1ZDXA

Solution structure of the type 1 pilus assembly platform fimd(25-125)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein fimD
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zdxA00
3BWUD 3RFZB 1ZE3D 4J3OD 4B0EA 1ZDXA 4B0MA 1ZDVA
chains in the Genus database with same CATH superfamily
1WZ3A 3R2IA 1GPXA 2BB6A 1TGZB 2FBWB 5IP4D 2LUEA 3SFEB 3KVFB 4HJKA 1SIJA 3DHIC 5EE0A 3P1MA 4XDCA 1QF6A 1GUAB 4RGMA 4S0RA 4GLSC 3UF8A 3BYTB 4W9GA 3PO0A 1NI3A 4IWPA 2WXRA 3SFDB 4P1BC 2KZRA 1XEEA 2BS4B 4ZHOA 4F1SA 5C3JB 3EA6A 2KFKA 3A9KB 4ASWC 4BKTA 2PVOD 2WXGA 4JIOU 1EWCA 4HKZE 3OG5A 4OZCA 1J7BA 3MJ5A 3NOBA 2MBHA 2V1YA 5FR6A 3AV8A 4BBNF 2VRRB 4ZDVA 1XLOA 1NDDA 1TZ1A 3BYYB 4A20A 2R61A 1SE4A 3WCQA 3DWGC 1F0ZA 1WM2A 4FULA 5D3IB 2PLPA 3PLVA 2GBKA 2E6XA 3BVZA 4HROA 2IGHA 2N1VA 2KX3A 1FRDA 3ML9A 2LEKA 1E8WA 1DOYA 4FLHA 1ZW7A 4ZHPA 1KFYB 5E6OA 2WX0A 3ZTDA 2M0XA 5LXIB 4JX1C 2V3PA 4WWMA 1BT0A 4I6LB 1WI0A 1I42A 4H2AA 1RFKA 2GI9A 2MWSB 4GSWA 5C2TB 4GIVA 3VTWA 2GMIC 1L2NA 1ZUD2 4W9IA 2VH1A 3H7SA 2N9KA 2JVCA 2LGSA 2KANA 2DZJA 3PLUA 1TYGB 3L08A 1STEA 2KMCA 2TSSA 2Y5CA 3ABVB 2L8JA 4MGKE 2MRPA 4WIPA 1UWXA 1XXGA 2WU2B 3RPFC 2GBRA 1T0YA 1AN8A 3PRPB 4MH0E 3L17A 2BBCA 2CR5A 3SHQA 4DDID 4LNKA 4WWNA 4EZJA 5KHQA 3KW5B 2YLMA 2IO0B 3P4RB 2YEPB 1Q0WB 2EMSA 4RH6A 3L0WB 3Q3JA 3MC8A 2QILA 2IY1B 2DZKA 1P1AA 5J18A 4YXDB 1UF0A 3QAQA 3ZJUA 1D4BA 1E9MA 2O6VD 4MGZE 3W5UB 5JZEB 3R7RA 2CHZA 3BK2A 2VZKD 4LNFA 2WU5B 4USAA 4BKGA 2BVCA 1R4NB 1QOGA 1AYFA 5HG2A 4XWTA 3RNFC 3ZDMC 5EE9A 2WXQA 1V1OA 1HA5A 4WH4A 1JQ4A 5IOIA 2KWCA 1XLPA 1EU4A 3B9JA 4ZRJA 4EFOA 1VCBA 2NPTA 2K0PA 5AZGA 3ZJVA 2OEDA 2QC8A 1U4AA 3Q8CA 3U52E 2V9HA 4P6VF 3AE5B 3M62B 3RT3B 3PSEB 2K8HA 1MHHE 2PW9A 2V3NA 5CHVC 1CJEA 4KGRA 2N4FA 5E6JA 2MCNB 4A8XC 2WQYB 4ICVA 2JZPA 2Z59B 1WZ0A 1PGBA 2QSDA 1T3QA 3BVGA 5LLIA 3R7QA 4LDTD 2KO3A 2KTFA 2BKRB 1GC7A 4REZA 3KYDD 4DK5A 2XN9C 2X38A 3A9KA 4AUQC 1XLNA 5DPSA 2KK8A 4IKGA 2JSVX 5HHDG 1CK1A 4ARIA 3SDLC 3TEYA 1V81A 2FNJB 2L32A 1DOXA 4CO7A 1JRPA 5G5HA 2KNBA 2N7EA 1UELA 1TS3A 3O13A 4I6NB 3N1ZC 2INDC 3EFCA 3I63C 3PREA 4DHJD 4W9JA 3ZIMA 3QHTA 4GMVA 1S3SG 1E8YA 5J17A 1WWTA 3WANA 3RULA 1UGJA 4ICUA 1RAXA 3PGEA 3PHWB 4C00A 1MI0A 1WR1A 3MP9A 1KM7A 1LXDA 5HI1A 2K5PA 1OQRA 3KUCB 2HTME 1JALA 2K6QA 3DBLB 3C0RB 5J2RA 3RNAC 4HRSA 2OOBB 2D07B 1WR6E 3H1UA 4ZOHC 1JMLA 3CWIA 3ZNID 3CMMB 4S17A 1XQQA 1Z5SB 5G2NA 3P42A 3I9V1 4K7SA 4P7IA 1PGXA 4G3XB 1HQRD 2KT7A 3AECB 3AE6B 4HCNB 4YSYB 2KDBA 2LXAA 2QIEB 2KLGA 4RMAA 5G5GA 4YTPB 4WURA 3H6NA 4YT0B 3ZLZA 3I57A 3NZUA 4C56C 3KQ4A 1WXQA 1YN5A 4XYCA 4MEMA 4DHZB 4OHJA 3BINA 2AL6A 2BPSA 2W54A 1YX5B 1E7UA 4XWWA 1LM8B 1T5XD 4YL8A 4KZ0A 3NG0A 4WJOA 2BS3B 2D5GA 1VDVA 4KX6B 2EKEC 4W9FA 3AE1B 4ACFA 4WJQA 4FJZA 1WYGA 3SU8X 1F1HA 2M8SA 4MM3B 3V60A 1TY2A 1GOZA 2DYMA 1V86A 3N1XC 4TSSA 3VVWB 3C19A 2AWTA 1FEHA 3L10B 5LXHA 1TY0A 1UBIA 3M95A 2JU6X 3VR9B 1WJUA 4PYUA 1Y8RC 2LHDA 1XLQA 3P4QB 2NTTA 1MHXA 3ZRCA 2IZVB 4AQ7A 1WJ4A 1K8RB 2KDFB 2LWPA 2PVGC 2WHIA 3W9CB 2DAJA 4K1RB 2IYDB 2H88B 2MBQA 4K7WA 3ALBA 3HRDD 1TS4A 1GNUA 2INCC 2DNFA 3NZ3A 2IDYA 4N6EB 4DHZE 1IPGA 4RNAA 1VD2A 3AMZA 2LXCA 3AEBB 1V9JA 3RNEC 3UQBA 2KN4A 2CS4A 1P0RA 3UIPB 1WJ6A 2L7RA 4IDIA 3QCAA 2K1FA 4BOZB 1OTRB 1VJKA 2LJ5A 1YIWA 4JGHB 1QT9A 2BYEA 1I4XA 1QOFA 3VQIA 2AQ2B 3Q3NC 2M1MA 4OVZA 4BOSC 2KDMA 2WS3B 4MH8A 2KVRA 3IXSA 1N63A 1WSPA 3ZUNA 3ECIA 1YD8U 4EZLA 2DLBA 4HPMB 3NVYA 1P9DU 4JPSA 1SJED 2QHOA 3Q8FA 4K7UA 5GMVA 1ACCA 3DBHB 3IT6B 2PTLA 1VR9A 4KSLC 3Q6BA 1I4RA 4MELA 1IGDA 1T0QC 2DYBA 1JROA 1UZXB 2AYOB 4JL9A 4ZRKA 4WWPA 1I4PA 2JX5A 4FJVB 3TSSA 2K8BA 2MEKA 4AJYB 2CHXA 2KJ6A 2XK5B 1E8XA 4HLEA 3KLSX 3GE8C 1J7AA 3EUB2 2LMCA 4HWIB 1FXAA 5KHOA 2HE7A 2G4DB 5IO9A 4RGNA 2CU3A 2XBBC 1J7CA 1ZDVA 2IJ0A 3W1YA 1OQYA 2KFJA 2W3SA 4KGTA 3LXFA 2LASA 1C4PA 3X0WA 1FXTB 3AM9A 2NPTB 1EWYC 1TJEA 4D2KA 1LFDA 1M4VA 2ZEQA 3TIXA 3U7DA 4KGSA 3CSFA 1KLGD 4L2YA 4NQLB 1NVID 2PMVA 4KSKC 4US9A 3DBLI 4A6QA 3TJPA 2V4LA 2KKCA 4MJSB 2NBVB 3IAS1 1SE2A 4OVUA 1ISNA 3H9DA 4PS8A 1AW7A 2AQ1B 2PKOA 2JZ3B 1L4ZB 1DGJA 1V1PB 4X57B 2LJIA 4YTNB 2LRUA 2KQ4X 1I35A 1I7HA 1QOAA 2MHJA 2V0GA 5BYRA 3H8HA 2LUMA 2MJDA 5EE3A 3J9CA 3DBSA 3A9JB 3BVMA 4BFRA 4ZRQA 1ROEA 3W1SA 2RR9A 2JY6A 2CU1A 3AI5A 4N59A 1EO6A 2FUHB 5CHWA 1L0VB 5EDSA 3R66C 2CJOA 1ZKHA 2B3AA 3LJ3A 4MM3A 2NCNA 3AE2B 2ZW1A 3P4PB 2UWQA 4NAMA 3IBEA 3PHXB 4DXGA 4AJWA 4A55A 1ZPSA 1LGRA 1FNWA 4B9KA 5AEKB 1PGAA 5IN7A 1FNUA 3NHEB 2UU7A 2R2QA 2J0KA 5JHBA 4JE3B 1DYQA 2OJWA 3EECA 4URKA 2D10A 4RF0A 2IGGA 4W9DA 1TZOA 3U7ZA 4HJGE 1ZE3D 1FO4A 2PIAA 3Q2AC 1UBQA 3V05A 1FMAD 2ACZB 1KH0A 3PZ7A 2LHEA 2GBMA 1L5PA 2K25A 3DHGC 1E10A 2NVUI 2KLCA 3VAWA 2R2OA 3ZVVA 2J4XA 2BYVE 2XNAC 5E6NA 3VUYA 1V49A 1GG3A 1FIQA 2DENB 4FADA 4ANVA 5JXVA 4CQNA 2L76A 2D3AA 1GC6A 2BKFA 3M3JA 4IC7B 1WJNA 1L4DB 2MBEA 2FIDA 1G6JA 4IM2A 3A33B 2ASQA 3KYCD 4G11A 4KIKB 4IWOA 4LNOA 5FK9C 2IBIB 1R4MB 1TBEA 1QZEA 2LGIA 4FJYA 4LLGM 4FHKA 3VDZA 1OEYJ 1PFDA 3TL5A 4KKIA 2JWZA 1EF1A 4CHKA 1DOIA 3VXWA 3EGRA 2W9NA 1E0ZA 4MGYE 2I2YA 3A1QB 3ZNHB 2RDGA 3DVGY 2MW5A 2WXJA 1PDXA 1C76A 3OWEB 1GAQB 1GJZA 2FIFA 1TT5B 1P98A 1UH6A 2XK5A 3QIJA 1D3ZA 1WE7A 3RFZB 4BVUC 4ARCA 1J8CA 3RYTA 4L23A 3TMPB 2DHZA 1V2YA 3DBHI 2Z0EB 2J53A 3MHZA 1CZPA 1TIFA 3APDA 1IP9A 3H7PB 3RCZA 3ENEA 4O1NA 2KC2A 2ZJDA 3OLMD 3JW0X 3ZNGC 1KJTA 3VUWA 4L1BA 3RNCC 2WNMA 4BZAA 3L54A 3VFKA 1YQBA 4NAWB 4R3DA 5AZHA 5C23A 1T0RC 1RLFA 2HJ1A 5D7GA 3LB8C 2C7MB 4NJ6A 4P16A 2GOWA 4BKSA 1OQQA 2MP2B 2GRIA 2BWFA 2AX5A 3FKYA 3K9PB 2HDEA 5D94A 2C5LC 2WXHA 3HVDA 3UINB 4RM9A 2N1WA 3N32A 4MACA 3P63A 2VH2A 4MJSA 3AE3B 1LO5D 3MJWA 2WGSA 2LRWA 5AUKA 4GGQA 1TKYA 4RF1A 3RMKC 1CMXB 1A5RA 3AEFB 5H92C 4US8A 1V1PA 3V3XA 1N5WA 1OGWA 1YN4A 3KWLA 3JSVB 4XC2A 4II2B 4WAAA 3A9JA 4DWFA 3NVWA 2ZNVB 3TEZA 4XX5A 1WX9A 5IKCM 1KTKA 2BW2A 3BWUD 4ANXA 2C7NB 2WXLA 3HHMA 1YX6B 2RPVA 3ZNZB 1HZ6A 2IO3B 4HPLB 2QEJC 1NYRA 4A90A 5TSSA 1Y56A 1VZ6A 2G4SA 1X1MA 3MC0B 2DZMA 5HKHA 2INNE 3VH4B 4LCDE 1E7VA 3N9YC 4RGOS 2N9LA 1N62A 3TBLD 3KWVA 1Q1OA 3OAWA 1YMHE 2L05A 1RWSA 1V5OA 3OJ3A 4W9HA 3RD2A 4KVGB 2N7DA 2MBBB 2WLBA 4M8MA 1XO3A 3QA8A 5IA7A 1IGCA 2PEAA 4AWJA 1QKZA 1XD3B 4EKUA 2GBNA 2WXOA 2KMAA 2N9XA 5D2MB 3CF6E 3ZW3A 3L16A 1SSNA 1ZOYB 2M4NA 2N0SB 2O2VB 4WJPA 3AE4B 3P2BA 1FFVA 3A4SC 1WGDA 2N9PC 4GU2A 4HEA1 2A4ZA 3VTVA 1L6VA 2K22A 2YEPF 3B2FA 3JYUA 3NS1A 2LVOA 5MPOA 4FBJB 3U8ZA 1TS2A 4ZYSA 2JUOA 1MPEA 1T0SC 2DAFA 2BF8B 2CHWA 5CHFA 2C7HA 4KIKA 3N3KB 4TV3A 3PS6A 1QQRA 1IUEA 5AUIA 3K9OB 2BS2B 2ONQA 1QILA 5BYQA 2ZVNA 5C1ZA 3AE9B 2RPQA 1OEYA 1WGKA 2MLBA 3DWMA 3V61A 3VRBB 2BT6A 2I1KA 3ZRFA 1TTNA 1YNTE 2M56B 2V4IB 3A1QA 3OJ4B 2GLSA 2KTRB 2IPKD 3DVNV 1MJDA 2WX1A 1FNVA 3P4SB 1WFYA 2BGFA 2WXKA 3W1SC 5BYSA 3NVZA 5D6JB 2KYWA 1R4MI 4K81A 1YN3A 4XZ4A 2FCQA 2N7JA 1V5TA 3V6CB 3IHPC 2KACA 3H7PA 4EOYA 3AULA 2KMMA 1I4QA 1K51A 2K8CA 2O6VB 2DYOA 4NAWA 1EU3A 3RI7C 4J6IA 3SD5A 1V6EA 2FCSA 4WAFA 3RZWC 4PK1A 4EZKA 4NNJB 2ZCCA 3ETRA 3RZFA 4B0EA 1HXYD 1JRUA 4UDUC 2MP2A 2JF5A 2WXMA 2YVCA 2WYQA 3TCAA 2QMTA 2WDQB 1KLVA 1E7PB 1KOTA 4DQOC 4GB9A 2ZPYA 2JT4B 1PYWD 2G45B 4I6PA 1F52A 1WGRA 1WRDB 4GDLB 2ZPNA 1ZXIA 2WDRB 2KJHB 2FUG1 2OJRA 3SR6A 1XT9B 4DXAB 2IY0B 2L00B 2L52A 2J42A 2X8XX 4KV2A 1WXSA 2WXPA 1V97A 3X23A 1UGMA 2RMMA 1WXVA 2W3RA 2KXJA 1S1QB 3JSVA 4MDKE 1CQVA 4C7ZA 3AU4A 1HTOA 3IVFA 1IYFA 1UNSA 3Q8BA 2JRHA 3PTFC 1WF9A 5GXGB 4LDTB 2RDHA 2PE6B 1WXMA 3ZXRA 2WWZA 4ZRPA 3DHHC 4OVVA 4B0MA 3VH3B 2H89B 4M8NA 1BUIC 3AEAB 4JWUC 2NTSA 3BZDB 2INPE 2D2QA 2RSUA 1H8CA 3GZNB 3DBRB 3N20C 1EUVB 3QK0A 3FC4A 2NR2A 1NENB 2FCMA 4G0NB 2LGXA 4IOIE 4LJPB 4XE0A 1UWMA 2KAJA 3SEBA 1C78A 4BAXA 5HFYA 4DHJB 3E9SA 1SB3C 1XF5L 3TEWA 4XDDA 3HVZA 5L95C 2QDFA 1ENFA 2ON8A 4ANWA 3R8BA 3PT2B 1HE8A 3ZKJC 1N5XA 1WX7A 1HZ5A 2KVZA 3JVZX 3VHTC 1NEKB 1SJHD 2HTHA 1VZ7A 2W55A 4MSQB 1KLUD 4FN2A 1N60A 4WWOA 2O2VA 3M63B 2KWUB 3R3MA 2KOXA 3ZTCA 4A3OA 4LJOB 4B6WA 3DPDA 3KUZA 1OFFA 4WJNA 1YJ1A 2MH7A 2KN5A 2KDIA 4TUUA 1GB4A 1TS5A 1UD7A 2L83A 2E3TA 5I4DA 1XCTL 2GB1A 4PT5A 3GS2A 4JWSC 3AE7B 3AEGB 3AN1A 4M02A 3QX1A 2XEWA 5DPTA 3Q3OC 1RFAA 4GXBA 3BK1A 3C8YA 2I38A 4IW0A 3AXCA 2MQJA 3O65B 1LQBA 5JH5C 2J52A 1L6UA 3NY5A 1L7YA 2JYEA 1WGGA 4AP4C 4KDIC 4K3CA 3PZDA 2KTRA 1C79A 3CIRB 1FXIA 4PYZA 4AOFA 2JXTA 2DBYA 2ZVOA 4EEWA 2HD5B 4IG7B 1GB1A 3Q8EA 1HTQA 2KWDA 1TKEA 1JWBD 3B1LX 2ZZPB 3W2DA 4MT5A 2MJEA 2SAKA 1NI2A 1I4GA 4OZAA 3N30A 5CTRC 4Q2JA 3BIID 2Y5BB 4W9EA 2O6VA 2RGFA 3I3TB 2LZ6A 2WXIA 4DXFA 2L0TA 2K6DB 2WXNA 4JLCA 4RFBA 1YJJA 2NBUA 4GDKB 5FKAC 1F77A 2JPHA 1VLBA 1YQ4B 5EE1A 4IM0A 4MSMB 1VZ8A 2K9XA 3B2GA 4GN1A 2MA9B 2V3SA 1ZDXA 3QARA 2KD0A 1KF6B 4N58A 2NBWB 1UUPA 2G1EA 2RDBC 2WP9B 4ITKA 4HDOA 2BYTA 4GDLA 1PUTA 2LGDA 2Z8LA 3ZJTA 2FAZA 3DQVA 3HM3A 4CYEA 2BB5A 3KUDB 2FCNA 3V6EB 3AEEB 4ZRIA 5D3DA 4A9AA 2Q5WD 2DZIA 3PRMB 4HVBA 5LNK1 4HKQA 1WH3A 3AEDB 2D11A 4G50A 2OHFA 4NZLB 1L0XB 4TKNA 3RN9C 4C7YA 2WXFA 1AWDA 1P7EA 1SEBD 1PQSA 4K3BA 5G55A 2LD9A 2NMQA 4KZCA 2IO2B 5BMIA 2D3CA 3IG3A 1F2RI 1FPYA 3PVLA 1J19A 4MGIE 1NBFC 2MBOA 4ANUA 1H4RA 2LFIA 4LK0M 1JCKB 3LYYA 1M94A 3A4RA 2QCZA 2CJNA 3UI3A 3GB1A 1ZXHA 4TQ1A 1AARA 4W9CA 4YTMB 3ZO5B 2BYFA 3NS8A 2N9EB 3RUIB 2I1JA 3U30A 3ML8A 2Y3AA 3ZYYX 4YWGG 3EHVA 1SF0A 3EC8A 3FILB 4J3OD 1Z2MA 1JWSD 3UQAA 3ZGZA 4II3B 2WDVB 4LNNA 3AU5A 5DPWA 1EM7A 2G9HD 1YJIA 2DWQA 3GZNI 1BXTA 3DBRI 1MG8A 3PRZA 4E3CA 4LNIA 4GOCA 3HM6X 3CSTA 3FAHA 2RD0A 1Q5WB 3EFUA 1Q10A 3PZ8A 1B1ZA 1FD6A 3LDZE 4P1CC 1SXTA 3AH7A 1WXAA 2MX2A 3L13A 4TQ0A 2JYTA 1E8ZA 3VTUA 1E6EB 1FM0D 3QJZA 3ONSA 2BWES 3Q3FA 2GBJA 1IBXB 3B0AA 4M0WB 2KDEB 2REXA 3R2TA 1YQ3B 4RCOA 1E5WA 3W5VB 5JHAA 3I5JC 1WY8A 4PS7A 4YSXB 2K39A 1A70A 4DDGD 2AQ3B 2C60A 2PE9A 1WRIA 1I4HA 2QJLA 4W9KA 2J0JA 1JWAD 3WIMA 4AS1A 1SBBB 4OZBA 3NRZA 2AEHA 3APCA 3L4PA 4KDLB 1WMHB 1WE6A 2ZNVC 2UYZB 2JXXA 3Q14C 3WAMA 4YSZB 5IAAC 5E6PA 4BKSD 1R7SA 1YOVB 3IT4B 2C9WB 4KKJA 1J0GA 2Z0DB 2EKIA 4IM3A 3U2SC 4NQKE 2W82A 4C4VB 3QC8B 1C77A 2KQSA 5H8YE 4B95A 3Q69A 1XCQL 1C4AA 1NYQA 3HIZA 3MHSD 3MFGA 4HDQA 2MSED 4N9F4 4QAYA 1WIAA 4HPPA 1TKGA 4OW0A 3HUIA 4GDKA 1FFUA 3AE8B 2WDTB 2M17A 3E56A 1V8CA 5CX3A 1SGHA 4F8CB 2KHWB 3Q8AA 2BQQA 3NZSA 5TR5A 3WAPA 2LVPA 4FHJA 3VRAB 3GOEA 3IFWB 1ZGUB 2DX5B 1QOBA 4M00A 2FE8A 2KFKB 3VR8B 4ZYNA 3WA0A 3PV1A 1EF5A 2ZCBA 2PJHA 2LVQA 2ICIA 5DPRA 1JWMD 1WM3A 4HXDA 3V62A 2JQRB 2A5UA 1P3QU 1WX8A 4IUMB 3DDCB 1RRBA 4EE2A 3MTNB 3T9LA 4M01A 3GE3C 4NPNA 2LGYA 3DVNU 5BMGA 1E90A 3N1YC 4NJ7A 4HK2A 4E71A 1FCCC 1WGYA 3RNBC 1JWUD 1K50A 3TUOA 1C9FA 2JWUA 2B76B 1T6BX 3PPAA 2L1AA 3U4EG 3AB5A 1C3TA 3BY4B 2J0MA 3MC9A 2MJ3A 3ZXVA 4BBNC 1RYJA 3NUHB 3DOWA 2KJRA 4A3PA 1ZP0B 2VZKB 2IO1B 1C4CA 1SE3A 3T3NA 1P7FA 2IGDA 2LI5A 1N61A 3HK0A 3FILA 2D3GA 3NVVA 5FR3A 2EMTA 4TMAB 5T8IA 3APFA 1VRAB 5AZFA 1D5MC 1R4NI 1HEZE 1MVKA 1FRRA 3T8MA 1K52A 2CKHB 2NS5A 3KH0A 1F9JA 4WQMA 1K53A 4F7ZA 2SEBD 2KWVB 2PPHA 3QQ8B 1N6ZA 2L3ZA 4PS3A 1ET6A 2ZW0A 4C80A 3DCGA 3Q3MC 5DCNA 1V80A 4EUTA 2BTEA 4W9LA 1WGHA 2JRIB 1B9RA 3S2AA 1L0YB 1D5ZC 1IBXA 2K3UA 1WYWB 3RNGC 4LTUA 4M0WA 1ESFA 4NY0A 4HCPB 3TEXA 3B08A 2EELA 2G3QB 1F2RC 3IAM1 4RM8A 1D6EC 4IWQA 3NJTA 5L83A 3DVGX 3UGBB 3QWZB 3GP7A 1BMLC 4WQOB 2J7QB 1ET9A 2D3BA 5BO4B 1WMHA 3URYA 2KX0A 3T3OA 1SE9A 1MFWA 3WAOA 4DBGA 4XGAB 4FA6A 1FCLA 3D32A 3UIOB 1QLBB 2JZZA 3ZQ4A 3VUXA 1C1YB 4JQWC 4RGTA 3WALA 2KQ7A 5BMHA 1JW9D 1D5XC 4C4VA 1KRHA 2M0AA 3ZDTA 1SIFA 4FXCA 4E74A 2L0FA 4NJCA 2M19A 1MG4A 2Y5PA 2KC1A 1RM6C 2HJ8A 2AL3A
chains in the Genus database with same CATH topology
1PUTA 2Z8LA 3R2IA 1GPXA 3TEZA 2BB6A 3ZJTA 1KTKA 2BW2A 2FBWB 1TY0A 3SFEB 2JU6X 3BWUD 3VR9B 1SIJA 2BB5A 2LHDA 2WXLA 5EE0A 1XLQA 3P1MA 3P4QB 4XDCA 2NTTA 1QF6A 1MHXA 2RPVA 4RGMA 3AEEB 1HZ6A 4AQ7A 5D3DA 4A9AA 2Q5WD 1NYRA 2PVGC 2QEJC 4GLSC 3W9CB 3BYTB 4A90A 5LNK1 5TSSA 1Y56A 3PO0A 1VZ6A 2H88B 4HKQA 1NI3A 3AEDB 2WXRA 3MC0B 3HRDD 1TS4A 3SFDB 3NZ3A 2INNE 2IDYA 4N6EB 1XEEA 2BS4B 4ZHOA 2OHFA 4RNAA 5C3JB 3N9YC 4NZLB 3AMZA 1L0XB 3EA6A 4C7YA 3AEBB 4RGOS 2N9LA 2WXFA 1AWDA 1P7EA 1N62A 1SEBD 2KN4A 3KWVA 2PVOD 2WXGA 1EWCA 1YMHE 4HKZE 2NMQA 4OZCA 1J7BA 3MJ5A 1RWSA 5BMIA 4IDIA 1F2RI 1VJKA 2WLBA 1XO3A 1QT9A 1IGCA 2LFIA 3AV8A 1I4XA 4LK0M 1JCKB 1QOFA 1XLOA 1QKZA 3VQIA 2AQ2B 3BYYB 3LYYA 4OVZA 2KDMA 2R61A 1SE4A 2WS3B 2CJNA 2WXOA 4MH8A 3UI3A 3DWGC 1ZXHA 3GB1A 4TQ1A 1F0ZA 5D3IB 2PLPA 3IXSA 1N63A 1SSNA 1WSPA 1ZOYB 2E6XA 4YTMB 3BVZA 4HROA 2IGHA 2N0SB 1FRDA 3AE4B 2DLBA 1FFVA 3NVYA 4JPSA 2Y3AA 1SJED 2LEKA 3ZYYX 4YWGG 3Q8FA 4HEA1 1SF0A 1ACCA 1DOYA 3IT6B 3FILB 2PTLA 4J3OD 1L6VA 2K22A 2YEPF 3B2FA 1VR9A 3NS1A 1I4RA 5MPOA 1IGDA 1JWSD 4ZHPA 1KFYB 3ZGZA 1JROA 2WDVB 1TS2A 1EM7A 2G9HD 4ZYSA 1MPEA 1YJIA 2DWQA 1BXTA 1I4PA 2JX5A 4JX1C 2V3PA 4WWMA 3TSSA 2MEKA 1QQRA 1IUEA 3FAHA 3KLSX 2BS2B 4H2AA 2ONQA 1QILA 1RFKA 5AUIA 2GI9A 1J7AA 5BYQA 5C2TB 1Q10A 3EUB2 2LMCA 3PZ8A 1FXAA 1B1ZA 1FD6A 3AE9B 1SXTA 3AH7A 1ZUD2 4RGNA 1WGKA 4TQ0A 2CU3A 2JYTA 3DWMA 2N9KA 1J7CA 3VRBB 1ZDVA 2BT6A 2IJ0A 2W3SA 1YNTE 2M56B 2V4IB 4KGTA 1E6EB 2IPKD 1FM0D 3LXFA 1TYGB 1C4PA 1STEA 2TSSA 2Y5CA 1FNVA 3P4SB 2WXKA 3ABVB 3AM9A 5BYSA 1IBXB 1EWYC 3NVZA 1TJEA 4D2KA 3R2TA 4WIPA 1YQ3B 4RCOA 3W5VB 1UWXA 1XXGA 2WU2B 2BYTA 3RPFC 1M4VA 1AN8A 1YN3A 2N7JA 2BBCA 4YSXB 1A70A 4KGSA 2AQ3B 2KACA 1KLGD 1WRIA 4L2YA 1I4HA 2QJLA 3P4RB 1JWAD 1NVID 2PMVA 4US9A 4AS1A 2YEPB 1SBBB 4OZBA 4A6QA 2KMMA 3NRZA 1I4QA 1K51A 3L4PA 4RH6A 4YSZB 3IAS1 2DYOA 1SE2A 1R7SA 1EU3A 2QILA 3IT4B 1AW7A 4WAFA 4KKJA 2AQ1B 4YXDB 2PKOA 2EKIA 3U2SC 1L4ZB 3ETRA 4B0EA 1HXYD 4UDUC 1DGJA 3ZJUA 1D4BA 1V1PB 2W82A 2WXMA 1C77A 2QMTA 2WDQB 5H8YE 1E9MA 2LJIA 4YTNB 3Q69A 3W5UB 1XCQL 1C4AA 1NYQA 1E7PB 2KQ4X 1I7HA 1QOAA 3MFGA 4DQOC 2V0GA 3BK2A 2VZKD 5BYRA 3H8HA 2LUMA 2WU5B 4USAA 1PYWD 2MJDA 5EE3A 3J9CA 3BVMA 1QOGA 4ZRQA 1TKGA 1ROEA 4GDLB 3W1SA 1ZXIA 3WCQA 4OW0A 2WDRB 1AYFA 5HG2A 4XWTA 3HUIA 4N59A 2FUG1 3SR6A 1FFUA 3AE8B 2L52A 2J42A 3E56A 2WXQA 5EE9A 1V1OA 1HA5A 1L0VB 1V8CA 4WH4A 2WXPA 1JQ4A 1V97A 2CJOA 1XLPA 3Q8AA 2RMMA 1EU4A 2W3RA 3AE2B 2ZW1A 1CQVA 4C7ZA 3B9JA 3P4PB 4NAMA 3VRAB 4DXGA 1UNSA 3Q8BA 2K0PA 3ZJVA 2OEDA 1QOBA 4A55A 1ZPSA 3Q8CA 2FE8A 3U52E 5GXGB 3VR8B 1FNWA 4P6VF 3AE5B 2RDHA 1PGAA 1FNUA 4ZRPA 1MHHE 2PW9A 2V3NA 1CJEA 4B0MA 2H89B 4KGRA 2ICIA 5E6JA 1JWMD 1BUIC 4JE3B 1DYQA 2WQYB 3AEAB 4JWUC 2JZPA 4A8XC 2NTSA 4RF0A 3BZDB 2IGGA 1PGBA 2INPE 2JQRB 1TZOA 2QSDA 3U7ZA 4HJGE 1T3QA 1ZE3D 3BVGA 1FO4A 2PIAA 4EE2A 3V05A 1FMAD 2ACZB 1KH0A 3PZ7A 4REZA 2LHEA 1L5PA 3FC4A 5BMGA 1E10A 2XN9C 2X38A 1NENB 1XLNA 4IOIE 4XE0A 2J4XA 1UWMA 2XNAC 4IKGA 2KAJA 2JSVX 1FCCC 3SEBA 5HHDG 1C78A 1CK1A 1JWUD 5HFYA 1FIQA 4ARIA 1K50A 3TEYA 3TUOA 1C9FA 2L32A 2JWUA 3E9SA 2B76B 1SB3C 1XF5L 1T6BX 4XDDA 3TEWA 5JXVA 3HVZA 1DOXA 2L1AA 4CQNA 3U4EG 1ENFA 1JRPA 2ON8A 3AB5A 5G5HA 3R8BA 1N5XA 1HZ5A 1L4DB 1NEKB 1SJHD 2MJ3A 1VZ7A 1TS3A 2W55A 1RYJA 3NUHB 3O13A 1KLUD 1N60A 5FK9C 1ZP0B 2VZKB 1C4CA 1SE3A 3T3NA 1P7FA 2IGDA 1OFFA 2LGIA 4LLGM 1WWTA 1PFDA 2MH7A 1N61A 4KKIA 3FILA 1GB4A 1TS5A 2L83A 2E3TA 5I4DA 1XCTL 3NVVA 1UGJA 5FR3A 1DOIA 1MI0A 3EGRA 3MP9A 1E0ZA 5HI1A 2GB1A 2K5PA 1OQRA 4PT5A 4TMAB 5T8IA 2I2YA 2HTME 1JALA 2RDGA 3GS2A 1VRAB 4JWSC 1D5MC 2WXJA 1PDXA 3AE7B 3AEGB 1C76A 3OWEB 4HRSA 1GAQB 3AN1A 1HEZE 1MVKA 1FRRA 1K52A 3BK1A 3C8YA 2I38A 4ZOHC 1JMLA 3CWIA 4WQMA 1K53A 2SEBD 3P42A 3I9V1 3RFZB 2J52A 4ARCA 1L6UA 1PGXA 1HQRD 1ET6A 3AECB 4L23A 3AE6B 2J53A 2JYEA 2ZW0A 3MHZA 1CZPA 4C80A 4YSYB 4O1NA 1C79A 3CIRB 1FXIA 2BTEA 2JXTA 2QIEB 4L1BA 2DBYA 5G5GA 4YTPB 2WNMA 4WURA 1B9RA 4YT0B 1L0YB 1D5ZC 1IBXA 2K3UA 4NAWB 4R3DA 1GB1A 4LTUA 3Q8EA 4M0WA 3I57A 1ESFA 5D7GA 3LB8C 3TEXA 4C56C 2KWDA 2EELA 4P16A 1TKEA 1JWBD 3KQ4A 1F2RC 3IAM1 1WXQA 1D6EC 1YN5A 3W2DA 1OQQA 4OHJA 4MT5A 2GRIA 2MJEA 2SAKA 1I4GA 4OZAA 2AX5A 2HDEA 2W54A 2WXHA 3HVDA 4Q2JA 3GP7A 1BMLC 4MACA 3BIID 1ET9A 3P63A 2WXIA 3AE3B 1LO5D 4DXFA 2WXNA 5AUKA 4XWWA 3URYA 1T5XD 4RFBA 3T3OA 1TKYA 4RF1A 1YJJA 4GDKB 5FKAC 1FCLA 1QLBB 2BS3B 3AEFB 1F77A 2D5GA 1VDVA 4KX6B 3ZQ4A 3AE1B 1VLBA 1YQ4B 4RGTA 5EE1A 5H92C 4US8A 5BMHA 1JW9D 1VZ8A 1V1PA 1D5XC 1WYGA 2K9XA 3B2GA 1KRHA 3V3XA 2M0AA 1ZDXA 4MM3B 1N5WA 4FXCA 1TY2A 1GOZA 1YN4A 1KF6B 3KWLA 4NJCA 4N58A 2DYMA 1UUPA 2M19A 2G1EA 2WP9B 2Y5PA 4TSSA 4ITKA 1RM6C 1FEHA 3NVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWU D;  3RFZ B;  1ZE3 D;  4J3O D;  4B0E A;  1ZDX A;  4B0M A;  1ZDV A; 
#chains in the Genus database with same CATH topology
 1WZ3 A;  3R2I A;  1GPX A;  2BB6 A;  1TGZ B;  2FBW B;  5IP4 D;  2LUE A;  3SFE B;  3KVF B;  4HJK A;  1SIJ A;  3DHI C;  5EE0 A;  3P1M A;  4XDC A;  1QF6 A;  1GUA B;  4RGM A;  4S0R A;  4GLS C;  3UF8 A;  3BYT B;  4W9G A;  3PO0 A;  1NI3 A;  4IWP A;  2WXR A;  3SFD B;  4P1B C;  2KZR A;  1XEE A;  2BS4 B;  4ZHO A;  4F1S A;  5C3J B;  3EA6 A;  2KFK A;  3A9K B;  4ASW C;  4BKT A;  2PVO D;  2WXG A;  4JIO U;  1EWC A;  4HKZ E;  3OG5 A;  4OZC A;  1J7B A;  3MJ5 A;  3NOB A;  2MBH A;  2V1Y A;  5FR6 A;  3AV8 A;  4BBN F;  2VRR B;  4ZDV A;  1XLO A;  1NDD A;  1TZ1 A;  3BYY B;  4A20 A;  2R61 A;  1SE4 A;  3WCQ A;  3DWG C;  1F0Z A;  1WM2 A;  4FUL A;  5D3I B;  2PLP A;  3PLV A;  2GBK A;  2E6X A;  3BVZ A;  4HRO A;  2IGH A;  2N1V A;  2KX3 A;  1FRD A;  3ML9 A;  2LEK A;  1E8W A;  1DOY A;  4FLH A;  1ZW7 A;  4ZHP A;  1KFY B;  5E6O A;  2WX0 A;  3ZTD A;  2M0X A;  5LXI B;  4JX1 C;  2V3P A;  4WWM A;  1BT0 A;  4I6L B;  1WI0 A;  1I42 A;  4H2A A;  1RFK A;  2GI9 A;  2MWS B;  4GSW A;  5C2T B;  4GIV A;  3VTW A;  2GMI C;  1L2N A;  1ZUD 2;  4W9I A;  2VH1 A;  3H7S A;  2N9K A;  2JVC A;  2LGS A;  2KAN A;  2DZJ A;  3PLU A;  1TYG B;  3L08 A;  1STE A;  2KMC A;  2TSS A;  2Y5C A;  3ABV B;  2L8J A;  4MGK E;  2MRP A;  4WIP A;  1UWX A;  1XXG A;  2WU2 B;  3RPF C;  2GBR A;  1T0Y A;  1AN8 A;  3PRP B;  4MH0 E;  3L17 A;  2BBC A;  2CR5 A;  3SHQ A;  4DDI D;  4LNK A;  4WWN A;  4EZJ A;  5KHQ A;  3KW5 B;  2YLM A;  2IO0 B;  3P4R B;  2YEP B;  1Q0W B;  2EMS A;  4RH6 A;  3L0W B;  3Q3J A;  3MC8 A;  2QIL A;  2IY1 B;  2DZK A;  1P1A A;  5J18 A;  4YXD B;  1UF0 A;  3QAQ A;  3ZJU A;  1D4B A;  1E9M A;  2O6V D;  4MGZ E;  3W5U B;  5JZE B;  3R7R A;  2CHZ A;  3BK2 A;  2VZK D;  4LNF A;  2WU5 B;  4USA A;  4BKG A;  2BVC A;  1R4N B;  1QOG A;  1AYF A;  5HG2 A;  4XWT A;  3RNF C;  3ZDM C;  5EE9 A;  2WXQ A;  1V1O A;  1HA5 A;  4WH4 A;  1JQ4 A;  5IOI A;  2KWC A;  1XLP A;  1EU4 A;  3B9J A;  4ZRJ A;  4EFO A;  1VCB A;  2NPT A;  2K0P A;  5AZG A;  3ZJV A;  2OED A;  2QC8 A;  1U4A A;  3Q8C A;  3U52 E;  2V9H A;  4P6V F;  3AE5 B;  3M62 B;  3RT3 B;  3PSE B;  2K8H A;  1MHH E;  2PW9 A;  2V3N A;  5CHV C;  1CJE A;  4KGR A;  2N4F A;  5E6J A;  2MCN B;  4A8X C;  2WQY B;  4ICV A;  2JZP A;  2Z59 B;  1WZ0 A;  1PGB A;  2QSD A;  1T3Q A;  3BVG A;  5LLI A;  3R7Q A;  4LDT D;  2KO3 A;  2KTF A;  2BKR B;  1GC7 A;  4REZ A;  3KYD D;  4DK5 A;  2XN9 C;  2X38 A;  3A9K A;  4AUQ C;  1XLN A;  5DPS A;  2KK8 A;  4IKG A;  2JSV X;  5HHD G;  1CK1 A;  4ARI A;  3SDL C;  3TEY A;  1V81 A;  2FNJ B;  2L32 A;  1DOX A;  4CO7 A;  1JRP A;  5G5H A;  2KNB A;  2N7E A;  1UEL A;  1TS3 A;  3O13 A;  4I6N B;  3N1Z C;  2IND C;  3EFC A;  3I63 C;  3PRE A;  4DHJ D;  4W9J A;  3ZIM A;  3QHT A;  4GMV A;  1S3S G;  1E8Y A;  5J17 A;  1WWT A;  3WAN A;  3RUL A;  1UGJ A;  4ICU A;  1RAX A;  3PGE A;  3PHW B;  4C00 A;  1MI0 A;  1WR1 A;  3MP9 A;  1KM7 A;  1LXD A;  5HI1 A;  2K5P A;  1OQR A;  3KUC B;  2HTM E;  1JAL A;  2K6Q A;  3DBL B;  3C0R B;  5J2R A;  3RNA C;  4HRS A;  2OOB B;  2D07 B;  1WR6 E;  3H1U A;  4ZOH C;  1JML A;  3CWI A;  3ZNI D;  3CMM B;  4S17 A;  1XQQ A;  1Z5S B;  5G2N A;  3P42 A;  3I9V 1;  4K7S A;  4P7I A;  1PGX A;  4G3X B;  1HQR D;  2KT7 A;  3AEC B;  3AE6 B;  4HCN B;  4YSY B;  2KDB A;  2LXA A;  2QIE B;  2KLG A;  4RMA A;  5G5G A;  4YTP B;  4WUR A;  3H6N A;  4YT0 B;  3ZLZ A;  3I57 A;  3NZU A;  4C56 C;  3KQ4 A;  1WXQ A;  1YN5 A;  4XYC A;  4MEM A;  4DHZ B;  4OHJ A;  3BIN A;  2AL6 A;  2BPS A;  2W54 A;  1YX5 B;  1E7U A;  4XWW A;  1LM8 B;  1T5X D;  4YL8 A;  4KZ0 A;  3NG0 A;  4WJO A;  2BS3 B;  2D5G A;  1VDV A;  4KX6 B;  2EKE C;  4W9F A;  3AE1 B;  4ACF A;  4WJQ A;  4FJZ A;  1WYG A;  3SU8 X;  1F1H A;  2M8S A;  4MM3 B;  3V60 A;  1TY2 A;  1GOZ A;  2DYM A;  1V86 A;  3N1X C;  4TSS A;  3VVW B;  3C19 A;  2AWT A;  1FEH A;  3L10 B;  5LXH A;  1TY0 A;  1UBI A;  3M95 A;  2JU6 X;  3VR9 B;  1WJU A;  4PYU A;  1Y8R C;  2LHD A;  1XLQ A;  3P4Q B;  2NTT A;  1MHX A;  3ZRC A;  2IZV B;  4AQ7 A;  1WJ4 A;  1K8R B;  2KDF B;  2LWP A;  2PVG C;  2WHI A;  3W9C B;  2DAJ A;  4K1R B;  2IYD B;  2H88 B;  2MBQ A;  4K7W A;  3ALB A;  3HRD D;  1TS4 A;  1GNU A;  2INC C;  2DNF A;  3NZ3 A;  2IDY A;  4N6E B;  4DHZ E;  1IPG A;  4RNA A;  1VD2 A;  3AMZ A;  2LXC A;  3AEB B;  1V9J A;  3RNE C;  3UQB A;  2KN4 A;  2CS4 A;  1P0R A;  3UIP B;  1WJ6 A;  2L7R A;  4IDI A;  3QCA A;  2K1F A;  4BOZ B;  1OTR B;  1VJK A;  2LJ5 A;  1YIW A;  4JGH B;  1QT9 A;  2BYE A;  1I4X A;  1QOF A;  3VQI A;  2AQ2 B;  3Q3N C;  2M1M A;  4OVZ A;  4BOS C;  2KDM A;  2WS3 B;  4MH8 A;  2KVR A;  3IXS A;  1N63 A;  1WSP A;  3ZUN A;  3ECI A;  1YD8 U;  4EZL A;  2DLB A;  4HPM B;  3NVY A;  1P9D U;  4JPS A;  1SJE D;  2QHO A;  3Q8F A;  4K7U A;  5GMV A;  1ACC A;  3DBH B;  3IT6 B;  2PTL A;  1VR9 A;  4KSL C;  3Q6B A;  1I4R A;  4MEL A;  1IGD A;  1T0Q C;  2DYB A;  1JRO A;  1UZX B;  2AYO B;  4JL9 A;  4ZRK A;  4WWP A;  1I4P A;  2JX5 A;  4FJV B;  3TSS A;  2K8B A;  2MEK A;  4AJY B;  2CHX A;  2KJ6 A;  2XK5 B;  1E8X A;  4HLE A;  3KLS X;  3GE8 C;  1J7A A;  3EUB 2;  2LMC A;  4HWI B;  1FXA A;  5KHO A;  2HE7 A;  2G4D B;  5IO9 A;  4RGN A;  2CU3 A;  2XBB C;  1J7C A;  1ZDV A;  2IJ0 A;  3W1Y A;  1OQY A;  2KFJ A;  2W3S A;  4KGT A;  3LXF A;  2LAS A;  1C4P A;  3X0W A;  1FXT B;  3AM9 A;  2NPT B;  1EWY C;  1TJE A;  4D2K A;  1LFD A;  1M4V A;  2ZEQ A;  3TIX A;  3U7D A;  4KGS A;  3CSF A;  1KLG D;  4L2Y A;  4NQL B;  1NVI D;  2PMV A;  4KSK C;  4US9 A;  3DBL I;  4A6Q A;  3TJP A;  2V4L A;  2KKC A;  4MJS B;  2NBV B;  3IAS 1;  1SE2 A;  4OVU A;  1ISN A;  3H9D A;  4PS8 A;  1AW7 A;  2AQ1 B;  2PKO A;  2JZ3 B;  1L4Z B;  1DGJ A;  1V1P B;  4X57 B;  2LJI A;  4YTN B;  2LRU A;  2KQ4 X;  1I35 A;  1I7H A;  1QOA A;  2MHJ A;  2V0G A;  5BYR A;  3H8H A;  2LUM A;  2MJD A;  5EE3 A;  3J9C A;  3DBS A;  3A9J B;  3BVM A;  4BFR A;  4ZRQ A;  1ROE A;  3W1S A;  2RR9 A;  2JY6 A;  2CU1 A;  3AI5 A;  4N59 A;  1EO6 A;  2FUH B;  5CHW A;  1L0V B;  5EDS A;  3R66 C;  2CJO A;  1ZKH A;  2B3A A;  3LJ3 A;  4MM3 A;  2NCN A;  3AE2 B;  2ZW1 A;  3P4P B;  2UWQ A;  4NAM A;  3IBE A;  3PHX B;  4DXG A;  4AJW A;  4A55 A;  1ZPS A;  1LGR A;  1FNW A;  4B9K A;  5AEK B;  1PGA A;  5IN7 A;  1FNU A;  3NHE B;  2UU7 A;  2R2Q A;  2J0K A;  5JHB A;  4JE3 B;  1DYQ A;  2OJW A;  3EEC A;  4URK A;  2D10 A;  4RF0 A;  2IGG A;  4W9D A;  1TZO A;  3U7Z A;  4HJG E;  1ZE3 D;  1FO4 A;  2PIA A;  3Q2A C;  1UBQ A;  3V05 A;  1FMA D;  2ACZ B;  1KH0 A;  3PZ7 A;  2LHE A;  2GBM A;  1L5P A;  2K25 A;  3DHG C;  1E10 A;  2NVU I;  2KLC A;  3VAW A;  2R2O A;  3ZVV A;  2J4X A;  2BYV E;  2XNA C;  5E6N A;  3VUY A;  1V49 A;  1GG3 A;  1FIQ A;  2DEN B;  4FAD A;  4ANV A;  5JXV A;  4CQN A;  2L76 A;  2D3A A;  1GC6 A;  2BKF A;  3M3J A;  4IC7 B;  1WJN A;  1L4D B;  2MBE A;  2FID A;  1G6J A;  4IM2 A;  3A33 B;  2ASQ A;  3KYC D;  4G11 A;  4KIK B;  4IWO A;  4LNO A;  5FK9 C;  2IBI B;  1R4M B;  1TBE A;  1QZE A;  2LGI A;  4FJY A;  4LLG M;  4FHK A;  3VDZ A;  1OEY J;  1PFD A;  3TL5 A;  4KKI A;  2JWZ A;  1EF1 A;  4CHK A;  1DOI A;  3VXW A;  3EGR A;  2W9N A;  1E0Z A;  4MGY E;  2I2Y A;  3A1Q B;  3ZNH B;  2RDG A;  3DVG Y;  2MW5 A;  2WXJ A;  1PDX A;  1C76 A;  3OWE B;  1GAQ B;  1GJZ A;  2FIF A;  1TT5 B;  1P98 A;  1UH6 A;  2XK5 A;  3QIJ A;  1D3Z A;  1WE7 A;  3RFZ B;  4BVU C;  4ARC A;  1J8C A;  3RYT A;  4L23 A;  3TMP B;  2DHZ A;  1V2Y A;  3DBH I;  2Z0E B;  2J53 A;  3MHZ A;  1CZP A;  1TIF A;  3APD A;  1IP9 A;  3H7P B;  3RCZ A;  3ENE A;  4O1N A;  2KC2 A;  2ZJD A;  3OLM D;  3JW0 X;  3ZNG C;  1KJT A;  3VUW A;  4L1B A;  3RNC C;  2WNM A;  4BZA A;  3L54 A;  3VFK A;  1YQB A;  4NAW B;  4R3D A;  5AZH A;  5C23 A;  1T0R C;  1RLF A;  2HJ1 A;  5D7G A;  3LB8 C;  2C7M B;  4NJ6 A;  4P16 A;  2GOW A;  4BKS A;  1OQQ A;  2MP2 B;  2GRI A;  2BWF A;  2AX5 A;  3FKY A;  3K9P B;  2HDE A;  5D94 A;  2C5L C;  2WXH A;  3HVD A;  3UIN B;  4RM9 A;  2N1W A;  3N32 A;  4MAC A;  3P63 A;  2VH2 A;  4MJS A;  3AE3 B;  1LO5 D;  3MJW A;  2WGS A;  2LRW A;  5AUK A;  4GGQ A;  1TKY A;  4RF1 A;  3RMK C;  1CMX B;  1A5R A;  3AEF B;  5H92 C;  4US8 A;  1V1P A;  3V3X A;  1N5W A;  1OGW A;  1YN4 A;  3KWL A;  3JSV B;  4XC2 A;  4II2 B;  4WAA A;  3A9J A;  4DWF A;  3NVW A;  2ZNV B;  3TEZ A;  4XX5 A;  1WX9 A;  5IKC M;  1KTK A;  2BW2 A;  3BWU D;  4ANX A;  2C7N B;  2WXL A;  3HHM A;  1YX6 B;  2RPV A;  3ZNZ B;  1HZ6 A;  2IO3 B;  4HPL B;  2QEJ C;  1NYR A;  4A90 A;  5TSS A;  1Y56 A;  1VZ6 A;  2G4S A;  1X1M A;  3MC0 B;  2DZM A;  5HKH A;  2INN E;  3VH4 B;  4LCD E;  1E7V A;  3N9Y C;  4RGO S;  2N9L A;  1N62 A;  3TBL D;  3KWV A;  1Q1O A;  3OAW A;  1YMH E;  2L05 A;  1RWS A;  1V5O A;  3OJ3 A;  4W9H A;  3RD2 A;  4KVG B;  2N7D A;  2MBB B;  2WLB A;  4M8M A;  1XO3 A;  3QA8 A;  5IA7 A;  1IGC A;  2PEA A;  4AWJ A;  1QKZ A;  1XD3 B;  4EKU A;  2GBN A;  2WXO A;  2KMA A;  2N9X A;  5D2M B;  3CF6 E;  3ZW3 A;  3L16 A;  1SSN A;  1ZOY B;  2M4N A;  2N0S B;  2O2V B;  4WJP A;  3AE4 B;  3P2B A;  1FFV A;  3A4S C;  1WGD A;  2N9P C;  4GU2 A;  4HEA 1;  2A4Z A;  3VTV A;  1L6V A;  2K22 A;  2YEP F;  3B2F A;  3JYU A;  3NS1 A;  2LVO A;  5MPO A;  4FBJ B;  3U8Z A;  1TS2 A;  4ZYS A;  2JUO A;  1MPE A;  1T0S C;  2DAF A;  2BF8 B;  2CHW A;  5CHF A;  2C7H A;  4KIK A;  3N3K B;  4TV3 A;  3PS6 A;  1QQR A;  1IUE A;  5AUI A;  3K9O B;  2BS2 B;  2ONQ A;  1QIL A;  5BYQ A;  2ZVN A;  5C1Z A;  3AE9 B;  2RPQ A;  1OEY A;  1WGK A;  2MLB A;  3DWM A;  3V61 A;  3VRB B;  2BT6 A;  2I1K A;  3ZRF A;  1TTN A;  1YNT E;  2M56 B;  2V4I B;  3A1Q A;  3OJ4 B;  2GLS A;  2KTR B;  2IPK D;  3DVN V;  1MJD A;  2WX1 A;  1FNV A;  3P4S B;  1WFY A;  2BGF A;  2WXK A;  3W1S C;  5BYS A;  3NVZ A;  5D6J B;  2KYW A;  1R4M I;  4K81 A;  1YN3 A;  4XZ4 A;  2FCQ A;  2N7J A;  1V5T A;  3V6C B;  3IHP C;  2KAC A;  3H7P A;  4EOY A;  3AUL A;  2KMM A;  1I4Q A;  1K51 A;  2K8C A;  2O6V B;  2DYO A;  4NAW A;  1EU3 A;  3RI7 C;  4J6I A;  3SD5 A;  1V6E A;  2FCS A;  4WAF A;  3RZW C;  4PK1 A;  4EZK A;  4NNJ B;  2ZCC A;  3ETR A;  3RZF A;  4B0E A;  1HXY D;  1JRU A;  4UDU C;  2MP2 A;  2JF5 A;  2WXM A;  2YVC A;  2WYQ A;  3TCA A;  2QMT A;  2WDQ B;  1KLV A;  1E7P B;  1KOT A;  4DQO C;  4GB9 A;  2ZPY A;  2JT4 B;  1PYW D;  2G45 B;  4I6P A;  1F52 A;  1WGR A;  1WRD B;  4GDL B;  2ZPN A;  1ZXI A;  2WDR B;  2KJH B;  2FUG 1;  2OJR A;  3SR6 A;  1XT9 B;  4DXA B;  2IY0 B;  2L00 B;  2L52 A;  2J42 A;  2X8X X;  4KV2 A;  1WXS A;  2WXP A;  1V97 A;  3X23 A;  1UGM A;  2RMM A;  1WXV A;  2W3R A;  2KXJ A;  1S1Q B;  3JSV A;  4MDK E;  1CQV A;  4C7Z A;  3AU4 A;  1HTO A;  3IVF A;  1IYF A;  1UNS A;  3Q8B A;  2JRH A;  3PTF C;  1WF9 A;  5GXG B;  4LDT B;  2RDH A;  2PE6 B;  1WXM A;  3ZXR A;  2WWZ A;  4ZRP A;  3DHH C;  4OVV A;  4B0M A;  3VH3 B;  2H89 B;  4M8N A;  1BUI C;  3AEA B;  4JWU C;  2NTS A;  3BZD B;  2INP E;  2D2Q A;  2RSU A;  1H8C A;  3GZN B;  3DBR B;  3N20 C;  1EUV B;  3QK0 A;  3FC4 A;  2NR2 A;  1NEN B;  2FCM A;  4G0N B;  2LGX A;  4IOI E;  4LJP B;  4XE0 A;  1UWM A;  2KAJ A;  3SEB A;  1C78 A;  4BAX A;  5HFY A;  4DHJ B;  3E9S A;  1SB3 C;  1XF5 L;  3TEW A;  4XDD A;  3HVZ A;  5L95 C;  2QDF A;  1ENF A;  2ON8 A;  4ANW A;  3R8B A;  3PT2 B;  1HE8 A;  3ZKJ C;  1N5X A;  1WX7 A;  1HZ5 A;  2KVZ A;  3JVZ X;  3VHT C;  1NEK B;  1SJH D;  2HTH A;  1VZ7 A;  2W55 A;  4MSQ B;  1KLU D;  4FN2 A;  1N60 A;  4WWO A;  2O2V A;  3M63 B;  2KWU B;  3R3M A;  2KOX A;  3ZTC A;  4A3O A;  4LJO B;  4B6W A;  3DPD A;  3KUZ A;  1OFF A;  4WJN A;  1YJ1 A;  2MH7 A;  2KN5 A;  2KDI A;  4TUU A;  1GB4 A;  1TS5 A;  1UD7 A;  2L83 A;  2E3T A;  5I4D A;  1XCT L;  2GB1 A;  4PT5 A;  3GS2 A;  4JWS C;  3AE7 B;  3AEG B;  3AN1 A;  4M02 A;  3QX1 A;  2XEW A;  5DPT A;  3Q3O C;  1RFA A;  4GXB A;  3BK1 A;  3C8Y A;  2I38 A;  4IW0 A;  3AXC A;  2MQJ A;  3O65 B;  1LQB A;  5JH5 C;  2J52 A;  1L6U A;  3NY5 A;  1L7Y A;  2JYE A;  1WGG A;  4AP4 C;  4KDI C;  4K3C A;  3PZD A;  2KTR A;  1C79 A;  3CIR B;  1FXI A;  4PYZ A;  4AOF A;  2JXT A;  2DBY A;  2ZVO A;  4EEW A;  2HD5 B;  4IG7 B;  1GB1 A;  3Q8E A;  1HTQ A;  2KWD A;  1TKE A;  1JWB D;  3B1L X;  2ZZP B;  3W2D A;  4MT5 A;  2MJE A;  2SAK A;  1NI2 A;  1I4G A;  4OZA A;  3N30 A;  5CTR C;  4Q2J A;  3BII D;  2Y5B B;  4W9E A;  2O6V A;  2RGF A;  3I3T B;  2LZ6 A;  2WXI A;  4DXF A;  2L0T A;  2K6D B;  2WXN A;  4JLC A;  4RFB A;  1YJJ A;  2NBU A;  4GDK B;  5FKA C;  1F77 A;  2JPH A;  1VLB A;  1YQ4 B;  5EE1 A;  4IM0 A;  4MSM B;  1VZ8 A;  2K9X A;  3B2G A;  4GN1 A;  2MA9 B;  2V3S A;  1ZDX A;  3QAR A;  2KD0 A;  1KF6 B;  4N58 A;  2NBW B;  1UUP A;  2G1E A;  2RDB C;  2WP9 B;  4ITK A;  4HDO A;  2BYT A;  4GDL A;  1PUT A;  2LGD A;  2Z8L A;  3ZJT A;  2FAZ A;  3DQV A;  3HM3 A;  4CYE A;  2BB5 A;  3KUD B;  2FCN A;  3V6E B;  3AEE B;  4ZRI A;  5D3D A;  4A9A A;  2Q5W D;  2DZI A;  3PRM B;  4HVB A;  5LNK 1;  4HKQ A;  1WH3 A;  3AED B;  2D11 A;  4G50 A;  2OHF A;  4NZL B;  1L0X B;  4TKN A;  3RN9 C;  4C7Y A;  2WXF A;  1AWD A;  1P7E A;  1SEB D;  1PQS A;  4K3B A;  5G55 A;  2LD9 A;  2NMQ A;  4KZC A;  2IO2 B;  5BMI A;  2D3C A;  3IG3 A;  1F2R I;  1FPY A;  3PVL A;  1J19 A;  4MGI E;  1NBF C;  2MBO A;  4ANU A;  1H4R A;  2LFI A;  4LK0 M;  1JCK B;  3LYY A;  1M94 A;  3A4R A;  2QCZ A;  2CJN A;  3UI3 A;  3GB1 A;  1ZXH A;  4TQ1 A;  1AAR A;  4W9C A;  4YTM B;  3ZO5 B;  2BYF A;  3NS8 A;  2N9E B;  3RUI B;  2I1J A;  3U30 A;  3ML8 A;  2Y3A A;  3ZYY X;  4YWG G;  3EHV A;  1SF0 A;  3EC8 A;  3FIL B;  4J3O D;  1Z2M A;  1JWS D;  3UQA A;  3ZGZ A;  4II3 B;  2WDV B;  4LNN A;  3AU5 A;  5DPW A;  1EM7 A;  2G9H D;  1YJI A;  2DWQ A;  3GZN I;  1BXT A;  3DBR I;  1MG8 A;  3PRZ A;  4E3C A;  4LNI A;  4GOC A;  3HM6 X;  3CST A;  3FAH A;  2RD0 A;  1Q5W B;  3EFU A;  1Q10 A;  3PZ8 A;  1B1Z A;  1FD6 A;  3LDZ E;  4P1C C;  1SXT A;  3AH7 A;  1WXA A;  2MX2 A;  3L13 A;  4TQ0 A;  2JYT A;  1E8Z A;  3VTU A;  1E6E B;  1FM0 D;  3QJZ A;  3ONS A;  2BWE S;  3Q3F A;  2GBJ A;  1IBX B;  3B0A A;  4M0W B;  2KDE B;  2REX A;  3R2T A;  1YQ3 B;  4RCO A;  1E5W A;  3W5V B;  5JHA A;  3I5J C;  1WY8 A;  4PS7 A;  4YSX B;  2K39 A;  1A70 A;  4DDG D;  2AQ3 B;  2C60 A;  2PE9 A;  1WRI A;  1I4H A;  2QJL A;  4W9K A;  2J0J A;  1JWA D;  3WIM A;  4AS1 A;  1SBB B;  4OZB A;  3NRZ A;  2AEH A;  3APC A;  3L4P A;  4KDL B;  1WMH B;  1WE6 A;  2ZNV C;  2UYZ B;  2JXX A;  3Q14 C;  3WAM A;  4YSZ B;  5IAA C;  5E6P A;  4BKS D;  1R7S A;  1YOV B;  3IT4 B;  2C9W B;  4KKJ A;  1J0G A;  2Z0D B;  2EKI A;  4IM3 A;  3U2S C;  4NQK E;  2W82 A;  4C4V B;  3QC8 B;  1C77 A;  2KQS A;  5H8Y E;  4B95 A;  3Q69 A;  1XCQ L;  1C4A A;  1NYQ A;  3HIZ A;  3MHS D;  3MFG A;  4HDQ A;  2MSE D;  4N9F 4;  4QAY A;  1WIA A;  4HPP A;  1TKG A;  4OW0 A;  3HUI A;  4GDK A;  1FFU A;  3AE8 B;  2WDT B;  2M17 A;  3E56 A;  1V8C A;  5CX3 A;  1SGH A;  4F8C B;  2KHW B;  3Q8A A;  2BQQ A;  3NZS A;  5TR5 A;  3WAP A;  2LVP A;  4FHJ A;  3VRA B;  3GOE A;  3IFW B;  1ZGU B;  2DX5 B;  1QOB A;  4M00 A;  2FE8 A;  2KFK B;  3VR8 B;  4ZYN A;  3WA0 A;  3PV1 A;  1EF5 A;  2ZCB A;  2PJH A;  2LVQ A;  2ICI A;  5DPR A;  1JWM D;  1WM3 A;  4HXD A;  3V62 A;  2JQR B;  2A5U A;  1P3Q U;  1WX8 A;  4IUM B;  3DDC B;  1RRB A;  4EE2 A;  3MTN B;  3T9L A;  4M01 A;  3GE3 C;  4NPN A;  2LGY A;  3DVN U;  5BMG A;  1E90 A;  3N1Y C;  4NJ7 A;  4HK2 A;  4E71 A;  1FCC C;  1WGY A;  3RNB C;  1JWU D;  1K50 A;  3TUO A;  1C9F A;  2JWU A;  2B76 B;  1T6B X;  3PPA A;  2L1A A;  3U4E G;  3AB5 A;  1C3T A;  3BY4 B;  2J0M A;  3MC9 A;  2MJ3 A;  3ZXV A;  4BBN C;  1RYJ A;  3NUH B;  3DOW A;  2KJR A;  4A3P A;  1ZP0 B;  2VZK B;  2IO1 B;  1C4C A;  1SE3 A;  3T3N A;  1P7F A;  2IGD A;  2LI5 A;  1N61 A;  3HK0 A;  3FIL A;  2D3G A;  3NVV A;  5FR3 A;  2EMT A;  4TMA B;  5T8I A;  3APF A;  1VRA B;  5AZF A;  1D5M C;  1R4N I;  1HEZ E;  1MVK A;  1FRR A;  3T8M A;  1K52 A;  2CKH B;  2NS5 A;  3KH0 A;  1F9J A;  4WQM A;  1K53 A;  4F7Z A;  2SEB D;  2KWV B;  2PPH A;  3QQ8 B;  1N6Z A;  2L3Z A;  4PS3 A;  1ET6 A;  2ZW0 A;  4C80 A;  3DCG A;  3Q3M C;  5DCN A;  1V80 A;  4EUT A;  2BTE A;  4W9L A;  1WGH A;  2JRI B;  1B9R A;  3S2A A;  1L0Y B;  1D5Z C;  1IBX A;  2K3U A;  1WYW B;  3RNG C;  4LTU A;  4M0W A;  1ESF A;  4NY0 A;  4HCP B;  3TEX A;  3B08 A;  2EEL A;  2G3Q B;  1F2R C;  3IAM 1;  4RM8 A;  1D6E C;  4IWQ A;  3NJT A;  5L83 A;  3DVG X;  3UGB B;  3QWZ B;  3GP7 A;  1BML C;  4WQO B;  2J7Q B;  1ET9 A;  2D3B A;  5BO4 B;  1WMH A;  3URY A;  2KX0 A;  3T3O A;  1SE9 A;  1MFW A;  3WAO A;  4DBG A;  4XGA B;  4FA6 A;  1FCL A;  3D32 A;  3UIO B;  1QLB B;  2JZZ A;  3ZQ4 A;  3VUX A;  1C1Y B;  4JQW C;  4RGT A;  3WAL A;  2KQ7 A;  5BMH A;  1JW9 D;  1D5X C;  4C4V A;  1KRH A;  2M0A A;  3ZDT A;  1SIF A;  4FXC A;  4E74 A;  2L0F A;  4NJC A;  2M19 A;  1MG4 A;  2Y5P A;  2KC1 A;  1RM6 C;  2HJ8 A;  2AL3 A; 
#chains in the Genus database with same CATH homology
 1PUT A;  2Z8L A;  3R2I A;  1GPX A;  3TEZ A;  2BB6 A;  3ZJT A;  1KTK A;  2BW2 A;  2FBW B;  1TY0 A;  3SFE B;  2JU6 X;  3BWU D;  3VR9 B;  1SIJ A;  2BB5 A;  2LHD A;  2WXL A;  5EE0 A;  1XLQ A;  3P1M A;  3P4Q B;  4XDC A;  2NTT A;  1QF6 A;  1MHX A;  2RPV A;  4RGM A;  3AEE B;  1HZ6 A;  4AQ7 A;  5D3D A;  4A9A A;  2Q5W D;  1NYR A;  2PVG C;  2QEJ C;  4GLS C;  3W9C B;  3BYT B;  4A90 A;  5LNK 1;  5TSS A;  1Y56 A;  3PO0 A;  1VZ6 A;  2H88 B;  4HKQ A;  1NI3 A;  3AED B;  2WXR A;  3MC0 B;  3HRD D;  1TS4 A;  3SFD B;  3NZ3 A;  2INN E;  2IDY A;  4N6E B;  1XEE A;  2BS4 B;  4ZHO A;  2OHF A;  4RNA A;  5C3J B;  3N9Y C;  4NZL B;  3AMZ A;  1L0X B;  3EA6 A;  4C7Y A;  3AEB B;  4RGO S;  2N9L A;  2WXF A;  1AWD A;  1P7E A;  1N62 A;  1SEB D;  2KN4 A;  3KWV A;  2PVO D;  2WXG A;  1EWC A;  1YMH E;  4HKZ E;  2NMQ A;  4OZC A;  1J7B A;  3MJ5 A;  1RWS A;  5BMI A;  4IDI A;  1F2R I;  1VJK A;  2WLB A;  1XO3 A;  1QT9 A;  1IGC A;  2LFI A;  3AV8 A;  1I4X A;  4LK0 M;  1JCK B;  1QOF A;  1XLO A;  1QKZ A;  3VQI A;  2AQ2 B;  3BYY B;  3LYY A;  4OVZ A;  2KDM A;  2R61 A;  1SE4 A;  2WS3 B;  2CJN A;  2WXO A;  4MH8 A;  3UI3 A;  3DWG C;  1ZXH A;  3GB1 A;  4TQ1 A;  1F0Z A;  5D3I B;  2PLP A;  3IXS A;  1N63 A;  1SSN A;  1WSP A;  1ZOY B;  2E6X A;  4YTM B;  3BVZ A;  4HRO A;  2IGH A;  2N0S B;  1FRD A;  3AE4 B;  2DLB A;  1FFV A;  3NVY A;  4JPS A;  2Y3A A;  1SJE D;  2LEK A;  3ZYY X;  4YWG G;  3Q8F A;  4HEA 1;  1SF0 A;  1ACC A;  1DOY A;  3IT6 B;  3FIL B;  2PTL A;  4J3O D;  1L6V A;  2K22 A;  2YEP F;  3B2F A;  1VR9 A;  3NS1 A;  1I4R A;  5MPO A;  1IGD A;  1JWS D;  4ZHP A;  1KFY B;  3ZGZ A;  1JRO A;  2WDV B;  1TS2 A;  1EM7 A;  2G9H D;  4ZYS A;  1MPE A;  1YJI A;  2DWQ A;  1BXT A;  1I4P A;  2JX5 A;  4JX1 C;  2V3P A;  4WWM A;  3TSS A;  2MEK A;  1QQR A;  1IUE A;  3FAH A;  3KLS X;  2BS2 B;  4H2A A;  2ONQ A;  1QIL A;  1RFK A;  5AUI A;  2GI9 A;  1J7A A;  5BYQ A;  5C2T B;  1Q10 A;  3EUB 2;  2LMC A;  3PZ8 A;  1FXA A;  1B1Z A;  1FD6 A;  3AE9 B;  1SXT A;  3AH7 A;  1ZUD 2;  4RGN A;  1WGK A;  4TQ0 A;  2CU3 A;  2JYT A;  3DWM A;  2N9K A;  1J7C A;  3VRB B;  1ZDV A;  2BT6 A;  2IJ0 A;  2W3S A;  1YNT E;  2M56 B;  2V4I B;  4KGT A;  1E6E B;  2IPK D;  1FM0 D;  3LXF A;  1TYG B;  1C4P A;  1STE A;  2TSS A;  2Y5C A;  1FNV A;  3P4S B;  2WXK A;  3ABV B;  3AM9 A;  5BYS A;  1IBX B;  1EWY C;  3NVZ A;  1TJE A;  4D2K A;  3R2T A;  4WIP A;  1YQ3 B;  4RCO A;  3W5V B;  1UWX A;  1XXG A;  2WU2 B;  2BYT A;  3RPF C;  1M4V A;  1AN8 A;  1YN3 A;  2N7J A;  2BBC A;  4YSX B;  1A70 A;  4KGS A;  2AQ3 B;  2KAC A;  1KLG D;  1WRI A;  4L2Y A;  1I4H A;  2QJL A;  3P4R B;  1JWA D;  1NVI D;  2PMV A;  4US9 A;  4AS1 A;  2YEP B;  1SBB B;  4OZB A;  4A6Q A;  2KMM A;  3NRZ A;  1I4Q A;  1K51 A;  3L4P A;  4RH6 A;  4YSZ B;  3IAS 1;  2DYO A;  1SE2 A;  1R7S A;  1EU3 A;  2QIL A;  3IT4 B;  1AW7 A;  4WAF A;  4KKJ A;  2AQ1 B;  4YXD B;  2PKO A;  2EKI A;  3U2S C;  1L4Z B;  3ETR A;  4B0E A;  1HXY D;  4UDU C;  1DGJ A;  3ZJU A;  1D4B A;  1V1P B;  2W82 A;  2WXM A;  1C77 A;  2QMT A;  2WDQ B;  5H8Y E;  1E9M A;  2LJI A;  4YTN B;  3Q69 A;  3W5U B;  1XCQ L;  1C4A A;  1NYQ A;  1E7P B;  2KQ4 X;  1I7H A;  1QOA A;  3MFG A;  4DQO C;  2V0G A;  3BK2 A;  2VZK D;  5BYR A;  3H8H A;  2LUM A;  2WU5 B;  4USA A;  1PYW D;  2MJD A;  5EE3 A;  3J9C A;  3BVM A;  1QOG A;  4ZRQ A;  1TKG A;  1ROE A;  4GDL B;  3W1S A;  1ZXI A;  3WCQ A;  4OW0 A;  2WDR B;  1AYF A;  5HG2 A;  4XWT A;  3HUI A;  4N59 A;  2FUG 1;  3SR6 A;  1FFU A;  3AE8 B;  2L52 A;  2J42 A;  3E56 A;  2WXQ A;  5EE9 A;  1V1O A;  1HA5 A;  1L0V B;  1V8C A;  4WH4 A;  2WXP A;  1JQ4 A;  1V97 A;  2CJO A;  1XLP A;  3Q8A A;  2RMM A;  1EU4 A;  2W3R A;  3AE2 B;  2ZW1 A;  1CQV A;  4C7Z A;  3B9J A;  3P4P B;  4NAM A;  3VRA B;  4DXG A;  1UNS A;  3Q8B A;  2K0P A;  3ZJV A;  2OED A;  1QOB A;  4A55 A;  1ZPS A;  3Q8C A;  2FE8 A;  3U52 E;  5GXG B;  3VR8 B;  1FNW A;  4P6V F;  3AE5 B;  2RDH A;  1PGA A;  1FNU A;  4ZRP A;  1MHH E;  2PW9 A;  2V3N A;  1CJE A;  4B0M A;  2H89 B;  4KGR A;  2ICI A;  5E6J A;  1JWM D;  1BUI C;  4JE3 B;  1DYQ A;  2WQY B;  3AEA B;  4JWU C;  2JZP A;  4A8X C;  2NTS A;  4RF0 A;  3BZD B;  2IGG A;  1PGB A;  2INP E;  2JQR B;  1TZO A;  2QSD A;  3U7Z A;  4HJG E;  1T3Q A;  1ZE3 D;  3BVG A;  1FO4 A;  2PIA A;  4EE2 A;  3V05 A;  1FMA D;  2ACZ B;  1KH0 A;  3PZ7 A;  4REZ A;  2LHE A;  1L5P A;  3FC4 A;  5BMG A;  1E10 A;  2XN9 C;  2X38 A;  1NEN B;  1XLN A;  4IOI E;  4XE0 A;  2J4X A;  1UWM A;  2XNA C;  4IKG A;  2KAJ A;  2JSV X;  1FCC C;  3SEB A;  5HHD G;  1C78 A;  1CK1 A;  1JWU D;  5HFY A;  1FIQ A;  4ARI A;  1K50 A;  3TEY A;  3TUO A;  1C9F A;  2L32 A;  2JWU A;  3E9S A;  2B76 B;  1SB3 C;  1XF5 L;  1T6B X;  4XDD A;  3TEW A;  5JXV A;  3HVZ A;  1DOX A;  2L1A A;  4CQN A;  3U4E G;  1ENF A;  1JRP A;  2ON8 A;  3AB5 A;  5G5H A;  3R8B A;  1N5X A;  1HZ5 A;  1L4D B;  1NEK B;  1SJH D;  2MJ3 A;  1VZ7 A;  1TS3 A;  2W55 A;  1RYJ A;  3NUH B;  3O13 A;  1KLU D;  1N60 A;  5FK9 C;  1ZP0 B;  2VZK B;  1C4C A;  1SE3 A;  3T3N A;  1P7F A;  2IGD A;  1OFF A;  2LGI A;  4LLG M;  1WWT A;  1PFD A;  2MH7 A;  1N61 A;  4KKI A;  3FIL A;  1GB4 A;  1TS5 A;  2L83 A;  2E3T A;  5I4D A;  1XCT L;  3NVV A;  1UGJ A;  5FR3 A;  1DOI A;  1MI0 A;  3EGR A;  3MP9 A;  1E0Z A;  5HI1 A;  2GB1 A;  2K5P A;  1OQR A;  4PT5 A;  4TMA B;  5T8I A;  2I2Y A;  2HTM E;  1JAL A;  2RDG A;  3GS2 A;  1VRA B;  4JWS C;  1D5M C;  2WXJ A;  1PDX A;  3AE7 B;  3AEG B;  1C76 A;  3OWE B;  4HRS A;  1GAQ B;  3AN1 A;  1HEZ E;  1MVK A;  1FRR A;  1K52 A;  3BK1 A;  3C8Y A;  2I38 A;  4ZOH C;  1JML A;  3CWI A;  4WQM A;  1K53 A;  2SEB D;  3P42 A;  3I9V 1;  3RFZ B;  2J52 A;  4ARC A;  1L6U A;  1PGX A;  1HQR D;  1ET6 A;  3AEC B;  4L23 A;  3AE6 B;  2J53 A;  2JYE A;  2ZW0 A;  3MHZ A;  1CZP A;  4C80 A;  4YSY B;  4O1N A;  1C79 A;  3CIR B;  1FXI A;  2BTE A;  2JXT A;  2QIE B;  4L1B A;  2DBY A;  5G5G A;  4YTP B;  2WNM A;  4WUR A;  1B9R A;  4YT0 B;  1L0Y B;  1D5Z C;  1IBX A;  2K3U A;  4NAW B;  4R3D A;  1GB1 A;  4LTU A;  3Q8E A;  4M0W A;  3I57 A;  1ESF A;  5D7G A;  3LB8 C;  3TEX A;  4C56 C;  2KWD A;  2EEL A;  4P16 A;  1TKE A;  1JWB D;  3KQ4 A;  1F2R C;  3IAM 1;  1WXQ A;  1D6E C;  1YN5 A;  3W2D A;  1OQQ A;  4OHJ A;  4MT5 A;  2GRI A;  2MJE A;  2SAK A;  1I4G A;  4OZA A;  2AX5 A;  2HDE A;  2W54 A;  2WXH A;  3HVD A;  4Q2J A;  3GP7 A;  1BML C;  4MAC A;  3BII D;  1ET9 A;  3P63 A;  2WXI A;  3AE3 B;  1LO5 D;  4DXF A;  2WXN A;  5AUK A;  4XWW A;  3URY A;  1T5X D;  4RFB A;  3T3O A;  1TKY A;  4RF1 A;  1YJJ A;  4GDK B;  5FKA C;  1FCL A;  1QLB B;  2BS3 B;  3AEF B;  1F77 A;  2D5G A;  1VDV A;  4KX6 B;  3ZQ4 A;  3AE1 B;  1VLB A;  1YQ4 B;  4RGT A;  5EE1 A;  5H92 C;  4US8 A;  5BMH A;  1JW9 D;  1VZ8 A;  1V1P A;  1D5X C;  1WYG A;  2K9X A;  3B2G A;  1KRH A;  3V3X A;  2M0A A;  1ZDX A;  4MM3 B;  1N5W A;  4FXC A;  1TY2 A;  1GOZ A;  1YN4 A;  1KF6 B;  3KWL A;  4NJC A;  4N58 A;  2DYM A;  1UUP A;  2M19 A;  2G1E A;  2WP9 B;  2Y5P A;  4TSS A;  4ITK A;  1RM6 C;  1FEH A;  3NVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...