A 4ARIA 4B0EA 2LI5A 1WX9A 3UQBA 3AH7A 3ZJVA 3TUOA 2FCMA 2WXKA 3HVZA 2D5GA 1DOIA 1HEZE 1NEKB 2YLMA 4EZLA 5D6JB 4XWWA 5DPWA 4G0NB 2XBBC 5FR3A 3DWGC 3ONSA 2ACZB 1V80A 3GE8C 2KNBA 2H88B 3Q8EA 3QK0A 2KDBA 3P1MA 2KD0A 2QC8A 5AEKB 2AEHA 3L54A 4RCOA 1ZP0B 1ZGUB 3FILB 5DPRA 2UWQA 1XEEA 2V3SA 1I4QA 2BWFA 1OFFA 4MH8A 2K5PA 2LASA 4I6NB 2WDTB 4PYUA 3W9CB 2INPE 3SD5A 3EFCA 2A4ZA 1SE4A 3AEDB 3SR6A 2GBRA 2DZIA 3DVNV 3AI5A 3HVDA 2MHJA 1SE2A 5D3IB 4MH0E 1S1QB 1V1PB 3AU4A 3SDLC 3NG0A 3QIJA 4MT5A 1OQRA 2W3RA 1K50A 3K9PB 3L17A 2LD9A 3W5UB 4GU2A 3DHHC 4AJWA 3BVGA 2NBVB 2L76A 2BYTA 2D2QA 2L05A 4KIKA 3U30A 4USAA 2RDHA 1FIQA 4ZRKA 2WXHA 3V6EB 2KTRB 1R4NI 3R8BA 3VR9B 2ON8A 4GIVA 5G2NA 5HHDG 3VUXA 3ZNHB 3U2SC 1SJED 3ZNID 2KZRA 2VZKD 1V81A 3H6NA 4K7WA 1YN4A 3D32A 4G50A 1JWSD 1WY8A 3Q6BA 1D5XC 3APCA 3ZRCA 2HTME 3PO0A 3ZW3A 1P9DU 3KYCD 4WQMA 4DBGA 1ET6A 4TMAB 1NVID 3DQVA 2BYEA 2IO1B 4LNFA 4BVUC 1YJ1A 3DBLI 3DOWA 2L83A 2FAZA 1VR9A 2PIAA 1N63A 2LUMA 1D5MC 2JYEA 2LWPA 2W9NA 4PS3A 4HJKA 4WWNA 1WXSA 1UZXB 3N3KB 3HUIA 1TBEA 4WAAA 2LXCA 4TV3A 3R2IA 2K8CA 4LNKA 5JH5C 3P63A 1KLGD 2I1JA 3KYDD 1V9JA 1VZ6A 1IYFA 1XD3B 4N6EB 4W9FA 3TSSA 2MBHA 1TS2A 2D3GA 1D5ZC 2WXQA 3Q3MC 5D3DA 3I5JC 4XYCA 1B9RA 2PE6B 2BBCA 1ZXIA 3Q3OC 2PEAA 2FCSA 3BINA 3AE1B 2MCNB 1ROEA 1TT5B 2C9WB 4C4VA 1WGHA 2MBBB 4F1SA 2IDYA 1YMHE 3TCAA 3ALBA 2ZPYA 2DWQA 1DGJA 5BYRA 5J18A 2BTEA 1C78A 4BZAA 2WXOA 4II2B 3ZGZA 3L4PA 3RYTA 2MBOA 1MVKA 4P1CC 1WIAA 4WQOB 3RNBC 4BOSC 4PS7A 3AEAB 2JRIB 3L13A 1N62A 1GUAB 2LHDA 3A9KA 1FEHA 1UGMA 1YQ4B 4IUMB 5AZFA 2CJNA 4W9EA 3DPDA 1Q1OA 2BT6A 2WDVB 1WI0A 4DXGA 3VUWA 2N9PC 4TUUA 1I4GA 1L0XB 4KZCA 1HTOA 4DDGD 3KUZA 2DBYA 3H8HA 3L0WB 2L00B 1Y8RC 3EECA 2RMMA 1WGRA 2BYVE 2JUOA 1E90A 1WF9A 2I2YA 1GAQB 2N1VA 1MFWA 4HKZE 1VDVA 2ZZPB 1XQQA 3JYUA 2NPTB 2LMCA 4GDLA 3EC8A 4NPNA 4NJ7A 3PSEB 4GB9A 2MBEA 2QDFA 1HZ5A 3FKYA 3L16A 2ZNVC 1JQ4A 3NZSA 4J3OD 2BS3B 3AV8A 2WX0A 1JROA 2R2QA 2LJIA 3PHWB 2N4FA 1D4BA 4FULA 3RZWC 4KV2A 3Q3NC 2DYOA 3B1LX 5IP4D 2JZ3B
chains in the Genus database with same CATH topology
2K22A 1QT9A 2OHFA 1A70A 5MPOA 1WSPA 4ZHPA 2EELA 4AQ7A 3ZYYX 2GRIA 2JXTA 2K9XA 3AB5A 4L2YA 1JRPA 2CJOA 3EGRA 1WWTA 3AE9B 3AEBB 4OW0A 4NZLB 4O1NA 1TKEA 4HROA 3VQIA 4MACA 4UDUC 3B2FA 1UWMA 3N9YC 4N59A 1T6BX 1I7HA 4H2AA 2YEPF 4KGTA 4DQOC 1AYFA 1NYRA 3I9V1 3MC0B 1IGDA 4JPSA 4US8A 1YQ3B 1FRDA 2KWDA 3GP7A 4XDDA 4A8XC 5C2TB 2WDRB 3I57A 1C4AA 1SIJA 3Q8CA 1HXYD 3BIID 3HRDD 3NZ3A 3R2TA 3NRZA 5LNK1 4RNAA 1CK1A 2AQ2B 2KDMA 3SEBA 3TEZA 2JSVX 4ZOHC 3NVYA 2ONQA 5HG2A 3PZ7A 2LFIA 3B9JA 1R7SA 2K3UA 3J9CA 3MJ5A 3BK1A 3P4RB 3FAHA 2V3NA 3AM9A 1FFVA 4HJGE 2FBWB 4ITKA 1D6EC 4XDCA 3RPFC 1ZE3D 5EE0A 1ZUD2 1PGXA 3AMZA 3RFZB 1F77A 3V05A 1E0ZA 1V1OA 2K0PA 2Z8LA 2KMMA 1TS3A 1JWBD 2LGIA 4IKGA 1TKGA 1TS4A 4C7YA 3MFGA 4XE0A 1L4ZB 1KRHA 4WAFA 2J53A 4JE3B 4MM3B 2V4IB 1EU4A 2PLPA 3T3NA 1L0YB 3TEXA 4A6QA 2QEJC 4C7ZA 2M0AA 4JX1C 5T8IA 3VR8B 3ZJTA 3P42A 1L4DB 1JWAD 3ETRA 2I38A 3VRAB 2KACA 3NVWA 4HRSA 2PW9A 3IT4B 5AUKA 2EKIA 1L0VB 4KGRA 4IDIA 1N5XA 1WRIA 1JMLA 1UNSA 1V97A 1BMLC 1TKYA 1XCTL 1JWUD 1YN3A 1XO3A 1I4PA 3ZQ4A 1XLNA 3IAS1 4WH4A 4KKJA 1V8CA 1UUPA 1WGKA 1F2RI 4CQNA 1XLPA 2WXIA 4ZYSA 4P16A 2DLBA 2LHEA 2FE8A 1CQVA 1RYJA 2W54A 2H89B 3CWIA 4OVZA 2GB1A 2J42A 5G5GA 1MHXA 1RM6C 1VZ7A 2BB6A 1FD6A 3C8YA 1HZ6A 3P4PB 1IUEA 2N7JA 1YJJA 1AW7A 1IBXB 1MPEA 2IGDA 4YTNB 1PDXA 1CZPA 3LB8C 3AEFB 3BK2A 4YTPB 1EWCA 5BMIA 3AE4B 3U7ZA 2WP9B 5FK9C 4ZHOA 2M19A 4OZBA 5AUIA 2BS2B 1QOGA 2JYTA 4KX6B 1EWYC 2YEPB 3NUHB 1C79A 1YJIA 2VZKB 4OZAA 1DYQA 4LTUA 1QQRA 2J4XA 2WS3B 4C80A 1T5XD 1QILA 3LXFA 4L23A 2AX5A 2W82A 3IAM1 4ARIA 1ENFA 1HA5A 3OWEB 2ZW1A 5H92C 4B0EA 4PT5A 3T3OA 2WU2B 1FCCC 3AH7A 3ZJVA 4L1BA 2QMTA 2QJLA 3AE2B 3TUOA 3AE8B 2V0GA 2R61A 2MJDA 2WXKA 1FNVA 3HVZA 5G5HA 2D5GA 3Q8AA 1DOIA 1HEZE 1NEKB 4XWWA 4TSSA 1I4HA 4ARCA 1BUIC 3CIRB 5FR3A 1KF6B 4ZRPA 1XLQA 3DWGC 5H8YE 2WXRA 1QOFA 1SB3C 2ACZB 2MEKA 3VRBB 1ESFA 3NS1A 4A9AA 1GOZA 2JZPA 2H88B 2ICIA 1XXGA 1TZOA 2WLBA 2RPVA 3P1MA 1PGAA 3Q8EA 1JCKB 2SEBD 1FMAD 1P7FA 2W55A 1QKZA 2L1AA 3E56A 4RCOA 1KH0A 1VJKA 4WWMA 1PFDA 2JU6X 4NAMA 1ZP0B 1FCLA 3FILB 3SFDB 2SAKA 2AQ1B 1SSNA 3Q69A 2OEDA 2KAJA 2KN4A 3O13A 1XEEA 3ABVB 2MJ3A 1MHHE 3AECB 2WXPA 2WXLA 3Q8BA 4NJCA 4ZRQA 1I4QA 1OFFA 5TSSA 2INNE 1E10A 1GB1A 3V3XA 4MH8A 4R3DA 1ZXHA 2K5PA 4YSZB 1N5WA 2PVGC 5FKAC 1L6VA 5E6JA 4DXFA 1UGJA 2V3PA 3W9CB 2INPE 1SE4A 3AEDB 3SR6A 2BS4B 1ACCA 4WURA 4KGSA 3HVDA 1C9FA 1SE2A 5D3IB 1CJEA 1NYQA 1KTKA 1RFKA 2PTLA 4YSYB 2HDEA 2X38A 1V1PB 2WXFA 1E7PB 2MJEA 4MT5A 1OQRA 4XWTA 3W5VB 2PMVA 4YSXB 2W3RA 1K50A 5BMHA 1TJEA 2GI9A 2JQRB 3URYA 2NTSA 4M0WA 2WXGA 1K52A 3W5UB 1SF0A 2WXJA 2QILA 3BVGA 1GPXA 4A55A 2BYTA 1SJHD 1IGCA 1XCQL 1XLOA 1VRAB 4USAA 5HI1A 2WU5B 4GDLB 1DOYA 1TY0A 4RF1A 1KLUD 2RDHA 1Y56A 2N9KA 1FIQA 4RH6A 4IOIE 1NENB 1L5PA 1QOBA 3AE6B 2WXHA 4RGMA 1FRRA 3AE7B 2IGHA 1AN8A 4RGOS 3R8BA 1FM0D 4YTMB 3KWLA 1HQRD 4GLSC 2L52A 3VR9B 1EM7A 1BXTA 1F0ZA 2PKOA 1TS5A 2ON8A 5GXGB 2QIEB 2G1EA 1OQQA 5HHDG 3WCQA 4N58A 1SJED 3U2SC 2AQ3B 2VZKD 5BYSA 1N60A 2WQYB 1YN4A 3P4QB 1JWSD 2TSSA 5EE1A 2FUG1 1D5XC 2E6XA 5EE9A 2HTME 3PO0A 1C76A 1K51A 2NTTA 1QLBB 3AEGB 5JXVA 2NMQA 2Y5CA 4WQMA 1PYWD 1YNTE 4RF0A 1ET6A 4TMAB 1NVID 1L6UA 1STEA 1FXAA 2XNAC 2J52A 1WXQA 1J7CA 4TQ0A 1M4VA 2XN9C 1E9MA 3AN1A 3E9SA 2L83A 2QSDA 2PIAA 1VR9A 3TEYA 1N63A 2LUMA 1D5MC 2JYEA 2WXMA 3EA6A 3KWVA 4B0MA 1FNWA 3HUIA 5I4DA 1N61A 1IBXA 3BYTB 2PVOD 3R2IA 4YWGG 4YXDB 5BMGA 3P63A 1KLGD 4D2KA 3BZDB 3P4SB 5C3JB 3TEWA 1VZ6A 3IXSA 4OZCA 4JWUC 4N6EB 3TSSA 1FO4A 1P7EA 3BWUD 3EUB2 1TS2A 1TY2A 1D5ZC 2IPKD 1SXTA 2WXQA 5D3DA 1TYGB 2WNMA 3BVMA 1B9RA 1QOAA 4REZA 2BBCA 1GB4A 2M56B 1DOXA 1ZDVA 1ZXIA 3IT6B 1WYGA 1J7AA 2W3SA 3AE1B 3GS2A 2B76B 1ROEA 1MI0A 2KQ4X 2IDYA 4LLGM 1YMHE 1JALA 2DWQA 3LYYA 1DGJA 3MHZA 2Y3AA 2MH7A 5BYRA 2BTEA 1C78A 1VLBA 2WXOA 2N9LA 3ZGZA 3L4PA 1B1ZA 5BYQA 4LK0M 2DYMA 1MVKA 1JW9D 1ZDXA 3BVZA 5D7GA 1E6EB 3FILA 2RDGA 3ZJUA 3AEAB 2JWUA 1FXIA 3W2DA 2L32A 4FXCA 1QF6A 1N62A 1LO5D 2E3TA 1ZOYB 2LHDA 3GB1A 4A90A 1FEHA 1JWMD 2G9HD 1YQ4B 2BB5A 5EE3A 2CJNA 1AWDA 1RWSA 2JX5A 2BT6A 2WDVB 3Q8FA 4HEA1 3KQ4A 4DXGA 3U4EG 1FFUA 3UI3A 1K53A 2IGGA 4KKIA 4RGTA 2CU3A 1I4GA 3AE5B 1C4PA 2Q5WD 1L0XB 3AEEB 1F2RC 1UWXA 2Y5PA 1YN5A 2WDQB 2DBYA 1KFYB 1Q10A 2WXNA 3H8HA 1NI3A 1V1PA 2N0SB 3DWMA 3FC4A 4P6VF 1VZ8A 1T3QA 2RMMA 4GDKB 3MP9A 1I4XA 4NAWB 4C56C 1XF5L 3NVVA 1I4RA 1SE3A 2LEKA 2I2YA 3SFEB 1GAQB 5HFYA 4OHJA 4HKZE 1VDVA 1C4CA 1C77A 3U52E 1J7BA 1EU3A 2IJ0A 2LMCA 4WIPA 4US9A 1SEBD 1ET9A 4EE2A 1SBBB 1PGBA 1PUTA 4RFBA 1HZ5A 3NVZA 4TQ1A 1JQ4A 3PZ8A 4AS1A 2BW2A 2BS3B 4J3OD 4JWSC 4Q2JA 3AV8A 2ZW0A 1JROA 3KLSX 3W1SA 2LJIA 4YT0B 1D4BA 3B2GA 4RGNA 3BYYB 4HKQA 1ZPSA 2DYOA 1FNUA 3AE3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE3 D;  4B0M A;  1ZDV A;  1ZDX A;  3RFZ B;  4B0E A;  4J3O D;  3BWU D; 
#chains in the Genus database with same CATH topology
 2RD0 A;  5MPO A;  1WSP A;  3WA0 A;  4XZ4 A;  4ZHP A;  3ZYY X;  2GRI A;  3H7P B;  1V2Y A;  4DDI D;  4BKT A;  3EGR A;  1WWT A;  3WAP A;  3AXC A;  4O1N A;  3DBR B;  1I7H A;  3I9V 1;  3VVW B;  1IGD A;  3MTN B;  4JPS A;  5D94 A;  4MGI E;  4M0W B;  2DAF A;  4MEM A;  1PQS A;  2JT4 B;  5LNK 1;  2KDM A;  2ONQ A;  2PJH A;  2VH2 A;  4HLE A;  3J9C A;  3P4R B;  3AM9 A;  5JHA A;  1FFV A;  5EE0 A;  2KFK B;  1PGX A;  3AMZ A;  2KT7 A;  4OVV A;  2K0P A;  2I1K A;  5IAA C;  1V5O A;  4II3 B;  1TKG A;  2N9X A;  4NQK E;  3KH0 A;  1WXV A;  4MM3 B;  2V4I B;  4K3C A;  2PLP A;  1V5T A;  2D07 B;  3BY4 B;  4A6Q A;  5JZE B;  5CX3 A;  4MJS B;  3VR8 B;  3P42 A;  1J8C A;  1WE7 A;  3T9L A;  3R7Q A;  1WR6 E;  2KAC A;  2PW9 A;  4IDI A;  1N5X A;  1JML A;  3AU5 A;  1XLN A;  3IAS 1;  4AWJ A;  3DHG C;  1UUP A;  3JVZ X;  2KYW A;  3PRE A;  4W9K A;  2GBJ A;  1XLP A;  2WXI A;  4ZYS A;  2DLB A;  1WGY A;  2BVC A;  2H89 B;  2W54 A;  4ICV A;  4GXB A;  2MRP A;  1MHX A;  2M8S A;  2Z0E B;  1YJJ A;  1AW7 A;  1IBX B;  1MPE A;  3PPA A;  3M62 B;  3LB8 C;  4DHJ B;  4YTP B;  1EWC A;  5BMI A;  3AE4 B;  5G55 A;  3U7Z A;  3HHM A;  1OEY A;  1Q5W B;  2O2V A;  4OZB A;  5AUI A;  1QOG A;  2GOW A;  2JYT A;  4KX6 B;  2YEP B;  1C79 A;  4EZK A;  4IM2 A;  5AZG A;  1YJI A;  2VZK B;  4W9I A;  4OZA A;  4LJO B;  2KOX A;  4NNJ B;  3PHX B;  2GBM A;  2JXX A;  2QMT A;  1IP9 A;  3AE8 B;  3LJ3 A;  2R61 A;  5AZH A;  2V0G A;  1FNV A;  1WJ4 A;  5G5H A;  3N32 A;  4ARC A;  1I4H A;  2K39 A;  3CIR B;  4ZRP A;  1XLQ A;  2CHZ A;  4W9D A;  5H8Y E;  2WXR A;  2MEK A;  4PYZ A;  3VRB B;  3WAN A;  3TIX A;  1ESF A;  2CHW A;  2RSU A;  1JCK B;  1FMA D;  1P7F A;  2W55 A;  1LQB A;  1QKZ A;  3ZTC A;  4WWM A;  2JU6 X;  1WZ3 A;  1FCL A;  3SHQ A;  4WJQ A;  1V49 A;  2KAJ A;  4RM8 A;  3O13 A;  1WMH A;  3ABV B;  3Q8B A;  2WXP A;  2WXL A;  1E8Z A;  2JRH A;  4FLH A;  2LGD A;  3QJZ A;  4K7U A;  1UEL A;  2INN E;  3QHT A;  2ZJD A;  3V3X A;  2PVG C;  5FKA C;  5E6J A;  2V3P A;  2Z59 B;  4W9L A;  5CHW A;  2BS4 B;  4K1R B;  1ACC A;  2LGY A;  2CS4 A;  2J7Q B;  3WAO A;  1SE9 A;  4YSY B;  1I35 A;  3QCA A;  2WXF A;  1E7P B;  1LGR A;  2DYB A;  2MJE A;  2K6D B;  4YSX B;  3UF8 A;  1KJT A;  2J0J A;  1TJE A;  4LNI A;  3EFU A;  2IYD B;  1K52 A;  2XK5 B;  1S3S G;  2WXJ A;  2QIL A;  4M8N A;  4ZRI A;  4A55 A;  2KWC A;  1SJH D;  1F9J A;  1LXD A;  1XCQ L;  1XLO A;  4AP4 C;  1VRA B;  5HI1 A;  3OLM D;  2WU5 B;  4BOZ B;  1A5R A;  4RH6 A;  5J2R A;  1L5P A;  2KAN A;  5E6O A;  2ASQ A;  4WWP A;  2IGH A;  1FM0 D;  5LXH A;  3ZRF A;  2KJR A;  4LDT B;  1OQQ A;  5TR5 A;  3X0W A;  5CHF A;  4DWF A;  3ZXR A;  3VH3 B;  1ZW7 A;  1NBF C;  3GZN B;  2TSS A;  2FUG 1;  2E6X A;  3V60 A;  5JXV A;  3VFK A;  1PYW D;  4RF0 A;  2MX2 A;  3DBH I;  1WX7 A;  1L6U A;  1E8X A;  2J0K A;  2XNA C;  2N1W A;  1WXQ A;  1J7C A;  3PZD A;  4DK5 A;  4HDO A;  1RRB A;  1SIF A;  3APF A;  3PS6 A;  1FNW A;  5I4D A;  1VD2 A;  2HJ8 A;  3PT2 B;  2GLS A;  4YWG G;  4YXD B;  4MGY E;  3VDZ A;  3JSV B;  3BZD B;  3ZO5 B;  1F1H A;  2IO3 B;  3QA8 A;  2D3A A;  4MSQ B;  1FO4 A;  2DEN B;  3BWU D;  3UIN B;  1TY2 A;  2OOB B;  2IPK D;  3M3J A;  4A3P A;  1TYG B;  2KC2 A;  4TKN A;  1QOA A;  4REZ A;  1WYG A;  4HCN B;  3GS2 A;  1V6E A;  2NS5 A;  2L8J A;  3PV1 A;  4FJZ A;  5C23 A;  4RMA A;  4ZYN A;  3MHZ A;  3RT3 B;  2LXA A;  1Z2M A;  1L7Y A;  4FA6 A;  3ZUN A;  1CMX B;  2N9L A;  1B1Z A;  1EF5 A;  4AUQ C;  2AYO B;  2JPH A;  4HPP A;  4LK0 M;  1JW9 D;  1E6E B;  4OVU A;  1M94 A;  4LJP B;  2L32 A;  3ENE A;  4FXC A;  1QF6 A;  1LO5 D;  2MW5 A;  3GB1 A;  1G6J A;  1JWM D;  1D3Z A;  1AWD A;  2JX5 A;  3KQ4 A;  2YVC A;  1EUV B;  3UI3 A;  2IGG A;  4KKI A;  2CU3 A;  1YIW A;  3AE5 B;  4DHZ E;  1GG3 A;  1RFA A;  1KFY B;  4NJ6 A;  1Q10 A;  1P0R A;  5J17 A;  2LVQ A;  1YOV B;  1E5W A;  1VZ8 A;  2B3A A;  2ZVO A;  3A1Q A;  4XX5 A;  3NY5 A;  3SFE B;  4WJN A;  5C1Z A;  2ZVN A;  4OHJ A;  4JGH B;  1EU3 A;  4WIP A;  4US9 A;  1WGD A;  3DVN U;  4RFB A;  2CR5 A;  2BF8 B;  4GMV A;  1IPG A;  2KFJ A;  3W1Y A;  4BFR A;  1HE8 A;  3PZ8 A;  1WH3 A;  1WR1 A;  4AS1 A;  2BW2 A;  3RUI B;  2WX1 A;  3IFW B;  3TBL D;  3B2G A;  3Q3J A;  3A9J A;  3BYY B;  4FAD A;  2KKC A;  3DBL B;  3RCZ A;  1QT9 A;  1A70 A;  1WJN A;  1NDD A;  2EEL A;  2O6V B;  3CSF A;  3QC8 B;  2K9X A;  4L2Y A;  1WM3 A;  1JRP A;  2CJO A;  4K3B A;  3NS8 A;  4NZL B;  3MJW A;  4HPM B;  4UDU C;  1RAX A;  2HJ1 A;  1T6B X;  2NCN A;  2MQJ A;  4H2A A;  4DQO C;  4JQW C;  4US8 A;  3CF6 E;  4F8C B;  2ZEQ A;  4A8X C;  4XGA B;  1EF1 A;  2C7H A;  3HRD D;  5CTR C;  3NRZ A;  3A4S C;  4RNA A;  3TEZ A;  2JSV X;  3NVY A;  5HG2 A;  2JF5 A;  4EKU A;  3PZ7 A;  2K3U A;  3MJ5 A;  4EZJ A;  3FAH A;  3O65 B;  2V3N A;  2KLC A;  3VUY A;  4HJG E;  2FBW B;  5IOI A;  4ITK A;  4EUT A;  2IND C;  3RPF C;  4HCP B;  1F77 A;  1E0Z A;  3C0R B;  1TS3 A;  1JWB D;  1TS4 A;  4XE0 A;  1KRH A;  3V62 A;  3I3T B;  4WAF A;  4JE3 B;  1L0Y B;  5HKH A;  2QEJ C;  4C7Z A;  5T8I A;  3QQ8 B;  2MP2 A;  1L4D B;  3CST A;  2RDB C;  4WJP A;  3VH4 B;  3NVW A;  5AUK A;  1L0V B;  4DHZ B;  1WRI A;  1UNS A;  1BML C;  2KX3 A;  1JWU D;  1YN3 A;  3B08 A;  1I4P A;  3VTU A;  1V8C A;  2LHE A;  5L83 A;  1J19 A;  4W9C A;  1VZ7 A;  1WFY A;  2BB6 A;  4PS8 A;  2G3Q B;  1R4M B;  2N7J A;  1CZP A;  3HIZ A;  3AEF B;  3RI7 C;  4MEL A;  1Q0W B;  2Z0D B;  1V86 A;  1MG4 A;  2WP9 B;  1TZ1 A;  1EWY C;  3IVF A;  4NAW A;  1WE6 A;  2JY6 A;  2WS3 B;  1T5X D;  1GC7 A;  4L23 A;  2AX5 A;  2W82 A;  3IAM 1;  1T0S C;  3T3O A;  1ENF A;  1HA5 A;  5H92 C;  4PT5 A;  2DZM A;  2WU2 B;  1FCC C;  2V1Y A;  1HTQ A;  3Q8A A;  2CHX A;  4TSS A;  3RNF C;  4C4V B;  1BUI C;  1OGW A;  1E7V A;  2OJW A;  4EOY A;  4AOF A;  1QOF A;  3DBR I;  2JZP A;  1J0G A;  1XXG A;  1TZO A;  2ICI A;  2WLB A;  2HD5 B;  2SEB D;  4MSM B;  2IY1 B;  3RD2 A;  1T0Q C;  4NAM A;  2KQS A;  1LM8 B;  3SFD B;  1WJ6 A;  2AQ1 B;  2KWU B;  3Q69 A;  5LXI B;  2OED A;  2EMT A;  4JL9 A;  2MJ3 A;  1MHH E;  3AEC B;  4ZRQ A;  1U4A A;  3MHS D;  1E10 A;  5IN7 A;  3A9K B;  4URK A;  1N5W A;  1L6V A;  1YD8 U;  4MDK E;  1UGJ A;  4JIO U;  2GBK A;  3HK0 A;  3CMM B;  5KHQ A;  4WUR A;  1C9F A;  3VTV A;  1NYQ A;  1KTK A;  2PTL A;  3PRM B;  4NY0 A;  3PLV A;  2X38 A;  3ML8 A;  1TGZ B;  2KTF A;  4XWT A;  2PMV A;  3W5V B;  3UIP B;  2L0T A;  2GI9 A;  2NTS A;  4GSW A;  1SF0 A;  1GPX A;  3QAQ A;  3B0A A;  2KLG A;  3EHV A;  4GDL B;  1KLU D;  3M63 B;  1Y56 A;  2N9K A;  2KDF B;  1UH6 A;  2DNF A;  1QOB A;  3AE6 B;  4RGM A;  1FRR A;  3AE7 B;  4M8M A;  1AN8 A;  4RGO S;  2K6Q A;  4YTM B;  4B6W A;  4GLS C;  2DHZ A;  1JRU A;  5GXG B;  2G1E A;  4N58 A;  5BYS A;  1Z5S B;  1T0Y A;  3P2B A;  3P4Q B;  2C5L C;  2KN5 A;  3H9D A;  5EE1 A;  4G11 A;  5EE9 A;  5E6P A;  2IZV B;  1C76 A;  2NTT A;  1QLB B;  2Y5C A;  3ZDT A;  4E3C A;  5EDS A;  1STE A;  1FXA A;  1LFD A;  4TQ0 A;  1M4V A;  1OEY J;  2QSD A;  1WM2 A;  4ANX A;  3EA6 A;  2WXM A;  4B0M A;  2M17 A;  3RNG C;  1BT0 A;  1WX8 A;  1N61 A;  3BYT B;  2ZNV B;  3DHI C;  3DVG X;  2M4N A;  5BMG A;  2D11 A;  3P4S B;  1X1M A;  5C3J B;  4OZC A;  5CHV C;  3IBE A;  4FN2 A;  4W9G A;  3ZNG C;  1GJZ A;  2NVU I;  4HK2 A;  2WNM A;  4WWO A;  3BVM A;  1DOX A;  1ZDV A;  3IT6 B;  1J7A A;  2KO3 A;  2KC1 A;  4LLG M;  4FJV B;  2XEW A;  1E8W A;  3JW0 X;  3T8M A;  2AL6 A;  3LYY A;  2Y3A A;  2MH7 A;  3JSV A;  5BYQ A;  5IA7 A;  3N1Z C;  2DYM A;  3ZIM A;  5FR6 A;  3OG5 A;  3BVZ A;  5D7G A;  3FIL A;  2JVC A;  4XC2 A;  2RDG A;  3RN9 C;  3C19 A;  2JWU A;  1FXI A;  4FHK A;  2D3B A;  2E3T A;  4A90 A;  3W1S C;  2BB5 A;  5EE3 A;  4PK1 A;  3U4E G;  4RGT A;  4EEW A;  1F2R C;  1UWX A;  1V1P A;  4NQL B;  3FC4 A;  1ZKH A;  2V9H A;  2VRR B;  4GDK B;  2BPS A;  4C56 C;  1XF5 L;  1I4R A;  1SE3 A;  2LEK A;  1WZ0 A;  3TMP B;  3GZN I;  5HFY A;  4N9F 4;  1WYW B;  1C77 A;  1F52 A;  5KHO A;  3U52 E;  2KHW B;  1SEB D;  4EE2 A;  3MC9 A;  1PGB A;  2KTR A;  3PGE A;  2G45 B;  3NVZ A;  4ACF A;  3H1U A;  2D3C A;  4Q2J A;  3Q14 C;  4LNN A;  3W1S A;  3KLS X;  3NJT A;  5JHB A;  3PTF C;  4YT0 B;  3DBH B;  2J0M A;  4RGN A;  4ANV A;  1WMH B;  1ISN A;  3AE3 B;  1NI2 A;  2K22 A;  4KSL C;  3DBS A;  4AQ7 A;  1YX5 B;  1C1Y B;  2KXJ A;  3DVG Y;  3UIO B;  2PE9 A;  4P7I A;  3AE9 B;  3WAM A;  1TKE A;  3B2F A;  1TIF A;  3N20 C;  2L0F A;  4BKG A;  2N9E B;  2YEP F;  4KGT A;  4KSK C;  2R2O A;  3MC0 B;  2MLB A;  4HWI B;  2C7N B;  1YQ3 B;  1FRD A;  2KWD A;  3GP7 A;  3ZVV A;  4XDD A;  4IWQ A;  1SGH A;  3KW5 B;  2RR9 A;  2LVP A;  3RNC C;  2WDR B;  3I57 A;  1SIJ A;  1HXY D;  3BII D;  4KDL B;  4JLC A;  1KLV A;  5LLI A;  1CK1 A;  2AQ2 B;  2KVR A;  4LCD E;  4C00 A;  2O6V A;  1XT9 B;  5DCN A;  2KDI A;  1ZUD 2;  3ZXV A;  3V05 A;  3L08 A;  1V1O A;  1H8C A;  4S17 A;  4BKS A;  2KMM A;  2LGI A;  4IKG A;  2LRW A;  3RNA C;  3MFG A;  2IY0 B;  2WYQ A;  4CO7 A;  3V6C B;  2MWS B;  5IO9 A;  5IKC M;  1EU4 A;  3T3N A;  2IBI B;  2QCZ A;  2M0A A;  1JWA D;  3ETR A;  3TJP A;  4HRS A;  2C60 A;  1N6Z A;  2EKI A;  4KGR A;  5E6N A;  1TKY A;  2UYZ B;  3PRZ A;  1XO3 A;  1VCB A;  3ZQ4 A;  4WH4 A;  4KKJ A;  1R4N B;  1F2R I;  4ANU A;  4DHJ D;  3RMK C;  2BYF A;  1L2N A;  2PPH A;  2FE8 A;  2NBW B;  3CWI A;  2GB1 A;  4S0R A;  4HVB A;  3C8Y A;  2DX5 B;  1IUE A;  3P4P B;  2C7M B;  2G4S A;  4IWO A;  3NHE B;  4YTN B;  3VAW A;  1PDX A;  4A3O A;  2KVZ A;  2RGF A;  1P1A A;  2BKF A;  4MGZ E;  5FK9 C;  4ZHO A;  4AJY B;  3NUH B;  1DYQ A;  4LTU A;  2KDE B;  2J4X A;  4C80 A;  3OWE B;  2ZW1 A;  4ZDV A;  3WAL A;  3IG3 A;  4L1B A;  5BO4 B;  2KJH B;  1P98 A;  2QJL A;  3AE2 B;  2NPT A;  2JWZ A;  4B95 A;  2MJD A;  1YQB A;  4GN1 A;  3Q2A C;  4BAX A;  1KF6 B;  2DZJ A;  3N30 A;  2UU7 A;  5L95 C;  1SB3 C;  2A5U A;  1QZE A;  2BGF A;  3NS1 A;  4A9A A;  1GOZ A;  2RPV A;  1PGA A;  4B9K A;  3WIM A;  2L1A A;  3E56 A;  1KH0 A;  1VJK A;  4YL8 A;  1PFD A;  2GBN A;  3U7D A;  2SAK A;  1SSN A;  3DCG A;  2KN4 A;  4NJC A;  4KIK B;  1UBQ A;  4BBN F;  2INC C;  5TSS A;  1GB1 A;  3H7P A;  4R3D A;  1ZXH A;  4YSZ B;  1KOT A;  4DXF A;  4KGS A;  3U8Z A;  1CJE A;  1RFK A;  4CHK A;  2HDE A;  1MG8 A;  2KK8 A;  3SU8 X;  3A1Q B;  5BMH A;  2JQR B;  1OQY A;  3URY A;  4M0W A;  2WXG A;  3ML9 A;  5DPT A;  3ZDM C;  1IGC A;  3R66 C;  2FCN A;  3NZU A;  4X57 B;  1DOY A;  4ASW C;  1TY0 A;  4RF1 A;  4LDT D;  1E7U A;  4IOI E;  1NEN B;  2EKE C;  2KFK A;  3ZLZ A;  3GE3 C;  3KWL A;  4E74 A;  1HQR D;  2L52 A;  2LGX A;  4CYE A;  1T0R C;  1EM7 A;  1BXT A;  2FID A;  1F0Z A;  2PKO A;  2ZPN A;  1TS5 A;  4IW0 A;  2QIE B;  4MM3 A;  2NBU A;  3WCQ A;  2AQ3 B;  3A9J B;  2FUH B;  1N60 A;  1R4M I;  2WQY B;  2LUE A;  4MJS A;  2RPQ A;  3RUL A;  1K51 A;  2Y5B B;  2CU1 A;  3AEG B;  2NMQ A;  1YNT E;  4ANW A;  4M00 A;  2J52 A;  2XN9 C;  1E9M A;  2DZK A;  2AWT A;  3AN1 A;  3E9S A;  3R7R A;  4LNO A;  3TEY A;  2K8H A;  3KWV A;  1IBX A;  4HPL B;  4IG7 B;  2PVO D;  2LJ5 A;  3HM3 A;  3VHT C;  2KX0 A;  5DPS A;  3KVF B;  4KVG B;  1K8R B;  4D2K A;  4E71 A;  5GMV A;  3I63 C;  3TEW A;  3IXS A;  2D10 A;  3KUC B;  4JWU C;  1I42 A;  1OTR B;  1P7E A;  3EUB 2;  2CKH B;  1SXT A;  3AUL A;  3QAR A;  1GB4 A;  2M56 B;  2W3S A;  3MC8 A;  3DDC B;  2B76 B;  1MI0 A;  2VH1 A;  2REX A;  2KQ4 X;  2K8B A;  1MJD A;  1JAL A;  4WJO A;  2MP2 B;  1RLF A;  4FHJ A;  4I6L B;  2X8X X;  1VLB A;  2GMI C;  1UD7 A;  1WJU A;  4HXD A;  2FNJ B;  1ZDX A;  1WRD B;  3N1Y C;  3ZJU A;  3VXW A;  3OJ3 A;  3W2D A;  2WGS A;  2ZCB A;  3A33 B;  1ZOY B;  2L7R A;  2G9H D;  3Q8F A;  4HEA 1;  1RWS A;  2LZ6 A;  2K25 A;  3H7S A;  1FFU A;  1WGG A;  1P3Q U;  1K53 A;  3APD A;  1C4P A;  2Q5W D;  4IM3 A;  3AEE B;  1WXA A;  2IO2 B;  2Y5P A;  1YN5 A;  2WDQ B;  3NOB A;  2WXN A;  3UGB B;  1NI3 A;  2N0S B;  4KZ0 A;  3DWM A;  3OJ4 B;  4P6V F;  1T3Q A;  5D2M B;  3VTW A;  3MP9 A;  1I4X A;  4NAW B;  3NVV A;  2XK5 A;  4F7Z A;  2LRU A;  3RNE C;  2DAJ A;  2HE7 A;  3KUD B;  1C4C A;  4ZRJ A;  1J7B A;  2IJ0 A;  2NR2 A;  2LVO A;  1ET9 A;  2EMS A;  1SBB B;  2ZCC A;  3S2A A;  3K9O B;  3UQA A;  1PUT A;  2HTH A;  4BBN C;  4TQ1 A;  2V4L A;  3QX1 A;  1C3T A;  3LDZ E;  4JWS C;  1UF0 A;  2ZW0 A;  1E8Y A;  1UBI A;  2O6V D;  3R3M A;  2BQQ A;  1WXM A;  2KMC A;  3QWZ B;  4QAY A;  4GDK A;  3Q3F A;  4HKQ A;  1ZPS A;  1FNU A;  4DXA B;  2QHO A;  4BKS D;  2OHF A;  2KQ7 A;  2JXT A;  3AB5 A;  1KM7 A;  2G4D B;  2JZZ A;  3AEB B;  2KWV B;  4OW0 A;  4J6I A;  2M0X A;  4HRO A;  3VQI A;  4MAC A;  4W9J A;  1UWM A;  2LGS A;  3N9Y C;  4N59 A;  4A20 A;  4IM0 A;  1AYF A;  1NYR A;  3N1X C;  5C2T B;  2MA9 B;  3ZNZ B;  3PRP B;  3OAW A;  1C4A A;  1AAR A;  3Q8C A;  3NZ3 A;  3R2T A;  1EO6 A;  3HM6 X;  4ICU A;  3SEB A;  4ZOH C;  4EFO A;  2MSE D;  4KDI C;  2LFI A;  3B9J A;  1R7S A;  4IC7 B;  4M01 A;  2WHI A;  3BK1 A;  1GC6 A;  1TTN A;  2N7E A;  4FBJ B;  4P1B C;  1FXT B;  1D6E C;  4XDC A;  2KMA A;  1ZE3 D;  3A4R A;  3RFZ B;  2Z8L A;  3M95 A;  4K7S A;  3GOE A;  4C7Y A;  1L4Z B;  2J53 A;  2L3Z A;  4G3X B;  3TEX A;  4FJY A;  4JX1 C;  1YX6 B;  3ZJT A;  4HDQ A;  2I38 A;  4MGK E;  3VRA B;  3IT4 B;  2O2V B;  3RZF A;  2M1M A;  1V97 A;  3L10 B;  1XCT L;  3TL5 A;  2AL3 A;  3ZKJ C;  1FPY A;  2BWE S;  1WGK A;  4CQN A;  2FIF A;  4P16 A;  2OJR A;  3PLU A;  1CQV A;  1RYJ A;  4OVZ A;  2J42 A;  5G5G A;  4I6P A;  1RM6 C;  4GOC A;  1H4R A;  1FD6 A;  1HZ6 A;  3ECI A;  4RM9 A;  2IGD A;  2BKR B;  2KJ6 A;  4W9H A;  4K81 A;  2MBQ A;  2K1F A;  3BK2 A;  3ZTD A;  4IWP A;  3PVL A;  2WWZ A;  4GGQ A;  3X23 A;  2M19 A;  2BS2 B;  2IO0 B;  1GNU A;  2N7D A;  3IHP C;  4M02 A;  1QQR A;  2FCQ A;  1QIL A;  3LXF A;  3V61 A;  4ARI A;  4B0E A;  2LI5 A;  1WX9 A;  3UQB A;  3AH7 A;  3ZJV A;  3TUO A;  2FCM A;  2WXK A;  3HVZ A;  2D5G A;  1DOI A;  1HEZ E;  1NEK B;  2YLM A;  4EZL A;  5D6J B;  4XWW A;  5DPW A;  4G0N B;  2XBB C;  5FR3 A;  3DWG C;  3ONS A;  2ACZ B;  1V80 A;  3GE8 C;  2KNB A;  2H88 B;  3Q8E A;  3QK0 A;  2KDB A;  3P1M A;  2KD0 A;  2QC8 A;  5AEK B;  2AEH A;  3L54 A;  4RCO A;  1ZP0 B;  1ZGU B;  3FIL B;  5DPR A;  2UWQ A;  1XEE A;  2V3S A;  1I4Q A;  2BWF A;  1OFF A;  4MH8 A;  2K5P A;  2LAS A;  4I6N B;  2WDT B;  4PYU A;  3W9C B;  2INP E;  3SD5 A;  3EFC A;  2A4Z A;  1SE4 A;  3AED B;  3SR6 A;  2GBR A;  2DZI A;  3DVN V;  3AI5 A;  3HVD A;  2MHJ A;  1SE2 A;  5D3I B;  4MH0 E;  1S1Q B;  1V1P B;  3AU4 A;  3SDL C;  3NG0 A;  3QIJ A;  4MT5 A;  1OQR A;  2W3R A;  1K50 A;  3K9P B;  3L17 A;  2LD9 A;  3W5U B;  4GU2 A;  3DHH C;  4AJW A;  3BVG A;  2NBV B;  2L76 A;  2BYT A;  2D2Q A;  2L05 A;  4KIK A;  3U30 A;  4USA A;  2RDH A;  1FIQ A;  4ZRK A;  2WXH A;  3V6E B;  2KTR B;  1R4N I;  3R8B A;  3VR9 B;  2ON8 A;  4GIV A;  5G2N A;  5HHD G;  3VUX A;  3ZNH B;  3U2S C;  1SJE D;  3ZNI D;  2KZR A;  2VZK D;  1V81 A;  3H6N A;  4K7W A;  1YN4 A;  3D32 A;  4G50 A;  1JWS D;  1WY8 A;  3Q6B A;  1D5X C;  3APC A;  3ZRC A;  2HTM E;  3PO0 A;  3ZW3 A;  1P9D U;  3KYC D;  4WQM A;  4DBG A;  1ET6 A;  4TMA B;  1NVI D;  3DQV A;  2BYE A;  2IO1 B;  4LNF A;  4BVU C;  1YJ1 A;  3DBL I;  3DOW A;  2L83 A;  2FAZ A;  1VR9 A;  2PIA A;  1N63 A;  2LUM A;  1D5M C;  2JYE A;  2LWP A;  2W9N A;  4PS3 A;  4HJK A;  4WWN A;  1WXS A;  1UZX B;  3N3K B;  3HUI A;  1TBE A;  4WAA A;  2LXC A;  4TV3 A;  3R2I A;  2K8C A;  4LNK A;  5JH5 C;  3P63 A;  1KLG D;  2I1J A;  3KYD D;  1V9J A;  1VZ6 A;  1IYF A;  1XD3 B;  4N6E B;  4W9F A;  3TSS A;  2MBH A;  1TS2 A;  2D3G A;  1D5Z C;  2WXQ A;  3Q3M C;  5D3D A;  3I5J C;  4XYC A;  1B9R A;  2PE6 B;  2BBC A;  1ZXI A;  3Q3O C;  2PEA A;  2FCS A;  3BIN A;  3AE1 B;  2MCN B;  1ROE A;  1TT5 B;  2C9W B;  4C4V A;  1WGH A;  2MBB B;  4F1S A;  2IDY A;  1YMH E;  3TCA A;  3ALB A;  2ZPY A;  2DWQ A;  1DGJ A;  5BYR A;  5J18 A;  2BTE A;  1C78 A;  4BZA A;  2WXO A;  4II2 B;  3ZGZ A;  3L4P A;  3RYT A;  2MBO A;  1MVK A;  4P1C C;  1WIA A;  4WQO B;  3RNB C;  4BOS C;  4PS7 A;  3AEA B;  2JRI B;  3L13 A;  1N62 A;  1GUA B;  2LHD A;  3A9K A;  1FEH A;  1UGM A;  1YQ4 B;  4IUM B;  5AZF A;  2CJN A;  4W9E A;  3DPD A;  1Q1O A;  2BT6 A;  2WDV B;  1WI0 A;  4DXG A;  3VUW A;  2N9P C;  4TUU A;  1I4G A;  1L0X B;  4KZC A;  1HTO A;  4DDG D;  3KUZ A;  2DBY A;  3H8H A;  3L0W B;  2L00 B;  1Y8R C;  3EEC A;  2RMM A;  1WGR A;  2BYV E;  2JUO A;  1E90 A;  1WF9 A;  2I2Y A;  1GAQ B;  2N1V A;  1MFW A;  4HKZ E;  1VDV A;  2ZZP B;  1XQQ A;  3JYU A;  2NPT B;  2LMC A;  4GDL A;  3EC8 A;  4NPN A;  4NJ7 A;  3PSE B;  4GB9 A;  2MBE A;  2QDF A;  1HZ5 A;  3FKY A;  3L16 A;  2ZNV C;  1JQ4 A;  3NZS A;  4J3O D;  2BS3 B;  3AV8 A;  2WX0 A;  1JRO A;  2R2Q A;  2LJI A;  3PHW B;  2N4F A;  1D4B A;  4FUL A;  3RZW C;  4KV2 A;  3Q3N C;  2DYO A;  3B1L X;  5IP4 D;  2JZ3 B; 
#chains in the Genus database with same CATH homology
 2K22 A;  1QT9 A;  2OHF A;  1A70 A;  5MPO A;  1WSP A;  4ZHP A;  2EEL A;  4AQ7 A;  3ZYY X;  2GRI A;  2JXT A;  2K9X A;  3AB5 A;  4L2Y A;  1JRP A;  2CJO A;  3EGR A;  1WWT A;  3AE9 B;  3AEB B;  4OW0 A;  4NZL B;  4O1N A;  1TKE A;  4HRO A;  3VQI A;  4MAC A;  4UDU C;  3B2F A;  1UWM A;  3N9Y C;  4N59 A;  1T6B X;  1I7H A;  4H2A A;  2YEP F;  4KGT A;  4DQO C;  1AYF A;  1NYR A;  3I9V 1;  3MC0 B;  1IGD A;  4JPS A;  4US8 A;  1YQ3 B;  1FRD A;  2KWD A;  3GP7 A;  4XDD A;  4A8X C;  5C2T B;  2WDR B;  3I57 A;  1C4A A;  1SIJ A;  3Q8C A;  1HXY D;  3BII D;  3HRD D;  3NZ3 A;  3R2T A;  3NRZ A;  5LNK 1;  4RNA A;  1CK1 A;  2AQ2 B;  2KDM A;  3SEB A;  3TEZ A;  2JSV X;  4ZOH C;  3NVY A;  2ONQ A;  5HG2 A;  3PZ7 A;  2LFI A;  3B9J A;  1R7S A;  2K3U A;  3J9C A;  3MJ5 A;  3BK1 A;  3P4R B;  3FAH A;  2V3N A;  3AM9 A;  1FFV A;  4HJG E;  2FBW B;  4ITK A;  1D6E C;  4XDC A;  3RPF C;  1ZE3 D;  5EE0 A;  1ZUD 2;  1PGX A;  3AMZ A;  3RFZ B;  1F77 A;  3V05 A;  1E0Z A;  1V1O A;  2K0P A;  2Z8L A;  2KMM A;  1TS3 A;  1JWB D;  2LGI A;  4IKG A;  1TKG A;  1TS4 A;  4C7Y A;  3MFG A;  4XE0 A;  1L4Z B;  1KRH A;  4WAF A;  2J53 A;  4JE3 B;  4MM3 B;  2V4I B;  1EU4 A;  2PLP A;  3T3N A;  1L0Y B;  3TEX A;  4A6Q A;  2QEJ C;  4C7Z A;  2M0A A;  4JX1 C;  5T8I A;  3VR8 B;  3ZJT A;  3P42 A;  1L4D B;  1JWA D;  3ETR A;  2I38 A;  3VRA B;  2KAC A;  3NVW A;  4HRS A;  2PW9 A;  3IT4 B;  5AUK A;  2EKI A;  1L0V B;  4KGR A;  4IDI A;  1N5X A;  1WRI A;  1JML A;  1UNS A;  1V97 A;  1BML C;  1TKY A;  1XCT L;  1JWU D;  1YN3 A;  1XO3 A;  1I4P A;  3ZQ4 A;  1XLN A;  3IAS 1;  4WH4 A;  4KKJ A;  1V8C A;  1UUP A;  1WGK A;  1F2R I;  4CQN A;  1XLP A;  2WXI A;  4ZYS A;  4P16 A;  2DLB A;  2LHE A;  2FE8 A;  1CQV A;  1RYJ A;  2W54 A;  2H89 B;  3CWI A;  4OVZ A;  2GB1 A;  2J42 A;  5G5G A;  1MHX A;  1RM6 C;  1VZ7 A;  2BB6 A;  1FD6 A;  3C8Y A;  1HZ6 A;  3P4P B;  1IUE A;  2N7J A;  1YJJ A;  1AW7 A;  1IBX B;  1MPE A;  2IGD A;  4YTN B;  1PDX A;  1CZP A;  3LB8 C;  3AEF B;  3BK2 A;  4YTP B;  1EWC A;  5BMI A;  3AE4 B;  3U7Z A;  2WP9 B;  5FK9 C;  4ZHO A;  2M19 A;  4OZB A;  5AUI A;  2BS2 B;  1QOG A;  2JYT A;  4KX6 B;  1EWY C;  2YEP B;  3NUH B;  1C79 A;  1YJI A;  2VZK B;  4OZA A;  1DYQ A;  4LTU A;  1QQR A;  2J4X A;  2WS3 B;  4C80 A;  1T5X D;  1QIL A;  3LXF A;  4L23 A;  2AX5 A;  2W82 A;  3IAM 1;  4ARI A;  1ENF A;  1HA5 A;  3OWE B;  2ZW1 A;  5H92 C;  4B0E A;  4PT5 A;  3T3O A;  2WU2 B;  1FCC C;  3AH7 A;  3ZJV A;  4L1B A;  2QMT A;  2QJL A;  3AE2 B;  3TUO A;  3AE8 B;  2V0G A;  2R61 A;  2MJD A;  2WXK A;  1FNV A;  3HVZ A;  5G5H A;  2D5G A;  3Q8A A;  1DOI A;  1HEZ E;  1NEK B;  4XWW A;  4TSS A;  1I4H A;  4ARC A;  1BUI C;  3CIR B;  5FR3 A;  1KF6 B;  4ZRP A;  1XLQ A;  3DWG C;  5H8Y E;  2WXR A;  1QOF A;  1SB3 C;  2ACZ B;  2MEK A;  3VRB B;  1ESF A;  3NS1 A;  4A9A A;  1GOZ A;  2JZP A;  2H88 B;  2ICI A;  1XXG A;  1TZO A;  2WLB A;  2RPV A;  3P1M A;  1PGA A;  3Q8E A;  1JCK B;  2SEB D;  1FMA D;  1P7F A;  2W55 A;  1QKZ A;  2L1A A;  3E56 A;  4RCO A;  1KH0 A;  1VJK A;  4WWM A;  1PFD A;  2JU6 X;  4NAM A;  1ZP0 B;  1FCL A;  3FIL B;  3SFD B;  2SAK A;  2AQ1 B;  1SSN A;  3Q69 A;  2OED A;  2KAJ A;  2KN4 A;  3O13 A;  1XEE A;  3ABV B;  2MJ3 A;  1MHH E;  3AEC B;  2WXP A;  2WXL A;  3Q8B A;  4NJC A;  4ZRQ A;  1I4Q A;  1OFF A;  5TSS A;  2INN E;  1E10 A;  1GB1 A;  3V3X A;  4MH8 A;  4R3D A;  1ZXH A;  2K5P A;  4YSZ B;  1N5W A;  2PVG C;  5FKA C;  1L6V A;  5E6J A;  4DXF A;  1UGJ A;  2V3P A;  3W9C B;  2INP E;  1SE4 A;  3AED B;  3SR6 A;  2BS4 B;  1ACC A;  4WUR A;  4KGS A;  3HVD A;  1C9F A;  1SE2 A;  5D3I B;  1CJE A;  1NYQ A;  1KTK A;  1RFK A;  2PTL A;  4YSY B;  2HDE A;  2X38 A;  1V1P B;  2WXF A;  1E7P B;  2MJE A;  4MT5 A;  1OQR A;  4XWT A;  3W5V B;  2PMV A;  4YSX B;  2W3R A;  1K50 A;  5BMH A;  1TJE A;  2GI9 A;  2JQR B;  3URY A;  2NTS A;  4M0W A;  2WXG A;  1K52 A;  3W5U B;  1SF0 A;  2WXJ A;  2QIL A;  3BVG A;  1GPX A;  4A55 A;  2BYT A;  1SJH D;  1IGC A;  1XCQ L;  1XLO A;  1VRA B;  4USA A;  5HI1 A;  2WU5 B;  4GDL B;  1DOY A;  1TY0 A;  4RF1 A;  1KLU D;  2RDH A;  1Y56 A;  2N9K A;  1FIQ A;  4RH6 A;  4IOI E;  1NEN B;  1L5P A;  1QOB A;  3AE6 B;  2WXH A;  4RGM A;  1FRR A;  3AE7 B;  2IGH A;  1AN8 A;  4RGO S;  3R8B A;  1FM0 D;  4YTM B;  3KWL A;  1HQR D;  4GLS C;  2L52 A;  3VR9 B;  1EM7 A;  1BXT A;  1F0Z A;  2PKO A;  1TS5 A;  2ON8 A;  5GXG B;  2QIE B;  2G1E A;  1OQQ A;  5HHD G;  3WCQ A;  4N58 A;  1SJE D;  3U2S C;  2AQ3 B;  2VZK D;  5BYS A;  1N60 A;  2WQY B;  1YN4 A;  3P4Q B;  1JWS D;  2TSS A;  5EE1 A;  2FUG 1;  1D5X C;  2E6X A;  5EE9 A;  2HTM E;  3PO0 A;  1C76 A;  1K51 A;  2NTT A;  1QLB B;  3AEG B;  5JXV A;  2NMQ A;  2Y5C A;  4WQM A;  1PYW D;  1YNT E;  4RF0 A;  1ET6 A;  4TMA B;  1NVI D;  1L6U A;  1STE A;  1FXA A;  2XNA C;  2J52 A;  1WXQ A;  1J7C A;  4TQ0 A;  1M4V A;  2XN9 C;  1E9M A;  3AN1 A;  3E9S A;  2L83 A;  2QSD A;  2PIA A;  1VR9 A;  3TEY A;  1N63 A;  2LUM A;  1D5M C;  2JYE A;  2WXM A;  3EA6 A;  3KWV A;  4B0M A;  1FNW A;  3HUI A;  5I4D A;  1N61 A;  1IBX A;  3BYT B;  2PVO D;  3R2I A;  4YWG G;  4YXD B;  5BMG A;  3P63 A;  1KLG D;  4D2K A;  3BZD B;  3P4S B;  5C3J B;  3TEW A;  1VZ6 A;  3IXS A;  4OZC A;  4JWU C;  4N6E B;  3TSS A;  1FO4 A;  1P7E A;  3BWU D;  3EUB 2;  1TS2 A;  1TY2 A;  1D5Z C;  2IPK D;  1SXT A;  2WXQ A;  5D3D A;  1TYG B;  2WNM A;  3BVM A;  1B9R A;  1QOA A;  4REZ A;  2BBC A;  1GB4 A;  2M56 B;  1DOX A;  1ZDV A;  1ZXI A;  3IT6 B;  1WYG A;  1J7A A;  2W3S A;  3AE1 B;  3GS2 A;  2B76 B;  1ROE A;  1MI0 A;  2KQ4 X;  2IDY A;  4LLG M;  1YMH E;  1JAL A;  2DWQ A;  3LYY A;  1DGJ A;  3MHZ A;  2Y3A A;  2MH7 A;  5BYR A;  2BTE A;  1C78 A;  1VLB A;  2WXO A;  2N9L A;  3ZGZ A;  3L4P A;  1B1Z A;  5BYQ A;  4LK0 M;  2DYM A;  1MVK A;  1JW9 D;  1ZDX A;  3BVZ A;  5D7G A;  1E6E B;  3FIL A;  2RDG A;  3ZJU A;  3AEA B;  2JWU A;  1FXI A;  3W2D A;  2L32 A;  4FXC A;  1QF6 A;  1N62 A;  1LO5 D;  2E3T A;  1ZOY B;  2LHD A;  3GB1 A;  4A90 A;  1FEH A;  1JWM D;  2G9H D;  1YQ4 B;  2BB5 A;  5EE3 A;  2CJN A;  1AWD A;  1RWS A;  2JX5 A;  2BT6 A;  2WDV B;  3Q8F A;  4HEA 1;  3KQ4 A;  4DXG A;  3U4E G;  1FFU A;  3UI3 A;  1K53 A;  2IGG A;  4KKI A;  4RGT A;  2CU3 A;  1I4G A;  3AE5 B;  1C4P A;  2Q5W D;  1L0X B;  3AEE B;  1F2R C;  1UWX A;  2Y5P A;  1YN5 A;  2WDQ B;  2DBY A;  1KFY B;  1Q10 A;  2WXN A;  3H8H A;  1NI3 A;  1V1P A;  2N0S B;  3DWM A;  3FC4 A;  4P6V F;  1VZ8 A;  1T3Q A;  2RMM A;  4GDK B;  3MP9 A;  1I4X A;  4NAW B;  4C56 C;  1XF5 L;  3NVV A;  1I4R A;  1SE3 A;  2LEK A;  2I2Y A;  3SFE B;  1GAQ B;  5HFY A;  4OHJ A;  4HKZ E;  1VDV A;  1C4C A;  1C77 A;  3U52 E;  1J7B A;  1EU3 A;  2IJ0 A;  2LMC A;  4WIP A;  4US9 A;  1SEB D;  1ET9 A;  4EE2 A;  1SBB B;  1PGB A;  1PUT A;  4RFB A;  1HZ5 A;  3NVZ A;  4TQ1 A;  1JQ4 A;  3PZ8 A;  4AS1 A;  2BW2 A;  2BS3 B;  4J3O D;  4JWS C;  4Q2J A;  3AV8 A;  2ZW0 A;  1JRO A;  3KLS X;  3W1S A;  2LJI A;  4YT0 B;  1D4B A;  3B2G A;  4RGN A;  3BYY B;  4HKQ A;  1ZPS A;  2DYO A;  1FNU A;  3AE3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...