1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
molecule keywords Adenylyltransferase thiF
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
5B4VA 4I08A 5JDIA 3KXDA 3FSRA 4GQAA 1NVGA 2CVOA 4KQWA 5T8KC 3ASVA 1ZK4A 1NQOA 4WK6A 3O4RA 3ZWVA 4NIMA 2NQ8A 4AG3A 2RHCA 2J5KA 3LYLA 3JQEA 1H0KA 4EJ0A 2PFGA 4BKQA 2GO1A 3KLPX 3VDRA 1I3NA 1MV8A 1C14A 4I9HA 1PZEA 3OJFA 2G1UA 2OBYA 3JV7A 3HSKA 1EMDA 4UVDA 4JP2A 1Z7BA 2EERA 5U9CA 4OGWA 4WUVA 2OFPA 4CM9A 4XWYA 1K0UA 4PGFA 4LCJA 1MFPA 1P44A 1KBZA 4Z0TA 5K6AA 3NKLA 4JNKA 3KSDO 3EDMA 1BSVA 4W9NA 3GMDA 2X6TA 3DHYA 4LN1A 5T67A 3ICCA 4DXHA 5IZCC 2SCUA 2Q1SA 2FPGA 3DTTA 3GGPA 3M2PA 4P38A 2EIHA 1LQTA 4HBGA 4NBTA 3M2TA 4JBHA 1NPDA 4OJNA 1EDZA 4E13A 1XIVA 4Y9DA 5JCJA 1KEVA 3O26A 3QY9A 5ER9A 3FR7A 5KVVA 4U0JA 4L0QA 4IGEA 1I36A 4OSPA 3GOHA 3T4EA 1R4NA 1T24A 2J3HA 2PTGA 1U3VA 1DRVA 4XX0A 4YQZA 2VYVD 2YQ5A 5DF1A 4D41A 5J23A 1KC1A 3I5MA 3FI9A 3G17A 1EUDA 5KIAA 1GDHA 1AUPA 1KOLA 3ST7A 3ZDFA 2PGLA 3SLGA 3MWDB 2QX7A 3ETDA 2OZPA 3FN4A 1GZ6A 1MG0A 3GF4A 4H15A 1E3EA 3QVWA 4XB2A 3QA9A 2JFFA 4B4WA 4CR6A 4DPKA 4FIZA 4I9UA 1X14A 4YXFA 2W2KA 1YO6A 4WOKA 1LRLA 5EPOA 1P9LA 1GV1A 1T25A 1UR5A 4YRBA 2I67A 4E33A 4DL9A 3JQ8B 2DT5A 3JYPA 3PVZA 2I99A 3CIFA 4N5LA 3ONDA 4Q9NA 3H5NA 4ZRMA 2ZCVA 1GUZA 1ADGA 4H7PA 4ALMA 5EJ2A 1NP3A 1ONPA 2C07A 2NLOA 4XA8A 2E48A 4Z9XA 2WMDA 3BYZA 3L4BA 2V6BA 2Q1WA 4TRRA 5F3RA 4EJMA 1BGVA 3BMQA 4XYGA 1T26A 3DBVO 4LISA 3UF0A 4RL6A 1KVTA 1HLPA 2AQKA 1PQUA 2QIOA 4PG4A 1ZJYA 5FF9A 4DQVA 4OYRA 1KYQA 5JBIA 2EP5A 4QUKA 3EK2A 4C7KA 5A9SB 1DHRA 2WJPA 1EK5A 1R15A 4NJMA 6LDHA 2ZTUA 2NU7A 4IUYA 4YAGA 2XXJA 4AJLA 5JMWA 1E6WA 1LSUA 3FCOA 3IMFA 2H6EA 2P5YA 1A4IA 4ILKA 5I9NA 3WOHA 4DQXA 3ZU5A 5ITWA 4H16A 4BO0A 1DIGA 3ZV6A 3GPIA 2BI7A 3KTDA 4ZVVA 1BMDA 1N7GA 4NU5A 2WYVA 3MJCA 3RBXA 2HJRA 1KVQA 1Z7EA 4OKNA 1YBMA 5L40A 5JS6A 4QFDA 2HMVA 4RVSA 5G4KB 2ZTLA 3AFMA 2BGLA 3NV9A 3U62A 3K2EA 1ORRA 3PXXA 1YDEA 4CM1A 5IXSA 1M76A 4UULA 3B1KA 3JYNA 1YS4A 4NPCA 5GZ6A 4BMVA 1JVBA 2EEZA 3V5NA 3ON5A 5THKA 4BKPA 4BNWA 1DIRA 4WEOA 3U49A 1B7GO 1Q7BA 4YDRA 2Y05A 4M86A 1GADO 3WTCA 1PL7A 2Q50A 5KJ1A 1GR0A 1VKNA 2EKLA 1RM3A 3MWEB 4MKXA 4II2A 4ZA2A 5TJ9A 1DOHA 3I9NA 5JDCA 4BNKA 5L3ZA 3AUUA 2BI8A 3MOGA 4IM7A 4GGOA 5JY1A 2HK8A 1QMGA 2IZZA 3WG9A 1T1SA 4XYLA 1PJ3A 4MVJF 3BTSA 2VWHA 5F1OA 1VKOA 4Q39A 2DQ4A 2IZ0A 1PJTA 1CJCA 3BZUA 1F12A 1WMAA 4L76A 4AJNA 4WCDA 5JMPA 3TNLA 1Q0QA 1PJQA 3WWZA 1EK6A 3FNFA 1EZ4A 1LBEA 1ZEMA 3VPSA 4FC6A 4QQRA 3RUCA 5I9LA 2B5VA 1R0LA 3VVBA 3D4OA 2WTBA 3HDJA 5GMOA 1ISMA 3LT4A 3Q9UA 1DO8A 3M6IA 1CRWG 2P2SA 2X0JA 3WJ7A 1B15A 1UXHA 5CEFA 4ALJA 1E6UA 3AW9A 2GN8A 5ILGA 4N18A 2Q1UA 3B1JA 1TT5B 5C7IO 1G0NA 4YVFA 1T2FA 3W6ZA 2VYVA 1UXGA 1C3VA 4HY3A 4PLTA 2BGKA 5IDYA 3UKOA 2J8ZA 1ISHA 3GEDA 4K6CA 2J3IA 3GZNB 3H3FA 4MKRA 3CXRA 4MP6A 1C1DB 4YAJA 5JPIA 5FEUA 4MVJI 2A92A 2BGMA 3LT1A 3RD5A 4M8SA 1OBFO 2AEJA 1TXGA 2IYPA 4A27A 1F8GA 1LQUA 2YHIA 2ZB7A 2X0NA 3AI2A 2ZQZA 3WX0A 2EV9A 2VNSA 3DTYA 4R69A 4HKTA 4KWIA 4TZKA 4CM7A 3GUCA 4BNTA 2O4UX 3KLMX 1JKJA 3GDOA 5I9MA 1AXEA 3BAZA 5BT9A 4CLHA 4FGSA 3DHEA 4Z6KA 3KSZO 3ZWNA 4DGSA 2G82A 2E49A 1A4UA 1SAYA 2WD8A 2ZYDA 1N7HA 4GGPA 4PLYA 4Z3DA 2B4TO 4A26A 4BQPA 1N5DA 3SBOA 3ENKA 1SOWA 2ET6A 2HJSA 4NBRA 2JCVA 3IJRA 1T2CA 3DQPA 2JD2A 3ZI0A 3PEFA 3K6JA 1LTHR 4KWHA 4F6LA 3KYCB 3H7AA 4PLZA 4TWRA 3W4JA 1XU7A 4BB6A 3B70A 4FW8A 4NNJA 3RSHA 1CYDA 3JQBA 3ORFA 4BO3A 3RUEA 4RQUA 4CLRA 1KVUA 3ZW9A 2GPTA 3N7UA 3ZHZA 4LMRA 4YJGB 3VPHA 1O89A 3QWAA 4R1TA 4XCVA 3H8VA 4Q3BA 1PWXA 1OAAA 4A7PA 3WXBA 5KJFA 4YYZA 1UP6A 2FWMX 3JQFA 4ND2A 3FF4A 4MVJG 5FFFA 1WW8A 4BB5A 3CUKA 2J6IA 3LK7A 2HSDA 4R1SA 4IDFA 4UREA 3WGOA 5TT1A 1LUAA 2EWMA 2H9IA 3CZMA 1QG6A 3RFVA 1PWZA 4CUJA 1D7OA 4LMPA 1XLTA 4KUGA 1VSVA 1ID1A 5ENVA 3AU8A 3TZHA 1PTJA 4M87A 4PLWA 5TX7A 2IYOA 3PDJA 5A04A 3MCVA 4XQEA 4KUHA 3F46A 3F4LA 2YHUA 5AXDA 3W8FA 3GVXA 1PGNA 1ISJA 3PIDA 3PQEA 3HNPA 1RYDA 1LJ8A 2PD4A 5AYVA 3NTQA 1Z73A 4JGBA 3OETA 1Z6ZA 3HFSA 1A72A 1XQ1A 2E6UX 2GLXA 3IJPA 5LC1A 3RUIA 4BIIA 4BNIA 1LRJA 1YWGO 4B3IA 2O50A 2V7PA 4R54A 1P1FA 5GZ1A 4K1LA 1UZNA 3A14A 1QP8A 3EUWA 2D59A 3GPDG 5HS4A 2QZZA 4YRDA 4FPXA 2EG9A 3ITDA 5DN9A 3GHHA 2BRUA 4IDDA 2V65A 1JQBA 4GX5A 5ADHA 1DAPA 3RKUA 2B35A 2YV1A 4GMGA 2EJVA 3TDKA 4J7CA 4UEKA 5G0UA 4DPLA 1ADFA 2GZ2A 1NVTA 1P1RA 5A4DA 1VJTA 1YGYA 3JD1A 3MJVA 2Y93A 3BMNB 3PGXA 3SC6A 2NM0A 4CM8B 1QLJA 1IULA 1GQYA 1R4MB 4QX6A 4WLNA 3DMTA 3O8QB 4M49A 3ZCXA 3OEWA 2BF7A 4Y6SA 5IFLA 2GDZA 3OJ0A 1B2LA 3WNVA 4NBUA 1HDRA 5KJ6A 1I24A 3KO8A 1EUZA 4LK3A 3Q2IA 1ZKMA 1UZLA 4XGNA 3FD8A 4RCVA 3I9OA 1WWKA 4BO4A 1ZSNA 1ISFA 2FN7A 2O3SA 1ZK2A 3FBGA 3INRA 2PZMA 3S2EA 4B7CA 4PLCA 4D43A 3C24A 3I52A 4GBJA 4E31A 4ALLA 3BTVA 1PL8A 1FXSA 3UGKA 1Q0HA 2Y1EA 2PZKA 3I3OA 5C7OO 3INGA 4F46A 1D4FA 1VLLA 2DFVA 5CEEA 4AJJA 2NVBA 2X5KO 4NFSA 1XR3A 4B7UA 5KJEA 3CTMA 3H6KA 4FS3A 5U1PA 3RASA 4WECA 4P4NA 1EEHA 4BMSA 1XGKA 3QWHA 2QRKA 4RLSA 3PZBA 3ONFA 4DA9A 4YEDA 1QXSA 3OBBA 4AL4A 2O7SA 3ENNA 4JXKA 2X0RA 1Y5RA 1PQPA 1YH3A 3GK3A 2DLDA 3HJAA 1TB4A 4BL5A 4FB5A 4YT2A 1D1SA 5THQA 2C54A 3WFJA 2UV8A 3U3XA 4WJZA 4CMIB 4IZHA 4E2ZA 4OIMA 3BMCB 4FFLA 2DPHA 3UUWA 1HL3A 3UW3A 3ZV5A 1NASA 5DCYA 2DFDA 4CMKA 4YR9A 1PGQA 4Z9FA 1EBFA 4URFA 2TMGA 2VOEA 2DAPA 2UUPA 5FI5A 1HLDA 2B4QA 4FOSA 1NHGA 3G0OA 1O95A 1Z75A 4BGEA 1HYGA 4RDIA 4INAA 4CUZA 3L4SO 3HUDA 3WQQA 1Q1NA 5LDGA 5MDHA 3UVEA 3W4KA 1QV6A 3E48A 1XU9A 2Y0DA 1TVEA 4CV1A 1E3WA 1Y5MA 2G17A 2B36A 3GC6A 1UXIA 5L9AA 2OL4A 1GQ2A 3JYOA 2CY0A 4J0FA 1JWAB 2CVQA 4FJ1A 5KTKA 4ZQEA 3S55A 4JJFA 4MJLA 2I76A 4ND3A 4UEJA 1GEEA 4CM9D 1F14A 5K0ZA 2CZCA 1NWHA 2HK7A 3KYBA 5EMHA 2H1SA 4EBFA 4K26A 1ZO8A 2NTNA 4GSLA 2AE1A 2C2XA 4J49A 4D0SA 3CSDA 5JNLA 1VC2A 1YJ8A 3CE6A 4CL3A 2YQ4A 3NGXA 3ZWBA 2WD7A 2NUAA 2WWRA 5DOZA 5TJHA 3F1LA 4CV2A 1T1RA 3U0BA 2BFAA 3I4CA 4ZQBA 3IUPA 3PHIA 5JCJD 4J4BA 1E3LA 3AFNA 1M75A 1LLUA 1JU9A 5EIOA 1CEQA 2O48X 4BO1A 4PZEA 4ID9A 4JBGA 4L73A 2FZWA 4N5MA 4O1MA 2BFPA 3WWYA 4BO9A 1U4OA 3KOUA 5GY7A 3VPGA 1NFQA 5COBA 1NBOA 3HG7A 5BSFA 3ZGYA 1U7TA 1DHTA 5H83A 4OOEA 2ZK7A 1LC0A 4RDHA 2FPPA 2WDZA 5T8KA 2AG5A 1G0OA 2LDBA 3ZWWA 4FFOA 4NG5A 4WCFB 5L7YA 3KVOA 4J90A 1FF9A 2GUGA 1PJ2A 1ZVMA 1MLDA 4NR0A 3DDNA 3I4FA 2AQIA 4AJ2A 3B6ZA 1MB4A 4B3JA 5CAEA 3QRWA 1LNQA 3L6DA 4RVUA 2ZYGA 1CDOA 1K3TA 5B1YA 1T2AA 3VZRA 4MP3A 1Y1PA 3GVCA 4PLVA 3TPCA 3GFGA 1WAMA 4J16A 3PQFA 1Y9EA 3GQVA 3LU1A 2NWQA 5IG2A 3GFBA 3KHUA 2OXIA 3DZFA 5A1TA 4Y8VA 1UDBA 2FR8A 4PG5A 2FHSA 4C7JA 4KTTE 2A94A 5FYDA 3V2GA 1PR3A 5DBIA 4CODB 5IZCA 2FR1A 3QQPA 3I23A 1LSOA 4P4GA 5JXWA 4Q3EA 1FDSA 4CLOB 1H5QA 2ZYAA 1BXKA 3STHA 1B26A 3VOSA 1O0SA 1R37A 1ZBQA 2WE8A 2VYND 3AK4A 3TOZA 5HTOA 4HFRA 1DFHA 3BA1A 4E2XA 4ZRNA 3GVPA 4GH5A 4ZQHA 1U7HA 4W99A 3HQ4O 4PLFA 3MJTA 5BNFA 3OECA 4BNVA 3C1OA 4LRTB 5EQFA 3NJ8A 5F5NA 4HNGA 3DBRB 4FQ8A 5BSEA 4BNMA 1PS8A 5AOVA 2CFCA 3F47A 5AXBA 3WYBA 3W1VA 2IDZA 4A10A 1A7KA 4D0RA 3JQ7A 4XD2A 2QYSA 3WGYA 1QYDA 4K28A 4QXMA 1R16A 2FPIA 5ER6A 3TL3A 5TSDA 2ZQYA 3OIFA 3E18A 3OMLA 1E7WA 1EDOA 1OC4A 1H6BA 4XYEA 4YJFB 4CV3A 3PQDA 1E6EA 2JL1A 2Y0EA 4BNJA 4BNGA 3KSUA 2VT3A 2OO5A 3U4IA 4CQLB 4MINA 1JA9A 1NR7A 1VRWA 2PK3A 3AWDA 4LW8A 4CM5A 4S3MA 1DSSG 1ARZA 3VZSA 4E32A 3P2OA 2EJWA 3WQRA 1XDWA 3D3WB 3EMKA 4DIFA 1GFSA 4NK5A 2R00C 3TN7A 4BOYA 2ZKLA 2GD1O 2VZ9A 4D3SA 2JAHA 2W90A 1BW9A 1K89A 2XXBA 1UP4A 1UDCA 4CLEA 2EKQA 1AXGA 1JKIA 4RF5A 4UUOA 5C37A 2JCXA 2HMUA 4XQGA 3Q6IA 4YAEA 3AJRA 1FDWA 4IDGA 1T4DA 1RJWA 3AI3A 1B16A 2HO5A 1YXMA 1F06A 1YL6A 4R9SA 4RZIA 1BXGA 1LX6A 2VHYA 4UUNA 1BDBA 1QKIA 1N1GA 4RGBA 3OFSA 1LDBA 2VCYA 1PGOA 1E1NA 5CP8A 5JC1A 4XYMA 4UAGA 4IQ8A 4E5NA 2XAAA 4J91A 5AXCA 3JQAB 1HE3A 3GUYA 2AA3A 3WGQA 3WR5A 3AI1A 3FPCA 1E1KA 1XHLA 1YVEI 2Y1DA 5B37A 2PH5A 1EQ2A 1HWYA 3E6AA 3R1IA 1OI7A 4L4RA 1DC6A 2NTVA 1PS0A 1VL8A 4R9RA 4YTEA 1IHXA 3PFFA 3WLEA 2QW8A 3ZNPA 4BNYA 1ZUD1 4IIUA 1P1JA 3GEGA 4RF4A 3UCEA 3RWBA 1JAYA 1GCUA 2Q4EA 3WBBA 4YRAA 1QYCA 4B7XA 1A71A 1HTBA 3IOYA 2VQ3A 5L4NA 5DBFA 4QFCA 4I9NA 2CDAA 3QV1A 4PFJA 3ROPA 4LGVA 1ULUA 1IOLA 1RWBA 3WS7A 3WTBA 3ZHBA 1EUCA 3BHJA 4MVJH 3PHGA 4Q3DA 1NAIA 4ZHSA 4D3FA 3DZKA 1NQAO 3LLVA 1M6HA 1PJ4A 3IP3A 1C0PA 1DRUA 1E7YA 1LU9A 1XKQA 3BMOA 4OHUA 2NU6A 3PYLA 4NMHA 5HA5A 4FN4A 2YW9A 3GZ4A 3P7MA 3WSVA 5I7FA 3SVTA 1P0CA 2B0JA 1BG6A 3HZZA 5JLAA 3NJ4A 5TIIA 4BNNA 1I33A 2VTEA 4WLEA 2F00A 3WGZA 1V3VA 4MP8A 4R41A 5DT9A 1Q0LA 3ZWOA 3Q1LA 4R01A 1E7SA 1HE5A 3GDFA 4AJIA 2P9EA 1OOEA 1SNYA 1X1EA 4GX2A 4CMBA 1I10A 1PEDA 2NNLD 2WM3A 3VTZA 2VRCA 4JK3A 2JHGA 4CM4A 1PL6A 3PRJA 3G49A 4GVLA 1XG5A 4BMNA 2VYNA 4DREA 2Y67A 1BXZA 1X0VA 1VJ1A 2BMAA 2I3GA 4GKBA 1YE3A 1YDWA 3DC2A 2V6MA 5F5LA 4W4TA 1JKFA 1HZJA 4CLXA 2Y1FA 2Y1GA 1WDKA 2FY8A 2CD9A 1XWFA 1W4ZA 3KZVA 1I2CA 4HUJA 4WE3A 4JIGA 4RV9A 2O7QA 4JLWA 2NTJA 5EQDA 1ML3A 4PG6A 1B8UA 1LDGA 4NZ9A 2NSDA 3L77A 3DR3A 1ZK3A 3V2HA 5G0VA 2DKNA 5L45A 2Y66A 4JCOA 4AJKA 4TVBA 5DDIP 5C3MA 3OJOA 2AG8A 3O9ZA 4OSOA 3E82A 3PJFA 4YPOA 1W6UA 3K92A 3N58A 4CLDA 2ZCUA 1Y8QB 3ZWMA 5ITVA 5FWNA 7ADHA 4UVGA 2BELA 3PIIA 4G81A 4G65A 2X58A 1WPQA 3JQ9C 4RJTA 4ND1A 4B3HA 3GGGA 5CFZA 4PLGA 1HDOA 3CMCO 3PJGA 2OMEA 3D1LA 4OQYA 1R0KA 2RH4A 3CMMA 3GDGA 1B3BA 2NQTA 1SOVA 3QWFA 3VHRA 4R16A 1SEVA 5A02A 1QORA 2PR2A 1FDTA 1PS9A 3KYDA 3HB5X 3VC7A 2QYTA 1I3LA 3DAGA 4XJTA 4OMUA 3TJRA 4XRRA 1V3UA 1OZAA 3ZU3A 1RKXA 4GI2A 4J1NA 2QG4A 4OOFA 3O38A 3VH2A 3GG9A 5A03A 3L6EA 2X23A 4MO2A 2QQ5A 2X9GA 3MJ4A 2ZB4A 3RCBA 4GL4A 2OUIA 1Y8RA 5CDGA 1KY5A 4ND4A 4R3NA 3LC1O 5T5QA 2ZTVA 3WGIA 1BVRA 1DPGA 2DVMA 3KB6A 4MKZA 4EGFA 4C4OA 4LSMA 3V1YA 1P1KA 2J3JA 4BO8A 2E82A 2PZJA 5DBGA 5JY6A 4M89A 1Y7TA 3K31A 2IRWA 3K73O 3FNHA 3JYQA 4CQMB 5I8ZA 1ZH8A 3KRTA 2B83A 5A5EA 3OIDA 3U4HA 1DIHA 1QYVA 1PSDA 3G1TA 4GX1A 3WGGA 3WSWA 1EVZA 2VT2A 4R3WA 2UUOA 1EVIA 2Q45A 3K8ZA 4XYBA 5JAQA 3RUAA 1AGNA 2R2GA 3LVFO 2GRAA 3D64A 1C1XA 3EC7A 3PFWO 2O3JA 2Y99A 4YAKA 5AXAA 5IDXA 4IQGA 3PZRA 1YL7A 2NVUA 3B1FA 2QRJA 4RVFA 1YBVA 3DBHA 3ZHXA 1I3MA 8ADHA 4YJHB 4JX8A 4A73A 2HK9A 5AQ1A 1IYZA 2X7HA 4BQRA 1YOVB 2IXBA 4IJWA 5TS3A 4GAEA 3PHHA 1ENYA 3ZV3A 4RZHA 5JAIA 5CPFA 4XQ9A 2HUNA 3E03A 1PR9A 3A06A 2Y1CA 3JQDA 4HP8A 4HFNA 1R6DA 5L51A 4IBOA 1RM5A 2JJYA 1N9GB 4HADA 4J2HA 3ZV4A 4DLLA 3GEMA 1QSGA 5I7VA 4DPMA 2O3TA 1YRLA 4WLUA 4ZICA 2YV2A 1Q2XA 4DMMA 1E5LA 3COSA 2JFGA 3ETEA 3PLNA 4IS3A 5TQVA 1WZEA 4J0EA 1BTOA 1CQJA 2POQX 4ALNA 2HMSA 1F0YA 1ADBA 1VL6A 1NPYA 3JQGA 3ZNOA 3OJLA 3ROQA 5CDYA 1GUYA 5L7TA 4OXNA 4RF3A 1UP7A 3I9JA 2NV6A 1I2ZA 4QECA 1ISIA 1UAYA 2C20A 2HCTA 3FWZA 3TSCA 2YFQA 3RFTA 4J43A 5JFOA 3I1JA 1E5QA 2DBRA 2C0CA 3K5PA 4W7IA 3TOXA 4DIOA 2CDBA 3DBLB 3WB9A 4GVXA 1HYHA 5BSGA 3PGJA 2JAPA 3I6QA 1HSOA 3AM5A 3SJ7A 3NGLA 1Z45A 1IPEA 1DFGA 3I9KA 3VZQA 2A35A 4NU6A 4WPGA 4I8XA 4JN6B 1ZNQO 2AEMA 5JAZA 1UH5A 3FR8A 3DEYX 4IJKA 2ZB3A 4I5GA 2X5OA 1I01A 2GYYA 1HEUA 1K5HA 1LA2A 3DAPA 2DTXA 4O59O 1K6XA 1ONNA 4IMPA 5MGBA 3MOIA 3V8BA 3S2FA 4FR5A 4PG8A 1P77A 2ZATA 4Z0HO 4WCFC 1GEGA 2HLPA 2AEFA 3TZKA 1K6JA 4BO2A 2X8LA 1LLQA 4DMLA 4CUKA 5KCZA 1JWBB 1D3AA 4WASA 3T7CA 3PP8A 4XEHA 5EESA 1W73A 4E30A 3AU9A 3E5MA 2DBQA 3WMXA 1DLJA 4KDFA 1R4NB 2P5UA 3PDUA 4B8WA 2BHLA 3JYLA 3ZNQA 3U09A 1KEUA 3GRPA 3I83A 4BV8A 3NUGA 5F21A 1DXYA 5IAAA 4XDYA 3RC9A 3C7DB 5CG1A 4D79A 1JDJA 2D5CA 5IZ4A 4YT8A 5CHEA 1H2BA 4CR8A 4DUPA 5L4LA 1BDMA 1AE1A 2B4RO 1SEPA 4D45A 2TMDA 4WGGA 2W2KB 3KETA 4X54A 3ANMA 5L53A 1KY4A 1K6IA 2DTDA 4RPKA 4RO0A 3RUFA 3EYWA 1M67A 3OA0A 2HRBA 2AXQA 2EP7A 1FK8A 3ADPA 4RF2A 5DCWA 5FI3A 4HXYA 5A9RA 1YB4A 5EL0A 5TNXA 3E9QA 1X0XA 4BNUA 2GN4A 3OQ6A 3R6DA 1KEPA 1GU7A 3BMQB 4R5MA 1FJHA 1HYEA 2BD0A 3JD0A 4OO3A 2PKQP 3UAGA 4UVEA 1MC5A 1UXKA 4DTIA 3SXPA 1DC4A 4TSKA 4W82A 1GPDG 4U8GA 5ICSA 3AY7A 1C0LA 4RVHA 4NJMB 2I66A 1MC4A 3I9MA 1M66A 2EW2A 3JQ8A 3RBZA 4I1IA 3RVDA 3PK0A 1HKUA 1MXHA 2H5LA 2G76A 1SCUA 3ZW8A 2IE0A 4EW6A 1MA0A 1VM6A 5A3VA 1YQXA 4GLLA 2YYYA 3R3JA 1MGOA 1QR6A 3RAJA 4IDAA 2DBZA 2YV3A 3H65A 2PKRA 1P0FA 1U5CA 2D2IA 4M1QA 4R51A 1W8DA 3I9LA 3L9XA 3TZCA 4BNXA 4M54A 1IUKA 5B4UA 2FSSA 3JCZA 1A27A 4R5HA 3UH1A 1H2HA 4TQGA 2VUSA 4EEXA 3TRIA 3EZYA 3ONEA 4FD3A 1I3KA 2RBEA 4BUCA 4XZ3A 4LVCA 4R68A 2FRDA 3SJUA 4CMAA 3RKRA 3RUHA 5EN4A 4CMGA 4CJXA 5A9SA 4IMRA 3OEYA 4OL9A 4QT0A 4F45A 1P3DA 3D7LA 4AJ1A 3EZLA 3MEQA 1KC3A 4IGFA 4L4XA 2AE2A 3ZWAA 1U8FO 3GY0A 3KEQA 2I65A 2C5EA 2A9FA 3LF1A 4PLHA 2X4GA 3U9LA 4BS9A 2CVZA 5KOIA 2LDXA 2WEKA 1BRMA 2CNBA 3ZNNA 4AICA 4E12A 3C1AA 3PLRA 3UCXA 2OORA 3NT4A 4PIVA 4E2YA 3QVXA 4TRNA 1VE9A 4XJSA 4UVHA 3C8MA 3JQ6A 4I5EA 2PNFA 4NDNE 3U4CA 4WKGA 2P91A 1S7CA 5G4KA 4AVYA 4TKMA 4F6CA 2FP4A 5HM8A 3NYWA 2FSVA 2NADA 4U5QA 4O0LA 1MG5A 2DBVO 1IHYA 3IIEA 3W8EA 2O3UA 1SB8A 4BO5A 4GX0A 1IZ0A 3VKUA 4MDHA 3HE3A 2VWGA 3WIDA 2PLAA 2B5WA 5JYDA 1PJBA 1H93A 2OBNA 1B0AA 5CDTA 2AQHA 2Y0CA 2DPGA 3OQ1A 1DFIA 1ZCJA 1EQUA 3DOJA 4IQ0A 4IXWA 3NDJA 5KVQA 3SC4A 1A7AA 3VH3A 1P31A 4DC1A 1KIFA 5F1KA 3E8XA 2Q46A 4LCEA 1PZHA 3DO5A 4DLAA 4UVIA 3UHAA 4E21A 4R1NA 5JYEA 3GNQA 5KJCA 5HS6A 1X1TA 2E4AA 1ENZA 3HN7A 4ZJUA 5G0WA 2JFHA 3OP4A 4OKIA 4DC0A 3GNSA 3PJDA 2NACA 4K6FA 2EGHA 2R00A 4KP7A 1X7HA 2B69A 1LDEA 1AHIA 5JW6A 3C7CB 4HNHA 4PVCA 4W6ZA 4AJEA 3GHYA 2BFMA 2P9CA 1GL3A 1VPDA 3KM0A 4ZD6A 1B8VA 1CF2O 1MX3A 2I5PO 2PD3A 2UYYA 2YHIB 3VDQA 4E0BA 5GZ3A 1WMBA 3HDQA 1E3JA 3HFGA 4CL8A 1HDCA 3PPIA 1LEHA 3UCFA 3P5SA 7MDHA 4PCVA 2FOIA 3WYCA 2C5AA 3FWNA 3DFZA 3VVCA 4QO8A 2VRCD 1TT5A 3DZHA 4PZDA 2JD0A 3EGOA 3B20A 3QE3A 1PJLA 3ICPA 3RU7A 4Y6RA 1TA4A 3Q11A 2AHRA 5K9ZA 2X0IA 1T2DA 4JP3A 3GZNA 1JTVA 1C1DA 4PRKA 4E5KA 3TL2A 1VSUA 4J9VA 3VKVA 3RQSA 2D5AA 1NM5A 1LSJA 2Z95A 3RJ5A 4RVGA 3Q0EA 1HDYA 4DBZA 4WLOA 2OOSA 4ND5A 4P22A 3SEFA 4CLRB 1HDXA 1CETA 2EF1A 3EY4A 3H5AA 4IDEA 3MJEA 1WDMA 3NTRA 4WOJA 3U4DA 3FRJA 5IN5A 1UUFA 3DZIA 1XQ6A 1HF3A 1CWUA 4B4UA 3AM4A 1KETA 3ROMA 2YZ7A 5G0TA 2IEDA 1U9JA 4AJOA 5ENDA 2C7GA 4QEDA 2CUKA 4KMSA 4BKRA 5IXYA 3IL2A 4YAIA 1E7RA 2DUUA 3KYCA 3Q2KA 4J4TA 3MTJA 1ZW1A 2VHZA 4KUEA 1WZIA 4GLOA 4N5NA 3A9WA 1HDZA 5G2OA 3FNGA 5TT0A 4GSKA 1JN0A 4ITUA 4YJGA 3PYXA 3RBVA 5KVSA 4TRJA 3GLQA 4E5PA 2JHFA 3F5SA 1Y9AA 1NQTA 5COAA 2ZIZA 3T7EA 1WDLA 1EBUA 4ZGWA 1PIWA 3TF5A 3DBLA 1TLTA 1ZIDA 1BVUA 4BKOA 2E37A 5F1PA 2BLLA 1YJQA 5BNIA 3IAHA 2VOJA 1QV7A 3RJ9A 3WLFA 2X9VA 1I5RA 4GWGA 3JTMA 1QYWA 1H9BA 3ZWYA 4CMEC 3CZRA 4CMCA 2PWZA 4I5FA 1DAOA 2RHRA 1PQWA 2VZ0A 4Y67A 5DZSA 3HN2A 1SBYA 2XF8A 3T4XA 1EE2A 1N1EA 2O3QA 2EGGA 1NPTO 3AOEC 3ULKA 3BHMA 1YKFA 1H94A 1B3RA 2W98A 4OAQA 4E3ZA 2EW8A 4BNFA 5IJZA 4J2OA 4EUHA 1LDYA 2IODA 4L8VA 5G4LA 3QW2A 4WNCA 1X15A 2I9PA 3L0DA 4MOWA 2GASA 2VRBA 2IZ1A 3NX4A 5I7SA 3H9GA 2DUWA 4Z3KA 2V6FA 2P68A 3LLSA 4OXKA 3EHEA 2VHXA 1H6CA 2D0IA 2W2LD 4CM3A 1UXJA 3M1AA 2X22A 3DZGA 3WGHA 3ANLA 3JQ9A 1QLHA 2UVDA 1KERA 2JD1A 2VN8A 4WNIA 2C82A 2VTDA 2O4CA 3CPSA 2NVWA 4FC7A 3OM9A 1UAGA 2Y1OA 1ENOA 1N8KA 2FR0A 1ZXLA 1YB5A 2UDPA 1N2SA 3BMNA 3UFXA 1O9BA 4CM8A 1R4MA 1XA0A 3ZU4A 3O8QA 3A28A 1FDVA 2JKVA 4O63O 1PJSA 2DM6A 4EUFA 1XEAA 1X13A 1YB1A 3GA0A 5JDIC 1GYQA 3RU9A 3W6UA 2HDHA 1RM4A 3FPLA 4CMHA 3RFXA 1E0DA 3IUSA 1R12A 4DBVO 2GR9A 4MIOA 3E1KA 3L07A 5DP1A 4CM6A 1GY8A 2Q2WA 1NFFA 4DYVA 4EITA 5TGDA 4G2NA 4R1UA 3C1TA 4YWJA 4HFMA 3G79A 4BGVA 3GN1A 4UEOA 4FSHA 1IPFA 4GMFA 2XOXA 4F3YA 3WIEA 4XQCA 2CF6A 3PWSA 4IDBA 3VPFA 1I8TA 4E5MA 4BNZA 4KTVE 4PN3A 4HV4A 3AUSA 2HAEA 3UXYA 4R4JA 3F1KA 3RIHA 4BNHA 4PRLA 4UUMA 3GG2A 1B8PA 3OA2A 1I30A 2UAGA 3OF2A 2YUTA 1L7DA 4U6QA 1MP0A 4ROSA 3OH8A 3QSGA 3ZN2A 2HKIA 4L9RA 5KKAA 5K6AC 3QWIA 5BR7A 1ZSYA 1EVJA 4W9NC 2FMUA 3H9JA 2A4KA 5ICMA 3DOCA 1E3WB 1ZMOA 3GVIA 2WYUA 1A9ZA 2NU9A 2PA3A 1P1HA 1PX0A 4CMIA 1KEWA 2EHDA 1DDOA 2PV7A 5HWSA 2PH3A 3BMCA 3PWZA 4N54A 2QHXA 1Y6JA 3ETGA 4YACA 4B4OA 4XR9A 3C3XA 4A03A 3AOGA 3TFQA 2WYWA 2RH8A 3OSUA 1HXHA 3DXFA 5TF4A 2VUTA 3WQSB 4YBZA 3GT0A 5LDHA 2WD7B 4BKUA 2ZJ0A 2XPCA 4HX5A 1J5PA 4J6FA 4MVJM 3GVHA 3A4VA 4MPDA 1MUUA 3IQDB 1ZSVA 1GTMA 3QIVA 3H5RA 5CEJA 3CH6A 1ZMTA 5ES3A 2X5JO 3X2FA 3IKTA 1OC2A 1TEHA 1NHWA 1NR1A 1RM0A 1T2EA 5IDWA 1I32A 2G0TA 2Q4BA 1DC5A 3E9MA 3PHJA 4PVDA 3TWOA 4A2CA 4EI2A 6ADHA 1PU2A 1PJCA 1G1AA 3LT2A 3QHAA 1DJQA 5DCUA 3OHSX 2QZ9A 1GPJA 4DYDA 1YONA 3AUAA 4E4YA 1O94A 4WEQA 1DRWA 4J1TA 1YBAA 3FTNA 3JQAD 3IKVA 2HRZA 3QVSA 2AQ8A 4XIJA 4PLPA 1ZJZA 4DIBA 1DLIA 4H3VA 4WLFA 1NFRA 2GSDA 3L4BC 2O2SA 1KVSA 1DBVO 1CERA 4A0SA 2D8AA 5JC8A 1HSZA 2DTEA 1DIAA 1LXCA 5HRUA 3NRCA 5C5IA 4WLVA 3WFIA 1LC3A 3LC7O 4YJDA 4IZIA 4RORA 2BFOA 4LVUA 3LT0A 4ZQFA 2PZLA 4P8RA 3PTZA 4KZPA 3LF2A 1U3UA 2Q1TA 1C0KA 3BIOA 4FFPA 2CSUA 4TMFA 1ZEJA 1V8BA 1Z82A 3HB4X 4BV9A 2J3KA 4XGKA 4O5OA 2C2YA 5C7LO 2Y68A 3D5TA 1VJ0A 1PZGA 2W2LA 1H6DA 1U1IA 3GAFA 5B4TA 1IB6A 1DJNA 3C7AA 4YT5A 4U6SA 4Q3CA 4IY1A 1M2WA 3D4PA 4WCFA 1E7MA 4GWKA 5CPBA 3BTUA 3H2SA 1ISGA 3ZWPA 5BSHA 1YQGA 1FDUA 2RIRA 1W0CA 2VHVA 1IZ9A 2J5RA 2D1YA 2OP1A 4XKJA 3DHNA 3D3EA 3H9QA 4FCCA 2X9NA 1DC3A 4YA6A 3ZU2A 4BO6A 4D44A 3F5QA 3GNTA 4TRMA 3QWBA 1WVGA 1I2BA 5A3JA 3AY3A 3EAGA 1C0IA 3ZHYA 1GYRA 3JQ7B 1RPNA 2H63A 3MJSA 4JBIA 9LDTA 2Q2QA 3NDRA 4JJIA 4NBWA 1UZMA 4AFNA 1J0XO 1T4BA 4XR4A 2OP0A 4XRGA 3VZPA 2HQ1A 1V0JA 4QO7A 1EVYA 2HMTA 4CLOA 5JAMA 3DAFA 5JDCC 1SC6A 3UICA 1XELA 5T6BA 1KS9A 1L1FA 3H4VA 3CKYA 1UDAA 5I8WA 4ESOA 2ILTA 1BHSA 2GERA 3QJ5A 3NEPX 3D4NA 1NX6A 1P74A 4Z0PA 2O3RA 4J7XA 3UN1A 4DQUA 3WICA 2VWQA 5CDSA 3S2GA 1U4SA 1A9YA 3DBRA 3JQCA 4J7UA 2P4QA 2ZB8A 1X7DA 1Q7GA 4DWVA 1BW9B 3CEAA 1AHHA 3PI7A 4D3DA 1TT7A 3GN2A 1L7EA 3ZH2A 3KUXA 4D7AA 3IS3A 2CF5A 1O5IA 1HRDA 4AJ4A 2DU8A 1OMOA 2GN6A 3GGOA 4L74A 3OIGA 2C7VA 4FJ0A 4QTZA 1XYGA 4YJFA 3DMYA 4ONEA 5L4SA 4ZU3A 1U8XX 3CINA 5TLSA 1BXGB 1R66A 1KVRA 1X7GA 4UUPA 3BTOA 1BWSA 4M55A 4BO7A 2WE7A 4CQLA 4J3FA 3DFUA 4MVJE 1SZJG 1N92A 3G3EA 2CMDA 4RPLA 4E5YA 1K2WA 5DP2A 1S6YA 8LDHA 4I5DA 3D3WA 2YY7A 3P2YA 4XB1A 3JD4A 4EJ6A 1WXDA 1FMCA 4CR7A 4GPD1 3RC1A 1G6KA 3R0IA 4J4HA 2IEBA 1PZFA 4JJGA 2VNAA 3AM3A 1P1IA 3ZWXA 3W4IA 2ZJ1A 1O8CA 2PGDA 3PJEA 1E3SA 3ASUA 3DONA 5DNAA 3H9EO 4RVDA 4D42A 1U28A 2PGJA 1HETA 4BVAA 4IINA 1U2DA 4EZBA 4BGIA 2C59A 1ADCA 4Y98A 3K30A 3GRKA 3LZ6A 3WDSA 5KKCA 2Q99A 4DVJA 3A1NA 2W4QA 1NXQA 4MVJP 4AJPA 3K96A 4CPDA 4EUEA 1ZXBA 1CQIA 3NAQA 3D5QA 3PHLA 3JQAA 3HADA 4U7WA 1NNUA 1Q7CA 2O23A 4OQZA 4B79A 1HT0A 4ZN6A 1F17A 2Q3EA 3SX2A 3UOGA 2GN9A 1NQ5A 3WGTA 4P4LA 2GZ3A 3BMOB 1LSSA 5CDUA 4DRYA 2HMWA 1EFLA 4QSMA 3TFOA 3VTFA 5G0SA 4OH1A 1D1TA 1E1MA 1EFKA 1LDMA 4A5OA 1QYXA 3JQBC 2VUUA 3LDHA 2D4AA 1P33A 4CQMD 3INTA 3ITKA 1U2GA 3IC5A 5L95A 3IDSA 3KV3O 4MIEA 1NVMB 4YQYA 3Q3CA 3WMWA 4TKLA 1GYPA 1V9LA 1WP4A 3ZWCA 3QVTA 4HFJA 3WYEA 1TI7A 4J1QA 4FBGA 5JE8A 2YDXA 5TC4A 1F8FA 4Y6PA 4RLHA 3RROA 1DB3A 3GAZA 3DOOA 3JQFC 4IIVA 1HZZA 3EVTA 5EINA 4CM4B 1SO8A 5JCXA 1GUFA 3R3SA 4YB8A 2X86A 2F1KA 3HDHA 1U3TA 4W7HA 5U4QA 5LCXA 4RPJA 2JCYA 2Q2VA 5T57A 1AN9A 3U5TA 1H6AA 2X1HA 1LI4A 4JQCA 3ZZNA 3TQHA 2GZ1A 5EERA 4PG7A 5IF3A 3V1TC 3FTPA 1J6UA 4Q3AA 5H81A 2QRLA 3I6IA 1IY8A 2AW5A 4FGWA 4MVJD 1GZ3A 2ZTMA 4NFYA 1VI2A 5JSFA 5B12A 3LC2O 1JLLA 1Z74A 3F3SA 3S2IA 4IPTA 2W8ZA 4B4VA 1A5ZA 1O6ZA 3QLJA 1H9AA 4KQXA 1QRRA 2O2YA 3F6YA 5L7WA 4Z9YA 4AJHA 1LDNA 4EDFA 5BQFA 5TRTA 2BH9A 5COQA 3LSYA 2OGUA 5KWEA 5CG2A 2D3TA 3M1LA 3ROKA 2C29D 3FBTA 1J49A 1LRKA 5H82A 1NWCA 4ALIA 3AY6A 3OICA 1LLCA 3TZQA 1E77A 4FDAA 4NH4A 1NTOA 3GH3A 4NBVA 3K2BA 3QVOA 3Q9NA 4RQTA 4D46A 4RPHA 5DULA 4L75A 3RUDA 1U3WA 3NTOA 3NDIA 4U0KA 2WSBA 3V2UA 2OHXA 1GD1O 4IXTA 2GGSA 2PD6A 1XCBA 9LDBA 2B37A 1E7QA 4FFRA 4TROA 1RYEA 3HDYA 3WBFA 4KDEA 4XDZA 3E9NA 3NT2A 3WNQA 2DC1A 3S8MA 4TZTA 2P4HX 4XGIA 5IN4A 1CIVA 1LLDA 3KYDB 3W8DA 3C85A 1ZZEA 1P45A 2R6JA 3AUTA 3DMTC 2PY6A 2RCYA 4G5HA 2BKAA 3BHIA 3OJEA 2VWPA 2Z5LA 3ANNA 3K9QO 4HWKA 2CDCA 3DL2A 4DLBA 4FFMA 1WLYA 1MXFA 1Y8QA 1IL0A 2YFHA 2Z1MA 4BHTA 3F4BA 1U5AA 5T64A 3V1UA 3FHLA 1ULSA 1Y8RB 4J9UE 2I6TA 3O03A 3LQFA 3BXXA 2GCGA 3H9UA 2IXAA 2VZ8A 4NFHA 3ABIA 3EW7A 5A05A 5I7EA 4ALKA 1SMKA 1SB9A 2J5QA 3TZ6A 4BGUA 1GAEO 4E2WA 1IE3A 3DWFA 1EE9A 4BNLA 1JVSA 5A06A 3KBOA 2RAFA 4FFNA 5IDQA 1OFGA 3KEOA 3E5RA 2P9GA 1HDGO 1V6AA 1Y81A 1C1XB 3DZJA 1E1LA 4IDCA 5A5FA 4FJ2A 3H2ZA 3JD2A 3L6OO 2YDYA 2Z1NA 2FZEA 3MZ0A 3PYMA 2NVUB 3RC2A 3DBHB 3VAZA 4YT4A 3GMSA 2VHWA 1V3TA 4JROA 4MIYA 1ZK1A 3VH1A 2Q49A 3RC7A 1NYTA 2EKPA 4II3A 1ENPA 1HE2A 4NJOA 4CQMA 3QP9A 4PZCA 4EYEA 4CMEA 1M6WA 1E92A 1YL5A 3H3JA 4S1VA 3WJAA 1PGJA 1HE4A 1I0ZA 1JW9B 4K9DA 1GCOA 4NQZA 4YCAA 1SPXA 2GF2A 2G5CA 2NU8A 3EVNA 3SLKA 1DIBA 5JO9A 4E6PA 1B14A 4NI5A 4EEZA 3AOEA 2EXXA 1YQDA 4NK4A 1DEHA 2I3AA 3HHPA 1VL0A 3NT5A 3JD3A 2V6GA 3JQGB 3N74A 3X2EA 1PGPA 4OM8A 2YJZA 2GNAA 1GZ4A 3DZBA 3FNEA 4FOOA 3ADOA 4YJHA 1MFZA 2HU2A 3S1LA 3D0OA 4Q3NA 5HBRA 4LSWA 4TVOA 3VH4A 4J1SA 1GV0A 1YOVA 4O6VA 5BNTA 5A9TA 1ZFNA 2AMFA 4LRSB 1GQQA 3JSAA 4XIYA 3GR6A 4CMJA 1XSEA 3DB2A 4NHEA 4N7RA 4MVJA 3HWRA 5KVCA 3P19A 1J4AA 1N9GA 3PWKA 3VPXA 1R0SA 3IP1A 4IJUA 4RPGA 3F9IA 1E3IA 4GKVA 1UJMA 1ZK0A 4ZQGA 1NAHA 1WNTA 1D8AA 5DOVA 3OQBA 5JO0A 1V35A 1JAXA 3MTGA 4IS2A 4L4SA 2PKQO 4IJVA 4CV0A 1ONOA 3G1UA 4OXYA 3L9WA 4B8ZA 5ILOA 4KOAA 3RI3A 5AVOA 5KNLA
chains in the Genus database with same CATH superfamily
3KXDA 3FSRA 1NIJA 4AKEA 4EZIA 5KYYA 2CVOA 4KQWA 5B64A 1L9KA 2Q28A 1PHRA 3O4RA 5JV5A 5CXXA 3D2LA 3ZDRA 3A1VA 2UXCB 1E9FA 3LYLA 3IV7A 4QJ3A 3SYTA 4EYKA 4BKQA 1GUDA 3PNQA 3WHLA 1LFDB 1W76A 3P2MA 5KINB 2QX6A 2FWRA 1L8XA 4Y2XA 4IHJF 1RI5A 1A2BA 1C14A 1K27A 1X7XB 2C84A 4I9HA 1QU2A 3O8BA 2RARA 5LOVB 3OJFA 4EY4A 4DNQA 1AUOA 2OBYA 2OILA 3GRRA 3HSKA 3JV7A 3A4MA 1H5NA 4U4AA 5KYUB 1P19A 3Q72A 5BY2A 3NM5A 4FFSA 5JRJA 2VDWB 4OGWA 4EW1A 2YV4A 1KQPA 3DDZX 4D3XA 4NQRA 2AL7A 2OFPA 2K6GA 4J16C 4CM9A 5J4KA 3LPAA 3QUSA 3BN3A 2XEXA 1G20E 2I80A 1VFNA 3PFCA 4CQJA 4LFBB 2K5UA 7MHTA 1ZIPA 3TVYA 1P44A 3A1DA 4LJSA 1KBZA 5AK0A 4JNKA 2J08A 3UJ6A 2ZWVA 5IASA 3R7DA 3EDMA 1BSVA 5LXTB 2IW1A 4LN1A 5T67A 4UFNA 1ZM3A 3IUYA 4IICA 2JJ2D 3M2PA 5E4JA 1G291 2EIHA 1ICEA 4XVQA 4B7AA 3ZG6A 2GT1A 4GR4A 3AERA 1NPDA 4NBTA 4E13A 5KVAA 3QA3E 5J4YA 3WK6A 3QY9A 1GN9A 4N03A 4WADA 3TTTA 5ER9A 3FR7A 2WHXA 4O5AA 3K70C 3C97A 2FJUA 5B58C 3GOHA 4FYKA 2IV2X 2P9JA 2E55A 4CKXA 1R4NA 1T24A 2J3HA 5HKBA 1G7TA 2PTGA 1U3VA 5KNDA 1TZ2A 1DRVA 4XX0A 4YQZA 2YQ5A 3N6XA 1KDVA 2BONA 2ORIA 1BVHA 2VQDA 4DM7A 1GPNA 3P2KA 4F2WA 4PGMA 2XA9A 1P2TA 3B7GA 2CJPA 3H2KA 4G5XA 5DM1A 3SBDA 3TMAA 1J1IA 4CBVA 2OZPA 2XE6A 2XW6A 1A97A 2ODTX 3D7KA 3IELA 2CFTA 3NP9A 4QULA 2GBPA 3OZUA 4CR6A 3NHMA 4I6EA 3PQ6A 1W85A 4FIZA 4M99A 3CNOA 2Q7DA 1T6ZA 4I9UA 4I3HA 3UJNA 1C9MA 1P62B 5DH9A 5EPOA 2BI4A 1P9LA 1T25A 1Y1TA 2QUHA 2W43A 3P9NA 3Q85A 2PZBA 2D1TA 4G9BA 2H17A 2BISA 4E33A 2XMCA 1U8TA 4DB2A 4OQDA 1QGUB 3EVBA 3O8OB 4WFQA 3DL7A 3LGSA 2OZEA 4N5LA 3IQGX 2VNJA 3PTAA 1OV4A 3HNOA 3I2GA 2G0AA 3X1ZA 5JH7B 2B8JA 1GUZA 3OMWA 5ILQA 1FUUA 4RK7A 2ZXUA 4N5IX 2NLOA 4V0NA 3IVCA 4Z9XA 2E48A 3B53X 3I9FA 3FSGD 2B94A 3L4BA 2AHOA 3IP6A 3G88A 2V6BA 4U5XA 2M6LA 5CLGA 1P2UA 3TKYA 1PG2A 3UWSA 1H05A 3DBVO 1NN3A 3EIEA 1G8AA 2EJUA 1KVTA 2PT6A 1OLOA 2HR1A 2IU0A 1DAIA 1PQUA 1LVUA 2AQKA 4ZEMA 1ZRNA 4POOA 1Q17A 3QXHA 3U80A 1TKBA 3NATA 4JLMA 4DQVA 3L7DA 4NZZA 3PT5A 5CD9A 5KNBA 5IT0A 4QUKA 1ESZA 3QITA 1QGAA 1EK5A 3OD5A 4IDPA 1YVUA 5E7IA 1M6NA 1QCYA 3WL4A 3WNZA 5J4LA 2NU7A 3ZHRA 4YAGA 2XWBF 2XXJA 3IHLA 2E5WA 5JMWA 2BTEA 1LSUA 3IMFA 1CEXA 1V6SA 2APJA 2H6EA 1MX5A 2P5YA 3ICVA 4YRZA 4O08A 4YXFA 5J2TB 1X74A 4X1IB 1ZNWA 2W2PA 4ILKA 1XPUA 1RHKA 1GFZA 1JJFA 1QJCA 3ZU5A 4HGQA 2GAIA 1DIGA 4FZ5A 1Q57A 1SWWA 2FG5A 2FCRA 3GJXC 3ZV6A 3KTDA 4ZVVA 1TCBA 4RE5A 4WKNA 4TS3A 1B74A 3RG8A 3VXKA 2Z98A 4AWXA 2BWJA 5CNJA 3T4PA 5JFTA 3MOSA 5E38A 4HYQA 2XYHA 1VJGA 1YBMA 3T38A 2I2AA 3DMDA 4QFDA 2HMVA 4K9RA 4RVSA 3THYA 2KYRA 2ZTLA 1G21A 2HADA 3QMWA 1W1UA 4EYGA 4R71A 1UFRA 3K2EA 4G24A 3H2YA 1N75A 4CM1A 4NZPA 621PA 4HZIA 1GTJ1 1M76A 4O1HA 5EJGA 2QDXA 2WFLB 3BK2A 1ORHA 3R7BA 3W8RA 4L57A 3JYNA 5ECDA 1YS4A 5GZ6A 4BMVA 3HKDB 4YJ2B 1Y63A 2PEYA 3IEPA 1JDNA 5THKA 3H2JA 1DIRA 3BXHA 5H0IA 3U49A 1B7GO 1CT9A 1Q7BA 1L4EA 3ZQ6A 4DUYB 2GHRA 4S35A 1GGNA 1PL7A 3PXUA 2LZ0A 3D6MA 2AOUA 3HY3A 3MWEB 4II2A 5TJ9A 3HSYA 2R8PA 4Q21A 3FVWA 1AS3A 3IKLA 1Q15A 1Y4DE 3AUUA 1NVUQ 3GLRA 3MOGA 3QFHA 4OQLA 4UHEA 2PVSA 1R0RE 4UZSA 1KE2A 2NZ2A 1XZEA 3TR0A 3UT5A 3V3KA 2O8CB 1SVKA 1QK4A 3WG9A 4CCYB 1PJ3A 3BTSA 2XRZA 4Q39A 1TZKA 2CXHA 2REOA 4JODA 2JLBA 2IDJA 4KLAA 5A5GA 1HQYE 5HFJA 2PLWA 1OH6A 4G84A 3EC2A 4AJNA 3QK7A 1L7RA 4WCDA 3WL7A 1IQRA 3RU2A 1PJQA 5CXQA 1MOSA 1RT9A 5JEDA 5JZVA 3BSSA 2WFZA 4N49A 4ZOLA 3AETA 4IIGA 3E8SA 4RH0A 1EFDN 3RUCA 4JXJA 3HYSA 2B5VA 4KK4A 1R0LA 3D4OA 2R7AA 4UM5A 3LT4A 3RAFC 1E2HA 1DO8A 4YGYA 4PRZA 3LBFA 1O97D 1CRWG 4FGUA 3KDSE 3WJ7A 5KSWB 3IOEA 5CFLA 3AB3A 5CEFA 4ALJA 4BP8A 1E6UA 2F1HA 2GN8A 3T7DA 1KKLA 4HX5A 2Q1UA 1V1JA 2R9VA 3B1JA 4QPCA 1V8ZA 3ORSA 3GLHE 1G0NA 4HBZA 2Z8XA 4Q4AA 1T2FA 4BVBA 1USGA 2COKA 2VYVA 1D0IA 2QV7A 4KXMA 2Q2NA 2QRMA 2OLKA 4UQOA 3O83A 4BEBA 5IDYA 1W75A 1VMDA 1Q16A 1GO2A 2GEVA 4OI2A 4MI3A 1ISHA 2HZ7A 3GEDA 4R01A 4MP6A 5K0EA 1G1MA 5JPIA 1F1BA 4MEAA 5E6UA 4W6QA 4QG7A 4EG1A 1IEXA 3L7NA 1C2TA 1IN5A 1FXUA 1KOFA 1NJ2A 5DRTA 3RD5A 4F56A 3KJEA 3FKJA 3NB0A 1TXGA 1OXVA 1RXSA 2Q5EA 1FQKA 2YHIA 4NENB 5E4TA 1L7XA 4M2LA 5KX5F 2ZQZA 3JVDA 4OL0A 2EV9A 1UBSB 3U7JA 2ZSAA 3VR5A 3DTYA 4BCBA 1A8PA 4TZKA 4CM7A 4IH4A 4HEHA 3GUCA 3HBJA 3Q3VA 4OHWA 5BSRA 4RKYA 3FMGA 2CFSA 3F4KA 4N0DA 1L8OA 4Z2AA 4FGSA 2PKYX 3K0FA 3R5FA 3KSZO 4KN5A 4FYMA 2AH5A 2G82A 4HGYA 2DQSA 4NU8X 3ZY6A 2FW6A 2CLKB 2XMGA 1VFPA 5JSUA 3ENKA 5D01A 4NBRA 4IVRA 3FTQA 3WIOA 4EIWA 1SXJD 1BWQA 5B7NA 1T2CA 2DE0X 3LH5A 4XIFA 3VR3D 3BCRA 4M8IA 2JD2A 3PEFA 3SYNA 1NXVA 2DOKA 4BKMA 4PLZA 3E3OA 4RQBA 4Y9UA 1RQPA 2NOAA 3VDMA 3B70A 3I5UA 5EMJA 1T6XA 1EI9A 4JY7A 4B8YA 3RSHA 2ACEA 4LRYA 4D6PA 5LQJA 1L7OA 3RUEA 3NHJA 5AM5A 5GONB 4YLYA 2G4LA 2VDUE 3BM5A 3ZHZA 1R5JA 2CLHB 3T5CA 2ESRA 4W5JA 5AVZA 3OPYB 4YJGB 5CYGA 1KS2A 5HRCA 4B85A 3M34A 3QKWA 4C87A 4E09A 3IT3A 2XZTA 2PV0A 3M6MD 2HF7A 3O0DA 3H8VA 3ETCA 4A7PA 3OFNA 3WXBA 3FOCA 1CJTC 3EGIA 1QR2A 1PVVA 3OTIA 3QM1A 4BGDA 1XNJA 2ZREA 3Q5EA 2C4WA 2EGUA 1DT5A 3FF4A 4LYFA 4MUXA 4MVJG 1UM8A 4LA4A 5FFFA 5BNZA 3UV6A 5HUHA 3D6VA 4BLPA 1KFCB 5D5QA 4CL0A 2P3SA 4TN5A 2J6IA 2GAJA 2JFNA 3GD5A 2HSDA 3LXRA 4W63A 2VSXA 1RYZA 1NX9A 4R1SA 4REMA 1PQ4A 1Y1KE 3WGOA 2XOKA 5LBIA 3MUOA 3HXLA 3ES9A 4ZQCB 3CC8A 5FO1A 2G5GX 3RFVA 4QPJC 4H31A 5D00A 2XEDA 4KSCA 3STUA 1O7JA 4Q9AA 4ZAXA 2Q2OA 2QJOA 3ORRA 4A5SA 1TO6A 1XZPA 1I7LA 1PTJA 2ID4A 4II7A 3G2OA 2IYOA 4JHXA 1OXTA 3PDJA 4M87A 4PLWA 4WXPA 5BW8A 1PVOA 1UPXA 3KQWA 2QJTA 3IA2A 2Y92A 3MCVA 5A04A 4OM7A 3ER8A 4YDHB 1A77A 1P4HA 3C3MA 3E8MA 1M3SA 2FWJA 3FGZA 3OIUA 3PIDA 4LBYA 4RZ3A 5EWLA 1F3LA 1GSHA 4G26A 1RYDA 4DAOA 1A2QA 5AYVA 1MW9X 2J09A 3KFXA 4K6GA 4ZYLA 2ZUWA 3NTQA 2CJYA 2ONYA 3DMPA 1SJ9A 1GTSA 2X7JA 5EAIA 4HHEA 5LC1A 2GLXA 3RUIA 4D26A 3WL3A 2GKGA 3VR4A 4B3IA 2R3SA 1RJFA 2PMBA 2ZRCA 3PQ2A 4K1LA 3P9SA 4JELA 1T8RA 4R54A 4AC9A 3ESXA 2N3ZA 3EUWA 5WRFA 3V8MA 2D59A 5HGXA 2Y4OA 1R6BX 4MUHA 4GZ3A 2PNJA 4YBRA 3AYZB 1IN6A 1Y4AE 2ATVA 2HSGA 2OECA 3ITDA 3S1SA 1C9KA 3K0SA 2UZ1B 2I9KA 2V65A 1C4KA 3QVMA 2OHHA 3LV8A 3BWCA 3CZCA 1MRSA 3SC2B 1SRQA 2HXGA 3EFBA 1T2VA 5TPZA 2RHHA 1DAPA 3A3NA 3C3DA 2PX4A 4JVNA 1JTEA 3H19A 2EJVA 4Q82A 5AK5A 3UJAA 3BILA 3OAAD 4DPLA 3GEBA 4PZZA 1J8FA 1VJTA 1RZ3A 3ECCA 2YHSA 2Y93A 4JQSA 2WWXA 3BMNB 3PGXA 3VAAA 2IBMA 3PNLA 3CV3A 2ZE6A 1GQYA 1R4MB 1S2GA 3EC1A 4WLNA 3O8QB 4C6RA 4WNYA 4Y6SA 1MQSA 4QHTA 1RHQA 1PHPA 3IIMA 4U2KA 1MPTA 3FMPB 2RSLA 1N9KA 1HDRA 4PFQA 1WKVA 1TGVA 2GWHA 1KRHA 4UZEA 4BU0A 4X5OA 5DMHA 1OGJA 2RKWA 3TW8B 6REQB 3I9OA 2QRNA 1WWKA 1HG0A 2FN7A 4LNAA 4BVLA 2IIQA 2BKUA 2AXEA 5HZKA 1ZK2A 1U31A 4HTFB 4YJ3A 3ROZA 2HA4A 9ABPA 4PLCA 3PEWA 2OCIA 1MIOA 2HFKA 5E7MA 4GBJA 2OFFA 1TU3A 1PL8A 1WU7A 2AFIA 3N2EA 3FPHA 4TLLB 1F8UA 2O2HA 4Y2RA 2RGWA 1D4FA 4C3UA 5K09A 1VLLA 4Z1MD 1Q1QA 4AJJA 2HF8A 2CE2X 2I62A 2NVBA 1ILWA 3E7PA 4JA2A 4LGMA 3WLOA 1YKSA 2OD7A 1FCJA 5JQGA 4B7UA 5U1PA 1HEIA 2CLLB 2ZVQX 3R0ZA 4C1BA 4RFVA 4D81A 2GTPA 4BMSA 1J2TA 4YRNA 4D9NA 5AVVA 3BSWA 1E4VA 3UXEA 1ECJA 1LJLA 4R8LA 4DXDA 3PZBA 4DA9A 2AZTA 4XTRA 2CCJA 5F2OA 4DJJA 1FP1D 3LPMA 1O5TA 5FJIA 5JPCA 3PLNA 4UE3S 4ITRC 1BFKA 2O7SA 2VKTA 1WOYA 2EZUA 3IILA 3U7EB 3FHTA 4INZA 1SVIA 2I22A 2AOTA 1UFOA 1T36A 3HJAA 3SS9X 1EBBA 4UBNA 2C54A 4R0NA 4PGGA 1MGPA 1UKCA 3KAJA 2MYNA 3EA5A 2C7BA 2OK7A 1RXEA 4IZHA 4QQFA 2QXTA 4YC7A 1GU1A 1V1RB 4FFLA 2DFKB 3UUWA 4P92A 3ZV5A 2PUTA 5M04A 1PGQA 2QIPA 2H1FA 4GZ6A 3LMKA 3TOSA 4ARUA 3KHSA 3FDZA 2I55A 2P3LA 3H99A 3GAAA 1EK2A 4RSMA 4E4RA 1ODKA 2DAPA 2D74A 1HLDA 2TSYB 2XYRA 5ALLA 1OXMA 5K3EA 3DA8A 4FOSA 3G0OA 4XQ0A 1DGQA 4R8SA 1GR1A 3MWLA 3D6FA 3DE1X 5JSYA 4GECA 4RDIA 4N8SA 4JC8A 4INAA 2Z4SA 3TE6A 2XCUA 4A8PA 5MDHA 1Q1NA 4IIJF 2FX3A 4BLWA 3R0JA 1BH6A 4N39A 4PBSA 1XU9A 2CZQA 4NYMQ 3VDNB 3OO1A 4N47A 2JFOA 1E3WA 1K5GA 1TA0A 1Y5MA 2IXFA 1UXIA 3GC6A 3OKPA 3P26A 4TL7A 1JPJA 4A16A 5AVXA 5IHPA 3L46A 4GZMA 2BL4A 1CB7A 4KLNA 3AIOA 1JECA 3TAXA 5SICE 1UOPA 3S55A 1N78A 4MJLA 5JYCA 1U2PA 2I76A 2QMQA 4ND3A 4C07A 3Q5GA 2B20A 1USIA 1VYUA 3O95A 3PDIA 4AAYA 2X4LA 2QD1A 3FGOA 4Q9JA 1NWHA 4ENUA 4I14A 5I7UA 1G5HA 4EBFA 2DPLA 2NUTB 2G4CA 1ZU5A 3F6EX 4Y2GA 4MW0A 3WZMA 4J49A 3TB6A 2HIGA 3VDXA 4CL3A 2P90A 3F7TA 5JWRA 2YQ4A 3ZKWA 4DAEA 4DZTA 4I1VA 1ECCA 3ZWBA 1IM5A 1KI2A 3MMXA 5CA1A 1DRKA 1MA3A 1QG4A 4OUDA 4UBLA 2NZWA 4HAUA 5EZQA 2PS1A 3K72B 1ZUIA 5SZKB 3I4CA 3KHTA 2QPLA 2I6QA 5AM3A 3USES 3FUXA 2DJIA 2MSNA 1KYXA 4TLBA 2H48A 2O5VA 1ORTA 2Z2KA 4S1TA 4QYWA 4ZT2A 1JIUA 2DBYA 1XZGA 2C83A 2O48X 3CWQA 2UZ4A 1KARA 4JBGA 4L73A 2P77A 2JAWA 4N5MA 3SX4A 121PA 4I50B 3E9YA 3F97A 3W5AA 2D5BA 2Z6VA 3FBWA 4LOKA 1N8TA 1NZFA 1Z28A 2HA0A 3UPTA 5IWAB 3HU1A 3TOCA 1RI1A 4XCQA 2Q3HA 4HXEB 4HCJA 5F1YA 4Q1AA 4HDSA 4EYQA 1QGDA 1SOMA 4R81A 4G0VA 1JG6A 2LDBA 3ZJTA 4DNOA 1CRLA 4ZEOA 1AUQA 3FVRA 4NG5A 4WCFB 3KVOA 2OQVA 4UUAA 2ZU6A 2BFWA 4TSRA 2GUGA 1MTOA 2KE5A 3HR4A 2VSQA 1NIPA 4HQNA 4OF4A 5EJMA 5G3ZA 4NBNA 3UK1A 1M8PA 3DDNA 3I4FA 4AJ2A 2GHQA 2JIPA 3W3AA 1T13A 3QRWA 4NABA 1GZUA 1VPWA 1QOPB 2ZAOA 1JHAA 5C52B 2ID9A 1T2AA 3HM9A 4UTNA 2IX3A 1T1EA 5E8JA 3RS2A 4HMPA 5JUWA 1CW2B 2YC4C 3ZX4A 1EGMB 2J33A 3DVLA 2JAUA 3DOFA 3TXYA 4C7BA 1QAOA 2H2HA 5F5XA 3J81A 3GQVA 1Z0JA 3ZJ5A 1TTTA 1L2TA 2H2WA 3KHUA 2OXIA 1UDBA 1N8SA 2PANA 2XYVA 4C7JA 4RGVA 4KTTE 3W5BA 5DI3A 5DBIA 3OEHD 1X1AA 4UZFA 1LSOA 2GKSA 5EA2A 4YQFA 3JY6A 1BXKA 2FZ5A 4GDMA 1E2NA 1ZBQA 2IEIA 4ASUD 3TOZA 3D02A 5TEVA 1A7UA 2QLMA 5ALWA 4C1NA 1LNSA 1IZ7A 3BA1A 1OXXK 3K09C 3NALA 4J0HA 2ZE8A 3SR0A 2GWRA 4HVTA 2B7CA 4W99A 3HQ4O 1U6IA 3MJTA 4NX2A 2FSVC 4NBLA 2WWHA 3TI9A 3LS2A 1ULBA 3O91A 4KN8A 4BFWA 1PO7A 5F5NA 4HEQA 2ZI6A 5ADVA 3HKBB 3DBRB 4HNGA 4CW7A 4FQ8A 4Q4LA 3MTAA 3VC3A 2ZFUA 2AX3A 3PUXA 1PS8A 2RAPA 4G5GA 1M54A 1O96B 2IFTA 3QELB 4P35A 2IDZA 1M1YE 3ADKA 3F9CA 1K97A 1B00A 2PO5A 1DTWA 4FT4A 3P8ZA 1Q3HA 3RLIA 4DEXA 1DXQA 2XUKA 3EXIB 1T1JA 1SFRA 3GEHA 3NNDA 3OMLA 3LA8A 3E18A 4JT9A 1EX1A 5E2BA 5TSDA 3LG2A 1OC4A 1RLIA 1H6BA 4XYEA 5T4FA 4DY6A 4JI1B 2B7LA 4ZHQA 1Y42X 3U5ZB 1PV4A 3HXPA 2R1VB 4BNJA 4BNGA 3AJ8A 3KSUA 4FFVA 3ZGNA 1WSBA 4PS1A 3U4IA 4CQLB 3BL5A 2ZR9A 3KWJA 4WDRA 3AWDA 2PK3A 2I7DA 3TPFA 1JP7A 3PE6A 2AR0A 1DSSG 1WTCA 3UMSA 3VZSA 3NLLA 3P2OA 4QOSA 1CJVC 2KX7A 2XWPA 3AESA 3TZQA 5H80A 2XT6A 3N07A 3WQRA 4OHPA 5D3MB 4FYVA 2ZYSA 1Q6YA 3RBAA 2P8SA 3HVRA 4R1QA 2ZKLA 1L5FA 2PXCA 2GD1O 2Y8EA 2HCRA 3N5CA 3PTLA 4LOIA 2W90A 5AKXA 1XP8A 3OQMA 1BW9A 2BV3A 2HD4A 2D8MA 1K89A 2BFFA 2XXBA 5AKZA 5FT9A 1SKBA 2EKQA 3RJZA 1AXGA 4MRMB 4RF5A 5IJ0B 4UUOA 2YXEA 5ISMA 4IEFB 4OHVA 2HMUA 2YWRA 3PU6A 2I6FA 2WLTA 4M22A 2NXNA 4TUYA 2GHIA 3AJRA 1FDWA 3K20A 4IDGA 1BEEA 2O0LA 3I28A 1RJWA 4ACAA 2HO5A 4RD6A 3ZY4A 1F06A 2BMEA 2W2MA 3MINB 4MW7A 4RZIA 1BXGA 2II6A 2VHYA 5C4GB 3FCXA 2ADMA 1N1GA 2B4AA 4UXIA 1X1QA 1QZ3A 2VDVE 3OFSA 1QWSA 4KKVA 5AJYA 3TMKA 1FS4A 3PKIA 4IZ6A 4M0KA 4DBLE 5JC1A 4XYMA 4QIHA 4TMKA 4UAGA 5JJIA 1CIJA 4BWYA 2XAAA 1NZDA 4LNUB 5NLLA 3WK5A 3SK0A 5I4BA 3F7OA 4K0RA 5FL7A 1Q77A 3GUYA 4LZLA 2C98A 2QN1A 3TXAA 4EOGA 1C9EA 3C70A 3WGQA 3OQNA 2G9NA 5K0JA 3QJYA 1U0FA 2RC5A 2XUOA 1E1KA 4JBWA 1W4LA 1EFRA 4KAXA 1Y3HA 1ULHA 1DAKA 3C4JA 2PWAA 3DB1A 4CTJA 4MTLA 4PYJA 2NTVA 2YZGA 1VL8A 3B3AA 2BEWB 4B84A 3FM9A 3V8VA 1NBMA 1IHXA 4YTEA 3GLIE 4YRTA 2OZLA 3D0QA 2J5BA 5EPEA 2IW3A 3J7TA 3SIXA 4BN0A 1P72A 3PXCX 4ZI7B 1UWKA 3UK2A 2PUCA 1D4OA 1ANKA 1RTTA 3RWBA 4PPYA 4X20B 1Z0AA 5AH0A 4JJ4A 5H7XA 1STOA 1E0KA 3N2NA 5HUQA 2TMKA 3V34A 1FYDA 3Q0IA 4X7MA 2GRJA 4WZAA 1V7PC 1T9GS 1RYYA 4NHOA 1N2HA 3A1EA 2GPYA 4QFCA 4I9NA 1V37A 5H02A 3QV1A 5JS1A 4LGVA 1ULUA 4QYIB 1RWBA 4H6WA 4OB6A 4Q93A 1EUCA 4TQ9A 3WS7A 2D5IA 9ATCA 3NWOA 4H6VA 2BE7A 4MVJH 5EIWA 3BUSA 4Q3DA 4U00A 4F9EA 5BVGA 4CKWB 4D3FA 1CHDA 3KPVA 4LYAA 3KD2A 1L4FA 4MUNA 1ECBA 1GTVA 1VDMA 3KKPA 3LLVA 2XCRB 3ZW7A 2HSJA 2NU6A 2PX8A 3P0EA 4GM4A 1K66A 2YW9A 3KDPA 2XH8A 1FPQA 3NV7A 2IPAB 3P7MA 2GPBA 3PQ7A 1EEXB 1WE2A 1MO2A 1Y9DA 2B0JA 2FW7A 4UBOA 1Z3IX 2KBEA 3ZUPA 3GGDA 2W6ID 4HX9A 3P4YA 2XVAA 4MP8A 1SUCA 1E7SA 4IHJB 4QU5A 3GDFA 3TQSA 4CDMA 4F91B 3BE6A 3IOBA 3WGJA 4HDAA 1ABEA 3I73A 4KH1A 3VNBA 2HPZA 3MLBA 3IYLW 1BCSA 1D5WA 3RS9A 4MQEB 4QQKA 1IFXA 4Y2PA 4JI0B 1IUNA 2G3YA 2YYSA 5J59A 3OT1A 3UV3A 4OGLA 2E7ZA 3BK1A 3DNPA 1MTZA 3PRHA 3ND5A 1WV0A 3WL6A 3G49A 1TZJA 2QUJA 1XG5A 2GX6A 1H65A 1TIBA 2WUGA 4XM0A 4DREA 1BXZA 2BMAA 4RTJA 2A9OA 1YE3A 4C0HA 3DC2A 2V6MA 4DABA 5F5LA 4UTXA 1JKFA 2CVHA 4OI1A 5EI5A 4CLXA 2Y1FA 4ZZIA 1S9DA 1NJ8A 4FFDA 1A82A 3UMBA 5JIBA 2YICA 3O9VA 3D8UA 3X1JA 2ODBA 2H8GA 4HUJA 4S0ZA 5K8JB 1ZRMA 4RV9A 4TTVA 2O7QA 2R6AA 4JEHA 2AEEA 4OFZA 4QRHA 3FTCA 5DTJA 3W7BA 5CH3A 4IRMA 5IM5A 3DKRA 1B8UA 1SVUA 1IEVA 3RS7A 1JIXA 2Q5JA 2EQ5A 2R8XA 1ZK3A 2B8NA 4FFBA 3V2HA 5L45A 1GKYA 1RQLA 1YJXA 4JCOA 4AJKA 1L5ZA 3PUVA 2QPTA 4L8GA 1KPGA 2D4HA 3EYAA 4LC1A 5C3MA 2XGJA 4A82A 2C99A 2VHTA 3OZEA 4PSVA 1H66A 1MJGA 5SY9A 2PUBA 4F8JA 5FTJA 1W6UA 1BS9A 3MQFA 5DYGA 3PPWA 1DE0A 1SXJE 5KS2A 1EJ2A 1FTGA 3I64A 5CCBA 5FLKA 3L2OB 3ZWMA 4BJ3A 3NHZA 1QHEA 4C4RA 4X6LA 3DCJA 2ZT6A 5FWNA 4BPBA 4RE6A 1L7NA 7ADHA 1QFSA 3THXB 2C3OA 2DUMA 4INOA 1GGFA 2J0VA 2X58A 3CZAA 5ERYA 2UXDB 4ZVTA 2KSQA 2LPMA 1P6XA 4TTQA 2H1IA 1SUWA 2FZLA 4BECA 1MZPA 4CT5A 3S8YA 3N8DA 4ND1A 1QJ4A 3CMCO 3OPNA 1V4BA 1DKMA 1DQRA 2PX2A 3FWYA 2MSWA 1CJBA 3AY0A 1B3BA 1SELA 1U3GA 1TZMA 1MOZA 3HCEA 1US8A 2XCOA 1FFYA 4R16A 5A7HA 3TR5A 2H1VA 1W48A 3OCCA 3Q9LA 2PR2A 1JV2B 1OLSB 4NV3A 2H8KA 3E7XA 1I3LA 4WUTA 1QHYA 4OMUA 2ACWA 3TJRA 1E1RA 2FDCA 2NPOA 3I04A 2MJLA 4GHWA 4JOSA 4EKNB 1FDRA 1X19A 3VH2A 5IUNC 5L6MB 3EDYA 1CB0A 5A03A 2BKEA 3C6XA 3L6EA 5DM4A 2Q7OE 1JR6A 1WP9A 4EKEA 1EFTA 2JKYA 3B7PA 2X9GA 1OLUA 1UMDB 1S8AA 1DU4A 1VGQA 4OHFA 3ESDA 3MJ4A 2Z5FA 5A2GA 4DJTA 4KXFB 3JVEA 3NBXX 3MRTA 2YIDA 5BQOA 4JWTA 4D8UA 4HN4B 5BMOA 4X64B 4ND4A 1Z4LA 1FBNA 2VRWA 3B1ZA 2QLNA 1DPGA 2DVMA 1QHFA 3R9XA 3N9IA 3AHHA 2F3SA 5H3CA 1IXZA 2C5BA 1P1KA 3KKKA 4BE7B 1F2VA 2J3JA 3NETA 2E82A 4K9MA 2VATA 4YO7A 3NIFB 3ACBA 3DM9B 4ZKEA 4X41A 1N6IA 1Y7TA 2C97A 3L8CA 1TLLA 1Y7LA 3JYQA 1E9CA 4I2NA 4LZOA 4AY2A 1ZH8A 2D7CA 1LBSA 1L4KA 3AHGA 3E1SA 1PSDA 3G1TA 3DLTA 4IX9A 1EVZA 1T3TA 2VT2A 3HEMA 3OUTA 4R3WA 1EVIA 2UUOA 4O29A 1BD4A 4XYBA 3RS0A 5F23A 3N6VA 4QLAA 3FIUA 2ZRQA 4JEMA 4L85A 1RLOA 4XWOA 3D64A 4F4JA 4KQ6A 2NU8B 2DPXA 2DF8A 3D3KA 3HLYA 2O3JA 1L5NA 5LQCA 4U9HS 3OEEA 3I05A 3UMYA 4JL8A 1ZN7A 1UBOS 1Z6TA 3VU9B 4KQKA 1U2ZA 1YL7A 4LG1A 3HKEA 3NKVA 4RVFA 2H1HA 4X8HA 4NRDA 2PL1A 3LGXA 3Q5DA 5AKGA 5TQ0A 1TU4A 1KIAA 3UENA 3DQQA 2ZDQA 1I3MA 3BSFA 4P84A 3UA4A 3W05A 3C87A 3ZHXA 1TIKA 4DLZA 4A8JA 4YJHB 3MT0A 4HDQB 2ZRJA 4JX8A 4MMYB 2HK9A 3TLAA 3A10A 3PI6A 1A95A 1G3MA 4N12A 5A0TA 2GYUA 1YOVB 2IXBA 1TRKA 3FXAA 4P32A 4TLAA 5EE9A 3WGVA 3ZE9A 4QG3A 4UW9A 4XQ9A 3JATB 5FUYA 3S0JA 3E03A 2ZUBA 2FUCA 3AH8A 1NV9A 1C9YA 3MWGA 4DRXA 4MRVA 1R6DA 1S7GA 3HN6A 3WAGA 2O5CA 3T3OA 1XRLA 2FVXA 3U7IA 3L93A 2BSQA 4G6ZA 4B74A 1QS0B 2PUDA 1UL1X 4LXTA 4KYIB 4MR7B 1V8DA 4UUQA 1KJJA 2OV8A 3BFPA 3ZV4A 1K4KA 2DMRA 4A92A 3OCXA 2IHTA 1XRMA 2WA1A 5FQNA 2JFGA 1JQDA 4IH1A 4YROA 4DUZB 1M9NA 1TCCA 1JSLA 3NEYA 2W8BB 2HHCA 4GBMA 3U4GA 4JI2B 4HPJB 2RGNC 3NFYA 4QOHA 2HMSA 1DWQA 2E4UA 3ODPA 1Q0TA 1GAXA 4EUSA 2H1LA 3V6LA 1XAHA 3ROQA 1SC4A 3MWYW 3W06A 3QVJA 4XLLA 2NV6A 3SZGA 1I2ZA 3IJ5A 4LJYA 2QRHA 2E89A 3A3YA 4CCAA 4CZ2A 1KQFA 4N40A 4CF6A 4DQ0A 1ISIA 1UAYA 3TSCA 2I3DA 2WDPA 1XLUA 5L6LB 4J1TC 3L4EA 1PKXA 1PLJA 2WINI 4X91A 1FP4A 1WY7A 3I1JA 2HSWA 1TC2A 1NTRA 4QBTA 4W7IA 2CDBA 3MT8A 3LOPA 2X6RA 1TEXA 1Y3IA 1YQEA 1UQRA 2GMWA 2ZBFA 5IP5A 5CA1B 1W88B 1VE7A 4A0FA 4OD0A 2V5VA 4K8RB 3PGJA 2JAPA 2PWBA 3WWEA 1ZNXA 1ZLYA 3QVUA 4JYMA 4RIFA 3E7DA 3OKAA 3A6PC 3CN7A 2A35A 1N4DA 1P4SA 1NONA 3NHKA 4DR4B 4NCXA 1TDJA 3SDSA 1IHUA 3CE9A 3URKA 3GB9A 4I6JA 3CVXA 4EPYA 2WSSA 2ZSHA 3QMVA 1CTQA 1Q2UA 3NASA 4GRIA 3OESA 2FI1A 3SHTA 1CY2A 4M1WA 5CIYA 5KX5B 1HEUA 1M74A 2CNLA 1LA2A 3LPCA 1OA0A 3KUKA 4EGJA 3ETJA 4JJ8A 1RQXA 1L6IA 2JDIA 3L6RA 3M6XA 4A0RA 3MOIA 4DDMA 4AROA 3BORA 3V8BA 1TJ4A 2ADFA 2UVPB 2ZWPA 3TLCA 1QHGA 1YB2A 1JI0A 1TM5E 2FH5B 4BJ5A 4EB0A 1GEGA 4HLUC 2AEFA 1BKYA 4EHFA 3CGGA 3LQQA 5AJHA 4RXTA 4L2IB 5JNTA 3TZKA 3FLAA 5YASA 3RRBA 2X8LA 4DMLA 4CUKA 1CDDA 1JWBB 1D3AA 4WASA 3A1TA 1TYDE 5FL3A 1PF7E 2FP3A 5EESA 4KDCA 1TOAA 4HH1A 4CNQA 4DDVA 2ZJFA 3EVAA 1BA3A 3GFQA 3ZCRA 1CZKA 4BX3A 4B8WA 3JYLA 1CJUC 1KEUA 1T9KA 5DYYA 3IEMA 4D9KA 3ESAA 3NUGA 4FGJA 4N3AA 1DI0A 3C45A 4P54A 3R3VA 5F21A 4D1YA 2R8EA 3T54A 5BN1A 4D79A 2D5CA 4JVOA 2XMQA 4EVRA 5CHEA 2IJGX 2DJ5A 4V38A 4EJSC 3WJ1A 2IYEA 3ZGZA 1WB4A 3PUZA 2J3EA 3HKCB 1VECA 4PCLA 5AI6A 4WGGA 4JEIA 2O7VA 1KR5A 2W2KB 3WNDA 1P2BA 4B2YA 3ABSB 3KETA 4X54A 5NULA 5DTMA 5LIRA 4DMUB 1K6IA 3EFHA 5AW7A 2AV6A 3RUFA 2YN2A 2W0MA 4RMGA 1IY1A 1M67A 2Q6OA 3NRJA 4KQCA 1IXRC 3PUWA 1K3UB 3RVQA 4UU1A 1J0CA 1YHZA 2HRBA 2AXQA 5BSTA 2EP7A 3ADPA 1B2RA 3VUFA 1COWD 3C5EA 5FI3A 3LXMA 5FTMA 2C2ZA 2ZAYA 4HXYA 5A9RA 4LX8A 5TNXA 4CU2A 1AHPA 1GRVA 1W36B 3AR4A 3DNMA 3AJAA 1JHDA 1E79A 2V7XA 3ZOZA 3AV3A 5IAOA 1J5EB 4LJ5A 4WJLA 1EB9A 1CY4A 5DK4A 2QTAA 3BMQB 4AQ7A 2P9HA 3NUQA 2BD0A 4G0NA 1U0BB 2PKQP 2EWVA 4YV0A 1PAUA 1UXKA 4IXNA 4CG0A 1GPKA 4Q4JB 3SXPA 2OY0A 1ESMA 4YRLA 1YDGA 3Q3IA 4E11A 2ZBUA 2MR5A 3UMGA 4URVR 1EESA 3ACDA 1EXWA 3JRNA 3L92A 3N0TA 4U8GA 1FRVA 1CZUA 2OBXA 2HIMA 4RVHA 2XB6A 4RVOA 4F2GA 4LDQA 2GM3A 1WJGA 1YNSA 1HFKA 1X7WA 2Z2YA 1AURA 3MT9A 4I1IA 5LZ8A 3RBZA 1XNRB 1T0JB 4NKRA 1GFWA 1SCUA 3VI4B 2J41A 4LMAA 4FBMA 5FLYA 4EW6A 5ALSA 2WOJA 4EVIA 3A11A 3WLNA 3K6SA 3LYHA 4GLLA 2V7EA 4HAOA 3R3JA 2P1ZA 1GGHA 3G2QA 5TMBA 1JQ3A 1OGYA 2V7QD 3RAJA 4B0OA 5K03A 2PG3A 4BUZA 1P2SA 3AEQB 2Y2VA 1QKKA 4U2DA 4IFEA 1P0FA 4OYLA 1P5JA 2LBPA 5K20A 1CUFA 1N2JA 3DUFA 3EMVA 2IKSA 4WW0A 1IUKA 3JCZA 1J7JA 3UH1A 1Y5LA 4CT4B 4EFMA 4QOFA 2F1RA 1H2HA 1PFQA 2BHRA 4R7ZA 4R2IA 3T3HA 1YJCA 3AZPA 2FRDA 5K8TA 4CMGA 3UMRA 2NYAA 5I48A 3L4KA 2IGBA 1Q1EA 1WQ3A 3G2NA 5IC5A 4AZWA 2NO9A 1G8KA 3OEYA 4OL9A 1B4DA 1TQ2A 2ZE5A 3SGLA 4AN0A 5JNVA 2G8LA 4M0DA 5FIUA 5T4BA 4ERXA 5I47A 3MEQA 1FU7A 1KC3A 4DR2B 3AVWA 3LI2A 4AKGA 2J7PD 1Z35A 2I65A 4WK2B 2GI4A 4RLQA 3LCRA 3M5CA 3LF1A 1V7ZA 4PLHA 3B6IA 3QOFA 2CVZA 4HLNA 1NN5A 4OVKA 1E9BA 5HQ3A 4FYWA 4Q19A 1XCGB 13PKA 1K86A 4AICA 1Q74A 1VG8A 3SQOA 4NXMB 2XRMA 5EIBD 3CZPA 2X42A 1VYTA 2C4TA 1JLRA 2ZQ5A 1Y3FE 4KR2A 4UVHA 3CJTA 2PFSA 4MGZR 5JBQA 1RLTA 2PNFA 3OF3A 4NDNE 4YAOA 4KOEC 4U39A 3RIXA 4B3DA 3RRXA 3NBMA 2J9FB 4F6CA 5HM8A 2FP4A 3G5TA 2V98A 3KQVA 4FB4A 4JYZA 5ESDA 4OQEA 2DBVO 3ENZA 1IHYA 2UYCA 5AI4A 1G8YA 4UXHA 3UB2A 1FBTA 1ZGJA 4JVLA 4JUDX 2Q5LA 4Q9LA 4YAFA 3LYAA 3THWA 3WLPA 2PLAA 2VXBA 4EMSA 3UUGA 1QNFA 2O2DA 3F5FA 2PRYA 1H93A 4B87A 1ZONA 1HH4A 1Z4JA 1HYQA 2QVGA 6Q21A 1DMRA 2VK8A 2ZWIA 2JBAB 3C6ZA 1DFIA 4KPEC 1DQZA 1WPRA 3NDJA 1KGDA 3G82C 1P31A 4TL6A 2F4NA 3OE5A 4FE3A 2VBCA 4DE5A 2GXUA 4GQBA 4R2MA 2H4WA 2IOFK 3G2LA 3MQ4A 2ZR7A 3DO5A 1WQ4A 3RB8A 3LM8A 5F35A 3RVMA 1IWPB 2QAIA 1UJ6A 3TTUA 3T3NA 4YP0A 4L9AA 5HS6A 2E85A 1QCDA 2DG2A 4GC5A 1U2TA 4JJ7A 3OP4A 1CR0A 2CE7A 4PPGA 1A8QA 3GNSA 1R9GA 1C8KA 1KTVA 1XTSA 5HIAA 1UM9A 2R00A 5FA8A 4KP7A 3T7TA 4ARVA 3Q3GE 4XDGA 1AHIA 4RDCA 1RAIA 1WSAA 3C7CB 4PVCA 3WYGA 1ECPA 4MXDA 5HKOA 5JW6A 1VG0B 1SVNA 4RTKA 1M1ZA 1R6UA 2BFMA 2C95A 2FPKA 5DHAA 4DSUA 1UQTA 2P9CA 1VPDA 4DNXA 4ZD6A 1QAMA 1B8VA 9GPBA 2VF5X 2PD3A 4IIJB 1KI1A 4CVNA 5AHKA 3WLKX 1Q0UA 2FSGA 2PXHA 3OM8A 4O4JF 1WMBA 2P0AA 5E9JA 2VZLA 1E3JA 3TQFA 4CL8A 2CT8A 1ZWKA 3EPKA 1T10A