1ZE3D

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
116
Chain Sequence
b'DLYFNPRFLLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/structural/membrane protein
total genus 26
structure length 116
sequence length 125
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ze3D00
4B0MA 3RFZB 4J3OD 1ZDVA 1ZE3D 1ZDXA 3BWUD 4B0EA
chains in the Genus database with same CATH superfamily
1F1HA 2FCQA 2WXQA 3KYDD 5FR6A 2UU7A 2NBUA 1I4HA 4W9FA 5TR5A 3NHEB 1ACCA 1WGDA 3DHHC 4W9CA 1QOFA 2YLMA 3B1LX 4GDKB 4ACFA 4WH4A 4ASWC 1TTNA 2AEHA 4A20A 2QSDA 1WX9A 1I4XA 2K8BA 3A1QA 3L17A 5LXHA 3Q8BA 5AEKB 2LI5A 2MP2A 1ZOYB 1WXSA 3MTNB 2BWFA 2RPVA 3RT3B 2K25A 3HK0A 4JL9A 1ZUD2 4HROA 2J0JA 4RMAA 2XN9C 3ZNGC 2ZW0A 1B9RA 4GGQA 4HRSA 2INCC 3RNEC 3V05A 3J9CA 1QOGA 2LVOA 2LZ6A 2MW5A 3B9JA 3T9LA 3B08A 4LNFA 2XK5A 2PVOD 2GBJA 5JH5C 2MJDA 4OVUA 2KKCA 3N30A 2JF5A 2CS4A 2C7NB 1T6BX 1ET9A 2D2QA 1IBXB 1NVID 1A70A 3PGEA 2KO3A 3VR8B 1GC7A 2ZJDA 3NG0A 1TKEA 1PQSA 2WXPA 2VRRB 3AB5A 2GRIA 2J4XA 5KHQA 2K9XA 3R2IA 3W5VB 5AZHA 3VR9B 1AWDA 5LLIA 1TIFA 4FHJA 4NNJB 1VCBA 4BVUC 4AS1A 1HZ5A 4DXGA 2B76B 3FKYA 2K8CA 3B0AA 4LNOA 4GMVA 3I57A 3RMKC 2KTFA 4RM8A 2DYMA 1SJHD 3WANA 4XX5A 4DQOC 1OQYA 2LEKA 3N9YC 1NI3A 1C4PA 1UH6A 4N9F4 1QKZA 1AW7A 3T3OA 2JU6X 3VRBB 1A5RA 2B3AA 3B2GA 2VH2A 1GB1A 4RGMA 3BZDB 4HPMB 3PPAA 1J0GA 4WJNA 1CZPA 2N9EB 3L54A 3A9JB 4ICUA 2LVPA 3MC9A 2JX5A 1PYWD 2WXHA 1XCTL 3Q3NC 4M00A 2KQ7A 4K81A 3KW5B 3QCAA 3ZQ4A 1LO5D 4GDKA 4FHKA 3MHSD 2L8JA 1YQ3B 1JCKB 2JXTA 1UWXA 5JXVA 3N1YC 5L95C 2INNE 2M56B 4P16A 2XEWA 2INPE 2MA9B 3A4SC 4MEMA 1FPYA 2V1YA 3UGBB 4UDUC 2J53A 2UYZB 4F8CB 1I7HA 3WAOA 4AWJA 1I4PA 1L4DB 1OEYJ 3GE3C 1SXTA 1SE4A 5G2NA 4KGTA 2N7EA 2QC8A 2A5UA 2G45B 2MHJA 3NS8A 1XO3A 3LB8C 1OQRA 2CU3A 3EFCA 4GLSC 1N60A 3KVFB 3KYCD 2IDYA 1HXYD 4TUUA 2ZCCA 3HIZA 4LDTB 3P4SB 3AEGB 1Y56A 2CHWA 1B1ZA 1C79A 5IO9A 3CMMB 1V49A 1I42A 1OGWA 4FLHA 2BYTA 2BT6A 2G9HD 3ZVVA 2L76A 2SAKA 1QILA 2W54A 1BUIC 1YQ4B 1EWCA 2NTSA 2EMSA 1FM0D 2Y5CA 1WGKA 5DPWA 4LK0M 1T0SC 2L52A 4BFRA 5BMHA 2QMTA 4B9KA 5TSSA 3BK2A 3QWZB 2KXJA 2VZKD 3R66C 2BKFA 4NZLB 1RFKA 1E7UA 5CHFA 2A4ZA 4XZ4A 5FKAC 4HDQA 4NJ7A 2AYOB 1SIFA 4JQWC 4NQLB 2WDTB 3SEBA 1UUPA 2JWUA 3ZYYX 4YSZB 2KDBA 5BO4B 1C3TA 2NPTB 1E8WA 1WGRA 2TSSA 3IFWB 3HVDA 3CF6E 1YD8U 2MBQA 5HFYA 4A3PA 1WY8A 1R4MB 4P6VF 1N5XA 4XYCA 2IO0B 2IJ0A 2QIEB 3DBHB 1XT9B 3VDZA 1D5XC 3Q6BA 4GN1A 2HJ1A 4EFOA 4B95A 4F1SA 1TY0A 2QILA 2ZNVC 3QA8A 3JVZX 4ZRIA 1RAXA 2WXKA 1NEKB 2W55A 1NI2A 3JW0X 4FJZA 2DAFA 2JZPA 3DHGC 2LRWA 2CJNA 4HCNB 3APCA 4E74A 4JPSA 1QF6A 1FFUA 3RZWC 2EKEC 2KDEB 4LNKA 2UWQA 3LDZE 4WAFA 1KF6B 2L0TA 3BY4B 4MGIE 2K1FA 4BBNF 3P4PB 4LNNA 3NVVA 1XLOA 2K8HA 2ZCBA 4AUQC 1K8RB 2OHFA 3ZRCA 4OW0A 3MC8A 1L6VA 1UWMA 2PW9A 1JWAD 2LGSA 3RN9C 3OG5A 2M17A 2NCNA 1YX5B 2Z8LA 2M4NA 3DVNV 2KDFB 5D94A 2MSED 1YX6B 4BBNC 3SDLC 2KFKB 1IGCA 5E6OA 4KV2A 3M3JA 3A9KA 3RNCC 1GAQB 2EMTA 4KX6B 2XNAC 2QHOA 2N9KA 1LM8B 2PJHA 5FR3A 2V4IB 3UF8A 5E6NA 4A55A 1RLFA 2L7RA 1FCLA 1H8CA 2BW2A 1ISNA 4US9A 1WE6A 4IM0A 2D3GA 2KZRA 3PS6A 1F52A 4HDOA 3RNAC 4P1CC 3NZUA 2MJ3A 1WZ3A 1E6EB 1X1MA 3AV8A 4YL8A 3ZDMC 1ZE3D 4KKIA 3HRDD 1OTRB 4HWIB 2MBEA 4GB9A 3VUWA 1TS3A 1JWSD 1I35A 2C5LC 3VTUA 3UIPB 1FIQA 3V60A 2WLBA 1WZ0A 4CHKA 4DXAB 1TKYA 1WYWB 3RZFA 3QAQA 2N9PC 4C00A 2WDQB 2NPTA 2CHXA 3P4RB 5D6JB 1ZW7A 3PVLA 2KANA 2JZZA 2DLBA 3KUDB 2KWUB 1WWTA 1E8XA 5DCNA 3P1MA 3PLVA 4LNIA 3T8MA 5JHAA 4ZDVA 3TSSA 1P1AA 3WAPA 1P98A 3R3MA 2JXXA 4DHZB 2LASA 1YJ1A 4DBGA 3H7SA 2BF8B 5G55A 1D5MC 4EZLA 3TEZA 3VQIA 3Q8AA 2LGXA 2ZPNA 2DWQA 1PDXA 3OJ3A 1TBEA 3A4RA 3NZ3A 4FJYA 2ZVNA 4IC7B 4J6IA 2Q5WD 2KN5A 2RMMA 4RGNA 3PO0A 5AUKA 2DZJA 2AQ1B 1WXMA 4MDKE 2KAJA 2D3BA 1Z5SB 3AE1B 3VVWB 5JZEB 1KJTA 4FULA 1FRRA 1D6EC 2KJHB 3KUCB 4HJKA 4WWPA 4TMAB 3ML9A 1N61A 4HJGE 2L3ZA 2N9XA 3P2BA 3ZJUA 2WXGA 1E8ZA 1M4VA 4A90A 2KFKA 2N1WA 3NVWA 3Q8FA 5CHWA 1H4RA 1WJNA 4KZ0A 1E10A 1E0ZA 2WXRA 4OZAA 4MM3B 3AEDB 2INDC 3R7RA 3LJ3A 4ZRPA 2KVZA 1GOZA 1EUVB 4ZYNA 2AQ3B 4WQOB 3WAMA 2LUEA 2KC2A 3AECB 1WE7A 2JYTA 2I2YA 2BB5A 5G5HA 1D4BA 2FBWB 4D2KA 2K0PA 3RYTA 2V0GA 4FXCA 1SEBD 3MJWA 4QAYA 1V97A 1RYJA 3EA6A 1E8YA 1E90A 2LGYA 1UGJA 4ARCA 4RFBA 2I1KA 3LYYA 3O13A 4XWWA 2Y5BB 3UQBA 1N62A 4X57B 3TEWA 4G3XB 2JYEA 3N1ZC 3TCAA 2GLSA 4IM3A 2L83A 3N3KB 3DBLI 5D3IB 1SE2A 3RULA 1XF5L 1SE3A 4NY0A 1D3ZA 4ZRKA 1Q0WB 4XGAB 4XDCA 1FNWA 3QX1A 2ZEQA 2FCNA 2J7QB 3QC8B 4Q2JA 4PS8A 2KLGA 2OEDA 2ONQA 5AUIA 5C3JB 4AP4C 3KWVA 4ZHPA 3DBHI 3JYUA 1WRDB 1YJJA 2GBKA 3UQAA 5AZGA 3AXCA 4EEWA 1MI0A 1WSPA 2DBYA 4RGOS 4P1BC 1QQRA 4DHJD 2XBBC 3GOEA 2M0XA 4B0MA 3P4QB 1ZPSA 2MCNB 1VZ7A 2D07B 3ZKJC 1F9JA 4KZCA 2KN4A 2R61A 1MPEA 3V61A 5CX3A 3BVMA 2BYEA 2PLPA 5EE3A 2RPQA 1KFYB 2DYBA 1R4NB 2LHEA 1RM6C 5LNK1 1GB4A 4IWQA 3V3XA 2WXLA 1IP9A 3L13A 4LCDE 3CIRB 3AEBB 3N20C 4YT0B 1P9DU 1VR9A 1WIAA 4BOZB 4TV3A 2LJ5A 3KH0A 3MFGA 3D32A 3VAWA 3GE8C 2BS4B 3ZGZA 4BZAA 4MGZE 3H9DA 3RNBC 4NPNA 4DDGD 2QDFA 1WMHB 2PVGC 4TQ1A 2YVCA 4LLGM 4TQ0A 2D5GA 4MM3A 4HKQA 2LMCA 2KX3A 4EKUA 1ENFA 1L4ZB 3NZSA 2N1VA 4LJOB 1FCCC 3AN1A 1WX7A 5HG2A 4NJ6A 3P42A 2MWSB 3U7DA 3DBSA 2GBNA 2G3QB 4KVGB 1CQVA 1F2RC 4K7WA 3L08A 4WJPA 3DVNU 1N5WA 1V80A 1FXAA 5IN7A 1WRIA 5IA7A 1P0RA 5DPRA 1FEHA 2V3NA 3BK1A 1FNVA 2N4FA 3AU4A 4HXDA 4YTPB 4PYUA 2YEPB 4A8XC 3EUB2 1L5PA 1T0RC 2DAJA 3ONSA 5E6PA 1C9FA 1ET6A 3VTVA 4ANVA 2AX5A 3RNGC 3DDCB 2PEAA 1ZGUB 1DOIA 4PS7A 2CR5A 2R2QA 3RUIB 2BBCA 1JROA 3IAM1 4WURA 1QT9A 3RNFC 3L16A 4JWUC 3VUYA 3OJ4B 3V6CB 3A9KB 3H6NA 1VDVA 1FO4A 4CQNA 4FADA 2DX5B 1LXDA 3SD5A 3GZNB 2WHIA 1WGYA 3ZJVA 2KK8A 4C7YA 3BVGA 2J0MA 4WJOA 3Q3JA 3AMZA 1XLPA 2LXAA 4I6PA 2KMAA 4KSKC 2HJ8A 2BB6A 1PGXA 3BYYB 4L1BA 2ASQA 2Y3AA 4M0WB 2E6XA 1V1OA 4IM2A 2WX0A 2C7MB 1EO6A 2L32A 1RWSA 5DPTA 2JUOA 3FC4A 4JIOU 2RDGA 3U8ZA 2LFIA 2GBMA 4YTNB 2NVUI 4P7IA 1ZXHA 2W82A 1T0YA 2FIFA 5EE1A 1V2YA 5J18A 1WXAA 2MX2A 4WWMA 3ZRFA 4WWOA 1L2NA 1JW9D 4BKSA 2D10A 4IWOA 4IOIE 2BYVE 3HUIA 4RH6A 2PE9A 3ZNHB 2RSUA 3B2FA 4CO7A 2ZZPB 3I5JC 4C7ZA 4AJYB 3IHPC 4WIPA 4H2AA 1V81A 3VFKA 1V9JA 3DPDA 1C4CA 1XCQL 2IGDA 1WMHA 3ZTDA 2FNJB 3E9SA 1DOYA 2H88B 2W9NA 1MG8A 1QLBB 5D2MB 2J52A 4FJVB 2WDVB 1JWUD 2LGDA 4YSYB 4ARIA 1DYQA 1KLUD 3SHQA 4GDLB 3IVFA 3ZIMA 2KQSA 4W9EA 2OJRA 2JRHA 2MBHA 4IDIA 2JY6A 1EWYC 3VH3B 1K53A 2ZW1A 3APFA 3AULA 1UD7A 1OEYA 2HTHA 3FILA 3PRMB 1SB3C 1CJEA 2KACA 3HM3A 1V5TA 2MLBA 5J2RA 2NS5A 1ESFA 2WP9B 4PT5A 2SEBD 3VH4B 2GB1A 1ZXIA 1EU4A 5BYRA 1CK1A 1GC6A 1P7FA 3DHIC 4IW0A 4IWPA 1S1QB 2NBWB 5BMGA 1MHHE 2KMCA 3EHVA 1J19A 4I6LB 3ML8A 1KRHA 2EKIA 1F77A 2MBOA 2Z0DB 3IAS1 3DWMA 1Y8RC 2M1MA 3HM6X 4OZBA 1L0XB 1NYQA 4M01A 3TEXA 3Q3OC 1BMLC 1KOTA 2C9WB 2KOXA 1HZ6A 2RGFA 3C0RB 2Z0EB 2WXFA 3GP7A 4K7UA 4ZRQA 1M94A 2WWZA 2V3SA 1V1PB 1SE9A 3W9CB 2KTRB 4M0WA 2LWPA 4REZA 4RM9A 1QZEA 4MT5A 3IT6B 3QK0A 2BS2B 1YOVB 3PTFC 4NAWA 1AN8A 1WM2A 2DZMA 4RCOA 3PHWB 4MGKE 3IG3A 3Q3FA 4EZJA 1I4GA 4A9AA 4IUMB 1XQQA 3AE3B 2AQ2B 1UBIA 2MJEA 2VZKB 1V8CA 3QHTA 2LGIA 2LUMA 2M19A 3OAWA 2WU2B 2BWES 5L83A 4OZCA 2V4LA 1GUAB 1K51A 2O2VB 4II3B 1LFDA 3K9PB 3LXFA 4USAA 4WQMA 5GMVA 1HQRD 1MFWA 2KFJA 1XLQA 4K3CA 1QOAA 5MPOA 3MP9A 3CWIA 4MSMB 5C2TB 3CSFA 1JRPA 2WQYB 4MJSB 4M02A 4GDLA 1V6EA 4RNAA 4B6WA 5AZFA 1L7YA 3ZW3A 4W9JA 2L1AA 2Z59B 2R2OA 2N7DA 2N7JA 2HE7A 2IYDB 2NBVB 2Y5PA 4EOYA 1HEZE 1I4QA 1GPXA 2WGSA 3BIID 3TJPA 2WX1A 4FN2A 3ECIA 3ZO5B 4KIKB 1ZKHA 2ON8A 4DDID 1D5ZC 2IPKD 4N59A 3EGRA 3VHTC 2N9LA 4KGSA 2CJOA 2L0FA 1C76A 1SF0A 2LXCA 3W2DA 4HPLB 3NVYA 2WYQA 1TY2A 1FFVA 3PV1A 2BTEA 2WU5B 1HTQA 2FCMA 1AARA 3ABVB 3AU5A 4JX1C 4C80A 5J17A 1XEEA 3ETRA 3TIXA 2DZKA 4HEA1 4JLCA 3AE2B 1UF0A 1K50A 3VXWA 3RD2A 4R3DA 4II2B 1V1PA 3GZNI 2C7HA 3KLSX 3AEEB 2KTRA 1VD2A 1YMHE 3MC0B 1ZDXA 1WX8A 2FUHB 3EECA 1E7VA 4JGHB 2FAZA 4PK1A 4IG7B 2WXMA 3ENEA 1MHXA 4BKGA 1AYFA 4RGTA 1L0YB 1TZOA 1S3SG 4J3OD 3JSVB 2EELA 2VH1A 4MH8A 5D7GA 2D3CA 3SFDB 1F2RI 1YN3A 4YSXB 3ZXVA 2K6QA 1TKGA 3AE9B 1WXVA 2LHDA 3Q69A 1RFAA 4LDTD 3SU8X 1ROEA 2IZVB 1YQBA 1FXTB 1YN4A 5DPSA 2JRIB 2NMQA 2WNMA 2ZPYA 1EU3A 4O1NA 4DHZE 3AM9A 4HKZE 2LVQA 4HK2A 1PGAA 4KKJA 1CMXB 1C1YB 2V9HA 4W9IA 1SJED 4XWTA 4MH0E 2O2VA 3QIJA 3W5UB 2BPSA 2BYFA 3QJZA 2KYWA 1C77A 1OQQA 1WH3A 2KDIA 2KT7A 1DGJA 2WXOA 1P7EA 3W1SA 2IY0B 3E56A 3PRZA 1R4MI 2BQQA 1IYFA 1WJUA 4XC2A 4HVBA 4XDDA 5IP4D 2IGHA 3SR6A 4K3BA 2O6VB 4GIVA 4W9DA 1J8CA 2YEPF 4MJSA 3M63B 4M8NA 2MRPA 4E3CA 4F7ZA 2HDEA 3BYTB 1T5XD 3X23A 3DVGY 1G6JA 2KNBA 3HVZA 1HTOA 4KGRA 3Q3MC 1TS4A 5C23A 1JMLA 2AL3A 2AWTA 5CHVC 1KLGD 1GJZA 3PZ8A 5KHOA 3H8HA 3AE4B 3NRZA 4IKGA 4PS3A 2MBBB 4BOSC 4KIKA 2K39A 3GB1A 2DNFA 3DVGX 2DHZA 5D3DA 3V6EB 3H1UA 4GU2A 3I63C 3NJTA 1STEA 4M8MA 4FBJB 1QOBA 5T8IA 3DBRB 3GS2A 3W1YA 1EF5A 2G4DB 4S0RA 4AOFA 2RDBC 2DYOA 1Q1OA 4A6QA 3PRPB 1PUTA 3K9OB 4OHJA 2CKHB 4XE0A 2E3TA 3AI5A 1FXIA 3Q14C 2D11A 1TZ1A 4C4VB 4K7SA 3FAHA 2PIAA 3ALBA 1JRUA 3C8YA 3Q8EA 1T0QC 2WXIA 4DK5A 4YXDB 1BT0A 1XD3B 3C19A 2QCZA 1NBFC 2JSVX 2IO2B 1JWMD 1J7CA 1T3QA 4E71A 1FMAD 3QQ8B 1WR1A 2K3UA 1IGDA 4JWSC 2D3AA 1FD6A 3R7QA 3I9V1 4YWGG 3AH7A 4W9KA 1FRDA 3BINA 4ANUA 3JSVA 1RRBA 2W3SA 5CTRC 4KDLB 3FILB 4HCPB 4K1RB 3L0WB 2JPHA 5BMIA 3PHXB 4GOCA 1K52A 5C1ZA 2BGFA 2I38A 3AE8B 2KQ4X 1WYGA 2QJLA 3PZ7A 4L2YA 2LJIA 1I4RA 2BKRB 5IOIA 1Z2MA 3NS1A 3BWUD 3AEFB 1SGHA 5EE9A 3TEYA 1E9MA 2BVCA 4OVZA 1C4AA 1L0VB 1VLBA 2FIDA 1KM7A 1TS5A 5FK9C 2O6VA 1ZP0B 2RR9A 3ZTCA 3VTWA 4FA6A 3IT4B 4EUTA 3DQVA 3M62B 1NYRA 1WI0A 4URKA 1IBXA 4YTMB 3ZNZB 2WXNA 1SSNA 1EM7A 4RF0A 3U7ZA 2K6DB 2K22A 3RPFC 1E5WA 3V62A 3OLMD 3ZUNA 4NQKE 2KWDA 2N0SB 2GOWA 2IGGA 2HD5B 2KMMA 4NAWB 3H7PB 1OFFA 1VZ6A 1YNTE 4WJQA 2I1JA 1LGRA 1VZ8A 2KDMA 5HHDG 2PTLA 5BYQA 1JQ4A 4GXBA 2L00B 5HI1A 3L10B 1TYGB 2IO1B 4DHJB 2LRUA 3M95A 1LQBA 4W9GA 1UNSA 4W9HA 1U4AA 2J42A 1WXQA 4US8A 4HPPA 1YIWA 3TL5A 3ZXRA 4AJWA 3URYA 1MVKA 2MH7A 1ZDVA 4PYZA 1WGGA 4ANWA 1V86A 2C60A 5H92C 3DBLB 4LJPB 1V5OA 3L4PA 4C4VA 1IPGA 2PE6B 3Q8CA 1UELA 1YN5A 1WGHA 4MSQB 3A9JA 2L05A 3NVZA 4ICVA 1WR6E 3ZJTA 4RF1A 3PLUA 1GNUA 1UBQA 3NUHB 4G50A 4TKNA 4OVVA 3I3TB 2IBIB 5EDSA 1VJKA 3OWEB 4S17A 1NDDA 2DZIA 2GMIC 3WCQA 4B0EA 2LD9A 4ZHOA 2G1EA 2PMVA 4DWFA 4G11A 4KDIC 2WXJA 1P3QU 2WDRB 3SFEB 3WA0A 2PKOA 2IO3B 5I4DA 2JZ3B 2FE8A 2J0KA 2CU1A 4W9LA 1PGBA 3W1SC 1BXTA 2ZVOA 2KLCA 1KH0A 4ZRJA 5LXIB 1NENB 3DOWA 2AL6A 4I6NB 1GG3A 3DWGC 4HLEA 4A3OA 3NOBA 1C78A 5H8YE 2HTME 3VUXA 3IBEA 1VRAB 1TGZB 2M0AA 4EZKA 1XXGA 2GBRA 4KSLC 1WJ4A 1SIJA 4WWNA 4CYEA 2KHWB 4DXFA 3WIMA 1TS2A 1J7AA 3APDA 1XLNA 3AE6B 5E6JA 3RCZA 2ZNVB 2MEKA 3H7PA 1YJIA 2H89B 2KWCA 1FNUA 2KD0A 3U30A 3ZLZA 1DOXA 1L6UA 3PZDA 2G4SA 3A1QB 2JT4B 2OJWA 3AE7B 1WF9A 2RD0A 2MP2B 4N58A 2K5PA 2KC1A 3N32A 4EE2A 5JHBA 1R4NI 1JALA 3PSEB 3UINB 3RFZB 3T3NA 4ITKA 3N1XC 1IUEA 3DBRI 2RDHA 4ANXA 2FUG1 4GSWA 1PFDA 4N6EB 3S2AA 3EFUA 2WS3B 2NTTA 3TBLD 1N63A 1JWBD 2O6VD 2DENB 4AQ7A 1SBBB 3CSTA 4L23A 1F0ZA 2XK5B 3U52E 1UGMA 5IAAC 3QARA 4LTUA 3AEAB 2JQRB 1J7BA 4ZYSA 1WJ6A 1WFYA 4NJCA 2V3PA 3HHMA 3DCGA 2W3RA 3R8BA 2KJRA 4WAAA 5GXGB 1HA5A 4MGYE 4MACA 3IXSA 1MJDA 4BAXA 5EE0A 3EC8A 2M8SA 2REXA 2FCSA 1R7SA 2KJ6A 4C56C 1UZXB 2ICIA 1KLVA 3O65B 3TUOA 5G5GA 1N6ZA 4BKSD 3MJ5A 3UI3A 3X0WA 3Q2AC 3P63A 1EF1A 2KWVB 3U2SC 3TMPB 2KX0A 2BS3B 3KQ4A 3KUZA 2ACZB 2MQJA 5BYSA 2X38A 4ZOHC 2JVCA 4TSSA 1TT5B 5HKHA 3RI7C 2CHZA 2GI9A 3ZNID 3AE5B 3VRAB 2IY1B 3PREA 4NAMA 2JWZA 2PPHA 2OOBB 1TJEA 5IKCM 2X8XX 1WM3A 3U4EG 3KWLA 3PT2B 4BKTA 3A33B 3R2TA 1E7PB 4MELA 3BVZA 1Q10A 3MHZA 1Q5WB 2NR2A 4JE3B 3NY5A 3ZDTA 4G0NB 2QEJC 3WALA 1KTKA 1MG4A 2KVRA 1HE8A 3UIOB
chains in the Genus database with same CATH topology
4OHJA 2WXQA 3AV8A 4XE0A 1I4HA 2E3TA 1FXIA 1ZE3D 4KKIA 4WWMA 3HRDD 1JW9D 4IOIE 3HUIA 4RH6A 1ACCA 1TS3A 3FAHA 1JWSD 3B2FA 2PIAA 4C7ZA 1QOFA 3C8YA 4GDKB 3Q8EA 4WH4A 2WXIA 1FIQA 4WIPA 4YXDB 4H2AA 2WLBA 2QSDA 1I4XA 1C4CA 2JSVX 1TKYA 3Q8BA 2WDQB 1XCQL 1JWMD 1J7CA 1T3QA 2IGDA 3P4RB 1FMAD 1ZOYB 2K3UA 3E9SA 2RPVA 2DLBA 1DOYA 2H88B 1IGDA 4JWSC 1FD6A 3I9V1 4YWGG 1WWTA 1ZUD2 1QLBB 4HROA 3AH7A 1FRDA 2XN9C 2J52A 3P1MA 2ZW0A 2W3SA 1B9RA 2WDVB 3FILB 4HRSA 1JWUD 4YSYB 3TSSA 4ARIA 1DYQA 1KLUD 3V05A 3J9CA 1QOGA 5BMIA 4GDLB 3B9JA 4IDIA 1K52A 1EWYC 1K53A 2PVOD 2I38A 2ZW1A 2MJDA 3AE8B 2KQ4X 1WYGA 3FILA 2QJLA 3PZ7A 4L2YA 2LJIA 1I4RA 1SB3C 1CJEA 2KACA 1D5MC 3BWUD 3AEFB 3NS1A 3TEZA 3VQIA 3Q8AA 1T6BX 1ET9A 2WP9B 1ESFA 5EE9A 2DWQA 1PDXA 3TEYA 4PT5A 2SEBD 1E9MA 1IBXB 3NZ3A 4OVZA 1C4AA 1L0VB 1A70A 1NVID 1VLBA 2GB1A 2Q5WD 1ZXIA 1EU4A 5BYRA 1CK1A 2RMMA 4RGNA 1TS5A 3VR8B 3PO0A 5FK9C 5AUKA 1P7FA 2AQ1B 1ZP0B 1TKEA 2KAJA 2WXPA 5BMGA 3IT4B 1MHHE 3AB5A 2GRIA 3AE1B 2J4XA 1NYRA 2K9XA 1IBXA 3R2IA 4YTMB 1FRRA 1D6EC 3W5VB 2WXNA 1KRHA 2EKIA 1F77A 1SSNA 3VR9B 1EM7A 3IAS1 4RF0A 3DWMA 3U7ZA 2K22A 1AWDA 3RPFC 4OZBA 1L0XB 4TMAB 1NYQA 3TEXA 1BMLC 1N61A 4AS1A 4HJGE 2KWDA 2N0SB 1HZ6A 1HZ5A 4DXGA 2IGGA 3ZJUA 2B76B 2WXGA 3GP7A 2KMMA 2WXFA 4ZRQA 4NAWB 1M4VA 1OFFA 1VZ6A 4A90A 3NVWA 3Q8FA 1V1PB 1YNTE 3I57A 3W9CB 2DYMA 1SJHD 1VZ8A 2KDMA 4M0WA 5HHDG 2PTLA 1E10A 4DQOC 1E0ZA 4REZA 5BYQA 4MT5A 1JQ4A 2WXRA 2LEKA 3N9YC 5HI1A 1TYGB 1NI3A 1C4PA 1QKZA 4OZAA 1AW7A 3IT6B 3T3OA 2JU6X 3VRBB 4MM3B 3AEDB 1UNSA 2BS2B 2J42A 3B2GA 1GB1A 1WXQA 4RGMA 1AN8A 3BZDB 4US8A 4ZRPA 1CZPA 1GOZA 4RCOA 3URYA 1MVKA 2AQ3B 2MH7A 1ZDVA 2JX5A 3AECB 1PYWD 2WXHA 1XCTL 2JYTA 5H92C 1I4GA 2BB5A 2I2YA 4A9AA 5G5HA 1D4BA 2FBWB 3L4PA 3AE3B 4D2KA 2AQ2B 2K0PA 2MJEA 2VZKB 2V0GA 3ZQ4A 1LO5D 1V8CA 3Q8CA 4FXCA 1SEBD 2LGIA 2LUMA 2M19A 1YQ3B 1V97A 1JCKB 1RYJA 1YN5A 2JXTA 2WU2B 3EA6A 4OZCA 1UWXA 5JXVA 1UGJA 4ARCA 4RFBA 1K51A 3LYYA 3NVZA 3O13A 2INNE 2M56B 4XWWA 4P16A 3LXFA 4RF1A 3ZJTA 4USAA 2INPE 1N62A 3TEWA 2JYEA 4WQMA 3NUHB 1HQRD 4UDUC 2J53A 1I7HA 1XLQA 2L83A 1I4PA 1L4DB 1QOAA 1VJKA 5MPOA 3OWEB 1SXTA 5D3IB 3MP9A 3CWIA 1SE4A 1SE2A 5C2TB 1JRPA 1XF5L 4KGTA 2WQYB 1SE3A 4RNAA 4XDCA 1XO3A 3WCQA 1FNWA 4B0EA 2L1AA 3LB8C 1OQRA 4Q2JA 2N7JA 2CU3A 4GLSC 1N60A 2IDYA 2G1EA 1HXYD 2OEDA 2PMVA 2ONQA 5AUIA 4ZHOA 5C3JB 3KWVA 4ZHPA 3P4SB 2Y5PA 1HEZE 1I4QA 3AEGB 1YJJA 1GPXA 1Y56A 2WXJA 2WDRB 1B1ZA 3SFEB 3BIID 1C79A 2PKOA 1MI0A 1WSPA 2DBYA 5I4DA 2FE8A 4RGOS 2ON8A 1D5ZC 2IPKD 1PGBA 4N59A 1QQRA 1BXTA 2BYTA 3EGRA 1KH0A 2BT6A 2N9LA 4KGSA 2CJOA 2G9HD 4B0MA 2SAKA 1C76A 1SF0A 1QILA 3P4QB 3W2DA 2W54A 1BUIC 1YQ4B 1EWCA 1NENB 1ZPSA 2NTSA 1VZ7A 3NVYA 1FM0D 3DWGC 2Y5CA 2KN4A 1WGKA 2R61A 1TY2A 4LK0M 2L52A 1C78A 1MPEA 5H8YE 1FFVA 3BVMA 5BMHA 2HTME 2PLPA 5EE3A 2BTEA 1VRAB 2WU5B 2M0AA 2QMTA 1KFYB 1XXGA 5TSSA 2LHEA 3ABVB 3BK2A 4JX1C 4C80A 1RM6C 2VZKD 1SIJA 5LNK1 1GB4A 1XEEA 4DXFA 3V3XA 2WXLA 3ETRA 4NZLB 1TS2A 3CIRB 3AEBB 1RFKA 1J7AA 1XLNA 3AE6B 4HEA1 4YT0B 3AE2B 5E6JA 5FKAC 1VR9A 2MEKA 1K50A 1YJIA 4R3DA 2H89B 1V1PA 1FNUA 3KLSX 3AEEB 3MFGA 1DOXA 1L6UA 2BS4B 1UUPA 1YMHE 1ZDXA 2JWUA 3MC0B 3SEBA 3ZYYX 3ZGZA 3AE7B 4YSZB 2TSSA 2WXMA 2PVGC 4TQ1A 1MHXA 4LLGM 1AYFA 2D5GA 2K5PA 4N58A 4RGTA 4TQ0A 1L0YB 4HKQA 3HVDA 2LMCA 1TZOA 4EE2A 1ENFA 1L4ZB 1JALA 5HFYA 3RFZB 4J3OD 3T3NA 2EELA 1FCCC 3AN1A 4MH8A 5D7GA 4ITKA 1IUEA 5HG2A 4P6VF 2RDHA 1F2RI 3P42A 3SFDB 1N5XA 2FUG1 1YN3A 4YSXB 1PFDA 3AE9B 1TKGA 4N6EB 2IJ0A 2QIEB 2LHDA 2WS3B 2NTTA 1D5XC 1CQVA 3Q69A 1F2RC 1N63A 1JWBD 4AQ7A 1ROEA 1N5WA 1TY0A 2QILA 1SBBB 4L23A 1F0ZA 1FXAA 1YN4A 4O1NA 2NMQA 2WNMA 1EU3A 3U52E 3AM9A 4HKZE 2WXKA 1NEKB 2W55A 1PGAA 4LTUA 3AEAB 4KKJA 1WRIA 2JQRB 1J7BA 2JZPA 4ZYSA 1SJED 2CJNA 4JPSA 4XWTA 1QF6A 1FFUA 4NJCA 3W5UB 1FEHA 2V3NA 2V3PA 1C77A 3BK1A 1FNVA 1OQQA 4YTPB 1DGJA 2W3RA 1KF6B 1P7EA 2WXOA 3E56A 4WAFA 3R8BA 5GXGB 3W1SA 2YEPB 4A8XC 1HA5A 3EUB2 1L5PA 1C9FA 4XDDA 1ET6A 2IGHA 3SR6A 4MACA 3IXSA 2AX5A 5EE0A 3P4PB 2YEPF 1DOIA 3NVVA 1XLOA 2BBCA 1JROA 1R7SA 3IAM1 4WURA 1QT9A 4C56C 2ICIA 2HDEA 4JWUC 3BYTB 1T5XD 3TUOA 2OHFA 4OW0A 5G5GA 1VDVA 1L6VA 3HVZA 3MJ5A 1FO4A 4KGRA 1UWMA 2PW9A 3UI3A 4CQNA 1JWAD 3P63A 3U2SC 1TS4A 1JMLA 1KLGD 2BS3B 3KQ4A 2ACZB 3PZ8A 5BYSA 3H8HA 2Z8LA 3AE4B 3ZJVA 4C7YA 2X38A 3NRZA 4ZOHC 3BVGA 4IKGA 4TSSA 3AMZA 2GI9A 1XLPA 3GB1A 1IGCA 3AE5B 5D3DA 1GAQB 4KX6B 2BB6A 1PGXA 2XNAC 2N9KA 3BYYB 3VRAB 4L1BA 2Y3AA 4NAMA 1STEA 2E6XA 1V1OA 1TJEA 5FR3A 1QOBA 2V4IB 3U4EG 3KWLA 5T8IA 4A55A 2L32A 1E7PB 3R2TA 3GS2A 3BVZA 1Q10A 3MHZA 4JE3B 1FCLA 1RWSA 2BW2A 4US9A 2QEJC 3FC4A 2RDGA 1KTKA 2LFIA 2MJ3A 2DYOA 1E6EB 4YTNB 4A6QA 1ZXHA 2W82A 1PUTA 5EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B0M A;  3RFZ B;  4J3O D;  1ZDV A;  1ZE3 D;  1ZDX A;  3BWU D;  4B0E A; 
#chains in the Genus database with same CATH topology
 1F1H A;  2FCQ A;  2WXQ A;  3KYD D;  5FR6 A;  2UU7 A;  2NBU A;  1I4H A;  4W9F A;  5TR5 A;  3NHE B;  1ACC A;  1WGD A;  3DHH C;  4W9C A;  1QOF A;  2YLM A;  3B1L X;  4GDK B;  4ACF A;  4WH4 A;  4ASW C;  1TTN A;  2AEH A;  4A20 A;  2QSD A;  1WX9 A;  1I4X A;  2K8B A;  3A1Q A;  3L17 A;  5LXH A;  3Q8B A;  5AEK B;  2LI5 A;  2MP2 A;  1ZOY B;  1WXS A;  3MTN B;  2BWF A;  2RPV A;  3RT3 B;  2K25 A;  3HK0 A;  4JL9 A;  1ZUD 2;  4HRO A;  2J0J A;  4RMA A;  2XN9 C;  3ZNG C;  2ZW0 A;  1B9R A;  4GGQ A;  4HRS A;  2INC C;  3RNE C;  3V05 A;  3J9C A;  1QOG A;  2LVO A;  2LZ6 A;  2MW5 A;  3B9J A;  3T9L A;  3B08 A;  4LNF A;  2XK5 A;  2PVO D;  2GBJ A;  5JH5 C;  2MJD A;  4OVU A;  2KKC A;  3N30 A;  2JF5 A;  2CS4 A;  2C7N B;  1T6B X;  1ET9 A;  2D2Q A;  1IBX B;  1NVI D;  1A70 A;  3PGE A;  2KO3 A;  3VR8 B;  1GC7 A;  2ZJD A;  3NG0 A;  1TKE A;  1PQS A;  2WXP A;  2VRR B;  3AB5 A;  2GRI A;  2J4X A;  5KHQ A;  2K9X A;  3R2I A;  3W5V B;  5AZH A;  3VR9 B;  1AWD A;  5LLI A;  1TIF A;  4FHJ A;  4NNJ B;  1VCB A;  4BVU C;  4AS1 A;  1HZ5 A;  4DXG A;  2B76 B;  3FKY A;  2K8C A;  3B0A A;  4LNO A;  4GMV A;  3I57 A;  3RMK C;  2KTF A;  4RM8 A;  2DYM A;  1SJH D;  3WAN A;  4XX5 A;  4DQO C;  1OQY A;  2LEK A;  3N9Y C;  1NI3 A;  1C4P A;  1UH6 A;  4N9F 4;  1QKZ A;  1AW7 A;  3T3O A;  2JU6 X;  3VRB B;  1A5R A;  2B3A A;  3B2G A;  2VH2 A;  1GB1 A;  4RGM A;  3BZD B;  4HPM B;  3PPA A;  1J0G A;  4WJN A;  1CZP A;  2N9E B;  3L54 A;  3A9J B;  4ICU A;  2LVP A;  3MC9 A;  2JX5 A;  1PYW D;  2WXH A;  1XCT L;  3Q3N C;  4M00 A;  2KQ7 A;  4K81 A;  3KW5 B;  3QCA A;  3ZQ4 A;  1LO5 D;  4GDK A;  4FHK A;  3MHS D;  2L8J A;  1YQ3 B;  1JCK B;  2JXT A;  1UWX A;  5JXV A;  3N1Y C;  5L95 C;  2INN E;  2M56 B;  4P16 A;  2XEW A;  2INP E;  2MA9 B;  3A4S C;  4MEM A;  1FPY A;  2V1Y A;  3UGB B;  4UDU C;  2J53 A;  2UYZ B;  4F8C B;  1I7H A;  3WAO A;  4AWJ A;  1I4P A;  1L4D B;  1OEY J;  3GE3 C;  1SXT A;  1SE4 A;  5G2N A;  4KGT A;  2N7E A;  2QC8 A;  2A5U A;  2G45 B;  2MHJ A;  3NS8 A;  1XO3 A;  3LB8 C;  1OQR A;  2CU3 A;  3EFC A;  4GLS C;  1N60 A;  3KVF B;  3KYC D;  2IDY A;  1HXY D;  4TUU A;  2ZCC A;  3HIZ A;  4LDT B;  3P4S B;  3AEG B;  1Y56 A;  2CHW A;  1B1Z A;  1C79 A;  5IO9 A;  3CMM B;  1V49 A;  1I42 A;  1OGW A;  4FLH A;  2BYT A;  2BT6 A;  2G9H D;  3ZVV A;  2L76 A;  2SAK A;  1QIL A;  2W54 A;  1BUI C;  1YQ4 B;  1EWC A;  2NTS A;  2EMS A;  1FM0 D;  2Y5C A;  1WGK A;  5DPW A;  4LK0 M;  1T0S C;  2L52 A;  4BFR A;  5BMH A;  2QMT A;  4B9K A;  5TSS A;  3BK2 A;  3QWZ B;  2KXJ A;  2VZK D;  3R66 C;  2BKF A;  4NZL B;  1RFK A;  1E7U A;  5CHF A;  2A4Z A;  4XZ4 A;  5FKA C;  4HDQ A;  4NJ7 A;  2AYO B;  1SIF A;  4JQW C;  4NQL B;  2WDT B;  3SEB A;  1UUP A;  2JWU A;  3ZYY X;  4YSZ B;  2KDB A;  5BO4 B;  1C3T A;  2NPT B;  1E8W A;  1WGR A;  2TSS A;  3IFW B;  3HVD A;  3CF6 E;  1YD8 U;  2MBQ A;  5HFY A;  4A3P A;  1WY8 A;  1R4M B;  4P6V F;  1N5X A;  4XYC A;  2IO0 B;  2IJ0 A;  2QIE B;  3DBH B;  1XT9 B;  3VDZ A;  1D5X C;  3Q6B A;  4GN1 A;  2HJ1 A;  4EFO A;  4B95 A;  4F1S A;  1TY0 A;  2QIL A;  2ZNV C;  3QA8 A;  3JVZ X;  4ZRI A;  1RAX A;  2WXK A;  1NEK B;  2W55 A;  1NI2 A;  3JW0 X;  4FJZ A;  2DAF A;  2JZP A;  3DHG C;  2LRW A;  2CJN A;  4HCN B;  3APC A;  4E74 A;  4JPS A;  1QF6 A;  1FFU A;  3RZW C;  2EKE C;  2KDE B;  4LNK A;  2UWQ A;  3LDZ E;  4WAF A;  1KF6 B;  2L0T A;  3BY4 B;  4MGI E;  2K1F A;  4BBN F;  3P4P B;  4LNN A;  3NVV A;  1XLO A;  2K8H A;  2ZCB A;  4AUQ C;  1K8R B;  2OHF A;  3ZRC A;  4OW0 A;  3MC8 A;  1L6V A;  1UWM A;  2PW9 A;  1JWA D;  2LGS A;  3RN9 C;  3OG5 A;  2M17 A;  2NCN A;  1YX5 B;  2Z8L A;  2M4N A;  3DVN V;  2KDF B;  5D94 A;  2MSE D;  1YX6 B;  4BBN C;  3SDL C;  2KFK B;  1IGC A;  5E6O A;  4KV2 A;  3M3J A;  3A9K A;  3RNC C;  1GAQ B;  2EMT A;  4KX6 B;  2XNA C;  2QHO A;  2N9K A;  1LM8 B;  2PJH A;  5FR3 A;  2V4I B;  3UF8 A;  5E6N A;  4A55 A;  1RLF A;  2L7R A;  1FCL A;  1H8C A;  2BW2 A;  1ISN A;  4US9 A;  1WE6 A;  4IM0 A;  2D3G A;  2KZR A;  3PS6 A;  1F52 A;  4HDO A;  3RNA C;  4P1C C;  3NZU A;  2MJ3 A;  1WZ3 A;  1E6E B;  1X1M A;  3AV8 A;  4YL8 A;  3ZDM C;  1ZE3 D;  4KKI A;  3HRD D;  1OTR B;  4HWI B;  2MBE A;  4GB9 A;  3VUW A;  1TS3 A;  1JWS D;  1I35 A;  2C5L C;  3VTU A;  3UIP B;  1FIQ A;  3V60 A;  2WLB A;  1WZ0 A;  4CHK A;  4DXA B;  1TKY A;  1WYW B;  3RZF A;  3QAQ A;  2N9P C;  4C00 A;  2WDQ B;  2NPT A;  2CHX A;  3P4R B;  5D6J B;  1ZW7 A;  3PVL A;  2KAN A;  2JZZ A;  2DLB A;  3KUD B;  2KWU B;  1WWT A;  1E8X A;  5DCN A;  3P1M A;  3PLV A;  4LNI A;  3T8M A;  5JHA A;  4ZDV A;  3TSS A;  1P1A A;  3WAP A;  1P98 A;  3R3M A;  2JXX A;  4DHZ B;  2LAS A;  1YJ1 A;  4DBG A;  3H7S A;  2BF8 B;  5G55 A;  1D5M C;  4EZL A;  3TEZ A;  3VQI A;  3Q8A A;  2LGX A;  2ZPN A;  2DWQ A;  1PDX A;  3OJ3 A;  1TBE A;  3A4R A;  3NZ3 A;  4FJY A;  2ZVN A;  4IC7 B;  4J6I A;  2Q5W D;  2KN5 A;  2RMM A;  4RGN A;  3PO0 A;  5AUK A;  2DZJ A;  2AQ1 B;  1WXM A;  4MDK E;  2KAJ A;  2D3B A;  1Z5S B;  3AE1 B;  3VVW B;  5JZE B;  1KJT A;  4FUL A;  1FRR A;  1D6E C;  2KJH B;  3KUC B;  4HJK A;  4WWP A;  4TMA B;  3ML9 A;  1N61 A;  4HJG E;  2L3Z A;  2N9X A;  3P2B A;  3ZJU A;  2WXG A;  1E8Z A;  1M4V A;  4A90 A;  2KFK A;  2N1W A;  3NVW A;  3Q8F A;  5CHW A;  1H4R A;  1WJN A;  4KZ0 A;  1E10 A;  1E0Z A;  2WXR A;  4OZA A;  4MM3 B;  3AED B;  2IND C;  3R7R A;  3LJ3 A;  4ZRP A;  2KVZ A;  1GOZ A;  1EUV B;  4ZYN A;  2AQ3 B;  4WQO B;  3WAM A;  2LUE A;  2KC2 A;  3AEC B;  1WE7 A;  2JYT A;  2I2Y A;  2BB5 A;  5G5H A;  1D4B A;  2FBW B;  4D2K A;  2K0P A;  3RYT A;  2V0G A;  4FXC A;  1SEB D;  3MJW A;  4QAY A;  1V97 A;  1RYJ A;  3EA6 A;  1E8Y A;  1E90 A;  2LGY A;  1UGJ A;  4ARC A;  4RFB A;  2I1K A;  3LYY A;  3O13 A;  4XWW A;  2Y5B B;  3UQB A;  1N62 A;  4X57 B;  3TEW A;  4G3X B;  2JYE A;  3N1Z C;  3TCA A;  2GLS A;  4IM3 A;  2L83 A;  3N3K B;  3DBL I;  5D3I B;  1SE2 A;  3RUL A;  1XF5 L;  1SE3 A;  4NY0 A;  1D3Z A;  4ZRK A;  1Q0W B;  4XGA B;  4XDC A;  1FNW A;  3QX1 A;  2ZEQ A;  2FCN A;  2J7Q B;  3QC8 B;  4Q2J A;  4PS8 A;  2KLG A;  2OED A;  2ONQ A;  5AUI A;  5C3J B;  4AP4 C;  3KWV A;  4ZHP A;  3DBH I;  3JYU A;  1WRD B;  1YJJ A;  2GBK A;  3UQA A;  5AZG A;  3AXC A;  4EEW A;  1MI0 A;  1WSP A;  2DBY A;  4RGO S;  4P1B C;  1QQR A;  4DHJ D;  2XBB C;  3GOE A;  2M0X A;  4B0M A;  3P4Q B;  1ZPS A;  2MCN B;  1VZ7 A;  2D07 B;  3ZKJ C;  1F9J A;  4KZC A;  2KN4 A;  2R61 A;  1MPE A;  3V61 A;  5CX3 A;  3BVM A;  2BYE A;  2PLP A;  5EE3 A;  2RPQ A;  1KFY B;  2DYB A;  1R4N B;  2LHE A;  1RM6 C;  5LNK 1;  1GB4 A;  4IWQ A;  3V3X A;  2WXL A;  1IP9 A;  3L13 A;  4LCD E;  3CIR B;  3AEB B;  3N20 C;  4YT0 B;  1P9D U;  1VR9 A;  1WIA A;  4BOZ B;  4TV3 A;  2LJ5 A;  3KH0 A;  3MFG A;  3D32 A;  3VAW A;  3GE8 C;  2BS4 B;  3ZGZ A;  4BZA A;  4MGZ E;  3H9D A;  3RNB C;  4NPN A;  4DDG D;  2QDF A;  1WMH B;  2PVG C;  4TQ1 A;  2YVC A;  4LLG M;  4TQ0 A;  2D5G A;  4MM3 A;  4HKQ A;  2LMC A;  2KX3 A;  4EKU A;  1ENF A;  1L4Z B;  3NZS A;  2N1V A;  4LJO B;  1FCC C;  3AN1 A;  1WX7 A;  5HG2 A;  4NJ6 A;  3P42 A;  2MWS B;  3U7D A;  3DBS A;  2GBN A;  2G3Q B;  4KVG B;  1CQV A;  1F2R C;  4K7W A;  3L08 A;  4WJP A;  3DVN U;  1N5W A;  1V80 A;  1FXA A;  5IN7 A;  1WRI A;  5IA7 A;  1P0R A;  5DPR A;  1FEH A;  2V3N A;  3BK1 A;  1FNV A;  2N4F A;  3AU4 A;  4HXD A;  4YTP B;  4PYU A;  2YEP B;  4A8X C;  3EUB 2;  1L5P A;  1T0R C;  2DAJ A;  3ONS A;  5E6P A;  1C9F A;  1ET6 A;  3VTV A;  4ANV A;  2AX5 A;  3RNG C;  3DDC B;  2PEA A;  1ZGU B;  1DOI A;  4PS7 A;  2CR5 A;  2R2Q A;  3RUI B;  2BBC A;  1JRO A;  3IAM 1;  4WUR A;  1QT9 A;  3RNF C;  3L16 A;  4JWU C;  3VUY A;  3OJ4 B;  3V6C B;  3A9K B;  3H6N A;  1VDV A;  1FO4 A;  4CQN A;  4FAD A;  2DX5 B;  1LXD A;  3SD5 A;  3GZN B;  2WHI A;  1WGY A;  3ZJV A;  2KK8 A;  4C7Y A;  3BVG A;  2J0M A;  4WJO A;  3Q3J A;  3AMZ A;  1XLP A;  2LXA A;  4I6P A;  2KMA A;  4KSK C;  2HJ8 A;  2BB6 A;  1PGX A;  3BYY B;  4L1B A;  2ASQ A;  2Y3A A;  4M0W B;  2E6X A;  1V1O A;  4IM2 A;  2WX0 A;  2C7M B;  1EO6 A;  2L32 A;  1RWS A;  5DPT A;  2JUO A;  3FC4 A;  4JIO U;  2RDG A;  3U8Z A;  2LFI A;  2GBM A;  4YTN B;  2NVU I;  4P7I A;  1ZXH A;  2W82 A;  1T0Y A;  2FIF A;  5EE1 A;  1V2Y A;  5J18 A;  1WXA A;  2MX2 A;  4WWM A;  3ZRF A;  4WWO A;  1L2N A;  1JW9 D;  4BKS A;  2D10 A;  4IWO A;  4IOI E;  2BYV E;  3HUI A;  4RH6 A;  2PE9 A;  3ZNH B;  2RSU A;  3B2F A;  4CO7 A;  2ZZP B;  3I5J C;  4C7Z A;  4AJY B;  3IHP C;  4WIP A;  4H2A A;  1V81 A;  3VFK A;  1V9J A;  3DPD A;  1C4C A;  1XCQ L;  2IGD A;  1WMH A;  3ZTD A;  2FNJ B;  3E9S A;  1DOY A;  2H88 B;  2W9N A;  1MG8 A;  1QLB B;  5D2M B;  2J52 A;  4FJV B;  2WDV B;  1JWU D;  2LGD A;  4YSY B;  4ARI A;  1DYQ A;  1KLU D;  3SHQ A;  4GDL B;  3IVF A;  3ZIM A;  2KQS A;  4W9E A;  2OJR A;  2JRH A;  2MBH A;  4IDI A;  2JY6 A;  1EWY C;  3VH3 B;  1K53 A;  2ZW1 A;  3APF A;  3AUL A;  1UD7 A;  1OEY A;  2HTH A;  3FIL A;  3PRM B;  1SB3 C;  1CJE A;  2KAC A;  3HM3 A;  1V5T A;  2MLB A;  5J2R A;  2NS5 A;  1ESF A;  2WP9 B;  4PT5 A;  2SEB D;  3VH4 B;  2GB1 A;  1ZXI A;  1EU4 A;  5BYR A;  1CK1 A;  1GC6 A;  1P7F A;  3DHI C;  4IW0 A;  4IWP A;  1S1Q B;  2NBW B;  5BMG A;  1MHH E;  2KMC A;  3EHV A;  1J19 A;  4I6L B;  3ML8 A;  1KRH A;  2EKI A;  1F77 A;  2MBO A;  2Z0D B;  3IAS 1;  3DWM A;  1Y8R C;  2M1M A;  3HM6 X;  4OZB A;  1L0X B;  1NYQ A;  4M01 A;  3TEX A;  3Q3O C;  1BML C;  1KOT A;  2C9W B;  2KOX A;  1HZ6 A;  2RGF A;  3C0R B;  2Z0E B;  2WXF A;  3GP7 A;  4K7U A;  4ZRQ A;  1M94 A;  2WWZ A;  2V3S A;  1V1P B;  1SE9 A;  3W9C B;  2KTR B;  4M0W A;  2LWP A;  4REZ A;  4RM9 A;  1QZE A;  4MT5 A;  3IT6 B;  3QK0 A;  2BS2 B;  1YOV B;  3PTF C;  4NAW A;  1AN8 A;  1WM2 A;  2DZM A;  4RCO A;  3PHW B;  4MGK E;  3IG3 A;  3Q3F A;  4EZJ A;  1I4G A;  4A9A A;  4IUM B;  1XQQ A;  3AE3 B;  2AQ2 B;  1UBI A;  2MJE A;  2VZK B;  1V8C A;  3QHT A;  2LGI A;  2LUM A;  2M19 A;  3OAW A;  2WU2 B;  2BWE S;  5L83 A;  4OZC A;  2V4L A;  1GUA B;  1K51 A;  2O2V B;  4II3 B;  1LFD A;  3K9P B;  3LXF A;  4USA A;  4WQM A;  5GMV A;  1HQR D;  1MFW A;  2KFJ A;  1XLQ A;  4K3C A;  1QOA A;  5MPO A;  3MP9 A;  3CWI A;  4MSM B;  5C2T B;  3CSF A;  1JRP A;  2WQY B;  4MJS B;  4M02 A;  4GDL A;  1V6E A;  4RNA A;  4B6W A;  5AZF A;  1L7Y A;  3ZW3 A;  4W9J A;  2L1A A;  2Z59 B;  2R2O A;  2N7D A;  2N7J A;  2HE7 A;  2IYD B;  2NBV B;  2Y5P A;  4EOY A;  1HEZ E;  1I4Q A;  1GPX A;  2WGS A;  3BII D;  3TJP A;  2WX1 A;  4FN2 A;  3ECI A;  3ZO5 B;  4KIK B;  1ZKH A;  2ON8 A;  4DDI D;  1D5Z C;  2IPK D;  4N59 A;  3EGR A;  3VHT C;  2N9L A;  4KGS A;  2CJO A;  2L0F A;  1C76 A;  1SF0 A;  2LXC A;  3W2D A;  4HPL B;  3NVY A;  2WYQ A;  1TY2 A;  1FFV A;  3PV1 A;  2BTE A;  2WU5 B;  1HTQ A;  2FCM A;  1AAR A;  3ABV B;  3AU5 A;  4JX1 C;  4C80 A;  5J17 A;  1XEE A;  3ETR A;  3TIX A;  2DZK A;  4HEA 1;  4JLC A;  3AE2 B;  1UF0 A;  1K50 A;  3VXW A;  3RD2 A;  4R3D A;  4II2 B;  1V1P A;  3GZN I;  2C7H A;  3KLS X;  3AEE B;  2KTR A;  1VD2 A;  1YMH E;  3MC0 B;  1ZDX A;  1WX8 A;  2FUH B;  3EEC A;  1E7V A;  4JGH B;  2FAZ A;  4PK1 A;  4IG7 B;  2WXM A;  3ENE A;  1MHX A;  4BKG A;  1AYF A;  4RGT A;  1L0Y B;  1TZO A;  1S3S G;  4J3O D;  3JSV B;  2EEL A;  2VH1 A;  4MH8 A;  5D7G A;  2D3C A;  3SFD B;  1F2R I;  1YN3 A;  4YSX B;  3ZXV A;  2K6Q A;  1TKG A;  3AE9 B;  1WXV A;  2LHD A;  3Q69 A;  1RFA A;  4LDT D;  3SU8 X;  1ROE A;  2IZV B;  1YQB A;  1FXT B;  1YN4 A;  5DPS A;  2JRI B;  2NMQ A;  2WNM A;  2ZPY A;  1EU3 A;  4O1N A;  4DHZ E;  3AM9 A;  4HKZ E;  2LVQ A;  4HK2 A;  1PGA A;  4KKJ A;  1CMX B;  1C1Y B;  2V9H A;  4W9I A;  1SJE D;  4XWT A;  4MH0 E;  2O2V A;  3QIJ A;  3W5U B;  2BPS A;  2BYF A;  3QJZ A;  2KYW A;  1C77 A;  1OQQ A;  1WH3 A;  2KDI A;  2KT7 A;  1DGJ A;  2WXO A;  1P7E A;  3W1S A;  2IY0 B;  3E56 A;  3PRZ A;  1R4M I;  2BQQ A;  1IYF A;  1WJU A;  4XC2 A;  4HVB A;  4XDD A;  5IP4 D;  2IGH A;  3SR6 A;  4K3B A;  2O6V B;  4GIV A;  4W9D A;  1J8C A;  2YEP F;  4MJS A;  3M63 B;  4M8N A;  2MRP A;  4E3C A;  4F7Z A;  2HDE A;  3BYT B;  1T5X D;  3X23 A;  3DVG Y;  1G6J A;  2KNB A;  3HVZ A;  1HTO A;  4KGR A;  3Q3M C;  1TS4 A;  5C23 A;  1JML A;  2AL3 A;  2AWT A;  5CHV C;  1KLG D;  1GJZ A;  3PZ8 A;  5KHO A;  3H8H A;  3AE4 B;  3NRZ A;  4IKG A;  4PS3 A;  2MBB B;  4BOS C;  4KIK A;  2K39 A;  3GB1 A;  2DNF A;  3DVG X;  2DHZ A;  5D3D A;  3V6E B;  3H1U A;  4GU2 A;  3I63 C;  3NJT A;  1STE A;  4M8M A;  4FBJ B;  1QOB A;  5T8I A;  3DBR B;  3GS2 A;  3W1Y A;  1EF5 A;  2G4D B;  4S0R A;  4AOF A;  2RDB C;  2DYO A;  1Q1O A;  4A6Q A;  3PRP B;  1PUT A;  3K9O B;  4OHJ A;  2CKH B;  4XE0 A;  2E3T A;  3AI5 A;  1FXI A;  3Q14 C;  2D11 A;  1TZ1 A;  4C4V B;  4K7S A;  3FAH A;  2PIA A;  3ALB A;  1JRU A;  3C8Y A;  3Q8E A;  1T0Q C;  2WXI A;  4DK5 A;  4YXD B;  1BT0 A;  1XD3 B;  3C19 A;  2QCZ A;  1NBF C;  2JSV X;  2IO2 B;  1JWM D;  1J7C A;  1T3Q A;  4E71 A;  1FMA D;  3QQ8 B;  1WR1 A;  2K3U A;  1IGD A;  4JWS C;  2D3A A;  1FD6 A;  3R7Q A;  3I9V 1;  4YWG G;  3AH7 A;  4W9K A;  1FRD A;  3BIN A;  4ANU A;  3JSV A;  1RRB A;  2W3S A;  5CTR C;  4KDL B;  3FIL B;  4HCP B;  4K1R B;  3L0W B;  2JPH A;  5BMI A;  3PHX B;  4GOC A;  1K52 A;  5C1Z A;  2BGF A;  2I38 A;  3AE8 B;  2KQ4 X;  1WYG A;  2QJL A;  3PZ7 A;  4L2Y A;  2LJI A;  1I4R A;  2BKR B;  5IOI A;  1Z2M A;  3NS1 A;  3BWU D;  3AEF B;  1SGH A;  5EE9 A;  3TEY A;  1E9M A;  2BVC A;  4OVZ A;  1C4A A;  1L0V B;  1VLB A;  2FID A;  1KM7 A;  1TS5 A;  5FK9 C;  2O6V A;  1ZP0 B;  2RR9 A;  3ZTC A;  3VTW A;  4FA6 A;  3IT4 B;  4EUT A;  3DQV A;  3M62 B;  1NYR A;  1WI0 A;  4URK A;  1IBX A;  4YTM B;  3ZNZ B;  2WXN A;  1SSN A;  1EM7 A;  4RF0 A;  3U7Z A;  2K6D B;  2K22 A;  3RPF C;  1E5W A;  3V62 A;  3OLM D;  3ZUN A;  4NQK E;  2KWD A;  2N0S B;  2GOW A;  2IGG A;  2HD5 B;  2KMM A;  4NAW B;  3H7P B;  1OFF A;  1VZ6 A;  1YNT E;  4WJQ A;  2I1J A;  1LGR A;  1VZ8 A;  2KDM A;  5HHD G;  2PTL A;  5BYQ A;  1JQ4 A;  4GXB A;  2L00 B;  5HI1 A;  3L10 B;  1TYG B;  2IO1 B;  4DHJ B;  2LRU A;  3M95 A;  1LQB A;  4W9G A;  1UNS A;  4W9H A;  1U4A A;  2J42 A;  1WXQ A;  4US8 A;  4HPP A;  1YIW A;  3TL5 A;  3ZXR A;  4AJW A;  3URY A;  1MVK A;  2MH7 A;  1ZDV A;  4PYZ A;  1WGG A;  4ANW A;  1V86 A;  2C60 A;  5H92 C;  3DBL B;  4LJP B;  1V5O A;  3L4P A;  4C4V A;  1IPG A;  2PE6 B;  3Q8C A;  1UEL A;  1YN5 A;  1WGH A;  4MSQ B;  3A9J A;  2L05 A;  3NVZ A;  4ICV A;  1WR6 E;  3ZJT A;  4RF1 A;  3PLU A;  1GNU A;  1UBQ A;  3NUH B;  4G50 A;  4TKN A;  4OVV A;  3I3T B;  2IBI B;  5EDS A;  1VJK A;  3OWE B;  4S17 A;  1NDD A;  2DZI A;  2GMI C;  3WCQ A;  4B0E A;  2LD9 A;  4ZHO A;  2G1E A;  2PMV A;  4DWF A;  4G11 A;  4KDI C;  2WXJ A;  1P3Q U;  2WDR B;  3SFE B;  3WA0 A;  2PKO A;  2IO3 B;  5I4D A;  2JZ3 B;  2FE8 A;  2J0K A;  2CU1 A;  4W9L A;  1PGB A;  3W1S C;  1BXT A;  2ZVO A;  2KLC A;  1KH0 A;  4ZRJ A;  5LXI B;  1NEN B;  3DOW A;  2AL6 A;  4I6N B;  1GG3 A;  3DWG C;  4HLE A;  4A3O A;  3NOB A;  1C78 A;  5H8Y E;  2HTM E;  3VUX A;  3IBE A;  1VRA B;  1TGZ B;  2M0A A;  4EZK A;  1XXG A;  2GBR A;  4KSL C;  1WJ4 A;  1SIJ A;  4WWN A;  4CYE A;  2KHW B;  4DXF A;  3WIM A;  1TS2 A;  1J7A A;  3APD A;  1XLN A;  3AE6 B;  5E6J A;  3RCZ A;  2ZNV B;  2MEK A;  3H7P A;  1YJI A;  2H89 B;  2KWC A;  1FNU A;  2KD0 A;  3U30 A;  3ZLZ A;  1DOX A;  1L6U A;  3PZD A;  2G4S A;  3A1Q B;  2JT4 B;  2OJW A;  3AE7 B;  1WF9 A;  2RD0 A;  2MP2 B;  4N58 A;  2K5P A;  2KC1 A;  3N32 A;  4EE2 A;  5JHB A;  1R4N I;  1JAL A;  3PSE B;  3UIN B;  3RFZ B;  3T3N A;  4ITK A;  3N1X C;  1IUE A;  3DBR I;  2RDH A;  4ANX A;  2FUG 1;  4GSW A;  1PFD A;  4N6E B;  3S2A A;  3EFU A;  2WS3 B;  2NTT A;  3TBL D;  1N63 A;  1JWB D;  2O6V D;  2DEN B;  4AQ7 A;  1SBB B;  3CST A;  4L23 A;  1F0Z A;  2XK5 B;  3U52 E;  1UGM A;  5IAA C;  3QAR A;  4LTU A;  3AEA B;  2JQR B;  1J7B A;  4ZYS A;  1WJ6 A;  1WFY A;  4NJC A;  2V3P A;  3HHM A;  3DCG A;  2W3R A;  3R8B A;  2KJR A;  4WAA A;  5GXG B;  1HA5 A;  4MGY E;  4MAC A;  3IXS A;  1MJD A;  4BAX A;  5EE0 A;  3EC8 A;  2M8S A;  2REX A;  2FCS A;  1R7S A;  2KJ6 A;  4C56 C;  1UZX B;  2ICI A;  1KLV A;  3O65 B;  3TUO A;  5G5G A;  1N6Z A;  4BKS D;  3MJ5 A;  3UI3 A;  3X0W A;  3Q2A C;  3P63 A;  1EF1 A;  2KWV B;  3U2S C;  3TMP B;  2KX0 A;  2BS3 B;  3KQ4 A;  3KUZ A;  2ACZ B;  2MQJ A;  5BYS A;  2X38 A;  4ZOH C;  2JVC A;  4TSS A;  1TT5 B;  5HKH A;  3RI7 C;  2CHZ A;  2GI9 A;  3ZNI D;  3AE5 B;  3VRA B;  2IY1 B;  3PRE A;  4NAM A;  2JWZ A;  2PPH A;  2OOB B;  1TJE A;  5IKC M;  2X8X X;  1WM3 A;  3U4E G;  3KWL A;  3PT2 B;  4BKT A;  3A33 B;  3R2T A;  1E7P B;  4MEL A;  3BVZ A;  1Q10 A;  3MHZ A;  1Q5W B;  2NR2 A;  4JE3 B;  3NY5 A;  3ZDT A;  4G0N B;  2QEJ C;  3WAL A;  1KTK A;  1MG4 A;  2KVR A;  1HE8 A;  3UIO B; 
#chains in the Genus database with same CATH homology
 4OHJ A;  2WXQ A;  3AV8 A;  4XE0 A;  1I4H A;  2E3T A;  1FXI A;  1ZE3 D;  4KKI A;  4WWM A;  3HRD D;  1JW9 D;  4IOI E;  3HUI A;  4RH6 A;  1ACC A;  1TS3 A;  3FAH A;  1JWS D;  3B2F A;  2PIA A;  4C7Z A;  1QOF A;  3C8Y A;  4GDK B;  3Q8E A;  4WH4 A;  2WXI A;  1FIQ A;  4WIP A;  4YXD B;  4H2A A;  2WLB A;  2QSD A;  1I4X A;  1C4C A;  2JSV X;  1TKY A;  3Q8B A;  2WDQ B;  1XCQ L;  1JWM D;  1J7C A;  1T3Q A;  2IGD A;  3P4R B;  1FMA D;  1ZOY B;  2K3U A;  3E9S A;  2RPV A;  2DLB A;  1DOY A;  2H88 B;  1IGD A;  4JWS C;  1FD6 A;  3I9V 1;  4YWG G;  1WWT A;  1ZUD 2;  1QLB B;  4HRO A;  3AH7 A;  1FRD A;  2XN9 C;  2J52 A;  3P1M A;  2ZW0 A;  2W3S A;  1B9R A;  2WDV B;  3FIL B;  4HRS A;  1JWU D;  4YSY B;  3TSS A;  4ARI A;  1DYQ A;  1KLU D;  3V05 A;  3J9C A;  1QOG A;  5BMI A;  4GDL B;  3B9J A;  4IDI A;  1K52 A;  1EWY C;  1K53 A;  2PVO D;  2I38 A;  2ZW1 A;  2MJD A;  3AE8 B;  2KQ4 X;  1WYG A;  3FIL A;  2QJL A;  3PZ7 A;  4L2Y A;  2LJI A;  1I4R A;  1SB3 C;  1CJE A;  2KAC A;  1D5M C;  3BWU D;  3AEF B;  3NS1 A;  3TEZ A;  3VQI A;  3Q8A A;  1T6B X;  1ET9 A;  2WP9 B;  1ESF A;  5EE9 A;  2DWQ A;  1PDX A;  3TEY A;  4PT5 A;  2SEB D;  1E9M A;  1IBX B;  3NZ3 A;  4OVZ A;  1C4A A;  1L0V B;  1A70 A;  1NVI D;  1VLB A;  2GB1 A;  2Q5W D;  1ZXI A;  1EU4 A;  5BYR A;  1CK1 A;  2RMM A;  4RGN A;  1TS5 A;  3VR8 B;  3PO0 A;  5FK9 C;  5AUK A;  1P7F A;  2AQ1 B;  1ZP0 B;  1TKE A;  2KAJ A;  2WXP A;  5BMG A;  3IT4 B;  1MHH E;  3AB5 A;  2GRI A;  3AE1 B;  2J4X A;  1NYR A;  2K9X A;  1IBX A;  3R2I A;  4YTM B;  1FRR A;  1D6E C;  3W5V B;  2WXN A;  1KRH A;  2EKI A;  1F77 A;  1SSN A;  3VR9 B;  1EM7 A;  3IAS 1;  4RF0 A;  3DWM A;  3U7Z A;  2K22 A;  1AWD A;  3RPF C;  4OZB A;  1L0X B;  4TMA B;  1NYQ A;  3TEX A;  1BML C;  1N61 A;  4AS1 A;  4HJG E;  2KWD A;  2N0S B;  1HZ6 A;  1HZ5 A;  4DXG A;  2IGG A;  3ZJU A;  2B76 B;  2WXG A;  3GP7 A;  2KMM A;  2WXF A;  4ZRQ A;  4NAW B;  1M4V A;  1OFF A;  1VZ6 A;  4A90 A;  3NVW A;  3Q8F A;  1V1P B;  1YNT E;  3I57 A;  3W9C B;  2DYM A;  1SJH D;  1VZ8 A;  2KDM A;  4M0W A;  5HHD G;  2PTL A;  1E10 A;  4DQO C;  1E0Z A;  4REZ A;  5BYQ A;  4MT5 A;  1JQ4 A;  2WXR A;  2LEK A;  3N9Y C;  5HI1 A;  1TYG B;  1NI3 A;  1C4P A;  1QKZ A;  4OZA A;  1AW7 A;  3IT6 B;  3T3O A;  2JU6 X;  3VRB B;  4MM3 B;  3AED B;  1UNS A;  2BS2 B;  2J42 A;  3B2G A;  1GB1 A;  1WXQ A;  4RGM A;  1AN8 A;  3BZD B;  4US8 A;  4ZRP A;  1CZP A;  1GOZ A;  4RCO A;  3URY A;  1MVK A;  2AQ3 B;  2MH7 A;  1ZDV A;  2JX5 A;  3AEC B;  1PYW D;  2WXH A;  1XCT L;  2JYT A;  5H92 C;  1I4G A;  2BB5 A;  2I2Y A;  4A9A A;  5G5H A;  1D4B A;  2FBW B;  3L4P A;  3AE3 B;  4D2K A;  2AQ2 B;  2K0P A;  2MJE A;  2VZK B;  2V0G A;  3ZQ4 A;  1LO5 D;  1V8C A;  3Q8C A;  4FXC A;  1SEB D;  2LGI A;  2LUM A;  2M19 A;  1YQ3 B;  1V97 A;  1JCK B;  1RYJ A;  1YN5 A;  2JXT A;  2WU2 B;  3EA6 A;  4OZC A;  1UWX A;  5JXV A;  1UGJ A;  4ARC A;  4RFB A;  1K51 A;  3LYY A;  3NVZ A;  3O13 A;  2INN E;  2M56 B;  4XWW A;  4P16 A;  3LXF A;  4RF1 A;  3ZJT A;  4USA A;  2INP E;  1N62 A;  3TEW A;  2JYE A;  4WQM A;  3NUH B;  1HQR D;  4UDU C;  2J53 A;  1I7H A;  1XLQ A;  2L83 A;  1I4P A;  1L4D B;  1QOA A;  1VJK A;  5MPO A;  3OWE B;  1SXT A;  5D3I B;  3MP9 A;  3CWI A;  1SE4 A;  1SE2 A;  5C2T B;  1JRP A;  1XF5 L;  4KGT A;  2WQY B;  1SE3 A;  4RNA A;  4XDC A;  1XO3 A;  3WCQ A;  1FNW A;  4B0E A;  2L1A A;  3LB8 C;  1OQR A;  4Q2J A;  2N7J A;  2CU3 A;  4GLS C;  1N60 A;  2IDY A;  2G1E A;  1HXY D;  2OED A;  2PMV A;  2ONQ A;  5AUI A;  4ZHO A;  5C3J B;  3KWV A;  4ZHP A;  3P4S B;  2Y5P A;  1HEZ E;  1I4Q A;  3AEG B;  1YJJ A;  1GPX A;  1Y56 A;  2WXJ A;  2WDR B;  1B1Z A;  3SFE B;  3BII D;  1C79 A;  2PKO A;  1MI0 A;  1WSP A;  2DBY A;  5I4D A;  2FE8 A;  4RGO S;  2ON8 A;  1D5Z C;  2IPK D;  1PGB A;  4N59 A;  1QQR A;  1BXT A;  2BYT A;  3EGR A;  1KH0 A;  2BT6 A;  2N9L A;  4KGS A;  2CJO A;  2G9H D;  4B0M A;  2SAK A;  1C76 A;  1SF0 A;  1QIL A;  3P4Q B;  3W2D A;  2W54 A;  1BUI C;  1YQ4 B;  1EWC A;  1NEN B;  1ZPS A;  2NTS A;  1VZ7 A;  3NVY A;  1FM0 D;  3DWG C;  2Y5C A;  2KN4 A;  1WGK A;  2R61 A;  1TY2 A;  4LK0 M;  2L52 A;  1C78 A;  1MPE A;  5H8Y E;  1FFV A;  3BVM A;  5BMH A;  2HTM E;  2PLP A;  5EE3 A;  2BTE A;  1VRA B;  2WU5 B;  2M0A A;  2QMT A;  1KFY B;  1XXG A;  5TSS A;  2LHE A;  3ABV B;  3BK2 A;  4JX1 C;  4C80 A;  1RM6 C;  2VZK D;  1SIJ A;  5LNK 1;  1GB4 A;  1XEE A;  4DXF A;  3V3X A;  2WXL A;  3ETR A;  4NZL B;  1TS2 A;  3CIR B;  3AEB B;  1RFK A;  1J7A A;  1XLN A;  3AE6 B;  4HEA 1;  4YT0 B;  3AE2 B;  5E6J A;  5FKA C;  1VR9 A;  2MEK A;  1K50 A;  1YJI A;  4R3D A;  2H89 B;  1V1P A;  1FNU A;  3KLS X;  3AEE B;  3MFG A;  1DOX A;  1L6U A;  2BS4 B;  1UUP A;  1YMH E;  1ZDX A;  2JWU A;  3MC0 B;  3SEB A;  3ZYY X;  3ZGZ A;  3AE7 B;  4YSZ B;  2TSS A;  2WXM A;  2PVG C;  4TQ1 A;  1MHX A;  4LLG M;  1AYF A;  2D5G A;  2K5P A;  4N58 A;  4RGT A;  4TQ0 A;  1L0Y B;  4HKQ A;  3HVD A;  2LMC A;  1TZO A;  4EE2 A;  1ENF A;  1L4Z B;  1JAL A;  5HFY A;  3RFZ B;  4J3O D;  3T3N A;  2EEL A;  1FCC C;  3AN1 A;  4MH8 A;  5D7G A;  4ITK A;  1IUE A;  5HG2 A;  4P6V F;  2RDH A;  1F2R I;  3P42 A;  3SFD B;  1N5X A;  2FUG 1;  1YN3 A;  4YSX B;  1PFD A;  3AE9 B;  1TKG A;  4N6E B;  2IJ0 A;  2QIE B;  2LHD A;  2WS3 B;  2NTT A;  1D5X C;  1CQV A;  3Q69 A;  1F2R C;  1N63 A;  1JWB D;  4AQ7 A;  1ROE A;  1N5W A;  1TY0 A;  2QIL A;  1SBB B;  4L23 A;  1F0Z A;  1FXA A;  1YN4 A;  4O1N A;  2NMQ A;  2WNM A;  1EU3 A;  3U52 E;  3AM9 A;  4HKZ E;  2WXK A;  1NEK B;  2W55 A;  1PGA A;  4LTU A;  3AEA B;  4KKJ A;  1WRI A;  2JQR B;  1J7B A;  2JZP A;  4ZYS A;  1SJE D;  2CJN A;  4JPS A;  4XWT A;  1QF6 A;  1FFU A;  4NJC A;  3W5U B;  1FEH A;  2V3N A;  2V3P A;  1C77 A;  3BK1 A;  1FNV A;  1OQQ A;  4YTP B;  1DGJ A;  2W3R A;  1KF6 B;  1P7E A;  2WXO A;  3E56 A;  4WAF A;  3R8B A;  5GXG B;  3W1S A;  2YEP B;  4A8X C;  1HA5 A;  3EUB 2;  1L5P A;  1C9F A;  4XDD A;  1ET6 A;  2IGH A;  3SR6 A;  4MAC A;  3IXS A;  2AX5 A;  5EE0 A;  3P4P B;  2YEP F;  1DOI A;  3NVV A;  1XLO A;  2BBC A;  1JRO A;  1R7S A;  3IAM 1;  4WUR A;  1QT9 A;  4C56 C;  2ICI A;  2HDE A;  4JWU C;  3BYT B;  1T5X D;  3TUO A;  2OHF A;  4OW0 A;  5G5G A;  1VDV A;  1L6V A;  3HVZ A;  3MJ5 A;  1FO4 A;  4KGR A;  1UWM A;  2PW9 A;  3UI3 A;  4CQN A;  1JWA D;  3P63 A;  3U2S C;  1TS4 A;  1JML A;  1KLG D;  2BS3 B;  3KQ4 A;  2ACZ B;  3PZ8 A;  5BYS A;  3H8H A;  2Z8L A;  3AE4 B;  3ZJV A;  4C7Y A;  2X38 A;  3NRZ A;  4ZOH C;  3BVG A;  4IKG A;  4TSS A;  3AMZ A;  2GI9 A;  1XLP A;  3GB1 A;  1IGC A;  3AE5 B;  5D3D A;  1GAQ B;  4KX6 B;  2BB6 A;  1PGX A;  2XNA C;  2N9K A;  3BYY B;  3VRA B;  4L1B A;  2Y3A A;  4NAM A;  1STE A;  2E6X A;  1V1O A;  1TJE A;  5FR3 A;  1QOB A;  2V4I B;  3U4E G;  3KWL A;  5T8I A;  4A55 A;  2L32 A;  1E7P B;  3R2T A;  3GS2 A;  3BVZ A;  1Q10 A;  3MHZ A;  4JE3 B;  1FCL A;  1RWS A;  2BW2 A;  4US9 A;  2QEJ C;  3FC4 A;  2RDG A;  1KTK A;  2LFI A;  2MJ3 A;  2DYO A;  1E6E B;  4YTN B;  4A6Q A;  1ZXH A;  2W82 A;  1PUT A;  5EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...