1ZDVA

Solution structure of the type 1 pilus assembly platform fimd(25-139)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane usher protein fimD
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdvA01
1ZE3D 1ZDVA 1ZDXA 4J3OD 3RFZB 4B0MA 3BWUD 4B0EA
chains in the Genus database with same CATH superfamily
4JQWC 3UI3A 3GZNB 3DBSA 2ZEQA 2JUOA 1C4PA 2L05A 2QCZA 3VR9B 2DAJA 1L4ZB 4NY0A 3SD5A 4KKJA 4F7ZA 4EE2A 3AU4A 5DPSA 1D4BA 3AV8A 4RF0A 1VJKA 4LNNA 2L52A 3HM6X 5EE9A 2JPHA 4MGYE 3U2SC 3ZQ4A 3PRPB 2GOWA 3R2IA 2EMSA 3FILB 3OJ3A 2BPSA 3NZ3A 2I1KA 4FHJA 2FUHB 1E6EB 1ZP0B 2CJOA 1WGGA 5BYSA 1YOVB 1D5MC 3VTUA 3LXFA 1I42A 1T5XD 3Q3MC 4LNIA 1Z2MA 3SEBA 4DHZE 2W3SA 4P1CC 5EE3A 3NS1A 2ZJDA 4IG7B 1FM0D 2QHOA 4BAXA 3NJTA 4FBJB 3Q3NC 5IAAC 2GBJA 4ARCA 4ZRPA 2DZIA 3Q2AC 2GB1A 4IWOA 2VZKD 2L0TA 1SXTA 2CJNA 3ZVVA 1L6UA 2LGIA 4GGQA 5C2TB 4B9KA 1OQYA 3Q3FA 2IDYA 1R4NI 4GU2A 1MFWA 2AYOB 1X1MA 3KWVA 2GBRA 3E56A 4C7ZA 1GG3A 4TMAB 1EWYC 3N30A 3MHZA 1RYJA 4XC2A 3TSSA 1YN4A 4MJSB 4BKGA 4HWIB 3DOWA 1L0VB 4RM9A 1V1PB 2ZW1A 2PJHA 2AL3A 3AE5B 1C4AA 4A9AA 5D2MB 4BKTA 4GMVA 4JX1C 4HPMB 4JL9A 1E7VA 3NHEB 5HKHA 1DYQA 1CK1A 3PSEB 3P63A 2WDVB 4WWOA 3AE6B 1RWSA 2RDHA 4NZLB 3DWGC 1PGBA 4HK2A 2NBUA 1H8CA 4YSXB 3CSFA 3GE8C 3N1YC 4A3PA 4KSKC 3TEZA 4JPSA 5E6PA 4HEA1 2NBVB 5J18A 3RNGC 4C80A 3B0AA 1V1OA 3RYTA 4ANWA 1YN3A 4KV2A 4GLSC 4ANUA 3ZRCA 3WA0A 2N1WA 1Q1OA 1V5OA 5JXVA 3UF8A 3KW5B 2NVUI 1WXMA 1ENFA 3C8YA 3RD2A 2G9HD 4F8CB 2LVPA 2O2VA 1M4VA 3DBHI 4Q2JA 4GDLB 5H8YE 2N9PC 1E8WA 5LXIB 2KX0A 1J7BA 2V4IB 2R2QA 3TJPA 5AZHA 3EFUA 3H6NA 3VFKA 3K9PB 3TCAA 2HJ8A 2MP2A 2I2YA 2BYFA 4CQNA 5T8IA 3W5VB 4P7IA 2YLMA 1UWXA 3CSTA 2LJIA 1SF0A 4PK1A 3LJ3A 2LVOA 2IY1B 4KZCA 1EM7A 4YTNB 2MLBA 1K52A 4K7WA 2WXHA 2BKRB 2PVGC 3WIMA 1LXDA 3R66C 4LTUA 5IP4D 3NRZA 1NENB 1WM3A 3PLVA 1VD2A 4W9KA 1STEA 2WXGA 4AQ7A 4HCPB 4KVGB 2FUG1 1T0RC 2MEKA 3B2FA 3Q6BA 1FNUA 2KOXA 4DXAB 4PS8A 4GB9A 1ZKHA 4TQ1A 1OEYJ 2FIFA 2MJDA 4US8A 2GBNA 3QWZB 2RGFA 1WRIA 1TS4A 1ACCA 4II3B 2MP2B 2NTSA 2KFJA 2DHZA 1D5ZC 2JRHA 3R7QA 1WE7A 1HZ5A 4MM3B 4XWTA 2PVOD 3CIRB 2HTME 4HPPA 2MH7A 2X38A 4DWFA 4MT5A 4MACA 3VR8B 5L83A 2AX5A 4AJYB 4ZHOA 2ICIA 1FCCC 1UELA 2N0SB 2KT7A 3I63C 3L4PA 2L32A 2JYTA 2K5PA 4GOCA 1KH0A 2GI9A 2KQ4X 3B9JA 4WQMA 3HK0A 2LWPA 2FIDA 1RM6C 1TIFA 1R4MB 3R2TA 5CTRC 4OVVA 3L54A 4D2KA 2IO1B 4WJOA 2INNE 4L23A 4HPLB 2WDTB 1I7HA 2N7JA 1WRDB 3VTVA 1WH3A 3SFDB 4P6VF 2ZCBA 3NVYA 1S3SG 1VRAB 1ZDVA 5CHFA 2JT4B 2M17A 4LNFA 1OQRA 3WANA 2AQ2B 3CMMB 4ZRJA 3ZNHB 1KFYB 3AEDB 2N1VA 2CR5A 1C77A 4HJKA 1K51A 2N7DA 2KXJA 4K1RB 1VZ6A 4UDUC 1V5TA 4NQLB 5D6JB 3VUYA 2H89B 2Y5BB 1HZ6A 3E9SA 2KMMA 4KGSA 1N5WA 1F1HA 2WQYB 2OJRA 2HJ1A 4JLCA 2JU6X 4KGTA 4A20A 2V0GA 3Q3OC 1PDXA 1E7PB 3NG0A 2N9KA 3QCAA 2KN4A 4WWMA 5CX3A 2BBCA 2JWZA 3RN9C 4HROA 1Y56A 3VHTC 4YSZB 4KIKB 3W9CB 2LFIA 3ZXVA 2ON8A 2M56B 3FILA 2WXMA 1V8CA 4W9DA 3BK1A 1TBEA 4HJGE 3EUB2 1UBIA 2Y3AA 1CZPA 3TEWA 5AZFA 2KJHB 3N1XC 4HKZE 4TUUA 5GXGB 1MVKA 1CJEA 2L76A 3QK0A 2IGHA 3A9KA 5DPWA 3QHTA 1TZOA 4G50A 2J4XA 1WXAA 4ASWC 5EDSA 3LDZE 2MW5A 2M0XA 4NJ7A 5FR6A 1QKZA 2LMCA 2RSUA 2WS3B 1QOAA 4JGHB 3T3OA 2D10A 3L17A 3A1QA 4E71A 5BYRA 1TS5A 2WWZA 3DDCB 3W1YA 4WIPA 3APFA 3AE3B 1E8XA 4TSSA 4ZDVA 3UINB 3AMZA 1F2RC 3PHXB 2BTEA 1PYWD 3W1SC 4PS7A 1FXTB 4IM0A 1L2NA 3J9CA 3QAQA 4II2B 4S0RA 1RFAA 1FFVA 4WJQA 1WJ6A 3ZDMC 4RMAA 3MJ5A 4GXBA 3A9JA 2WDQB 3DHGC 3DWMA 3ZO5B 1KJTA 2KDIA 5IKCM 3AN1A 1V1PA 1XD3B 3SDLC 2IBIB 2BB5A 3A9KB 4IM3A 2BS2B 3RNBC 2J52A 3R3MA 1IYFA 2MBEA 3U7ZA 3UGBB 1MHXA 4MELA 1E8YA 3IAM1 1L6VA 3JSVA 4WJNA 1Z5SB 2L83A 4F1SA 1GAQB 1NI3A 3WCQA 5LNK1 2OOBB 4WJPA 2K25A 4ICVA 1IP9A 4IDIA 1WM2A 1CQVA 4IOIE 5I4DA 1BT0A 4PT5A 1NI2A 4A6QA 3ENEA 4XWWA 1WGKA 4BOZB 1DGJA 2NCNA 2O6VB 3WAPA 1YNTE 1WXSA 4KZ0A 1U4AA 3V60A 1UWMA 1IBXB 3RNEC 2KACA 1P9DU 2PEAA 2D3CA 3UQAA 2VRRB 1GNUA 3APCA 3JVZX 5HHDG 3L08A 2UYZB 2FE8A 1B9RA 4DDID 5DPRA 4BZAA 4N59A 3RUIB 4LJOB 3KYDD 2ASQA 2IO3B 4OW0A 1SIJA 2JXXA 1C79A 5BMGA 5FKAC 3CF6E 1R4NB 3R7RA 1TY2A 3VH4B 4XE0A 2OEDA 2LUEA 4MJSA 3AEEB 1WX8A 2J0KA 3NVWA 2D3GA 1AN8A 2K3UA 3PV1A 2IGGA 1LM8B 1EWCA 1JMLA 1K8RB 3ETRA 1XO3A 2V9HA 1LFDA 2MQJA 5TSSA 1F0ZA 3T3NA 2YEPF 3N20C 2PMVA 2KO3A 2DZKA 2WGSA 1IGDA 3P4QB 3N32A 4G0NB 1A70A 1QOFA 2RMMA 4DHZB 2PIAA 3IBEA 1QT9A 2DX5B 4EKUA 1ZW7A 1YN5A 2M19A 3C19A 1J8CA 3D32A 4ANVA 3VVWB 1I4XA 4O1NA 3RPFC 2CKHB 3N9YC 3OLMD 4RGNA 4C4VA 1DOXA 5G5HA 4MGZE 1B1ZA 3DBLB 1MG4A 1OEYA 2L00B 1VZ7A 2BB6A 4X57B 4EFOA 3IFWB 2IO0B 3IAS1 1YJJA 1I4HA 2IJ0A 4K81A 3AE1B 3TMPB 1IUEA 3GS2A 4EZLA 2XK5A 2MA9B 2BQQA 3TIXA 2DLBA 2D07B 3H7PA 4ZOHC 2O2VB 3KVFB 3PS6A 1N6ZA 1QILA 2RPQA 4W9GA 3LB8C 4GDKB 3A33B 4FJYA 1JWMD 3ZNGC 5J2RA 5IN7A 1Q5WB 4W9IA 4OVUA 3PZDA 1WGDA 1WGYA 2BWFA 3ZW3A 4ARIA 4M0WA 2DYBA 3RNFC 2KDMA 1WJ4A 2KFKA 3VUXA 2BS4B 2CU3A 2KVZA 2M8SA 2J0MA 3EGRA 3W1SA 4C4VB 2XN9C 1XT9B 2K22A 1QLBB 4A55A 3DBRI 3KH0A 3BIID 2INDC 1I4GA 1EUVB 5AZGA 1BMLC 2WU2B 2W54A 2E3TA 5E6JA 1MJDA 2L7RA 1UF0A 3AECB 3AEGB 3VDZA 3DVNU 1UGMA 3DQVA 2PKOA 3DPDA 1LGRA 2K8HA 3QIJA 1DOIA 1NEKB 1GUAB 1TKYA 4ZRKA 2D5GA 1WX9A 3JYUA 4JWSC 4ZYNA 3X23A 4G3XB 4HRSA 1SIFA 1ZXHA 2E6XA 1N63A 3ZJUA 2RD0A 2C5LC 2RPVA 2NS5A 1WR1A 4ANXA 1AW7A 4XX5A 2JSVX 4NAWB 4BBNC 5LXHA 1FNVA 1YD8U 4LDTD 1EF5A 4CYEA 4GDLA 3P42A 1T6BX 1ZE3D 1HXYD 4MSQB 1YQBA 4KIKA 1XCTL 1WF9A 1YX5B 4M00A 3NY5A 2M0AA 4WWNA 3WAMA 2FCMA 4W9CA 2MBBB 1HQRD 3L0WB 2R61A 2KTFA 2K9XA 1OQQA 2QSDA 3N1ZC 4E3CA 2G3QB 1SE2A 1P7FA 1TGZB 4H2AA 2WLBA 3EECA 4GSWA 4XYCA 1D5XC 4J3OD 1J0GA 3OG5A 1BUIC 3P2BA 3Q8AA 3O65B 1JALA 4K7SA 4KSLC 1WY8A 4ZYSA 2MBHA 2DZJA 3U30A 2IYDB 4NAWA 2JZPA 2MBQA 4G11A 1WGHA 4RCOA 4MH0E 1HTQA 3M62B 3ALBA 4RF1A 2KQ7A 2DZMA 2KKCA 2TSSA 4C00A 2VH1A 1NVID 1WYWB 2YVCA 4ZRIA 1WR6E 2KC1A 1F77A 3L13A 5G55A 3T9LA 1L0XB 2WHIA 5D94A 2HD5B 4IKGA 2RR9A 3ZXRA 1P3QU 1Q0WB 2JZZA 3RNCC 2AL6A 2K0PA 2MJ3A 2JZ3B 2KLCA 3M63B 1JWBD 1JRPA 2I38A 3RFZB 1NBFC 3V61A 2J42A 3TBLD 2HDEA 2FBWB 2MJEA 2NPTB 1EO6A 2EMTA 3AH7A 3AB5A 2LD9A 2INPE 1NYQA 3GP7A 4OZBA 1NDDA 4RH6A 5IO9A 3PVLA 4K3CA 4W9LA 3PT2B 1JWSD 2M1MA 3L10B 5DCNA 4JIOU 1I4PA 4GIVA 4TKNA 3TL5A 4RNAA 2FAZA 1ZDXA 1E90A 4RGOS 2I1JA 4HCNB 3MC8A 1WI0A 2D2QA 2KD0A 2PLPA 1KRHA 4LLGM 3NVVA 2WX1A 2MRPA 1XLPA 2V3SA 4BKSA 1WWTA 3W2DA 3V6EB 1FD6A 2H88B 1LQBA 4YTPB 2IO2B 1N62A 3P4RB 1UNSA 2ACZB 2IY0B 4W9HA 2D3BA 3DHIC 3ECIA 3AI5A 3MP9A 4HLEA 1AARA 2PPHA 1FO4A 4URKA 2KQSA 5H92C 1FCLA 4KDIC 2LASA 4FHKA 5CHWA 4BFRA 1I4QA 4KX6B 2W55A 1T3QA 1YQ4B 5AUIA 3V6CB 3KLSX 2GBKA 1KM7A 2L1AA 2UWQA 1I35A 1WMHB 2AQ3B 2IPKD 2KYWA 1JWAD 3TEXA 1FRDA 4W9FA 5AUKA 3O13A 1WJUA 1VZ8A 4NJ6A 2LGSA 3RI7C 3OWEB 3ZYYX 4OZAA 5CHVC 4FN2A 3BYTB 4FXCA 3BINA 1E5WA 2ZZPB 2FCQA 1L0YB 3QQ8B 1C76A 1J19A 1JW9D 3DCGA 4A3OA 3AULA 4DXFA 4M0WB 5EE0A 1KLVA 4EEWA 2BS3B 2KNBA 3JSVB 2J0JA 2ONQA 3RT3B 3DVNV 1IPGA 2UU7A 2K1FA 3PHWB 4PYUA 4IUMB 2NTTA 4TQ0A 3PGEA 2LXCA 2KJ6A 2JVCA 3KUZA 3Q14C 1MG8A 3ZDTA 2MHJA 2V3PA 5MPOA 3FAHA 4BVUC 2ZW0A 3I5JC 2WXPA 4DHJB 1ISNA 4L2YA 2MBOA 2R2OA 3N3KB 4RGTA 4I6PA 1WX7A 1N5XA 2K6QA 3IG3A 1F2RI 2OJWA 3Q8EA 1L4DB 2N9LA 2KN5A 2C60A 3VH3B 5D3IB 1ET6A 2G4SA 1TS3A 4RGMA 4XDCA 2FCNA 1YIWA 1GB1A 4FULA 4IWPA 5HI1A 1SE3A 4OZCA 1XCQL 4ITKA 5D3DA 5BO4B 4AWJA 2G1EA 3ZLZA 4LCDE 3B08A 1QQRA 1XLOA 5KHOA 3ZIMA 5L95C 4B95A 2FNJB 2LEKA 4S17A 2JQRB 4JWUC 2Y5PA 1J7CA 4K7UA 1P1AA 2A5UA 1VCBA 2MX2A 2C7NB 1KLGD 3AE8B 3HM3A 3I57A 5HFYA 4ZHPA 1AYFA 2EKEC 1FIQA 2J53A 1KTKA 2KANA 4J6IA 3VQIA 2L8JA 2BYEA 1UH6A 4LDTB 2WDRB 2BWES 2REXA 5HG2A 3TUOA 4YWGG 3EFCA 2DNFA 3QA8A 2W9NA 2K6DB 5JHAA 3DBRB 2C7MB 3PLUA 2MCNB 3V62A 3HHMA 5IOIA 3DHHC 4MEMA 1C78A 3V05A 4IW0A 1FNWA 2KFKB 2D11A 1M94A 1WXQA 2OHFA 1WSPA 3ML9A 1QZEA 2KZRA 1VLBA 2WP9B 1TTNA 2LZ6A 3AEFB 2X8XX 4KDLB 3HVDA 2MSED 4MM3A 3Q3JA 1ZPSA 2L3ZA 2IZVB 2JY6A 3NZSA 4C7YA 1A5RA 1TZ1A 3Q8FA 4KGRA 2VZKB 1L5PA 1ZOYB 3VAWA 2RDGA 4PS3A 1PGAA 2HE7A 3U52E 1T0QC 4MGKE 2XK5B 1UGJA 1WGRA 2NBWB 1SEBD 5FR3A 2JWUA 4B0MA 1GC6A 3VXWA 5D7GA 1T0YA 4AUQC 2JXTA 4NPNA 1WXVA 1PGXA 2JX5A 3HRDD 2ZPNA 4WURA 4YTMB 1ROEA 1YMHE 1Y8RC 3AE7B 1WYGA 3BK2A 1D3ZA 1BXTA 5DPTA 1V80A 2WXFA 1TYGB 4WAAA 3A4SC 4AOFA 2M4NA 4HDOA 2PW9A 1E7UA 1ZGUB 3AEBB 3RULA 4NJCA 2BVCA 1E9MA 2KLGA 2KWDA 3JW0X 1G6JA 2WYQA 1WZ3A 4GN1A 3U7DA 1KLUD 2AWTA 4WAFA 2LJ5A 2QILA 5JH5C 5TR5A 3GB1A 3MC9A 4B0EA 2KDBA 3RZFA 2Q5WD 4IM2A 1TJEA 2RDBC 4XGAB 4HVBA 1Q10A 2DBYA 1MPEA 4USAA 3ZKJC 2V1YA 3UIOB 2A4ZA 1XQQA 2WXKA 2QEJC 3LYYA 4YL8A 3DVGX 2KWUB 1S1QB 1N60A 5E6NA 1UUPA 3BVGA 3BY4B 1JWUD 2B76B 4EOYA 3T8MA 1TS2A 1OGWA 1PFDA 4US9A 1P98A 4P16A 3U8ZA 1PQSA 2IGDA 3DVGY 1R4MI 1V86A 2GMIC 2KX3A 4HXDA 3I9V1 3H8HA 1H4RA 1WZ0A 4RFBA 1E10A 1V6EA 2GLSA 3APDA 1F9JA 1E8ZA 3ML8A 1WIAA 2PE6B 2L0FA 1SE9A 3PZ7A 3HIZA 4BOSC 3DBHB 4B6WA 3KUDB 4FLHA 2KTRA 2CHZA 4W9EA 1XF5L 3FKYA 2K8BA 1EF1A 4I6NB 2LVQA 1EU4A 2WX0A 4CO7A 3P4PB 1TY0A 2D3AA 3KUCB 4M8NA 1GB4A 3ZTDA 3A9JB 3AXCA 1C3TA 4XDDA 1AWDA 2BKFA 1FXAA 4L1BA 2DYMA 5LLIA 4LNKA 1OFFA 4DBGA 1YQ3B 3HUIA 3Q8BA 1ZXIA 3K9OB 2N9EB 1TKEA 2KDEB 2O6VA 2QC8A 3MJWA 3OAWA 1V2YA 4QAYA 2ZVNA 1SGHA 1JCKB 3RNAC 3PREA 2JRIB 1K53A 3BZDB 4IC7B 1V97A 2W82A 2ZNVB 3BWUD 5GMVA 1XEEA 3ZRFA 5JHBA 2JF5A 3AE4B 1SSNA 2BGFA 3A4RA 3IT6B 1HA5A 2GBMA 4AJWA 2WXOA 1RRBA 2Z59B 2KDFB 4P1BC 2ZVOA 5KHQA 4C56C 1N61A 2LRUA 1V81A 3A1QB 3MHSD 2HTHA 1J7AA 2CU1A 3V3XA 2DWQA 2YEPB 3AE2B 3IXSA 1E0ZA 4JE3B 2KTRB 1NYRA 1RFKA 1HE8A 3I3TB 4ZRQA 2N9XA 2K8CA 2N4FA 5EE1A 4N58A 2GRIA 3EA6A 1MHHE 2DYOA 3FC4A 3EC8A 1I4RA 1JRUA 1V9JA 4K3BA 1SBBB 4DDGD 4FJZA 4M8MA 3BVZA 1P7EA 5JZEB 1DOYA 4I6LB 1HEZE 3UQBA 4A90A 1C1YB 2G4DB 3NUHB 3QARA 3OJ4B 3AU5A 3NOBA 2QMTA 2LGXA 1IBXA 2KVRA 3B1LX 3GE3C 3VUWA 1TT5B 2KK8A 4ICUA 3IT4B 3KYCD 4EZJA 1XLNA 3DBLI 1PUTA 3PTFC 3GZNI 3P4SB 2WXNA 2NR2A 2DAFA 4YSYB 1D6EC 2BYVE 1T0SC 1OTRB 1F52A 5BMIA 2BF8B 4MGIE 1R7SA 4AP4C 3WAOA 3H9DA 2V4LA 2B3AA 2N7EA 3SR6A 3AM9A 2SEBD 1UD7A 2WXRA 1RLFA 3R8BA 4HDQA 1VDVA 1GPXA 1GOZA 4DXGA 4EUTA 2PE9A 3ABVB 2KAJA 2SAKA 1UBQA 3KWLA 4GDKA 3NS8A 3VTWA 4DQOC 3H7PB 1L7YA 4NAMA 1SJED 3VRBB 1CMXB 2EELA 1QOBA 2G45B 3AEAB 4WQOB 2V3NA 1GC7A 2LRWA 4YT0B 3ZGZA 4DK5A 2MWSB 4PYZA 4DHJD 3ZTCA 2ZCCA 2QDFA 1EU3A 3P1MA 1HTOA 3SFEB 2ZNVC 2CHWA 2XNAC 3IVFA 2INCC 4FA6A 1K50A 2KJRA 2Z8LA 3GOEA 5AEKB 2KMCA 1FMAD 1FEHA 3M3JA 2BYTA 4N6EB 4WH4A 3BYYB 3B2GA 5G2NA 3PRZA 1YJIA 4TV3A 4CHKA 1QF6A 4NNJB 2LI5A 1P0RA 2LGDA 2WXJA 1FXIA 1YJ1A 3WALA 2KHWB 2QIEB 5E6OA 3H7SA 2KWCA 4MDKE 2W3RA 1C4CA 2QJLA 2O6VD 2WXIA 4W9JA 1RAXA 1MI0A 4HKQA 3QX1A 1YX6B 1UZXB 5J17A 1SE4A 2AQ1B 2J7QB 3X0WA 1WJNA 2KMAA 4EZKA 2WNMA 4RM8A 3BVMA 1XXGA 2Y5CA 3ZJTA 2KC2A 1TKGA 3MC0B 3KQ4A 2LHEA 5IA7A 2NMQA 2WXQA 3PZ8A 4LNOA 1WE6A 3NVZA 3W5UB 3PPAA 2CS4A 4FADA 3PRMB 2C7HA 2Z0DB 1ESFA 3SHQA 2C9WB 1JQ4A 4FJVB 5BYQA 3CWIA 4A8XC 3PO0A 2XBBC 4LK0M 2LHDA 3U4EG 1V49A 1FFUA 2WU5B 1IGCA 3EHVA 3HVZA 3AE9B 2ZPYA 5FK9C 2XEWA 2VH2A 4LJPB 3ZUNA 1KOTA 3MTNB 3RCZA 3QJZA 3QC8B 3Q69A 3RMKC 1XLQA 4R3DA 3ZNZB 2KWVB 4YXDB 1SB3C 3L16A 2LUMA 1VR9A 4IWQA 5C23A 2BT6A 4NQKE 2BW2A 1GJZA 5G5GA 1WFYA 4REZA 3UIPB 5C1ZA 2WXLA 4XZ4A 2EKIA 2LGYA 3NZUA 3ZJVA 1ZUD2 2K39A 3S2AA 3VRAB 4WWPA 3ONSA 2DENB 2CHXA 3ZNID 4BBNF 3M95A 2PTLA 4AS1A 2AEHA 5C3JB 2FCSA 1QOGA 3SU8X 3IHPC 2NPTA 3RZWC 3C0RB 1SJHD 2LXAA 3H1UA 4E74A 4N9F4 3Q8CA 4M01A 4ACFA 5BMHA 1FPYA 1C9FA 1KF6B 1WMHA 1ET9A 3TEYA 2JYEA 2Z0EB 4OHJA 1LO5D 4MH8A 4BKSD 3URYA 1FRRA 4MSMB 3MFGA 1JROA 4M02A 4KKIA 4OVZA
chains in the Genus database with same CATH topology
1F77A 4US9A 1CJEA 1L0XB 3UI3A 4IKGA 4P16A 2IGDA 2IGHA 1C4PA 3I9V1 3VR9B 3H8HA 1TZOA 1L4ZB 2J4XA 4RFBA 4KKJA 1E10A 4EE2A 2K0PA 1QKZA 2LMCA 2WS3B 1QOAA 2MJ3A 1D4BA 3AV8A 4RF0A 3T3OA 1VJKA 5BYRA 3PZ7A 1TS5A 1JWBD 1JRPA 2L52A 4WIPA 2I38A 3RFZB 3AE3B 2J42A 4TSSA 2HDEA 2FBWB 2MJEA 5EE9A 3AH7A 1XF5L 3U2SC 3ZQ4A 3AMZA 3AB5A 1F2RC 1EU4A 3R2IA 2INPE 2BTEA 1NYQA 3GP7A 4OZBA 1PYWD 3P4PB 3FILB 4RH6A 1TY0A 3NZ3A 1GB4A 1JWSD 1I4PA 3J9CA 4XDDA 1AWDA 1E6EB 1FXAA 1ZP0B 4RNAA 2CJOA 4L1BA 5BYSA 2DYMA 1D5MC 1ZDXA 4RGOS 1FFVA 3LXFA 1T5XD 3MJ5A 1OFFA 3SEBA 2PLPA 2W3SA 1KRHA 4LLGM 1YQ3B 3NS1A 5EE3A 3NVVA 2WDQB 1FM0D 3DWMA 3HUIA 3Q8BA 1ZXIA 3AN1A 1V1PA 4ARCA 1XLPA 1TKEA 2BB5A 4ZRPA 2GB1A 1WWTA 3W2DA 1JCKB 2VZKD 1SXTA 2CJNA 1FD6A 2H88B 1K53A 3BZDB 2BS2B 1L6UA 2LGIA 2J52A 4YTPB 1V97A 2W82A 5C2TB 1N62A 3U7ZA 3P4RB 1UNSA 1MHXA 2ACZB 3BWUD 1XEEA 2IDYA 3IAM1 3MP9A 3AE4B 1L6VA 1SSNA 3KWVA 3E56A 2L83A 4C7ZA 1FO4A 3IT6B 4TMAB 1HA5A 1GAQB 1NI3A 3WCQA 1EWYC 5H92C 5LNK1 1FCLA 2WXOA 1I4QA 3MHZA 4IDIA 4KX6B 1RYJA 2W55A 1T3QA 1YQ4B 1YN4A 1CQVA 5AUIA 4IOIE 4C56C 3KLSX 5I4DA 1N61A 1L0VB 2L1AA 4PT5A 1J7AA 4A6QA 3V3XA 2DWQA 2YEPB 4XWWA 2AQ3B 1V1PB 1WGKA 2ZW1A 2IPKD 3AE2B 3IXSA 1DGJA 1JWAD 1E0ZA 3AE5B 1C4AA 1FRDA 1YNTE 4JE3B 3TEXA 4A9AA 5AUKA 3O13A 4JX1C 1NYRA 1RFKA 1UWMA 1IBXB 2KACA 4ZRQA 1VZ8A 5EE1A 4N58A 2GRIA 3EA6A 1MHHE 2DYOA 1DYQA 3FC4A 3OWEB 4OZAA 3ZYYX 1CK1A 5HHDG 3BYTB 4FXCA 3P63A 2WDVB 2FE8A 3AE6B 1RWSA 2RDHA 1I4RA 4NZLB 1B9RA 1SBBB 3DWGC 4N59A 1L0YB 1PGBA 1C76A 1JW9D 4DXFA 3BVZA 4YSXB 1P7EA 4OW0A 5EE0A 1SIJA 1DOYA 2BS3B 1C79A 2ONQA 5BMGA 5FKAC 1HEZE 3TEZA 4A90A 4JPSA 1TY2A 3NUHB 4HEA1 4XE0A 2OEDA 4C80A 1V1OA 3AEEB 2NTTA 4TQ0A 2QMTA 1IBXA 1YN3A 3NVWA 1AN8A 2K3UA 2V3PA 5MPOA 4GLSC 3IT4B 3FAHA 2IGGA 1XLNA 2ZW0A 2WXPA 1PUTA 1EWCA 5JXVA 1JMLA 3P4SB 2WXNA 4YSYB 4L2YA 1D6EC 1ENFA 3C8YA 2G9HD 1XO3A 3ETRA 4RGTA 1M4VA 4Q2JA 1N5XA 4GDLB 5H8YE 5BMIA 1F2RI 5TSSA 3Q8EA 1F0ZA 1R7SA 1L4DB 3T3NA 2N9LA 1J7BA 2V4IB 2YEPF 3SR6A 3AM9A 2PMVA 2SEBD 5D3IB 2WXRA 1ET6A 3R8BA 1IGDA 3P4QB 1A70A 1QOFA 2RMMA 1VDVA 1GPXA 1GOZA 4DXGA 1TS3A 2PIAA 3ABVB 2KAJA 4RGMA 4XDCA 2SAKA 3KWLA 1GB1A 2I2YA 1QT9A 5HI1A 1SE3A 4OZCA 4CQNA 1XCQL 5T8IA 3W5VB 1YN5A 2M19A 4ITKA 1UWXA 5D3DA 4DQOC 4NAMA 1SJED 1I4XA 2LJIA 3VRBB 1SF0A 4O1NA 3RPFC 2G1EA 3N9YC 2EELA 1QOBA 4RGNA 1DOXA 5G5HA 1QQRA 1B1ZA 1XLOA 3AEAB 2V3NA 1VZ7A 1EM7A 4YTNB 1K52A 2BB6A 2WXHA 4YT0B 2LEKA 3ZGZA 3IAS1 1YJJA 2JQRB 1I4HA 2IJ0A 3AE1B 2PVGC 1IUEA 4JWUC 2Y5PA 1J7CA 4LTUA 3GS2A 1EU3A 3NRZA 3P1MA 3SFEB 1NENB 2DLBA 4ZOHC 1STEA 2WXGA 3AE8B 1KLGD 2XNAC 3I57A 4AQ7A 5HFYA 4ZHPA 1AYFA 1QILA 2FUG1 1K50A 2Z8LA 1FIQA 3LB8C 4GDKB 2J53A 1KTKA 2MEKA 3VQIA 3B2FA 1JWMD 1FNUA 1FMAD 1FEHA 2BYTA 2WDRB 4N6EB 4TQ1A 3BYYB 4WH4A 5HG2A 3TUOA 2MJDA 4YWGG 3B2GA 4US8A 1YJIA 4ARIA 1WRIA 4M0WA 1TS4A 1QF6A 2KDMA 1ACCA 2NTSA 2BS4B 2CU3A 2WXJA 1FXIA 1D5ZC 3EGRA 1C78A 3V05A 2QIEB 1HZ5A 3W1SA 1FNWA 2W3RA 1C4CA 2QJLA 4MM3B 4XWTA 2XN9C 2PVOD 2WXIA 3CIRB 2HTME 2K22A 1MI0A 1QLBB 1WXQA 2OHFA 2MH7A 2X38A 4A55A 3BIID 4HKQA 1WSPA 4MT5A 4MACA 3VR8B 1I4GA 1SE4A 2AX5A 1VLBA 2ICIA 2AQ1B 2WP9B 4ZHOA 1BMLC 1FCCC 3AEFB 2N0SB 2WU2B 3L4PA 2WNMA 2W54A 2L32A 2JYTA 2K5PA 3HVDA 2E3TA 5E6JA 3AEGB 3AECB 3BVMA 1ZPSA 4C7YA 1KH0A 1XXGA 2Y5CA 2GI9A 2KQ4X 3B9JA 4WQMA 2PKOA 1TKGA 3MC0B 3KQ4A 3Q8FA 4KGRA 3ZJTA 2VZKB 1L5PA 2LHEA 2NMQA 1ZOYB 1DOIA 2RDGA 2WXQA 1PGAA 1NEKB 3PZ8A 1RM6C 1TKYA 3U52E 2D5GA 3NVZA 3W5UB 3R2TA 1UGJA 4JWSC 1SEBD 4KKIA 4HRSA 1ESFA 4D2KA 1ZXHA 5FR3A 2JWUA 2E6XA 1JQ4A 4B0MA 2INNE 5BYQA 3CWIA 4L23A 1N63A 4A8XC 5D7GA 3ZJUA 3PO0A 1I7HA 2N7JA 4LK0M 1MVKA 2JXTA 3SFDB 2LHDA 1PGXA 2RPVA 3NVYA 2JX5A 3HRDD 4P6VF 1VRAB 3U4EG 4WURA 1ZDVA 1FFUA 4YTMB 2WU5B 1IGCA 3HVZA 1AW7A 1ROEA 3AE9B 5FK9C 2JSVX 1OQRA 4NAWB 1YMHE 2AQ2B 1FNVA 1KFYB 3AE7B 1WYGA 3AEDB 3BK2A 3P42A 1T6BX 3Q69A 1ZE3D 1BXTA 1C77A 2WXFA 1HXYD 1XLQA 4R3DA 1K51A 4YXDB 1TYGB 1SB3C 1XCTL 1VZ6A 2LUMA 1VR9A 4UDUC 2M0AA 2BT6A 2BW2A 2H89B 5G5GA 4REZA 1HZ6A 3E9SA 2WXLA 1HQRD 2KMMA 4KGSA 1N5WA 2WQYB 2R61A 2K9XA 2EKIA 1OQQA 2QSDA 2PW9A 3ZJVA 1ZUD2 3AEBB 2JU6X 4NJCA 3VRAB 1E9MA 4KGTA 1SE2A 2KWDA 1P7FA 2V0GA 4H2AA 1PDXA 1E7PB 2WLBA 2N9KA 2PTLA 1D5XC 1KLUD 4J3OD 4AS1A 4WAFA 5C3JB 1QOGA 1BUIC 3Q8AA 2KN4A 2QILA 4WWMA 1JALA 2BBCA 3GB1A 4B0EA 1SJHD 4ZYSA 2Q5WD 4HROA 3Q8CA 1TJEA 1Y56A 1Q10A 2DBYA 2JZPA 4YSZB 1MPEA 4RCOA 4USAA 2LFIA 3W9CB 2ON8A 5BMHA 2WXKA 1C9FA 2M56B 1KF6B 1ET9A 3FILA 2QEJC 3LYYA 2WXMA 1V8CA 4RF1A 3TEYA 3BK1A 2JYEA 2TSSA 1NVID 1N60A 4HJGE 4OHJA 3EUB2 1LO5D 4MH8A 1UUPA 3BVGA 1JWUD 2B76B 1CZPA 2Y3AA 3TEWA 3URYA 1FRRA 1TS2A 4HKZE 5GXGB 3MFGA 1JROA 3TSSA 1PFDA 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE3 D;  1ZDV A;  1ZDX A;  4J3O D;  3RFZ B;  4B0M A;  3BWU D;  4B0E A; 
#chains in the Genus database with same CATH topology
 4JQW C;  3UI3 A;  3GZN B;  3DBS A;  2ZEQ A;  2JUO A;  1C4P A;  2L05 A;  2QCZ A;  3VR9 B;  2DAJ A;  1L4Z B;  4NY0 A;  3SD5 A;  4KKJ A;  4F7Z A;  4EE2 A;  3AU4 A;  5DPS A;  1D4B A;  3AV8 A;  4RF0 A;  1VJK A;  4LNN A;  2L52 A;  3HM6 X;  5EE9 A;  2JPH A;  4MGY E;  3U2S C;  3ZQ4 A;  3PRP B;  2GOW A;  3R2I A;  2EMS A;  3FIL B;  3OJ3 A;  2BPS A;  3NZ3 A;  2I1K A;  4FHJ A;  2FUH B;  1E6E B;  1ZP0 B;  2CJO A;  1WGG A;  5BYS A;  1YOV B;  1D5M C;  3VTU A;  3LXF A;  1I42 A;  1T5X D;  3Q3M C;  4LNI A;  1Z2M A;  3SEB A;  4DHZ E;  2W3S A;  4P1C C;  5EE3 A;  3NS1 A;  2ZJD A;  4IG7 B;  1FM0 D;  2QHO A;  4BAX A;  3NJT A;  4FBJ B;  3Q3N C;  5IAA C;  2GBJ A;  4ARC A;  4ZRP A;  2DZI A;  3Q2A C;  2GB1 A;  4IWO A;  2VZK D;  2L0T A;  1SXT A;  2CJN A;  3ZVV A;  1L6U A;  2LGI A;  4GGQ A;  5C2T B;  4B9K A;  1OQY A;  3Q3F A;  2IDY A;  1R4N I;  4GU2 A;  1MFW A;  2AYO B;  1X1M A;  3KWV A;  2GBR A;  3E56 A;  4C7Z A;  1GG3 A;  4TMA B;  1EWY C;  3N30 A;  3MHZ A;  1RYJ A;  4XC2 A;  3TSS A;  1YN4 A;  4MJS B;  4BKG A;  4HWI B;  3DOW A;  1L0V B;  4RM9 A;  1V1P B;  2ZW1 A;  2PJH A;  2AL3 A;  3AE5 B;  1C4A A;  4A9A A;  5D2M B;  4BKT A;  4GMV A;  4JX1 C;  4HPM B;  4JL9 A;  1E7V A;  3NHE B;  5HKH A;  1DYQ A;  1CK1 A;  3PSE B;  3P63 A;  2WDV B;  4WWO A;  3AE6 B;  1RWS A;  2RDH A;  4NZL B;  3DWG C;  1PGB A;  4HK2 A;  2NBU A;  1H8C A;  4YSX B;  3CSF A;  3GE8 C;  3N1Y C;  4A3P A;  4KSK C;  3TEZ A;  4JPS A;  5E6P A;  4HEA 1;  2NBV B;  5J18 A;  3RNG C;  4C80 A;  3B0A A;  1V1O A;  3RYT A;  4ANW A;  1YN3 A;  4KV2 A;  4GLS C;  4ANU A;  3ZRC A;  3WA0 A;  2N1W A;  1Q1O A;  1V5O A;  5JXV A;  3UF8 A;  3KW5 B;  2NVU I;  1WXM A;  1ENF A;  3C8Y A;  3RD2 A;  2G9H D;  4F8C B;  2LVP A;  2O2V A;  1M4V A;  3DBH I;  4Q2J A;  4GDL B;  5H8Y E;  2N9P C;  1E8W A;  5LXI B;  2KX0 A;  1J7B A;  2V4I B;  2R2Q A;  3TJP A;  5AZH A;  3EFU A;  3H6N A;  3VFK A;  3K9P B;  3TCA A;  2HJ8 A;  2MP2 A;  2I2Y A;  2BYF A;  4CQN A;  5T8I A;  3W5V B;  4P7I A;  2YLM A;  1UWX A;  3CST A;  2LJI A;  1SF0 A;  4PK1 A;  3LJ3 A;  2LVO A;  2IY1 B;  4KZC A;  1EM7 A;  4YTN B;  2MLB A;  1K52 A;  4K7W A;  2WXH A;  2BKR B;  2PVG C;  3WIM A;  1LXD A;  3R66 C;  4LTU A;  5IP4 D;  3NRZ A;  1NEN B;  1WM3 A;  3PLV A;  1VD2 A;  4W9K A;  1STE A;  2WXG A;  4AQ7 A;  4HCP B;  4KVG B;  2FUG 1;  1T0R C;  2MEK A;  3B2F A;  3Q6B A;  1FNU A;  2KOX A;  4DXA B;  4PS8 A;  4GB9 A;  1ZKH A;  4TQ1 A;  1OEY J;  2FIF A;  2MJD A;  4US8 A;  2GBN A;  3QWZ B;  2RGF A;  1WRI A;  1TS4 A;  1ACC A;  4II3 B;  2MP2 B;  2NTS A;  2KFJ A;  2DHZ A;  1D5Z C;  2JRH A;  3R7Q A;  1WE7 A;  1HZ5 A;  4MM3 B;  4XWT A;  2PVO D;  3CIR B;  2HTM E;  4HPP A;  2MH7 A;  2X38 A;  4DWF A;  4MT5 A;  4MAC A;  3VR8 B;  5L83 A;  2AX5 A;  4AJY B;  4ZHO A;  2ICI A;  1FCC C;  1UEL A;  2N0S B;  2KT7 A;  3I63 C;  3L4P A;  2L32 A;  2JYT A;  2K5P A;  4GOC A;  1KH0 A;  2GI9 A;  2KQ4 X;  3B9J A;  4WQM A;  3HK0 A;  2LWP A;  2FID A;  1RM6 C;  1TIF A;  1R4M B;  3R2T A;  5CTR C;  4OVV A;  3L54 A;  4D2K A;  2IO1 B;  4WJO A;  2INN E;  4L23 A;  4HPL B;  2WDT B;  1I7H A;  2N7J A;  1WRD B;  3VTV A;  1WH3 A;  3SFD B;  4P6V F;  2ZCB A;  3NVY A;  1S3S G;  1VRA B;  1ZDV A;  5CHF A;  2JT4 B;  2M17 A;  4LNF A;  1OQR A;  3WAN A;  2AQ2 B;  3CMM B;  4ZRJ A;  3ZNH B;  1KFY B;  3AED B;  2N1V A;  2CR5 A;  1C77 A;  4HJK A;  1K51 A;  2N7D A;  2KXJ A;  4K1R B;  1VZ6 A;  4UDU C;  1V5T A;  4NQL B;  5D6J B;  3VUY A;  2H89 B;  2Y5B B;  1HZ6 A;  3E9S A;  2KMM A;  4KGS A;  1N5W A;  1F1H A;  2WQY B;  2OJR A;  2HJ1 A;  4JLC A;  2JU6 X;  4KGT A;  4A20 A;  2V0G A;  3Q3O C;  1PDX A;  1E7P B;  3NG0 A;  2N9K A;  3QCA A;  2KN4 A;  4WWM A;  5CX3 A;  2BBC A;  2JWZ A;  3RN9 C;  4HRO A;  1Y56 A;  3VHT C;  4YSZ B;  4KIK B;  3W9C B;  2LFI A;  3ZXV A;  2ON8 A;  2M56 B;  3FIL A;  2WXM A;  1V8C A;  4W9D A;  3BK1 A;  1TBE A;  4HJG E;  3EUB 2;  1UBI A;  2Y3A A;  1CZP A;  3TEW A;  5AZF A;  2KJH B;  3N1X C;  4HKZ E;  4TUU A;  5GXG B;  1MVK A;  1CJE A;  2L76 A;  3QK0 A;  2IGH A;  3A9K A;  5DPW A;  3QHT A;  1TZO A;  4G50 A;  2J4X A;  1WXA A;  4ASW C;  5EDS A;  3LDZ E;  2MW5 A;  2M0X A;  4NJ7 A;  5FR6 A;  1QKZ A;  2LMC A;  2RSU A;  2WS3 B;  1QOA A;  4JGH B;  3T3O A;  2D10 A;  3L17 A;  3A1Q A;  4E71 A;  5BYR A;  1TS5 A;  2WWZ A;  3DDC B;  3W1Y A;  4WIP A;  3APF A;  3AE3 B;  1E8X A;  4TSS A;  4ZDV A;  3UIN B;  3AMZ A;  1F2R C;  3PHX B;  2BTE A;  1PYW D;  3W1S C;  4PS7 A;  1FXT B;  4IM0 A;  1L2N A;  3J9C A;  3QAQ A;  4II2 B;  4S0R A;  1RFA A;  1FFV A;  4WJQ A;  1WJ6 A;  3ZDM C;  4RMA A;  3MJ5 A;  4GXB A;  3A9J A;  2WDQ B;  3DHG C;  3DWM A;  3ZO5 B;  1KJT A;  2KDI A;  5IKC M;  3AN1 A;  1V1P A;  1XD3 B;  3SDL C;  2IBI B;  2BB5 A;  3A9K B;  4IM3 A;  2BS2 B;  3RNB C;  2J52 A;  3R3M A;  1IYF A;  2MBE A;  3U7Z A;  3UGB B;  1MHX A;  4MEL A;  1E8Y A;  3IAM 1;  1L6V A;  3JSV A;  4WJN A;  1Z5S B;  2L83 A;  4F1S A;  1GAQ B;  1NI3 A;  3WCQ A;  5LNK 1;  2OOB B;  4WJP A;  2K25 A;  4ICV A;  1IP9 A;  4IDI A;  1WM2 A;  1CQV A;  4IOI E;  5I4D A;  1BT0 A;  4PT5 A;  1NI2 A;  4A6Q A;  3ENE A;  4XWW A;  1WGK A;  4BOZ B;  1DGJ A;  2NCN A;  2O6V B;  3WAP A;  1YNT E;  1WXS A;  4KZ0 A;  1U4A A;  3V60 A;  1UWM A;  1IBX B;  3RNE C;  2KAC A;  1P9D U;  2PEA A;  2D3C A;  3UQA A;  2VRR B;  1GNU A;  3APC A;  3JVZ X;  5HHD G;  3L08 A;  2UYZ B;  2FE8 A;  1B9R A;  4DDI D;  5DPR A;  4BZA A;  4N59 A;  3RUI B;  4LJO B;  3KYD D;  2ASQ A;  2IO3 B;  4OW0 A;  1SIJ A;  2JXX A;  1C79 A;  5BMG A;  5FKA C;  3CF6 E;  1R4N B;  3R7R A;  1TY2 A;  3VH4 B;  4XE0 A;  2OED A;  2LUE A;  4MJS A;  3AEE B;  1WX8 A;  2J0K A;  3NVW A;  2D3G A;  1AN8 A;  2K3U A;  3PV1 A;  2IGG A;  1LM8 B;  1EWC A;  1JML A;  1K8R B;  3ETR A;  1XO3 A;  2V9H A;  1LFD A;  2MQJ A;  5TSS A;  1F0Z A;  3T3N A;  2YEP F;  3N20 C;  2PMV A;  2KO3 A;  2DZK A;  2WGS A;  1IGD A;  3P4Q B;  3N32 A;  4G0N B;  1A70 A;  1QOF A;  2RMM A;  4DHZ B;  2PIA A;  3IBE A;  1QT9 A;  2DX5 B;  4EKU A;  1ZW7 A;  1YN5 A;  2M19 A;  3C19 A;  1J8C A;  3D32 A;  4ANV A;  3VVW B;  1I4X A;  4O1N A;  3RPF C;  2CKH B;  3N9Y C;  3OLM D;  4RGN A;  4C4V A;  1DOX A;  5G5H A;  4MGZ E;  1B1Z A;  3DBL B;  1MG4 A;  1OEY A;  2L00 B;  1VZ7 A;  2BB6 A;  4X57 B;  4EFO A;  3IFW B;  2IO0 B;  3IAS 1;  1YJJ A;  1I4H A;  2IJ0 A;  4K81 A;  3AE1 B;  3TMP B;  1IUE A;  3GS2 A;  4EZL A;  2XK5 A;  2MA9 B;  2BQQ A;  3TIX A;  2DLB A;  2D07 B;  3H7P A;  4ZOH C;  2O2V B;  3KVF B;  3PS6 A;  1N6Z A;  1QIL A;  2RPQ A;  4W9G A;  3LB8 C;  4GDK B;  3A33 B;  4FJY A;  1JWM D;  3ZNG C;  5J2R A;  5IN7 A;  1Q5W B;  4W9I A;  4OVU A;  3PZD A;  1WGD A;  1WGY A;  2BWF A;  3ZW3 A;  4ARI A;  4M0W A;  2DYB A;  3RNF C;  2KDM A;  1WJ4 A;  2KFK A;  3VUX A;  2BS4 B;  2CU3 A;  2KVZ A;  2M8S A;  2J0M A;  3EGR A;  3W1S A;  4C4V B;  2XN9 C;  1XT9 B;  2K22 A;  1QLB B;  4A55 A;  3DBR I;  3KH0 A;  3BII D;  2IND C;  1I4G A;  1EUV B;  5AZG A;  1BML C;  2WU2 B;  2W54 A;  2E3T A;  5E6J A;  1MJD A;  2L7R A;  1UF0 A;  3AEC B;  3AEG B;  3VDZ A;  3DVN U;  1UGM A;  3DQV A;  2PKO A;  3DPD A;  1LGR A;  2K8H A;  3QIJ A;  1DOI A;  1NEK B;  1GUA B;  1TKY A;  4ZRK A;  2D5G A;  1WX9 A;  3JYU A;  4JWS C;  4ZYN A;  3X23 A;  4G3X B;  4HRS A;  1SIF A;  1ZXH A;  2E6X A;  1N63 A;  3ZJU A;  2RD0 A;  2C5L C;  2RPV A;  2NS5 A;  1WR1 A;  4ANX A;  1AW7 A;  4XX5 A;  2JSV X;  4NAW B;  4BBN C;  5LXH A;  1FNV A;  1YD8 U;  4LDT D;  1EF5 A;  4CYE A;  4GDL A;  3P42 A;  1T6B X;  1ZE3 D;  1HXY D;  4MSQ B;  1YQB A;  4KIK A;  1XCT L;  1WF9 A;  1YX5 B;  4M00 A;  3NY5 A;  2M0A A;  4WWN A;  3WAM A;  2FCM A;  4W9C A;  2MBB B;  1HQR D;  3L0W B;  2R61 A;  2KTF A;  2K9X A;  1OQQ A;  2QSD A;  3N1Z C;  4E3C A;  2G3Q B;  1SE2 A;  1P7F A;  1TGZ B;  4H2A A;  2WLB A;  3EEC A;  4GSW A;  4XYC A;  1D5X C;  4J3O D;  1J0G A;  3OG5 A;  1BUI C;  3P2B A;  3Q8A A;  3O65 B;  1JAL A;  4K7S A;  4KSL C;  1WY8 A;  4ZYS A;  2MBH A;  2DZJ A;  3U30 A;  2IYD B;  4NAW A;  2JZP A;  2MBQ A;  4G11 A;  1WGH A;  4RCO A;  4MH0 E;  1HTQ A;  3M62 B;  3ALB A;  4RF1 A;  2KQ7 A;  2DZM A;  2KKC A;  2TSS A;  4C00 A;  2VH1 A;  1NVI D;  1WYW B;  2YVC A;  4ZRI A;  1WR6 E;  2KC1 A;  1F77 A;  3L13 A;  5G55 A;  3T9L A;  1L0X B;  2WHI A;  5D94 A;  2HD5 B;  4IKG A;  2RR9 A;  3ZXR A;  1P3Q U;  1Q0W B;  2JZZ A;  3RNC C;  2AL6 A;  2K0P A;  2MJ3 A;  2JZ3 B;  2KLC A;  3M63 B;  1JWB D;  1JRP A;  2I38 A;  3RFZ B;  1NBF C;  3V61 A;  2J42 A;  3TBL D;  2HDE A;  2FBW B;  2MJE A;  2NPT B;  1EO6 A;  2EMT A;  3AH7 A;  3AB5 A;  2LD9 A;  2INP E;  1NYQ A;  3GP7 A;  4OZB A;  1NDD A;  4RH6 A;  5IO9 A;  3PVL A;  4K3C A;  4W9L A;  3PT2 B;  1JWS D;  2M1M A;  3L10 B;  5DCN A;  4JIO U;  1I4P A;  4GIV A;  4TKN A;  3TL5 A;  4RNA A;  2FAZ A;  1ZDX A;  1E90 A;  4RGO S;  2I1J A;  4HCN B;  3MC8 A;  1WI0 A;  2D2Q A;  2KD0 A;  2PLP A;  1KRH A;  4LLG M;  3NVV A;  2WX1 A;  2MRP A;  1XLP A;  2V3S A;  4BKS A;  1WWT A;  3W2D A;  3V6E B;  1FD6 A;  2H88 B;  1LQB A;  4YTP B;  2IO2 B;  1N62 A;  3P4R B;  1UNS A;  2ACZ B;  2IY0 B;  4W9H A;  2D3B A;  3DHI C;  3ECI A;  3AI5 A;  3MP9 A;  4HLE A;  1AAR A;  2PPH A;  1FO4 A;  4URK A;  2KQS A;  5H92 C;  1FCL A;  4KDI C;  2LAS A;  4FHK A;  5CHW A;  4BFR A;  1I4Q A;  4KX6 B;  2W55 A;  1T3Q A;  1YQ4 B;  5AUI A;  3V6C B;  3KLS X;  2GBK A;  1KM7 A;  2L1A A;  2UWQ A;  1I35 A;  1WMH B;  2AQ3 B;  2IPK D;  2KYW A;  1JWA D;  3TEX A;  1FRD A;  4W9F A;  5AUK A;  3O13 A;  1WJU A;  1VZ8 A;  4NJ6 A;  2LGS A;  3RI7 C;  3OWE B;  3ZYY X;  4OZA A;  5CHV C;  4FN2 A;  3BYT B;  4FXC A;  3BIN A;  1E5W A;  2ZZP B;  2FCQ A;  1L0Y B;  3QQ8 B;  1C76 A;  1J19 A;  1JW9 D;  3DCG A;  4A3O A;  3AUL A;  4DXF A;  4M0W B;  5EE0 A;  1KLV A;  4EEW A;  2BS3 B;  2KNB A;  3JSV B;  2J0J A;  2ONQ A;  3RT3 B;  3DVN V;  1IPG A;  2UU7 A;  2K1F A;  3PHW B;  4PYU A;  4IUM B;  2NTT A;  4TQ0 A;  3PGE A;  2LXC A;  2KJ6 A;  2JVC A;  3KUZ A;  3Q14 C;  1MG8 A;  3ZDT A;  2MHJ A;  2V3P A;  5MPO A;  3FAH A;  4BVU C;  2ZW0 A;  3I5J C;  2WXP A;  4DHJ B;  1ISN A;  4L2Y A;  2MBO A;  2R2O A;  3N3K B;  4RGT A;  4I6P A;  1WX7 A;  1N5X A;  2K6Q A;  3IG3 A;  1F2R I;  2OJW A;  3Q8E A;  1L4D B;  2N9L A;  2KN5 A;  2C60 A;  3VH3 B;  5D3I B;  1ET6 A;  2G4S A;  1TS3 A;  4RGM A;  4XDC A;  2FCN A;  1YIW A;  1GB1 A;  4FUL A;  4IWP A;  5HI1 A;  1SE3 A;  4OZC A;  1XCQ L;  4ITK A;  5D3D A;  5BO4 B;  4AWJ A;  2G1E A;  3ZLZ A;  4LCD E;  3B08 A;  1QQR A;  1XLO A;  5KHO A;  3ZIM A;  5L95 C;  4B95 A;  2FNJ B;  2LEK A;  4S17 A;  2JQR B;  4JWU C;  2Y5P A;  1J7C A;  4K7U A;  1P1A A;  2A5U A;  1VCB A;  2MX2 A;  2C7N B;  1KLG D;  3AE8 B;  3HM3 A;  3I57 A;  5HFY A;  4ZHP A;  1AYF A;  2EKE C;  1FIQ A;  2J53 A;  1KTK A;  2KAN A;  4J6I A;  3VQI A;  2L8J A;  2BYE A;  1UH6 A;  4LDT B;  2WDR B;  2BWE S;  2REX A;  5HG2 A;  3TUO A;  4YWG G;  3EFC A;  2DNF A;  3QA8 A;  2W9N A;  2K6D B;  5JHA A;  3DBR B;  2C7M B;  3PLU A;  2MCN B;  3V62 A;  3HHM A;  5IOI A;  3DHH C;  4MEM A;  1C78 A;  3V05 A;  4IW0 A;  1FNW A;  2KFK B;  2D11 A;  1M94 A;  1WXQ A;  2OHF A;  1WSP A;  3ML9 A;  1QZE A;  2KZR A;  1VLB A;  2WP9 B;  1TTN A;  2LZ6 A;  3AEF B;  2X8X X;  4KDL B;  3HVD A;  2MSE D;  4MM3 A;  3Q3J A;  1ZPS A;  2L3Z A;  2IZV B;  2JY6 A;  3NZS A;  4C7Y A;  1A5R A;  1TZ1 A;  3Q8F A;  4KGR A;  2VZK B;  1L5P A;  1ZOY B;  3VAW A;  2RDG A;  4PS3 A;  1PGA A;  2HE7 A;  3U52 E;  1T0Q C;  4MGK E;  2XK5 B;  1UGJ A;  1WGR A;  2NBW B;  1SEB D;  5FR3 A;  2JWU A;  4B0M A;  1GC6 A;  3VXW A;  5D7G A;  1T0Y A;  4AUQ C;  2JXT A;  4NPN A;  1WXV A;  1PGX A;  2JX5 A;  3HRD D;  2ZPN A;  4WUR A;  4YTM B;  1ROE A;  1YMH E;  1Y8R C;  3AE7 B;  1WYG A;  3BK2 A;  1D3Z A;  1BXT A;  5DPT A;  1V80 A;  2WXF A;  1TYG B;  4WAA A;  3A4S C;  4AOF A;  2M4N A;  4HDO A;  2PW9 A;  1E7U A;  1ZGU B;  3AEB B;  3RUL A;  4NJC A;  2BVC A;  1E9M A;  2KLG A;  2KWD A;  3JW0 X;  1G6J A;  2WYQ A;  1WZ3 A;  4GN1 A;  3U7D A;  1KLU D;  2AWT A;  4WAF A;  2LJ5 A;  2QIL A;  5JH5 C;  5TR5 A;  3GB1 A;  3MC9 A;  4B0E A;  2KDB A;  3RZF A;  2Q5W D;  4IM2 A;  1TJE A;  2RDB C;  4XGA B;  4HVB A;  1Q10 A;  2DBY A;  1MPE A;  4USA A;  3ZKJ C;  2V1Y A;  3UIO B;  2A4Z A;  1XQQ A;  2WXK A;  2QEJ C;  3LYY A;  4YL8 A;  3DVG X;  2KWU B;  1S1Q B;  1N60 A;  5E6N A;  1UUP A;  3BVG A;  3BY4 B;  1JWU D;  2B76 B;  4EOY A;  3T8M A;  1TS2 A;  1OGW A;  1PFD A;  4US9 A;  1P98 A;  4P16 A;  3U8Z A;  1PQS A;  2IGD A;  3DVG Y;  1R4M I;  1V86 A;  2GMI C;  2KX3 A;  4HXD A;  3I9V 1;  3H8H A;  1H4R A;  1WZ0 A;  4RFB A;  1E10 A;  1V6E A;  2GLS A;  3APD A;  1F9J A;  1E8Z A;  3ML8 A;  1WIA A;  2PE6 B;  2L0F A;  1SE9 A;  3PZ7 A;  3HIZ A;  4BOS C;  3DBH B;  4B6W A;  3KUD B;  4FLH A;  2KTR A;  2CHZ A;  4W9E A;  1XF5 L;  3FKY A;  2K8B A;  1EF1 A;  4I6N B;  2LVQ A;  1EU4 A;  2WX0 A;  4CO7 A;  3P4P B;  1TY0 A;  2D3A A;  3KUC B;  4M8N A;  1GB4 A;  3ZTD A;  3A9J B;  3AXC A;  1C3T A;  4XDD A;  1AWD A;  2BKF A;  1FXA A;  4L1B A;  2DYM A;  5LLI A;  4LNK A;  1OFF A;  4DBG A;  1YQ3 B;  3HUI A;  3Q8B A;  1ZXI A;  3K9O B;  2N9E B;  1TKE A;  2KDE B;  2O6V A;  2QC8 A;  3MJW A;  3OAW A;  1V2Y A;  4QAY A;  2ZVN A;  1SGH A;  1JCK B;  3RNA C;  3PRE A;  2JRI B;  1K53 A;  3BZD B;  4IC7 B;  1V97 A;  2W82 A;  2ZNV B;  3BWU D;  5GMV A;  1XEE A;  3ZRF A;  5JHB A;  2JF5 A;  3AE4 B;  1SSN A;  2BGF A;  3A4R A;  3IT6 B;  1HA5 A;  2GBM A;  4AJW A;  2WXO A;  1RRB A;  2Z59 B;  2KDF B;  4P1B C;  2ZVO A;  5KHQ A;  4C56 C;  1N61 A;  2LRU A;  1V81 A;  3A1Q B;  3MHS D;  2HTH A;  1J7A A;  2CU1 A;  3V3X A;  2DWQ A;  2YEP B;  3AE2 B;  3IXS A;  1E0Z A;  4JE3 B;  2KTR B;  1NYR A;  1RFK A;  1HE8 A;  3I3T B;  4ZRQ A;  2N9X A;  2K8C A;  2N4F A;  5EE1 A;  4N58 A;  2GRI A;  3EA6 A;  1MHH E;  2DYO A;  3FC4 A;  3EC8 A;  1I4R A;  1JRU A;  1V9J A;  4K3B A;  1SBB B;  4DDG D;  4FJZ A;  4M8M A;  3BVZ A;  1P7E A;  5JZE B;  1DOY A;  4I6L B;  1HEZ E;  3UQB A;  4A90 A;  1C1Y B;  2G4D B;  3NUH B;  3QAR A;  3OJ4 B;  3AU5 A;  3NOB A;  2QMT A;  2LGX A;  1IBX A;  2KVR A;  3B1L X;  3GE3 C;  3VUW A;  1TT5 B;  2KK8 A;  4ICU A;  3IT4 B;  3KYC D;  4EZJ A;  1XLN A;  3DBL I;  1PUT A;  3PTF C;  3GZN I;  3P4S B;  2WXN A;  2NR2 A;  2DAF A;  4YSY B;  1D6E C;  2BYV E;  1T0S C;  1OTR B;  1F52 A;  5BMI A;  2BF8 B;  4MGI E;  1R7S A;  4AP4 C;  3WAO A;  3H9D A;  2V4L A;  2B3A A;  2N7E A;  3SR6 A;  3AM9 A;  2SEB D;  1UD7 A;  2WXR A;  1RLF A;  3R8B A;  4HDQ A;  1VDV A;  1GPX A;  1GOZ A;  4DXG A;  4EUT A;  2PE9 A;  3ABV B;  2KAJ A;  2SAK A;  1UBQ A;  3KWL A;  4GDK A;  3NS8 A;  3VTW A;  4DQO C;  3H7P B;  1L7Y A;  4NAM A;  1SJE D;  3VRB B;  1CMX B;  2EEL A;  1QOB A;  2G45 B;  3AEA B;  4WQO B;  2V3N A;  1GC7 A;  2LRW A;  4YT0 B;  3ZGZ A;  4DK5 A;  2MWS B;  4PYZ A;  4DHJ D;  3ZTC A;  2ZCC A;  2QDF A;  1EU3 A;  3P1M A;  1HTO A;  3SFE B;  2ZNV C;  2CHW A;  2XNA C;  3IVF A;  2INC C;  4FA6 A;  1K50 A;  2KJR A;  2Z8L A;  3GOE A;  5AEK B;  2KMC A;  1FMA D;  1FEH A;  3M3J A;  2BYT A;  4N6E B;  4WH4 A;  3BYY B;  3B2G A;  5G2N A;  3PRZ A;  1YJI A;  4TV3 A;  4CHK A;  1QF6 A;  4NNJ B;  2LI5 A;  1P0R A;  2LGD A;  2WXJ A;  1FXI A;  1YJ1 A;  3WAL A;  2KHW B;  2QIE B;  5E6O A;  3H7S A;  2KWC A;  4MDK E;  2W3R A;  1C4C A;  2QJL A;  2O6V D;  2WXI A;  4W9J A;  1RAX A;  1MI0 A;  4HKQ A;  3QX1 A;  1YX6 B;  1UZX B;  5J17 A;  1SE4 A;  2AQ1 B;  2J7Q B;  3X0W A;  1WJN A;  2KMA A;  4EZK A;  2WNM A;  4RM8 A;  3BVM A;  1XXG A;  2Y5C A;  3ZJT A;  2KC2 A;  1TKG A;  3MC0 B;  3KQ4 A;  2LHE A;  5IA7 A;  2NMQ A;  2WXQ A;  3PZ8 A;  4LNO A;  1WE6 A;  3NVZ A;  3W5U B;  3PPA A;  2CS4 A;  4FAD A;  3PRM B;  2C7H A;  2Z0D B;  1ESF A;  3SHQ A;  2C9W B;  1JQ4 A;  4FJV B;  5BYQ A;  3CWI A;  4A8X C;  3PO0 A;  2XBB C;  4LK0 M;  2LHD A;  3U4E G;  1V49 A;  1FFU A;  2WU5 B;  1IGC A;  3EHV A;  3HVZ A;  3AE9 B;  2ZPY A;  5FK9 C;  2XEW A;  2VH2 A;  4LJP B;  3ZUN A;  1KOT A;  3MTN B;  3RCZ A;  3QJZ A;  3QC8 B;  3Q69 A;  3RMK C;  1XLQ A;  4R3D A;  3ZNZ B;  2KWV B;  4YXD B;  1SB3 C;  3L16 A;  2LUM A;  1VR9 A;  4IWQ A;  5C23 A;  2BT6 A;  4NQK E;  2BW2 A;  1GJZ A;  5G5G A;  1WFY A;  4REZ A;  3UIP B;  5C1Z A;  2WXL A;  4XZ4 A;  2EKI A;  2LGY A;  3NZU A;  3ZJV A;  1ZUD 2;  2K39 A;  3S2A A;  3VRA B;  4WWP A;  3ONS A;  2DEN B;  2CHX A;  3ZNI D;  4BBN F;  3M95 A;  2PTL A;  4AS1 A;  2AEH A;  5C3J B;  2FCS A;  1QOG A;  3SU8 X;  3IHP C;  2NPT A;  3RZW C;  3C0R B;  1SJH D;  2LXA A;  3H1U A;  4E74 A;  4N9F 4;  3Q8C A;  4M01 A;  4ACF A;  5BMH A;  1FPY A;  1C9F A;  1KF6 B;  1WMH A;  1ET9 A;  3TEY A;  2JYE A;  2Z0E B;  4OHJ A;  1LO5 D;  4MH8 A;  4BKS D;  3URY A;  1FRR A;  4MSM B;  3MFG A;  1JRO A;  4M02 A;  4KKI A;  4OVZ A; 
#chains in the Genus database with same CATH homology
 1F77 A;  4US9 A;  1CJE A;  1L0X B;  3UI3 A;  4IKG A;  4P16 A;  2IGD A;  2IGH A;  1C4P A;  3I9V 1;  3VR9 B;  3H8H A;  1TZO A;  1L4Z B;  2J4X A;  4RFB A;  4KKJ A;  1E10 A;  4EE2 A;  2K0P A;  1QKZ A;  2LMC A;  2WS3 B;  1QOA A;  2MJ3 A;  1D4B A;  3AV8 A;  4RF0 A;  3T3O A;  1VJK A;  5BYR A;  3PZ7 A;  1TS5 A;  1JWB D;  1JRP A;  2L52 A;  4WIP A;  2I38 A;  3RFZ B;  3AE3 B;  2J42 A;  4TSS A;  2HDE A;  2FBW B;  2MJE A;  5EE9 A;  3AH7 A;  1XF5 L;  3U2S C;  3ZQ4 A;  3AMZ A;  3AB5 A;  1F2R C;  1EU4 A;  3R2I A;  2INP E;  2BTE A;  1NYQ A;  3GP7 A;  4OZB A;  1PYW D;  3P4P B;  3FIL B;  4RH6 A;  1TY0 A;  3NZ3 A;  1GB4 A;  1JWS D;  1I4P A;  3J9C A;  4XDD A;  1AWD A;  1E6E B;  1FXA A;  1ZP0 B;  4RNA A;  2CJO A;  4L1B A;  5BYS A;  2DYM A;  1D5M C;  1ZDX A;  4RGO S;  1FFV A;  3LXF A;  1T5X D;  3MJ5 A;  1OFF A;  3SEB A;  2PLP A;  2W3S A;  1KRH A;  4LLG M;  1YQ3 B;  3NS1 A;  5EE3 A;  3NVV A;  2WDQ B;  1FM0 D;  3DWM A;  3HUI A;  3Q8B A;  1ZXI A;  3AN1 A;  1V1P A;  4ARC A;  1XLP A;  1TKE A;  2BB5 A;  4ZRP A;  2GB1 A;  1WWT A;  3W2D A;  1JCK B;  2VZK D;  1SXT A;  2CJN A;  1FD6 A;  2H88 B;  1K53 A;  3BZD B;  2BS2 B;  1L6U A;  2LGI A;  2J52 A;  4YTP B;  1V97 A;  2W82 A;  5C2T B;  1N62 A;  3U7Z A;  3P4R B;  1UNS A;  1MHX A;  2ACZ B;  3BWU D;  1XEE A;  2IDY A;  3IAM 1;  3MP9 A;  3AE4 B;  1L6V A;  1SSN A;  3KWV A;  3E56 A;  2L83 A;  4C7Z A;  1FO4 A;  3IT6 B;  4TMA B;  1HA5 A;  1GAQ B;  1NI3 A;  3WCQ A;  1EWY C;  5H92 C;  5LNK 1;  1FCL A;  2WXO A;  1I4Q A;  3MHZ A;  4IDI A;  4KX6 B;  1RYJ A;  2W55 A;  1T3Q A;  1YQ4 B;  1YN4 A;  1CQV A;  5AUI A;  4IOI E;  4C56 C;  3KLS X;  5I4D A;  1N61 A;  1L0V B;  2L1A A;  4PT5 A;  1J7A A;  4A6Q A;  3V3X A;  2DWQ A;  2YEP B;  4XWW A;  2AQ3 B;  1V1P B;  1WGK A;  2ZW1 A;  2IPK D;  3AE2 B;  3IXS A;  1DGJ A;  1JWA D;  1E0Z A;  3AE5 B;  1C4A A;  1FRD A;  1YNT E;  4JE3 B;  3TEX A;  4A9A A;  5AUK A;  3O13 A;  4JX1 C;  1NYR A;  1RFK A;  1UWM A;  1IBX B;  2KAC A;  4ZRQ A;  1VZ8 A;  5EE1 A;  4N58 A;  2GRI A;  3EA6 A;  1MHH E;  2DYO A;  1DYQ A;  3FC4 A;  3OWE B;  4OZA A;  3ZYY X;  1CK1 A;  5HHD G;  3BYT B;  4FXC A;  3P63 A;  2WDV B;  2FE8 A;  3AE6 B;  1RWS A;  2RDH A;  1I4R A;  4NZL B;  1B9R A;  1SBB B;  3DWG C;  4N59 A;  1L0Y B;  1PGB A;  1C76 A;  1JW9 D;  4DXF A;  3BVZ A;  4YSX B;  1P7E A;  4OW0 A;  5EE0 A;  1SIJ A;  1DOY A;  2BS3 B;  1C79 A;  2ONQ A;  5BMG A;  5FKA C;  1HEZ E;  3TEZ A;  4A90 A;  4JPS A;  1TY2 A;  3NUH B;  4HEA 1;  4XE0 A;  2OED A;  4C80 A;  1V1O A;  3AEE B;  2NTT A;  4TQ0 A;  2QMT A;  1IBX A;  1YN3 A;  3NVW A;  1AN8 A;  2K3U A;  2V3P A;  5MPO A;  4GLS C;  3IT4 B;  3FAH A;  2IGG A;  1XLN A;  2ZW0 A;  2WXP A;  1PUT A;  1EWC A;  5JXV A;  1JML A;  3P4S B;  2WXN A;  4YSY B;  4L2Y A;  1D6E C;  1ENF A;  3C8Y A;  2G9H D;  1XO3 A;  3ETR A;  4RGT A;  1M4V A;  4Q2J A;  1N5X A;  4GDL B;  5H8Y E;  5BMI A;  1F2R I;  5TSS A;  3Q8E A;  1F0Z A;  1R7S A;  1L4D B;  3T3N A;  2N9L A;  1J7B A;  2V4I B;  2YEP F;  3SR6 A;  3AM9 A;  2PMV A;  2SEB D;  5D3I B;  2WXR A;  1ET6 A;  3R8B A;  1IGD A;  3P4Q B;  1A70 A;  1QOF A;  2RMM A;  1VDV A;  1GPX A;  1GOZ A;  4DXG A;  1TS3 A;  2PIA A;  3ABV B;  2KAJ A;  4RGM A;  4XDC A;  2SAK A;  3KWL A;  1GB1 A;  2I2Y A;  1QT9 A;  5HI1 A;  1SE3 A;  4OZC A;  4CQN A;  1XCQ L;  5T8I A;  3W5V B;  1YN5 A;  2M19 A;  4ITK A;  1UWX A;  5D3D A;  4DQO C;  4NAM A;  1SJE D;  1I4X A;  2LJI A;  3VRB B;  1SF0 A;  4O1N A;  3RPF C;  2G1E A;  3N9Y C;  2EEL A;  1QOB A;  4RGN A;  1DOX A;  5G5H A;  1QQR A;  1B1Z A;  1XLO A;  3AEA B;  2V3N A;  1VZ7 A;  1EM7 A;  4YTN B;  1K52 A;  2BB6 A;  2WXH A;  4YT0 B;  2LEK A;  3ZGZ A;  3IAS 1;  1YJJ A;  2JQR B;  1I4H A;  2IJ0 A;  3AE1 B;  2PVG C;  1IUE A;  4JWU C;  2Y5P A;  1J7C A;  4LTU A;  3GS2 A;  1EU3 A;  3NRZ A;  3P1M A;  3SFE B;  1NEN B;  2DLB A;  4ZOH C;  1STE A;  2WXG A;  3AE8 B;  1KLG D;  2XNA C;  3I57 A;  4AQ7 A;  5HFY A;  4ZHP A;  1AYF A;  1QIL A;  2FUG 1;  1K50 A;  2Z8L A;  1FIQ A;  3LB8 C;  4GDK B;  2J53 A;  1KTK A;  2MEK A;  3VQI A;  3B2F A;  1JWM D;  1FNU A;  1FMA D;  1FEH A;  2BYT A;  2WDR B;  4N6E B;  4TQ1 A;  3BYY B;  4WH4 A;  5HG2 A;  3TUO A;  2MJD A;  4YWG G;  3B2G A;  4US8 A;  1YJI A;  4ARI A;  1WRI A;  4M0W A;  1TS4 A;  1QF6 A;  2KDM A;  1ACC A;  2NTS A;  2BS4 B;  2CU3 A;  2WXJ A;  1FXI A;  1D5Z C;  3EGR A;  1C78 A;  3V05 A;  2QIE B;  1HZ5 A;  3W1S A;  1FNW A;  2W3R A;  1C4C A;  2QJL A;  4MM3 B;  4XWT A;  2XN9 C;  2PVO D;  2WXI A;  3CIR B;  2HTM E;  2K22 A;  1MI0 A;  1QLB B;  1WXQ A;  2OHF A;  2MH7 A;  2X38 A;  4A55 A;  3BII D;  4HKQ A;  1WSP A;  4MT5 A;  4MAC A;  3VR8 B;  1I4G A;  1SE4 A;  2AX5 A;  1VLB A;  2ICI A;  2AQ1 B;  2WP9 B;  4ZHO A;  1BML C;  1FCC C;  3AEF B;  2N0S B;  2WU2 B;  3L4P A;  2WNM A;  2W54 A;  2L32 A;  2JYT A;  2K5P A;  3HVD A;  2E3T A;  5E6J A;  3AEG B;  3AEC B;  3BVM A;  1ZPS A;  4C7Y A;  1KH0 A;  1XXG A;  2Y5C A;  2GI9 A;  2KQ4 X;  3B9J A;  4WQM A;  2PKO A;  1TKG A;  3MC0 B;  3KQ4 A;  3Q8F A;  4KGR A;  3ZJT A;  2VZK B;  1L5P A;  2LHE A;  2NMQ A;  1ZOY B;  1DOI A;  2RDG A;  2WXQ A;  1PGA A;  1NEK B;  3PZ8 A;  1RM6 C;  1TKY A;  3U52 E;  2D5G A;  3NVZ A;  3W5U B;  3R2T A;  1UGJ A;  4JWS C;  1SEB D;  4KKI A;  4HRS A;  1ESF A;  4D2K A;  1ZXH A;  5FR3 A;  2JWU A;  2E6X A;  1JQ4 A;  4B0M A;  2INN E;  5BYQ A;  3CWI A;  4L23 A;  1N63 A;  4A8X C;  5D7G A;  3ZJU A;  3PO0 A;  1I7H A;  2N7J A;  4LK0 M;  1MVK A;  2JXT A;  3SFD B;  2LHD A;  1PGX A;  2RPV A;  3NVY A;  2JX5 A;  3HRD D;  4P6V F;  1VRA B;  3U4E G;  4WUR A;  1ZDV A;  1FFU A;  4YTM B;  2WU5 B;  1IGC A;  3HVZ A;  1AW7 A;  1ROE A;  3AE9 B;  5FK9 C;  2JSV X;  1OQR A;  4NAW B;  1YMH E;  2AQ2 B;  1FNV A;  1KFY B;  3AE7 B;  1WYG A;  3AED B;  3BK2 A;  3P42 A;  1T6B X;  3Q69 A;  1ZE3 D;  1BXT A;  1C77 A;  2WXF A;  1HXY D;  1XLQ A;  4R3D A;  1K51 A;  4YXD B;  1TYG B;  1SB3 C;  1XCT L;  1VZ6 A;  2LUM A;  1VR9 A;  4UDU C;  2M0A A;  2BT6 A;  2BW2 A;  2H89 B;  5G5G A;  4REZ A;  1HZ6 A;  3E9S A;  2WXL A;  1HQR D;  2KMM A;  4KGS A;  1N5W A;  2WQY B;  2R61 A;  2K9X A;  2EKI A;  1OQQ A;  2QSD A;  2PW9 A;  3ZJV A;  1ZUD 2;  3AEB B;  2JU6 X;  4NJC A;  3VRA B;  1E9M A;  4KGT A;  1SE2 A;  2KWD A;  1P7F A;  2V0G A;  4H2A A;  1PDX A;  1E7P B;  2WLB A;  2N9K A;  2PTL A;  1D5X C;  1KLU D;  4J3O D;  4AS1 A;  4WAF A;  5C3J B;  1QOG A;  1BUI C;  3Q8A A;  2KN4 A;  2QIL A;  4WWM A;  1JAL A;  2BBC A;  3GB1 A;  4B0E A;  1SJH D;  4ZYS A;  2Q5W D;  4HRO A;  3Q8C A;  1TJE A;  1Y56 A;  1Q10 A;  2DBY A;  2JZP A;  4YSZ B;  1MPE A;  4RCO A;  4USA A;  2LFI A;  3W9C B;  2ON8 A;  5BMH A;  2WXK A;  1C9F A;  2M56 B;  1KF6 B;  1ET9 A;  3FIL A;  2QEJ C;  3LYY A;  2WXM A;  1V8C A;  4RF1 A;  3TEY A;  3BK1 A;  2JYE A;  2TSS A;  1NVI D;  1N60 A;  4HJG E;  4OHJ A;  3EUB 2;  1LO5 D;  4MH8 A;  1UUP A;  3BVG A;  1JWU D;  2B76 B;  1CZP A;  2Y3A A;  3TEW A;  3URY A;  1FRR A;  1TS2 A;  4HKZ E;  5GXG B;  3MFG A;  1JRO A;  3TSS A;  1PFD A;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...