1ZESA

Bef3- activated phob receiver domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Activation for Transcription Factor PhoB Suggested by Different Modes of Dimerization in the Inactive and Active States.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords Phosphate regulon transcriptional regulatory protein phoB
total genus 39
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zesA00
4RY8A 4Z4GA 1E6LA 1B00A 3A3KA 2AYXA 3Q7SA 3F6PA 4H3KB 1JFSA 1VKRA 2ZAYA 3OLWA 3DGEC 3BREA 1NXOA 4Z4IA 3M9XA 4KRFA 4OTZA 2L2QA 3KLOA 4LE2A 3JVDA 3GA5A 3EQ2A 4LRQA 2QSJA 3CTPA 3HV2A 4XAQA 4NCBA 1P8AA 4E7OA 5HM6A 2IPLA 5JNVA 5IC5A 4ZPJA 5CNMA 4Z4FA 4OG2A 2RJOA 4Z99A 5FBKA 5T3YA 2LUOA 3Q41A 3CU5A 3T6KA 4EYGA 2PUDA 3UUGA 2HQRA 3LUJA 1E6KA 3QEKA 4HNRA 2FMFA 3JPYA 2FN8A 2IOYA 3KG2A 1MVOA 4RK4A 4P98A 3UKJA 4KPYA 5IULC 1KRWA 5EWMB 2FMHA 3SAJA 1OXBB 5EWMA 4EUKA 4OLAA 4IRXA 2BGGA 3CZCA 1JX6A 3QELA 3GV0A 4FE4A 3OO1A 4L85A 2E4ZA 4MAAA 4Z4CA 1ISRA 3H6HA 4RV5A 1RNLA 3CG0A 2JK1A 1KRXA 1ISSA 2IKSA 5TPZD 3TB6A 1BAPA 2ID7A 4NV3A 3QK7A 4M88A 3H5OA 3RVJA 2V0NA 3C97A 4KQCA 4RK1A 1JH9A 3KYIB 1YK1A 1HEYA 3H75A 2MYTA 4RKRA 2E4XA 3RVRA 3I09A 1YMVA 5IBQA 3QLUA 3H5VA 4D74A 3LUHA 1JYFA 3I45A 1JF8A 1DG9A 3HZHA 1SXHA 3JY6A 3EAFA 2JB9A 4MR9B 4Q7EA 4WXMA 1TM2A 3SM9A 3NHZA 2VK2A 4G0QA 2J48A 4LE0A 5D2CA 1SXIA 3LKVA 4F8JA 3H5LA 2FSPA 3EDCA 3OM1A 2WY2D 3FFXA 4KFCA 3DLBA 4O1IA 4KK3A 4Z0NA 4JASB 3LKBA 3KS9A 1A2OA 3N8IA 2PUCA 4MRMA 2VUHB 4EVRA 2B1JA 4WT7A 1K66A 3L6UA 4WXEA 4EYOA 1U2QA 2WWVD 1JFTA 2OQRA 2QZJA 3LMKA 2E4YA 4EGSA 3IP7A 1FFWA 3HDGA 4RKQA 1PHRA 3P9YA 4G97A 5KC8A 3OQMA 1T34A 4H60A 3KJXA 2LPMA 1DCMA 5DGCA 2QW1A 2E4UA 3RVQA 4YRZA 5BRJA 4N76A 1ZITA 3KTOA 3GBVA 3LUGA 2A9OA 2O20A 1LJLA 1QPZA 3HJFA 4MS3A 3CRNA 2KYRA 3LUAA 1NXTA 3FGZA 4RY9A 5FWXB 3HDVA 5HKOA 4EVSA 1EWVA 4F11A 3ROFA 3H1EA 3TD9A 1JFVA 2PLNA 1RXIA 4RS3A 1F51E 5JNRA 5IUJC 2W42A 2P9HA 4WUTA 5I4CA 2M1ZA 1L5YA 3VNBA 1ZH4A 3JVIA 1RZRA 4KREA 1NY5A 1DBQA 3OQOA 3Q15C 4HNSA 4Z9BA 4GNRA 3QLVA 1QP4A 4KV7A 3IPCA 4G0PA 5KC9A 3DZDA 3LUDA 1BVHA 2LBPA 3NHMA 1DBPA 2X7XA 1ZGZA 4PE5B 4MQFA 1S8NA 3LTEA 2R48A 1EAYA 3GRCA 4O5AA 1TVMA 3UK0A 4JB2A 2CD7A 1RPJA 4F12A 3CKMA 2CWDA 5HSGA 5JS1A 2HSGA 3RVOA 4TLLB 3HM9A 3OM0A 5B3JA 5KQGA 2IPMA 1Z13A 4PICA 4YWHA 3MM4A 4YP9A 2PMCA 3QLVC 2PUEA 3QLUC 2OENG 3FDFA 3RH0A 2IPAB 3HVRA 1D5WA 4LZLA 4H3HB 1NXSA 1MB0A 1TLFA 1LBHA 3E3MA 3O2SB 3O2QB 4G86A 1GUDA 2E4WA 4MQEB 4O1HA 4W5OA 4RWEA 2Q5CA 4JAVC 3Q7TA 1WETA 2FVYA 1YIOA 3HK2A 4G0OA 1PNRA 3CZ5A 3HSYA 3IP9A 4ZMSA 3A0UA 4YV7A 4N47A 3F6CA 3VNAA 2JBAA 5E3JA 4FE7A 2QVCA 4YGXB 1A04A 2A9PA 1DBWA 3OLVA 4MLCA 2P4UA 3JTEA 5IEBA 4Z4HA 4RY0A 5DLEA 3HUUA 3SQNA 1DCKA 3HUTA 3IP5A 3HCWA 4YR7A 1P6QA 2JVKA 1AB6A 2MSKA 2F8TA 1M2EA 3B2NA 1TMYA 1D2AA 3RVMA 4MGEA 3QEMB 1DZ3A 1BDHA 4OLBA 4P1ZA 4RXMA 4RXUA 4KQ9A 1Y1LA 3JPWA 4E7PA 2H3HA 2FW0A 2MSLA 3JS5A 3O75A 5ED4A 2PL9A 1QQAA 4Z4EA 3GYBA 2ZWMA 4TN5A 3C3MA 5F64A 1JWLA 4DADA 3LOPA 3BRQA 2A9QA 3N6VA 5KWSA 1VPWA 5KI6A 4MPTA 8ABPA 2GBPA 1GLGA 1QNLA 2L18A 4HNQA 3SNKA 2HPHA 3URMA 2YHAA 5TPZA 3KKEA 5GOTA 3QLTA 4JP1A 3NNDA 7ABPA 4NCAA 4IILA 5TQ0A 2PE5A 3IP6A 1PEYA 2PJUA 1GUBA 4KMRA 1ZDMA 1BDIA 2FQYA 2DRIA 2NZUG 4ZJPA 1XHFA 3L49A 2NUBA 1QO0D 3BRSA 1ABEA 3MMNA 1A0OA 1ZN2A 3RVPA 3ROTA 1YVUA 2E4VA 3CFYA 3BILA 1LBIA 5PNTA 1QP0A 1LJUA 3R0JA 3FFTA 2PUBA 1Z12A 1PEAA 4W5RA 4RK6A 5B3JC 1JLKA 1YK0A 4JOQA 1JYEA 3N53A 4G0XA 1QKKA 2QXYA 3O21A 3MF4A 5JNTA 5IUNC 3Q7RA 4MR9A 3O1HB 2HJ9A 4EVQA 2F8SA 3CNBA 3MA0A 4RK0A 3S99A 2PAFA 2PUFA 4B09A 4D6YA 4YO7A 1FFGA 1DCFA 3FMVA 2RDMA 5TQJA 3H5TA 4WZZA 1LK0A 3HXMA 4ETMA 1I3CA 2QV0A 2AYZA 5BRAA 5T7BA 4MQEA 5EWLB 4QYWA 6CHYA 1D1PA 2H0AA 3RVKA 1FSPA 1BDJA 1IIBA 2FEWB 4ZYLA 3IDOA 5JNSA 1JL3A 4QPJC 2FTKE 2PL1A 5EWJB 5FWYB 5C5CA 1ABFA 2QR3A 5FBHA 1M5TA 3RVNA 1APBA 4KZKA 1SXGA 3C3WA 1MB3A 1C4WA 2B4AA 1Z25A 3I42A 3ILHA 1MAVA 3KHTA 5TE9A 1CYEA 4RXTA 4FB4A 4YS6A 1ZH2A 5BQ3A 3QELB 1NXWA 1OXKB 2GKGA 2VYCA 3E61A 2RGYA 2L19A 2VUIB 1NTRA 3D02A 3TO5A 2FEKA 3GWGA 4UHKA 4GPAA 1E2BA 2A9RA 3MQ4A 1EWKA 5KQPA 1Z17A 1ZHHA 1M5UA 4XXHA 5FWXA 1XHEA 1JBEA 4MR8B 4IGAA 4L4UA 2R4QA 1NXPA 5GQSA 3T8YA 2QVGA 5JS2A 1ZESA 3G85A 3KLNA 3RVLA 4Q6WA 2FXIA 1JHZA 3NNSA 3Q9SA 1YS6A 6ABPA 1K68A 4MQFB 3KCNA 1KGSA 3LFTA 1F4VA 4ETNA 4MLDA 5CHYA 4CBVA 1QO0A 3T95A 3OLYA 2FQXA 4PEVA 3TX6A 1QP7A 4QYMA 1D4ZA 3HO1A 1U2PA 1TJYA 3O1JC 3F73A 5HQJA 5KQMA 1JDNA 4MS1A 2R25B 3G1WA 1W9HA 3F7NA 1SRRA 4LE1A 4MRMB 1GCGA 3GT7A 4OATA 4N0PA 1NXXA 2JCGA 1EHCA 3CHYA 3HS3A 5EWLA 2GX6A 2TMYA 4G0ZA 3M6MD 4MR7B 1Z2DA 3EODA 5TQ2B 1YS7A 1ZY2A 3N75A 3EULA 4MR7A 4F06A 4RK5A 4Z9AA 4TMYA 3M9WA 3N0RA 4MYRA 4LDZA 1Z15A 1U04A 2PKXA 3OMWA 2FN9A 4Y9TA 1CHNA 3SG0A 1W25A 5DKFA 1M2FA 2MYNA 1KMIY 3CS3A 1P2FA 2FEPA 4LX8A 3C3KA 1DP4A 3BBLA 5CNJA 2IPNA 2MYPA 1E6MA 2XDYA 3O1IC 3DLHA 1VRVA 1YTUA 1DC8A 4G0MA 3MYYA 2R47A 4IMIB 1Z26A 1YMUA 5CNIA 4Q6BA 3QEMA 2FLKA 1RXEA 2CHEA 2WRZA 3LUCA 2NT3A 1DC7A 3O2JA 4MR8A 2CHFA 4EYKA 3GBPA 4KVFA 1CEYA 4PZ0A 5CNKA 1NXVA 1MIHA 4RZSA 2HQBA 4EY3A 1QQBA 3QX9A 3W9SA 1EFAA 5IX8A 2FMIA 3CG4A 4XARA 1U8TA 3FFWA 3EJWA 3HEBA 1XWWA 3O74A 1C0EA 1UDRA 5DTEA 2PUAA 3NNNA 1Z16A 1D1QA 2LP4Y 1FQWA 3I5AA 3DBIA 5BR1A 4WWHA 4NICA 3MIZA 4YLEA 4TLMB 4YCSA 3H1GA 4ZMRA 4JA2A 1JDPA 4UHJA 1USIA 4LDAA 3LUKA 1Z18A 3A10A 2FLWA 1ZGGA 3KYJB 4EYQA 4D6XA 3SY8A 9ABPA 2IDMA 4MS3B 4JB0A 4MS4A 4HYEA 4RDCA 2IYNA 2WJWA 5TQ2A 3RQIA 4MS4B 1PNTA 5TQ0B 1BA2A 3H6GA 5JNWA 1ZVVA 2QU7A 5IEJA 4W5TA 3CLKA 2NT4A 1P6UA 5IUKC 3OLZA 2WB4A 1J56A 3KSMA 4G0YA 2ID9A 2YHBA 3C6QA 3NBMA 3RVSA 3EQZA 2MYUA 4DN6A 4XFKA 4F3TA 5JNUA 2JVIA 4NQRA 1ZAYA 3IPAA 1L5ZA 2FKAA 2JBAB 4ETIA 4OBBA 3A0RB 1RZRD 1DRKA 2PUGA 2HQOA 5TPWA 3GL9A 2L17A 4W5QA 2LIVA 1U0SY 4PYRA 3H5WA 1QMPA 5ABPA 5TPWB 3DGFC 2RJNA 2JRLA 4S05A 3OQNA 2NZVG 3OO0A 4ML3A 1FFSA 2JVJA 1USGA 3H5IA 3EGCA 3H1FA 2FQWA 2I6FA 4IMJB 1AB5A 1DJMA 4MS1B 2M98A 4XASA 2WJAA 1R8JA 3T38A 4DQDA 1USKA 1URPA 3OMXA 1EWTA 4KK4A 4N0QA 1PUXA 4N03A 3D8UA 4QICA 1Z2EA 3QX8A 3ILYA 2MSWA 4RU1A 4RSMA 4N41A 1DRJA 1GCAA 3OLXA 4IF4A 4RK7A 1H9CA 1SD5A 3TMYA 1NATA 3K9CA 2GWRA 3N0WA 5KQLA 2WMYA 4KNYA 4W5NA 2N9UA 3LUFA 4XLTA 5EWJA 5FWYA 4S04A 3N0XA 2FMKA 5DCLA 2GI4A 3K4HA 1VLZA 5C5EA
chains in the Genus database with same CATH superfamily
4Z4GA 2GM3A 2H1SA 2H52A 1O94A 2QSYA 3CLVA 4MB2A 4NBVA 4QU0A 4RABA 5E9JA 3ZYCA 4C0AC 1EFRD 3C3JA 1CE8B 5LWQA 1OTYA 1N6OA 3I23A 3I01A 4EO7A 3B6IA 5KPDA 1F4LA 1L4FA 1U8XX 4DV2B 2R8EA 2GXUA 4MMYB 2V6IA 3FNBA 3UOAB 3SZUA 3HYLA 3AB7A 5KREA 1WULS 3KXPA 1MO2A 1KDTA 2AL7A 1UBGA 3OIUA 2BCEA 4M60A 3A1TA 5JIBA 3VH3A 1G20B 1MX3A 2FB9A 2YR0A 2ZJ4A 4JEUA 4HR7A 3GG2A 3IMFA 5DEIA 3MJVA 3AL3A 1E5VA 2QL7A 2QRJA 3OUZA 5DLYA 1ECPA 4ZP1A 5ILQA 2O6LA 3LLUA 4HYYA 3BJEA 3E5RA 2ZIWB 4RLQA 1HGXA 4MVJF 3T6KA 3LNTA 2Z3WA 3RSCA 1NVGA 2M1XA 4HYTA 3V4VB 2BFFB 3WLFA 2ZSHA 2AZMA 3GUVA 3VUFA 4D3ZA 3SC3A 3O4IA 2Y71A 2FXVA 3JPYA 1FE8A 3KG2A 3U4IA 1BRMA 4E1AA 2RKWA 3A6LA 3OEED 1FF9A 1HZZA 2CYCA 2QAIA 5K1ZA 3U7IA 5CXUA 3IULA 3NHSA 2NAPA 4F3RA 6NULA 1N77A 5G0UA 4GBMA 3N86A 4TSRA 1WXDA 3KOZA 4MCJA 5ER9A 5H83A 5JAZA 5DSXA 4LJAA 1R66A 3AGQA 4QVKA 2GBCA 3AHCA 5KQSA 2B4KA 2WA1A 1W5FA 2J3KA 3EGOA 3KUCA 4R2JA 3PZBA 4DJ5X 2Q6TA 1IQ0A 3G5MA 2JLUA 2VH1A 3Q1LA 5I9TA 4E51A 4P7GA 4RYDA 1Y7PA 2VDWA 2PANA 2C78A 4OV6B 2ZYAA 5KJEA 5BR7A 1BMQA 3HFGA 4NV3A 4EF6A 5J2TB 3KK0A 1IATA 4Z3DA 1CR0A 1KMHB 3VYWA 5DYNA 1ZIXA 5ELMA 3K4QA 2YMPA 3KB6A 4TTIA 3BWXA 1N2BA 1U5BB 3QU5A 3I09A 3RAPR 4FEEA 2AFHA 4UBNA 3VOSA 2PZKA 1S1MA 3EPKA 5AHWA 1VXRA 2ATCA 1QLWA 1OB5A 5F5NA 1V7ZA 3CEJA 4B6PA 2O2JA 4EGCB 5AKKA 3K70C 1MVLA 1V5FA 3K53A 1TXGA 1KPHA 1EFHA 3KXDA 3NHZA 3C3EA 4ZRNA 4GYWA 3S8YA 1X15A 3M6XA 4AF6A 1Z4IA 6YASA 3ES9A 4QHSA 4DSNA 5BYKA 4MV4A 4KPGA 4BFCA 2WY2D 4PFQA 1MG5A 5AVRA 3RS9A 3DHNA 2TMDA 2BV3A 3JD2A 4PM4A 3L6UA 5ALSA 4JKOA 2DJIA 1GVHA 2OQRA 2WUFA 3PCXA 3X44A 1B7GO 5AVZA 2IHKA 4YJ2B 3THYA 1MUUA 1DO0A 4R1PA 5A9SB 1H66A 1N5IA 1Q2UA 1FDRA 2V6BA 3MTDA 1E9FA 1OY1A 4GF5A 4H60A 4NAUA 4RL4A 4YRSA 5J4HA 1YULA 4DA4A 3DWIA 2PH5A 2ZRDA 4BDSA 1HYQA 1BYIA 1ZGJA 2W48A 3KCQA 4GXRA 3D8SA 1OH6A 4L73A 1ZM3A 2HUPA 3JYQA 1X1TA 4YRZA 2EIXA 3AY3A 1PJCA 1ZITA 4M7PA 1BYUA 4LRXA 5BV8A 2O20A 2YVUA 1UDCA 2QM0A 3QVTA 4MS3A 2ZR7A 5I8WA 1NMSA 2P9CA 3TDMA 1JAXA 3EMKA 4JLSA 1KBZA 3FETA 3GH1A 4DXHA 3RROA 3NHRA 5T8KA 3LDGA 4WXRA 5BXQC 2RI0A 2QX7A 1TQ2A 3HNPA 1QDEA 1PAUA 4RS3A 3NWOA 4DMGA 4EBBA 2AG6A 4NYIR 2VP2A 1X1BA 3IGFA 1NT2A 4LG1A 4EUSA 4CNQA 4NBLA 4N40A 5E1DA 3FRHA 3TLCA 1SNYA 1U0FA 1ST2A 4EHHA 4QDJA 1TJNA 1CQWA 1G2OA 2VHYA 3T5AA 3AESB 2LBPA 3NWBA 5IBPA 3CSSA 3SVTA 5CDSA 3UG6A 2QN9A 3SKVA 5IVDA 5SZKB 4XM1A 2FPMA 4Z0TA 5D8DA 4D4MA 1ZN8A 3D1JA 3SJCA 4IIDA 4DSUA 5K8VA 3HCNA 4F12A 3ZHXA 4RHUA 1V7CA 2W90A 3EFEA 5HUQA 4A7PA 4L4SA 3R7FA 1OZHA 5B1DA 1CK4A 3R6GA 3CB4A 2P1ZA 3A3NA 1VIMA 5A4AA 3BFJA 2R4UA 4HDAA 1ECFA 4K6HA 5AHXA 2PUEA 1NJFA 3FDFA 4MARA 5LSAA 4OHYA 1SRQA 4G1BA 3AF2A 3AWDA 2AVDA 3OPNA 4L3WA 3D8BA 3OICA 4PRYA 3I6BA 1DAHA 1WTAA 4RZ2A 1NXSA 5GVSA 1I6WA 3BXEA 5BW6B 4ZT6A 1DUIA 1ULUA 2OBLA 5DLPA 5AW9A 1FUIA 4HT3B 5LOVB 2H0RA 3STYA 1WETA 2XZDA 3PEVA 1CY4A 4OUDB 3RTAA 3ZNNA 1USVA 1W46A 4EJ0A 4KWTA 3ZDCA 1CUJA 3CRRA 3IEXA 3HR4A 5FTLA 2WU8A 2WM3A 4ZQEA 1B4DA 4DSZA 3OC6A 3RIGA 3EISA 4L08A 3VU3A 2X42A 4Z8YA 4MMXB 3ZIUA 4RY0A 4F71A 2I22A 3QP9A 4EHKA 2VLIA 2YZMA 2PG3A 1XQ9A 1MBZA 2POQX 4UVEA 3AYZB 5F3RA 4FNGA 4IXMA 1R74A 2FF7A 1VA5A 2ERXA 2P69A 1IFXA 4GP9A 4QVGA 1I2MA 4EJSC 3J81A 4RMGA 2P5YA 2VWPA 3R7SA 4LSWA 4M8LA 1BDHA 2P0YA 3TNLA 3IIEA 4NC9A 4CKBB 4H3VA 1GQRA 2MSLA 2YJ3A 3D6UA 4G01B 1R0KA 2EKBA 2UYQA 3AG5A 4CMJA 1R5OA 5C5DA 3JS5A 3O75A 4YMLA 4P84A 2WD9A 1EUDA 4KH0A 5F64A 4OXYA 5L4LA 5ES4B 2GLUA 3AJ9A 1YR2A 4HEJA 5BSTA 1OT5A 2CD9A 4H35A 2A84A 1L8QA 3BL6A 2ZBFA 4KG7A 1XZEA 1C3XA 4Q9JA 2PZFA 5T8KC 2B21A 2Y1CA 3CIFA 3FPHA 1BOFA 4MITA 4A2QA 4R8RA 4IP0A 3H0KA 5FUBA 2Q1UA 2PZLA 3GJTA 4XCXA 1CDOA 1U2EA 2XUJA 2JIMA 2QBYA 4GP6A 3HKDA 1ZUD1 2BGUA 1XEWX 1V8BA 4B3MB 1X0VA 1HSZA 4JP1A 1RYBA 3O83A 4JJFA 4QC2A 4ZAZA 1NMQA 2IHBA 4NU6A 3PFIA 4OGFA 5HKLA 2PE5A 3QUBA 3WV5A 1WD7A 3HN2A 4LYGA 2WM2A 3D4IA 1WTCA 4IDPA 3HBFA 4L8VA 1JQ3A 2HT1A 3HCDA 4O4IB 1IXKA 2EFDB 4B76A 4ZJPA 3SD7A 2W6CX 1O7JA 1WUIS 3FFAA 1VSQA 4YRRA 3ZU3A 3BRSA 4LY0A 5AW3A 4X61A 3JWIA 3MMNA 5ER6A 3RVPA 2CXXA 4YRQA 3WAJA 4PGGA 1QP0A 2DFPA 1FQOA 2PR7A 3FFTA 1A9PA 1AT1A 2Q8PA 5KYWA 1PEAA 2I1VB 2RONA 2ZTVA 2AFHB 1RLTA 2H7XA 2IYRA 1LPNA 2GVDC 3MJDA 3GNLA 3G82C 4OKSA 4FOPA 2QLFA 2OD9A 2DT5A 2QZPA 3MF4A 4GBED 1XMSA 4WOKA 2OP0A 1PJSA 5G4KA 2GA8A 2W71A 1AKUA 2ZPUA 1JKMA 1NI5A 3MA0A 2PL3A 1ZO8A 3VO1A 2HZBA 2A7QA 1PGNA 2HTFA 3BSYA 1FRQA 5FI0B 5HFNA 1WL8A 3ZE2B 3NTXA 1DCFA 2AQHA 3FMVA 3OLQA 3HXTA 2QI9F 4NDNE 3PQ6A 4C43A 4Z9FA 5TRTA 2QV0A 4JWKA 3LBAA 3M2PA 2WM8A 3AXSA 4BIMA 5CGZA 2DPGA 2JS7A 1IJBA 1E3LA 4XVRA 5H5JA 5LUAA 4KPUB 1WABA 1Q6ZA 5C7LO 1ZBQA 5JPDA 1UIMA 5IJWA 2BGMA 2ACVA 3MUEA 3LLSA 3BQNB 1AOXA 3BOSA 2PLWA 2FWJA 3K5IA 4K26A 2P9EA 3BXPA 2RSLA 1JZSA 4G37A 3ZU4A 5J58A 4GEKA 1TM5E 3PVZA 4WLNA 5JE8A 5M7EA 3TRKA 4X41A 4ALLA 4D9BA 4EFNA 3VDNB 3V1UA 2IXTA 3D6MA 4W8GA 5BN1A 1EE1A 3DVRX 3IODA 4PSDA 5ETJA 2QG6A 3GWGA 2XTZA 1TKRA 4YLYA 3PEWA 3GARA 1F8XA 1T4DA 1THMA 3BAZA 2HMSA 2C97A 4XXHA 4EA9A 2XMCA 4KVZA 3OFND 3I2KA 4EYSA 4Q7JB 2IS2A 4BP1A 4MB6A 4DZTA 1JFFB 2ZCJA 4EELA 1NJ1A 3ZZ0A 2OGUA 4TMZA 3RWOA 2QRVA 3EIUA 4GMDA 1WKBA 1KE2A 3ZJVA 3DLTA 3W05A 3UJDA 3MQ2A 1R8QA 2J3JA 4FX2A 4Q6WA 4B6RA 2VAXA 3QF4A 3E7DA 4G5FA 4QNMA 1W4ZA 2F7SA 4L9AA 2FZLA 2HC9A 3D1VA 5CHYA 4IHJB 4P38A 1C2YA 1U1DA 1K4MA 2WE7A 1UQTA 3CUSA 2VXCA 3GCZA 3OLYA 3MS4A 4YIHA 1ES9A 4UC0A 3OVMA 5EZ6B 5KTYA 2JFVA 1MX5A 2V7GA 3ZDXB 2F3RA 4LVOA 3IJPA 3LP5A 4D1YA 4FPXA 2VIIA 2VSXA 3G1WA 1NJ6A 3S2YA 3PEYA 1AKQA 1U1GA 3DFUA 1WDTA 3WJ1A 4E4TA 2I3BA 3G89A 4KE8A 4N0PA 4OU5A 4R41A 5COAA 2IBSA 4UM9B 3RC3A 4RZIA 1ZR4A 2GX6A 2IU3A 1GQ2A 4JLMA 1Q19A 4QOGA 4TXLA 2ATEA 4AY6A 4TYPA 2G8NA 2BKVA 2E82A 4QEZA 2ZUEA 3IKVA 3VKUA 4B7ZA 3ICEA 3FOWA 1YH3A 2XNDD 3EZLA 2FN9A 3SQXA 4Q3CA 3LYAA 3M81A 4RJIA 1KAQA 1MB9A 4RF3A 4BNDA 2JANA 3ROQA 4LC0A 1ILWA 3ABZA 4WZ6A 2F00A 1QSGA 3CC8A 1UC5B 1JI0A 3SC2B 1X1CA 1VRVA 3I52A 1JBKA 1G42A 1U1EA 1ZXBA 2NXWA 2WF6A 4OU4A 4YWJA 1NZFA 2HDNB 3IDSA 4HAUA 3SU8A 2Z6VA 2GNPA 4TN1A 4HLQB 1HQDA 2BONA 3O2JA 5IJ9B 3OTOB 4EYKA 4E5YA 3ZDDA 2VHCA 1E0SA 4YQZA 4QM7A 3W5AA 4KN8A 5AVYA 3G2IA 4EW6A 3OD1A 4CMEA 1LKZA 4J6FA 3W9SA 1EP2B 5BW4A 3IAXA 2CVZA 5FTNA 5HZKA 2IZ1A 3FCOA 1W2HA 3KQTA 4M1YA 2FW1A 5BYJA 2MT9A 3GMIA 5D3MB 1Z39A 3GPBA 4ZYZA 2O59A 1J8YF 3ASZA 1MT0A 3IIIA 1XWWA 3QQ5A 3LTNC 1II8A 2PUVA 1I2CA 4PWYA 5HG0A 1FCJA 3WL7A 1KZ4A 4DDHA 5I7VA 4OHOA 1QUEA 2QA5A 3G7SA 4PU0A 3ZDAA 2P4QA 5FL3A 5D3QA 2Z6QA 1N7JA 3UBMA 3DAHA 3PJRA 4I5DA 2F17A 5M5BA 1FXWF 5JVDB 4P83A 1EHIA 3G6KA 4AP9A 4N5MA 4EJFA 1EAMA 5G40A 2FLWA 1R27A 2I4LA 2A5GA 2NPOA 3S40A 1UKZA 2P5TB 4B84A 3RHTA 4CLXA 1IXZA 2JIBA 1H2BA 1QF6A 1VSTA 2QGNA 2WJWA 1GT91 3DR3A 3GFPA 4KAAA 5TQ0B 3MJCA 3FDZA 1WQ4A 3NHBA 3HSSA 3QWAA 1F3OA 2QOEA 2ODWA 5IUKC 1IN5A 3K1TA 5E3HA 3DHEA 3HI6A 5AOCA 2AOTA 2V7WA 5H4GA 2K7FA 3CPEA 4Q0MA 4OKIA 3JVUA 1U94A 4MUXA 3O8BA 3R0VA 1SXJC 4UTVA 3K71B 2VJQA 4BV3A 3WMXA 4D9MA 1KYVA 3F67A 3OF3A 1J7JA 4K2HA 4V0OA 3S68A 3E35A 4R1UA 2XYVA 1KNQA 4LV8B 2GEVA 4LOHA 3CKKA 3E7XA 2HSEA 3F6BX 3FCSB 3HFJA 4W5QA 2QMOA 4PZAA 2FGKA 1WCXA 4LA4A 1KIFA 5IVPA 4FGSA 5AMXA 5DVZA 1MEJA 3TTYA 4HD8A 2ZR0A 5B55A 1SEVA 3HWRA 3OPYB 1OASA 3MBOA 4O1MA 4EHNA 3ZV4A 4Y2XA 2GYVA 4WXYB 3U3MA 4JI1B 1RMYA 4IRUB 3FVVA 4GYYA 1TW2A 3DUFA 4DQDA 4DXDA 2VHEA 1XZMA 3DDOA 4LOLA 3NI2A 3KKZA 4NRDA 1QZ3A 1OR8A 3EUWA 1D0VA 3UPTA 1SUWA 1GARA 4B2IA 1M83A 3N2GB 1QH9A 4MRAA 1WPRA 3VZQA 1AJEA 5IK2A 5C9ZA 3QX7A 3UHFA 5ALFA 3ZUPA 1WZ2A 3SHVA 4U7FA 3T7SA 3QMWA 3L4EA 4JLAA 2BJWA 2ZXEA 4OYYA 3ER8A 1RM0A 4OVKA 4IQ8A 2EBUA 5K8CA 4YDHB 4DBLE 2V3WA 3C6BA 1EP1B 2WLTA 3CVOA 1XDZA 3HB0A 1YRAA 5HF6A 5I7AA 1KC3A 3GC6A 4Z4IA 4RVDA 4Y9DA 3JVDA 4LRQA 3EQ2A 3WIEA 4TVOA 1AMNA 1ORHA 2FJUA 2GERA 3QKWA 4DA8A 1E9BA 1ZNYA 3VX3A 1T13A 3JALA 4HAOA 4L75A 5I4IA 2I2AA 2CMFA 1PG5A 3ETCA 3HL0A 1CQJB 1P62B 2B61A 2P2LA 1FUKA 1NOIA 2Q3LA 3GIDA 5D7NA 5J4YA 1RAEA 2LKDA 3I1FA 4IM7A 2C2BA 4Z2YA 5AESA 3TOVA 2HU5A 3G17A 4AZTA 4R16A 2C83A 1OU0A 2IOQA 5TS2A 4FR2A 5JMOA 1A96A 1OAAA 4G1CA 3ITDA 4GH5A 5DEOA 4QHTA 5G1NA 4BO7A 4DCPA 1DV1A 2CNKA 3U44A 1C7FA 2VOEA 5FNVF 2O8BA 5DASA 3TPZA 3V7WA 1PD1A 4HV4A 1AIPA 3FHOA 1JV2B 1T5BA 3L84A 4RQUA 4F1WA 2OECA 1E2DA 3GV0A 5G0VA 1TCUA 1YA8A 3LDAA 2WP8J 3NEYA 2NYVA 1PS0A 1NVWQ 3FAZA 2Q62A 3LPDA 5EVJA 3QE3A 1Q92A 1P9RA 2I8CA 1MQ8B 3FVQA 5I7SA 5LJIA 3GY0A 3TB6A 1YTLA 1OFHA 1QCYA 2ID7A 2VNKA 1XPJA 3HVKA 2HK6A 5EMMA 4CG1A 2G77B 4J0KA 4RD3A 2JJ2D 4UBJA 2FQQA 1JH9A 3GN2A 4RLSA 1F8FA 3W8NA 2XTJA 4JP5A 1Y4AE 2XYRA 4NPAA 3TQHA 2F3UA 4DLZA 3THWA 1NN0A 1W581 4YP6A 4AWAA 4R5HA 4UBLA 3F4BA 3O9VA 2NQ2C 2ET6A 4FS8A 5A3SA 3BT7A 3WQHA 3JZMA 4XWTA 3ZJYA 2O57A 1UPBA 2OOKA 4BB0A 2HK7A 4MR9B 2JA2A 4UXIA 1SCAA 3L46A 2VZ9A 1F06A 4Y1FA 3TS1A 1XT6A 7AT1A 1E2MA 3PX2A 2Y1EA 1H4VB 3H4IA 2X0FA 3RTDA 4Z3KA 1G66A 1VLQA 5JPIA 1VI2A 2R5WA 3T5BA 5HR5A 2P6PA 3K09A 2P78A 4JASB 4UAVA 4A5OA 2N1MA 1X1RA 4LSMA 4NJEB 4KAFA 3AHHA 2VUHB 2W2LD 5F77A 2VZEA 3B70A 3WKAA 4D9FA 2B1JA 1BKDR 5EJMA 1W48A 1PRYA 4KVAA 2O3JA 4OCZA 5BVGA 2G5CA 3PSAA 4JXJA 4JI2B 1US8B 2ONCA 3R8XA 2NO5A 5G02A 5CXXA 4FSDA 1MEEA 5CYPA 4R81A 2D0IA 4Y30A 3IEPA 2CXQA 2FE4A 1CDEA 1OMOA 1VJ1A 2Z5VA 2I6GA 2OC4A 2XVAA 3G68A 3PHCA 1I8TA 2E4UA 1L4NA 2Z8YA 1KETA 1JJVA 3WYFA 1FTYA 1YO6A 1KEEA 1P7ZA 3BE6A 2GAJA 2BF7A 4IJ6A 4KQXA 3QEJA 2R6ZA 3BDIA 4Q4AB 2EL9A 2RK6A 4WLUA 3AP3A 1NUHA 3H8JA 3UIEA 3PTAA 2VYNA 2XQFA 3LUAA 2IEBA 2ZIFA 4OMUA 4XUDA 2KW5A 3KOWA 3PC4A 4YACA 1W85A 2BZGA 4NAVA 5EJ7A 4MQ5A 1PGJA 1XKLA 3IIMA 1ESNA 2ORED 4QXOA 4BHTA 3VXKA 1KY2A 4DREA 2QTRA 4YCCA 1JFVA 2OBNA 1F51E 2GBIA 1E63A 3D3WA 3NC0C 3TBKA 2B7BA 5DX0A 4C22A 1DOAA 3DBHA 4D79A 3JQBA 1GGMA 1B6GA 3IR7A 4OXIA 4WUTA 1H6BA 4ZI5A 4QDXA 4CLRB 5HJ5A 3IAHA 1ZCZA 4DB4A 5AKYA 1PT8A 3QXCA 1NY5A 2BFEA 3GAMA 2J3EA 1UMDB 1SXJE 2BRUC 5CYFA 3B3AA 1W4AA 2WWYA 1XLUA 1HG1A 2X0JA 4BNDB 1BQ3A 1UXJA 2WF8A 1DBPA 2X7XA 2YQ4A 4ZQHA 3RGGA 3EVNA 3O47A 4K87A 2AT1A 1XRQA 2C29D 2JLQA 1YD7A 2FMTA 1QQTA 1PUIA 1L5OA 3A7DA 1YJBA 2HT6A 1R0ZA 4P36A 1UWCA 3ITNA 1A9XB 1YZTA 1VGQA 2ECQA 3IKMB 5E2AA 3LT1A 3QVOA 2V74B 4DXAA 1YVPA 3MT8A 2Z98A 3NKFA 5K03A 3BMXA 4MK4A 1Z13A 3PUWA 5LA6F 3VZPA 4RE5A 2OXTA 5IJ0A 4YP9A 3U4QA 2PCLA 3LF2A 2Q07A 1YCHA 1J8VA 4DEYA 5DU2A 3TLGB 5FRDA 1FJHA 1LI7A 1D6JA 2IHZA 3TZHA 1XZDA 5ECWA 1KI6B 5B1HA 2VBIA 4M0PA 5D87A 1NN5A 2G80A 1MB0A 5AI9A 1ADYA 4GKVA 1IN1A 2I1LA 4R69A 1JDVA 1ICEA 4L4YA 1JPUA 3DAFA 3DEJA 3G2HA 3MWKA 3DWEX 4XPZA 4ZMSA 1J49A 1SCBA 1G21E 2JZNA 2CL0X 4FYYA 3B1VA 1S9DA 1V5GA 1AGYA 1R9NA 3DPUA 1T8UA 2XOEA 4UBMA 3EYWA 3VNAA 4C2BA 3BE8A 1AMUA 4CXMA 5J2UA 3HBMA 4PBTA 1AXRA 4WDRA 2CDAA 4KR2A 3U2QA 2XXAB 4B3TB 2R9VA 1E8NA 1BQEA 1GTG1 1T9BA 2KB0A 3HUUA 3WOHA 1MABB 1CQIA 4JBWA 1CR6A 1FX0B 2R84A 2N0SA 3IP5A 4YR7A 2BFCA 2JFWA 4L8FA 4XD7D 5J5VA 3SMVA 1KVSA 2X14A 3TSCA 1L7OA 1EIZA 1NQWA 3DJYA 2CXRA 4C1NA 3UN1A 4K0KB 3FHLA 4RV4A 3KEFA 5B4UA 4JQOA 1N5DA 4PHGA 5ALMA 3UJ6A 2KLHA 5LQDA 3TJRA 4YMTA 4UATA 4TRNA 3WYEA 5DH9A 2QTTA 4U7GA 4AKEA 5C80A 3LOPA 3EXIB 1IY9A 2WWHA 6REQA 1GNRA 1EE9A 1YBVA 4G9GA 3J7TA 4MQMA 3II6X 3ANLA 1FZQA 1RHQA 2HPHA 3EVEA 4XRGA 1Z5OA 1EFLA 1YWGO 2OV6A 5LUBA 3TSZA 1CSEE 4BIIA 4DBVO 3QLTA 4KXLA 2VQEB 4RH0A 2B2NA 2ZQ5A 3M83A 3KALA 4Q4CA 3UTDA 5C4MA 1BFKA 2YICA 1WB4A 2HW8A 3ND9A 4C4YA 2I2CA 2V45A 1ARZA 2Q2QA 1T8SA 2VXOA 2PJUA 4NABA 5FBQB 1YQWA 3K3PA 2HJHA 3OZBA 2A0WA 2F4NA 1QFJA 3IV6A 4NESA 3ZNQA 4FFPA 1JDBC 4AYWA 1THZA 1KBQA 2M6RA 4BQPA 2KBEA 5HX7A 2YRXA 3PX7A 4NZPA 3P94A 4EI8A 3G7UA 3ZHCA 5BSVA 3C0KA 1P1CA 3B9PA 4IOJA 4U6QA 2EHDA 3UNXA 3NVMB 5CYOA 4ILEA 1KR5A 3PYXA 3OE7A 5CBPB 1PP4A 3BJZA 1QU2A 1PZNA 4OSEA 4XVUA 3LT0A 2YOHA 2QM7A 1JYEA 4DQVA 4MDEA 3F97A 1KO4A 3BXXA 4ZA2A 4R8KA 3TBHA 1TKCA 4MR9A 1KWKA 4M7RA 1PT6A 2BEWA 2J41A 2ZG6A 3V2HA 1Z2CA 1MJFA 3RU7A 1U11A 4EW1A 4FOSA 5HZGA 4ARIA 3LQ4A 1XTBA 3O82A 3BVPA 4UNNA 721PA 3BDVA 1QIDA 2EATA 1YQDA 4BVGA 3P9IA 1JEYA 5HA5A 2J0UB 3KO8A 4DZRA 4F3NA 1FSFA 2I3DA 1WW8A 3MB5A 5FPKA 1EXMA 2JIDA 2XMQA 1R6BX 3BGOS 1GV1A 5EP4A 5BN4B 4CFZA 1EUQA 1CS0B 2WSYB 4LJ5A 4PV7A 3MGBA 4ZV7A 2GTIA 4V1CA 4D8TA 1WSBA 3I1IA 4TRRA 3L4KA 4CEHB 4KX5A 5IC4A 2XRFA 3ESCA 3BDAA 3L01A 1TCCA 4QYTA 1ND5A 2QNIA 1U8FO 3DBOB 2J6BA 1SXGA 1JDTA 1TVCA 2CNBA 4RKWA 5DYTA 2BE9A 2XUAA 1Z45A 3HQ4O 4MP8A 5FYQA 3IE2A 3FPEA 3UKOA 4WBNB 1EM8A 4HLDA 2E49A 2XCLA 5AK0A 2YJ6A 4ZVTA 5KNBD 1SBNE 3UGKA 3P96A 1TKBA 4J3NA 3BBPA 3OJWA 2FEKA 2CB0A 1ZL2A 1HK7A 4IDAA 2V4UA 2XXJA 3KWMA 3QKIA 4PLCA 1WU8A 2XVZA 3LUPA 4JSYA 4G6ZA 4IEIA 1GTL1 4BNIA 1GKYA 3PEEA 4G5SA 3ZKWA 1ZUIA 3NBXX 5EXXA 5FQOA 4YJHA 5HIIA 4TYQA 2HJGA 3KOYA 2NXJA 4J1QA 1HDXA 4H0NA 2IUSA 4AZ0A 5JISA 3HV0A 1GPBA 3Q0IA 5EJ6A 3WO1A 3TOXA 3L1HA 2FXIA 1DFGA 3QUTA 2IH2A 4EF5A 4C3UA 2Y6UA 1V8DA 4M0UA 4IJ5A 5CX1A 4UU8A 4WFKA 1DNPA 1CUUA 1T8WA 2IYOA 4K6OA 4L5BA 3W0LB 3M6UA 4GR5A 4JKYA 2VDKB 2WKPA 1NJ8A 1NUTA 1XVVA 4ED9A 4E5SA 2TECE 3V8BA 2P0AA 3U48A 5I9NA 3RK4A 3REGA 4ZEMA 3EVCA 4Z1MD 1JLLB 1MQ9A 1RRCA 1Y5MA 4HNHA 4AURA 1SKUA 1SG6A 4LE1A 3KR9A 5IRCD 3AR2A 3H19A 2RGWA 5B3KA 4BLTA 1W36D 3I4CA 2IZ0A 1MORA 3ZVNA 3KAQA 1DWOA 4MPJA 4LJ7A 5AJYA 1T2VA 1ZJ6A 1C4OA 2WTEA 3CVYA 3GGPA 1KYTA 1NMZA 5ICGA 5KTTA 1GQYA 1DJLA 2XVMA 2AXPA 5L95A 1HLPA 2QE7D 3GZNA 3HPQA 3HYNA 4MYRA 4AZ3A 5KX5A 3WZ2A 2VVTA 4XGQA 4XPIB 1GOTA 3SZGA 2W2VA 1OAOC 4Y9TA 1B0AA 1N92A 2C5GA 3O1LA 2UDPA 3VC2A 5F23A 2JHFA 1C7EA 1O6CA 3CS3A 3OAAD 3AESA 2V4ZA 2XXBA 3QE4A 4K81B 5JWOA 5H02A 4F7DA 4H7JA 3AVWA 4FIDA 2YXLA 3D6NB 4IJWA 1H4QA 3AVYA 5A6VA 1RBYA 2KSQA 4DIEA 2QUHA 4Q6BA 2Y1FA 2CXTA 1M34E 4HPXB 3T0IA 2EDCA 2PRZA 1KY4A 1P33A 3AEQA 4MR8A 4S2EA 1PG0A 4TTJA 4UDNA 4G26A 3ZW7A 4EATA 1XEFA 4PZUA 3IUQA 2NU9B 1L7MA 4X0EA 3DD1A 1NF8A 3ZE1B 2ZAGA 4JGGA 3EVAA 3NWJA 5BNWA 3O5AA 4OHVA 2MSNA 4NL4H 3C3YA 1US8A 4RTLA 3A7EA 1RQPA 1FMLA 4EKDA 4KITB 4YAUA 1YB6A 3PKJA 1M74A 3CRW1 5CB4F 1XEXA 3BX1A 3JQPA 4HS9A 2FR8C 3KKKA 1G63A 4WNAB 5FOXA 4LF6B 2VPZA 2QW8A 1KJIA 5DTEA 3H13A 3NFYA 5E4TA 4AROA 5ICSA 4DV3B 4JI0B 1G20E 2ETXA 3DBIA 5HIMA 3L7YA 3UFXA 1JSCA 4F46A 1XRPA 2FPOA 1AXGA 1QFMA 3DHVA 2PTGA 5EE3A 5J5CA 3CT6A 4TKLA 1AKEA 1U0OC 4NU5A 1JEOA 3NVDA 1JDPA 4V03A 4LXHA 3A10A 1Z6AA 3KYJB 1T9AA 3DL2A 2LXNA 3JQQA 3V8VA 1LPMA 3BE4A 4EYQA 1QB8A 4JXKA 2IX9A 4IDGA 2E1PA 4Q05A 4OI1A 3UICA 3A28A 4HDKA 4X60A 2QZ9A 2YZGA 3BHJA 4ER5A 3DZHA 1W85B 5A4KA 1BEZA 2IZOA 4P58A 3ISVA 3PC2A 1AGXA 3AYXB 3PQDA 4MVJA 4PZPA 1R4MB 3D3WB 4HWKA 1ULSA 3CJQA 4R1MA 1J56A 2WYIA 3U7QA 2WJ6A 1JB1A 3DDZX 3SDSA 2VRBA 1JTVA 1NMEA 4ZGBA 4F6LA 4TL8A 2VH2A 2FG7C 4N12A 5K09A 1PU2A 2BHTA 2PKWA 3TIXB 2ZRMA 1T2UA 2J08A 3D7RA 1NR1A 3I9V1 1C9MA 4XRRA 3U4MA 2ZFUA 1DAEA 2HIAA 3V7NA 3WLQA 3P2KA 4FC6A 5D3KA 3A4NA 4YCLA 4KZPA 4LRUA 3P4XA 4WLFA 3EMDA 5U4QA 3ZY5A 4FUTA 2PX5A 4OK6A 2IEGA 2O8BB 3PXUA 2OXIA 3B1KA 4F9GA 1FTNA 1DT3A 1UEXC 1POWA 5CUQA 3NPAA 3H5NA 2LNDA 2RHLA 4LNUA 2SCUA 3AEUB 2WJAA 2UV8A 3H87A 3PUVA 5C52B 2LR0A 1HSOA 4KDCA 3AINA 3OTIA 1YZLA 2XMSA 5CT9A 2VYFA 5DK6A 4X8OA 5REQA 2C92A 1O5IA 1CUIA 4FTWA 1RYZA 2F43B 4HAXA 4FMCB 4HEA6 3OCWA 4IF4A 4MICA 4YROA 3WGLA 3TMYA 1XMXA 1Y8RA 3FZGA 2AJLI 2GWRA 3R5FA 3DWFA 2DY1A 2GK6A 2QTLA 1OWOA 1C3VA 1ZL0A 2AEMA 3K8YA 5GINE 1VRWA 5ERYA 2I67A 1UJ5A 2NGRA 3ADOA 1VLZA 4KX3A 1DDIA 2I76A 1E6LA 2QN6A 3NKLA 5EZYF 4OM8A 2NW6A 5ANRB 2BZ1A 1FU7A 3S8EA 4N7RA 2ZAYA 1I2AA 3PP8A 1A9ZA 5AXBA 1RWOA 1XAIA 1HL3A 1Z4MA 1WMFA 1WRBA 4K9RA 1WUTA 1S6YA 4CKWB 4PRKA 2Z58A 3CTPA 3HV2A 4AZVA 5BWLA 5C2JB 1P8AA 3CV3A 4NF2A 3BTVA 4LN1A 4Z0PA 1V5IA 2FR8A 2WIJA 4OLFA 2JH3A 3S27A 1KO1A 3AW8A 4L07A 4EMUA 3IAAA 2CSXA 4E32A 4I3FA 3NONA 3ZPXA 5AQEA 4OM7A 2XAAA 4FVTA 5DSTA 3FF4A 3NHWA 3A2MA 2YOGA 3PD1A 3Q8XB 1QH0A 2HQRA 2EV9A 3HGTA 2JLSA 4CPDA 1Z4PX 4R5MA 3BC1A 4UUOA 5BSHA 1IMJA 3SOZA 2Q27A 2J67A 5JRDS 4J90A 3CZ9A 1PIWA 4FSHA 3LHFA 5FCDA 4DAEA 1ZHFA 1WO8A 1KDOA 1HT2E 4DT1A 3MGCA 1IBCA 2ZB8A 3NBUA 1EJ2A 1DXOA 2VJAA 3LXUX 3QXGA 4J0CA 4EUKA 5KTSA 2C1ZA 4IKPA 1I3OA 1ZZEA 2ZI3A 3LPNA 3RCBA 3ZTYA 1JSLA 3NBKA 3AP1A 3S2EA 5B6PA 1XZCA 4ZCTA 1QIFA 3B36A 4OQQA 2XITA 1TQ6A 4B48A 1PQPA 2H4ZA 4HVAA 2O8CB 5TPZD 3Q3JB 2Q5QA 2BHLA 3OCXA 1I5RA 3C6KA 3D8HA 3TRIA 1YK1A 4BQOA 4MXDA 4D9GA 1NBEA 2O3RA 1CJSA 1XZJA 3H9QA 3NATA 3IAM6 5E6UB 3DVSX 1V16B 1IJKA 2FWNA 4RCZA 3EEBA 4FN5A 4HPWA 1AKWA 4FLMA 1JYFA 2DXIA 1E2EA 3AJAA 3H2GA 1TRHA 1P72A 4LWZA 4NYMQ 5LA6A 1C8LA 4WXMA 1JVNA 2BFDA 2I99A 4OK5A 3S5UA 1YZKA 1WX1A 1MKYA 3ESRA 4IHJA 5DTRA 1K7EB 4YMUA 1A9RA 4JNKA 4U0KA 3IB3A 1Z6GA 3Q5GA 5C35A 3FTEA 3GXBA 1QHHB 3MLEA 2ZSFA 3GLUA 3ZV6A 1MPXA 2PFKA 3L04A 3U19A 2F3PA 1BE8A 2G0TA 3GOQA 3I28A 4AVYA 4B3DA 4OAPA 2PUCA 3R76A 3W6PA 1XX6A 4TV8B 1PV4A 1V71A 2C4MA 3DFFA 4W8HA 4WXEA 4X8MA 3RUFA 1BN7A 3WIBA 2HM7A 3ZBPA 5BW5A 4HQLA 4CKEB 2DQKA 1EK1A 1WVIA 2P1RA 3P0JA 5C8YB 1QOQB 4Q9DA 4HUJA 3SN6A 5K3CA 4UM7A 3ND7A 3CBQA 4HQ0A 1DQZA 3OQMA 4C4SA 2P91A 2W6OA 3GDGA 3QYJA 1SB9A 2Z2IA 1J39A 5IK2D 5EZYB 3PTLA 1BGVA 3R3HA 3HMKA 4DEVA 2ECFA 5I7FA 2XOXA 2WKQA 4RD6A 5KHLB 5CP8A 3VISA 2QMEA 1WXGA 1G60A 1EFUA 3BL8A 3GBVA 1AQLA 4BTVA 1DE0A 2YDXA 4XQ9A 5JJLA 3UJPA 4ZDJA 3BMCA 1H1DA 1QC5A 2W11A 3KZMA 3Q5EA 1FFHA 3NV9A 3UJ3X 4C4XA 2LIPA 5FJJA 1VG1A 3AT1A 4J16A 1E1NA 1MABA 5DLQC 3CLSC 3LD9A 2EZ9A 3P0IA 3H3JA 1XZBA 3MTJA 1TMKA 2JW5A 3CE9A 4GMFA 3EFOB 2HCBA 5JMWA 2UZ3A 4RH3A 3HLYA 1SCIA 2XUQA 3JU3A 4UHFA 5LOVF 5IUJC 4UQOA 4NTZA 3RDPA 4RTKA 4L5JA 4D0RA 5AI6A 4G5OA 2ZAOA 2B4QA 4KIJA 1E7MA 1RD4A 1T8YA 1BXRB 2ZWAA 3CUWA 2ECPA 4Y18A 3T1OA 3WB9A 1NYRA 4B8WA 3L3BA 3G0IA 3KOOA 1GM5A 1D04A 2AG8A 3UXMA 4UJ5A 3IVGA 1W94A 2R48A 3R5KA 4POOA 3DW3X 2E6KA 4A27A 2Q8NA 4FYWA 4Y9UA 2H1IA 2AW5A 2ZWPA 1OC2A 1SQ5A 2I9KA 3AY6A 2HSGA 5B36A 1M76A 5JCPA 3CN9A 2B5OA 4CKYA 4DSTA 5GP1A 3RADC 2NO6A 4GX1A 4CIYA 4D57A 4TV8A 1TAHA 2A0KA 1K6JA 1YIDA 5KSWB 4XA8A 4UVIA 1L7BA 3MWFA 1JA9A 4GZ3A 3OKCA 4O8CA 3B60A 5GJWC 3GHYA 1XTKA 3AHGA 2O8FB 1QPGA 2BFBA 4RMNA 1OFIA 1XYVA 1NOKA 3OFKA 4MKGA 3D2BA 5JLAA 3TW4A 4C0WA 4P7BA 5LJLA 1KK1A 3PTZA 2EFHB 3IT2A 1V4VA 3EIHA 4RWEA 3UB3A 3WYAA 4I7EA 2L69A 3Q7TA 3L82B 3SIRA 2JFYA 5L3SA 2PVSA 4B79A 4BFSA 2J31A 2WU3A 3LBHA 3N8GA 1FDTA 4RUKA 4MV1A 4ZICA 2F55A 1M34A 1YZFA 4YRLA 3O8QA 3AC0A 5E3JA 2CV1A 2FPGA 2BFMA 4AL4A 4Q16A 5JO9A 2RHHA 3GPCA 4ITUA 3K70D 3DF7A 2DWPA 2FX3A 5TVKA 2G0AA 4PZDA 4D2IA 1L5HB 2BI7A 4N7JA 1XBTA 4EG7A 1ODCA 2MSKA 3GN1A 3TG8A 2OY0A 4AUEA 1T5DX 3QEMB 1QCCA 3LX8A 3EIQA 1YBMA 1MTZA 3EGVA 2Y0BA 3GEDA 3T7KA 3U80A 4CM4A 2ZJYA 3WKEA 1NIPA 4EAAA 3ZIAA 3A6DA 3IUEA 3T15A 1KA9H 4ZT4A 5TSDA 5LU9A 4GKJB 2JLWA 4AQDA 3C5WP 3OQIB 4J91A 3UK1A 5BSKA 3TW8B 1VIYA 5BUQA 2XNDA 1QHEA 1I01A 3RR2A 2WJIA 4YUZA 4GRIA 4KIFA 4QDUA 4GPD1 1FMJA 5EKDA 5ESRA 2OWDA 3Q4GA 4TV9B 3E22B 1GLGA 3WMGA 3A58B 5BRJA 3S2FA 3TPCA 2PU5A 2QT0A 1O0BA 2WIDA 2BDUA 2G7ZA 3KYCB 4LISA 4LV6A 1Q20A 2X0NA 4RHTA 4GMKA 4N3AA 5DMHA 1Q5PA 1CY7A 5KYVA 1H6AA 3NNDA 2YWEA 4HFJA 3R7LA 4LYAA 4FILA 1MNAA 2GYWA 2QIOA 3BQ9A 4Q1EA 4RZUA 4UBKA 4X6XA 2B83A 1A72A 2VC2B 4OYHA 4B75A 2H4JA 1N0HA 1VG0B 5BMVA 1UCFA 3AU8A 1RI1A 3L49A 2D4AA 3JQRA 4H31A 3RSZA 1GA1A 2R66A 3LYLA 4MI1A 2QTVA 3F47A 1GZVA 4TROA 1U0LA 1KI4A 1M6VB 3KDPA 5DGXA 5HE9A 3B38A 3CNEA 2Q7XA 2ZIVB 4PONA 1U65A 1Q0UA 3E9YA 4LRWA 2I4TA 3R9WA 1M2HA 1M6HA 1TE2A 3MUFA 2GZAA 3AW9A 3ESBA 1O89A 2BH2A 3VX4A 1MOPA 2GH1A 1PJLA 2GQ0A 4HY3A 5TEVA 5IUNC 3ORYA 4YALA 3HNRA 3SDZA 3L07A 3TQRA 5ERGB 3R9XA 3IP1A 2ADMA 5AKGA 2DWUA 3BCHA 3O92A 4UOQA 3HO8A 2FEOA 4JQYA 3TGWA 3ZVMA 3THRA 3DCJA 3KAKA 1RU3A 5HILA 2R3SA 3UCXA 5BUZA 3WADA 4GR9A 4JC4A 1QR2A 1G0NA 2V5VA 4D8UA 1Z56C 3IOCA 5HZHA 1XPUA 2ZVPX 4X3PA 4KYTA 1I9GA 2Y1DA 1P0MA 2ZI4A 4L9WA 3DXFA 4J0JA 1JL3A 2WYOA 2H7CA 3KFXA 2XECA 4ZVVA 2GMWA 4LDNA 1ZRMA 2Z9DA 5I7EA 4KQIA 1Z4OA 4MPDA 1XU7A 5EE9A 4IGFA 1CBUA 3AF3A 4M21A 3OEYA 4HDRA 3A4IA 1J2RA 4UULA 2QLNA 2C9YA 4AWBA 4D41A 4ZYXA 1VKZA 4FWIB 5LP6C 3COYA 4PC3A 2IU4A 3GEEA 5FLKA 5DI9A 3CKYA 1T36A 4IIGA 3VNVA 4GGPA 1ADJA 2CFOA 3E61A 3OU2A 4H6WA 1XKQA 3AI1A 3H2JA 4BLVA 2ODEA 3ZD8A 4UOZA 2PK3A 1WP4A 2XZPA 1E2BA 2IE8A 4CKWA 3GT3A 2OFFA 3VVMA 4YJHB 4C07A 1KZ1A 1SD2A 1N2HA 3AEQB 3O90A 4MR8B 2RI1A 1E2QA 4NDZA 5EMHA 1GNVA 1PTKA 3RNLA 3WGGA 3KR1A 4A8HA 3T8YA 3M9LA 2AI1A 4X93A 5AOAA 2NO4A 2RGRA 3I6YA 2C0QA 4IW3B 2JLAA 1EA7A 4DUPA 4DF3A 1AMOA 1NBMA 4UZFA 3TQFA 3ZBQA 4A4DA 2D62A 3TE6A 1I3MA 2HRRA 1Z82A 7REQB 1GCIA 3VI4B 1SBCA 5KTOA 3Q0EA 4QPPA 3D6AA 5JAQA 5I8PA 1AO0A 4M83A 4Q3OA 4S1NA 1PR0A 4MLDA 4A2WA 2P8JA 1TYAE 5EYPA 4CCYA 2FQXA 3NEAA 4ON9A 1YZQA 3QYPA 4O2BF 4LGMA 4NZYA 3NRBA 5EJGA 3TKYA 1OAOA 3IE1A 1C30A 4UTXA 3WC4A 5DXFA 3NHKA 3DMPA 3COVA 3IIJA 4LNUB 4YBZA 4CETA 1TU3A 1WCWA 3AG6A 3O9MA 4BNMA 4MRMB 1BVUA 5K8UA 3M5WA 1KJZA 3HDHA 4BZZA 5MGNA 1EHCA 4GLBA 3C5HA 2XT9A 4HTFA 4QPDA 3ETEA 3HJBA 2XZOA 2G9UA 2BFBB 3PL1A 5CHEA 1SVUA 4NG5A 1IHOA 3PNLA 1YS7A 3RI3A 1MDFA 5KTNA 3MWJA 4BJ3A 3MCTA 3ORSA 2Q2OA 4K6KA 2I3AA 3N0RA 2ZIGA 2QTWB 3VMFA 1WUYA 2VT7A 1FVFA 1CEXA 1VL1A 1W6RA 2C61A 2WF9A 3DM9B 3P9PA 3VSCA 3WGKA 4B32A 3L7JA 2WIFA 1NP3A 1R2QA 1ADCA 3Q5DA 2DZDA 4JVLA 5JH7A 3JR3A 4JJ4A 1M2FA 1WV0A 3L8GA 1F1JA 1OLSB 5CNJA 3JARB 2BHNA 1J07A 3D81A 2YXBA 2J5RA 5J3JA 2P7HA 3LCJA 3DLHA 1J5XA 3AUYA 1YTUA 4ACBA 4F04A 2C9DA 3ZK8A 4AIRA 2P9ZA 1M7BA 4NU0A 4X66B 4KKXB 1UK8A 2CHEA 5JJIA 4UPDA 2FSGA 1P2UA 5EE0A 1WPGA 2Q45A 4IOLA 2PZ8A 3VPGA 4J8PA 1L7AA 2XAUA 1KFEB 3C6XA 2Q46A 1K3TA 2WU0A 1GA6A 4PZ0A 4QU5A 4J0DA 4PGAA 4JEIA 5K3EA 2QKYA 1HYHA 3MOGA 3TKAA 5A9SA 3UCEA 4BL5A 1H4SA 5AKHA 1RP7A 2RMKA 3AFNA 1EFAA 3L8ZA 2FMIA 5LDHA 2BGNA 1WEKA 4R7ZA 2YV4A 1VLLA 3DAYA 1DU4A 3R3YA 1SZPA 4FT4A 1PW5A 2OG2A 2NZYA 1N6HA 3DT9A 3CVWA 1M75A 3PRHA 1NFRA 5J47A 3ET4A 4ASUD 4CZ2A 4KSBA 1Z07A 1YJ8A 2CDCA 4FC7A 1J9GA 1D1QA 1YHNA 2G1UA 3E22A 3U40A 2CV2A 3UXHA 2HEGA 4BNXA 3RABA 1J0AA 3I6IA 2QG9A 4P7JA 3VOAA 1A82A 2AQIA 2P1DA 2FOIA 3OCYA 3H1GA 2J3LA 2WV9A 4TYYA 1Q95A 2PS3A 2REXB 2ZBDA 1FP4A 3KQWA 4X65B 5DIFA 2VXBA 1RYFA 4TTVA 1P9NA 2J3IA 1TUIA 3ZKWB 3GJ0A 1Y82A 1I2DA 1G0OA 3ETJA 1Z74A 2YOFA 3E18A 4BKQA 3RARA 1HDCA 1MRNA 2XMGA 4A26A 4MA4A 4O3MA 3JR7A 1Z5UA 2ADFA 2W2KB 4OQYA 4BU1A 3ASYA 1T8TA 2IODA 5DM70 2HLHA 5FYDA 2EJBA 1OYVA 3EWAA 4ND8A 4OHBA 3Q8MA 3U9SA 2HPVA 5J2TA 4CV3A 5EHIA 4ZI7F 1N2EA 1GAWA 1GZUA 2P11A 4B5KA 4N7MA 1DKUA 2A8YA 2XADA 3I5UA 2C2MA 3A0RB 1R4NB 2C2GA 1Z6QA 3FPKA 1ZJZA 5TPWA 5A0VA 5UKDA 3K7EA 4IUYA 4HH4A 4DDUA 3O94A 5JV5A 5CLLA 4QUBA 3ERCA 4LRYA 1QCZA 2WVHA 4Z9XA 3TMKA 1UBFA 5HDBB 3RC2A 3LW7A 3H9BA 2F67A 4BE4A 1HDYA 1TYEB 3WKDA 4N5DA 2ZBEA 2CCKA 2PKCA 4PANA 1MJNA 1Y9DA 1CCWA 2WR8A 4G4GA 4MDHA 4FKMA 3WA6A 4LFAB 2HU7A 4W6QA 5KZMB 1IJFA 1Z0JA 4JITA 3ZWKA 4RNCA 2VJLA 3RF6A 1C3JA 3FYUB 1OKKA 2F1KA 1Y1SA 2VRWA 3KQPA 2YVKA 1XJQA 1XL0A 2BFPA 4UFOA 4UU7A 5DCUA 5F73A 4RK7A 2H5IA 3H0CA 3SSAA 3V1YA 4U2EA 3LK6A 4BMDA 1NTOA 4LRTB 1HURA 3TVDA 4ALKA 2H4WA 1MAHA 5SYNA 3FZYA 2UUAB 3TTSA 5B6JA 2EEZA 5LDDC 1LI4A 3ECSA 4BC0A 2HPAA 1GITA 2PRYA 3S2ZA 3WDKA 5IZCA 1EUYA 3A3KA 1L5MA 4J4HA 4ARCA 1M73E 1NJSA 2P41A 5J1TB 4YRNA 1QG0A 2IYUA 2XYQA 3DGEC 2XDAA 1I6LA 2V7QD 3M9XA 4KRFA 1FS5A 4LE2A 1PZEA 2VDQB 5F7ZA 2OK8A 5IJAA 4F92B 1Z29A 3HWWA 3NO4A 4XE5A 3ORQA 1PL0A 3QUCA 4NFSA 1XNGA 3I53A 1WV1A 4Q1CA 4W99A 4YUVA 3NHFA 2Z5FA 4QJIA 4ZPJA 1QHNA 3E3NA 4CLEA 4XGNA 3FPFA 1HF3A 1E94E 2ORVA 4MV9A 3W5UA 2G3YA 5KNLA 3VKHA 3WX0A 3DKPA 1DO8A 1XRLA 5T3YA 1Y5IA 3X1DA 5F35A 1OA1A 3UUGA 1EX6A 5A4FS 2C2OA 2DGDA 1L1FA 3ODGA 1E6KA 4Y6GB 2JFOA 4NPCA 1UZLA 4DJFC 3JRWA 3TVTA 1IBKB 1RBQA 3IX7A 4P98A 4ABTA 4OQMA 4FE3A 1CIPA 3QJGA 2B92A 2O2EA 2FMHA 3GUCA 4KXVA 4U7TB 2WJ3A 1OXBB 2VP4A 3U09A 5IM4A 5THXA 1ZYUA 5EJ5A 3HKBA 1OH7A 4ZJYA 1MB2A 2PH3A 3HUDA 3NLLA 4IRXA 4FYPA 3LY8A 3RSQA 3UJAA 5J4LA 3O84A 4MYUA 3DB1A 3BAFA 1VKOA 3GAAA 4PG8A 3BXGA 3WP1B 1VHQA 3PI6A 3X2SA 2PBRA 3FXAA 1PFQA 3LT5A 4EEXA 1K8ZB 3A2KA 3GZTB 4WOBA 4PX9A 2FFHA 2GZ1A 5LQRA 1BWQA 2VHVA 1LSOA 3IVCA 4KR3A 4KKVA 1SEPA 5I4KA 5LZ5A 3EOZA 2DEUA 1XVUA 5DRYA 2CYBA 3C97A 3QV2A 4A03A 3QJ5A 2KMLA 5CLQA 4C7KA 1XDDA 4HYQA 4YP5A 5ICCA 2MYTA 1JP7A 2CLCX 1PNQA 3H7IA 1X1SA 3I9KA 4WA7A 2WSIA 5IBQA 1ZR2A 1A7AA 2HA3A 2ZB7A 4OGWA 4XIYA 3D7LA 1V6SA 1IZYA 2BFDB 4C6HA 1XRNA 2DHQA 3JY6A 3P2YA 1JZQA 3QI2A 5JFGA 1RRVA 3RAEC 3ST7A 1E96A 2AMLA 4Z7NB 2CCGA 3IAEA 4I1VA 4LJKA 3ZCSA 2EG9A 2R96A 2XNCA 1YJAA 4CM9A 5K0JA 1ORWA 1P4JA 2VF7A 1STOA 2XB8A 1MT3A 3PIRA 3RS8A 2ZATA 2VNIA 4CMIB 5CT6A 1RQNA 3OY2A 2FWPA 2GN9A 4B44A 4EHDA 1LDMA 1I10A 4D44A 3M1AA 4OGGA 1VPTA 2XUFA 5GPBA 2Q8QA 4B6QA 2X2OA 1DB3A 3DO6A 3KJIA 4PAOA 1EH5A 1O94D 1QIGA 2E21A 1VJ0A 3AKYA 3C5VA 4TTPA 4RSRA 1EFTA 1JJBA 1Z0DA 4IWYA 4JVOA 4B4UA 2P7IA 2X4LA 4KI0A 3VTAA 2HA0A 5EPEA 3E7FA 2XUZA 1ONOA 4IQGA 5IBCA 5FJIA 1P9WA 3B89A 2ZYSA 4OLHA 3ZTTA 3JQGB 3OE7D 3QPCA 3TXAA 2GCOA 1JH8A 4P9NA 4MYHA 2NTYC 3RYCA 4C78A 3WLOA 4CV2A 4GOMD 3OHPA 4LQCA 3WGTA 1C30B 4RZQA 2XD9A 3IFSA 3W8RA 4DG9A 1TAUA 2GZDA 1VDMA 2KYRA 2PMFA 2Q5FA 3FBTA 4GSKA 2NV2B 3VC3A 4JJGA 3UC9A 3FGZA 2LRHA 2PQ6A 5JD5A 2QVYX 4GX2A 1NBME 4V0ME 3FAKA 3ZJ4A 4UVGA 5AXCA 3TD9A 2VJCA 5YASA 2EAUA 1U0GA 2QD2A 3AJDA 5CVJA 3SLRA 1W5BA 4Q9AA 1L5YA 3CO0S 1O8BA 4Y2HA 3WRWA 3NT2A 1EBUA 4FFNA 1MXFA 1I1HA 1RKQA 1DBQA 2XEXA 3IPCA 1EZ4A 3TTUA 4KR0A 3V8NA 4CL8A 2QD3A 2WMNB 1ACLA 2PSDA 3B6ZA 2ZSEA 2CLKB 1VLHA 4F3YA 1U8AA 3U4HA 1TD1A 3FYTA 3H8WA 1TJ4A 3PDJA 4QRHA 4BCCA 1GQSA 5EEGA 5L9AA 2BI8A 3FPAA 4O3FA 3GLHA 4KOEC 4KHZA 1O96B 2YWJA 4J1NA 3NGXA 4CGZA 5IJ0B 2NIPA 3ZWQA 4LYDA 3K0AB 3OM0A 4KUGA 3RUAA 1DXYA 2HL6A 1C14A 3KD2A 3BTUA 3KTAB 4INZA 3R7DA 5EIOA 4AMBA 4JBNA 4QATA 5C5IA 3BULA 4GI5A 2BC9A 3HXQA 2BM1A 1BX1A 5CM9C 1P7CA 4ZV4A 3DO8A 3VAZA 4G86A 2X3YA 3H18A 4JBIA 2NLOA 3FNEA 4HFNA 3M3HA 4CF4A 1SUDA 3LLMA 5LLTA 2D3TA 2IDZA 3FN4A 3I5XA 3WLHA 2QD4A 2RC6A 1W6UA 1OA0A 3IP9A 1X7WA 1G41A 1QAMA 2FPPB 2JCBA 2JLCA 4P33A 5T4EA 5K4GA 2O2DA 5A3VA 4CMAA 4RTNA 5FTKA 5LYJF 4WBSA 2ZIXB 4PQYA 4EHLA 4UUPA 2HRZA 5G0TA 1DUVG 1L5HA 1Y1TA 2HOQA 5SZJA 2LDBA 1LGYA 4YCJA 2W6JD 2VNSA 1SHUX 2FY8A 4ZTBA 1VMAA 4NYJR 1OLXB 2OHJA 5BOSB 2HHAA 4X24A 2EYUA 5EA2A 1J0BA 4YFYA 2I2WA 5A9RA 3NRCA 1CDDA 2EKZA 1NPDA 1RPTA 3RVMA 1OLUB 2F8LA 3P9ZA 3LRXA 5FAXA 4HWOA 4C14A 2VAPA 3IAM1 3V46A 1VJRA 2APJA 3P0EA 4JI5B 3RSFA 1SPXA 5IXYA 3OTGA 3TSAA 3FD8A 2KBFA 3GDHA 2R68A 1E69A 3I64A 3L8YA 2IS1A 5JXWA 1TUGA 2GHTA 3GGSA 2WYUA 4TWJA 3EAQA 4DPKA 3WDMA 1WDWB 5CFRA 1EB9A 1BXZA 5DK4A 2NWQA 3AP2A 4B2PA 4YV2A 4CW7A 8OHMA 3OOYA 3A3YA 5KDOA 1Y3CE 3FOZA 2YHAA 1L7VC 2GNOA 3F3YA 1K6EA 2YJNA 4R4JA 3BFXA 4LCBA 5I5GA 3TLEA 1N33B 2V7XA 4BQEA 4O2BB 3QFCA 2ES4A 4K46A 1X6VA 4OSOA 1CY8A 2WMOB 5FR2A 3OQBA 1RQLA 1KU6A 2CEKA 2C1EA 1ODIA 3FZNA 3Q3VA 1EB8A 5D3ZA 3EIXA 1KO7A 2DRIA 3KJEA 4O2AF 1BXRA 4I5EA 4LJYA 4LVCA 3VGJA 5I5EA 1QK4A 1Z0UA 4QBTA 1QGUB 1ISPA 2HIMA 3C1UA 4X3OA 3WYGA 3ZCRA 1K0UA 3QHPA 1YS9A 1E5QA 4N18A 5KKCA 3AVVA 5CRIA 5E7JA 2O8DA 3C8DA 4DUZB 3IQWA 3E8MA 4F1JA 4UUQA 3HCCA 2ZWIA 2DH5A 1IOLA 1QKKA 2KI5A 2ST1A 3AZQA 3AUJB 3KHSA 5JNTA 2VQ6A 4MGYR 3NU1A 3NP7A 4H08A 4C7JA 3Q7RA 4EMBA 3GOHA 4O4LB 3F1LA 5C0OE 3EVDA 1G3UA 1D4OA 1AXEA 2FGJA 4ZAWA 3RRXA 5FH9A 5CU7A 2QX6A 4BEVA 2FDRA 3VC1A 4BECA 4QU9A 5ENZA 3WKBA 4BLPA 1TO6A 2N1BA 4WZAE 1CS0A 2AN4A 2OXEA 4HAIA 3CNNA 5HIJA 5F3WB 3OSZA 2XNHA 1TT7A 4KNWA 2ZQYA 1ZLYA 3P0HA 4YT4A 4MW1A 1QJCA 3V34A 3V2IA 3Q40A 3QBJA 3WHLA 2IS4A 4D99A 5C81A 4JZYA 4V1CI 1YV9A 2GZRA 4QPJC 1SK9A 2EW8A 4UPEA 2DB3A 4V02A 3L7CA 2XRZA 2PUTA 1ZOPA 5HBRA 1UDBA 1JAYA 3EDOA 5JH7B 1KOGA 1LLDA 3ZHVA 2QUBA 2FPUA 1DOHA 4MWTA 1C3EA 4FB4A 4G81A 4UXJA 3HZZA 1ZI8A 2Y1OA 4GGOA 4WI1A 1NL3A 4AB1A 4MAMA 2X6RA 2FW8A 3CUKA 4R1QA 5TMDA 2Q6IA 3TFQA 4X63A 3WWEA 5IHXA 2WVAA 4QGGA 1VJ5A 3MQ4A 4L78A 4BV2A 4XM2A 1E20A 3G9ZA 3PFBA 2W8BB 2AUNA 4RA6A 4B6EA 3JAMA 4DR4B 1TJPB 1JBEA 2OILA 1EUZA 2QXUA 1NF2A 2BMDA 1YOVA 5BV0A 3CZPA 3BD7A 1Q7RA 1QH8A 1RHUA 2B69A 3E0QA 3JATB 3O4VA 4YBRA 4UASA 2B78A 4HO1X 4J7UA 1DXQA 3TLMA 3V33A 1WZUA 1DDOA 2HA4A 1D0IA 2WUWE 1KYZA 1RTKA 4KUHA 4BQSA 2UAGA 3DMYA 3GLRA 2C0PA 2Q1TA 4AD8A 1SWWA 1Q91A 4LBYA 2PSJA 1I7DA 2OD2A 4CTMA 2R5NA 1RRPA 1U6KA 1VKHA 4JC8A 3SYTA 3AX6A 3JAKB 4IR7A 3B52X 4ZI2A 5JOQA 4GO1A 1ZONA 3HGMA 1JSZA 3MTBA 1D4ZA 3NDIA 4A8JC 4NQZA 1L7NA 3IUMA 3PXGA 2XYGA 1IN7A 4YXWA 4M9QA 1RMTA 3GQBB 4WEQA 4TS3A 4CIVA 2JFFA 4RV9A 1W5EA 2Q3EA 1GCGA 3BH0A 4UU0A 1TEVA 3VR4H 4P4TA 1VZ3A 3OPYA 2AMJA 3ZCVA 3HKEB 4N01A 3M6MD 1KOFA 2O0KA 4L6IA 4AJKA 4B0PA 4ZJUA 5A9TA 2O0JA 4Z7QB 1V1MB 3EPJA 3FX2A 4JROA 4OIFA 3M9WA 4KDRA 4M1EA 3DMNA 4JXZA 2RB4A 4DQXA 1VRCA 4JJZA 3REOA 1THTA 4BXOA 4HS4A 5JUWA 4ZN6A 2XCOA 3KU1A 1HYEA 1BIFA 1H0RA 2Z04A 3JYHA 3LH5A 1R5JA 4ZOLA 2H1OA 1SBZA 3DFIA 2P0EA 3EUAA 2O0HA 3NCHA 1DP4A 4DNOA 3T3PB 4CLOA 2HNBA 1WHTB 2P27A 1BGXT 2O05A 3OPVA 2P6UA 2VPWA 4BJ1A 3MXTA 4UHBA 3RSLA 1NW9B 1QBKC 3EHDA 1HZJA 3CRVA 4EO4A 1IVYA 3D5EA 4WBXC 2FH5B 2K87A 3OJEA 4NPHA 1YA6A 1DEHA 3DTTA 4OGLA 3YASA 4II2A 4I1OA 3ITKA 4AZ0B 4URXR 2GYYA 4A3SA 4H4CA 5G0SA 3P32A 1PYGA 2A88A 1KMMA 2I33A 3QX9A 1CD5A 2J5XA 3KFLA 4PSUA 3CG4A 1QX3A 3Q3CA 3CF6R 4PLTA 4YJFA 3CLUD 1ZM2A 4DJEC 3A36A 3T5CA 5CCBA 5E1MA 3C6MA 2QL6A 3E81A 4KMMA 1UPTA 3F74A 3UT6A 3JZFA 1NURA 1VMIA 2BY4A 2MU1A 4HAWA 2REOA 1QFSA 3C1TA 1E66A 3GFSA 3PC8C 5DBGA 3QSYA 4G56A 4O33A 4ZYVA 2Q5OA 3FUXA 4WINA 1KKMA 3IUPA 4F91B 3TTWA 1RQ7A 1A9YA 4MQ6A 3DV0A 1X42A 4ZV9A 2CLMB 5BWBA 5FNZA 2H2DA 1V1RB 4BMVA 2VSYA 4I08A 1CJCA 3SBEA 2YFHA 5DN9A 1I94B 2RI6A 4D4LA 1E6CA 1NR5A 3IEMA 2C1XA 2P2DA 4N8EA 2WB4A 4XW2A 3EC7A 4W5HA 1O08A 1N78A 3EGIA 2ID9A 1GQOA 4A8JA 4BP9A 2XMDA 2WUEA 2JBHA 5FT9A 4EPRA 5BR8B 1IPHA 1FLVA 2GN2A 3A9UA 4OL0A 2VTDA 1FIUA 3HCRA 1L5ZA 1QGZA 2FKAA 2QX8A 4L27A 4YGYA 3FBGA 4QREA 5CVUA 2EJVA 3EPRA 3GL9A 4V0MA 1CUFA 4D43A 1O6GA 5B1IA 2Z4TA 2C95A 3PR2B 3NORA 2AOXA 4LOKA 1G7CA 4J0EA 5A2GA 1U2SA 1G2IA 3VZCA 4CQMA 1IM5A 4PGMA 1KEKA 1IG0A 4RS4A 3PEUA 2QLMA 5HQ3B 1CERA 4GYKA 4NG4A 3ZG6A 2I6FA 1QYRA 5KYUB 3KYDA 4ZTUB 3P5BA 1VYUA 4K05A 3WQBA 4RULA 2C82A 4KP7A 2F1OA 4TSKA 4PTLA 5FOTA 3R3VA 4J07A 3T94A 5FBZA 4KB5A 2ZTLA 1IOWA 3AQIA 4AMGA 4IXNA 1NLFA 5L7TA 1ESZA 1EFPB 4JU8A 4C7OB 2J33A 2RIRA 5DFAA 2VPXA 4MLZA 1JB9A 3LPMA 3OT5A 3VDMA 4JR2A 1TPZA 4NATA 1TLTA 5HCNA 4JI7B 5FFMA 5FWYA 5F9FA 3SDBA 1AS3A 3K2BA 5CDHA 1BHO1 5GM2A 3CN7A 3GFGA 2PA3A 4QTTB 2DTDA 1OBFO 3G8YA 1VKRA 2FJ0A 2H1VA 1KDPA 4MJLA 3VTZA 2NYUA 3SEQA 5AW8A 2HDOA 4RNDB 2PH7A 1QYVA 4IXTA 3TVYA 4OTZA 1JMKC 2CZQA 4H7EA 5ILGA 3DMHA 2XCSB 1E9EA 2D06A 5D85A 3AVXA 2UUOA 4WKCA 3CF4G 2O23A 4LMBA 3D3JA 4BO8A 5ALZA 4TLBA 1WJGA 4GWLA 4JDPA 3IEUA 5IC5A 1Y4SA 3VA7A 2AOTB 3FHCB 5E9QA 3LKDA 5BMOA 4PFSA 3PC8A 4ZCLA 1K7SN 1W0KD 4B73A 1I7PA 5JSQA 3FPGA 2PGIA 4ALNA 2Z2YA 3GU3A 5JCZA 3G9QA 1JQAA 3ZLTA 3GLSA 2OORA 1TF2A 3QEKA 2YHSA 2PUDA 1B93A 2IOYA 3I5YA 5D84A 1EUDB 3JCZA 1W36C 4RQBA 4A6PA 2CXHA 2O7SA 4NCJA 1YB2A 2O8NA 3AI2A 1N9GB 2Y0DA 2I5PO 1OUMA 1L5FA 3ODPA 4R0NA 3PA8A 3IT0A 5JQWA 4MAAA 4ENPA 3WV4A 5JADA 5JZVA 4EA8A 3MMSA 3FH0A 3E9DA 4DMCA 2IKSA 3CW2A 3GUHA 1PQUA 3E0XA 4U4AA 1RHJA 2OGSA 2HBYA 5MFZA 4Q01A 4KSCA 1HYBA 2VQSA 1T0PA 3K6SB 1L6IA 1TO1E 2W2OA 2ZUBA 2ACKA 3GFBA 5LIRA 1NI4B 1YE3A 3L0YA 4EHAA 1WY5A 4KRXA 5LNK1 1VTKA 3OM9A 4Z54A 3LUHA 4FJ1A 3NTOA 1MJGM 1PR1A 2CJXA 2C9OA 2D1YA 2GJ4A 4KQ1A 4XWKA 4DMFA 1EXDA 1LCIA 1XXHA 1FDSA 3B7PA 3SM9A 1D7AA 1OXUA 2EFYA 4JUBA 1UAYA 4KU4A 3L0ZA 3PT5A 5G41A 4LE0A 4XJVA 1E8MA 2RHGB 5FX2A 3LKVA 4REQB 4ATNA 1Y5RA 2UYOA 2WZCA 4P3PA 1N0WA 1L8LA 2XR1A 2C3YA 2NP7A 1O4WA 3I4FA 3CNQS 1YONA 1M72A 3R6DA 2IUEA 2HF9A 4IRMA 1N5LA 4MRMA 4S12A 5GAJA 1V26A 1SUSA 3JVVA 3KSDO 2FR1A 4ID3A 3NHPA 3TPFA 4B17A 2O9JA 4JY7A 4D3FA 4BFYA 2CVHA 3O7WA 3U1TA 2ZVDA 4O25A 2QRPA 4M37A 4A2CA 2ZE5A 1FVXA 2A1TR 1DIHA 2JLBA 3AR4A 3LF1A 3GMDA 3OZAA 3PFGA 4RIGA 4C7XA 4YRMA 3S44A 5IN5A 2O54A 5JJKA 4LHWA 4RF5A 5CEJA 1G1MA 1GEGA 3QPVA 3HP4A 3U44B 3N8KA 3WGVA 1G5RA 1PT9A 2R79A 4EB8A 5KVVA 5P21A 4QUKA 4IH1A 2KHZA 4G25A 3LQ1A 4I55F 3QHAA 2EW2A 4FGLA 3FOBA 2ZUWA 4PLVA 1U28A 5T4FA 3THOA 1DAPA 4ND5A 3JQ9C 4I50A 1QONA 2VPQA 3IOYA 5JATA 1KK2A 1UPUA 5LQSA 5HKOA 5ENDA 3D5QA 5HNKA 1QHIA 4ZWNA 3ZLBA 3PDUA 3A6KA 2BDTA 2OORC 4FONA 1J8QA 4CDNA 2VT2A 2DOKA 4NMXB 5IDYA 1Z4JA 4D0SA 4Y1RB 1D4AA 2YV1A 3QG1A 2DFKB 1OHHD 4FD2A 4FCCA 2R85A 1BZYA 3PHGA 4L7VA 4URUR 2J30A 4A8JB 4BX9A 1JFFA 4HUQB 4E0BA 4V3CA 1YB5A 4O4IF 1I6KA 1A8SA 3ZZMA 3VJMA 3OQOA 2OG1A 3G7NA 4DLPA 1G59A 4Z9YA 2IEIA 1U3FA 3SCZA 5FNVB 4PPGA 4A9AA 3BXOA 4MSUA 4RGVA 1AK2A 5A4IS 1ZHOA 1K8XB 1YC5A 3VR6A 1F9EA 5C8VA 2XQGA 1AUQA 5SICE 1UEJA 2CD7A 1OI4A 4TWIA 1GNQA 3WLLA 4U7DA 1J22A 1P2SA 3GLIE 1J7KA 5JS1A 4UQLA 5AH0A 4OQ4A 1U2GC 1JXMA 1ZM9A 2GCGA 4QQ8A 1Y8QB 4FOTA 2GA9A 4CTKA 1HT0A 3H3FA 4HN4B 4LZOA 5KQGA 4D8XA 4E30A 2ZJ8A 4RTQA 4JYCA 2A4MA 4BZQA 1XIVA 4YAGA 3RH0A 1UJBA 2AMYA 3NOVA 3HVRA 2CKDA 4WK2B 2PPLA 2IGBA 1EFVB 1TUBB 2E37A 3DTVD 4CM8A 1M1XB 1TLFA 4GZ6A 4O1HA 1RAFA 4MWEA 3UMGA 5K0BA 2JIOA 1AZTA 3R3UA 2BEKA 4EVIA 1OT3A 3B1XA 1PNRA 3I83A 3GLQA 2VPIA 3AI3A 3LC1O 1Z38A 2GHIA 3COWA 4MYCA 1NX6A 2AHOA 4O4JB 5FADA 5IAJA 3UG7A 5HXAA 1VE5A 4PO1A 1A77A 1SVKA 1X7WB 2FPPA 1TC1A 2E4AA 5L3VA 3MCVA 5BSWA 1WB9A 1HX7A 3GVPA 3KQMA 4YGXB 4W9NC 3WGYA 3WOVA 4MLCA 4DA6A 4KW7A 5ALXA 2PNJA 4F56A 2XV1A 3BZWA 3U62A 3ZWBA 1P0PA 3WK6A 4LCJA 221PA 2QD5A 3EB9A 2JKVA 4BPBA 1WHTA 1ZG3A 2A3RA 2VF4X 2PMDA 5LXTA 3R9IA 4K86A 4NU8X 1Y4UA 4HEQA 1G8HA 1W30A 4H7HA 4CR7A 1LSJA 5AVSA 3JPWA 4DC0A 1ZQ9A 3CSDA 1Z62A 2Y0PA 1XO1A 3RC1A 1UMDA 3P9SA 2ZDHA 4HCJA 2AN3A 4PPYA 1L7QA 3N6RA 3HN6A 5IFKA 5KQRA 3CVUA 4Z4EA 2IY9A 5EP1A 5K6AA 1H65A 1JSXA 1XF1A 4JQCA 5HOQA 2ZROA 3HDJA 4O4HA 1T4CA 3JQ9A 2FW7A 1BMDA 3WI7A 2H59A 3FSGA 1RJWA 4JIMA 5KI6A 2V6JA 1PJ3A 2QW0X 1N0IA 2Y4NA 1IDN1 1J4AA 2PMKA 4Y2RA 1Z37A 1JPVA 4C0SA 2CW5A 3ITEA 3R20A 4L5YA 5JSZB 1VPLA 1WVGA 5DYWA 5F9HA 4TKUB 3EZXA 3GLTA 3BB4A 1P39A 2V55B 2ZRPA 3MOIA 1HR0B 2H65A 3RUDA 2X0EA 1CG6A 4IILA 1AQYA 1XK6A 4MI3A 1CR2A 3HY4A 4R40A 1KHHA 4X7RA 4HDKB 2JAHA 1GUBA 3QE2A 1VB5A 1T5HX 1GZ6A 1O95C 2WHRA 3IAS1 3NETA 4PXYA 3GLIA 2C07A 3C4JA 3NUQA 4W4TA 2R8PA 2HA5A 1B0ZA 1D8AA 2WWXA 3TAXA 3ZDZB 2JGDA 2E4VA 3AIIA 3SVLA 3N2KA 2DLCX 3NDBB 4IH9A 1B8PA 4DMUB 2VQ3A 1U2GA 1XVAA 3M4NA 1TEZA 1H0HA 3EFHA 2FW6A 1WBJB 4RD1A 2VSOA 2GEBA 3BCUA 1IHDA 1XCGB 3ZV5A 1PFWA 1H2XA 3GMTA 1K4KA 4HDNA 4YP0A 1S2NA 1ZD3A 4C4OA 1CIJA 2OEPA 2IYSA 5ALLA 4EVQA 3QVWA 1WF6A 3NB0A 1N5OX 2EGHA 4FLFA 5D00A 3QU4A 2EKPA 1TCAA 2GEUA 2Z2JA 3L7NA 3CNHA 3ZU2A 4Q9HA 2PT6A 1E61A 4WZZA 5DBOA 4EEZA 1V2HE 2IRWA 3F