1ZEAH

Structure of the anti-cholera toxin antibody fab fragment te33 in complex with a d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
209
Chain Sequence
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRSWYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an anti-cholera toxin antibody Fab in complex with an epitope-derived D-peptide: a case of polyspecific recognition.
pubmed doi rcsb
molecule tags Immune system
molecule keywords monoclonal anti-cholera toxin IGG1 KAPPA antibody, L chain
total genus 45
structure length 209
sequence length 216
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zeaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zeaH02
4L4TA 3O4LE 4NT6B 1QO3B 3TYFA 3H3PL 3SDDD 2V5RA 4KK6D 2CJUH 5EBWB 3EGSB 5MHSD 3DX7A 3MRQA 2YD5A 3EYVA 2EYSA 4H26A 3QEUA 2FHCA 2PO6C 3SQOH 2PCPA 2JB6B 5K59F 4EXPX 4X98A 3BPCB 5CIPA 2CKBA 2IFGA 1AD0A 4IMLB 1WBYB 1IGMH 4YHMH 3E8UH 1JPFB 3I3BA 1ED3A 1AI1L 5ERWB 1DLHA 2HT3C 4GLRH 3SGKA 5A43C 1JF1B 2OSLA 3H9SE 4X9IA 1TETL 3VGGA 4OBRA 1NCDH 2BVQA 4G8EB 2OL3A 2HJKA 3BD4A 2FEDD 1FH5L 3U7YL 3QXTA 5JMOC 1KFAH 4I2XB 1UZ6F 5KSBA 3VWJD 1LEKA 4XHJD 4QXUH 2XA8L 3D18B 2R0WL 1AP2A 3RDTB 3UTZA 4PY8I 3X3GH 3MRIB 3UTSB 3DVGB 3X11B 1NCCL 3HUJF 2B7DT 2DTML 4X6DB 5SWZA 1MVUB 3GBLA 5E2TH 3RZCC 1WFNA 2IMMA 1TZIB 5GGTH 3VFPA 5C2UB 2XZQH 4TNVF 4IS6A 2QADD 1Y0LB 5SV3A 2EH7L 2PO6D 2X4RA 2JJTC 5GS1C 4FQJH 4EN3D 4XBEH 1EO5A 5I19L 3IDIB 4UQ2B 2A77H 3JWOH 4HCRL 4YK4B 5DD1L 3VRLF 4Y19E 3LD8B 5SX4I 5B8CB 1WC7A 3VXPB 3IRPX 1FGNH 1HEZA 1N5YH 3K2MC 1Q9KA 4OZ4B 3QDAA 4HIHB 1MCLA 1UB6A 4HHAA 1P1ZB 1CDUA 1RZKC 2BSTA 3C5ZA 4XPHH 4RA3A 4G5ZL 2A1WH 1R3LB 5JW4N 1UT9A 1AD9A 5F7EL 5FM4A 4OM1L 3GMLA 1FNLA 2B4CC 1INQA 4NQCA 4QHNA 5SX4H 2VWEC 2YWYA 4OLVH 3BP7B 4XPTH 1XR9B 1IFHL 4HS6B 3VGFA 2CDEA 1ZHBA 3FKUS 3TZVB 5MENB 3QCVH 4MJ4A 5HJ3B 1CLOL 3S98A 3BFOA 4H0GA 1XF5B 1SYSB 3OKYA 2FIRT 1KB5B 4FQ1L 3OHXB 5IMLA 3I75A 1WT5C 5F96L 4M1GH 4Y16A 5ENWA 5LBSL 2VLKD 5JPNB 1W0YT 3LSOB 2GI7A 2C3HA 4IOIA 3BDYH 2VE6A 4M7JL 4YHKL 4JVUA 3EHBC 4JQVC 5CP7A 5D7JB 4ZDHA 4QXTA 2R15A 2J12B 5HYIA 4LSVH 3JV5A 3MO1A 5JIKA 1FJ1A 5JHDA 4BQ6A 4DAGH 1PG7H 5KG9A 5DD3H 3S34H 1LP9E 4W4OC 1DQJA 1LDPL 3RGVD 4LQFH 1FL5A 4GBXD 3SGJC 3IXAB 3K74B 2Q8BH 4XP5L 2BSTB 1VCAA 2EDLA 3CDGB 3VGAC 4UIMA 1VKXA 4GG8A 4IMKA 4NKDB 4D8PB 3FQUA 4JM2B 3GDBA 1T5WA 2MPAL 3AXLA 4QLRA 4JRYA 4PYHA 5I9QC 1NBZB 4NZTH 2XNAA 1WT5A 2OTWA 4I3RL 5DJXB 2Z93B 1J05A 3V4UH 4HUWB 3DI3B 2ZPKH 5I1JL 1RUPH 5HY9B 3VJ6B 3CD4A 4PRHA 4QHUB 5D2NE 1DBJL 2GUOB 5KSBF 1KYOK 4FXGB 4P57A 2ZOLB 4YXLH 2RFXB 1FO0A 4HC1H 4FN0A 4YK4C 5IG7B 1FZJA 5MI0C 5H37H 1U8IB 4PRHD 1MNUL 1YEKH 1XIWB 2P8PB 4H88L 1YYLL 4L3EB 4O5LL 1B9ZA 3WIHH 2F8XC 3GHEH 4KDTA 1ZLVH 4Y4FD 2A0LD 1F58L 1BBDH 1NGWB 2F74B 2VERN 2VLRE 4LDLB 4WO4B 1I3GL 2XICA 3IJSA 1CBVL 5EB9A 4DUVA 1CE1L 2WLYA 3W82A 5DK0A 5DJ0B 2DQGL 1JZ7A 1Y18A 4WW2A 3UTSA 1YECH 1CFTB 3HAEH 2P42B 3C8KB 3QCUL 1C5DB 1CD9B 3RJQB 2KQNA 3EW3B 2MFNA 3MLZL 5CEZD 5K9KB 3UTTD 3OB8A 4Q97A 1DANT 1ZGLP 4JFPB 15C8H 1VENA 4RA0C 1CXHA 2UWEE 3BZ4A 4XNZB 5KSUB 3MJ9H 1A5FH 4NZJA 2AK4D 4N0FB 2X42A 1CVSC 2IQAA 3DPBA 4ALAL 2E6PA 2I60L 4ONFL 4LCUA 1S7UA 3VFSB 2YPKB 4G42A 3BJ91 5JDJA 2YK1H 1IC7L 1A64A 1J0JA 4RDQG 5BW7A 3SDDC 4RGMC 4ZODA 4JFEE 3RUGF 3DO3A 3U1SH 1DN0A 5DS8B 2P1YA 5AG9A 1IM3B 4N8CH 3QAZB 4X6CB 1I1YA 1FZKB 1AH1A 4MAYB 2EDWA 3ELAT 5EZLA 5T1LA 5IUSA 3F7YB 2PYEE 4LRNH 1OGAB 5J0BA 2Y06H 1LNUA 4AEEA 1RZFH 4ODVL 3AUVA 3QNXA 4JM2C 4Z7WF 1ORSB 5HXMA 4X9BA 3L3OB 4JFQA 4LKCA 4ZTOL 2OTPA 2GKIA 3W9EA 4GBXA 3DUUB 5B4MD 3S36L 5ESQB 4ZMAT 5DD0H 2AXHA 4JLRB 3VFGL 3B9DA 3C2SA 3LEXB 4QXWA 4TQEL 5E00A 1OAQH 3FFDB 3BX7C 4NFCA 3LQAC 3NFSH 4QRSA 1MCPH 4MA8H 3T0WA 3TM6A 4JHZA 5C0JA 1CICC 1MCQA 3QPQC 3QUZC 3WFHA 4WUKH 2QKIB 2NYYC 4I77L 4F7EB 2J7LA 2HKFL 4POYA 2LTQC 4O2CB 5GS2H 3TT1L 3KPMA 1MELA 5IB2B 3VDBA 4ODTL 2Y6SD 3LV3A 4TVSa 5J6HB 3MBXL 4I8DA 1J0IA 1TCMA 2VC2H 4D8PA 4GAJL 4MNHB 3FQWA 4NZUH 3CSPA 1OQXA 5E6IA 3M1BA 4L1HA 3HI5H 5K9QG 2HVKB 1VFBB 1QSZA 3VXNB 4TSAH 5DJ8A 1B88A 1J0YA 5KN5A 5FGCB 3HG1B 1IILE 2NW2A 3KS0H 4NJAL 4P2QD 5BZDA 1KACB 1F2QA 2O5YH 2FLRT 1OT1A 5I8EB 4G6AC 4BK5A 1CQKA 3TN0D 2R0KH 3L3KB 4UZGA 2V9RA 5F88A 4OZHA 5CSGA 1NBVL 2OXGA 1U93B 1WFOA 2XPGA 5HHOD 1BD2A 4APQC 5F7UA 3RU8H 1RIHH 3O9WB 3P11L 1W0VB 1GGBL 1ODAA 1QLRA 2YPLD 5C0FA 3DUSB 4G9FD 4ZUTA 4M9OA 4OUUB 4QYOB 5GPRA 5HYSB 1HWGB 1EERB 5DEZA 4P2OA 5HHNB 2OR8A 5HHVH 1N0XH 3EDKA 4DGYH 3U0PB 3ZKQD 3JTSA 3JWDC 5I8OL 5L7XH 3PQYB 3PL6B 2I5YL 3MJ8B 2V2XB 2XWTA 2H32H 5DXWA 3TH4T 1AIFB 4J1UA 4WWID 1ZWIA 1G0YR 2VDPH 1EMTL 1G9ML 4HQQH 4LIQL 4PJCE 2Q7YB 3C2AH 2JIXA 1HOCB 3LRHA 4KVNL 5JR1L 1F45A 3IDYB 4PRAB 3BSZH 2VO5A 5E08H 4CU7A 4OM0H 5FO8A 1QNZH 1BVZA 3RZCA 4G43B 3WEXB 1I1AD 4D0CB 3KYNB 4KROB 3MOQA 3DXAE 1NCNA 3G5YB 1GGYA 1OARH 1CFTA 3H9YA 5J9PA 1MRDH 2YOCA 5EO9A 3Q2CA 3PV6A 2YD9A 3L1OL 2H3NB 1KJ2L 5D1XA 2CRMA 4OLYH 3TBSB 4M43L 3MCG1 1CI5A 4LCIL 3RWGB 1SEBA 1I1RA 4HUNB 3EFDH 1JF6A 1H15A 4O2FB 2IPUG 4XHJC 3SKJL 3ZDYF 1IVLA 1FYHB 1KB5L 1YEFH 4ZSOE 3VWJC 3HHRB 3IGAA 4Y2DA 2X1OA 3TWCL 2HG5A 4MGXA 3ARVA 1RUAL 2X10A 5FHBH 2C3WA 1RZ8A 1WITA 4HFUH 5EOCH 1PY9A 1KIRA 1N3NA 1RY7B 1CU4L 3L7EA 3A6BH 2FJFA 3T65B 5DMKB 3ZTNH 4JRXB 4NO2A 2UUDK 2G9HA 1WCBB 3GB7A 3CMOL 3QIWB 1MUJA 1D9KC 3C6SA 5F7FA 5C08B 1S9YB 1Z6JT 5D93B 2BC4A 3NMEA 4I0PB 5ISZE 4L5FL 2BNRD 3S5LB 3IDGA 4DKFH 4ODUA 2UV3A 2BOCA 4WCYH 2XTJD 5FGSA 3UYOD 4YZFF 3RJDA 4C54A 2KL6A 4XPFH 4GKSB 1U8LB 4GOSA 1OAYH 3IFOA 3UYRL 4MYWB 3IKKA 1RZ8B 3FFDA 3T2QA 5H2BB 2YA1A 1MIEH 2NNAB 4L4TB 4YXKL 2ENSA 5FV1L 3CPLB 2J88H 5C0EB 4JFOA 1G7HA 1XGYH 3P0VH 3TCXA 4QRQA 3TFKD 2ZUQB 3KLDA 3PL6A 5TPWH 2GY5A 4RGOH 1ERNA 4MVBD 3BDXA 4K7PX 3TCLA 1A7RL 4H25B 4YAQB 4A6YL 1AGCA 1A6ZB 3F58H 3QO1B 2P44B 3DX9B 4LKXB 5EG6C 3IFNL 2PUQT 2BX5A 2W91A 4OF0A 2WMPA 3CFEA 3QAZC 1HHGA 3IDXH 5ENWB 4X4ZA 2NXYB 5FO8B 2IBBA 4L9LC 4PG9A 5HI5D 4PG2C 4X6CA 1A6VH 3HFMH 3MROA 1NFKA 5FCUL 1J0HA 1RUMH 2VLJA 1DN2A 2XKNA 3TZVA 3GBMH 2WNGA 3MV9D 5I1GH 2AV1B 3QPXL 3QFJE 2X40A 4YHPB 2ARWA 5BZDB 3E3QE 1RZGB 5KS9B 3C60D 4ZOCA 3O6KL 4PJAA 2DICA 4CU6A 2VXQH 2DLIA 5I8KL 4JGJA 1TVBA 3KPQA 3NH7H 3QHFL 1CL7H 1IGCL 1A3LH 1OSZB 3UDWA 4P59L 2Q76A 1XR8B 1VFAA 5I1HL 2WLZA 4ESKA 2GSGB 3MGTA 4PJEE 2XQYK 4ONGH 1RZJH 5EBMA 2RR3A 2EECA 3RKDC 3CZFB 4HPOL 3U7WH 3R06B 4JFDE 2KQMA 1A1NA 1EO7A 3QBTB 2CUMA 2FECL 4PRBA 3RFZC 4KZEL 1FL6A 1WFUA 3OB0H 4I0CC 1UZ8B 1MAML 2QKIA 3RNQA 3TNMA 5FF6A 4XAWL 1F4WH 3HAEA 5B38G 2FH8A 2HVKA 4QT5A 2XN9B 4KHTL 3VWKB 2BDNL 1KCKA 3DIFB 4P2RD 1UM5L 3MRPA 4YNYB 2NY6D 4P9ML 1DJSA 2HT2D 3QUKA 5F8QC 5D93C 3GIVA 5LQBL 3BW9B 3BIBX 2YSSA 4KMTL 1MHPL 5D1QC 2NY7L 2WANA 4OD1H 2NX5A 3NABH 3GIZL 5GHWL 2OS7A 1T22B 1E6OH 3DUUA 5FGRA 4Z95H 1X5HA 4K3HA 4MAUH 5IFHH 4QHUA 3K80A 4YBQD 4PRBB 1VADA 3QNXB 3V8OA 5C70A 4MJID 3OKEA 5ESVB 5C0AE 3I50L 1CXEA 1DANU 1OW0C 4FFYH 4Z5RA 3WJJA 2P47B 1JPGA 1N26A 1XF3B 1YEJH 3S4SG 1PZUB 3O3DA 3NA9H 5E8NA 4BFGA 3WKNA 5ESQA 3STBA 4WFHE 3T0EC 3ZHLA 2RAMA 4X0KA 2Q1EA 3RGVC 5B39A 5IR1A 4ONHB 2V9QA 1RZ7H 3EGSA 4Y1AE 1NEUA 2G5BA 3WHE1 3T2OA 4CN1A 4K7FB 4NN5B 5ICXA 4L3AA 2ITDB 4G80B 1IKFL 2UZYB 3LKRA 5IB4B 1AKJB 3OKKB 4JFPA 4HWZB 4UT9H 3MRDB 5EU5B 3BH8B 4RNRB 5EOQH 1FZOA 4S11A 4R90L 2ICWJ 3IU4H 1WZLA 4M5ZL 4MZ2A 2DQTH 2DBJA 1CDBA 4QXGH 5EBLA 2HH0L 2WBJC 2VDNH 2VH5H 3QEQA 3EJYD 1AGFB 3QUYA 3BP7A 1T4KB 5C09B 5L2KE 1WEJL 1OTTC 2XA8H 4ZPTB 3T1FB 4P4KB 4Z7WE 4V2CB 3PWUA 4BZ2H 2JJUA 3TVMD 1CVRA 4FQXA 1E0OB 4NFDA 4F3FB 3NGBB 4M7ZC 1MFDL 2UY7A 3HMXA 1CE6B 1A3RL 2NX5E 2W60A 3DHMA 3WLBA 3QDMD 4YPJA 2R29H 2F54B 1OF2A 3QXDA 2ADJA 3OSKA 2PYEB 2XG4A 2HG5B 3QDJE 4Z7QE 4PGBB 1OGAE 4WEUD 3IGAB 2NX5B 4R4FH 4LSTH 3C8KA 5K9OA 2BFVH 3I02B 1EAPA 1JHTB 1X4ZA 1MJJB 2DLFL 3MRBB 4OJFL 5AWNH 1KCLA 4S10A 3OGCA 1VKXB 1TQBC 4OKDA 3C5JA 3O4LD 1SJHB 5SWSD 5DR5L 1ZT7A 1GC1H 3GSRB 5E8OA 5DT1H 3HNTL 5F7EH 1QHOA 3EDDA 2A6DB 2YC1A 1CDIA 4XNXL 1NBYA 2Z93A 4UILH 1KJVA 4Y5XC 3UZEA 2UZIL 5FYKL 3CDFA 2R69L 1BFOA 4U1MA 2AJZB 2L0DA 4KVCL 2VL5B 2VDQL 2VE6B 3QCTL 1XR8A 5IB3A 5F9OH 2CQVA 4ZUSB 4FQHA 1BIIA 2XT1B 3DMMA 2XKUA 2W0FB 4G7VH 2Z0BA 3KYNA 2FATL 4RWYL 1CLCA 2V17H 3WYRA 2WBKA 2I07B 1SYSA 4N0YL 3WN5B 4X5XA 2WIIB 5JIHA 4PJ9B 2CIIB 2AEIT 1TJHH 2BXZA 2YA2A 4N0UA 3PQYA 4WHYG 4ZPVA 3TO4D 3SY0A 1YN6B 3WXWL 43C9A 1V8HA 4GG8B 1CLZH 3WBDA 2X4QA 4K3EL 2QQQA 3NTCL 2ERJB 5GGRA 4E5XA 4NWUH 2JB5L 4K9EC 3QEGL 3UTPE 3RTQA 4RGNB 2AGJL 4WTZA 1X9QA 4ERSH 4QOKE 4HIHA 1TPXB 3SGEI 3TH3T 5ABDE 3DI2B 4JFFE 4HAFA 1VHPA 3WKMH 3MBEB 3S37L 1DBKL 4YR6A 1NCBL 1A7QH 3EDFA 5JW5B 3ULSA 5M95B 4P5MA 5I1LB 4H20L 3PDOB 2IH1B 3U4BL 2VXTL 1XR9A 4I3RH 3IT8D 3MXWH 1FNHA 4Z7UB 1TZGL 3OF6A 4N9GB 1U8JA 3FT3A 4LLUB 1XEDA 1HCVA 4XC3H 3QZWB 3NIFE 4Y2DD 1EZVX 3CX5K 3O6LL 4YBHA 1J86A 4XMKL 3WFBH 5M94B 2NLJA 3QNYA 2VXUH 2CIKA 4HFWA 2GT9A 4ZOAA 5ANMB 1MCHA 4JZJB 1KN4H 2IPTH 1FL3A 4EQ3A 3QA3B 2FWOB 2CIIA 5FO7B 3KXFD 1MNUH 1YEKL 5TE4L 5C0DB 4NQXB 4HX1A 4QWWD 2VZ1A 1FFPA 1YNKL 3QI9B 3ZDYE 4ETQB 3VW3H 4IRSA 5A2JH 4FZ8L 4LL9A 2VAJA 25C8L 2YD1A 4LSSH 4UB0H 2C3VA 4MNGE 1TVHA 2E27L 2NY0C 2NZIA 3L7EB 2FX9L 4KJWC 3BKYH 5IHLB 2XPGB 2H1PH 1WC7B 1KNOB 3HPLA 1C5CL 1N3NB 2K3TA 2AJZA 1DBMH 4YBLC 1J8HB 3IAQA 4LBEB 4XCNB 2A74A 3MYJB 1YPZF 1KCSL 5C07E 1HZHL 3LEXA 1QRNB 3SQBA 4QO1A 4EIGB 4Y5YA 4IRZH 1GGUA 1ZHNB 3CXHJ 3WE6A 5EORH 1B2WH 3OXSB 3PDDA 5FA4A 3VD5A 5J13C 4M4RA 2DQJL 2AI0L 3H9SD 1IQWL 3ZHDA 4ALAH 1U8HB 4YJZL 1RZIB 3VFWB 1KIQA 2F53A 5E8DL 4JE4B 3RDTD 3TGXA 5D70H 4K71C 4G8IA 1DSFH 5I0DA 4GMTL 1DBBL 5I30L 2FX8H 1CTOA 2Y5EA 3GRWL 1DLHB 4IOFD 1AXSB 4HUXB 2GK0B 5EU5A 2GTWB 4NKMA 3HZYA 2IEPA 4KFZC 2ZCLH 3QXAA 3BIKA 4OAWB 2E6JA 2AEWA 3QB7C 1K8IA 3ARDD 4MMZC 4OQTH 1BOGB 3W2DH 3FO0L 4PRPD 2EICA 2D7QA 3TEUA 3EYUL 1WLHA 3TP4A 3HB3D 5MI0B 2OTUA 3P9LB 3V5DB 2FIKB 3H7LA 3VU2A 1GAFL 4ZFFA 2VLRA 4BK4A 5GQBA 1EHXA 5C8JA 4NUJB 3S36H 1NFDF 5CZVL 5HPOA 5A2FA 5EC1B 5IFJA 5EZJA 4OF7A 3P40A 2GK0A 1M4KA 1OAQL 1RMFH 3LHPH 3ARDC 1FRGL 1UWEL 3PWPE 2BERA 4OCSH 1SEQL 3HLAA 3LD8C 3WFEH 4P2OB 5HHNA 1TCRB 5EN2A 4LLVB 3CFKB 4NRXB 3Q1SL 4R4NC 5BQ7A 5MEND 5F1NB 4PJGB 1MLCB 4LLDB 5I18H 2Y07H 4MA7L 3FQRB 5KVGL 3X14B 5T3XL 1KOAA 4HJGA 3D0VA 2IANA 4OLEA 3MMEB 3KPSE 1VSCA 5D7LE 3T8XB 4HUXA 1PSKL 2VLKB 3E0GA 5KANG 2ORBL 3ROOA 5GZND 1YMME 1HQ4A 3ARYA 4PREA 5CJQL 4XP4L 3G9VA 2R2HA 3QH3A 3LB6D 3ORJA 5JUEL 3HPLB 3K4AA 3DO7B 1ZA3B 4PY7A 4PJDF 1OW0A 3RWJB 3TYGH 3IRZA 2H2SD 3ROLB 1KTLB 3LQZA 5D71L 3ULVL 2AP2A 1XGQA 4UBDD 5KZCB 5TFSL 1HSAB 4G8GA 2B4CL 5KS9E 4P23B 3GMMA 4WI6A 4WNQB 1Q72H 4PJIF 5IGXL 4X4XB 3T3ME 4XP1H 2VZ3A 4YO0B 5GGSY 1IRAY 3CVHA 1Q94B 2VSDA 3V0VB 2GT9B 5INDB 3LEVL 3A67L 3HC0A 5HHPA 3LS4H 2LAGB 4P3CH 3IXAA 4NC2B 3L7FA 3V79C 3HC4H 5I1IH 4LLUA 3QNZB 4JFEA 2NXZB 3VXMD 4YWGH 1A4KA 4Z7UA 3V2AR 3CX5J 4JRYB 3T77A 1NAKH 1M71B 1F4XH 1U91B 2FEEI 5GRUL 2CIKB 5H94B 1L0XA 2OJZH 2J5LC 1D5BA 2VRAA 2I9TB 4PRHB 5HD8C 3N1PC 5CGTA 4FG6D 3WD5H 4L3ED 5EOCJ 3FQNB 3IFLH 4U33A 4S1RH 3B9KB 4IJ3B 4PRHE 2DQUH 4QXTB 5H35A 4HLZG 2L4OA 1FPTH 4LVOC 5TQ2H 5L9DL 2EEAA 3R1GL 4JFYB 1F3JB 1QSFD 4G6KL 2PF6A 3RWCB 3T77B 2VZOA 3X3FL 5ITBH 1MY7A 1BZ9A 1ZT4B 1VGKB 3NIFF 2AJUH 3G5VA 4RFEB 1T1ZB 2PTUA 1OP5K 2XZAL 3VFNB 4CW1B 2N7AA 4AEHH 2LFGA 2P45B 4WO4C 5T1MB 3RWEB 2XWBA 3KJ6H 5CJXA 3N85H 1EEZA 2Y72A 3W0WD 1G6VK 3RIAF 1R24B 4NN7B 2Q87A 2AK4B 3TJEH 1KJMA 1Q0YL 1T1XA 2HP4A 4KHXH 1D5MB 2PW1A 3ZSSA 2KDGA 1HDMB 3DVNA 5DF0A 3SKJH 4IM8A 5LCVL 1DVFD 2V7NB 3IDIA 4UQ2A 3GSXA 1KEMH 1OPGL 1KPVB 2ZKHH 4KKBD 1DUYA 1HSAA 4G8GB 4PJBF 5DVKA 1MLBA 2PXYA 4FXLA 1QLRB 2DL9A 2ZJSH 2VDRH 2EC8A 1GOGA 5IB3B 1IZKA 3BZFB 3TT3H 1GOHA 4NDMB 5IMOA 5GRWA 3OJDA 5DEGB 1RHHB 3E1F1 3DYPA 4NPYA 4YDLB 1PKQB 1AQDA 3HE7C 3FRPG 3O6MH 4LCWA 3PGCB 4DN3H 3DURB 1ZANL 2ARJB 3F6LA 3EJZD 1PKQE 1S7TA 3GKWL 2X4RB 5CEYB 1EPFA 3IKCB 5CJXC 3MV8A 2B2XL 4J23A 2OLDA 1UB6B 1LO0H 1EFXA 2ADGA 3ARED 4X6DA 3IDYC 3KYAA 5SWZB 1ZGLB 1Z2KA 1JWUB 1I9RL 1NMCC 5CJ8A 5T1KA 2EDRA 3P4NA 4LARH 3AMLA 1MRCL 3RZCB 4FABL 3DHJA 3HUJA 3V5HA 2X4SB 3QFDB 2QEJA 5E6IC 1ACYL 5TF0A 3S4SA 1Q9OA 2P24A 4IBLT 4OV5A 1IQDA 4W6YB 3GKZA 4M1DH 4X9FA 4PJGF 3HS0A 2BNUA 5JLZA 1FC1A 4PGCB 1MREH 4N9OB 4EBQL 1H3PL 1CGTA 3D25A 4Z7QF 3L3GB 1H0DA 2Y36L 1J88A 1VGKA 4LU5L 3IYLW 1F11A 3I6KB 5E6ID 4C59B 1P4BL 2GJZB 4XNYL 3EYVB 5JHDB 4Y19D 3GBML 3LKOB 1N8ZB 3RGHA 4JPWL 2PR4H 2GAZB 3SE8H 5CJOL 4OGXL 5DJDA 3HG1D 3CLEL 4P2OC 1JWSA 5E2UL 5TH2B 1KBGH 1CDGA 1CFVL 4K7FA 4XCEB 5I75C 2QQNL 2JCCA 3G5YA 2E9BA 4K9EL 4U3XA 4HG4K 4P59H 5CWSA 5EWIH 2FNBA 3C08L 3MACH 1Y6KR 3LKRB 4JKWA 5HJ3A 5EA0H 1E27B 2YPLB 1RZJC 5E8NB 4K3JH 1L7IL 3CVHH 4N5UA 3X12B 5ISZD 4HIEA 3HCVB 2XTLA 5B3JE 5GS0H 1RJLA 3S35L 5DJCA 3TA3C 4MX7B 4JFZL 4JM4L 2BDNH 4L8SB 2OK0H 1ES0B 4NO3A 5LWYH 5I0ZA 2IFFL 5MERB 4EIZC 4DCQB 2H6PA 1J1XL 4DVBB 3I84A 2JJWA 5SX5H 4F8TA 1E4XH 4GQPH 4F7CB 5T5FL 2BSSB 1V05A 2DKSA 4G9FA 1RUQH 2FWOA 3QA3A 5FO7A 1UEYA 4X7CC 2E9JA 1T6VN 4JO3L 1TMCB 4HIIA 3Q0HA 4TTDD 4PJEF 4LQFL 3L9RB 3ROLA 3ARSA 3G5ZB 3GSNA 2YUXA 4XP5H 1TTUA 1MCOH 2AW2A 5F7DA 3QQ4B 3KPNB 5IEKA 5TDNA 4KRMB 4EN3A 4NC1E 5DVNA 5FA3A 4BSVA 4C4KT 4UINL 2Z31B 1AGEA 4Q0XH 4PJ5D 3MRIA 2A74B 5J12C 4EOWL 4NZTL 2R0LL 1HKLL 1FO0B 4L9LA 3VXQB 3CSYA 2IANB 1IGYB 5GRYA 4NC0B 2VDOL 1P7KA 3KLHC 4H8WL 3MFFA 2VLLA 5T5NG 1RZ7L 5EC2B 3H3BC 1CFQA 1F3DJ 5BOPA 2FECI 5AUMB 4CVZB 4ZS7H 1DUYB 2JTDA 3OR6A 4QRRE 2DDQL 3BT2H 4HC1L 1QBMH 4MA3B 4Z8FL 3IXTA 1MWAL 1HHKB 4ZFGL 4JG0L 3OX8B 2R9HD 3B8SA 4F37K 2FZ3A 2BK8A 4PJ7A 3WIHL 1KXQE 5D1QB 5F7YC 3ZKSD 1AE6H 4I3GA 1KN2H 2W65B 3L95B 4QHMA 3VFVA 4OLUH 4M5ZH 4CW1A 1R3HA 2AABH 2X7LA 5E99L 3GJFH 5E1HB 1IZJA 4HK3N 4MQSB 5J6GB 2DQGH 2RJMA 4KUCF 2XY2A 4NNXA 5GJSL 3T65A 3F5WA 4OV5B 1IAII 2DB8A 4NRYB 3KVQA 4N0FA 1E27A 2YPLA 1UACH 4F7MB 5J06A 4CADA 2AERT 2BNRE 1JUFA 2H32A 1RVFH 5E5UB 3FB6B 2A9NL 3MJ9L 4MNQD 4L4TD 3ULVD 2A83B 4R4BA 1D6EA 2BZDA 3BRGC 4BKLA 1X7QA 3AREC 3DYMA 4P3DA 4KI5D 5T1LD 3VXRA 3VDAA 4Y4KC 4AYFA 4FXKA 3MSPA 3JV0A 1KUMA 1W2KT 4HWEH 4LDOB 4WO4A 4EVNA 3MXVH 3MRBA 2C7UA 4OD2A 1QEWA 2ATPB 3LH2L 4DVRL 4NQEE 4P2YA 4DK3A 3CPLA 5HI3C 3BGFB 3D25B 1BBJB 4KXZH 3RVWC 4NM8H 4K2UH 3FZUD 4WFHD 1BF2A 1W72L 1FZJB 5BO1H 2ADJB 3TNNA 3VG9C 1OSPL 2FGZA 4Y8DC 4M6NH 2EDNA 5DMYA 3GO1L 2DI8A 2HAZA 1GC1L 3VXUB 4PJHE 4S1SH 3CMGA 3RVWD 5IMKB 1S9YA 3C60B 4XNXH 1WFTA 3IDJB 5K9JH 4KI1A 5GGVY 5H8DA 2ESVB 2ARJA 3VXUE 2AVGA 1U3YA 1EFXD 3AREA 4FFWD 3BE1L 1D5MA 4PJGE 4W81A 3HRPA 2VDQH 4P4KC 5GS2D 1UM4H 3BN3B 1IBGL 1Z3GL 4WJ5A 4A2LA 3ARBC 4GMSH 2DQHL 4QY8B 1WZMA 3BVNB 1DP0A 3C9NA 2QR0A 3D87B 3ZE0E 5EUOF 1CT8A 1MI5B 1G7PA 5CMAA 4FFWC 2AAVA 1IC5L 3WXWH 2DKMA 5E9DA 4KKLC 1ORQB 4WI5A 4F8QA 3MOBL 5F1NA 1GVIA 2PW1B 4YR6B 2AV7A 1P69B 2N1KA 5LG1A 1L4IA 3FTGB 3NCCB 5HVHB 1S5HB 4QGYA 4NOFA 5E9DD 4KY1L 4P5TA 3BKMH 4Y16B 1SQ2N 4ZG1A 4P2QE 5TQ0L 3QJHB 4LSUL 3UP1A 1A7QL 4FQQB 4KAQL 4GRWE 4JZNB 1LMKA 2BP3A 2R0ZL 5FKAB 1U91A 1FVCB 1FVEB 4PB9L 3QHTC 4AK1A 3WSQH 3BXNA 3V5KB 3K1KC 5ETUB 2FSEB 4I3SH 1CR9H 2FYYA 5EUOE 3EFFB 1KCUL 5BRZD 1XF2A 4J3OC 3BRDA 4MJIE 1DQJB 5DGQA 3TA3B 3HE7A 1GGCH 5C0AD 4XNZC 3BO8A 2VLLB 4CDGC 1NFDE 5INCB 5HD8D 1LQSR 4TUJA 3PUCA 2IH3B 3WCYA 4HKBA 3VGAB 5E5RB 4NSKB 2LU3A 1GZPA 2QSQA 1MJUL 2BXYA 4YHZH 1BGXH 1KENL 3MLYL 1G84A 2BNQA 2WBWB 3L3IB 2WK2A 4P9HH 1INDL 2NW3B 5D5ME 4HQQL 5ADOL 4MCZA 4YE4H 1XIWD 4TTDC 5T3ZD 1EVTC 3QIUA 4POUB 4IIQC 2UWEF 2EIZA 4P3WA 3HC0B 4NQVA 3OGCB 5H94A 5DQJA 3MLVH 2CDEB 3UJTL 5ID0A 1HZHH 1A7PL 3UBXG 3R06A 1F6LL 4FQXC 3FO1B 4LEXL 4RAVB 5KN5B 5JXEA 4GRMB 3SDYH 1QUNA 2MNUA 3ULUC 1LEIB 2Z92A 5IB1A 3HR6A 5CBAB 2NY2B 2QQKH 3L9RA 1ZGLM 4K94L 5C09D 4XCCL 3WJLA 3G6JA 3L1OH 1T0NB 1H3GA 5IIEB 2J1KA 4XCYB 1HILB 1X5GA 3PGDB 4HGWB 1AC6A 4MXWH 3LN5B 4FTVE 5E2VL 5D1XD 4UNUA 2OR9L 5DEFA 4JFFD 1MCWW 1OWWA 3A6CL 1QFUH 5L2KD 1I4FB 2D7MA 4CGTA 4KPHL 2DLGA 4L8BA 2AV1A 2N4IA 2EIDA 3GNMH 5HSFA 1CGSL 2NY5C 3DROB 4J6RH 3KG5A 4HCRA 3FN0L 4IIQA 4EVNB 1A6TA 2YUVA 4OCYL 1NC2B 2H2SC 1RFDL 1M6OA 2O93L 3RUGE 1P7QA 4M62L 5C0RL 2XOTA 1T7YA 3NN8B 1S7QA 3CGTA 2ZSVA 5DRXA 4LCCB 5HHXL 2WINB 2R4RL 4MQXC 4BUHA 2IQ9H 1UG9A 5J8OA 4K8RD 3RP1A 3D18A 2NY1C 4HLZH 1CK0L 4RFNC 5IQ9A 4X80H 5CZVH 1NLBL 3X13A 3BO8B 1IM3A 4U7MA 2EKSA 5C0EA 1RMFL 3RNKA 3TA3A 3MUY1 2EDBA 3HZVB 1JWSB 4FHBD 4X7SL 3MRKA 5T1DH 1U58A 4WV1B 3UMTA 1RQ5A 3F7YA 1U8HA 3V52L 3UX9B 5EZJB 3P9WB 5IESL 2Y7QA 3CCHB 1F11B 4K71B 1OM3H 3OAUL 3HE6B 1J12A 3UPAA 3WV0A 2Z4QB 4LNRB 3BZ4B 3MNWA 3UZQA 2GTWA 4WW1A 3CFDB 1A7OL 1K4CB 5TE6L 4EUPA 3OX8A 4UI2A 1HHGB 3SPVB 2QSVA 5FHAL 4GO6B 1D6VL 1CWVA 1HWHB 3TIEA 4ZUSA 3IFNH 3MRKB 4UUJA 1VFMA 3CDCA 1VADB 2MKLC 5CFHA 1JHLH 2DQDL 5C0CD 5BZWB 4HWBH 5F3BB 3U0TA 1VFUA 5C07A 5MEPB 1JZ2A 5ACMA 3VG0H 5I2IB 3MV9E 4OFIA 4Y5VB 1FNSH 4XH2A 4BUGA 1RUML 4I13B 3ZKMC 4RAVA 3IF1B 5I76B 5DA4A 4HF5H 2YD3A 3S9DB 1T1WB 3EYFA 4NWTL 5EOTA 3G6JF 4N0CD 3FQXB 3T0DA 2R1WB 2D7OA 4GFTB 5IG7A 4PR5B 4UOW0 4X7TB 3LQAL 4JHAH 1P4IH 2IALA 4M8QB 4ODHH 1I9EA 3EO0A 5T3XD 1QVOB 4DUWA 3ARGB 1LILA 4NO0A 5FA4B 4Q9CA 1NL0H 1LO3H 5JXAL 4FOMA 2DLEA 3RWIB 1UH3A 1E6JL 5K9OB 1UZ8A 3TNMB 3FO9B 4YWGL 4U6YB 5KAQG 4OCRL 5GISH 3QDGE 3PWPA 1LO4H 2WBJD 1EJOL 4JFDD 4G9FB 2ADIA 5JHLL 1J8HA 3ZHKA 5DLML 4MCYB 4AL8H 2VQ1B 3QDGB 5EUKB 1TJIH 1ZLWH 3WO4C 2V2WA 4QHLA 5IQ7L 5IV2A 4HUUB 4MQXD 4J3XA 4XMLH 3KLAB 3EJJX 5D7LA 4K3DH 4ZNEA 2KH2B 3K4ZA 3Q3GB 1NKOA 4Z9KB 5HGAB 2VQUA 1LO2H 3PABA 3VFNA 1ZS8A 1G0XA 5GGSA 1SVZA 1A7NL 3HCVA 3O2WH 5D7LD 1FVCA 4OD1L 1UXSB 2QSTA 5D7KE 5I16B 5IT2H 5I17A 2AJSL 1E6OL 3U0PA 4JN1H 4NQDD 4Z95L 1W8OA 3WXVH 1NDMA 4NBZB 1MJ8L 1R3JB 3VXSB 1U8NB 1JL8A 2R23B 3GMPA 5DRNA 1RIVL 3BI9X 4JHBA 1IEHA 3GMNA 1QSEE 3CFIC 4BH8B 1FZOB 5DJ6A 3L5WA 4KROD 4YHYC 1OAUL 5DJ2A 2IANE 3OKDA 1ZLSH 1NCWH 3JWDH 3P73A 4LPTA 5E03A 5C0BB 3EBAA 5D1ZB 1YEJL 3NA9L 2B1AH 3UTQB 4ZQKA 1BWWA 5KJRL 5BS0D 4PTUA 1UM6L 3MV8D 3G6DH 1SM3L 1AO7A 4YFLI 1R3JA 4QTIH 3VXSA 3LMJH 4ZO8A 5HDLA 4ZUWB 1IGJB 1RIUL 3DBXA 2Q8AH 1I8MA 1DDHB 5FCSH 2VR5A 4YQXL 3P9MB 4LMQI 2CKNA 3PHQA 5CJ5A 5DTFB 2R4SH 2R1XA 1V7NL 3BP5B 2X4UB 3N50A 5KW9L 2B0SH 1U42A 2ED8A 1JWUA 5HGGS 3E3QC 1IT9L 4HDIB 1BIIB 4HIXH 1GGIH 4NKOA 1C5BL 2RQ8A 4Z77B 1S9XA 4I0PD 4MDIA 5C0JB 1CFNB 2DBLH 5BJTA 2VDNL 5T3ZL 2N56A 2B5IC 2R2HB 4JG1H 4S2SB 5KTEL 9CGTA 2HWZL 4EDWL 3EO9L 1KJVB 2O61B 1GGTA 2AJYL 1K6QH 3WO4B 3MRGA 1HYSD 5LJYH 4F2MA 3S7GA 1ZE3C 1ACYH 3L7FB 3KPOB 1D9KB 5I1KH 2FL5B 4L4VE 1YY9D 1U92B 1YC7A 3QXDB 3UTTA 4CVXB 3EYOA 3PGFH 4FQ2H 1D5XA 3IETA 3CVHB 1T5XB 2P4AB 1C1EH 3W0WE 3QDJD 1XZ0A 3ZDZE 2W0KA 3U48A 4GG6B 4U7KA 1Q9LA 2EYTB 3PIQB 5CEZH 2DLFH 5AWNL 4D0BB 3KPSA 1KTDA 4XPGL 4C83A 1LE5B 1RZKH 1URLA 4P23D 5MP6L 4PREB 3TYFB 3H3PH 3FHQA 2BY0A 2LE9A 1JFQL 5GGUB 3VH8G 4WTZG 1T1ZA 3BIKB 3DRTA 5JW3L 2EKSB 5FUOH 3HE6A 1OCWL 4H26B 3WFZA 1JI1A 1X44A 5D2LE 3HKFA 4KK6C 2YMXH 2YS4A 4N0RA 1UB5B 5BXFB 1YY8B 3CFKA 3BWAA 2DIAA 1YYML 4YHLH 3GSQA 3EOAA 3RX8A 5IOPA 2FX7H 1AY1L 4YXHH 1A6TB 1RULL 1KFAL 4V1DD 4XNMA 4JKPH 1T20A 3QUZA 4HGMA 2AJXL 2MSPA 5EU4B 3V8CA 3VFOB 4FMKA 5FO9B 1I9IH 4M7KL 4I9WD 2OM5A 3EZ8A 5TDOA 4XVSH 1G7JB 3ULVF 1QD0A 3MUHL 3MV9A 5HYJA 3HB3C 4WGVB 4KTEL 2JB5H 5JTWA 1F4YH 1IAKB 4U31A 4QOKD 1FO0L 1BLNB 4EUPH 1H3UA 2NY3C 2EH7H 1F6AB 3UCRA 3QIBB 1ZVSA 2HN7B 1IGFH 2VUYA 4IRSB 4OSUL 1BAFL 4OTXH 2A77L 3PDGA 2J4WH 4OZIF 4W6XB 2BSRB 4X8XA 4JM2A 2VDOH 3OWEA 2NLJB 2F8OA 4X7FC 3RVUC 1RZIA 1LK3L 2GJ6B 4DW2H 3LQZB 1UCBH 3OAZH 2BVOA 4HD9A 3KPQB 4JFDA 1G9MC 5GGQH 1JMXA 2WUBL 2XZZA 1AO7B 3D85D 1ITBB 2UUDH 4PJBB 5C0DA 4LHUG 2WP3T 3BUYA 1MWAH 4ZFGH 4TNWF 3NACH 3U9UB 3GSOA 3MX0A 2CK0L 5E5MB 3L5XL 2YHGA 1FORL 1YDPB 1YEGL 4HKJA 4MNQA 1CFNA 4XP6L 1Q1JL 2CLZB 2DQFB 1IAOA 1KPUA 1N4XL 3HZMA 2Z8SA 1MSPA 3BGMA 3MGAA 4FQIH 2EYRB 3K8MA 5IFAL 4L8SC 4KK5D 2EE2A 4QHKJ 1C5CH 1T89A 2CRZA 4G43A 1HHIB 3NCJL 1MCJA 2NZ9D 5C07D 1HYRC 3FMGL 1N59B 4OF6A 4G7YH 4JFHD 5HBBA 3T2NH 2C26A 3D9AL 2JK5A 3QP3A 2F5AH 4NNPH 3MZGB 2A9MH 2APTA 5C2BH 1MCSA 4HSQA 3ZKND 4UT6H 5BS0A 2FIKA 1JE6A 1G7MB 4UMGA 4D9LL 1KLGA 3RZCD 4UU9A 4N9GA 4Z0BL 5CBEB 5DD6B 2VLJD 2W9LA 2XWTB 1S7UB 3VFSA 3KPLB 4GMTH 1MFEH 3GSVA 4JZNA 1SBBA 1BREA 4YHIB 2HT3D 3QISA 4PG9B 4NP4H 1FYTB 4FP8L 2FO4A 4DQOH 4KUZL 1G9NH 3QDMB 4PLKC 3JV4A 5K9KA 1X5AA 2F54D 4X4MA 1ADQA 4P5TB 3V4UL 1J8KA 4GXUN 2A6KA 4DKEH 2FEDC 3T4YB 4OQTL 4JB9H 4H8WC 3GO1H 4JO2H 4NIKB 5E8PA 4FTVA 4QRRD 3W9DA 5DD5L 2AEQL 4OZGA 3LIZL 4UV4L 3WNPA 4O5LH 5E95B 3C9NB 4XH2B 1UENA 3BE1H 1PD6A 3BVNA 1F58H 2Y5TB 2WWMD 4XCNA 1T1YA 1QSFA 2QHLA 4WFGE 1FNEA 4N90D 3G6AB 4N1HB 2AJ3A 1QFWH 1CD0A 1S5IH 5FUCE 1F8TH 5ITFA 1CYGA 1X5IA 1T3FA 5GGVH 5FYLH 4Q6IC 2MHAA 1I7UB 2LQRA 5KAQF 4UDTB 4XWOC 4PJ8C 2A2QT 1DQDL 4OLXL 5LKNA 4RISH 1WCBA 3GB7B 1ZV5A 3R4DA 1FZMA 2KPNA 4P46B 1F6AA 3MOBH 4Y88A 1ZLWK 3PL6C 1KIPA 4MNQE 2JKXA 3DX7B 4NGHL 4X6CF 2EXWD 3SO3C 3U9PL 4BQ8A 1QVOA 1P2CB 1P9MC 1UH2A 1S7RB 4U6VH 4PGZA 4OKVA 2DIBA 1TJGL 3QHZL 2RCSL 3RA7L 5TDOB 3H42L 4KRPD 5MEOB 5IJVA 4NJ9H 3F7VB 1LWRA 2YUZA 5JZ7D 4KAQH 3F7RA 4PGBA 3SDAD 1BEYL 2E6QA 2OR7A 5J7CC 2CDFA 3KHQA 1UQSA 1KPRB 3WIFB 1KF9B 3MBED 4MS8D 2MCG1 3B2UD 1G9NC 4EXKA 3AVEA 4YPGA 1YEIH 4BQBA 4BSWB 4WFEE 4IMKC 3BKJL 5J9PB 3GM0A 1YNTA 2G5BB 1GGCL 1MJ7H 5LXGL 2EDDA 4TUOA 1BD2B 4OZGF 3MRCA 1IAOB 4I18B 3BEWA 2IBZY 2J5LB 3OB0K 4NKIH 4TVPE 1EUUA 1KCVH 3OTTA 5BVPL 3QULB 4GSDL 4M7LL 2N7BA 4OQ1A 3RX7A 2O5XH 2VDLL 4LIQE 4E41D 4X5WA 5IW1A 4LLYB 1I8KB 3ZT5A 4YHZL 1C08A 2I9LA 2OI9C 1KENH 3MLYH 3RBSA 3OAYH 3BH9B 1U58B 3NOIA 4M5YL 1SJVA 1FLTX 2R2EA 4JDTL 1A21A 3FOLB 2DQIL 2ILLA 5DFVC 4RFEA 5EC2A 5D72H 1W0VA 3QEQE 3QI9D 4U1JB 4WUKL 4KXZI 3NFNB 2Z35B 3JBG7 5CAYB 3I6LE 1XF3A 2Q7NA 1KPUB 2VQ1A 3QQ3B 3MLVL 4OFYD 1S7WB 3D3VB 4OLWH 1A7PH 4M7LT 3JV6A 2NCMA 2EDFA 4QOKA 4FZEL 5ITBL 2Y1VA 4V2BA 4BZ1H 2X9XA 3SDYL 3SOBL 2NY3B 3T04D 1NSNH 3TVMA 1GHFH 1ZT1B 1R3KB 1KG0A 5F7DB 3TN0A 5C0BE 3U83A 1YNLL 1BVKA 4ACPA 4PJ8B 4MXWL 1RAMA 4NZDA 4APQD 4Z78B 3L5HA 4MD5A 1BVLB 3G5XB 2HKHL 2OR9H 4ZD3L 4G6JL 1XFPA 2BSRA 5HHMB 2IGFL 1FFRA 3RHWK 5I1CL 3GI8L 4ZO7A 3CH1A 3SO3B 4MHHG 4X5LA 3LN4A 2ZUQC 4Y4KD 5JOPD 1ACZA 1F3RB 1EGJL 1N64H 3H8NA 4PJFB 2XYCA 3F65A 3LPGA 4PV9B 1PJ9A 5CIPH 3QSKB 4KI5E 3RU8L 3L3OA 4LKCB 5BZWA 3MOAL 5F3BA 4NKQB 1GGBH 3HE7B 3TT3L 5C0RH 3WNKA 1L7TH 1FBIH 3EOAB 4MD4A 1H9VA 5DJXA 4EUPG 1RK1A 4BSJA 5D6CB 4FNLL 1I3UA 1HNFA 1FVDB 2R2BA 3UO1L 1WBYA 1S7WA 3D3VA 4KJPC 2GSGA 4QF1B 2RIKA 5EZIH 1S9VB 3DMMD 3OG6B 5EU4A 3ESUF 4HS8H 5IBLC 2VL4A 4C55A 3GKWH 3RVXC 4WEBL 2ICES 3CCHA 5L8LB 3KYMB 3MRCB 5HGBB 4M48H 4OCLC 2XA3A 2Y7QB 4MMXC 4MCZB 4KRPC 3RVXD 3P0YL 1EMTH 1G9MH 4OZIE 3WL9B 4QRPB 1G6RL 3OQ3B 4ZTPL 4P99A 5T3ZE 1C08B 1G7JA 3V52H 3E6FB 4TUKH 1NFDA 4G9DB 1B90A 2D0HA 1I7ZB 4Q9QL 4CJ1A 1OD9A 2WP3O 4JZOB 2ZUVA 4H5SB 3U4AA 3FCTA 3D0VB 2VZTA 1FZKA 4QRQB 1DUZA 1EA9C 4U1JA 1NGXA 2NY2C 4LASL 3SGJA 4YHML 2ICWA 1GCFA 4LHUD 1A4JB 4P5TC 5LGKA 4ZXBB 4TSBH 1U8NA 3GSQB 5ICXB 4LLMA 1TCRA 3OHXA 3UJJH 2VLMD 4XNUL 2XQBL 5ETUA 1NCDL 2XTJC 4GKSA 1NC2A 2CDFB 4D2NA 2UWEB 1NGZB 2UYLA 1B6DA 1OTTD 3KPOA 3L5JA 3LS5H 1XF1A 2YRPA 4GW5B 2DQEH 1GIGL 4XB7A 3CIQA 3M8OH 1LE9B 4RBPK 2YN5A 2IAMB 2CDGA 3F7QA 3VFRB 4OZHE 4HXAH 1BZ7B 1UGNA 5GRJH 4NM4L 5IBUG 5E9DE 1KCRL 5IJKC 1D5ZA 2H41A 3GHBH 4MLIA 3QUYD 4FQJL 2F5BH 4O4YH 1OTSD 2Z92B 4PP1D 5FUCC 1QFWM 3RAJL 1K8DB 3LN4B 1FNAA 3MZTA 5DTFA 3GMQB 3TA3D 2P8PA 5IB5A 2B39A 2NXZD 5F6HJ 3VXMB 4WCYL 4GKZA 5J1TC 2H8PA 4XTRC 4P23C 1F02I 1P2CA 3W39B 3QUMA 1S9XB 1J5OL 4GAFB 2R39A 2DM7A 4XPHL 3I2CL 4FFVC 1EAPB 1JHTA 1DFBH 4LMQE 3U7YH 3OXSA 3ULVC 5EPMA 2FB4H 3VFMA 4OM1H 1FDLL 5TGBB 3SE3C 2ESVA 4XI5D 3KAAA 2X4UA 1KB9J 4XPTL 4OCNC 1BQHA 1JUFB 2H32B 4PJXE 2R0WH 4HMDA 3P4MA 3CJJA 4JRWA 1RUQL 1J11A 2IH3A 3IDNB 1CLOH 2V6HA 4N8VA 3GSVB 3K3QA 4Z77A 3RDTC 2UY6A 3MBEA 2APVA 1IEBB 1X5ZA 1H8OA 2QSCH 4OD3H 4PJXB 4UIMB 5D9SA 2A6KB 3E2HB 4XXCA 4NQEA 2X44D 4JFXB 4AQOA 2Y5TA 4KV5E 4BYHA 1FP5A 2FR4B 2VYRE 3CFCH 4OLZL 4PTUB 3K2UL 4R0LB 2X05A 2BCKA 5IHUH 4NUGH 3GI9H 3HMXH 4G3YL 3RVVD 4JGUA 4OD2B 4UQ3B 4LSVL 3V7AE 5EU6D 1IAIH 3MFGB 1ULVA 2P46B 3G6DL 1FGNL 4PJBE 3SDXE 5HDQH 4S0TD 1C16A 5B8CC 2CO7B 3OKLB 5T3XE 3FO2A 5MEQA 2WW8A 4BFBD 5JPNA 4FTVD 4UDUB 4QRRA 3UBXB 4IHOB 2P5WE 5C9KA 3BT2L 3WUWG 5ICZA 3UYPA 1S7SB 2BRRH 4ONGL 1WF5A 3QO0B 4OZFB 4TULH 3ILQC 4PRDB 4OGAD 4KZEH 4OIIL 3TZVC 1MAMH 5KS9F 3HN3A 5IMLB 3AAZA 3AU1B 3Q3GA 1JRHH 4QCIA 3OKNB 5C0GA 3N1QC 2PO6A 5DUML 3UTSE 5KTEH 4KDWA 3SCMC 3IJYB 4XZUA 4U6HB 2P8LB 2G2RA 1I1FA 3AREB 5I71C 1YMMA 1HH9A 1OTSC 1X5YA 4PP1C 2W59A 2IG2L 3O2DH 5DD3L 3BQUB 2HJLB 4WWKB 4HK0B 1HXMA 5IHBA 3QPQD 2X2YA 3HE6D 5DK3A 3VRIA 4HKXA 4YX2L 2P8MB 4LCWE 5CUSL 2LVCA 2Q8BL 4JDVB 3LVEA 3TIDA 4X6DE 4R8WH 5ERWA 3V4VH 5JW4M 3P4MB 4PGDA 2CDGB 4NQED 4M3KB 4NNYB 3EZJB 4HBCL 3R0MA 2LU4A 4HJ0D 2ZZUT 2QTEA 4LNRA 2CGRH 3UJIL 3V0AC 1KC5L 3MRFB 5C0CB 1CD8A 2EH8L 3HNVL 1QBBA 1G1YA 1SEBB 4ODBD 5BS0E 1VACA 4TVPH 2C4FU 2ED7A 1A6WL 4OFPA 5E6IB 1JNLL 4HAGA 4N0UE 4Y19B 3ZE2F 5C0CE 1IC7H 2BVEA 2F58H 4UUJB 4RGNC 1A1NB 5IVOA 1JFQH 1CD1B 1A0QL 1AGBB 4U1KA 1IKFH 1UB5A 5DQDL 5IVXB 3D5OF 4UT9L 4HWZA 3DVIA 1B0RB 5EOQL 4Z76B 4YHIA 4NYLB 4PJGA 3MQIA 3U30C 4NRYA 4DWHA 5C6TH 1MCKA 3C6LD 3UBXI 1KSRA 4XPAH 4I4WA 2H26B 3HUJE 1AHWB 2WIMA 1CE1H 5J12B 4KUCD 1BJ1J 1U8OA 4GRLD 1RJCA 4YXHL 1XGUB 2P7TB 1OGTA 2P5WA 4JKPL 5I75B 2FCBA 1T4KA 5ECJE 3ZYJA 2CO6B 3DOSA 1JYWA 4NHCL 4LPXA 2VDML 4MZ3A 1P84J 3F8UB 1I8IA 3RTQD 4I48A 3U4EA 2DTMH 1J0KA 2CXGA 2OMBA 5E94A 3IXTB 4POZC 3ILPA 2EE6A 4MA8L 3QG6A 3LOWA 4GW4A 4XGZA 1IMHC 3F6IA 3LKSB 1SJEB 3KPSB 2CMRL 1MFDH 1P7HL 1UKQA 1JTOA 4MJ6A 4YAQA 2GY7B 2BY2A 4EI5D 5I71B 4D0DB 2B20A 4X6BB 5I19H 5L6YL 4KQ4L 3FO1A 4HCRH 4LSTL 4MXVE 2C1PA 5LAXA 3C5SB 5JPMB 4U1HA 2NNAA 4Q9RL 4P4RA 4WEMB 4PGDB 4M9PA 3WNNA 4KZDH 4CRPA 5JLZB 5IVNA 1EK3A 3FB8B 3MRHB 2Y06L 4NBYB 2ZUTA 5DJZB 4XHQA 3TIDB 3MV7B 1D9KA 3HAEB 3KHOA 4DKDC 4HJ0C 4F33B 4PJXF 3HNSH 3MV01 3GSWB 5AZEH 1UWGH 3F12B 1LEIA 1MUJB 3KPRE 4XPBL 3ZE0F 3EYSL 5J13B 2R0KL 1MCCA 1FORH 1MJUH 3WNOA 1ZGLA 3MV8E 1HILA 3PGDA 4XP6H 1VFAB 4FQ1H 1A3QA 3KPRB 4G6FB 1EEZB 5DMIL 1X5JA 4YE4L 3MODH 4JO4H 4A2MA 5DQ9B 1E4XI 2IF7A 2HVJB 1CGXA 1V3LA 3BYYA 3T0ED 1N0XL 2VIRA 4DGYL 2GITB 4N0YH 3G5VB 3AB0B 4ZAKB 1FFOB 2P5ED 3H9SA 3P30H 3I3DA 3H2WA 4P5KA 1QFPA 5EZOH 1CLZL 3OJDB 5DEGA 3OPZH 2H3NA 5C09E 4FQLH 2WBJA 2YEZA 2VISB 4NWUL 4Y8AA 3VJ6A 1PX3A 4GQ9L 1K3ZA 3QXVA 2VKWA 3C2AL 3QUZD 4LKXA 2AEPL 1EEYB 4OB5L 4YFDB 2QHRH 2FYYB 3TESA 3MCKB 4NJAH 5GRZA 5EZLB 1AR2A 5T1LB 1SBSH 4HPYL 2FJGA 1CXLA 3LKPA 4LSQL 1B4JH 1RJYA 3BDBA 3CU1A 4NNXB 1R3IH 3CNKA 4H1LB 3I6KA 4H20H 1UA6L 5EO1A 5FIEA 3O8XD 4L4VD 3GMNB 4J4PD 5DVMA 5MEQB 1A4KB 1QYGH 4KWUA 1C16B 5J1AB 1JPST 2DLTA 3P4OA 5HI4D 1JYNA 4OKVB 1D5IL 2YN3A 1OAZL 4JO2L 4HHAB 1EXUA 4LRIA 5DWUH 3INUH 4OLYL 4HWUA 2IQAB 2EDJA 5B8CA 1WTLA 2P24B 5D1ZA 1G7QB 3MLXH 4YGVB 2D03L 3WIIL 3JTSB 5F1SA 1L9MA 1N5AB 2CKBH 4P23A 5ILTL 1QP1A 3SGDI 1JI2A 4Z18A 3KWWA 1JNHA 3VW3L 1RUAH 3SDXF 4J2XA 5HHQA 4BSWA 2AKRB 2YEZB 4MB5A 1NGYB 4OCMC 3AY4C 4HWNA 1I9JH 1FE8H 2ZUSA 3A6BL 4I5BB 4WJ5B 5F88B 2XACC 2F74A 3O2DA 3BQUC 4GW1A 3OAUH 3RWDB 3T4AA 3O3AB 3JTTA 3HR5A 1AP2B 4OM0L 15C8L 3RDTA 3UTZB 3ULUL 5KVDH 3IDJA 2IBGA 5FK9B 2FRGP 3T08A 5K59E 1PAMA 3C60A 2FO1A 4V1DB 1IQWH 3FHAA 4ONFH 1D6VH 5D2LA 2DYPD 2H8PB 5JORA 5FYLD 3AM8A 4RFOL 4K23L 3DSFL 1RK0B 3QHZH 1MIEL 5I30H 1NEZG 1NEZA 3UTOA 3LZFL 3IF1A 3IFPA 5E94B 4XRCA 4J3UA 3U1SL 4JANB 4RGNE 4X6EA 1HSBB 1DCLA 2YUWA 2FO4B 5JNYB 4QTHA 4NO5A 2G60L 4RGOL 1N5AA 4HF5L 4I1NB 4J3TA 4KK9D 3ZL4L 4A6YH 4ENEC 4RMRA 3AXLB 3BYTA 2ZCLL 4ODSL 1PLGL 2F54E 4D3CL 4HFUL 1AJ7L 3IAGC 4JHAL 2P49B 2GSIB 5DUPL 1IEAB 2HJFA 5E8EB 2IPUK 2XZQL 1Q0XL 4FQXB 1YN7B 1JPFA 5T1MA 3RWEA 1FC2D 4JN2B 5LXGH 1UKTA 1E6JH 2PNDA 4NO0D 1H3WM 3MNVB 2D3VA 3MRRB 4NN7C 3PJSB 3SDCA 1IL1B 2CPCA 4B0MM 1NGZA 2HRPL 5ALCH 5FM5M 3WS3B 5JHLH 1A6UL 4I2XA 1AHWC 1QQDA 5KSBB 5DD1H 4JFQB 4TQEH 1PYWB 2R1YB 1U2HA 3NZ8A 3HI1A 4MXQC 4GAYB 3F5WB 1N5YL 4EDXB 4IRJA 4XGZB 3CVIL 3UYRH 2DIJA 1QA9B 2FHBA 2V5YA 5D72L 5AZ2H 1VACB 3QDMA 1WUNT 2DJSA 1JZ3A 1YPZA 2HKFH 5DHYA 5FGBA 2DOCA 1GZQB 1XGYL 4OLWL 1WV7T 4PRNA 3SDCB 4P2RA 4PV8A 5D7KD 4CMMA 2EEBA 3O0RH 3QWOA 4XXDA 4JN1L 4WUUB 1QKZL 5IEKB 1EHLL 4NZUL 3RHWF 4KJQC 5D7JD 5F96H 5M7QA 5JUEH 4DEPB 3JUYA 5CSZB 2GYSA 5CCKH 4ZS6D 3X13B 5GRVL 1T2QL 3HTLX 1BM3H 4ZD3H 5D5MF 4K8RL 1NMCB 2NXYC 4R2GC 5I1GL 5C1MB 1EGJH 1CN4A 2GK2A 1J1PH 5MERA 1X5KA 4JRXE 1ZVSB 4F33A 3MRJA 4O9HL 3K0WA 4WHCA 5CEXA 2VXQL 3JSSA 3MOAH 2E9IA 5D7IF 2D31A 4H1LG 5IMMB 2VLJE 2NTSP 3G04B 5IWLC 1VGEL 3QHFH 4LVEA 1L7TL 2J8OA 3GGWA 2Q8AL 5D2NC 4OF8A 1FGVL 3NPSB 4LSPH 4FFYL 5CKAA 5L2JB 2MPAH 1JTTA 32C2B 3GM8A 2DL2A 5HYQA 5C71A 4HWBA 4PGEB 3K4DA 3MLWH 1PKQA 2BRQA 4CMMB 5EBMB 3L6FA 5JW5A 1WSST 5TF1L 4MDIB 3DV6B 4NKOB 5I1JH 2HMIC 2EEDA 1KG0B 3P0YH 5F8RC 3X14A 5CEXB 3VH8B 2XQYG 5T1KD 4XAWH 1A7BA 5TH2A 1SJEA 4WI7A 4HH9B 5DJCB 5BCAA 3RVUD 3CLFH 3BSZL 1A14L 1C12A 1EZVY 3O4OC 3Q6FB 4Y4HB 3FOMB 4LVOB 4QWWC 5FYJE 2AQ2A 1XCTB 4MAYA 5ANMA 1WBXB 4WHYH 4NKDA 1KB9K 4F7EA 1JGLH 2Z4QA 3NZHH 3GSUB 2AJUL 3SKNB 3B4NA 1IM9D 1BBDL 1DE4A 3B8YA 4HUMB 3O2VH 5JQ6H 5DHVH 5AAMA 1ZOXA 4FQ2L 4LHQB 4LLQA 4JFXA 3UC0H 4PRDA 4ZOBA 4KTDL 2HH0H 1NGPH 2HLFD 4C83B 1RJYB 4Z7VE 1ZEAL 1Z0NA 4WV1C 3IDNA 4TRPH 1UJ3A 1MPAH 1GIGH 4TUOB 1I3VA 3STZA 4JCMA 5E56A 1KEML 2C1OB 5JOPE 1A1MB 3O45B 5EIVA 4JFOB 2F15A 4DEPC 5EOCL 4O00A 2B1HH 5HYEA 5L8JB 5ADPH 4E5XB 1JTPA 3SDAB 5DFWH 3IFOB 4PG2A 1KIUA 3MJ6A 4KDVA 1HXYB 1XF4A 2F5BL 4O4YL 1UXWA 4Q58C 1JNJA 3O4LA 1TLKA 2NY6C 5JW3H 1QSVA 4O2EB 4ZAKA 4WI8A 3G9AB 3PWVA 3RL2A 3DUHA 4DN3L 4OZIA 3HR5B 3ARGD 3VFUA 5AG8A 1EEQA 1XIWA 1IC4L 5MEOA 4ODXB 3SO5A 3U2SB 3JXAA 1S7VA 3IU4L 3D39A 4PJEB 5D5MA 1H5BA 4WFFD 1K2DA 3KYOB 4PRIB 3GBNH 5ITFB 1NC4B 3BZEA 5D8JL 2W9EH 4YDIH 5EO0A 1J5OH 3U46B 5DT1L 4ODUB 3HNTH 5FYKD 3MUGB 4PJHA 2BC4B 3ETBF 4S1QH 2J88L 4ELKA 3PWPB 1W8NA 2IC2A 3P4NB 3NA4A 1MRCH 2X41A 4CJ0A 1HH9B 5FYKH 4U6YA 1XZ0B 3PE9A 3X3GL 1I9IL 1YMHA 2GQHA 4GW5A 3EIFA 3F58L 1MHCA 1XGPA 2EDKA 2C7UB 1KJMB 1N6QH 1I8MB 3LKQA 5HYJE 3HMWH 3DV4A 5C0GB 3TBWA 5BVJB 5GGTL 4OI8A 3D2UA 1CF8L 1NUNB 3FONA 1ADQL 1MI5E 2XI9A 4JAMA 1FO0H 4HC1A 3MLSL 5EFIB 2BJMH 2XKSA 4FA8A 5EO9B 3VI4F 4XBEL 5HYSG 1EJ6A 4Y7MA 4O58L 3PV7A 1OTUD 3ECBB 4R4FL 4L29A 3VD9A 2IAMC 1WIOA 4UV7L 4JPWH 3MV7E 5DURB 2VR4A 1MCFA 5BJTB 1G7QA 4YGVA 5DYOA 2JJSC 4OZGE 2DMCA 3IS1X 3UBXA 5C0BD 2FEEL 2Q7YA 5D4QA 5IROA 4Y4KB 3MR9A 1JJUA 5TE7H 2D4DA 2X4TA 2ATKA 4U6XA 1DBKH 3QWRA 5GIRA 3D85A 2BRRL 1NUFA 2DI7A 2VXSH 1ND0B 2HLFC 3OZ9H 5EUOB 1BZ9B 3WS6A 2EYSB 3HE7D 3TBTA 4NQDA 2AS5M 1I85C 1DLFH 3CDGA 5IBUB 2D7PA 3SDAA 4I4WB 4DOHE 3P11H 1S78D 5LBSH 3VG9B 5IFAH 4PD4K 3HZVA 2Q6WB 3DMMB 2YR3A 3TLRA 1R0AH 5D2LF 4P9MH 3BP4B 3ALXA 1DVFC 2QBWA 5LWYL 4MA1B 3GFUA 3OJVC 1KN4L 2IPTL 5HGDA 2FJGB 2QL1A 5D7JA 4MQ7B 1SY6A 2OBGA 1VDGA 1A47A 3D9AH 1KEGH 4R2GB 5I8EA 1A2YB 1JZ4A 4W4NA 2A73B 3BUYB 1PGRB 1Q9WA 2A6DA 3DGCR 1P7QB 4HZLA 4R6UA 5DRNB 1W0WB 3QNZA 4JFEB 4YNYA 5JXEC 4DUXA 4W70A 2W65A 3L95A 4QHMB 3VFVB 4ERSL 1MCOL 1XCQA 4U2YA 1T7VA 3NPSC 3V4VL 1FL6B 2E7CA 3SKMB 4AEFA 2F19L 2NW2B 5JO5B 6FABH 1YMHB 2C1PB 5LAXB 5BV7C 1QR1B 1NGQH 2HFGH 2VIRB 1SY6L 4DQOL 3CUPA 3MA9L 5I74B 5SV4A 3V0WL 3QDJB 4H8WH 1X4XA 2ZOKB 4JB9L 4OT1L 5E8DH 3GK8L 4ZS7L 4LPUA 4JVPA 3DO7A 5K93A 2OSLB 3QJFB 2GCYB 2IAMD 4LCIH 3RTQC 2P5WD 3TNNB 3W11C 2YXMA 4PJEA 5IWLA 2F9BT 3O81A 4XZUB 4H88H 1KB5H 5CGMA 3U0WL 4X98B 4ZPTA 3BHBA 3SHSA 3T1FA 1YNKH 3SE9H 1V7MH 3MV7A 1OD7A 1YPZB 5DK2A 1OAXL 4GRWH 4O51B 1U8OB 1W0WA 1NQBA 1YNTB 3QIWC 4JY6B 1GJIA 2FX9H 5IM7B 3RPIA 3MJGX 2V5TA 1DBML 4I0PC 3AS2A 3ILPB 3HLAB 3B43A 3WIFA 4GXVH 4HT1L 5TDPA 5FM8A 1S9WA 4MNGA 1QACA 2GJZA 5GJTL 3GMOB 1KT2B 5B21A 3SCMA 3VGEA 2A9NH 1A5FL 1N7ML 3WJLC 1EHNA 4NGHH 1UWEH 4PBXA 2XXMB 1OGTB 2WINA 5JOFA 2Y25A 3ARFD 3EOBA 4DGVH 2AJVH 1BQHG 2JCCF 2YD7A 4MA7H 2CUIA 1I8KA 3GZKA 4IIQB 1CS6A 4F9LA 1IQDB 1VPOH 1ZSDB 4Y2DC 3HZYB 1JCKA 5DHYB 3QJHA 2MOVA 1JPTL 2ORBH 4L8BB 1KULA 5K9QI 4F80A 3D69A 3MR9B 4DN4H 3QIWA 4LRNL 1DR9A 2XRAH 4CN6A 4KZDL 4IRSD 1O0VA 4PJXA 1K8IB 2MTPA 4XX1G 1DQTA 1PX4A 3Q6GH 4N8VB 4XVJL 1RSFA 5F7KC 3PQYE 5JDSA 3QG7L 5KSBE 1U3HD 3IJSB 3QFDA 5I1DB 1T1YB 3RRQA 2W07A 4TVPD 3QI9A 4PS4L 4E41E 2W0LA 3KLHD 2GJ6D 1T7ZA 5TDPB 5EU6E 5J11B 3EYSH 3VI3E 1MY5A 4PJDB 5ANME 2OCFD 3LHPL 3E6HB 4DKAA 3QCTH 3AS1A 4M6ML 1BVLA 1JGDB 3TBWB 5BOZG 5BVJA 4RMVA 3QQ4A 1BQLL 3LS4L 4G7VL 4GS7C 4QT5B 3TZVD 3BZFA 3OXRB 4HXBL 4FQCL 2D31B 4RCAA 1YJDL 3T09A 4DZBB 1U8JB 3FT3B 3L3IA 3OKMA 4KKNA 3DXAB 3KWWB 3VD3A 3VD7A 3LPWA 1Z5LB 4M6OH 4QRTB 1PSKH 2IJ0C 2NTFB 4LEOA 1LP9F 3EOYG 1RJZB 1Z9LA 1J8HE 3B3IB 1MEXH 4K7PH 5ALBH 1KLUA 5DMKA 5HGDB 1PZ5A 4M03A 1AR1C 1FL3B 3SOBH 3W81A 3ZYOA 1FAIL 4FQLL 3ARWA 3G6AA 3QUMH 1G9EA 3I9GH 1AFVH 4BH7A 4LQ1A 3SCMD 5I73C 3FT2B 2ICEA 5CZKA 1MFBH 5DMGD 1V3JA 3D39B 1TVBB 1WAAE 3UTSD 2J8UB 4Y16C 2R1XB 2YD8A 2X4QB 2R8SH 4Y5YC 4S1RL 2EZ0D 3BISA 5GSVA 4WUUA 4HIEB 4H0IA 4U6HA 5EO1B 2UYLB 1UZ6E 2NY7H 3GSNH 4JR9L 5DQJB 4LCYA 1Q72L 4IRJC 2QADB 2VLJB 2PO6B 3T0VA 1HXYA 1NBVH 1N64L 3VCLB 1IGJA 4I18A 4I3SL 4MLSA 2MQCA 4MAUL 4PP2A 5IFHL 1MIMH 3N9GL 3LEVH 1KCUH 2DLHA 2BNRA 2Z91B 4Z7UF 1B0GB 3THMH 5C08E 4RZCB 4P46C 2JJSA 3WIHA 4H1LA 3O3UN 4HMCA 2X4OB 5AYUL 4HKBB 4KHXL 4G6AD 4LVHB 2D03H 4H25A 5J1SC 1SHMA 3BAEH 3L3KA 1U6AH 5L7XL 3VRLE 5DVOA 3V6FA 1TZHA 2VDKL 4QRRB 4UDUA 5GGSB 1NANH 3DVFA 4Y1AD 2A6IB 1F4HA 1WBZB 2ESVE 2EZ0C 3S88H 5ADOH 5EU6A 1P5VA 1BFVL 1RD6A 1YN7A 2J8HA 1UVQB 2VWEE 3W39A 1PQZA 3VXOA 4MNHA 1DQLH 1R5VA 3DX6B 3NIGF 3V7MA 4UIKL 2DQUL 1F3JA 1KCSH 4GJTB 3DRQB 5HDBF 4NZRL 5GZNC 2WIIA 4LGSB 4ZXBC 3QIUD 5KVEH 3X3FH 2X4TB 4LEXH 1RK1B 1BQHB 3QUXA 1BF8A 4HH9A 1OAKL 1NEZB 2AI0H 1MRDL 4Z7VB 4Z7NF 1JPSH 5D9SB 5HHPB 1XGQB 1OQOA 3VXUA 43CAB 4HUUA 5EBGA 4QXGL 1ZT7B 4K23H 5DMJB 3REWB 4PJFA 3B3IA 2APBA 1INEL 1DBBH 3MRHA 1AGDB 4KRNA 4J8RB 3RL1B 2IAMA 3CDYA 4QNPF 4QRTA 3VXMA 3CK0L 1MQKH 3ZTJH 2DQEL 2Z31A 1RUKH 1U8QB 3VGBA 3S3PA 3VFUB 3PWJB 1WAAF 1VB9A 2G60H 2OQJA 2YPVH 5CILH 1NPUA 2HFEA 3M8OL 1L0YA 3P2TA 1S3KH 5F6IB 1SJHA 4JM2D 2M2DA 3TBSA 4XMPL 4KI5F 2NX5D 4XP9H 2X5PA 1K5NA 4LLVA 4POZD 1B4RA 2JCCE 3EYFB 3ZTNL 4PJDA 4LCCC 4EBQH 3QWRD 3B2UC 3GMQA 1OGAD 3MA7A 3KPMB 12E8L 3MRLA 1T21A 3D1MC 4ZS6C 3IDMB 1E28A 2FJHB 1OY3B 1FRGH 1BD2D 2OP4H 1RI8A 4XPFL 3CLEH 1JHKL 3QH3B 4F3FA 1C7TA 1OAYL 5DR5H 4WU5B 4WV1A 2YKLH 4LLWB 3ARBA 1EFQA 1KTDB 1ZWIB 2ZSWA 4WDIB 5EWIL 1BJMA 3TF7C 1AIFA 3AY4A 4J1UB 4WO4D 4NQSA 3KPRD 4G6FD 4MJIA 5EU3A 1AGFA 3IDUA 5ESAB 4B5EA 5IW6B 5JW4Q 2R69H 3IDMA 5F44A 4GKNA 1HINH 2FD6H 5F7MC 1QA9A 3K8KA 4KVCH 4ORGB 5BQ7B 1QKZH 4LHUA 5GGTA 4M1DL 1QLFB 4AIXA 3D3VD 5F9OL 4LCCA 3SBWC 1FFQA 4WI2A 4PJ9C 1NCAH 1YA5A 3S35X 5FYLE 3V6ZB 3VFWA 2W38A 5CCKL 2D7TL 1I8IB 1CICA 1QTYT 3RWHA 1HIML 1KJ2B 3KYMA 2ZUXA 2DQFA 2P5EE 5DGRA 5HGBA 1GYAA 5IB4A 4K8RH 3DROA 3VXQA 5IBTL 4RGND 2ERJC 5IEHA 4L3EA 2ZSWB 4WDIA 1NMBL 1CFSB 1U0QA 2OL3H 3IJHB 2VN4A 5H37G 3LPFA 4BSVB 4E41A 3UTPD 3NTCH 1F90L 1UKSA 3LQAH 1ZTXL 2HJFB 4PJBA 4O9HH 3QUXD 3RY6C 1AQKH 5HI5C 4P3CL 3PXHA 4JDVA 3TN0B 3ARGC 4MAYD 4OAWA 2HTKD 1LEGA 4R96A 3C6LC 3S4SB 4E0RA 2WV3A 1FGVH 2EKJA 3V0VA 1F2XK 1J05B 3FFCB 5GISL 3O9WD 3GJEB 4TULL 1NAKL 1U2CA 4U1KB 1ZA6B 4KROC 3U7WL 2HLAB 2NR6C 2OX5A 3SDCC 2OJZL 3BMVA 4O2CA 5SWZE 5TF1H 1CXIA 2OJEA 3G6JB 1L9NA 35C8H 2ZOKA 3OKNA 1JGEB 3KXFB 4X99A 1F4WL 5CSZA 4C57C 3VE0A 3BQUA 3UZVB 3QXUA 1GC1C 4TSCL 2J6EL 3V6OA 4Z8FH 1I1FB 4Y5YB 1E4KC 2IFFH 3PWNA 3RVTC 3KXFE 3PNWB 1H15B 3R1GH 1QRNA 3RWFA 2YSSB 4LLYA 1AGEB 1G0DA 1PEZA 3TPKA 1MFCL 4P5MB 5I1LA 4NPYB 4OCWL 5FKPB 4S2SA 5I8CB 5IT2L 4KQ3H 5CP7B 3NZHL 4LDEB 4L9DA 5CINH 4FXGA 2XN9A 3AS3A 4FZ8H 4HJGB 4YBLB 3ZKNC 5LGHL 1MH5A 5FF6B 1WICA 1QRND 2AKRA 1ZT1A 5JHDE 4DFIA 4IRJB 4LF3B 4PJAB 1H8SA 4NSKA 1H3TA 3MV11 4LHUB 3V4PL 4KKCC 2PW2A 3JV6B 5GS0D 4OCXH 3VCLA 3I85A 4XC1L 3TBVA 1DL7H 2F8VA 3FQUB 4IRZL 2BHZA 4IHOA 4CAGA 3B6SB 4X8JA 5A2IH 4TVPL 1U36A 1RJLB 1Z9SA 5JOEA 3EFFA 4ETYA 1JNLH 1U3ZA 2KZ1B 3LAFA 1RZGA 4XWGH 2I9LB 2Z8WC 1HEZB 3KYKH 4ISVB 3RKDD 4ZPVB 43C9B 3O3EA 5HHOB 1P6FA 1ND0A 4Z76A 4P46A 1MFNA 2IWGA 1PFCA 4ODWB 2D9QB 3BEWB 3LKNA 3MLUH 4GS7B 1U9KA 1HSBA 5DJAA 2GTZA 1B6UA 1V7NH 3DXAA 4WTWA 1GL4B 2WQ8A 1W72B 2B2XH 4YHNB 1TXKA 3OV6A 5IJVB 4PFEA 4PRPE 4R3SA 2D0FA 3CXHK 3H9HB 3HPJB 2HFTA 5D8JH 6CGTA 5DJ0A 3TJHC 5I17B 3O4OB 3WNMA 1TNMA 3T3PE 3U9UA 1MF2L 1KIPB 3G08A 1IL1A 2AJYH 1JRHI 4KK8D 3KXFA 2HTLD 5E8PB 5F7NC 1IBGH 3SDCD 5SWQB 5MENE 5D7SH 3CU7A 1U95A 4GKZB 1JZ8A 3BJLA 2BJML 2WUCH 4R3SB 4PBVC 1C1EL 1LD9A 4KJWD 5IB2A 3KDMA 4O58H 5D6DC 1Z5LA 3K8LA 1FFPB 3BPCA 2M8XA 4R97C 4YH6A 1LEGB 4NM8L 3G08B 4RMTA 5A40E 5FV2A 4N1EA 2V2TA 1HOCA 3RVTD 3O6FD 3UPCA 3MV9B 3QR2A 2CJUL 4K9EH 5EU6B 3P4OB 3ULVH 1LP9B 5JOFB 3BRFA 1JGUH 3HNSL 3C08H 2HA1A 4LSUH 3EJZC 3U7AA 5EA0L 1NJ9A 2BY3A 5IGXH 1XMWA 5CGYC 2AQ3A 4JRXD 4G80A 4AG4H 2GW5A 1I7ZA 3O3EB 5HHOA 5IF0B 1KTRL 3QIWD 3VXRB 3PV6B 4LSDA 3MODL 4JO4L 3GMPB 2BNRB 3BGMB 4F9PA 2OK0L 1HI6A 2JJVA 5J57B 4EEEA 3ZLQC 5D2NB 3VGDA 1BFSA 1M05A 4JKLA 3MJ8A 4LGRB 4UAOC 1FV1B 3SY0B 3VWKD 1F97A 2A6JB 4A6YB 5L0QB 3VFGH 1IAIM 3OPZL 4YC2B 4L4VA 3UXFA 4L3EE 4ONOA 4EQ2A 1V3MA 1CDYA 2FLBT 1WWBX 1UFUA 1F4AA 4WI9A 1MH5B 2M26A 3BQUD 5A1AA 5SX5K 5F6IC 4QF1A 1QSFE 5FYJD 1FPTL 5TQ2L 3CUPB 1MHHA 3MA7B 2OYPA 4Y4HC 3JVGC 4AZ8A 2WQRA 1F42A 4PB9H 3GMMB 1Y6NR 4OIBA 5LGJB 1U8MB 2BMKA 3C8HA 2J4WL 3EDJA 4OF5A 4L3CB 4EN3B 1FHGA 3SJVB 4GAJH 2DD8L 4QRUA 3KPNA 1BWMA 3O9WA 3WUWA 2VR9A 3HI5L 1D5BB 4BM7A 3DSNA 3VE0B 3ARXA 2VTFA 5HI4C 1R3KA 3RNQB 2IALB 3WE6B 2A38A 1Q0YH 3A6CH 4XVTH 4OLVL 3MLXL 3AROA 1Z0MA 5FYJU 4AIZB 4F15C 1AE6L 5DJYB 1JGVL 4X7EC 3MJ7B 1I7RA 4MJ5B 4UB0L 2H45A 5JDSB 4OCYH 5ICYB 3D0LA 5E7BA 1QBAA 3BKYL 1CE6A 4L3CA 1FE8L 4MA1C 2GEEA 1QLFA 3LDBB 4RMSA 1GPOL 4KMQA 1NLDH 2G2RB 1OHQA 3O6ML 2EDEA 4PRID 2BSED 1MCRA 4I18C 3QQ3A 3WFCL 1FVEA 3TVMC 3SKMA 4P4KA 3KNBB 2F5AL 2XZCH 4P2RB 4Z78A 3DBXB 5C2BL 1T03H 2DTSA 2I25N 5D7IE 4WFFE 5E70A 4MB3A 3AAZB 3AU1A 3P9LA 3V5DA 4KDTC 5I74C 4LIQH 4WU5A 4P4KD 3GJFA 3DSFH 5D7IB 1FCCA 1EVUA 3M07A 2DWDA 4HWEL 5IESH 2V9TA 2Q86B 2DM3A 5C7XH 1REIA 4PRNB 1DQML 2BVPA 4WY7H 1E28B 4GKNB 4GBXB 1VFOA 4NP4L 3BP4A 1QNZL 2J2ZA 4MJIB 5ESAA 5EU3B 5IW6A 1MFAL 4JQIH 4FMFA 1MLCA 1OARL 1NFDB 3QWQB 5DC9B 5HPMB 2K1MA 4K94C 3NZ8B 3D2UB 4YXLL 2K7QA 4UTBL 4M43H 3LKQB 1ONQA 4LCYB 4XBPB 3C5ZD 4Z6AT 3ZSTA 3FZUC 1TIUA 4KJYB 4GRLA 4LSRL 4ZFFB 3F7VA 3RY4A 3LEYH 4BJLA 1NDGB 3GHEL 5DMGC 3MCLH 3C6SB 3HG1E 5CJOH 4EI6A 3MYJA 1P1ZA 1I3GH 1UM4L 1WIPA 4GG6F 3WFEL 1YQVL 5FUZL 5J3HC 4KI5C 1S5HA 4GMSL 3DTXA 4ZOEA 2BOCB 2QQNH 1WCQA 5D2LB 1NMAL 2EYTA 1SMOA 1YECL 4LEOB 3QDJA 2K9UA 4GRMA 1AXTL 1DQDH 2V5MA 4WU7A 1Z9OA 2DQCL 3IFPB 4RISL 3SE3A 1JYXA 1T7WA 1NFIB 4R97B 1FN4A 5DLMH 4AL8L 3BKCH 3T0EB 4CKVX 4CUCA 4HUVA 4UTAL 3BUTA 2DN7A 5C0NC 5CJQH 1KXTB 5SWQA 4ZAKD 2I60H 1T0MA 2LV4A 3UTTB 4RQQA 3BGAA 1NGWA 3BKML 5DI8B 1MJJA 4N8VG 4HIJB 3X11A 2DQDH 1JBJA 4JZJC 3DMMC 5TQ0H 3TVMB 1T66D 4NJ9L 4CNIB 3VG0L 4OGYH 3SKUD 1BEYH 4GT7A 4JR9H 5FFLA 4U1LB 4Y5VC 2X4OA 2FJFB 5DJ2B 3H0TA 2AJ3B 4ISVA 5E2TL 3RIFK 4JO3H 2PYED 1P4IL 1MIML 3N9GH 1WWWX 2B8OT 3IU3B 3BKJH 4MDJA 1UYWH 4GH7B 2OXHA 4AM0B 4X6FA 1EO8H 2GTZB 3O8XB 2CKBB 2NY1D 1QPPA 1VEMA 4WW1B 5EU7C 3CH8A 4OCRH 5I6XC 5E2WH 3CC5A 3RUGB 2E7BA 1TQCC 3BXNB 5C09A 4Q0XL 4NKIL 1LO4L 3MLWL 3O4LB 4G6MH 4EOWH 4H0HB 2GJ6E 5SWSB 5DD0L 5JA8B 2NZ9C 4PJ9A 4QCIB 1P5UA 3MREA 4Y1AA 4YDKL 5HPMA 1INQB 4QHNB 2VXVL 1KLGB 1MCPL 1T2XA 3O6KH 4ZSOB 2MMXA 5F1IA 3S88L 3LMJL 3NH7L 1WJ3A 4DFHA 3MRMA 3KLAA 2R23A 4XCFH 5FDWA 4D0CA 5KG9B 2DI9A 3IFLL 2DWEB 1A3LL 5DFVD 5HDBE 4OGZA 3HZMB 1A14H 1PDKA 4OI9A 1IKNC 4UIKH 3QO1A 3TT1H 5F3HB 5FOJA 1UXSA 3REVB 5BV7L 5A2LH 5ICZB 1JWMA 1J8HD 2VC2L 2QR0B 4O51A 4AEHL 4MSWA 8CGTA 4Q6IA 1NDMB 3ARTA 1N6VA 3WLWD 4KHTH 4N0CC 4MNQB 3BDYL 3UAJC 2V2TB 5INDA 3TJEL 2ZG2A 2GHWB 1QPXA 4EI5A 3QDGA 3H9SB 3BP6B 5EUKA 5T33H 1NCWL 1IE5A 1L0QA 4ZNEE 1NFIA 2ED9A 1MHPH 2IPKB 3KR3L 1RUKL 3S3SA 1RPQA 2LU7A 4L4TE 3ULVE 4MA3A 5C08A 1P9MA 3CFJB 3FN0H 5I1KL 1H8NA 3T3PF 3OKMB 1RIHL 1MRFL 3RWIA 2EDYA 4FQHB 4JKMA 2W60B 5ADPL 3MFFB 1IAKA 5KVFL 3E2HC 2X70B 4N5EC 3S3JA 1TZIA 2X09A 2IQ9L 1H5BB 4J3WA 2ADIB 5JO5A 1XT5A 3FB5B 3ARZA 4Y2DB 3F12A 3ROOB 1XGRB 4CDHA 1WISA 2H9GB 4HS8L 1RU9H 4NHUA 3T8XA 2BNQE 4PJIB 3T1WA 3V9FA 3DIFA 1FAKT 5DZNA 5MEPA 1BX2A 4WHTA 2DS4A 1RUPL 2C9AA 4R7DB 1JGEA 4X99B 1LO0L 1HHHA 1ORSA 5BMFL 2ESVD 3DWTA 4EI5C 2W9EL 3T0AA 4NRXA 2BNQB 4PJIE 3PQYD 3PL6D 5IVXE 4NBXB 3C5SA 5JPMA 1YY8A 3VFOA 3A6OA 4LNVA 5JA9A 3CXDH 3KS0J 2NY4D 3SQOL 4U05A 4DGIL 1UJ3B 4HULB 4AMKH 5HYJD 1QSEB 5I1EH 1PY4A 1AI1H 2E7LA 2OZ4A 3DXAD 1MI5D 3HMWL 5GS1A 2DQTL 2G75B 5F21B 1CGVA 4JREB 4U1SB 2NXZC 3ZKXC 1U8PA 4Z7WA 5IVXF 1FH5H 1SMAA 1AY1H 1AXIB 4ONHA 4WENB 2VKXA 2Y36H 3FAXA 4NYLA 4FQQA 5E4IA 3DRTB 4FFVD 3GMOA 2FBOJ 3SCMB 4XNYH 2X4SA 4U0RC 4Z0XB 1NCCH 4OGXH 1FVDA 2R2BB 1BECA 1HN1A 5F89B 5GS1B 1II4E 4KKCD 3BWAB 4JFFA 4PJFE 1M6OB 3DJ9A