1ZE3D

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
116
Chain Sequence
DLYFNPRFLLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/structural/membrane protein
total genus 26
structure length 116
sequence length 125
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ze3D00
1ZE3D 1ZDXA 3BWUD 3RFZB 4J3OD 4B0MA 1ZDVA 4B0EA
chains in the Genus database with same CATH superfamily
1A5RA 2JU6X 5D94A 4BZAA 4W9EA 4DXAB 1C1YB 4BOZB 5AZFA 4W9LA 1GC7A 3ML9A 1V81A 4X57B 3M63B 2MCNB 4ZRQA 1PGAA 4C7YA 3ZTDA 1ET6A 2JZ3B 2AQ2B 2FIFA 3S2AA 1BT0A 3HHMA 4RF1A 1WMHA 3EGRA 1ZXHA 5G2NA 3AM9A 4MH8A 2CS4A 2J7QB 2M17A 4IW0A 4NAWB 2CKHB 4K3BA 1FXIA 3AH7A 1RWSA 1WSPA 1DOIA 4DXFA 1L2NA 1TS3A 2N9PC 4BKSD 1TKEA 2WDVB 3UQAA 5AZHA 2JXXA 2O6VD 3P1MA 4KX6B 3NVZA 5KHQA 2JUOA 3W1YA 4W9CA 2O6VB 4ASWC 4DK5A 4MSQB 3X0WA 2AQ1B 2KMAA 2QJLA 3W1SA 2QMTA 2RDGA 2OJRA 1VRAB 2IBIB 3R66C 1R4NB 2ZPYA 1C4CA 4S17A 4IG7B 2H88B 4LNOA 1ISNA 4WAFA 1V5OA 4Q2JA 1YX5B 3ZDMC 1PYWD 2W9NA 2XBBC 3B0AA 2LHDA 1EU3A 2JXTA 3NG0A 3DBLI 3PS6A 4TMAB 2XK5B 1UH6A 2M0XA 5MPOA 3DBLB 2K6DB 2VZKD 3VHTC 1K53A 1P7EA 1QKZA 2VZKB 3U8ZA 1N5WA 1WJUA 1GUAB 4OZBA 3FILB 1JQ4A 4JE3B 3BINA 2BQQA 2KFKB 2C5LC 3C0RB 2NBUA 3HM6X 3RCZA 2LEKA 4HEA1 1KTKA 3AU5A 3MC8A 1K51A 1F77A 1B9RA 4JQWC 2AL6A 1FXAA 3N1YC 2MWSB 4LTUA 4K7WA 3OWEB 4JPSA 1V6EA 4HWIB 2KLGA 1QOBA 1FNVA 3VVWB 3V6EB 2K3UA 1KM7A 1I4GA 2KJHB 3VRAB 4WH4A 4M01A 5LXHA 1EWYC 1GJZA 4KSLC 1NVID 2N9XA 1TZ1A 4BFRA 2AEHA 5GXGB 1A70A 1FEHA 2KWDA 4GSWA 2IO1B 3B08A 1RRBA 3GE8C 2PIAA 2Y3AA 1XXGA 1L6UA 4LJPB 1ZKHA 4OZAA 3AE9B 3AE8B 1XQQA 3RPFC 4HPMB 1YJJA 5L95C 3H7SA 3R7QA 3ONSA 2WXHA 1YX6B 1WXMA 4HROA 4FHKA 3TCAA 2RDBC 1D5MC 2R61A 3P63A 3UIPB 5DPRA 5CHFA 1QOFA 1OEYA 1PUTA 1TKGA 2ONQA 2NR2A 4PS8A 3A9JA 3V6CB 1QF6A 3TEXA 2KMCA 1E8ZA 2LVPA 1C4PA 2WHIA 1WX7A 5CHWA 1IGCA 2RPVA 3ETRA 3UINB 3VTUA 3FAHA 3AN1A 3PZDA 1XEEA 4YSXB 3MJ5A 2Z0DB 2PVGC 1JALA 5C2TB 2NVUI 4PYUA 2NTTA 3MJWA 3B2GA 4M0WA 4NZLB 2DAFA 2BF8B 1L0XB 2M56B 3TJPA 4IM3A 1E6EB 3RYTA 4BBNF 3TIXA 1QZEA 4HDQA 4ICUA 2QSDA 3Q8AA 3DVNU 4KGRA 3D32A 4FJYA 3NS1A 4TKNA 4YXDB 1HXYD 1XLNA 4C4VA 4EOYA 1I4PA 3KUZA 4ANXA 4K1RB 2IDYA 3ZRCA 3ZGZA 2FUG1 1NYQA 3V62A 4A20A 4XYCA 1WF9A 2PVOD 2KZRA 5CTRC 2J52A 2E6XA 2TSSA 5BO4B 1FRDA 4FLHA 4GDLA 4L1BA 2ZJDA 2OOBB 2J42A 1JRUA 3PVLA 1E8YA 2ZCCA 4HPLB 4OHJA 3AEBB 4M00A 2W3SA 1F2RC 3U7ZA 1ACCA 3H7PB 3I57A 2LFIA 2GB1A 3AE4B 1C77A 1UWXA 1YMHE 2PE6B 3IVFA 5TSSA 3DBSA 1RFAA 3H1UA 2DZKA 4WURA 3TEZA 2BWES 2BYFA 2D5GA 2LGIA 2RD0A 4HXDA 1AN8A 3SHQA 4IKGA 2JRHA 2MH7A 5D7GA 1K52A 3I5JC 1WM3A 2ASQA 4TQ1A 2KT7A 4C56C 4BOSC 2KX3A 2UU7A 1Y8RC 4PK1A 1XF5L 2DHZA 2I2YA 2BS3B 2D3AA 2FCSA 2G45B 3A1QA 2GI9A 2BYVE 3HVDA 3Q3FA 1I4HA 4ANVA 4EFOA 4ZRJA 1WXSA 3RI7C 2UWQA 4XWTA 2JY6A 1UGMA 2BKFA 3PHXB 2ON8A 3PLVA 5CX3A 1BUIC 1YQBA 1RLFA 1V8CA 4USAA 4RH6A 1CZPA 2KDFB 3FKYA 4W9FA 4MEMA 5HI1A 1D6EC 1EM7A 2AWTA 1C9FA 2JVCA 1P98A 3QAQA 1HQRD 4ZRKA 4II2B 2KKCA 4OZCA 1AW7A 2WXNA 4KV2A 4JGHB 1K8RB 2DBYA 3KLSX 2IYDB 2DENB 1VZ7A 2LD9A 3SU8X 3VFKA 2WGSA 1TT5B 2WDTB 4KDLB 3U2SC 4IUMB 2FCMA 2BKRB 4HLEA 3R7RA 4TQ0A 4W9JA 4GOCA 5AZGA 3ZJUA 1TZOA 2MP2B 2RDHA 3AV8A 2M1MA 4GGQA 2LVOA 1D3ZA 2ZCBA 1IP9A 2KFJA 3NOBA 3ZJVA 1GOZA 2NS5A 2INCC 2IO2B 1H4RA 4C80A 1XCQL 3T3OA 1UZXB 1FPYA 1PGXA 4YSZB 1ZP0B 3VUXA 3SEBA 3VH3B 2CHZA 3HRDD 3NRZA 3AE2B 4PS7A 2KN4A 3IAS1 3BZDB 2WXFA 1MPEA 3DVNV 3MTNB 3VRBB 2PTLA 3RNEC 2KC2A 2CR5A 1EF1A 4ZYNA 3VR8B 3BK1A 1I35A 4KKJA 2IGGA 1AWDA 4A3PA 2DAJA 1T0SC 1C4AA 2K5PA 1GG3A 4YTMB 1GC6A 4OVUA 1MVKA 2LGYA 2LUMA 5IKCM 1YN5A 1ZPSA 2C7NB 1KH0A 1C3TA 2NTSA 3Q14C 1YD8U 2N9EB 3TEWA 3ZIMA 3DHHC 2LMCA 1WZ0A 2KNBA 2D3GA 1HZ5A 2WXLA 2MRPA 1JWUD 2ZNVB 5IP4D 2MA9B 3RZWC 3JW0X 2HJ8A 1V1OA 3TBLD 1SIFA 1IBXA 1GAQB 3BK2A 4W9IA 3WAMA 1TJEA 5AUIA 1E8WA 3PPAA 4KDIC 1VLBA 1OGWA 3PSEB 2JT4B 4WJNA 3WALA 1SJED 1WIAA 3R3MA 2WS3B 2WXPA 2V4IB 4M8MA 1QOAA 4FJZA 4A9AA 2LJ5A 2L0TA 1I7HA 1AARA 1J19A 3UQBA 3ZNZB 2HDEA 1UUPA 3JSVB 3PO0A 3A1QB 2E3TA 2KMMA 2K0PA 3P4RB 5TR5A 1H8CA 1LGRA 3GS2A 4BBNC 2A5UA 4KIKA 4HDOA 4CO7A 2JZPA 1CK1A 1NI2A 2N1WA 1QOGA 5J18A 3L17A 3SR6A 1UWMA 1T5XD 4XC2A 3OLMD 5LNK1 2JYEA 2GLSA 1L7YA 3UIOB 1SE4A 2MBEA 1DYQA 4JIOU 4M02A 1TIFA 4LJOB 2BVCA 1V80A 1CJEA 1RYJA 3WAOA 3M3JA 2NBVB 1LFDA 5BMHA 3QK0A 2KDEB 3VUWA 3BIID 4LCDE 4MGZE 3CWIA 2FE8A 1BMLC 2R2OA 2PPHA 4NJ6A 3TUOA 3WIMA 1TS2A 1VD2A 4AJWA 1TYGB 4EUTA 5JZEB 1YIWA 4L23A 5BYRA 2XN9C 3N9YC 2LWPA 1GNUA 1D5ZC 3L0WB 3I63C 3ABVB 3U7DA 2Z8LA 4PYZA 2AYOB 2KDMA 2JSVX 4BKGA 4WJPA 5BMIA 3IG3A 2N9KA 2INNE 4HCNB 1CMXB 2M0AA 4IM2A 2LGXA 2WXIA 4K81A 2L05A 1R4NI 5D3DA 2XNAC 1T6BX 4ARIA 4LK0M 4OW0A 1Q0WB 3Q3MC 3W5VB 4NNJB 2DZIA 1GB1A 1HTQA 4LNKA 3Q6BA 3OAWA 1N62A 4ITKA 1G6JA 4YTNB 3EA6A 1ROEA 2KOXA 3DBHB 3ZXVA 4GB9A 4AS1A 5E6OA 3AU4A 4FN2A 3SFEB 3KYCD 3C19A 1AYFA 5HFYA 1UBQA 3PRMB 3VTVA 5IA7A 2BGFA 4ANWA 3NZ3A 1FNUA 2N7JA 2X8XX 3QHTA 1WZ3A 2D10A 2V0GA 1UGJA 2HTME 1GB4A 5H8YE 1J0GA 2ACZB 4IM0A 4ZOHC 2DWQA 2K8CA 2J0JA 1J7AA 2BTEA 2QIEB 3Q8EA 2PW9A 2LASA 1MG8A 1V97A 4MELA 3IHPC 3WAPA 1JWMD 2WXKA 3Q69A 1J8CA 2DYOA 4EE2A 4ANUA 2FCNA 2WXOA 2WXQA 1Y56A 4MT5A 2VH1A 4DQOC 4MJSA 3RNAC 2KX0A 5C3JB 4AP4C 1NYRA 4N59A 2NPTA 4L2YA 3H8HA 4URKA 1OFFA 4KIKB 2ZW1A 2GBMA 1PDXA 1NEKB 4G50A 3LDZE 5CHVC 1I4XA 4A6QA 4CHKA 2LXAA 1L5PA 4ZDVA 1E7VA 2KTRA 3KYDD 3PZ8A 3B2FA 3OJ3A 4WIPA 2MJDA 3DBRI 4EZJA 1WE6A 1YJIA 3DBRB 4E74A 3DVGX 4DBGA 2WP9B 1E0ZA 3NS8A 4P1CC 2GMIC 1RAXA 3K9OB 3RFZB 4K7UA 2WQYB 1JWSD 5FK9C 1XT9B 2AL3A 1YNTE 1TKYA 2C7MB 4US8A 4I6LB 4NJ7A 1WJ4A 3Q2AC 4WWPA 1T0RC 4EZLA 1EWCA 3JVZX 4W9GA 3PTFC 1WMHB 1N5XA 5JHBA 3Q8FA 5EE3A 1T0QC 4RFBA 4KKIA 4WAAA 4C7ZA 1F9JA 4KZCA 2QILA 2RSUA 3KWLA 3APFA 4I6PA 1QLBB 3IBEA 1VR9A 2RGFA 3RMKC 5I4DA 2RPQA 1WXQA 1M94A 4HK2A 1D4BA 4MSMB 4S0RA 2WXRA 3NHEB 2OHFA 3N1ZC 2CU1A 3N30A 2AX5A 2W82A 1PFDA 3WANA 4B95A 2KXJA 3DQVA 1LQBA 3DVGY 2CHWA 4GMVA 3EC8A 2KJ6A 5C1ZA 4YL8A 4E71A 1JWAD 3CSFA 3QX1A 4XWWA 2HE7A 4P1BC 4RGTA 3V61A 3SD5A 4YTPB 2KWCA 3EFCA 2DYMA 4BKTA 3MFGA 1HEZE 1WJ6A 3VUYA 4IWQA 3GB1A 3A9KA 1FM0D 5J17A 2FAZA 4M8NA 2WXGA 2CJNA 4GDKA 1UD7A 1YOVB 3HVZA 4MACA 4DHJB 1WGDA 2KQ4X 4EKUA 2QC8A 3OJ4B 3QQ8B 3HIZA 2LHEA 2PKOA 4N58A 2QEJC 2K9XA 2KN5A 3GE3C 4ZHOA 4HKZE 3CIRB 1YQ3B 3IFWB 1MHHE 3ZW3A 1EUVB 2CJOA 1RM6C 2N4FA 2M8SA 2LGSA 3U52E 4MH0E 3A4RA 4DDID 2QHOA 5HHDG 3DDCB 2IY0B 1C78A 3ZNID 2BS2B 1WXAA 5BMGA 1IPGA 1P3QU 4DWFA 1Z2MA 1IYFA 2K8HA 3A4SC 4US9A 1N6ZA 1C79A 2FBWB 5H92C 1Q5WB 3AE6B 4H2AA 1R7SA 2WU2B 3N1XC 1F1HA 3E9SA 1IUEA 3GOEA 2FCQA 1MJDA 2L52A 1KLVA 2Y5PA 2KC1A 2MJEA 2I1JA 3H6NA 5FKAC 2KJRA 4MM3A 1V49A 3NZSA 3ZQ4A 1ZXIA 3UI3A 4B0MA 2DX5B 1FIQA 2GBNA 5GMVA 2JX5A 2IY1B 5FR6A 5LXIB 2H89B 3IXSA 2Q5WD 1SB3C 3ENEA 3T3NA 1SIJA 2M4NA 4OVZA 3AEFB 1SE9A 2LRWA 1FXTB 2ZNVC 4XX5A 4AUQC 2MSED 1V2YA 1STEA 4BAXA 2SAKA 1WJNA 1FRRA 3A33B 2KDBA 3Q3NC 5DPTA 3A9JB 5D3IB 1NENB 2K1FA 2HJ1A 2Z0EB 2GOWA 3QCAA 4P7IA 2BYTA 3O13A 1WE7A 2ZVNA 3BY4B 1FO4A 4W9DA 3L54A 3NVYA 4TSSA 3CMMB 3DCGA 3L08A 4NJCA 3SFDB 2K6QA 2KDIA 3ZXRA 2YLMA 5DPSA 3VAWA 4M0WB 1E90A 3J9CA 1OQYA 3ZTCA 3W5UB 1UF0A 5E6PA 4NAWA 3U30A 5JHAA 1ZE3D 1HTOA 1WYWB 3L4PA 2KVZA 1JW9D 2L76A 3RN9C 2L8JA 3AEDB 1WH3A 1IGDA 3ZVVA 1L4DB 4BKSA 3AMZA 2MLBA 4MGYE 4AQ7A 2O6VA 1HA5A 4C4VB 2MBQA 2R2QA 4IWOA 2RR9A 1EO6A 3N20C 3QWZB 3PREA 2J53A 2SEBD 5AUKA 1L0VB 2D3CA 2BB5A 1WYGA 2IPKD 3PRPB 4AWJA 2WLBA 2PLPA 3A9KB 4GDLB 3KUDB 1K50A 2N1VA 2JYTA 1B1ZA 3GP7A 4XZ4A 3VDZA 2LZ6A 2XK5A 4GDKB 5E6NA 4TUUA 2PEAA 1F0ZA 3EUB2 1ZGUB 2K8BA 4WQOB 4IOIE 2LGDA 1UELA 4ARCA 1NDDA 3NY5A 1WX9A 4RGMA 1LO5D 1MHXA 2L00B 2NMQA 1ZW7A 3M62B 3TSSA 2KQSA 3NJTA 3I3TB 3CSTA 3AECB 5IAAC 1WRIA 1I4QA 2BS4B 2EKEC 1UBIA 2L83A 3VXWA 2J0KA 1X1MA 2ZW0A 1FCCC 5DCNA 1TBEA 3RNBC 1KOTA 2EMTA 4DDGD 3HK0A 1SGHA 5D2MB 3UF8A 3MHSD 1FNWA 3ZNGC 1TGZB 4MM3B 3VTWA 1J7BA 2NBWB 1E7UA 4JWSC 1WXVA 2Y5CA 1J7CA 2C7HA 5BYSA 2OJWA 4LLGM 3KW5B 4LDTD 1SSNA 2L3ZA 4FXCA 3Q8CA 3RNGC 4LDTB 5JXVA 1ZDVA 1L4ZB 2CU3A 4JWUC 2JWZA 4HPPA 3L16A 2YEPB 2BT6A 2LJIA 1VDVA 2D07B 3NUHB 1VZ6A 3PV1A 2VH2A 4MGKE 4XGAB 4RM8A 1Q1OA 1SXTA 5HKHA 3Q3OC 3AEEB 5AEKB 3IAM1 4DHZE 3RUIB 1T3QA 3ZLZA 1WRDB 3CF6E 2W55A 3BYYB 3MC0B 4EEWA 4JLCA 2MHJA 1ESFA 2KHWB 1WY8A 2DLBA 1ZOYB 3DHIC 1QILA 3N3KB 4DXGA 1DOYA 2GBKA 2GBRA 1QT9A 3PGEA 2ZZPB 3DBHI 2JPHA 3U4EG 2K25A 3PT2B 2BB6A 3AEGB 4WWMA 4PT5A 2MQJA 3ZDTA 3AE5B 3P4SB 3WA0A 2N7EA 4NY0A 3PHWB 2DNFA 5G55A 3TEYA 5E6JA 1LM8B 1E10A 1XD3B 2MW5A 1HE8A 4TV3A 3P42A 2L0FA 3P2BA 4K7SA 4O1NA 1YJ1A 2NCNA 4YWGG 4WQMA 3X23A 1PQSA 3HUIA 4FBJB 3DPDA 2V1YA 2WDRB 1LXDA 2WX1A 3QARA 3K9PB 4KVGB 4ZYSA 1IBXB 3JYUA 4HKQA 1ET9A 1HZ6A 4GLSC 2L32A 3HM3A 1WGHA 1V1PA 2L1AA 3V05A 2PJHA 3NVVA 3APCA 3IT4B 4G3XB 5IOIA 1E7PB 3MC9A 4E3CA 5BYQA 3H7PA 2BPSA 4ZRIA 1XLQA 1I42A 2FIDA 4J6IA 1YN3A 2ZPNA 3LYYA 2B3AA 2DYBA 1MG4A 1TS5A 3W1SC 3ZJTA 3BYTB 2LI5A 2O2VA 4IC7B 5EE9A 4D2KA 1JMLA 1XLPA 2G3QB 3TL5A 5L83A 4HCPB 2Y5BB 1C76A 4KGTA 4A3OA 1XO3A 2IO3B 1N60A 2JWUA 2G4DB 4MDKE 3AE3B 1XCTL 2PE9A 2UYZB 3RNCC 1GPXA 1KRHA 1EU4A 2BBCA 2WXMA 4A90A 1TY2A 4HJGE 2K22A 1WR1A 2WWZA 2JZZA 3GZNI 5DPWA 4F1SA 2HD5B 1SF0A 1JROA 4B9KA 1WGYA 1VCBA 2C60A 3GZNB 2PMVA 4GXBA 2KLCA 4FULA 4CQNA 4XDCA 1P7FA 4GU2A 1TY0A 2I38A 2GBJA 2YEPF 1NBFC 3B1LX 3EECA 4ICVA 3T9LA 4B6WA 2KTFA 2J4XA 1OQQA 4LNIA 2CHXA 4NPNA 1D5XC 1L6VA 5FR3A 3MP9A 3APDA 3VQIA 1EF5A 2LUEA 4GN1A 1WR6E 4W9HA 3VH4B 3L10B 1CQVA 2MJ3A 1V9JA 2MBHA 5EE0A 3URYA 4HJKA 2G9HD 2M19A 1N61A 3AEAB 2MP2A 1TTNA 2ICIA 3T8MA 2QCZA 1UNSA 4GIVA 1SE2A 2WYQA 2X38A 2BYEA 3DWGC 4EZKA 1P0RA 2D2QA 4UDUC 1L0YB 1XLOA 4WJOA 4DHZB 3PLUA 3BVMA 3ZRFA 2IZVB 4A55A 4F7ZA 1WWTA 3DOWA 4I6NB 4P6VF 1WI0A 2KAJA 4HVBA 3ZYYX 4RF0A 3BWUD 1SJHD 1JWBD 1YQ4B 4R3DA 4W9KA 5EDSA 4HRSA 2LXCA 4B0EA 3QC8B 1PGBA 2V9HA 4XDDA 1P9DU 5EE1A 2V3PA 4RMAA 1KJTA 4IDIA 1WX8A 2BW2A 4P16A 3KVFB 3P4QB 2LRUA 2Z59B 3O65B 2JF5A 4DHJD 3EFUA 4G11A 5IN7A 1ZDXA 4KSKC 3OG5A 1E9MA 3KWVA 1V1PB 1MI0A 4WWOA 1JRPA 1YN4A 2JQRB 1WGGA 3R2TA 3AULA 2B76B 3AE7B 4REZA 2N7DA 3KUCB 2EKIA 1KLUD 1WM2A 4RM9A 2KK8A 3V3XA 2KO3A 4MJSB 2KWVB 5G5GA 1Q10A 4LNFA 2KD0A 1FFVA 4FADA 2NPTB 2O2VB 3Q3JA 4JL9A 3NZUA 4WWNA 4K3CA 4FHJA 2G4SA 2N9LA 2KTRB 3PRZA 3IT6B 3Q8BA 3PZ7A 1SE3A 4QAYA 3JSVA 1SEBD 2ZEQA 1FFUA 4G0NB 3ZNHB 3AB5A 1KLGD 1P1AA 2IGHA 1V86A 4CYEA 2KQ7A 2KYWA 3QIJA 5D6JB 2REXA 3RD2A 1QQRA 4PS3A 3LJ3A 2GRIA 4ACFA 4AJYB 4J3OD 2IJ0A 1BXTA 3R8BA 1WGKA 1U4AA 2DZMA 2WDQB 1ENFA 3M95A 1KFYB 3N32A 2D11A 3RZFA 4RGOS 3RNFC 5HG2A 2W54A 4IWPA 2FNJB 2V4LA 4N6EB 2INDC 3AI5A 2YVCA 4RNAA 3BVZA 2ZVOA 2KACA 1R4MI 5J2RA 1F2RI 5LLIA 3R2IA 1R4MB 4OVVA 4F8CB 2HTHA 1F52A 1FCLA 2KVRA 4BVUC 3BVGA 2JRIB 2V3NA 3DWMA 4KZ0A 2IO0B 2V3SA 5JH5C 5C23A 2L7RA 3W2DA 3UGBB 4A8XC 2I1KA 1DOXA 1E5WA 1VZ8A 3AXCA 3RT3B 2WU5B 5T8IA 1MFWA 3ZUNA 2OEDA 1FD6A 2IGDA 5G5HA 4YT0B 3LB8C 1KF6B 3RULA 1S3SG 1I4RA 3ML8A 4YSYB 1ZUD2 3TMPB 2RMMA 2C9WB 3H9DA 2MX2A 2WNMA 1FMAD 3ZKJC 2MBBB 1DGJA 1TS4A 2N0SB 3ECIA 3W9CB 2XEWA 3L13A 3P4PB 4RGNA 2QDFA 3C8YA 2EELA 1M4VA 2INPE 2KANA 2FUHB 5IO9A 1JCKB 4NQLB 2MBOA 2VRRB 3WCQA 3V60A 4C00A 1V5TA 4NAMA 2D3BA 4MGIE 4XE0A 3B9JA 1E8XA 2AQ3B 4AOFA 3E56A 1NI3A 2WXJA 4FA6A 1N63A 2BWFA 2MEKA 3LXFA 2J0MA 3EHVA 4ZHPA 2WX0A 3NVWA 1WGRA 3FILA 2KWUB 4KGSA 3SDLC 2KFKA 4LNNA 1RFKA 3AE1B 2K39A 4NQKE 4N9F4 2EMSA 4WJQA 4ZRPA 2G1EA 4II3B 4RCOA 3MHZA 3QA8A 4FJVB 1VJKA 1S1QB 2LVQA 3KH0A 5KHOA 1Z5SB 3ZO5B 2A4ZA 1WFYA 1SBBB 3I9V1 1OEYJ 3ALBA 3VR9B 3QJZA 1T0YA 1OQRA 3KQ4A 2DZJA 4JX1C 1OTRB 2W3RA 3FC4A 3DHGC
chains in the Genus database with same CATH topology
2RDHA 3AV8A 5BYQA 4YTPB 2JU6X 1XLQA 2DYMA 1YN3A 3LYYA 3MFGA 1HEZE 3ZJVA 1GOZA 1TS5A 3ZJTA 3BYTB 4C80A 1XCQL 3GB1A 5EE9A 3T3OA 1PGXA 4YSZB 1ZP0B 3SEBA 4D2KA 1JMLA 1XLPA 1FM0D 3HRDD 3NRZA 3AE2B 2KN4A 3IAS1 1C76A 3BZDB 2WXFA 2WXGA 1MPEA 4KGTA 3VRBB 2CJNA 4ZRQA 2PTLA 1PGAA 1XO3A 2JWUA 1N60A 4MACA 3HVZA 3AE3B 1XCTL 4C7YA 1ET6A 2AQ2B 2KQ4X 3VR8B 1GPXA 3BK1A 1KRHA 4KKJA 4RF1A 1EU4A 2IGGA 1AWDA 2LHEA 2BBCA 2PKOA 2WXMA 4N58A 2QEJC 1TY2A 4A90A 2K9XA 1C4AA 2K5PA 3EGRA 4HJGE 1ZXHA 2K22A 4YTMB 4ZHOA 3AM9A 4HKZE 4MH8A 3CIRB 1YQ3B 1SF0A 1JROA 4NAWB 1MHHE 2CJOA 1FXIA 1MVKA 1RM6C 3AH7A 3U52E 1RWSA 2PMVA 1WSPA 1DOIA 2LUMA 4CQNA 1YN5A 4DXFA 1ZPSA 5HHDG 1TS3A 1KH0A 1C78A 2NTSA 2BS2B 4XDCA 5BMGA 1TKEA 2WDVB 3P1MA 4KX6B 3NVZA 3TEWA 1P7FA 4US9A 2LMCA 1C79A 1TY0A 2I38A 2FBWB 1HZ5A 5H92C 2YEPF 2WXLA 1JWUD 3AE6B 4H2AA 1R7SA 2WU2B 2AQ1B 2QJLA 3W1SA 2QMTA 2RDGA 3E9SA 2J4XA 1OQQA 1IUEA 1V1OA 1VRAB 1D5XC 1IBXA 1GAQB 2L52A 1L6VA 5FR3A 3BK2A 3MP9A 1C4CA 2Y5PA 3VQIA 1TJEA 5AUIA 2H88B 2MJEA 1VLBA 4WAFA 4Q2JA 5FKAC 1PYWD 1CQVA 2MJ3A 1SJED 2WS3B 2LHDA 1EU3A 2V4IB 2WXPA 5EE0A 3ZQ4A 3URYA 1ZXIA 1QOAA 4A9AA 2JXTA 3UI3A 4B0MA 2G9HD 1FIQA 2M19A 1N61A 3AEAB 4TMAB 2JX5A 2ICIA 1I7HA 2H89B 3IXSA 2Q5WD 5MPOA 1UNSA 1SB3C 3T3NA 2HDEA 1SIJA 4OVZA 2VZKD 1UUPA 3AEFB 1SE2A 3PO0A 2X38A 1K53A 1P7EA 1QKZA 2E3TA 2KMMA 3DWGC 1STEA 2K0PA 3P4RB 2SAKA 2VZKB 3GS2A 1FRRA 4UDUC 1L0YB 5D3IB 1XLOA 1NENB 1N5WA 3BVMA 4OZBA 2JZPA 4A55A 1CK1A 1WWTA 3FILB 1JQ4A 4JE3B 1QOGA 4P6VF 2KAJA 3SR6A 2BYTA 3ZYYX 1UWMA 3O13A 4RF0A 1T5XD 5LNK1 1FO4A 2JYEA 3BWUD 1SJHD 1JWBD 3NVYA 2LEKA 4TSSA 4HEA1 1YQ4B 4R3DA 1KTKA 4HRSA 4NJCA 4B0EA 1K51A 4XDDA 1PGBA 1SE4A 1DYQA 1F77A 3SFDB 1B9RA 5EE1A 2V3PA 1FXAA 1CJEA 4IDIA 2BW2A 3J9CA 1RYJA 4LTUA 3OWEB 4P16A 4JPSA 3W5UB 3P4QB 5BMHA 1QOBA 3BIID 1FNVA 1ZE3D 1ZDXA 2K3UA 3CWIA 2FE8A 1BMLC 1I4GA 3L4PA 3VRAB 4WH4A 3TUOA 1E9MA 1JW9D 3KWVA 3AEDB 1EWYC 1V1PB 1IGDA 1MI0A 1L4DB 1TS2A 1JRPA 1NVID 1YN4A 2JQRB 3AMZA 3R2TA 4AQ7A 2B76B 3AE7B 1TYGB 4REZA 1HA5A 4L23A 5BYRA 2EKIA 1KLUD 1A70A 2XN9C 3N9YC 5GXGB 1FEHA 1D5ZC 2KWDA 3V3XA 3ABVB 5G5GA 1Q10A 2Z8LA 1FFVA 2PIAA 2J53A 2SEBD 1XXGA 1L6UA 2Y3AA 5AUKA 1L0VB 3AE9B 3AE8B 2BB5A 1WYGA 2IPKD 2KDMA 4OZAA 3RPFC 2JSVX 2WLBA 1YJJA 2PLPA 5BMIA 2WXHA 4GDLB 1K50A 2N9KA 2JYTA 2INNE 1B1ZA 3GP7A 2M0AA 4HROA 2N9LA 1D5MC 2R61A 3P63A 3IT6B 2WXIA 4GDKB 3Q8BA 1QOFA 5D3DA 3PZ7A 1SE3A 2XNAC 1T6BX 4ARIA 1PUTA 1SEBD 4LK0M 4OW0A 1FFUA 1F0ZA 1TKGA 3AB5A 3W5VB 2ONQA 1KLGD 3EUB2 1GB1A 4IOIE 1QF6A 4ARCA 3TEXA 1N62A 2IGHA 4ITKA 1C4PA 4YTNB 3EA6A 1ROEA 4RGMA 1IGCA 2RPVA 1QQRA 1LO5D 1MHXA 3ETRA 2NMQA 4AS1A 2GRIA 3AN1A 3FAHA 1XEEA 3SFEB 4J3OD 2IJ0A 1BXTA 3R8BA 3TSSA 4YSXB 1WGKA 1AYFA 5HFYA 3MJ5A 2WDQB 1ENFA 3NZ3A 3AECB 1WRIA 1FNUA 2N7JA 1JALA 2PVGC 1I4QA 5C2TB 2BS4B 2V0GA 1KFYB 2L83A 2NTTA 3B2GA 1UGJA 4M0WA 4RGOS 4NZLB 2HTME 1L0XB 2M56B 2ZW0A 2W54A 5H8YE 5HG2A 2ACZB 1GB4A 4N6EB 4ZOHC 4RNAA 1FCCC 3BVZA 1E6EB 2DWQA 2KACA 1J7AA 2BTEA 2QIEB 2QSDA 3Q8AA 4KGRA 3ZJUA 3Q8EA 1F2RI 2PW9A 3R2IA 1V97A 1FCLA 1JWMD 2WXKA 3NS1A 3BVGA 3Q69A 1FNWA 4MM3B 2V3NA 3DWMA 1J7BA 2DYOA 4YXDB 4EE2A 2WXOA 1HXYD 4JWSC 2WXQA 1XLNA 3W2DA 2Y5CA 4A8XC 1J7CA 1DOXA 5BYSA 1Y56A 1VZ8A 4MT5A 4LLGM 1I4PA 1SSNA 4DQOC 4FXCA 2WU5B 3Q8CA 5T8IA 5C3JB 2IDYA 3ZGZA 2FUG1 1NYQA 1NYRA 4N59A 2PVOD 5JXVA 4L2YA 1ZDVA 1L4ZB 2OEDA 2CU3A 4JWUC 2IGDA 3H8HA 1FD6A 1OFFA 2J52A 2E6XA 5G5HA 2ZW1A 4YT0B 2TSSA 1PDXA 1FRDA 4L1BA 1NEKB 3LB8C 2YEPB 1KF6B 2BT6A 2LJIA 2J42A 1I4XA 1VDVA 1I4RA 4A6QA 4OHJA 4YSYB 1ZUD2 3NUHB 3AEBB 1VZ6A 2W3SA 1F2RC 3U7ZA 1L5PA 2RMMA 1ACCA 2WNMA 3I57A 2LFIA 1FMAD 3PZ8A 2GB1A 3AE4B 3B2FA 1C77A 1DGJA 1SXTA 1UWXA 1YMHE 2MJDA 4WIPA 5TSSA 1TS4A 2N0SB 3W9CB 4WURA 3TEZA 2D5GA 2LGIA 1YJIA 3AEEB 3P4PB 4RGNA 3IAM1 3C8YA 2WP9B 1T3QA 1E0ZA 1AN8A 2EELA 1M4VA 4IKGA 2INPE 2W55A 2MH7A 5D7GA 3BYYB 1K52A 3MC0B 3RFZB 4TQ1A 1JCKB 4C56C 2WQYB 1JWSD 5FK9C 1ESFA 1YNTE 1TKYA 1XF5L 4US8A 2I2YA 2DLBA 3WCQA 2BS3B 4NAMA 1ZOYB 4XE0A 2GI9A 1QILA 3B9JA 1EWCA 3HVDA 4DXGA 2AQ3B 1I4HA 1DOYA 3E56A 1NI3A 1QT9A 2WXJA 1N5XA 1N63A 2MEKA 3Q8FA 5EE3A 3LXFA 3U4EG 4XWTA 4ZHPA 2BB6A 3NVWA 3AEGB 4KKIA 4RFBA 3FILA 4WWMA 4PT5A 4C7ZA 4KGSA 3AE5B 3P4SB 2ON8A 2QILA 1RFKA 3AE1B 3KWLA 1BUIC 3TEYA 5E6JA 1E10A 1V8CA 4USAA 4RH6A 1CZPA 1QLBB 1VR9A 5I4DA 3P42A 4O1NA 4ZRPA 2G1EA 4YWGG 5HI1A 4WQMA 1WXQA 4RCOA 1D6EC 3HUIA 3MHZA 1D4BA 1EM7A 1C9FA 1VJKA 1HQRD 2WDRB 2WXRA 2OHFA 4OZCA 2AX5A 2W82A 1AW7A 1PFDA 2WXNA 2DBYA 3KLSX 4ZYSA 1IBXB 1SBBB 4HKQA 3I9V1 1ET9A 1HZ6A 4GLSC 1VZ7A 3VR9B 2L32A 1OQRA 1V1PA 2L1AA 3KQ4A 3U2SC 3V05A 3NVVA 4JX1C 3IT4B 1JWAD 4TQ0A 2W3RA 1E7PB 4XWWA 3FC4A 4RGTA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE3 D;  1ZDX A;  3BWU D;  3RFZ B;  4J3O D;  4B0M A;  1ZDV A;  4B0E A; 
#chains in the Genus database with same CATH topology
 1A5R A;  2JU6 X;  5D94 A;  4BZA A;  4W9E A;  4DXA B;  1C1Y B;  4BOZ B;  5AZF A;  4W9L A;  1GC7 A;  3ML9 A;  1V81 A;  4X57 B;  3M63 B;  2MCN B;  4ZRQ A;  1PGA A;  4C7Y A;  3ZTD A;  1ET6 A;  2JZ3 B;  2AQ2 B;  2FIF A;  3S2A A;  1BT0 A;  3HHM A;  4RF1 A;  1WMH A;  3EGR A;  1ZXH A;  5G2N A;  3AM9 A;  4MH8 A;  2CS4 A;  2J7Q B;  2M17 A;  4IW0 A;  4NAW B;  2CKH B;  4K3B A;  1FXI A;  3AH7 A;  1RWS A;  1WSP A;  1DOI A;  4DXF A;  1L2N A;  1TS3 A;  2N9P C;  4BKS D;  1TKE A;  2WDV B;  3UQA A;  5AZH A;  2JXX A;  2O6V D;  3P1M A;  4KX6 B;  3NVZ A;  5KHQ A;  2JUO A;  3W1Y A;  4W9C A;  2O6V B;  4ASW C;  4DK5 A;  4MSQ B;  3X0W A;  2AQ1 B;  2KMA A;  2QJL A;  3W1S A;  2QMT A;  2RDG A;  2OJR A;  1VRA B;  2IBI B;  3R66 C;  1R4N B;  2ZPY A;  1C4C A;  4S17 A;  4IG7 B;  2H88 B;  4LNO A;  1ISN A;  4WAF A;  1V5O A;  4Q2J A;  1YX5 B;  3ZDM C;  1PYW D;  2W9N A;  2XBB C;  3B0A A;  2LHD A;  1EU3 A;  2JXT A;  3NG0 A;  3DBL I;  3PS6 A;  4TMA B;  2XK5 B;  1UH6 A;  2M0X A;  5MPO A;  3DBL B;  2K6D B;  2VZK D;  3VHT C;  1K53 A;  1P7E A;  1QKZ A;  2VZK B;  3U8Z A;  1N5W A;  1WJU A;  1GUA B;  4OZB A;  3FIL B;  1JQ4 A;  4JE3 B;  3BIN A;  2BQQ A;  2KFK B;  2C5L C;  3C0R B;  2NBU A;  3HM6 X;  3RCZ A;  2LEK A;  4HEA 1;  1KTK A;  3AU5 A;  3MC8 A;  1K51 A;  1F77 A;  1B9R A;  4JQW C;  2AL6 A;  1FXA A;  3N1Y C;  2MWS B;  4LTU A;  4K7W A;  3OWE B;  4JPS A;  1V6E A;  4HWI B;  2KLG A;  1QOB A;  1FNV A;  3VVW B;  3V6E B;  2K3U A;  1KM7 A;  1I4G A;  2KJH B;  3VRA B;  4WH4 A;  4M01 A;  5LXH A;  1EWY C;  1GJZ A;  4KSL C;  1NVI D;  2N9X A;  1TZ1 A;  4BFR A;  2AEH A;  5GXG B;  1A70 A;  1FEH A;  2KWD A;  4GSW A;  2IO1 B;  3B08 A;  1RRB A;  3GE8 C;  2PIA A;  2Y3A A;  1XXG A;  1L6U A;  4LJP B;  1ZKH A;  4OZA A;  3AE9 B;  3AE8 B;  1XQQ A;  3RPF C;  4HPM B;  1YJJ A;  5L95 C;  3H7S A;  3R7Q A;  3ONS A;  2WXH A;  1YX6 B;  1WXM A;  4HRO A;  4FHK A;  3TCA A;  2RDB C;  1D5M C;  2R61 A;  3P63 A;  3UIP B;  5DPR A;  5CHF A;  1QOF A;  1OEY A;  1PUT A;  1TKG A;  2ONQ A;  2NR2 A;  4PS8 A;  3A9J A;  3V6C B;  1QF6 A;  3TEX A;  2KMC A;  1E8Z A;  2LVP A;  1C4P A;  2WHI A;  1WX7 A;  5CHW A;  1IGC A;  2RPV A;  3ETR A;  3UIN B;  3VTU A;  3FAH A;  3AN1 A;  3PZD A;  1XEE A;  4YSX B;  3MJ5 A;  2Z0D B;  2PVG C;  1JAL A;  5C2T B;  2NVU I;  4PYU A;  2NTT A;  3MJW A;  3B2G A;  4M0W A;  4NZL B;  2DAF A;  2BF8 B;  1L0X B;  2M56 B;  3TJP A;  4IM3 A;  1E6E B;  3RYT A;  4BBN F;  3TIX A;  1QZE A;  4HDQ A;  4ICU A;  2QSD A;  3Q8A A;  3DVN U;  4KGR A;  3D32 A;  4FJY A;  3NS1 A;  4TKN A;  4YXD B;  1HXY D;  1XLN A;  4C4V A;  4EOY A;  1I4P A;  3KUZ A;  4ANX A;  4K1R B;  2IDY A;  3ZRC A;  3ZGZ A;  2FUG 1;  1NYQ A;  3V62 A;  4A20 A;  4XYC A;  1WF9 A;  2PVO D;  2KZR A;  5CTR C;  2J52 A;  2E6X A;  2TSS A;  5BO4 B;  1FRD A;  4FLH A;  4GDL A;  4L1B A;  2ZJD A;  2OOB B;  2J42 A;  1JRU A;  3PVL A;  1E8Y A;  2ZCC A;  4HPL B;  4OHJ A;  3AEB B;  4M00 A;  2W3S A;  1F2R C;  3U7Z A;  1ACC A;  3H7P B;  3I57 A;  2LFI A;  2GB1 A;  3AE4 B;  1C77 A;  1UWX A;  1YMH E;  2PE6 B;  3IVF A;  5TSS A;  3DBS A;  1RFA A;  3H1U A;  2DZK A;  4WUR A;  3TEZ A;  2BWE S;  2BYF A;  2D5G A;  2LGI A;  2RD0 A;  4HXD A;  1AN8 A;  3SHQ A;  4IKG A;  2JRH A;  2MH7 A;  5D7G A;  1K52 A;  3I5J C;  1WM3 A;  2ASQ A;  4TQ1 A;  2KT7 A;  4C56 C;  4BOS C;  2KX3 A;  2UU7 A;  1Y8R C;  4PK1 A;  1XF5 L;  2DHZ A;  2I2Y A;  2BS3 B;  2D3A A;  2FCS A;  2G45 B;  3A1Q A;  2GI9 A;  2BYV E;  3HVD A;  3Q3F A;  1I4H A;  4ANV A;  4EFO A;  4ZRJ A;  1WXS A;  3RI7 C;  2UWQ A;  4XWT A;  2JY6 A;  1UGM A;  2BKF A;  3PHX B;  2ON8 A;  3PLV A;  5CX3 A;  1BUI C;  1YQB A;  1RLF A;  1V8C A;  4USA A;  4RH6 A;  1CZP A;  2KDF B;  3FKY A;  4W9F A;  4MEM A;  5HI1 A;  1D6E C;  1EM7 A;  2AWT A;  1C9F A;  2JVC A;  1P98 A;  3QAQ A;  1HQR D;  4ZRK A;  4II2 B;  2KKC A;  4OZC A;  1AW7 A;  2WXN A;  4KV2 A;  4JGH B;  1K8R B;  2DBY A;  3KLS X;  2IYD B;  2DEN B;  1VZ7 A;  2LD9 A;  3SU8 X;  3VFK A;  2WGS A;  1TT5 B;  2WDT B;  4KDL B;  3U2S C;  4IUM B;  2FCM A;  2BKR B;  4HLE A;  3R7R A;  4TQ0 A;  4W9J A;  4GOC A;  5AZG A;  3ZJU A;  1TZO A;  2MP2 B;  2RDH A;  3AV8 A;  2M1M A;  4GGQ A;  2LVO A;  1D3Z A;  2ZCB A;  1IP9 A;  2KFJ A;  3NOB A;  3ZJV A;  1GOZ A;  2NS5 A;  2INC C;  2IO2 B;  1H4R A;  4C80 A;  1XCQ L;  3T3O A;  1UZX B;  1FPY A;  1PGX A;  4YSZ B;  1ZP0 B;  3VUX A;  3SEB A;  3VH3 B;  2CHZ A;  3HRD D;  3NRZ A;  3AE2 B;  4PS7 A;  2KN4 A;  3IAS 1;  3BZD B;  2WXF A;  1MPE A;  3DVN V;  3MTN B;  3VRB B;  2PTL A;  3RNE C;  2KC2 A;  2CR5 A;  1EF1 A;  4ZYN A;  3VR8 B;  3BK1 A;  1I35 A;  4KKJ A;  2IGG A;  1AWD A;  4A3P A;  2DAJ A;  1T0S C;  1C4A A;  2K5P A;  1GG3 A;  4YTM B;  1GC6 A;  4OVU A;  1MVK A;  2LGY A;  2LUM A;  5IKC M;  1YN5 A;  1ZPS A;  2C7N B;  1KH0 A;  1C3T A;  2NTS A;  3Q14 C;  1YD8 U;  2N9E B;  3TEW A;  3ZIM A;  3DHH C;  2LMC A;  1WZ0 A;  2KNB A;  2D3G A;  1HZ5 A;  2WXL A;  2MRP A;  1JWU D;  2ZNV B;  5IP4 D;  2MA9 B;  3RZW C;  3JW0 X;  2HJ8 A;  1V1O A;  3TBL D;  1SIF A;  1IBX A;  1GAQ B;  3BK2 A;  4W9I A;  3WAM A;  1TJE A;  5AUI A;  1E8W A;  3PPA A;  4KDI C;  1VLB A;  1OGW A;  3PSE B;  2JT4 B;  4WJN A;  3WAL A;  1SJE D;  1WIA A;  3R3M A;  2WS3 B;  2WXP A;  2V4I B;  4M8M A;  1QOA A;  4FJZ A;  4A9A A;  2LJ5 A;  2L0T A;  1I7H A;  1AAR A;  1J19 A;  3UQB A;  3ZNZ B;  2HDE A;  1UUP A;  3JSV B;  3PO0 A;  3A1Q B;  2E3T A;  2KMM A;  2K0P A;  3P4R B;  5TR5 A;  1H8C A;  1LGR A;  3GS2 A;  4BBN C;  2A5U A;  4KIK A;  4HDO A;  4CO7 A;  2JZP A;  1CK1 A;  1NI2 A;  2N1W A;  1QOG A;  5J18 A;  3L17 A;  3SR6 A;  1UWM A;  1T5X D;  4XC2 A;  3OLM D;  5LNK 1;  2JYE A;  2GLS A;  1L7Y A;  3UIO B;  1SE4 A;  2MBE A;  1DYQ A;  4JIO U;  4M02 A;  1TIF A;  4LJO B;  2BVC A;  1V80 A;  1CJE A;  1RYJ A;  3WAO A;  3M3J A;  2NBV B;  1LFD A;  5BMH A;  3QK0 A;  2KDE B;  3VUW A;  3BII D;  4LCD E;  4MGZ E;  3CWI A;  2FE8 A;  1BML C;  2R2O A;  2PPH A;  4NJ6 A;  3TUO A;  3WIM A;  1TS2 A;  1VD2 A;  4AJW A;  1TYG B;  4EUT A;  5JZE B;  1YIW A;  4L23 A;  5BYR A;  2XN9 C;  3N9Y C;  2LWP A;  1GNU A;  1D5Z C;  3L0W B;  3I63 C;  3ABV B;  3U7D A;  2Z8L A;  4PYZ A;  2AYO B;  2KDM A;  2JSV X;  4BKG A;  4WJP A;  5BMI A;  3IG3 A;  2N9K A;  2INN E;  4HCN B;  1CMX B;  2M0A A;  4IM2 A;  2LGX A;  2WXI A;  4K81 A;  2L05 A;  1R4N I;  5D3D A;  2XNA C;  1T6B X;  4ARI A;  4LK0 M;  4OW0 A;  1Q0W B;  3Q3M C;  3W5V B;  4NNJ B;  2DZI A;  1GB1 A;  1HTQ A;  4LNK A;  3Q6B A;  3OAW A;  1N62 A;  4ITK A;  1G6J A;  4YTN B;  3EA6 A;  1ROE A;  2KOX A;  3DBH B;  3ZXV A;  4GB9 A;  4AS1 A;  5E6O A;  3AU4 A;  4FN2 A;  3SFE B;  3KYC D;  3C19 A;  1AYF A;  5HFY A;  1UBQ A;  3PRM B;  3VTV A;  5IA7 A;  2BGF A;  4ANW A;  3NZ3 A;  1FNU A;  2N7J A;  2X8X X;  3QHT A;  1WZ3 A;  2D10 A;  2V0G A;  1UGJ A;  2HTM E;  1GB4 A;  5H8Y E;  1J0G A;  2ACZ B;  4IM0 A;  4ZOH C;  2DWQ A;  2K8C A;  2J0J A;  1J7A A;  2BTE A;  2QIE B;  3Q8E A;  2PW9 A;  2LAS A;  1MG8 A;  1V97 A;  4MEL A;  3IHP C;  3WAP A;  1JWM D;  2WXK A;  3Q69 A;  1J8C A;  2DYO A;  4EE2 A;  4ANU A;  2FCN A;  2WXO A;  2WXQ A;  1Y56 A;  4MT5 A;  2VH1 A;  4DQO C;  4MJS A;  3RNA C;  2KX0 A;  5C3J B;  4AP4 C;  1NYR A;  4N59 A;  2NPT A;  4L2Y A;  3H8H A;  4URK A;  1OFF A;  4KIK B;  2ZW1 A;  2GBM A;  1PDX A;  1NEK B;  4G50 A;  3LDZ E;  5CHV C;  1I4X A;  4A6Q A;  4CHK A;  2LXA A;  1L5P A;  4ZDV A;  1E7V A;  2KTR A;  3KYD D;  3PZ8 A;  3B2F A;  3OJ3 A;  4WIP A;  2MJD A;  3DBR I;  4EZJ A;  1WE6 A;  1YJI A;  3DBR B;  4E74 A;  3DVG X;  4DBG A;  2WP9 B;  1E0Z A;  3NS8 A;  4P1C C;  2GMI C;  1RAX A;  3K9O B;  3RFZ B;  4K7U A;  2WQY B;  1JWS D;  5FK9 C;  1XT9 B;  2AL3 A;  1YNT E;  1TKY A;  2C7M B;  4US8 A;  4I6L B;  4NJ7 A;  1WJ4 A;  3Q2A C;  4WWP A;  1T0R C;  4EZL A;  1EWC A;  3JVZ X;  4W9G A;  3PTF C;  1WMH B;  1N5X A;  5JHB A;  3Q8F A;  5EE3 A;  1T0Q C;  4RFB A;  4KKI A;  4WAA A;  4C7Z A;  1F9J A;  4KZC A;  2QIL A;  2RSU A;  3KWL A;  3APF A;  4I6P A;  1QLB B;  3IBE A;  1VR9 A;  2RGF A;  3RMK C;  5I4D A;  2RPQ A;  1WXQ A;  1M94 A;  4HK2 A;  1D4B A;  4MSM B;  4S0R A;  2WXR A;  3NHE B;  2OHF A;  3N1Z C;  2CU1 A;  3N30 A;  2AX5 A;  2W82 A;  1PFD A;  3WAN A;  4B95 A;  2KXJ A;  3DQV A;  1LQB A;  3DVG Y;  2CHW A;  4GMV A;  3EC8 A;  2KJ6 A;  5C1Z A;  4YL8 A;  4E71 A;  1JWA D;  3CSF A;  3QX1 A;  4XWW A;  2HE7 A;  4P1B C;  4RGT A;  3V61 A;  3SD5 A;  4YTP B;  2KWC A;  3EFC A;  2DYM A;  4BKT A;  3MFG A;  1HEZ E;  1WJ6 A;  3VUY A;  4IWQ A;  3GB1 A;  3A9K A;  1FM0 D;  5J17 A;  2FAZ A;  4M8N A;  2WXG A;  2CJN A;  4GDK A;  1UD7 A;  1YOV B;  3HVZ A;  4MAC A;  4DHJ B;  1WGD A;  2KQ4 X;  4EKU A;  2QC8 A;  3OJ4 B;  3QQ8 B;  3HIZ A;  2LHE A;  2PKO A;  4N58 A;  2QEJ C;  2K9X A;  2KN5 A;  3GE3 C;  4ZHO A;  4HKZ E;  3CIR B;  1YQ3 B;  3IFW B;  1MHH E;  3ZW3 A;  1EUV B;  2CJO A;  1RM6 C;  2N4F A;  2M8S A;  2LGS A;  3U52 E;  4MH0 E;  3A4R A;  4DDI D;  2QHO A;  5HHD G;  3DDC B;  2IY0 B;  1C78 A;  3ZNI D;  2BS2 B;  1WXA A;  5BMG A;  1IPG A;  1P3Q U;  4DWF A;  1Z2M A;  1IYF A;  2K8H A;  3A4S C;  4US9 A;  1N6Z A;  1C79 A;  2FBW B;  5H92 C;  1Q5W B;  3AE6 B;  4H2A A;  1R7S A;  2WU2 B;  3N1X C;  1F1H A;  3E9S A;  1IUE A;  3GOE A;  2FCQ A;  1MJD A;  2L52 A;  1KLV A;  2Y5P A;  2KC1 A;  2MJE A;  2I1J A;  3H6N A;  5FKA C;  2KJR A;  4MM3 A;  1V49 A;  3NZS A;  3ZQ4 A;  1ZXI A;  3UI3 A;  4B0M A;  2DX5 B;  1FIQ A;  2GBN A;  5GMV A;  2JX5 A;  2IY1 B;  5FR6 A;  5LXI B;  2H89 B;  3IXS A;  2Q5W D;  1SB3 C;  3ENE A;  3T3N A;  1SIJ A;  2M4N A;  4OVZ A;  3AEF B;  1SE9 A;  2LRW A;  1FXT B;  2ZNV C;  4XX5 A;  4AUQ C;  2MSE D;  1V2Y A;  1STE A;  4BAX A;  2SAK A;  1WJN A;  1FRR A;  3A33 B;  2KDB A;  3Q3N C;  5DPT A;  3A9J B;  5D3I B;  1NEN B;  2K1F A;  2HJ1 A;  2Z0E B;  2GOW A;  3QCA A;  4P7I A;  2BYT A;  3O13 A;  1WE7 A;  2ZVN A;  3BY4 B;  1FO4 A;  4W9D A;  3L54 A;  3NVY A;  4TSS A;  3CMM B;  3DCG A;  3L08 A;  4NJC A;  3SFD B;  2K6Q A;  2KDI A;  3ZXR A;  2YLM A;  5DPS A;  3VAW A;  4M0W B;  1E90 A;  3J9C A;  1OQY A;  3ZTC A;  3W5U B;  1UF0 A;  5E6P A;  4NAW A;  3U30 A;  5JHA A;  1ZE3 D;  1HTO A;  1WYW B;  3L4P A;  2KVZ A;  1JW9 D;  2L76 A;  3RN9 C;  2L8J A;  3AED B;  1WH3 A;  1IGD A;  3ZVV A;  1L4D B;  4BKS A;  3AMZ A;  2MLB A;  4MGY E;  4AQ7 A;  2O6V A;  1HA5 A;  4C4V B;  2MBQ A;  2R2Q A;  4IWO A;  2RR9 A;  1EO6 A;  3N20 C;  3QWZ B;  3PRE A;  2J53 A;  2SEB D;  5AUK A;  1L0V B;  2D3C A;  2BB5 A;  1WYG A;  2IPK D;  3PRP B;  4AWJ A;  2WLB A;  2PLP A;  3A9K B;  4GDL B;  3KUD B;  1K50 A;  2N1V A;  2JYT A;  1B1Z A;  3GP7 A;  4XZ4 A;  3VDZ A;  2LZ6 A;  2XK5 A;  4GDK B;  5E6N A;  4TUU A;  2PEA A;  1F0Z A;  3EUB 2;  1ZGU B;  2K8B A;  4WQO B;  4IOI E;  2LGD A;  1UEL A;  4ARC A;  1NDD A;  3NY5 A;  1WX9 A;  4RGM A;  1LO5 D;  1MHX A;  2L00 B;  2NMQ A;  1ZW7 A;  3M62 B;  3TSS A;  2KQS A;  3NJT A;  3I3T B;  3CST A;  3AEC B;  5IAA C;  1WRI A;  1I4Q A;  2BS4 B;  2EKE C;  1UBI A;  2L83 A;  3VXW A;  2J0K A;  1X1M A;  2ZW0 A;  1FCC C;  5DCN A;  1TBE A;  3RNB C;  1KOT A;  2EMT A;  4DDG D;  3HK0 A;  1SGH A;  5D2M B;  3UF8 A;  3MHS D;  1FNW A;  3ZNG C;  1TGZ B;  4MM3 B;  3VTW A;  1J7B A;  2NBW B;  1E7U A;  4JWS C;  1WXV A;  2Y5C A;  1J7C A;  2C7H A;  5BYS A;  2OJW A;  4LLG M;  3KW5 B;  4LDT D;  1SSN A;  2L3Z A;  4FXC A;  3Q8C A;  3RNG C;  4LDT B;  5JXV A;  1ZDV A;  1L4Z B;  2CU3 A;  4JWU C;  2JWZ A;  4HPP A;  3L16 A;  2YEP B;  2BT6 A;  2LJI A;  1VDV A;  2D07 B;  3NUH B;  1VZ6 A;  3PV1 A;  2VH2 A;  4MGK E;  4XGA B;  4RM8 A;  1Q1O A;  1SXT A;  5HKH A;  3Q3O C;  3AEE B;  5AEK B;  3IAM 1;  4DHZ E;  3RUI B;  1T3Q A;  3ZLZ A;  1WRD B;  3CF6 E;  2W55 A;  3BYY B;  3MC0 B;  4EEW A;  4JLC A;  2MHJ A;  1ESF A;  2KHW B;  1WY8 A;  2DLB A;  1ZOY B;  3DHI C;  1QIL A;  3N3K B;  4DXG A;  1DOY A;  2GBK A;  2GBR A;  1QT9 A;  3PGE A;  2ZZP B;  3DBH I;  2JPH A;  3U4E G;  2K25 A;  3PT2 B;  2BB6 A;  3AEG B;  4WWM A;  4PT5 A;  2MQJ A;  3ZDT A;  3AE5 B;  3P4S B;  3WA0 A;  2N7E A;  4NY0 A;  3PHW B;  2DNF A;  5G55 A;  3TEY A;  5E6J A;  1LM8 B;  1E10 A;  1XD3 B;  2MW5 A;  1HE8 A;  4TV3 A;  3P42 A;  2L0F A;  3P2B A;  4K7S A;  4O1N A;  1YJ1 A;  2NCN A;  4YWG G;  4WQM A;  3X23 A;  1PQS A;  3HUI A;  4FBJ B;  3DPD A;  2V1Y A;  2WDR B;  1LXD A;  2WX1 A;  3QAR A;  3K9P B;  4KVG B;  4ZYS A;  1IBX B;  3JYU A;  4HKQ A;  1ET9 A;  1HZ6 A;  4GLS C;  2L32 A;  3HM3 A;  1WGH A;  1V1P A;  2L1A A;  3V05 A;  2PJH A;  3NVV A;  3APC A;  3IT4 B;  4G3X B;  5IOI A;  1E7P B;  3MC9 A;  4E3C A;  5BYQ A;  3H7P A;  2BPS A;  4ZRI A;  1XLQ A;  1I42 A;  2FID A;  4J6I A;  1YN3 A;  2ZPN A;  3LYY A;  2B3A A;  2DYB A;  1MG4 A;  1TS5 A;  3W1S C;  3ZJT A;  3BYT B;  2LI5 A;  2O2V A;  4IC7 B;  5EE9 A;  4D2K A;  1JML A;  1XLP A;  2G3Q B;  3TL5 A;  5L83 A;  4HCP B;  2Y5B B;  1C76 A;  4KGT A;  4A3O A;  1XO3 A;  2IO3 B;  1N60 A;  2JWU A;  2G4D B;  4MDK E;  3AE3 B;  1XCT L;  2PE9 A;  2UYZ B;  3RNC C;  1GPX A;  1KRH A;  1EU4 A;  2BBC A;  2WXM A;  4A90 A;  1TY2 A;  4HJG E;  2K22 A;  1WR1 A;  2WWZ A;  2JZZ A;  3GZN I;  5DPW A;  4F1S A;  2HD5 B;  1SF0 A;  1JRO A;  4B9K A;  1WGY A;  1VCB A;  2C60 A;  3GZN B;  2PMV A;  4GXB A;  2KLC A;  4FUL A;  4CQN A;  4XDC A;  1P7F A;  4GU2 A;  1TY0 A;  2I38 A;  2GBJ A;  2YEP F;  1NBF C;  3B1L X;  3EEC A;  4ICV A;  3T9L A;  4B6W A;  2KTF A;  2J4X A;  1OQQ A;  4LNI A;  2CHX A;  4NPN A;  1D5X C;  1L6V A;  5FR3 A;  3MP9 A;  3APD A;  3VQI A;  1EF5 A;  2LUE A;  4GN1 A;  1WR6 E;  4W9H A;  3VH4 B;  3L10 B;  1CQV A;  2MJ3 A;  1V9J A;  2MBH A;  5EE0 A;  3URY A;  4HJK A;  2G9H D;  2M19 A;  1N61 A;  3AEA B;  2MP2 A;  1TTN A;  2ICI A;  3T8M A;  2QCZ A;  1UNS A;  4GIV A;  1SE2 A;  2WYQ A;  2X38 A;  2BYE A;  3DWG C;  4EZK A;  1P0R A;  2D2Q A;  4UDU C;  1L0Y B;  1XLO A;  4WJO A;  4DHZ B;  3PLU A;  3BVM A;  3ZRF A;  2IZV B;  4A55 A;  4F7Z A;  1WWT A;  3DOW A;  4I6N B;  4P6V F;  1WI0 A;  2KAJ A;  4HVB A;  3ZYY X;  4RF0 A;  3BWU D;  1SJH D;  1JWB D;  1YQ4 B;  4R3D A;  4W9K A;  5EDS A;  4HRS A;  2LXC A;  4B0E A;  3QC8 B;  1PGB A;  2V9H A;  4XDD A;  1P9D U;  5EE1 A;  2V3P A;  4RMA A;  1KJT A;  4IDI A;  1WX8 A;  2BW2 A;  4P16 A;  3KVF B;  3P4Q B;  2LRU A;  2Z59 B;  3O65 B;  2JF5 A;  4DHJ D;  3EFU A;  4G11 A;  5IN7 A;  1ZDX A;  4KSK C;  3OG5 A;  1E9M A;  3KWV A;  1V1P B;  1MI0 A;  4WWO A;  1JRP A;  1YN4 A;  2JQR B;  1WGG A;  3R2T A;  3AUL A;  2B76 B;  3AE7 B;  4REZ A;  2N7D A;  3KUC B;  2EKI A;  1KLU D;  1WM2 A;  4RM9 A;  2KK8 A;  3V3X A;  2KO3 A;  4MJS B;  2KWV B;  5G5G A;  1Q10 A;  4LNF A;  2KD0 A;  1FFV A;  4FAD A;  2NPT B;  2O2V B;  3Q3J A;  4JL9 A;  3NZU A;  4WWN A;  4K3C A;  4FHJ A;  2G4S A;  2N9L A;  2KTR B;  3PRZ A;  3IT6 B;  3Q8B A;  3PZ7 A;  1SE3 A;  4QAY A;  3JSV A;  1SEB D;  2ZEQ A;  1FFU A;  4G0N B;  3ZNH B;  3AB5 A;  1KLG D;  1P1A A;  2IGH A;  1V86 A;  4CYE A;  2KQ7 A;  2KYW A;  3QIJ A;  5D6J B;  2REX A;  3RD2 A;  1QQR A;  4PS3 A;  3LJ3 A;  2GRI A;  4ACF A;  4AJY B;  4J3O D;  2IJ0 A;  1BXT A;  3R8B A;  1WGK A;  1U4A A;  2DZM A;  2WDQ B;  1ENF A;  3M95 A;  1KFY B;  3N32 A;  2D11 A;  3RZF A;  4RGO S;  3RNF C;  5HG2 A;  2W54 A;  4IWP A;  2FNJ B;  2V4L A;  4N6E B;  2IND C;  3AI5 A;  2YVC A;  4RNA A;  3BVZ A;  2ZVO A;  2KAC A;  1R4M I;  5J2R A;  1F2R I;  5LLI A;  3R2I A;  1R4M B;  4OVV A;  4F8C B;  2HTH A;  1F52 A;  1FCL A;  2KVR A;  4BVU C;  3BVG A;  2JRI B;  2V3N A;  3DWM A;  4KZ0 A;  2IO0 B;  2V3S A;  5JH5 C;  5C23 A;  2L7R A;  3W2D A;  3UGB B;  4A8X C;  2I1K A;  1DOX A;  1E5W A;  1VZ8 A;  3AXC A;  3RT3 B;  2WU5 B;  5T8I A;  1MFW A;  3ZUN A;  2OED A;  1FD6 A;  2IGD A;  5G5H A;  4YT0 B;  3LB8 C;  1KF6 B;  3RUL A;  1S3S G;  1I4R A;  3ML8 A;  4YSY B;  1ZUD 2;  3TMP B;  2RMM A;  2C9W B;  3H9D A;  2MX2 A;  2WNM A;  1FMA D;  3ZKJ C;  2MBB B;  1DGJ A;  1TS4 A;  2N0S B;  3ECI A;  3W9C B;  2XEW A;  3L13 A;  3P4P B;  4RGN A;  2QDF A;  3C8Y A;  2EEL A;  1M4V A;  2INP E;  2KAN A;  2FUH B;  5IO9 A;  1JCK B;  4NQL B;  2MBO A;  2VRR B;  3WCQ A;  3V60 A;  4C00 A;  1V5T A;  4NAM A;  2D3B A;  4MGI E;  4XE0 A;  3B9J A;  1E8X A;  2AQ3 B;  4AOF A;  3E56 A;  1NI3 A;  2WXJ A;  4FA6 A;  1N63 A;  2BWF A;  2MEK A;  3LXF A;  2J0M A;  3EHV A;  4ZHP A;  2WX0 A;  3NVW A;  1WGR A;  3FIL A;  2KWU B;  4KGS A;  3SDL C;  2KFK A;  4LNN A;  1RFK A;  3AE1 B;  2K39 A;  4NQK E;  4N9F 4;  2EMS A;  4WJQ A;  4ZRP A;  2G1E A;  4II3 B;  4RCO A;  3MHZ A;  3QA8 A;  4FJV B;  1VJK A;  1S1Q B;  2LVQ A;  3KH0 A;  5KHO A;  1Z5S B;  3ZO5 B;  2A4Z A;  1WFY A;  1SBB B;  3I9V 1;  1OEY J;  3ALB A;  3VR9 B;  3QJZ A;  1T0Y A;  1OQR A;  3KQ4 A;  2DZJ A;  4JX1 C;  1OTR B;  2W3R A;  3FC4 A;  3DHG C; 
#chains in the Genus database with same CATH homology
 2RDH A;  3AV8 A;  5BYQ A;  4YTP B;  2JU6 X;  1XLQ A;  2DYM A;  1YN3 A;  3LYY A;  3MFG A;  1HEZ E;  3ZJV A;  1GOZ A;  1TS5 A;  3ZJT A;  3BYT B;  4C80 A;  1XCQ L;  3GB1 A;  5EE9 A;  3T3O A;  1PGX A;  4YSZ B;  1ZP0 B;  3SEB A;  4D2K A;  1JML A;  1XLP A;  1FM0 D;  3HRD D;  3NRZ A;  3AE2 B;  2KN4 A;  3IAS 1;  1C76 A;  3BZD B;  2WXF A;  2WXG A;  1MPE A;  4KGT A;  3VRB B;  2CJN A;  4ZRQ A;  2PTL A;  1PGA A;  1XO3 A;  2JWU A;  1N60 A;  4MAC A;  3HVZ A;  3AE3 B;  1XCT L;  4C7Y A;  1ET6 A;  2AQ2 B;  2KQ4 X;  3VR8 B;  1GPX A;  3BK1 A;  1KRH A;  4KKJ A;  4RF1 A;  1EU4 A;  2IGG A;  1AWD A;  2LHE A;  2BBC A;  2PKO A;  2WXM A;  4N58 A;  2QEJ C;  1TY2 A;  4A90 A;  2K9X A;  1C4A A;  2K5P A;  3EGR A;  4HJG E;  1ZXH A;  2K22 A;  4YTM B;  4ZHO A;  3AM9 A;  4HKZ E;  4MH8 A;  3CIR B;  1YQ3 B;  1SF0 A;  1JRO A;  4NAW B;  1MHH E;  2CJO A;  1FXI A;  1MVK A;  1RM6 C;  3AH7 A;  3U52 E;  1RWS A;  2PMV A;  1WSP A;  1DOI A;  2LUM A;  4CQN A;  1YN5 A;  4DXF A;  1ZPS A;  5HHD G;  1TS3 A;  1KH0 A;  1C78 A;  2NTS A;  2BS2 B;  4XDC A;  5BMG A;  1TKE A;  2WDV B;  3P1M A;  4KX6 B;  3NVZ A;  3TEW A;  1P7F A;  4US9 A;  2LMC A;  1C79 A;  1TY0 A;  2I38 A;  2FBW B;  1HZ5 A;  5H92 C;  2YEP F;  2WXL A;  1JWU D;  3AE6 B;  4H2A A;  1R7S A;  2WU2 B;  2AQ1 B;  2QJL A;  3W1S A;  2QMT A;  2RDG A;  3E9S A;  2J4X A;  1OQQ A;  1IUE A;  1V1O A;  1VRA B;  1D5X C;  1IBX A;  1GAQ B;  2L52 A;  1L6V A;  5FR3 A;  3BK2 A;  3MP9 A;  1C4C A;  2Y5P A;  3VQI A;  1TJE A;  5AUI A;  2H88 B;  2MJE A;  1VLB A;  4WAF A;  4Q2J A;  5FKA C;  1PYW D;  1CQV A;  2MJ3 A;  1SJE D;  2WS3 B;  2LHD A;  1EU3 A;  2V4I B;  2WXP A;  5EE0 A;  3ZQ4 A;  3URY A;  1ZXI A;  1QOA A;  4A9A A;  2JXT A;  3UI3 A;  4B0M A;  2G9H D;  1FIQ A;  2M19 A;  1N61 A;  3AEA B;  4TMA B;  2JX5 A;  2ICI A;  1I7H A;  2H89 B;  3IXS A;  2Q5W D;  5MPO A;  1UNS A;  1SB3 C;  3T3N A;  2HDE A;  1SIJ A;  4OVZ A;  2VZK D;  1UUP A;  3AEF B;  1SE2 A;  3PO0 A;  2X38 A;  1K53 A;  1P7E A;  1QKZ A;  2E3T A;  2KMM A;  3DWG C;  1STE A;  2K0P A;  3P4R B;  2SAK A;  2VZK B;  3GS2 A;  1FRR A;  4UDU C;  1L0Y B;  5D3I B;  1XLO A;  1NEN B;  1N5W A;  3BVM A;  4OZB A;  2JZP A;  4A55 A;  1CK1 A;  1WWT A;  3FIL B;  1JQ4 A;  4JE3 B;  1QOG A;  4P6V F;  2KAJ A;  3SR6 A;  2BYT A;  3ZYY X;  1UWM A;  3O13 A;  4RF0 A;  1T5X D;  5LNK 1;  1FO4 A;  2JYE A;  3BWU D;  1SJH D;  1JWB D;  3NVY A;  2LEK A;  4TSS A;  4HEA 1;  1YQ4 B;  4R3D A;  1KTK A;  4HRS A;  4NJC A;  4B0E A;  1K51 A;  4XDD A;  1PGB A;  1SE4 A;  1DYQ A;  1F77 A;  3SFD B;  1B9R A;  5EE1 A;  2V3P A;  1FXA A;  1CJE A;  4IDI A;  2BW2 A;  3J9C A;  1RYJ A;  4LTU A;  3OWE B;  4P16 A;  4JPS A;  3W5U B;  3P4Q B;  5BMH A;  1QOB A;  3BII D;  1FNV A;  1ZE3 D;  1ZDX A;  2K3U A;  3CWI A;  2FE8 A;  1BML C;  1I4G A;  3L4P A;  3VRA B;  4WH4 A;  3TUO A;  1E9M A;  1JW9 D;  3KWV A;  3AED B;  1EWY C;  1V1P B;  1IGD A;  1MI0 A;  1L4D B;  1TS2 A;  1JRP A;  1NVI D;  1YN4 A;  2JQR B;  3AMZ A;  3R2T A;  4AQ7 A;  2B76 B;  3AE7 B;  1TYG B;  4REZ A;  1HA5 A;  4L23 A;  5BYR A;  2EKI A;  1KLU D;  1A70 A;  2XN9 C;  3N9Y C;  5GXG B;  1FEH A;  1D5Z C;  2KWD A;  3V3X A;  3ABV B;  5G5G A;  1Q10 A;  2Z8L A;  1FFV A;  2PIA A;  2J53 A;  2SEB D;  1XXG A;  1L6U A;  2Y3A A;  5AUK A;  1L0V B;  3AE9 B;  3AE8 B;  2BB5 A;  1WYG A;  2IPK D;  2KDM A;  4OZA A;  3RPF C;  2JSV X;  2WLB A;  1YJJ A;  2PLP A;  5BMI A;  2WXH A;  4GDL B;  1K50 A;  2N9K A;  2JYT A;  2INN E;  1B1Z A;  3GP7 A;  2M0A A;  4HRO A;  2N9L A;  1D5M C;  2R61 A;  3P63 A;  3IT6 B;  2WXI A;  4GDK B;  3Q8B A;  1QOF A;  5D3D A;  3PZ7 A;  1SE3 A;  2XNA C;  1T6B X;  4ARI A;  1PUT A;  1SEB D;  4LK0 M;  4OW0 A;  1FFU A;  1F0Z A;  1TKG A;  3AB5 A;  3W5V B;  2ONQ A;  1KLG D;  3EUB 2;  1GB1 A;  4IOI E;  1QF6 A;  4ARC A;  3TEX A;  1N62 A;  2IGH A;  4ITK A;  1C4P A;  4YTN B;  3EA6 A;  1ROE A;  4RGM A;  1IGC A;  2RPV A;  1QQR A;  1LO5 D;  1MHX A;  3ETR A;  2NMQ A;  4AS1 A;  2GRI A;  3AN1 A;  3FAH A;  1XEE A;  3SFE B;  4J3O D;  2IJ0 A;  1BXT A;  3R8B A;  3TSS A;  4YSX B;  1WGK A;  1AYF A;  5HFY A;  3MJ5 A;  2WDQ B;  1ENF A;  3NZ3 A;  3AEC B;  1WRI A;  1FNU A;  2N7J A;  1JAL A;  2PVG C;  1I4Q A;  5C2T B;  2BS4 B;  2V0G A;  1KFY B;  2L83 A;  2NTT A;  3B2G A;  1UGJ A;  4M0W A;  4RGO S;  4NZL B;  2HTM E;  1L0X B;  2M56 B;  2ZW0 A;  2W54 A;  5H8Y E;  5HG2 A;  2ACZ B;  1GB4 A;  4N6E B;  4ZOH C;  4RNA A;  1FCC C;  3BVZ A;  1E6E B;  2DWQ A;  2KAC A;  1J7A A;  2BTE A;  2QIE B;  2QSD A;  3Q8A A;  4KGR A;  3ZJU A;  3Q8E A;  1F2R I;  2PW9 A;  3R2I A;  1V97 A;  1FCL A;  1JWM D;  2WXK A;  3NS1 A;  3BVG A;  3Q69 A;  1FNW A;  4MM3 B;  2V3N A;  3DWM A;  1J7B A;  2DYO A;  4YXD B;  4EE2 A;  2WXO A;  1HXY D;  4JWS C;  2WXQ A;  1XLN A;  3W2D A;  2Y5C A;  4A8X C;  1J7C A;  1DOX A;  5BYS A;  1Y56 A;  1VZ8 A;  4MT5 A;  4LLG M;  1I4P A;  1SSN A;  4DQO C;  4FXC A;  2WU5 B;  3Q8C A;  5T8I A;  5C3J B;  2IDY A;  3ZGZ A;  2FUG 1;  1NYQ A;  1NYR A;  4N59 A;  2PVO D;  5JXV A;  4L2Y A;  1ZDV A;  1L4Z B;  2OED A;  2CU3 A;  4JWU C;  2IGD A;  3H8H A;  1FD6 A;  1OFF A;  2J52 A;  2E6X A;  5G5H A;  2ZW1 A;  4YT0 B;  2TSS A;  1PDX A;  1FRD A;  4L1B A;  1NEK B;  3LB8 C;  2YEP B;  1KF6 B;  2BT6 A;  2LJI A;  2J42 A;  1I4X A;  1VDV A;  1I4R A;  4A6Q A;  4OHJ A;  4YSY B;  1ZUD 2;  3NUH B;  3AEB B;  1VZ6 A;  2W3S A;  1F2R C;  3U7Z A;  1L5P A;  2RMM A;  1ACC A;  2WNM A;  3I57 A;  2LFI A;  1FMA D;  3PZ8 A;  2GB1 A;  3AE4 B;  3B2F A;  1C77 A;  1DGJ A;  1SXT A;  1UWX A;  1YMH E;  2MJD A;  4WIP A;  5TSS A;  1TS4 A;  2N0S B;  3W9C B;  4WUR A;  3TEZ A;  2D5G A;  2LGI A;  1YJI A;  3AEE B;  3P4P B;  4RGN A;  3IAM 1;  3C8Y A;  2WP9 B;  1T3Q A;  1E0Z A;  1AN8 A;  2EEL A;  1M4V A;  4IKG A;  2INP E;  2W55 A;  2MH7 A;  5D7G A;  3BYY B;  1K52 A;  3MC0 B;  3RFZ B;  4TQ1 A;  1JCK B;  4C56 C;  2WQY B;  1JWS D;  5FK9 C;  1ESF A;  1YNT E;  1TKY A;  1XF5 L;  4US8 A;  2I2Y A;  2DLB A;  3WCQ A;  2BS3 B;  4NAM A;  1ZOY B;  4XE0 A;  2GI9 A;  1QIL A;  3B9J A;  1EWC A;  3HVD A;  4DXG A;  2AQ3 B;  1I4H A;  1DOY A;  3E56 A;  1NI3 A;  1QT9 A;  2WXJ A;  1N5X A;  1N63 A;  2MEK A;  3Q8F A;  5EE3 A;  3LXF A;  3U4E G;  4XWT A;  4ZHP A;  2BB6 A;  3NVW A;  3AEG B;  4KKI A;  4RFB A;  3FIL A;  4WWM A;  4PT5 A;  4C7Z A;  4KGS A;  3AE5 B;  3P4S B;  2ON8 A;  2QIL A;  1RFK A;  3AE1 B;  3KWL A;  1BUI C;  3TEY A;  5E6J A;  1E10 A;  1V8C A;  4USA A;  4RH6 A;  1CZP A;  1QLB B;  1VR9 A;  5I4D A;  3P42 A;  4O1N A;  4ZRP A;  2G1E A;  4YWG G;  5HI1 A;  4WQM A;  1WXQ A;  4RCO A;  1D6E C;  3HUI A;  3MHZ A;  1D4B A;  1EM7 A;  1C9F A;  1VJK A;  1HQR D;  2WDR B;  2WXR A;  2OHF A;  4OZC A;  2AX5 A;  2W82 A;  1AW7 A;  1PFD A;  2WXN A;  2DBY A;  3KLS X;  4ZYS A;  1IBX B;  1SBB B;  4HKQ A;  3I9V 1;  1ET9 A;  1HZ6 A;  4GLS C;  1VZ7 A;  3VR9 B;  2L32 A;  1OQR A;  1V1P A;  2L1A A;  3KQ4 A;  3U2S C;  3V05 A;  3NVV A;  4JX1 C;  3IT4 B;  1JWA D;  4TQ0 A;  2W3R A;  1E7P B;  4XWW A;  3FC4 A;  4RGT A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...