1ZE3D

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
116
Chain Sequence
DLYFNPRFLLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/structural/membrane protein
total genus 26
structure length 116
sequence length 125
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ze3D00
1ZE3D 4B0MA 3RFZB 1ZDVA 1ZDXA 4B0EA 3BWUD 4J3OD
chains in the Genus database with same CATH superfamily
2QSDA 3ZNHB 3DBSA 4W9KA 4M0WB 1E90A 3NVZA 2WXQA 1EUVB 2JZZA 3DBRB 4ZHOA 4NJ6A 3GOEA 3B08A 2ZCBA 4KX6B 2KANA 1ZXHA 2PTLA 1QQRA 5H92C 1SF0A 1N62A 3FILB 5KHQA 2JX5A 2JXXA 2DAJA 4DK5A 5G5HA 4GN1A 1BUIC 4WJNA 5TR5A 1WYGA 4FA6A 2IYDB 3Q3NC 3I5JC 4US9A 1FPYA 3JSVB 1V6EA 4RF0A 1KM7A 5BMIA 3SD5A 3AEDB 3P4SB 4DHJB 4E71A 1HZ6A 2Y5PA 2CS4A 3AEBB 1JALA 3Q8EA 3SR6A 1WXQA 1FFVA 3CSTA 1QOAA 2MP2A 3QA8A 1D4BA 3RNBC 5FKAC 2KWDA 1UELA 2K9XA 4NQLB 4FBJB 1YN5A 3H6NA 1CK1A 1FXTB 2FUG1 3AU4A 1E0ZA 3HK0A 1WMHA 3AE3B 1I4GA 1UH6A 2KN5A 1T3QA 1WX9A 3L0WB 1WR6E 4OZAA 1XLOA 4AP4C 1WFYA 2GB1A 1E8ZA 4IG7B 1F1HA 2BKFA 2KX3A 4REZA 2M17A 3ZXRA 2VZKD 1ZDVA 2DZIA 2R2QA 4WQOB 1RYJA 1B9RA 1JW9D 1WGHA 1OEYJ 2LVOA 4JPSA 1I4QA 2GMIC 1JRUA 1V9JA 3WANA 1SXTA 4B0EA 5IOIA 1V1OA 1JWMD 2CU1A 2FAZA 3NZSA 3SFEB 3QQ8B 5J18A 3Q6BA 1JMLA 2M8SA 4TQ1A 4W9GA 1SJED 3U52E 2JT4B 4CO7A 1I7HA 1HEZE 3NJTA 1F2RI 5LNK1 2VZKB 3I63C 1ZOYB 1WJ4A 1Q5WB 1FXIA 2ZW1A 2MP2B 1KJTA 2IO0B 3JW0X 4RGNA 1E7UA 3ZUNA 2RDBC 3TEXA 2BYFA 2IJ0A 1ROEA 1D5ZC 1Y56A 2KXJA 1FO4A 1J0GA 3GE3C 2BVCA 2D07B 1I4HA 4NZLB 2FIFA 3B2FA 1GJZA 3ZTDA 2RR9A 4YSYB 2J7QB 4LLGM 3MTNB 2PPHA 2MBOA 4BZAA 3B2GA 1GB1A 3A1QB 1IBXA 3CWIA 3U7ZA 4TMAB 3V60A 2EMTA 1GC7A 4CQNA 2JY6A 1PDXA 4YL8A 2BYTA 2A5UA 4XE0A 4BKGA 2GBMA 4DXFA 5G55A 2WXMA 1P7EA 1J7AA 1KLUD 2G4SA 1T0YA 3DVGY 1SIJA 3B9JA 1HE8A 4LNOA 2IDYA 2ZEQA 1V2YA 3DCGA 2JSVX 2NMQA 3AE7B 3I3TB 4P1CC 4ANVA 3UF8A 3HHMA 5JZEB 4F7ZA 1FMAD 1TS5A 2NPTA 2WU5B 4YTNB 1GB4A 3Q3MC 4HJKA 2KWCA 5C3JB 4AUQC 1UWMA 4J3OD 3AEAB 4HROA 2C7MB 4W9FA 4BFRA 2FCNA 1N60A 3QARA 1ZUD2 2NR2A 1XF5L 2N7JA 3NRZA 1K8RB 2KKCA 1IGDA 1TZOA 4K81A 5HI1A 2WYQA 4BAXA 2XBBC 4K1RB 1VLBA 1IBXB 2FUHB 3HIZA 3TL5A 4ZRQA 3N3KB 1WGRA 3IAM1 4B9KA 3KW5B 2LFIA 1FNWA 1FRDA 1V81A 1XLPA 4FADA 2K6QA 1MG4A 1HZ5A 3W1SC 1KTKA 2MWSB 2Z0EB 2KHWB 3BVGA 3NHEB 3U4EG 4ASWC 1L0XB 3L16A 4IDIA 4HLEA 3GE8C 3T8MA 2H89B 1AWDA 4W9HA 2WNMA 2PLPA 2MCNB 2NPTB 3N30A 1YN3A 2MJEA 3QWZB 2DNFA 2AQ3B 4ZRIA 1N5WA 1ZGUB 3O13A 4OHJA 2LWPA 4A9AA 5BYSA 4ZOHC 1JQ4A 2GI9A 2UWQA 5D94A 3PGEA 4F8CB 3ZW3A 2L00B 2K3UA 2I2YA 5BYRA 2J52A 1L2NA 1RWSA 2WLBA 2JVCA 2AQ2B 2K1FA 4ANUA 3JYUA 1MHXA 1J8CA 4PYUA 5IO9A 2LZ6A 3QAQA 4MELA 1HA5A 1P7FA 1L0YB 4HCNB 3NS1A 2LJIA 3HVZA 2FE8A 4NJ7A 1NYRA 2WXGA 2C7NB 4YSXB 2KVRA 2DENB 3IHPC 4W9JA 4GU2A 2QHOA 2WXHA 1LGRA 1WGGA 1HTOA 4JX1C 3V3XA 1Q10A 4JGHB 3DWGC 4DXGA 3UIOB 1KOTA 1F52A 1P0RA 2Z8LA 5IKCM 4D2KA 4RM9A 1ZP0B 2KMAA 3B0AA 4BKSA 1OEYA 2D3AA 4IC7B 1SIFA 4WAFA 1OTRB 2WGSA 2X8XX 3V6CB 2WXNA 4M8MA 3NZUA 3DVGX 3OJ3A 1WZ0A 4QAYA 2JU6X 5AUIA 1UZXB 4KIKA 3WAPA 1I4XA 2K0PA 1SE4A 4YWGG 5T8IA 2PIAA 3ZLZA 2B76B 2NTSA 3NZ3A 1UGJA 2KDMA 4J6IA 2MW5A 1TS2A 2L8JA 3BK2A 2OJRA 3UGBB 2DZKA 4FHKA 2NVUI 1R4NB 4WWPA 4M00A 4JQWC 3CF6E 1T5XD 4O1NA 4YT0B 2EKIA 3ML9A 4K3BA 2YVCA 4EOYA 1NVID 1E6EB 3UIPB 5HHDG 3HM6X 2WWZA 2RSUA 1ACCA 2UYZB 3U8ZA 1RFKA 1YMHE 3RNCC 2KD0A 2FNJB 2KLGA 3VTVA 1E5WA 1C4CA 2MRPA 2FCSA 3RULA 2L0TA 2AWTA 4ITKA 2V3NA 3PRZA 2AX5A 2BKRB 4KGTA 2MX2A 3QC8B 3KQ4A 4KIKB 4FJVB 4WJQA 4HVBA 1EWYC 5H8YE 5DPWA 1E8XA 3PZ8A 4KKIA 4LTUA 4BOSC 1QOBA 3UQAA 4LK0M 1WE6A 1Q1OA 2N9PC 3QCAA 2D3BA 3H1UA 2Y3AA 2IY0B 2WU2B 1KRHA 2N1VA 3AECB 1WSPA 4PS8A 4GDKA 3H8HA 1AN8A 4BKTA 3KVFB 5C23A 2PJHA 1JWAD 4Q2JA 5J2RA 1E8YA 2IBIB 3AB5A 2KK8A 2V3SA 3AM9A 3AEGB 1WI0A 2WXFA 1T0RC 2NBUA 3ML8A 4II2B 2LASA 5G5GA 1TS4A 2C7HA 1HXYD 1WXMA 1UUPA 5GXGB 3GZNI 2V1YA 4BVUC 3AE4B 3LJ3A 3I57A 1D3ZA 3BYTB 1E7VA 1V5OA 2HTHA 2ZNVC 3ZKJC 2L83A 3MHZA 2G1EA 3URYA 2CHXA 4LNIA 5DCNA 1PQSA 1L7YA 1PGXA 2WDTB 1K51A 3IAS1 3FAHA 4DHJD 4K7SA 1L6UA 3WAMA 2L05A 3AE6B 3HVDA 2KYWA 5JHAA 3PV1A 3OG5A 4EFOA 2KTFA 4XC2A 1D5MC 3QHTA 5JHBA 2W3SA 1GG3A 3N1XC 1TBEA 4GDKB 4JWSC 3SHQA 4GMVA 2Y5CA 3P42A 2K25A 4P7IA 4XX5A 5E6OA 5C2TB 2MA9B 1IP9A 4W9DA 1CZPA 2J53A 3V05A 1PGBA 2MQJA 1WYWB 3SU8X 1UBQA 4L23A 4RH6A 2J0MA 1C77A 1RFAA 4K3CA 4EE2A 1S1QB 1D6EC 1EU3A 3QX1A 4P16A 1WXVA 1VZ6A 3L13A 3GS2A 3AH7A 3V6EB 2PEAA 2KDEB 2A4ZA 1G6JA 1UBIA 1K50A 1JROA 3VRBB 1EF5A 2YLMA 2KDFB 5DPSA 3WAOA 1CMXB 2L76A 1MFWA 1OQYA 1P1AA 3PLUA 3FC4A 5EE3A 3TEWA 4TUUA 3AXCA 1V1PB 3ZGZA 1UD7A 3QK0A 1TKGA 2K8HA 4IWPA 2KJHB 3A1QA 1SE3A 2DWQA 2KC1A 3BWUD 1WGYA 5CX3A 2JWUA 2QCZA 4YTPB 4WWMA 2RGFA 4GB9A 4II3B 3KYDD 3NOBA 3B1LX 5D2MB 1TKEA 1WGDA 2KJRA 1TGZB 4ACFA 2V0GA 1PYWD 3ZNZB 4IKGA 2LXCA 2LGIA 2MBBB 3KUZA 2DAFA 1EM7A 4ICVA 2GBRA 5AEKB 4GXBA 2GOWA 3H7PA 1XCQL 1SE2A 3RYTA 2IGGA 4C56C 2HTME 5HFYA 3EC8A 3RUIB 5CHVC 1V5TA 5D6JB 3VHTC 4H2AA 2RD0A 4MSQB 3R8BA 4AJWA 5CTRC 2Y5BB 2O2VA 4A20A 4C7YA 1YJIA 1OQQA 4OVZA 4UDUC 2GRIA 4NPNA 4I6LB 3NVWA 1XQQA 1QKZA 3PZ7A 2K5PA 1TY0A 2LGYA 4XGAB 1OGWA 3W9CB 4ZHPA 4IW0A 2N9EB 4M8NA 4US8A 3VVWB 4W9LA 4HKQA 1KLVA 4KSLC 1WE7A 3VUWA 1OFFA 1SGHA 3EA6A 1ZXIA 4ARIA 4FXCA 2EKEC 2CHZA 4RCOA 3U2SC 4HPMB 4KDLB 2KMMA 2ASQA 2BYEA 5L83A 2DZMA 2MBEA 2N9XA 1SJHD 1RM6C 3OWEB 3TMPB 1H8CA 3ABVB 1IUEA 4LDTD 2LHDA 3H7PB 2PVGC 2ZZPB 2ZPNA 4OW0A 2L0FA 2JPHA 2KJ6A 3X23A 3MP9A 3R2TA 3AE2B 3A33B 2PE9A 1ISNA 4KGRA 3NY5A 2K39A 2QMTA 2O2VB 1T6BX 2HJ8A 1E10A 4E3CA 1WX7A 1YIWA 3HRDD 4TSSA 5EE9A 3J9CA 3DWMA 2INPE 3P4QB 3SFDB 4G50A 3TSSA 1BMLC 3MC0B 2JRHA 2MBQA 2FIDA 1E7PB 2BTEA 4NQKE 1FNVA 4LDTB 3ZJTA 1OQRA 3L10B 4JL9A 3Q3OC 2K8BA 1YQ4B 4HKZE 1IGCA 2WDQB 4FJYA 3UQBA 3BVMA 2B3AA 4ZRPA 4FULA 2WX1A 2ZPYA 2G45B 3BIID 1VJKA 3N9YC 2WXPA 1C4PA 1YNTE 3LXFA 5AZFA 2DX5B 1E8WA 3VUXA 2HDEA 4XDDA 3RNEC 4W9IA 4OZCA 3TIXA 3A4SC 2NBWB 2WX0A 1I42A 2KFKA 4RM8A 2IPKD 3EUB2 1FCCC 2W55A 4G11A 1TY2A 4JLCA 1C78A 1UWXA 2D2QA 2IGHA 3ZJVA 4S0RA 3RD2A 4YTMB 2J42A 3DDCB 4F1SA 2MJDA 1L4DB 2AEHA 3IVFA 4HK2A 1A70A 4RGTA 1WJNA 2NCNA 1ZKHA 1IPGA 1WWTA 1NENB 1K52A 3M63B 2BQQA 2FCMA 1ZE3D 5FR3A 3CSFA 3PRPB 4KGSA 1MPEA 1X1MA 3PO0A 3Q3JA 3ZO5B 4EZLA 1GPXA 1V86A 5E6NA 3AE1B 1C1YB 1L5PA 2CR5A 1U4AA 4CYEA 4WWOA 3OLMD 2KFKB 4C80A 4CHKA 1LQBA 2ON8A 3TEYA 3BZDB 2N1WA 3BY4B 4E74A 2KACA 2KT7A 2DBYA 4URKA 2JUOA 1J7BA 1VD2A 4KV2A 3CIRB 2GBNA 4K7WA 3SDLC 2ZJDA 3P4PB 3V61A 1MJDA 1WX8A 4BOZB 2K8CA 4HPLB 3W5VB 4DXAB 2DYMA 2N7DA 2KDBA 4LCDE 2LUEA 1UGMA 2MSED 2MJ3A 3N20C 3R7RA 3KYCD 1VZ8A 2PVOD 1FXAA 2W3RA 2N0SB 3R3MA 3PSEB 1V49A 4MGYE 4BKSD 2JWZA 3W1YA 1VR9A 3E56A 3EGRA 1F2RC 1GUAB 1F9JA 1FCLA 2R61A 2W54A 1P98A 5KHOA 1NDDA 3RMKC 2LVQA 1P3QU 3ZQ4A 4NNJB 1Z5SB 3RCZA 2XN9C 2LGSA 2M19A 2EMSA 2WXKA 3C8YA 1LFDA 2WXJA 3R66C 2L1AA 4ZYNA 2C5LC 3NVVA 4USAA 2KLCA 1NI3A 1WXSA 1XEEA 1Q0WB 4B95A 3MJ5A 3SEBA 4ANXA 2Q5WD 3Q8BA 1AARA 1LO5D 2D11A 1SBBB 3QIJA 3AI5A 1I4RA 5AZGA 2WP9B 4I6NB 1YX6B 2FCQA 4L2YA 4MGKE 2WQYB 4WWNA 2V9HA 2ZCCA 3Q69A 1ZPSA 2BT6A 1CJEA 1L4ZB 2INDC 2OJWA 1SB3C 1HQRD 4MJSA 3RFZB 5D3IB 1TTNA 2IGDA 2OHFA 3AE5B 3RT3B 1WR1A 1C9FA 4HXDA 1WM3A 4W9CA 3QJZA 1XLQA 1J19A 2KNBA 2LHEA 2YEPF 3PTFC 5JXVA 1JWUD 3VH3B 1JRPA 2V4LA 3BVZA 1MI0A 4RF1A 1WJUA 3VAWA 3DQVA 5D7GA 1TYGB 2RDGA 1FRRA 4R3DA 4XWTA 1FFUA 3PHWB 2M1MA 2M4NA 2K6DB 1FD6A 1T0SC 3L08A 1EWCA 1DOIA 2IO1B 5AUKA 1V80A 3ALBA 1TKYA 4MM3A 1WH3A 3IBEA 3Q14C 4EEWA 2PW9A 2ZVOA 2K22A 3ZNGC 3DVNU 3AE9B 3P63A 3TUOA 5GMVA 3Q8AA 3N1YC 4ZRJA 1GAQB 2ZVNA 2HJ1A 2R2OA 1XLNA 1YJJA 5E6JA 1L6VA 4MT5A 4IM3A 2REXA 3PT2B 4GOCA 4AQ7A 3WA0A 1N6ZA 3DVNV 4MJSB 3DBHI 1PGAA 3NG0A 2JRIB 4M02A 4B6WA 3AN1A 3WALA 4TKNA 5HKHA 2CHWA 4DBGA 5LXHA 3L17A 1P9DU 2IO2B 2VH1A 4WQMA 3VR9B 1V1PA 2KC2A 2I1JA 4OVUA 2L52A 3K9PB 3GZNB 3KLSX 3OAWA 2PKOA 2C60A 5C1ZA 1WJ6A 5J17A 3DHHC 1AW7A 4NJCA 1MVKA 2W9NA 1EU4A 2DYOA 2KQ7A 4KDIC 2NBVB 2CU3A 4EZKA 5IP4D 3APCA 3TCAA 2KAJA 2KDIA 1E9MA 1L0VB 1KH0A 2LEKA 4DDGD 3A9KA 3BYYB 3VFKA 3ZYYX 1HTQA 4A55A 3DBHB 3MC8A 1TT5B 1GC6A 3IFWB 4LNFA 2KVZA 4MM3B 3ZRFA 4EUTA 3EHVA 2L7RA 1GOZA 3W2DA 1GNUA 1H4RA 1WZ3A 4MH8A 2LRUA 3M95A 3IT4B 2NTTA 1ESFA 3KWLA 4XDCA 1XXGA 4G3XB 3PZDA 3ZNID 4ZYSA 4DHZB 2KWVB 4LNNA 2UU7A 2JYTA 2LXAA 4KZ0A 1EF1A 2OEDA 3RNAC 1NYQA 2KOXA 4YXDB 1TS3A 1QT9A 3VRAB 1WF9A 1YJ1A 2LI5A 5EDSA 5D3DA 1ENFA 4WJOA 2G9HD 2D3GA 1QOFA 2N7EA 3Q8FA 4GLSC 3EECA 3Q2AC 3PLVA 4W9EA 3GB1A 2WXLA 2MHJA 4K7UA 4MEMA 3R7QA 1YX5B 4NY0A 3A9KB 1A5RA 3DPDA 3PREA 3AMZA 2LMCA 2PMVA 5BO4B 2KTRA 2N4FA 2Z59B 2HD5B 4PK1A 2PE6B 2LRWA 2QJLA 5E6PA 1PUTA 2JYEA 1WY8A 4AS1A 3EFUA 4GGQA 1D5XC 2D10A 3KH0A 1STEA 1UF0A 3RI7C 1YOVB 3W5UB 2KQ4X 2BGFA 4PS7A 5CHWA 1KLGD 4A90A 2RPVA 2J4XA 1UNSA 2AL6A 3HUIA 1VZ7A 2V3PA 3DHIC 1FIQA 4RMAA 1JWSD 1RAXA 1QLBB 2AL3A 3CMMB 4NAWA 4DQOC 2KWUB 4I6PA 1WMHB 3NVYA 3PRMB 2GBJA 4ARCA 5FK9C 1DOXA 3UINB 4GDLA 3A9JA 4KZCA 1XT9B 3AULA 1B1ZA 2D5GA 3NS8A 2KZRA 4FN2A 2IO3B 4LJOB 4ANWA 4C7ZA 2ONQA 2BPSA 1SE9A 2RPQA 2WDVB 4C4VA 1YD8U 3T3NA 4P6VF 2XNAC 3IG3A 2HE7A 3AV8A 2KTRB 4YSZB 2LVPA 3VH4B 2BW2A 2G3QB 3P4RB 4AJYB 4BBNC 2KN4A 4WAAA 1TZ1A 4G0NB 2V4IB 5I4DA 1VCBA 2H88B 2LJ5A 2MLBA 3T9LA 1FM0D 1QOGA 4PT5A 4HDQA 5EE1A 2J0JA 1C4AA 2ICIA 2QDFA 4X57B 5MPOA 3VR8B 1K53A 3N1ZC 2L32A 4FJZA 1R4MI 1YN4A 2NS5A 3ENEA 1SSNA 2WS3B 4P1BC 3VUYA 4NAWB 2N9LA 3ZXVA 1Y8RC 2BYVE 2I38A 4ICUA 4GDLB 3A9JB 2ZW0A 1EO6A 2MEKA 4XYCA 3VTUA 1N5XA 3L54A 4HEA1 2QIEB 4MSMB 4PS3A 3K9OB 2GLSA 4FHJA 2JQRB 4HWIB 1NEKB 4AWJA 4C4VB 2WXRA 2FBWB 4IUMB 2VRRB 2CJNA 1JCKB 5IA7A 1QZEA 1R4MB 2BWFA 4MGIE 1DGJA 5CHFA 4NAMA 3AEEB 4A8XC 3VDZA 3C0RB 5DPRA 3U7DA 1AYFA 3X0WA 4C00A 5FR6A 3BINA 1N63A 2KQSA 1RLFA 4IOIE 4OZBA 1DYQA 3WCQA 1ZW7A 4HDOA 2JXTA 4WH4A 1MG8A 1RRBA 2XK5A 2BS2B 4DWFA 2GBKA 3PS6A 3VTWA 3RNFC 2E6XA 2J0KA 2W82A 1QF6A 2ZNVB 3RZWC 3KWVA 1VDVA 1C79A 2BBCA 4RGOS 1WRIA 3ECIA 1BXTA 3VQIA 1XO3A 5LXIB 3L4PA 1ZDXA 4HCPB 3O65B 3RPFC 2JZ3B 1LXDA 1WM2A 1IYFA 3MJWA 1M4VA 3R2IA 1C3TA 2BS3B 4EKUA 3DBLI 3Q8CA 2WXIA 2KX0A 4N58A 4MDKE 4EZJA 4TV3A 1S3SG 2AQ1B 3C19A 3V62A 5IN7A 2E3TA 3Q3FA 2LD9A 4A6QA 2BB5A 2QEJC 1J7CA 4MGZE 2QILA 3EFCA 2G4DB 1I4PA 2XK5B 2MBHA 1DOYA 2BS4B 2BWES 2DHZA 4ZRKA 2IZVB 3MHSD 3N32A 3M3JA 4M01A 4FLHA 1JWBD 2MH7A 3DBLB 3I9V1 3ETRA 2RMMA 3M62B 4LJPB 3S2AA 4KSKC 3ZDTA 2QC8A 1YQ3B 4ZDVA 5BMHA 2Z0DB 2CJOA 4PYZA 4GSWA 1ET6A 3T3OA 3H7SA 4RGMA 3KUDB 3ZVVA 1R4NI 3DHGC 3KUCB 1TIFA 4IM0A 2X38A 3TJPA 2SAKA 4N9F4 2DZJA 5BMGA 1NBFC 3DOWA 3P1MA 3IXSA 3ZIMA 4XWWA 2M56B 3AU5A 1Z2MA 3U30A 3NUHB 4JWUC 3TBLD 4A3OA 1YQBA 3OJ4B 3ZRCA 3APFA 3UI3A 4DHZE 1MHHE 2CKHB 3PVLA 2LGDA 3JVZX 3H9DA 5DPTA 5IAAC 4RFBA 1NI2A 3A4RA 5L95C 3AEFB 3ZDMC 3GP7A 4JE3B 4HPPA 1ET9A 4DDID 4RNAA 2AYOB 1WIAA 2INNE 4GIVA 1KFYB 4TQ0A 3BK1A 3P2BA 1XCTL 3TEZA 1SEBD 2LGXA 1TJEA 2WHIA 5AZHA 1F77A 3APDA 4MH0E 2N9KA 2BB6A 3ONSA 2O6VA 4BBNF 2DYBA 2OOBB 1I35A 4IM2A 3VXWA 1T0QC 3LDZE 1F0ZA 1XD3B 4HRSA 4OVVA 3ZTCA 4N59A 4KVGB 3RZFA 2JZPA 2ACZB 3IT6B 3PHXB 1M94A 3MFGA 2WDRB 3D32A 2DLBA 4M0WA 3RN9C 2JF5A 2M0XA 1PFDA 4S17A 1V8CA 1CQVA 2KFJA 2EELA 4IWOA 2I1KA 3PPAA 2LUMA 2O6VD 4N6EB 4JIOU 2VH2A 5G2NA 2TSSA 3FILA 2BF8B 2INCC 4WURA 4HJGE 3AE8B 4LNKA 1WXAA 2M0AA 2KO3A 1LM8B 2KMCA 1BT0A 3W1SA 3WIMA 4AOFA 2L3ZA 3DBRI 5EE0A 2RDHA 2WXOA 4WIPA 1N61A 5TSSA 5HG2A 4XZ4A 2D3CA 3LB8C 2XEWA 3JSVA 4B0MA 4KKJA 1QILA 2YEPB 2C9WB 1FNUA 1WRDB 4WJPA 3E9SA 3HM3A 2O6VB 1V97A 5JH5C 2SEBD 3ZJUA 1R7SA 1KF6B 3LYYA 2IY1B 5BYQA 1VRAB 4L1BA 3MC9A 5LLIA 3RNGC 1C76A 4A3PA 1FEHA 1WGKA 3FKYA 4MACA 4IWQA
chains in the Genus database with same CATH topology
2RPVA 2B76B 2J4XA 2NTSA 1UNSA 2QSDA 2HDEA 4XDDA 3HUIA 1VZ7A 3NVZA 3NZ3A 2WXQA 1UGJA 4OZCA 2KDMA 2V3PA 1FIQA 4ZHOA 1TS2A 1JWSD 3BK2A 2IPKD 1QLBB 3EUB2 1FCCC 2W55A 1TY2A 1C78A 4KX6B 4DQOC 1ZXHA 1UWXA 2PTLA 1QQRA 3NVYA 5H92C 1SF0A 1N62A 1T5XD 4O1NA 2IGHA 5FK9C 3ZJVA 3FILB 4ARCA 1DOXA 4YT0B 2EKIA 2JX5A 4YTMB 2J42A 1B1ZA 1NVID 1E6EB 1L4DB 2MJDA 5HHDG 2D5GA 5G5HA 1BUIC 4C7ZA 1ACCA 4RGTA 1A70A 1WYGA 2ONQA 1RFKA 2WDVB 1YMHE 4US9A 3T3NA 4P6VF 1WWTA 2XNAC 1NENB 3AV8A 4YSZB 1C4CA 1K52A 1ZE3D 4RF0A 4ITKA 2BW2A 5BMIA 2V3NA 3P4RB 3AEDB 3P4SB 2AX5A 5FR3A 4KGTA 1HZ6A 2KN4A 2Y5PA 3AEBB 1JALA 3Q8EA 3KQ4A 3SR6A 1WXQA 4KGSA 2V4IB 1MPEA 5I4DA 1EWYC 1FFVA 2H88B 3PO0A 5H8YE 3PZ8A 1QOAA 4KKIA 4LTUA 1GPXA 1QOBA 1FM0D 1QOGA 1D4BA 4LK0M 4PT5A 5FKAC 2KWDA 2K9XA 3AE1B 1L5PA 5EE1A 1YN5A 1CK1A 1C4AA 2FUG1 2ICIA 5MPOA 1E0ZA 2Y3AA 3AE3B 1I4GA 3VR8B 1K53A 1T3QA 2L32A 1KRHA 2WU2B 1YN4A 3AECB 4OZAA 1WSPA 4C80A 2ON8A 1XLOA 1SSNA 2GB1A 3TEYA 2WS3B 3BZDB 4REZA 3H8HA 4NAWB 1AN8A 2KACA 2VZKD 1ZDVA 2DBYA 2N9LA 1J7BA 1JWAD 4Q2JA 2I38A 3CIRB 1RYJA 1B9RA 3AB5A 4GDLB 2ZW0A 3AM9A 3AEGB 1JW9D 2MEKA 2WXFA 1N5XA 3P4PB 4HEA1 5G5GA 1TS4A 2QIEB 3W5VB 2DYMA 4JPSA 1I4QA 1HXYD 1UUPA 2JQRB 5GXGB 1NEKB 1SXTA 4B0EA 3AE4B 1V1OA 2WXRA 1JWMD 3I57A 2FBWB 3BYTB 2MJ3A 3SFEB 1VZ8A 2CJNA 2PVOD 1JCKB 1FXAA 2W3RA 1JMLA 2N0SB 4TQ1A 2L83A 3MHZA 2G1EA 3URYA 1SJED 3U52E 1DGJA 1VR9A 1I7HA 3E56A 3EGRA 1HEZE 4NAMA 3AEEB 1F2RC 1F2RI 4A8XC 5LNK1 2VZKB 1PGXA 1FCLA 2R61A 1AYFA 2W54A 1ZOYB 1K51A 3IAS1 3FAHA 1FXIA 2ZW1A 3ZQ4A 1N63A 1L6UA 4RGNA 4IOIE 4OZBA 2XN9C 1DYQA 3AE6B 2M19A 3HVDA 3WCQA 2JXTA 2WXKA 4WH4A 3TEXA 3C8YA 1D5MC 2IJ0A 2WXJA 2L1AA 2BS2B 1ROEA 1D5ZC 1Y56A 3NVVA 2W3SA 4USAA 1NI3A 4GDKB 1FO4A 4JWSC 1XEEA 2Y5CA 2E6XA 2W82A 3MJ5A 1QF6A 3P42A 1I4HA 4NZLB 3SEBA 5C2TB 2Q5WD 3KWVA 1VDVA 3Q8BA 1C79A 3B2FA 1LO5D 1SBBB 2BBCA 4YSYB 4RGOS 1WRIA 4LLGM 1CZPA 1I4RA 1BXTA 2WP9B 3B2GA 1GB1A 3VQIA 2J53A 1XO3A 1PGBA 3V05A 1IBXA 3CWIA 4L2YA 3U7ZA 4TMAB 4CQNA 3L4PA 1ZDXA 2WQYB 4L23A 1PDXA 3Q69A 2BYTA 4RH6A 1ZPSA 2BT6A 4XE0A 3RPFC 1CJEA 1C77A 1L4ZB 4EE2A 1SB3C 1HQRD 1D6EC 1EU3A 4P16A 4DXFA 1M4VA 1VZ6A 1P7EA 2WXMA 3R2IA 1J7AA 1KLUD 5D3IB 2BS3B 3RFZB 2IGDA 1SIJA 2OHFA 3B9JA 3AE5B 1C9FA 3Q8CA 3GS2A 1XLQA 2IDYA 3AH7A 2WXIA 2LHEA 2JSVX 2YEPF 4N58A 5JXVA 2NMQA 3AE7B 1JWUD 2AQ1B 1K50A 1JROA 3VRBB 1JRPA 3BVZA 2E3TA 1MI0A 4RF1A 1FMAD 1TS5A 4A6QA 2BB5A 2QEJC 2WU5B 1J7CA 4YTNB 1GB4A 2QILA 3FC4A 5EE3A 5C3JB 5D7GA 3TEWA 1I4PA 1UWMA 4J3OD 1V1PB 1TYGB 3AEAB 3ZGZA 4HROA 2RDGA 1TKGA 1FRRA 4R3DA 4XWTA 1FFUA 1DOYA 2BS4B 1N60A 1ZUD2 1SE3A 1XF5L 2DWQA 1FD6A 2N7JA 3BWUD 1EWCA 3NRZA 1DOIA 1JWBD 2MH7A 5AUKA 2JWUA 4YTPB 1TKYA 1IGDA 3I9V1 3ETRA 4WWMA 2PW9A 2RMMA 2K22A 1TZOA 3AE9B 1YQ3B 3P63A 3TUOA 5BMHA 5HI1A 3Q8AA 2CJOA 1TKEA 1VLBA 1ET6A 1IBXB 3T3OA 1GAQB 4RGMA 4ZRQA 2V0GA 1XLNA 1YJJA 1PYWD 5E6JA 1L6VA 4IKGA 4MT5A 2X38A 2LGIA 3IAM1 2SAKA 1EM7A 2LFIA 4AQ7A 1FNWA 1FRDA 5BMGA 1XLPA 1PGAA 3P1MA 3IXSA 3AN1A 1HZ5A 4XWWA 2M56B 1XCQL 1KTKA 1SE2A 3BVGA 2IGGA 3U4EG 4C56C 2HTME 5HFYA 1L0XB 3NUHB 4IDIA 4JWUC 4WQMA 3VR9B 1V1PA 2H89B 1AWDA 4H2AA 2L52A 2WNMA 3KLSX 3R8BA 3UI3A 2PKOA 2PLPA 4C7YA 1MHHE 1AW7A 1YJIA 4NJCA 1OQQA 4OVZA 1MVKA 1YN3A 2GRIA 4UDUC 2MJEA 3NVWA 1EU4A 4RFBA 2AQ3B 1QKZA 3AEFB 3PZ7A 2DYOA 3GP7A 2K5PA 4JE3B 2CU3A 1N5WA 1TY0A 3O13A 1ET9A 4OHJA 3W9CB 2KAJA 4ZHPA 4A9AA 5BYSA 1E9MA 4RNAA 1L0VB 4ZOHC 1KH0A 2LEKA 2INNE 1JQ4A 2GI9A 3BYYB 3ZYYX 4A55A 4US8A 1KFYB 4TQ0A 3BK1A 4HKQA 1XCTL 3TEZA 2K3UA 4MM3B 1SEBD 2I2YA 1TJEA 1F77A 1OFFA 3EA6A 5BYRA 1ZXIA 4ARIA 2J52A 4FXCA 1GOZA 1RWSA 3W2DA 2N9KA 2BB6A 4MH8A 2WLBA 4RCOA 3U2SC 2KMMA 2AQ2B 3IT4B 2NTTA 1F0ZA 4HRSA 1ESFA 3KWLA 4XDCA 1SJHD 1RM6C 3OWEB 4N59A 1XXGA 1MHXA 2JZPA 2ACZB 3ABVB 3IT6B 1IUEA 4ZYSA 3MFGA 2WDRB 2DLBA 4M0WA 2JYTA 2LHDA 2OEDA 1HA5A 1P7FA 2PVGC 1L0YB 1NYQA 3NS1A 2LJIA 3HVZA 4OW0A 4YXDB 1PFDA 1TS3A 2FE8A 1V8CA 1NYRA 1CQVA 3MP9A 2WXGA 3R2TA 3AE2B 4YSXB 2EELA 1QT9A 3VRAB 2LUMA 4KGRA 4N6EB 5D3DA 1ENFA 2WXHA 2QMTA 2G9HD 2TSSA 1QOFA 3FILA 1T6BX 4JX1C 4WURA 3Q8FA 4GLSC 1Q10A 4HJGE 3DWGC 3V3XA 1E10A 3AE8B 4DXGA 3HRDD 4TSSA 5EE9A 2M0AA 3DWMA 3J9CA 2INPE 2Z8LA 3P4QB 3GB1A 3SFDB 3W1SA 4D2KA 2WXLA 1ZP0B 3TSSA 1BMLC 3MC0B 5EE0A 2RDHA 2WXOA 4WIPA 4WAFA 1N61A 1E7PB 2BTEA 5TSSA 5HG2A 3LB8C 3AMZA 2LMCA 2PMVA 1FNVA 2WXNA 4B0MA 3ZJTA 1OQRA 4KKJA 2QJLA 1PUTA 1QILA 2JYEA 2YEPB 4AS1A 1FNUA 1YQ4B 4HKZE 1IGCA 2WDQB 3BVMA 2JU6X 3E9SA 5AUIA 4ZRPA 1V97A 3ZJUA 2SEBD 1D5XC 1R7SA 1KF6B 1STEA 3BIID 1I4XA 2K0PA 3LYYA 5BYQA 1VRAB 1VJKA 3N9YC 3W5UB 4L1BA 2WXPA 1SE4A 1C4PA 2KQ4X 4YWGG 1YNTE 1C76A 3LXFA 1KLGD 5T8IA 1FEHA 1WGKA 2PIAA 4A90A 4MACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE3 D;  4B0M A;  3RFZ B;  1ZDV A;  1ZDX A;  4B0E A;  3BWU D;  4J3O D; 
#chains in the Genus database with same CATH topology
 2QSD A;  3ZNH B;  3DBS A;  4W9K A;  4M0W B;  1E90 A;  3NVZ A;  2WXQ A;  1EUV B;  2JZZ A;  3DBR B;  4ZHO A;  4NJ6 A;  3GOE A;  3B08 A;  2ZCB A;  4KX6 B;  2KAN A;  1ZXH A;  2PTL A;  1QQR A;  5H92 C;  1SF0 A;  1N62 A;  3FIL B;  5KHQ A;  2JX5 A;  2JXX A;  2DAJ A;  4DK5 A;  5G5H A;  4GN1 A;  1BUI C;  4WJN A;  5TR5 A;  1WYG A;  4FA6 A;  2IYD B;  3Q3N C;  3I5J C;  4US9 A;  1FPY A;  3JSV B;  1V6E A;  4RF0 A;  1KM7 A;  5BMI A;  3SD5 A;  3AED B;  3P4S B;  4DHJ B;  4E71 A;  1HZ6 A;  2Y5P A;  2CS4 A;  3AEB B;  1JAL A;  3Q8E A;  3SR6 A;  1WXQ A;  1FFV A;  3CST A;  1QOA A;  2MP2 A;  3QA8 A;  1D4B A;  3RNB C;  5FKA C;  2KWD A;  1UEL A;  2K9X A;  4NQL B;  4FBJ B;  1YN5 A;  3H6N A;  1CK1 A;  1FXT B;  2FUG 1;  3AU4 A;  1E0Z A;  3HK0 A;  1WMH A;  3AE3 B;  1I4G A;  1UH6 A;  2KN5 A;  1T3Q A;  1WX9 A;  3L0W B;  1WR6 E;  4OZA A;  1XLO A;  4AP4 C;  1WFY A;  2GB1 A;  1E8Z A;  4IG7 B;  1F1H A;  2BKF A;  2KX3 A;  4REZ A;  2M17 A;  3ZXR A;  2VZK D;  1ZDV A;  2DZI A;  2R2Q A;  4WQO B;  1RYJ A;  1B9R A;  1JW9 D;  1WGH A;  1OEY J;  2LVO A;  4JPS A;  1I4Q A;  2GMI C;  1JRU A;  1V9J A;  3WAN A;  1SXT A;  4B0E A;  5IOI A;  1V1O A;  1JWM D;  2CU1 A;  2FAZ A;  3NZS A;  3SFE B;  3QQ8 B;  5J18 A;  3Q6B A;  1JML A;  2M8S A;  4TQ1 A;  4W9G A;  1SJE D;  3U52 E;  2JT4 B;  4CO7 A;  1I7H A;  1HEZ E;  3NJT A;  1F2R I;  5LNK 1;  2VZK B;  3I63 C;  1ZOY B;  1WJ4 A;  1Q5W B;  1FXI A;  2ZW1 A;  2MP2 B;  1KJT A;  2IO0 B;  3JW0 X;  4RGN A;  1E7U A;  3ZUN A;  2RDB C;  3TEX A;  2BYF A;  2IJ0 A;  1ROE A;  1D5Z C;  1Y56 A;  2KXJ A;  1FO4 A;  1J0G A;  3GE3 C;  2BVC A;  2D07 B;  1I4H A;  4NZL B;  2FIF A;  3B2F A;  1GJZ A;  3ZTD A;  2RR9 A;  4YSY B;  2J7Q B;  4LLG M;  3MTN B;  2PPH A;  2MBO A;  4BZA A;  3B2G A;  1GB1 A;  3A1Q B;  1IBX A;  3CWI A;  3U7Z A;  4TMA B;  3V60 A;  2EMT A;  1GC7 A;  4CQN A;  2JY6 A;  1PDX A;  4YL8 A;  2BYT A;  2A5U A;  4XE0 A;  4BKG A;  2GBM A;  4DXF A;  5G55 A;  2WXM A;  1P7E A;  1J7A A;  1KLU D;  2G4S A;  1T0Y A;  3DVG Y;  1SIJ A;  3B9J A;  1HE8 A;  4LNO A;  2IDY A;  2ZEQ A;  1V2Y A;  3DCG A;  2JSV X;  2NMQ A;  3AE7 B;  3I3T B;  4P1C C;  4ANV A;  3UF8 A;  3HHM A;  5JZE B;  4F7Z A;  1FMA D;  1TS5 A;  2NPT A;  2WU5 B;  4YTN B;  1GB4 A;  3Q3M C;  4HJK A;  2KWC A;  5C3J B;  4AUQ C;  1UWM A;  4J3O D;  3AEA B;  4HRO A;  2C7M B;  4W9F A;  4BFR A;  2FCN A;  1N60 A;  3QAR A;  1ZUD 2;  2NR2 A;  1XF5 L;  2N7J A;  3NRZ A;  1K8R B;  2KKC A;  1IGD A;  1TZO A;  4K81 A;  5HI1 A;  2WYQ A;  4BAX A;  2XBB C;  4K1R B;  1VLB A;  1IBX B;  2FUH B;  3HIZ A;  3TL5 A;  4ZRQ A;  3N3K B;  1WGR A;  3IAM 1;  4B9K A;  3KW5 B;  2LFI A;  1FNW A;  1FRD A;  1V81 A;  1XLP A;  4FAD A;  2K6Q A;  1MG4 A;  1HZ5 A;  3W1S C;  1KTK A;  2MWS B;  2Z0E B;  2KHW B;  3BVG A;  3NHE B;  3U4E G;  4ASW C;  1L0X B;  3L16 A;  4IDI A;  4HLE A;  3GE8 C;  3T8M A;  2H89 B;  1AWD A;  4W9H A;  2WNM A;  2PLP A;  2MCN B;  2NPT B;  3N30 A;  1YN3 A;  2MJE A;  3QWZ B;  2DNF A;  2AQ3 B;  4ZRI A;  1N5W A;  1ZGU B;  3O13 A;  4OHJ A;  2LWP A;  4A9A A;  5BYS A;  4ZOH C;  1JQ4 A;  2GI9 A;  2UWQ A;  5D94 A;  3PGE A;  4F8C B;  3ZW3 A;  2L00 B;  2K3U A;  2I2Y A;  5BYR A;  2J52 A;  1L2N A;  1RWS A;  2WLB A;  2JVC A;  2AQ2 B;  2K1F A;  4ANU A;  3JYU A;  1MHX A;  1J8C A;  4PYU A;  5IO9 A;  2LZ6 A;  3QAQ A;  4MEL A;  1HA5 A;  1P7F A;  1L0Y B;  4HCN B;  3NS1 A;  2LJI A;  3HVZ A;  2FE8 A;  4NJ7 A;  1NYR A;  2WXG A;  2C7N B;  4YSX B;  2KVR A;  2DEN B;  3IHP C;  4W9J A;  4GU2 A;  2QHO A;  2WXH A;  1LGR A;  1WGG A;  1HTO A;  4JX1 C;  3V3X A;  1Q10 A;  4JGH B;  3DWG C;  4DXG A;  3UIO B;  1KOT A;  1F52 A;  1P0R A;  2Z8L A;  5IKC M;  4D2K A;  4RM9 A;  1ZP0 B;  2KMA A;  3B0A A;  4BKS A;  1OEY A;  2D3A A;  4IC7 B;  1SIF A;  4WAF A;  1OTR B;  2WGS A;  2X8X X;  3V6C B;  2WXN A;  4M8M A;  3NZU A;  3DVG X;  3OJ3 A;  1WZ0 A;  4QAY A;  2JU6 X;  5AUI A;  1UZX B;  4KIK A;  3WAP A;  1I4X A;  2K0P A;  1SE4 A;  4YWG G;  5T8I A;  2PIA A;  3ZLZ A;  2B76 B;  2NTS A;  3NZ3 A;  1UGJ A;  2KDM A;  4J6I A;  2MW5 A;  1TS2 A;  2L8J A;  3BK2 A;  2OJR A;  3UGB B;  2DZK A;  4FHK A;  2NVU I;  1R4N B;  4WWP A;  4M00 A;  4JQW C;  3CF6 E;  1T5X D;  4O1N A;  4YT0 B;  2EKI A;  3ML9 A;  4K3B A;  2YVC A;  4EOY A;  1NVI D;  1E6E B;  3UIP B;  5HHD G;  3HM6 X;  2WWZ A;  2RSU A;  1ACC A;  2UYZ B;  3U8Z A;  1RFK A;  1YMH E;  3RNC C;  2KD0 A;  2FNJ B;  2KLG A;  3VTV A;  1E5W A;  1C4C A;  2MRP A;  2FCS A;  3RUL A;  2L0T A;  2AWT A;  4ITK A;  2V3N A;  3PRZ A;  2AX5 A;  2BKR B;  4KGT A;  2MX2 A;  3QC8 B;  3KQ4 A;  4KIK B;  4FJV B;  4WJQ A;  4HVB A;  1EWY C;  5H8Y E;  5DPW A;  1E8X A;  3PZ8 A;  4KKI A;  4LTU A;  4BOS C;  1QOB A;  3UQA A;  4LK0 M;  1WE6 A;  1Q1O A;  2N9P C;  3QCA A;  2D3B A;  3H1U A;  2Y3A A;  2IY0 B;  2WU2 B;  1KRH A;  2N1V A;  3AEC B;  1WSP A;  4PS8 A;  4GDK A;  3H8H A;  1AN8 A;  4BKT A;  3KVF B;  5C23 A;  2PJH A;  1JWA D;  4Q2J A;  5J2R A;  1E8Y A;  2IBI B;  3AB5 A;  2KK8 A;  2V3S A;  3AM9 A;  3AEG B;  1WI0 A;  2WXF A;  1T0R C;  2NBU A;  3ML8 A;  4II2 B;  2LAS A;  5G5G A;  1TS4 A;  2C7H A;  1HXY D;  1WXM A;  1UUP A;  5GXG B;  3GZN I;  2V1Y A;  4BVU C;  3AE4 B;  3LJ3 A;  3I57 A;  1D3Z A;  3BYT B;  1E7V A;  1V5O A;  2HTH A;  2ZNV C;  3ZKJ C;  2L83 A;  3MHZ A;  2G1E A;  3URY A;  2CHX A;  4LNI A;  5DCN A;  1PQS A;  1L7Y A;  1PGX A;  2WDT B;  1K51 A;  3IAS 1;  3FAH A;  4DHJ D;  4K7S A;  1L6U A;  3WAM A;  2L05 A;  3AE6 B;  3HVD A;  2KYW A;  5JHA A;  3PV1 A;  3OG5 A;  4EFO A;  2KTF A;  4XC2 A;  1D5M C;  3QHT A;  5JHB A;  2W3S A;  1GG3 A;  3N1X C;  1TBE A;  4GDK B;  4JWS C;  3SHQ A;  4GMV A;  2Y5C A;  3P42 A;  2K25 A;  4P7I A;  4XX5 A;  5E6O A;  5C2T B;  2MA9 B;  1IP9 A;  4W9D A;  1CZP A;  2J53 A;  3V05 A;  1PGB A;  2MQJ A;  1WYW B;  3SU8 X;  1UBQ A;  4L23 A;  4RH6 A;  2J0M A;  1C77 A;  1RFA A;  4K3C A;  4EE2 A;  1S1Q B;  1D6E C;  1EU3 A;  3QX1 A;  4P16 A;  1WXV A;  1VZ6 A;  3L13 A;  3GS2 A;  3AH7 A;  3V6E B;  2PEA A;  2KDE B;  2A4Z A;  1G6J A;  1UBI A;  1K50 A;  1JRO A;  3VRB B;  1EF5 A;  2YLM A;  2KDF B;  5DPS A;  3WAO A;  1CMX B;  2L76 A;  1MFW A;  1OQY A;  1P1A A;  3PLU A;  3FC4 A;  5EE3 A;  3TEW A;  4TUU A;  3AXC A;  1V1P B;  3ZGZ A;  1UD7 A;  3QK0 A;  1TKG A;  2K8H A;  4IWP A;  2KJH B;  3A1Q A;  1SE3 A;  2DWQ A;  2KC1 A;  3BWU D;  1WGY A;  5CX3 A;  2JWU A;  2QCZ A;  4YTP B;  4WWM A;  2RGF A;  4GB9 A;  4II3 B;  3KYD D;  3NOB A;  3B1L X;  5D2M B;  1TKE A;  1WGD A;  2KJR A;  1TGZ B;  4ACF A;  2V0G A;  1PYW D;  3ZNZ B;  4IKG A;  2LXC A;  2LGI A;  2MBB B;  3KUZ A;  2DAF A;  1EM7 A;  4ICV A;  2GBR A;  5AEK B;  4GXB A;  2GOW A;  3H7P A;  1XCQ L;  1SE2 A;  3RYT A;  2IGG A;  4C56 C;  2HTM E;  5HFY A;  3EC8 A;  3RUI B;  5CHV C;  1V5T A;  5D6J B;  3VHT C;  4H2A A;  2RD0 A;  4MSQ B;  3R8B A;  4AJW A;  5CTR C;  2Y5B B;  2O2V A;  4A20 A;  4C7Y A;  1YJI A;  1OQQ A;  4OVZ A;  4UDU C;  2GRI A;  4NPN A;  4I6L B;  3NVW A;  1XQQ A;  1QKZ A;  3PZ7 A;  2K5P A;  1TY0 A;  2LGY A;  4XGA B;  1OGW A;  3W9C B;  4ZHP A;  4IW0 A;  2N9E B;  4M8N A;  4US8 A;  3VVW B;  4W9L A;  4HKQ A;  1KLV A;  4KSL C;  1WE7 A;  3VUW A;  1OFF A;  1SGH A;  3EA6 A;  1ZXI A;  4ARI A;  4FXC A;  2EKE C;  2CHZ A;  4RCO A;  3U2S C;  4HPM B;  4KDL B;  2KMM A;  2ASQ A;  2BYE A;  5L83 A;  2DZM A;  2MBE A;  2N9X A;  1SJH D;  1RM6 C;  3OWE B;  3TMP B;  1H8C A;  3ABV B;  1IUE A;  4LDT D;  2LHD A;  3H7P B;  2PVG C;  2ZZP B;  2ZPN A;  4OW0 A;  2L0F A;  2JPH A;  2KJ6 A;  3X23 A;  3MP9 A;  3R2T A;  3AE2 B;  3A33 B;  2PE9 A;  1ISN A;  4KGR A;  3NY5 A;  2K39 A;  2QMT A;  2O2V B;  1T6B X;  2HJ8 A;  1E10 A;  4E3C A;  1WX7 A;  1YIW A;  3HRD D;  4TSS A;  5EE9 A;  3J9C A;  3DWM A;  2INP E;  3P4Q B;  3SFD B;  4G50 A;  3TSS A;  1BML C;  3MC0 B;  2JRH A;  2MBQ A;  2FID A;  1E7P B;  2BTE A;  4NQK E;  1FNV A;  4LDT B;  3ZJT A;  1OQR A;  3L10 B;  4JL9 A;  3Q3O C;  2K8B A;  1YQ4 B;  4HKZ E;  1IGC A;  2WDQ B;  4FJY A;  3UQB A;  3BVM A;  2B3A A;  4ZRP A;  4FUL A;  2WX1 A;  2ZPY A;  2G45 B;  3BII D;  1VJK A;  3N9Y C;  2WXP A;  1C4P A;  1YNT E;  3LXF A;  5AZF A;  2DX5 B;  1E8W A;  3VUX A;  2HDE A;  4XDD A;  3RNE C;  4W9I A;  4OZC A;  3TIX A;  3A4S C;  2NBW B;  2WX0 A;  1I42 A;  2KFK A;  4RM8 A;  2IPK D;  3EUB 2;  1FCC C;  2W55 A;  4G11 A;  1TY2 A;  4JLC A;  1C78 A;  1UWX A;  2D2Q A;  2IGH A;  3ZJV A;  4S0R A;  3RD2 A;  4YTM B;  2J42 A;  3DDC B;  4F1S A;  2MJD A;  1L4D B;  2AEH A;  3IVF A;  4HK2 A;  1A70 A;  4RGT A;  1WJN A;  2NCN A;  1ZKH A;  1IPG A;  1WWT A;  1NEN B;  1K52 A;  3M63 B;  2BQQ A;  2FCM A;  1ZE3 D;  5FR3 A;  3CSF A;  3PRP B;  4KGS A;  1MPE A;  1X1M A;  3PO0 A;  3Q3J A;  3ZO5 B;  4EZL A;  1GPX A;  1V86 A;  5E6N A;  3AE1 B;  1C1Y B;  1L5P A;  2CR5 A;  1U4A A;  4CYE A;  4WWO A;  3OLM D;  2KFK B;  4C80 A;  4CHK A;  1LQB A;  2ON8 A;  3TEY A;  3BZD B;  2N1W A;  3BY4 B;  4E74 A;  2KAC A;  2KT7 A;  2DBY A;  4URK A;  2JUO A;  1J7B A;  1VD2 A;  4KV2 A;  3CIR B;  2GBN A;  4K7W A;  3SDL C;  2ZJD A;  3P4P B;  3V61 A;  1MJD A;  1WX8 A;  4BOZ B;  2K8C A;  4HPL B;  3W5V B;  4DXA B;  2DYM A;  2N7D A;  2KDB A;  4LCD E;  2LUE A;  1UGM A;  2MSE D;  2MJ3 A;  3N20 C;  3R7R A;  3KYC D;  1VZ8 A;  2PVO D;  1FXA A;  2W3R A;  2N0S B;  3R3M A;  3PSE B;  1V49 A;  4MGY E;  4BKS D;  2JWZ A;  3W1Y A;  1VR9 A;  3E56 A;  3EGR A;  1F2R C;  1GUA B;  1F9J A;  1FCL A;  2R61 A;  2W54 A;  1P98 A;  5KHO A;  1NDD A;  3RMK C;  2LVQ A;  1P3Q U;  3ZQ4 A;  4NNJ B;  1Z5S B;  3RCZ A;  2XN9 C;  2LGS A;  2M19 A;  2EMS A;  2WXK A;  3C8Y A;  1LFD A;  2WXJ A;  3R66 C;  2L1A A;  4ZYN A;  2C5L C;  3NVV A;  4USA A;  2KLC A;  1NI3 A;  1WXS A;  1XEE A;  1Q0W B;  4B95 A;  3MJ5 A;  3SEB A;  4ANX A;  2Q5W D;  3Q8B A;  1AAR A;  1LO5 D;  2D11 A;  1SBB B;  3QIJ A;  3AI5 A;  1I4R A;  5AZG A;  2WP9 B;  4I6N B;  1YX6 B;  2FCQ A;  4L2Y A;  4MGK E;  2WQY B;  4WWN A;  2V9H A;  2ZCC A;  3Q69 A;  1ZPS A;  2BT6 A;  1CJE A;  1L4Z B;  2IND C;  2OJW A;  1SB3 C;  1HQR D;  4MJS A;  3RFZ B;  5D3I B;  1TTN A;  2IGD A;  2OHF A;  3AE5 B;  3RT3 B;  1WR1 A;  1C9F A;  4HXD A;  1WM3 A;  4W9C A;  3QJZ A;  1XLQ A;  1J19 A;  2KNB A;  2LHE A;  2YEP F;  3PTF C;  5JXV A;  1JWU D;  3VH3 B;  1JRP A;  2V4L A;  3BVZ A;  1MI0 A;  4RF1 A;  1WJU A;  3VAW A;  3DQV A;  5D7G A;  1TYG B;  2RDG A;  1FRR A;  4R3D A;  4XWT A;  1FFU A;  3PHW B;  2M1M A;  2M4N A;  2K6D B;  1FD6 A;  1T0S C;  3L08 A;  1EWC A;  1DOI A;  2IO1 B;  5AUK A;  1V80 A;  3ALB A;  1TKY A;  4MM3 A;  1WH3 A;  3IBE A;  3Q14 C;  4EEW A;  2PW9 A;  2ZVO A;  2K22 A;  3ZNG C;  3DVN U;  3AE9 B;  3P63 A;  3TUO A;  5GMV A;  3Q8A A;  3N1Y C;  4ZRJ A;  1GAQ B;  2ZVN A;  2HJ1 A;  2R2O A;  1XLN A;  1YJJ A;  5E6J A;  1L6V A;  4MT5 A;  4IM3 A;  2REX A;  3PT2 B;  4GOC A;  4AQ7 A;  3WA0 A;  1N6Z A;  3DVN V;  4MJS B;  3DBH I;  1PGA A;  3NG0 A;  2JRI B;  4M02 A;  4B6W A;  3AN1 A;  3WAL A;  4TKN A;  5HKH A;  2CHW A;  4DBG A;  5LXH A;  3L17 A;  1P9D U;  2IO2 B;  2VH1 A;  4WQM A;  3VR9 B;  1V1P A;  2KC2 A;  2I1J A;  4OVU A;  2L52 A;  3K9P B;  3GZN B;  3KLS X;  3OAW A;  2PKO A;  2C60 A;  5C1Z A;  1WJ6 A;  5J17 A;  3DHH C;  1AW7 A;  4NJC A;  1MVK A;  2W9N A;  1EU4 A;  2DYO A;  2KQ7 A;  4KDI C;  2NBV B;  2CU3 A;  4EZK A;  5IP4 D;  3APC A;  3TCA A;  2KAJ A;  2KDI A;  1E9M A;  1L0V B;  1KH0 A;  2LEK A;  4DDG D;  3A9K A;  3BYY B;  3VFK A;  3ZYY X;  1HTQ A;  4A55 A;  3DBH B;  3MC8 A;  1TT5 B;  1GC6 A;  3IFW B;  4LNF A;  2KVZ A;  4MM3 B;  3ZRF A;  4EUT A;  3EHV A;  2L7R A;  1GOZ A;  3W2D A;  1GNU A;  1H4R A;  1WZ3 A;  4MH8 A;  2LRU A;  3M95 A;  3IT4 B;  2NTT A;  1ESF A;  3KWL A;  4XDC A;  1XXG A;  4G3X B;  3PZD A;  3ZNI D;  4ZYS A;  4DHZ B;  2KWV B;  4LNN A;  2UU7 A;  2JYT A;  2LXA A;  4KZ0 A;  1EF1 A;  2OED A;  3RNA C;  1NYQ A;  2KOX A;  4YXD B;  1TS3 A;  1QT9 A;  3VRA B;  1WF9 A;  1YJ1 A;  2LI5 A;  5EDS A;  5D3D A;  1ENF A;  4WJO A;  2G9H D;  2D3G A;  1QOF A;  2N7E A;  3Q8F A;  4GLS C;  3EEC A;  3Q2A C;  3PLV A;  4W9E A;  3GB1 A;  2WXL A;  2MHJ A;  4K7U A;  4MEM A;  3R7Q A;  1YX5 B;  4NY0 A;  3A9K B;  1A5R A;  3DPD A;  3PRE A;  3AMZ A;  2LMC A;  2PMV A;  5BO4 B;  2KTR A;  2N4F A;  2Z59 B;  2HD5 B;  4PK1 A;  2PE6 B;  2LRW A;  2QJL A;  5E6P A;  1PUT A;  2JYE A;  1WY8 A;  4AS1 A;  3EFU A;  4GGQ A;  1D5X C;  2D10 A;  3KH0 A;  1STE A;  1UF0 A;  3RI7 C;  1YOV B;  3W5U B;  2KQ4 X;  2BGF A;  4PS7 A;  5CHW A;  1KLG D;  4A90 A;  2RPV A;  2J4X A;  1UNS A;  2AL6 A;  3HUI A;  1VZ7 A;  2V3P A;  3DHI C;  1FIQ A;  4RMA A;  1JWS D;  1RAX A;  1QLB B;  2AL3 A;  3CMM B;  4NAW A;  4DQO C;  2KWU B;  4I6P A;  1WMH B;  3NVY A;  3PRM B;  2GBJ A;  4ARC A;  5FK9 C;  1DOX A;  3UIN B;  4GDL A;  3A9J A;  4KZC A;  1XT9 B;  3AUL A;  1B1Z A;  2D5G A;  3NS8 A;  2KZR A;  4FN2 A;  2IO3 B;  4LJO B;  4ANW A;  4C7Z A;  2ONQ A;  2BPS A;  1SE9 A;  2RPQ A;  2WDV B;  4C4V A;  1YD8 U;  3T3N A;  4P6V F;  2XNA C;  3IG3 A;  2HE7 A;  3AV8 A;  2KTR B;  4YSZ B;  2LVP A;  3VH4 B;  2BW2 A;  2G3Q B;  3P4R B;  4AJY B;  4BBN C;  2KN4 A;  4WAA A;  1TZ1 A;  4G0N B;  2V4I B;  5I4D A;  1VCB A;  2H88 B;  2LJ5 A;  2MLB A;  3T9L A;  1FM0 D;  1QOG A;  4PT5 A;  4HDQ A;  5EE1 A;  2J0J A;  1C4A A;  2ICI A;  2QDF A;  4X57 B;  5MPO A;  3VR8 B;  1K53 A;  3N1Z C;  2L32 A;  4FJZ A;  1R4M I;  1YN4 A;  2NS5 A;  3ENE A;  1SSN A;  2WS3 B;  4P1B C;  3VUY A;  4NAW B;  2N9L A;  3ZXV A;  1Y8R C;  2BYV E;  2I38 A;  4ICU A;  4GDL B;  3A9J B;  2ZW0 A;  1EO6 A;  2MEK A;  4XYC A;  3VTU A;  1N5X A;  3L54 A;  4HEA 1;  2QIE B;  4MSM B;  4PS3 A;  3K9O B;  2GLS A;  4FHJ A;  2JQR B;  4HWI B;  1NEK B;  4AWJ A;  4C4V B;  2WXR A;  2FBW B;  4IUM B;  2VRR B;  2CJN A;  1JCK B;  5IA7 A;  1QZE A;  1R4M B;  2BWF A;  4MGI E;  1DGJ A;  5CHF A;  4NAM A;  3AEE B;  4A8X C;  3VDZ A;  3C0R B;  5DPR A;  3U7D A;  1AYF A;  3X0W A;  4C00 A;  5FR6 A;  3BIN A;  1N63 A;  2KQS A;  1RLF A;  4IOI E;  4OZB A;  1DYQ A;  3WCQ A;  1ZW7 A;  4HDO A;  2JXT A;  4WH4 A;  1MG8 A;  1RRB A;  2XK5 A;  2BS2 B;  4DWF A;  2GBK A;  3PS6 A;  3VTW A;  3RNF C;  2E6X A;  2J0K A;  2W82 A;  1QF6 A;  2ZNV B;  3RZW C;  3KWV A;  1VDV A;  1C79 A;  2BBC A;  4RGO S;  1WRI A;  3ECI A;  1BXT A;  3VQI A;  1XO3 A;  5LXI B;  3L4P A;  1ZDX A;  4HCP B;  3O65 B;  3RPF C;  2JZ3 B;  1LXD A;  1WM2 A;  1IYF A;  3MJW A;  1M4V A;  3R2I A;  1C3T A;  2BS3 B;  4EKU A;  3DBL I;  3Q8C A;  2WXI A;  2KX0 A;  4N58 A;  4MDK E;  4EZJ A;  4TV3 A;  1S3S G;  2AQ1 B;  3C19 A;  3V62 A;  5IN7 A;  2E3T A;  3Q3F A;  2LD9 A;  4A6Q A;  2BB5 A;  2QEJ C;  1J7C A;  4MGZ E;  2QIL A;  3EFC A;  2G4D B;  1I4P A;  2XK5 B;  2MBH A;  1DOY A;  2BS4 B;  2BWE S;  2DHZ A;  4ZRK A;  2IZV B;  3MHS D;  3N32 A;  3M3J A;  4M01 A;  4FLH A;  1JWB D;  2MH7 A;  3DBL B;  3I9V 1;  3ETR A;  2RMM A;  3M62 B;  4LJP B;  3S2A A;  4KSK C;  3ZDT A;  2QC8 A;  1YQ3 B;  4ZDV A;  5BMH A;  2Z0D B;  2CJO A;  4PYZ A;  4GSW A;  1ET6 A;  3T3O A;  3H7S A;  4RGM A;  3KUD B;  3ZVV A;  1R4N I;  3DHG C;  3KUC B;  1TIF A;  4IM0 A;  2X38 A;  3TJP A;  2SAK A;  4N9F 4;  2DZJ A;  5BMG A;  1NBF C;  3DOW A;  3P1M A;  3IXS A;  3ZIM A;  4XWW A;  2M56 B;  3AU5 A;  1Z2M A;  3U30 A;  3NUH B;  4JWU C;  3TBL D;  4A3O A;  1YQB A;  3OJ4 B;  3ZRC A;  3APF A;  3UI3 A;  4DHZ E;  1MHH E;  2CKH B;  3PVL A;  2LGD A;  3JVZ X;  3H9D A;  5DPT A;  5IAA C;  4RFB A;  1NI2 A;  3A4R A;  5L95 C;  3AEF B;  3ZDM C;  3GP7 A;  4JE3 B;  4HPP A;  1ET9 A;  4DDI D;  4RNA A;  2AYO B;  1WIA A;  2INN E;  4GIV A;  1KFY B;  4TQ0 A;  3BK1 A;  3P2B A;  1XCT L;  3TEZ A;  1SEB D;  2LGX A;  1TJE A;  2WHI A;  5AZH A;  1F77 A;  3APD A;  4MH0 E;  2N9K A;  2BB6 A;  3ONS A;  2O6V A;  4BBN F;  2DYB A;  2OOB B;  1I35 A;  4IM2 A;  3VXW A;  1T0Q C;  3LDZ E;  1F0Z A;  1XD3 B;  4HRS A;  4OVV A;  3ZTC A;  4N59 A;  4KVG B;  3RZF A;  2JZP A;  2ACZ B;  3IT6 B;  3PHX B;  1M94 A;  3MFG A;  2WDR B;  3D32 A;  2DLB A;  4M0W A;  3RN9 C;  2JF5 A;  2M0X A;  1PFD A;  4S17 A;  1V8C A;  1CQV A;  2KFJ A;  2EEL A;  4IWO A;  2I1K A;  3PPA A;  2LUM A;  2O6V D;  4N6E B;  4JIO U;  2VH2 A;  5G2N A;  2TSS A;  3FIL A;  2BF8 B;  2INC C;  4WUR A;  4HJG E;  3AE8 B;  4LNK A;  1WXA A;  2M0A A;  2KO3 A;  1LM8 B;  2KMC A;  1BT0 A;  3W1S A;  3WIM A;  4AOF A;  2L3Z A;  3DBR I;  5EE0 A;  2RDH A;  2WXO A;  4WIP A;  1N61 A;  5TSS A;  5HG2 A;  4XZ4 A;  2D3C A;  3LB8 C;  2XEW A;  3JSV A;  4B0M A;  4KKJ A;  1QIL A;  2YEP B;  2C9W B;  1FNU A;  1WRD B;  4WJP A;  3E9S A;  3HM3 A;  2O6V B;  1V97 A;  5JH5 C;  2SEB D;  3ZJU A;  1R7S A;  1KF6 B;  3LYY A;  2IY1 B;  5BYQ A;  1VRA B;  4L1B A;  3MC9 A;  5LLI A;  3RNG C;  1C76 A;  4A3P A;  1FEH A;  1WGK A;  3FKY A;  4MAC A;  4IWQ A; 
#chains in the Genus database with same CATH homology
 2RPV A;  2B76 B;  2J4X A;  2NTS A;  1UNS A;  2QSD A;  2HDE A;  4XDD A;  3HUI A;  1VZ7 A;  3NVZ A;  3NZ3 A;  2WXQ A;  1UGJ A;  4OZC A;  2KDM A;  2V3P A;  1FIQ A;  4ZHO A;  1TS2 A;  1JWS D;  3BK2 A;  2IPK D;  1QLB B;  3EUB 2;  1FCC C;  2W55 A;  1TY2 A;  1C78 A;  4KX6 B;  4DQO C;  1ZXH A;  1UWX A;  2PTL A;  1QQR A;  3NVY A;  5H92 C;  1SF0 A;  1N62 A;  1T5X D;  4O1N A;  2IGH A;  5FK9 C;  3ZJV A;  3FIL B;  4ARC A;  1DOX A;  4YT0 B;  2EKI A;  2JX5 A;  4YTM B;  2J42 A;  1B1Z A;  1NVI D;  1E6E B;  1L4D B;  2MJD A;  5HHD G;  2D5G A;  5G5H A;  1BUI C;  4C7Z A;  1ACC A;  4RGT A;  1A70 A;  1WYG A;  2ONQ A;  1RFK A;  2WDV B;  1YMH E;  4US9 A;  3T3N A;  4P6V F;  1WWT A;  2XNA C;  1NEN B;  3AV8 A;  4YSZ B;  1C4C A;  1K52 A;  1ZE3 D;  4RF0 A;  4ITK A;  2BW2 A;  5BMI A;  2V3N A;  3P4R B;  3AED B;  3P4S B;  2AX5 A;  5FR3 A;  4KGT A;  1HZ6 A;  2KN4 A;  2Y5P A;  3AEB B;  1JAL A;  3Q8E A;  3KQ4 A;  3SR6 A;  1WXQ A;  4KGS A;  2V4I B;  1MPE A;  5I4D A;  1EWY C;  1FFV A;  2H88 B;  3PO0 A;  5H8Y E;  3PZ8 A;  1QOA A;  4KKI A;  4LTU A;  1GPX A;  1QOB A;  1FM0 D;  1QOG A;  1D4B A;  4LK0 M;  4PT5 A;  5FKA C;  2KWD A;  2K9X A;  3AE1 B;  1L5P A;  5EE1 A;  1YN5 A;  1CK1 A;  1C4A A;  2FUG 1;  2ICI A;  5MPO A;  1E0Z A;  2Y3A A;  3AE3 B;  1I4G A;  3VR8 B;  1K53 A;  1T3Q A;  2L32 A;  1KRH A;  2WU2 B;  1YN4 A;  3AEC B;  4OZA A;  1WSP A;  4C80 A;  2ON8 A;  1XLO A;  1SSN A;  2GB1 A;  3TEY A;  2WS3 B;  3BZD B;  4REZ A;  3H8H A;  4NAW B;  1AN8 A;  2KAC A;  2VZK D;  1ZDV A;  2DBY A;  2N9L A;  1J7B A;  1JWA D;  4Q2J A;  2I38 A;  3CIR B;  1RYJ A;  1B9R A;  3AB5 A;  4GDL B;  2ZW0 A;  3AM9 A;  3AEG B;  1JW9 D;  2MEK A;  2WXF A;  1N5X A;  3P4P B;  4HEA 1;  5G5G A;  1TS4 A;  2QIE B;  3W5V B;  2DYM A;  4JPS A;  1I4Q A;  1HXY D;  1UUP A;  2JQR B;  5GXG B;  1NEK B;  1SXT A;  4B0E A;  3AE4 B;  1V1O A;  2WXR A;  1JWM D;  3I57 A;  2FBW B;  3BYT B;  2MJ3 A;  3SFE B;  1VZ8 A;  2CJN A;  2PVO D;  1JCK B;  1FXA A;  2W3R A;  1JML A;  2N0S B;  4TQ1 A;  2L83 A;  3MHZ A;  2G1E A;  3URY A;  1SJE D;  3U52 E;  1DGJ A;  1VR9 A;  1I7H A;  3E56 A;  3EGR A;  1HEZ E;  4NAM A;  3AEE B;  1F2R C;  1F2R I;  4A8X C;  5LNK 1;  2VZK B;  1PGX A;  1FCL A;  2R61 A;  1AYF A;  2W54 A;  1ZOY B;  1K51 A;  3IAS 1;  3FAH A;  1FXI A;  2ZW1 A;  3ZQ4 A;  1N63 A;  1L6U A;  4RGN A;  4IOI E;  4OZB A;  2XN9 C;  1DYQ A;  3AE6 B;  2M19 A;  3HVD A;  3WCQ A;  2JXT A;  2WXK A;  4WH4 A;  3TEX A;  3C8Y A;  1D5M C;  2IJ0 A;  2WXJ A;  2L1A A;  2BS2 B;  1ROE A;  1D5Z C;  1Y56 A;  3NVV A;  2W3S A;  4USA A;  1NI3 A;  4GDK B;  1FO4 A;  4JWS C;  1XEE A;  2Y5C A;  2E6X A;  2W82 A;  3MJ5 A;  1QF6 A;  3P42 A;  1I4H A;  4NZL B;  3SEB A;  5C2T B;  2Q5W D;  3KWV A;  1VDV A;  3Q8B A;  1C79 A;  3B2F A;  1LO5 D;  1SBB B;  2BBC A;  4YSY B;  4RGO S;  1WRI A;  4LLG M;  1CZP A;  1I4R A;  1BXT A;  2WP9 B;  3B2G A;  1GB1 A;  3VQI A;  2J53 A;  1XO3 A;  1PGB A;  3V05 A;  1IBX A;  3CWI A;  4L2Y A;  3U7Z A;  4TMA B;  4CQN A;  3L4P A;  1ZDX A;  2WQY B;  4L23 A;  1PDX A;  3Q69 A;  2BYT A;  4RH6 A;  1ZPS A;  2BT6 A;  4XE0 A;  3RPF C;  1CJE A;  1C77 A;  1L4Z B;  4EE2 A;  1SB3 C;  1HQR D;  1D6E C;  1EU3 A;  4P16 A;  4DXF A;  1M4V A;  1VZ6 A;  1P7E A;  2WXM A;  3R2I A;  1J7A A;  1KLU D;  5D3I B;  2BS3 B;  3RFZ B;  2IGD A;  1SIJ A;  2OHF A;  3B9J A;  3AE5 B;  1C9F A;  3Q8C A;  3GS2 A;  1XLQ A;  2IDY A;  3AH7 A;  2WXI A;  2LHE A;  2JSV X;  2YEP F;  4N58 A;  5JXV A;  2NMQ A;  3AE7 B;  1JWU D;  2AQ1 B;  1K50 A;  1JRO A;  3VRB B;  1JRP A;  3BVZ A;  2E3T A;  1MI0 A;  4RF1 A;  1FMA D;  1TS5 A;  4A6Q A;  2BB5 A;  2QEJ C;  2WU5 B;  1J7C A;  4YTN B;  1GB4 A;  2QIL A;  3FC4 A;  5EE3 A;  5C3J B;  5D7G A;  3TEW A;  1I4P A;  1UWM A;  4J3O D;  1V1P B;  1TYG B;  3AEA B;  3ZGZ A;  4HRO A;  2RDG A;  1TKG A;  1FRR A;  4R3D A;  4XWT A;  1FFU A;  1DOY A;  2BS4 B;  1N60 A;  1ZUD 2;  1SE3 A;  1XF5 L;  2DWQ A;  1FD6 A;  2N7J A;  3BWU D;  1EWC A;  3NRZ A;  1DOI A;  1JWB D;  2MH7 A;  5AUK A;  2JWU A;  4YTP B;  1TKY A;  1IGD A;  3I9V 1;  3ETR A;  4WWM A;  2PW9 A;  2RMM A;  2K22 A;  1TZO A;  3AE9 B;  1YQ3 B;  3P63 A;  3TUO A;  5BMH A;  5HI1 A;  3Q8A A;  2CJO A;  1TKE A;  1VLB A;  1ET6 A;  1IBX B;  3T3O A;  1GAQ B;  4RGM A;  4ZRQ A;  2V0G A;  1XLN A;  1YJJ A;  1PYW D;  5E6J A;  1L6V A;  4IKG A;  4MT5 A;  2X38 A;  2LGI A;  3IAM 1;  2SAK A;  1EM7 A;  2LFI A;  4AQ7 A;  1FNW A;  1FRD A;  5BMG A;  1XLP A;  1PGA A;  3P1M A;  3IXS A;  3AN1 A;  1HZ5 A;  4XWW A;  2M56 B;  1XCQ L;  1KTK A;  1SE2 A;  3BVG A;  2IGG A;  3U4E G;  4C56 C;  2HTM E;  5HFY A;  1L0X B;  3NUH B;  4IDI A;  4JWU C;  4WQM A;  3VR9 B;  1V1P A;  2H89 B;  1AWD A;  4H2A A;  2L52 A;  2WNM A;  3KLS X;  3R8B A;  3UI3 A;  2PKO A;  2PLP A;  4C7Y A;  1MHH E;  1AW7 A;  1YJI A;  4NJC A;  1OQQ A;  4OVZ A;  1MVK A;  1YN3 A;  2GRI A;  4UDU C;  2MJE A;  3NVW A;  1EU4 A;  4RFB A;  2AQ3 B;  1QKZ A;  3AEF B;  3PZ7 A;  2DYO A;  3GP7 A;  2K5P A;  4JE3 B;  2CU3 A;  1N5W A;  1TY0 A;  3O13 A;  1ET9 A;  4OHJ A;  3W9C B;  2KAJ A;  4ZHP A;  4A9A A;  5BYS A;  1E9M A;  4RNA A;  1L0V B;  4ZOH C;  1KH0 A;  2LEK A;  2INN E;  1JQ4 A;  2GI9 A;  3BYY B;  3ZYY X;  4A55 A;  4US8 A;  1KFY B;  4TQ0 A;  3BK1 A;  4HKQ A;  1XCT L;  3TEZ A;  2K3U A;  4MM3 B;  1SEB D;  2I2Y A;  1TJE A;  1F77 A;  1OFF A;  3EA6 A;  5BYR A;  1ZXI A;  4ARI A;  2J52 A;  4FXC A;  1GOZ A;  1RWS A;  3W2D A;  2N9K A;  2BB6 A;  4MH8 A;  2WLB A;  4RCO A;  3U2S C;  2KMM A;  2AQ2 B;  3IT4 B;  2NTT A;  1F0Z A;  4HRS A;  1ESF A;  3KWL A;  4XDC A;  1SJH D;  1RM6 C;  3OWE B;  4N59 A;  1XXG A;  1MHX A;  2JZP A;  2ACZ B;  3ABV B;  3IT6 B;  1IUE A;  4ZYS A;  3MFG A;  2WDR B;  2DLB A;  4M0W A;  2JYT A;  2LHD A;  2OED A;  1HA5 A;  1P7F A;  2PVG C;  1L0Y B;  1NYQ A;  3NS1 A;  2LJI A;  3HVZ A;  4OW0 A;  4YXD B;  1PFD A;  1TS3 A;  2FE8 A;  1V8C A;  1NYR A;  1CQV A;  3MP9 A;  2WXG A;  3R2T A;  3AE2 B;  4YSX B;  2EEL A;  1QT9 A;  3VRA B;  2LUM A;  4KGR A;  4N6E B;  5D3D A;  1ENF A;  2WXH A;  2QMT A;  2G9H D;  2TSS A;  1QOF A;  3FIL A;  1T6B X;  4JX1 C;  4WUR A;  3Q8F A;  4GLS C;  1Q10 A;  4HJG E;  3DWG C;  3V3X A;  1E10 A;  3AE8 B;  4DXG A;  3HRD D;  4TSS A;  5EE9 A;  2M0A A;  3DWM A;  3J9C A;  2INP E;  2Z8L A;  3P4Q B;  3GB1 A;  3SFD B;  3W1S A;  4D2K A;  2WXL A;  1ZP0 B;  3TSS A;  1BML C;  3MC0 B;  5EE0 A;  2RDH A;  2WXO A;  4WIP A;  4WAF A;  1N61 A;  1E7P B;  2BTE A;  5TSS A;  5HG2 A;  3LB8 C;  3AMZ A;  2LMC A;  2PMV A;  1FNV A;  2WXN A;  4B0M A;  3ZJT A;  1OQR A;  4KKJ A;  2QJL A;  1PUT A;  1QIL A;  2JYE A;  2YEP B;  4AS1 A;  1FNU A;  1YQ4 B;  4HKZ E;  1IGC A;  2WDQ B;  3BVM A;  2JU6 X;  3E9S A;  5AUI A;  4ZRP A;  1V97 A;  3ZJU A;  2SEB D;  1D5X C;  1R7S A;  1KF6 B;  1STE A;  3BII D;  1I4X A;  2K0P A;  3LYY A;  5BYQ A;  1VRA B;  1VJK A;  3N9Y C;  3W5U B;  4L1B A;  2WXP A;  1SE4 A;  1C4P A;  2KQ4 X;  4YWG G;  1YNT E;  1C76 A;  3LXF A;  1KLG D;  5T8I A;  1FEH A;  1WGK A;  2PIA A;  4A90 A;  4MAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...