1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
b'MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyltransferase thiF
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
1EQ2A 3RCBA 1CIVA 3DBHA 1E3SA 1BXGB 2J3HA 2NM0A 3ETDA 3GDFA 4WCFC 3KSUA 3VAZA 3KRTA 4NBVA 4D3SA 3AUUA 1WW8A 1IB6A 4AVYA 4R1UA 5JDIC 1XSEA 1H5QA 2FPIA 4E2WA 1RYEA 1DPGA 3OHSX 4J4HA 3OJFA 4L4XA 3U5TA 3E8XA 3KZVA 1VI2A 1I3MA 3TZCA 1U7TA 2DC1A 1XU7A 2LDXA 4LSMA 2HSDA 1XDWA 1JW9B 1A5ZA 3UAGA 4UULA 5JPIA 5TS3A 1GDHA 1O94A 4FCCA 4XRRA 4J1NA 3LT4A 3ZHZA 3CZRA 3ENKA 3O38A 1Z82A 3ZV3A 5K6AA 3DHYA 5I7FA 4LK3A 1UZMA 2ZB8A 5H82A 4IDCA 2NVUB 1Y8RB 3E9MA 1ONNA 1KEUA 2P5YA 2XOXA 3I4CA 2WJPA 4JJGA 2CSUA 2HAEA 5HTOA 1VJTA 1M6WA 3R6DA 3F4LA 3HHPA 3KB6A 1EZ4A 3GNSA 4KTVE 1B3RA 4PG5A 1U7HA 2IXBA 3RQSA 4XIYA 1YO6A 1E77A 4NBTA 4BNJA 1E5QA 5B37A 3U4HA 1B3BA 4YT4A 4RGBA 3CEAA 3MJEA 2J3IA 4PLTA 2RBEA 3ZU4A 3WB9A 1I5RA 1EBUA 4J9UE 3B1KA 1DO8A 1O8CA 1XEAA 3FTNA 1QLHA 3UGKA 3BZUA 3JQAD 1B16A 2P9GA 4YACA 3LQFA 3FPLA 3D4PA 3WOHA 4E32A 1MB4A 4FFOA 1VJ1A 4NBUA 3FPCA 4FR5A 1PZHA 4M1QA 1V8BA 2OZPA 2NNLD 3Q9UA 2E37A 3U4IA 2YZ7A 2NLOA 1X15A 4EZBA 1KEVA 2PKQP 4MP8A 3WFJA 3JD2A 4CMIA 1B2LA 4W7IA 3LF2A 4OH1A 1GZ4A 2JHGA 1UP4A 2TMGA 4L4SA 1ZH8A 2YJZA 5I7SA 1ZKMA 2X0JA 3UH1A 1NFRA 3L4BA 4R1TA 4H15A 1V3UA 3JQAB 1HXHA 3K31A 3QW2A 1LQUA 4NJMA 4CM4B 4ND2A 4BO0A 1PZFA 3TJRA 3JQGA 2PH5A 4C7JA 1NASA 1E5LA 2Y67A 4GLLA 4O0LA 5EN4A 3D64A 1WLYA 3OBBA 1PU2A 1ADFA 3GVHA 1DFHA 2CDCA 5T8KA 3ZU3A 2X9NA 1DAOA 2O3QA 4PIVA 1N9GA 3PWKA 4RCVA 3VPGA 4TVOA 4BNLA 5CPBA 1K2WA 4G65A 4UEKA 1E1KA 2RHCA 1YL7A 5ITWA 2X0NA 4H7PA 2NADA 3VVBA 1U1IA 3OIGA 1Z6ZA 3DZKA 3JQ9C 1J4AA 3SBOA 4KDEA 1O89A 1P3DA 1WZEA 1TA4A 4IJVA 3C7DB 1U8FO 1E6UA 2VUUA 2EJVA 1E1LA 3WLEA 1EVYA 3ICCA 3JQ8A 3FI9A 4UVEA 4UUOA 4K26A 3R3JA 3Q9NA 1ZVMA 3N7UA 1TEHA 1V0JA 3F6YA 3TOXA 4KOAA 1E6EA 4RL6A 3VVCA 3NV9A 1X7HA 1EVZA 1FMCA 4DQUA 1ZJZA 4M89A 2VYNA 2OP1A 1BDBA 4MVJM 3H9EO 5EQDA 3ICPA 5LDHA 4KP7A 3A4VA 2FR1A 3C8MA 3E03A 2NQ8A 4NZ9A 1WNTA 4XGKA 1R0SA 4PLGA 1F8GA 1HTBA 3KBOA 3WLFA 4CLOB 5A9TA 1B14A 3WQSB 4E5MA 2J5KA 3AOGA 4XR4A 3PVZA 1UXGA 2PD3A 4ZQGA 5JAZA 4KUGA 4PCVA 2CFCA 3ON5A 3TZ6A 3RASA 1HDRA 2AE2A 2EP5A 3MOIA 1HL3A 2NACA 1B15A 2CVZA 2Z5LA 2V6GA 2EJWA 2I99A 4OYRA 4EEXA 4D3DA 1LLUA 2Y1DA 3HNPA 1W73A 2VZ0A 4RF3A 1HSOA 5G4KA 4IXWA 3SLKA 1Z75A 1KS9A 5LDGA 3ITKA 4FN4A 3ZW9A 3AM5A 4D44A 3E82A 4YJFB 1GR0A 2FOIA 1GZ6A 2CVOA 3W6UA 3PJEA 2QIOA 2DBQA 5TT1A 4A73A 4B4UA 1CDOA 3NRCA 4Z9FA 3G49A 4BKUA 4DQVA 1FK8A 4IDFA 2DFVA 2PKRA 2YDYA 1R6DA 3VPSA 3L9XA 4FSHA 5IAAA 2CDBA 1GQQA 3O8QA 1W8DA 1LBEA 4J1SA 3IMFA 3WIEA 3PEFA 4NJOA 3DZBA 4H3VA 4NPCA 3KLMX 1EFKA 4Q3EA 5JCJD 1G6KA 2O4UX 1ISJA 1SEVA 4OOFA 3ZU5A 4NIMA 1J0XO 1E3WB 4RLHA 5DULA 1LDNA 4TMFA 1VC2A 2X5KO 2YFHA 3ZGYA 5CG2A 4XRGA 5CDSA 2VNSA 4E5KA 3BMCA 7ADHA 4CV1A 1U2DA 3JD1A 5KCZA 1K5HA 1DRUA 1ENZA 4PGFA 1TT5B 5COQA 3RC7A 4J1TA 4YT2A 1HRDA 5DZSA 1YDEA 1I3KA 5F1OA 2JAHA 4W82A 5DCWA 4PG7A 2H5LA 3TSCA 6ADHA 4R3NA 3FWZA 3NTQA 1W6UA 3E5RA 4GQAA 3KO8A 4RLSA 2PZLA 4BNIA 4WCFA 4E2ZA 3AU8A 4Z0HO 2B4TO 3FN4A 3VZPA 1GEEA 3PQDA 3JYQA 3KLPX 1JU9A 4Q3BA 3LLSA 4M8SA 4Q39A 5G0VA 3VC7A 2NSDA 1L7EA 4KQXA 2G1UA 3ZZNA 1IYZA 4DIBA 4BV8A 4IQ0A 3WWYA 2JCXA 4YJDA 4CV3A 3M2TA 3AW9A 4LGVA 4YRDA 2GPTA 3HN7A 4W7HA 4DC1A 1E1NA 4J7CA 4R69A 4TVBA 3NTOA 1Q2XA 1NQOA 3NGXA 8LDHA 4YJHB 1IOLA 2G17A 1NHGA 2NUAA 3RUEA 4XZ3A 4HY3A 2BGMA 2EP7A 5G2OA 3SLGA 2HQ1A 1H9BA 3E18A 4O6VA 4IIVA 3K6JA 4YVFA 2OL4A 5JAQA 2WEKA 1D3AA 1VKNA 3KYCB 2Q46A 3DZFA 4Q3CA 4IGFA 2P91A 1A71A 4MVJG 2PGJA 4LMPA 3I23A 4MVJE 1T2DA 4Y6SA 4B7XA 5ILOA 3V8BA 2OFPA 5G0WA 4X54A 3JQCA 4EGFA 2UUOA 3GNTA 3O03A 3EW7A 1YKFA 3GUCA 2AEMA 1DDOA 1ZCJA 5AVOA 4DIFA 1VRWA 1O9BA 1HE3A 2WYUA 4RV9A 4XQEA 1PGOA 4B4VA 3FR8A 5AYVA 1BVUA 4JQCA 4MO2A 9LDTA 2CD9A 3WGIA 3DOCA 3PZRA 3ADPA 4ALIA 4RDHA 2O3SA 2QZ9A 3PYLA 2HLPA 1N1GA 2DPGA 1V35A 1M75A 4BMNA 4LVCA 2BRUA 5L95A 3DHNA 4PLPA 5BNFA 2O7SA 1N92A 5FEUA 4OQYA 4F6CA 2D8AA 2FMUA 4PN3A 1WWKA 4QO8A 4GAEA 3DR3A 4I08A 1UDCA 4BNTA 4HFNA 1GEGA 4ZRNA 1SC6A 1DIGA 1B26A 2VN8A 5C37A 3NT2A 2I76A 2P4HX 3WIDA 2PV7A 4R1SA 3HSKA 4W4TA 4YT8A 1CETA 1YL5A 3NDJA 4NG5A 1XKQA 2H9IA 4FJ1A 5L7YA 4BO3A 1SNYA 5KJCA 1BTOA 4LRSB 4WASA 4AJJA 4DC0A 2J8ZA 3GK3A 3NJ4A 3ZNQA 4IMPA 5CDTA 3RKUA 2W90A 3I83A 2FHSA 1EEHA 1NFFA 1SPXA 3RUCA 3VDQA 3L6DA 2WD7A 3KOUA 4KMSA 3EAGA 1T1RA 4KDFA 4NU5A 4YYZA 3UW3A 1LSOA 1CJCA 4EDFA 1UR5A 4Q3DA 5A9SA 3LT0A 1CQJA 5IN4A 5DBFA 1FDWA 4IINA 1NNUA 4EJ6A 1CWUA 2VUSA 4P38A 4QO7A 1MXHA 1R37A 3RBVA 2YFQA 3PPIA 3H4VA 4I9UA 4TRRA 3EUWA 5JNLA 3JQ9A 3PLNA 5H81A 3ANMA 4UREA 1S7CA 4Z9YA 2GASA 3GY0A 3WDSA 3DBVO 1F0YA 5L4SA 4RF5A 4CMHA 2ZYAA 4U7WA 3NGLA 4PRKA 2OBNA 1LLCA 1HDOA 3PWSA 1HYHA 1HZZA 3QVSA 1W4ZA 1EMDA 3OJOA 4AJ4A 1RWBA 1LDBA 1MUUA 4P4NA 5BSEA 3PHGA 1CEQA 3ZHXA 5CEJA 3PK0A 3F4BA 5EIOA 3TF5A 5CPFA 4BMSA 7MDHA 2O4CA 3X2EA 1VKOA 3ZV5A 3OJEA 5T67A 4D45A 2GRAA 2UDPA 1H2BA 1QYXA 1XLTA 4OOEA 4S3MA 3LDHA 1I8TA 2J3JA 2X9VA 4OSPA 4DMLA 3RWBA 3GVXA 4QFDA 4WECA 4A27A 5C5IA 3V5NA 3HFSA 3AJRA 2QQ5A 3O26A 2VT3A 2FY8A 4CLHA 1V3TA 3IDSA 1PGQA 2ZYDA 2B83A 3NDIA 1Z45A 3Q11A 4MVJI 5A02A 1S6YA 3GFGA 1A9ZA 3GN2A 1KY4A 2Q3EA 1DHTA 3EYWA 3EVNA 1NQTA 3L0DA 1PR3A 3JQBC 4Q9NA 3ZCXA 1HETA 5GMOA 2Q2QA 1R4MA 4HUJA 1VSUA 3W8EA 2R2GA 3L4BC 2PFGA 5JY1A 3PWZA 2FPPA 4LRTB 3MJ4A 4QSMA 4DMMA 4HFMA 2DVMA 3GEGA 1DRWA 1U5AA 3Q0EA 1I01A 1ZK3A 4DUPA 3V2GA 1WDLA 3ZHYA 4D42A 1PJ4A 2XAAA 1KETA 1NAIA 3GAFA 4J1QA 3TFOA 5T8KC 1YDWA 1DC3A 3DZJA 4M86A 1BHSA 2IZ1A 4MKZA 1JVBA 2EGGA 3M1LA 2YHIB 2XF8A 4GX0A 1GCUA 3TL3A 4KQWA 1NM5A 2I66A 3LLVA 1L7DA 1ULSA 3QVOA 3AI2A 1OMOA 1T26A 4PLWA 2E6UX 3CSDA 2QG4A 3R3SA 3FBTA 1SB8A 4CMBA 2BF7A 1YL6A 1JWAB 1U9JA 5JO9A 4NK4A 4TSKA 2EERA 1U5CA 3FBGA 3MTGA 1Y8RA 1YJ8A 3CTMA 4I9NA 2GN9A 3D3WA 1PGPA 1KIFA 1A4IA 5A5EA 3RROA 2VUTA 3EC7A 4ALJA 4BNGA 3Q2KA 5CDUA 2IEDA 4RF2A 1C0IA 3CMCO 3F47A 4MKXA 4NMHA 4CM8B 1UZLA 5JS6A 1E7WA 1JDJA 3OEYA 4NFHA 2NTVA 4MKRA 1G0NA 3IOYA 2WE8A 5ER6A 3U49A 4F3YA 4YAJA 2UAGA 1E92A 2I3AA 2PWZA 3MTJA 5TJHA 1QV7A 3PHHA 4FJ0A 5IZ4A 4JCOA 4YQYA 3HUDA 2JFHA 4BB6A 3WJ7A 5HBRA 2BMAA 2OO5A 2RIRA 1LC0A 3DOOA 2Y99A 4ZQFA 5EMHA 5A05A 3G79A 4ND1A 1A27A 3HDQA 5T64A 1M76A 5G0SA 2IODA 3UUWA 3HE3A 4FC6A 3HWRA 4JGBA 4EBFA 3F3SA 1PWZA 2YV3A 2B35A 1H93A 3H65A 3KV3O 4GMGA 3GPDG 1GYPA 3H9GA 4Z0TA 1GV0A 1K89A 4JNKA 2O48X 4DREA 2RH8A 3JCZA 5KTKA 4KUEA 3WWZA 2DFDA 1NVGA 4BKRA 3WBFA 1UXIA 2DTDA 3C3XA 3KXDA 2W2LD 5I7VA 4OSOA 1WDKA 3H7AA 3JQAA 1J5PA 4WOKA 5JYEA 2VHVA 2WMDA 4CM4A 1MA0A 3ZV4A 2H63A 3FF4A 9LDBA 1LLDA 3AOEC 3GN1A 2V7PA 1LI4A 1Y81A 4WK6A 4EUEA 4D7AA 5COBA 3GMDA 1DIRA 4XGIA 3WG9A 1HF3A 1HDXA 1JQBA 1UXJA 4NR0A 1Z74A 4YR9A 2I3GA 1HE2A 1Z7EA 4AL4A 4W99A 3BHIA 5DP1A 4XDYA 4TQGA 4J3FA 4HFRA 5KVVA 5HRUA 3RC2A 2EWMA 1GYQA 2Y1FA 1EUDA 4ZQEA 2DTXA 1F17A 3H2ZA 1BXZA 2X7HA 3A9WA 4YJGB 3GPIA 5F5LA 4ZU3A 8ADHA 2OGUA 5HS6A 4AJNA 1LXCA 1YJQA 1H6BA 4JXKA 5ICSA 4UEJA 2RH4A 3FNHA 2HCTA 4IDAA 4ESOA 3VH1A 1PJ3A 4BNMA 5MGBA 1KY5A 2XXBA 4MOWA 2OP0A 2Q2WA 3DBLB 4WLNA 3BMOA 4FIZA 1AXGA 1VJ0A 1EQUA 5FI5A 1GADO 1C1DB 3EY4A 3QIVA 4J7XA 4BVAA 3CINA 3OA2A 3ADOA 4YQZA 4QTZA 3WS7A 5HS4A 4LMRA 2Q49A 4JP2A 3G1UA 1NR1A 4GMFA 3WSVA 5TLSA 3ONEA 4GPD1 3TPCA 4A5OA 1Z73A 1RM5A 4IMRA 3BMQA 4CV2A 2V6FA 3IP1A 5IG2A 1C1XB 4TROA 4BGIA 2B0JA 3BMNA 1DC6A 3JYLA 2IXAA 1DB3A 1Y8QA 1R0KA 2X5JO 1GQ2A 3JQ6A 3GRKA 3DTYA 1CYDA 2FSVA 4CMAA 3WNVA 3GT0A 2P5UA 3W4JA 4E3ZA 4Y9DA 5L53A 4ZN6A 1KVTA 4FFRA 4UVGA 2C82A 4IQ8A 2VRBA 3V1TC 1ENYA 2GDZA 2AQHA 1BMDA 3GLQA 1HLPA 4PZEA 4E4YA 1ISMA 4OKNA 3DAFA 1FF9A 3ULKA 3LVFO 1VL0A 4TRJA 1Y6JA 4L73A 5AXAA 2AW5A 1ADGA 3PFWO 3JQ7A 3TDKA 5ER9A 2H6EA 3ZI0A 1UDBA 1IL0A 4Q3AA 1ONOA 4OO3A 4YJFA 2Y1EA 5FF9A 3MJTA 3SC6A 1O0SA 1VPDA 2DLDA 3DAGA 4BIIA 2O3UA 4B7CA 4OJNA 3NT5A 1CRWG 1ZMTA 1R66A 3PGXA 5U1PA 1PQPA 2Q45A 3DHEA 2C7VA 3E6AA 2I9PA 3MJVA 4FB5A 1GFSA 1DC4A 5AQ1A 1BXKA 1GD1O 3WMWA 1DIAA 1N2SA 1JVSA 2FZWA 4JBIA 3INRA 4ZD6A 2G82A 1K6XA 4ND3A 5L3ZA 2GN8A 3GZNA 3PIIA 1ZFNA 4N54A 3ZWBA 4BNHA 4JK3A 2VWPA 3OQBA 4Z3DA 5J23A 3WFIA 2BHLA 1I3NA 2GZ3A 4WNIA 2WM3A 3TRIA 3EGOA 4IDGA 3AM3A 1B0AA 2AEFA 2B36A 2G5CA 4MJLA 4IDEA 2D1YA 2PA3A 4GWGA 2GSDA 3JQBA 1PS0A 1X13A 2P2SA 2VHZA 3GAZA 4WLFA 3SEFA 4WOJA 1Q7GA 1E1MA 4DPMA 5CEEA 5CEFA 2QYTA 1L1FA 3DMYA 5LC1A 2EKLA 5IDXA 2UV8A 4KUHA 4PRLA 2NVWA 1J49A 4DYDA 1K6JA 3V2UA 1IULA 2QZZA 4GGPA 5DOVA 3ZWAA 4KWIA 1NAHA 2AQKA 5JXWA 4BUCA 4NHEA 4YRBA 2BD0A 4CUZA 4OGWA 4HADA 4CJXA 2VOJA 4IJWA 4OAQA 4GKBA 3ETGA 3INGA 1KC1A 1LTHR 4WCDA 1JTVA 3JQDA 4NK5A 1ENOA 3N58A 4J2OA 3B70A 1VM6A 4O63O 1OC4A 4FFLA 5EESA 3RIHA 1JLLA 4R51A 1ONPA 5I9NA 1GV1A 2P4QA 3DZIA 3L77A 5JC8A 1PJLA 4TZTA 4BO7A 1I10A 4I8XA 1BW9A 3GRPA 4E5NA 1XIVA 3DBRA 2DBZA 1IHYA 4IIUA 5JE8A 2C54A 1DBVO 3KSZO 5EERA 2VNAA 4U0KA 5AXDA 3ZNNA 3BTUA 2O3JA 4IGEA 3I9NA 5AXCA 3GNQA 4QEDA 1R12A 3UHAA 4BO6A 1ML3A 2YDXA 3RC9A 4FOSA 4OL9A 2X86A 1C14A 1OBFO 5BQFA 5EJ2A 5FWNA 4RVHA 4B3IA 5JSFA 3LF1A 4GSLA 4R01A 2Q1UA 4J16A 5KVSA 3D7LA 3H5NA 2DUWA 1ZK1A 3PJGA 5I8ZA 5BSGA 2VHXA 4CLRB 2Q4EA 4IJUA 1R4NB 2Y0DA 3DBHB 3FHLA 3VZSA 4P4LA 5K9ZA 3OJ0A 4IPTA 4YAGA 3FNFA 3BXXA 4I9HA 4XB2A 1QP8A 3RFXA 2QHXA 5B12A 4O5OA 1UXKA 2HK8A 3OQ6A 4XJTA 2X0IA 3BHMA 4OM8A 2PZKA 1K3TA 3QWAA 5B4UA 1DLIA 1AUPA 1P0FA 1U4SA 1XCBA 2HMUA 3D1LA 3UXYA 1MX3A 2OHXA 1HT0A 4YEDA 2Q1TA 3AFMA 4HNGA 4EJ0A 1OZAA 1UH5A 3HB5X 1NVMB 1AHHA 5I8WA 5HA5A 4MINA 4D43A 1E7QA 4ITUA 1VE9A 3JD4A 3WGTA 1YGYA 4E33A 4OMUA 3DL2A 2YV1A 2CUKA 3MWEB 2QRJA 2Y66A 3AWDA 3P5SA 1ENPA 1PZGA 4Z9XA 3WYEA 4B8ZA 4DVJA 2EV9A 3VKVA 4TRMA 4INAA 5GY7A 1I0ZA 3DONA 4JN6B 1IZ9A 2OXIA 3LC7O 4LCJA 4QX6A 5DDIP 2PZJA 1LSJA 3AOEA 4J91A 2O50A 2EF1A 4GH5A 2IE0A 4XQGA 1A4UA 1C3VA 1I2BA 4Z3KA 1HZJA 2RAFA 1IE3A 1U8XX 1ZXBA 2AQ8A 1LSSA 3RAJA 2BFOA 4ZHSA 3BHJA 2WSBA 2YV2A 3IJPA 1KEPA 4L76A 2VTDA 3WGOA 4CL3A 4NFSA 1LDYA 4N5LA 3GGOA 3RVDA 4R9RA 5L4NA 4HWKA 4B79A 4D41A 1BDMA 2B4RO 5KVQA 3VZRA 5JFOA 4J43A 1B8VA 4WLEA 2EG9A 3CIFA 3WNQA 2ZATA 3DFZA 1ISGA 2NU9A 3E48A 4XYBA 1WVGA 2Q99A 5L40A 4RPHA 4IZHA 4R54A 3HDJA 2DM6A 2GR9A 3I3OA 3O9ZA 4OXKA 1LDEA 5H83A 1YOVA 4BO8A 3FRJA 3RBXA 4CMIB 3UN1A 4NFYA 1KOLA 5CG1A 1CQIA 1I30A 3GGPA 1SCUA 4FGSA 1JAXA 1F12A 2P9CA 5U4QA 2PD6A 3ONFA 4WEOA 4PVCA 1HEUA 4CQMA 3ZWWA 2PH3A 4NJMB 5G4LA 3GG9A 3DC2A 3CPSA 3JV7A 2I67A 3JQGB 2AXQA 2ZTMA 2GD1O 4HXYA 3V2HA 4RJTA 1PGNA 1I36A 4ALNA 4IJKA 1E7SA 1RJWA 1EDZA 1O95A 4B3HA 2YHUA 3MJCA 3VKUA 1N9GB 3IJRA 1UP7A 1E3EA 3G17A 1Q7CA 1GUYA 1N7HA 1NQ5A 2C07A 2FZEA 2HK7A 5ES3A 1UJMA 2X6TA 3NYWA 4NBRA 2VYND 4DQXA 2W2KA 1DJNA 4LSWA 2W98A 3BTVA 4FS3A 3ROQA 4BS9A 4IS3A 4CMJA 4EUFA 3Q2IA 3HB4X 1AN9A 3KYDA 3ZWOA 1F8FA 4JBGA 1A72A 2JCVA 2IZ0A 4E12A 5L9AA 2A92A 3NJ8A 4ALMA 5HWSA 3ANNA 2D2IA 3PDUA 2VCYA 1PJBA 4GWKA 4HP8A 2X9GA 3IAHA 3RBZA 1P33A 1GAEO 1PTJA 1T25A 4K6CA 2EW8A 1KVQA 3JQ8B 2ZKLA 1D7OA 4RVFA 1P0CA 3H2SA 3OFSA 4TKLA 1H6DA 3RUDA 2GF2A 4HV4A 1EBFA 4YTEA 1LRKA 3U4CA 1DLJA 2TMDA 1N7GA 1ZO8A 4GGOA 5GZ6A 1LSUA 2ZQYA 1Y9EA 3RUAA 3PFFA 1GTMA 2B5WA 5L7WA 1LRLA 4YPOA 3OEWA 1YS4A 1FDSA 4GI2A 5DOZA 3TL2A 3FSRA 2FN7A 2OMEA 2BLLA 1NWHA 3WGGA 4YAKA 3Q3CA 4Z6KA 4UUMA 3WQQA 1SEPA 3S2GA 3ZNPA 1MP0A 3Q6IA 1XQ1A 3AY3A 3D4OA 3TWOA 4PVDA 3PJFA 1QYVA 1Q1NA 3LK7A 2VWGA 3K8ZA 1BWSA 2Y1CA 2CF6A 4RPLA 4F46A 2I5PO 4GVLA 5A04A 2CY0A 1ZNQO 2D0IA 5G4KB 1B7GO 3PTZA 1XGKA 5DBGA 4J7UA 5G0TA 4CM8A 3GQVA 3K96A 1J6UA 3GG2A 4ZQBA 3D0OA 4EITA 4RVGA 3PI7A 4YDRA 4UEOA 1TVEA 1PZEA 1QYCA 3I6QA 1XA0A 2VZ8A 4UUNA 3Q1LA 1EK5A 2POQX 2AE1A 1V6AA 3GOHA 4ZVVA 3B20A 4K9DA 4QT0A 4CQLA 2J3KA 1DFGA 4MIOA 1ZK4A 3DQPA 2O23A 4L74A 4YBZA 3H8VA 1LDGA 4IY1A 4P8RA 3QRWA 3LT2A 4BB5A 6LDHA 1P1RA 4ALLA 1HDCA 1MGOA 1DEHA 3BIOA 1JKFA 4U0JA 3B1JA 3W6ZA 2DPHA 4RF4A 5CP8A 4MVJH 2J5RA 1GPJA 2ILTA 2WD8A 1QSGA 3I4FA 3BMCB 3RI3A 3I9OA 2AA3A 3ZW8A 3TQHA 2VWQA 5I9LA 1JN0A 2VYVA 1E3JA 4XQ9A 5T6BA 1HDZA 1OC2A 4GVXA 4I5FA 4I5DA 2FR0A 3WBBA 2FSSA 3NX4A 3FR7A 3RKRA 3WTBA 2HMSA 3QSGA 4A0SA 3AUAA 5ADHA 4J49A 4AJIA 3ROKA 4M54A 4J9VA 1K0UA 4JLWA 3GGGA 4OQZA 4QQRA 2Z1MA 4BNFA 2BFMA 3D4NA 4WCFB 3JQFC 2DT5A 1VL8A 2FWMX 2HK9A 2JFGA 1O5IA 4E2YA 1AGNA 5JDCC 1NYTA 5FI3A 2C59A 4A2CA 4CMEC 3WGQA 4WEQA 4XEHA 3UKOA 5U9CA 1PGJA 4MVJP 3NUGA 2DAPA 5L51A 3OIDA 3VZQA 3I9KA 1HWYA 3TZHA 1DIBA 2ZTLA 3HFGA 4M87A 2JD1A 3W8FA 3V1YA 4G81A 3TFQA 2D4AA 3P7MA 2C2YA 1ID1A 3S2IA 2OUIA 3WTCA 4ZA2A 4XB1A 2HRBA 4ZRMA 2XXJA 1NFQA 4YRAA 4ZICA 2X4GA 1BXGA 3ZWYA 1YE3A 4CUKA 4AJPA 3VHRA 3AI1A 2V6MA 3D5TA 3IS3A 3KYBA 1NQAO 1BVRA 3G3EA 3IP3A 4XIJA 4U5QA 4CV0A 1ZJYA 4LVUA 2C0CA 2BFAA 3WQRA 4C7KA 1QRRA 4IS2A 2V6BA 2V65A 3RSHA 4BOYA 4FFPA 4DIOA 2ZK7A 3AY6A 1ORRA 3CE6A 3H3JA 3HZZA 1HDGO 1EVIA 3KSDO 1SAYA 1M67A 2GZ1A 5ICMA 4YB8A 1C0PA 5FYDA 5DP2A 2IDZA 3C1OA 5IZCC 3FWNA 4RORA 5B1YA 1GL3A 3I6IA 5BNTA 4Y6RA 4FFNA 2NVUA 5TRTA 3E5MA 4QXMA 2FR8A 3EMKA 3GEMA 3PQEA 4ALKA 3BAZA 4IXTA 3PLRA 4RQUA 4FFMA 4RVDA 5F5NA 1EVJA 4LISA 5JAMA 4I5GA 4A03A 1SOVA 2GN4A 3VTZA 4TKMA 3DB2A 4Y8VA 3NKLA 5DNAA 4MVJD 4GX1A 1YBAA 4LN1A 4CR7A 2NWQA 1H6AA 1SOWA 4II3A 4Y98A 5L7TA 2GNAA 1MFZA 3WYBA 1ISFA 1P45A 4ZQHA 2Q2VA 2EIHA 3PGJA 4XWYA 2PKQO 3GHYA 3L9WA 1KVSA 4HBGA 2ZJ1A 5HM8A 4HKTA 1DC5A 1YONA 1LRJA 1D1TA 1DHRA 1X1EA 2AMFA 2WD7B 1IPFA 2C7GA 1UZNA 4GKVA 4IBOA 5THKA 3GH3A 2DUUA 1PQWA 5A9SB 1GY8A 3JYNA 5L45A 2JD0A 4CMCA 4AICA 2HO5A 4RZIA 3INTA 1WMBA 3LZ6A 1HE5A 1YB1A 3AFNA 4AFNA 4EYEA 2HMTA 3AU9A 3AK4A 4N7RA 2VT2A 3DTTA 4KWHA 4A26A 2UYYA 3F9IA 5A3VA 3RUHA 3U62A 5F1KA 3M2PA 3A14A 1E7MA 1NP3A 5JCXA 4BMVA 4CM9D 3PIDA 2PGDA 3O4RA 4FBGA 5JBIA 2E48A 1LQTA 3ZWPA 1R0LA 4BNZA 4CPDA 2IZZA 4XD2A 5KWEA 1DRVA 1VL6A 2H1SA 2OBYA 4BHTA 3H3FA 4R5HA 1I2ZA 5CHEA 2GYYA 1I24A 2HMVA 2Q50A 2I6TA 2A4KA 4E21A 2YW9A 2BELA 1HYEA 2VQ3A 2C5EA 2PLAA 4R1NA 4QECA 3VH4A 4EEZA 2VTEA 1MFPA 5DF1A 1MC5A 5TT0A 3DMTA 3U4DA 4DLLA 4BNUA 2JJYA 2DQ4A 2ZQZA 3M6IA 4XA8A 3VH3A 3K2EA 3K92A 3K5PA 4BGVA 4E30A 4YWJA 1T2EA 3ZDFA 1W0CA 3LT1A 4ZJUA 4R5MA 2YYYA 5TX7A 5T57A 4N18A 1FJHA 1OI7A 1QG6A 4AJ2A 1T4BA 3UF0A 3WYCA 4IDDA 2LDBA 3QWIA 1TB4A 5TIIA 4DTIA 1I32A 1Y1PA 5F1PA 3GUYA 1IPEA 4RZHA 5EQFA 5JYDA 1R4MB 4EUHA 3VOSA 4CLXA 2NU8A 1XWFA 3RU9A 2FP4A 4N5MA 2Y1OA 4HNHA 3JSAA 5JY6A 3CKYA 4BGEA 3IIEA 1BG6A 3DOJA 4CLRA 4BGUA 5A03A 4BO2A 1R4NA 1XYGA 4CLOA 1C0LA 1JA9A 4K28A 3IQDB 3PQFA 4L4RA 1KYQA 3UOGA 1YH3A 2QX7A 4EJMA 3U09A 4BKOA 1TT7A 2R00A 3EK2A 3ITDA 3WICA 1FXSA 4M55A 1RM3A 3S55A 3UICA 2NVBA 1XQ6A 5BSHA 3E9NA 4R3WA 4H16A 1NR7A 4PLVA 1XELA 2QYSA 4L9RA 3V1UA 3ZWVA 1RM0A 1N8KA 1Q0QA 2B69A 4JP3A 4J2HA 1ZSNA 4FQ8A 4B7UA 1G0OA 2ZJ0A 3CH6A 4B3JA 3GC6A 1D4FA 3D5QA 3BTOA 3K2BA 4J6FA 3D3WB 3U0BA 4DYVA 1H9AA 3SXPA 2WTBA 5GZ1A 4UUPA 1PIWA 1TI7A 5DT9A 1ISIA 2PK3A 2CF5A 2NTJA 3RFTA 4PFJA 3ZWNA 5B4TA 2EKQA 3T7CA 1E3IA 4XYLA 2YUTA 2VRCD 3JQFA 4FC7A 1ZBQA 1XHLA 5C3MA 2GN6A 3TZQA 1T24A 5KJFA 3QJ5A 2D3TA 3EZLA 5JDCA 4CMEA 4U6SA 1P74A 5TQVA 1P31A 4E5PA 4ND5A 3PXXA 1E3WA 4PG8A 2ZTUA 4NQZA 2DTEA 2HJSA 2BKAA 1PJCA 1LEHA 1MG0A 3ZWXA 2AQIA 3QP9A 1EUCA 5IDYA 3I52A 1TT5A 5BSFA 1P77A 1DFIA 1ULUA 4ND4A 3F1KA 4RVSA 3I1JA 5A9RA 1IHXA 1XG5A 4BO4A 5DCYA 1KVRA 1U4OA 3H6KA 4FGWA 2ZCUA 5FFFA 5A1TA 1T4DA 3L6OO 4B8WA 4JJIA 4D3FA 1K6IA 2IYOA 3B6ZA 4WLOA 5K0ZA 1M2WA 4GSKA 5JCJA 3VTFA 2DU8A 2VHYA 2Q1SA 4OHUA 3JYPA 3MEQA 3H5RA 4DPLA 1U28A 2ZB7A 4PLZA 1ISHA 1TLTA 1KBZA 1PX0A 3DAPA 3AY7A 3MZ0A 4NU6A 3OH8A 1WPQA 1QR6A 3GHHA 1AE1A 3I9LA 5IJZA 4R68A 4YJHA 3BTSA 1P9LA 2X0RA 4J4BA 5IZCA 1WP4A 3HADA 4XR9A 3LC2O 3GF4A 2GCGA 4DRYA 4E5YA 3DO5A 3T7EA 5KNLA 1SZJG 3P2OA 5MDHA 4AJ1A 3ZH2A 3RC1A 2A9FA 3C1TA 3C7CB 4RDIA 1LDMA 5IF3A 2O2YA 2ET6A 4XYEA 5TGDA 3KYCA 3H9QA 1N1EA 3ASVA 3QE3A 4F6LA 1GUFA 2VZ9A 1RPNA 3NT4A 3K9QO 3D3EA 4FPXA 4G5HA 4GL4A 1DSSG 2E49A 4YXFA 4E13A 3B1FA 4IUYA 2R6JA 2QRLA 2EW2A 2AEJA 5TC4A 3CXRA 2GERA 5KJ1A 1V9LA 2JKVA 1GQYA 1JKIA 5EPOA 2JD2A 4PLYA 4YAIA 3ETEA 1ZEMA 1H94A 1V3VA 3QY9A 1ZK2A 3BMOB 3DEYX 3QWHA 3VDRA 4HX5A 5KKCA 3PYXA 2X5OA 5DN9A 5B4VA 2EHDA 3RFVA 4D0SA 4UVHA 3C85A 3WGYA 3KETA 1DAPA 4JROA 1H0KA 4URFA 1FDUA 3BMQB 1WXDA 3G1TA 2CZCA 1YB4A 2GLXA 2W4QA 1UDAA 4XGNA 4XQCA 3KEOA 2WE7A 4Z0PA 4R41A 1NWCA 3X2FA 1GCOA 1DJQA 4AJOA 4RVUA 3BMNB 2F1KA 2Y0EA 4JIGA 3KHUA 4ILKA 4BKQA 5ENDA 1Y8QB 1MC4A 3JD3A 3QVTA 5KIAA 2PNFA 3SJUA 4BNXA 1H6CA 3NEPX 2YQ5A 3COSA 3IKTA 1PJTA 1O6ZA 5KJ6A 4K1LA 1Q7BA 1R15A 4DBVO 3OA0A 1RYDA 3QLJA 2PZMA 4O1MA 4E6PA 1HSZA 1BRMA 3C24A 4OXYA 5BR7A 3S1LA 1QORA 2HDHA 3W4KA 4W6ZA 1PJSA 1UUFA 4ONEA 2W8ZA 1SMKA 3HG7A 3JQ7B 5JAIA 5JC1A 1WMAA 2OORA 2O3TA 1GUZA 3E9QA 1PQUA 1WDMA 1A7AA 3WMXA 5I7EA 4F45A 5EL0A 4IDBA 4ROSA 3TN7A 4CUJA 4E2XA 1LJ8A 4P4GA 1OOEA 2ZTVA 1X1TA 5TJ9A 3ZN2A 4A10A 3QV1A 1ZXLA 3TOZA 3LSYA 1NXQA 3ROMA 2JHFA 4NH4A 3ONDA 2HJRA 2WYVA 3GZNB 5ENVA 3S2FA 3WX0A 1T2CA 1BGVA 3EDMA 4KZPA 3DXFA 2JL1A 4BQPA 2NQTA 1YBMA 2Y0CA 1N5DA 4WKGA 3GMSA 4AG3A 2IYPA 3PYMA 2X8LA 3AI3A 2BI8A 3JTMA 3ZV6A 4PG4A 4FOOA 2Q4BA 4RO0A 2CMDA 2ZCVA 1YWGO 3BA1A 5ILGA 4A7PA 4L0QA 4D46A 4D79A 2FPGA 3FNEA 1GZ3A 1PR9A 2NU6A 4R9SA 4RPJA 3EHEA 1ZK0A 1NVTA 3C1AA 5F21A 3IUPA 2E4AA 3L6EA 2AHRA 3QHAA 5TSDA 4RPKA 2EGHA 4S1VA 2HUNA 5JDIA 4MPDA 2RCYA 1ZSVA 2C29D 4XX0A 4W9NC 3I9JA 3CZMA 4M49A 3PHIA 4DLAA 4DXHA 1YBVA 1LU9A 3GA0A 3OF2A 2AG5A 4U8GA 3WJAA 1YXMA 1MG5A 4HFJA 3QWBA 1E3LA 1F14A 4AJKA 1F06A 3LU1A 4EW6A 1BW9B 5I9MA 4MVJF 1U3WA 3DBRB 1X0VA 2HRZA 3ASUA 3DZHA 3K30A 3RU7A 1D8AA 1GPDG 5THQA 3SC4A 4CL8A 4LCEA 3FNGA 3JYOA 2PD4A 2PGLA 3R1IA 1PL8A 1RKXA 1SBYA 3U9LA 1KVUA 3UVEA 5IDQA 3FD8A 1Y5RA 3IKVA 3VPXA 1EDOA 2O7QA 4BNYA 3ENNA 4DWVA 2YHIA 3KEQA 4YCAA 4CM1A 5T5QA 2XPCA 1YQDA 3N74A 1T1SA 3PP8A 1P1FA 1AXEA 4CODB 3RUIA 2CNBA 3ROPA 2CVQA 1PS8A 2Z95A 1LA2A 3OICA 3DMTC 2J6IA 5TF4A 1A9YA 4IZIA 2G76A 1SO8A 1CF2O 3IL2A 3CUKA 1HLDA 3RUFA 4BO1A 5IXSA 4C4OA 5C7LO 3H9JA 3HDHA 3QVXA 4L75A 4DLBA 4D0RA 3S2EA 1PEDA 3MJSA 5CAEA 5L4LA 1LNQA 4GLOA 1IUKA 1WZIA 4MP6A 1QMGA 3QQPA 2ZB4A 1U2GA 1SB9A 2ZYGA 3KVOA 3NDRA 4LW8A 4WPGA 4J0EA 3PHLA 1UAYA 5IDWA 1D1SA 2G0TA 3KTDA 1PJQA 5COAA 3GDGA 3OETA 1ZZEA 1BSVA 1E6WA 3HDYA 5A06A 1T2AA 3I9MA 2DBRA 1VSVA 3MOGA 4PLCA 4WE3A 1G1AA 1LX6A 1R16A 2Z1NA 3FTPA 1OAAA 2D5AA 1Q0LA 3TZKA 4I5EA 4ID9A 3PJDA 2B5VA 5BT9A 2R00C 2PTGA 1E7RA 3BYZA 5JO0A 2X22A 4RPGA 3HQ4O 4PZDA 1X7GA 4R4JA 3L07A 3O8QB 4BL5A 4CMGA 1GU7A 2BI7A 3GEDA 3U3XA 4XJSA 3ZWCA 4FDAA 2GGSA 5KJEA 3HN2A 1B8UA 3OQ1A 1P1KA 3GVCA 3UCXA 3TNLA 2VOEA 1NBOA 4YT5A 2DBVO 4Y67A 1DIHA 1NPDA 3JD0A 4CM6A 1X7DA 5K6AC 1Y7TA 3H5AA 1ZIDA 5ITVA 4I1IA 2WYWA 4CQMD 4ZGWA 5G0UA 1NPTO 3WSWA 3OJLA 1JKJA 3E1KA 4BV9A 3SVTA 2WWRA 2P9EA 2YQ4A 1CERA 2BH9A 4MVJA 1EK6A 4YAEA 2F00A 1KC3A 2O3RA 2QRKA 3GZ4A 3C7AA 4TZKA 5KKAA 3ZHBA 4Y6PA 2X1HA 1YOVB 2HMWA 4MDHA 4OKIA 4FJ2A 4JJFA 1IY8A 2QW8A 4NBWA 1A7KA 1MLDA 4IM7A 4BNVA 2YY7A 3H9UA 3HJAA 2UVDA 4K6FA 1E0DA 4XCVA 4CM5A 3DWFA 4XYMA 3RJ5A 1M6HA 1EE9A 4CQMB 2EKPA 4CM7A 2I65A 4JBHA 2W2LA 1VLLA 3QWFA 1H2HA 4KTTE 4YJGA 4PLFA 2C5AA 5EINA 4L8VA 4J4TA 1PWXA 3CMMA 3OP4A 5F3RA 4CM9A 3JQEA 1C0KA 2A35A 5IFLA 3OM9A 4BKPA 3ORFA 5AOVA 5AXBA 1LC3A 2ZB3A 3W1VA 4XKJA 4GX2A 3QA9A 4E0BA 3DBLA 3PRJA 3ZNOA 5JMWA 4B4OA 2W2KB 3LYLA 3AM4A 4DBZA 1XU9A 2GUGA 5JMPA 1LUAA 1C1DA 2VWHA 3KYDB 1QV6A 4BNNA 1EE2A 3R0IA 2RHRA 4CLEA 1U3VA 2IRWA 5IXYA 2J5QA 3RJ9A 1EFLA 1NHWA 4GX5A 3MWDB 3M1AA 3F5QA 4CLDA 4E31A 4BO9A 3UCEA 1TXGA 2UUPA 3ABIA 3F1LA 2AG8A 2A94A 3QVWA 2D5CA 5DBIA 4O59O 1C1XA 1E7YA 4WGGA 4FW8A 4AJLA 5C7OO 5CDYA 4OIMA 1NX6A 4AJEA 2O2SA 3NAQA 3ZU2A 4EI2A 1B8PA 1PJ2A 2CDAA 1OFGA 5A4DA 3STHA 4CR6A 1HDYA 3VH2A 1I2CA 2SCUA 4WNCA 2B37A 1FDVA 4MP3A 1X0XA 4GBJA 1QYDA 2Q1WA 4WJZA 4MIYA 1AHIA 5DCUA 1PL7A 3S8MA 2NTNA 5C7IO 2WDZA 4PZCA 1Z7BA 3PHJA 4WUVA 4IQGA 2NV6A 3RD5A 3GVIA 4P22A 4BNKA 4FD3A 5JW6A 3EVTA 4JX8A 5A5FA 3LC1O 3IUSA 1DXYA 2NU7A 2HU2A 2C20A 1YQXA 4NDNE 3UFXA 1P44A 1ZSYA 1DOHA 3K73O 4CMKA 1YRLA 4CR8A 4DL9A 2Y68A 3UCFA 3DDNA 1HKUA 3PZBA 1QKIA 5IN5A 1XR3A 4DGSA 3DFUA 1P1IA 5BNIA 3GVPA 3A28A 3PDJA 4TWRA 1I33A 1P1HA 1NPYA 4XYGA 3SX2A 3W4IA 3OECA 1PS9A 4PG6A 1HE4A 4PLHA 1X14A 4NI5A 5GZ3A 1HYGA 3AUSA 3P19A 4W9NA 3T4EA 2B4QA 2JCYA 4RQTA 2GZ2A 1ZMOA 3KUXA 3T4XA 3W8DA 1U3UA 2VYVD 5JLAA 1UP6A 4J90A 4NNJA 2DKNA 3FCOA 1ARZA 4CQLB 4CM3A 2JFFA 4BQRA 2GO1A 3L4SO 4TRNA 1QLJA 2BGKA 3VPFA 4WLUA 4UVDA 1Q0HA 5A3JA 4BO5A 4BNWA 1Y5MA 3VPHA 1NTOA 1PSDA 2PR2A 3ST7A 3OMLA 1Y9AA 1YQGA 1FDTA 1GYRA 2VRCA 2BGLA 2VHWA 1P1JA 1ZW1A 1KERA 1YVEI 3GFBA 2X58A 3DZGA 4MIEA 1ZUD1 3WR5A 1JAYA 1LLQA 3I5MA 5KVCA 3GR6A 2Y93A 3G0OA 3F46A 3WGZA 3ANLA 1QXSA 4UVIA 3EZYA 1IZ0A 2E82A 3P2YA 4G2NA 5LCXA 4R16A 2BFPA 1ADCA 1WAMA 2EXXA 4YA6A 3KM0A 1M66A 4N5NA 4B4WA 4WLVA 3WXBA 2D59A 4UAGA 1RM4A 3GDOA 3WGHA 2P68A 4DPKA 2HKIA 4II2A 3OSUA 3AUTA 4XDZA 3F5SA 2X23A 3A1NA 3NTRA 4Q3NA 3OIFA 5CFZA 3IC5A 1ZEJA 1ADBA 2OOSA 2Y1GA 3ZWMA 3SJ7A 1MV8A 1YB5A 3A06A 1JWBB 4DA9A 5CDGA 4OXNA 5TNXA 2EEZA 2FRDA 1MXFA 4U6QA 2IEBA 4J0FA 1U3TA 4QUKA 1QYWA 2ZIZA 2C2XA 5KOIA 4AJHA 1I3LA 1T2FA 1KEWA 1UAGA 1UXHA 3MCVA 1EUZA 4QFCA 2JAPA 2Y05A 2PY6A 1PL6A
chains in the Genus database with same CATH superfamily
1CDZA 3VV2A 1CIVA 4HF7A 1BXGB 4CG1A 3BWVA 2NM0A 2PIAA 2X4IA 3VAZA 1L4GA 2QSYA 2VHCA 1QQTA 5K3EA 3VKGA 4ZOBA 3A3YA 2UZ0A 4RHFA 2NO1A 1XVAA 1IB6A 1ZRHA 3DNFA 3I12A 4R1UA 1XSEA 5JDIC 3RREA 2XNHA 1JB1A 5KNCH 2HSJA 5TARA 3UWPA 1W94A 3OC6A 4J4HA 1Z6XA 3OJFA 4BYGA 3KZVA 3DVRX 3VC7A 3QX7A 5I7AA 4BMXA 1I3MA 1N6NA 4AULA 3TZCA 5IVPA 2O8FB 1U7TA 3SYRA 1XU7A 2VZLA 4LSMA 3USES 4RTKA 1USWA 1XDWA 3Q10A 5FAXA 1QFJA 1R6AA 2PWBA 4CN9A 1A5ZA 2X9QA 3E9YA 1Z5UA 4N48A 4C0KA 3AB3A 3WLKX 3ZHZA 4XRRA 3MMPA 4J1NA 5GM2A 1L3CA 3CZRA 2BE9A 2O8DB 2O7RA 2ZXFA 3LPNA 3QPVA 1GZDA 3U6KA 3DUFB 5KHOC 1M10A 4D9CA 4U9UA 2VXBA 1HMPA 2H1CA 5MF6A 3E9MA 4XH9B 1D2HA 2WJPA 3QEKA 2CSUA 3BRCA 4X0EA 3EBPA 4ZI3A 1RE1A 5HTOA 4RMJA 2WNSA 1V6SA 3F4LA 4DY6A 3IBGA 3KB6A 4JVNA 2ZRNA 3FVWA 3GNSA 2DP4E 1KI4A 1SIUA 2PS1A 4GGMX 1OBOA 1X3SA 2O2HA 2NV2B 2QMHA 3OLYA 3VZCA 3FB1A 5JH7A 4A8TA 3A4MA 1YO6A 3M0EA 2JFZA 2W6OA 3H2YA 4HZUA 4Y2UA 5B37A 3U4HA 2ZUWA 3UA4A 3CEAA 2QIPA 3LAWA 5C8ZA 3IMGA 4FHZA 3ZCTA 1O77A 3KFVA 3A0RB 4JR1A 5JATA 2R0QC 1AS0A 5HVNA 2HUPA 1GPAA 3OZBA 1NOKA 4GI7A 2AXEA 3HCEA 1J42A 5C3UA 3UYLA 5CFNA 1YRWA 2WB2A 2WZCA 1B16A 2D0DA 4EHLA 4YACA 2QY6A 3QLTA 1RI5A 3G82C 4I14A 1EFRA 3BE8A 1FYEA 4KVFA 5ERYA 3BKXA 3PV0A 4E32A 1MB4A 3S8YA 5DK4A 3I1FA 2CE7A 1R18A 3FPCA 4FR5A 4ZK6A 4Q4HB 5GONA 1L7XA 1RRMA 1S4MA 1Z88A 2YXBA 4PY2A 2XEDA 2OO3A 3PFIA 1GFWA 1C0EA 3QXGA 4KN6A 4V3BA 1MO5A 3LK6A 4JEUA 4JSRA 4A8JA 2F6RA 4MCAA 1H2FA 2BI4A 3U4IA 5HPYB 4OMDA 3QKSB 5CNIA 1M2OA 1X15A 1H1TA 4TLDA 4EZBA 4MP8A 4N6GA 4DLKA 3N3BC 1UKYA 3E3MA 3TPFA 3VBEA 1YR8A 1VL1A 4ZGBA 3UMGA 3LF2A 4LVOA 4KVZA 1ORDA 4NZOA 1N6RA 2JHGA 2Q8QA 3VVLA 4YJ2F 1Z34A 2PAFA 1QTQA 1Z7GA 3ASZA 2Y0BA 3H4IA 3I30X 4XXHA 4M0LA 3CN9A 2FPRA 4EHNA 1JQ3A 1LQUA 4AMZA 2F3SA 4CM4B 4RTMA 1PZFA 3UEOA 4ESHA 2XHZA 3WB2A 1BFUA 4C7JA 2Y67A 4HDKB 3R0VA 4X41A 3D64A 1T5HX 1WLYA 3EULA 4MLDA 4EYOA 2OM6A 1KRWA 3FLMA 1QGUA 2QL6A 1PU2A 5T8KA 4KBYA 3F2IA 3PRYA 3OJXA 1S8FA 2WOOA 2O7NA 2O3QA 2PFKA 5ALLA 2COKA 1AKUA 4TLMB 4CRWB 5EJ4A 3BQ9A 3PWKA 3VPGA 4AWXA 1KRXA 3A7DA 5JAOA 3AVVA 1BFKA 3EC1A 1ZN9A 1JHPA 2OLEA 4FKZA 4E7OA 1XVUA 2ZUTA 1NLUA 1BN7A 3OHPA 1MEJA 2CNLA 4H7PA 5LLSA 4RTPA 1EUDB 2KJQA 2OZEA 2R79A 4JB8A 3JQ9C 3HKDB 1E2UA 1JI0A 1X7WA 3BF8A 2IH4A 1Z4LA 1YD7A 1P3DA 1JG1A 4Q4JA 1WZEA 1TA4A 5J47A 3E05A 3C7DB 3SN6A 4M1TA 4FHGA 1ZX1A 5KYXA 3V1KA 2VP5A 3ECCA 3ICCA 3LM8A 3U9SA 3ADCA 4Q66C 3AHIA 2GARA 3JQ8A 1NYLA 2ZIXB 2ZSBA 4G5YA 4JLOA 3H1BA 4KXVA 4IHAA 1BS2A 3HO1A 3TMYA 1WMFA 4C4PA 3TLXA 2D06A 1T0HB 1V0JA 2P77A 1CUEA 3TOXA 1AQUA 2P9QA 3HLTA 4O4IF 4RL6A 5CLGA 3VVCA 1ZD4A 1X7HA 3WMRA 3T7TA 3ZGOA 2JJ1A 4O4JA 4DCPA 4TTJA 2ZSEA 4QYTA 1ZJZA 3GFVA 5TVGA 3VYVA 4CQJA 5CLQA 4MVJM 2A2ZA 1UC5B 1Z47A 2YZNA 1TX4B 1XXLA 2Z04A 1G18A 1K7CA 3TRDA 5KYGA 3IRVA 3OPYI 4LZJA 4KP7A 1G63A 4O2LA 3A4VA 3CLUD 4P83A 4AW9A 2C7BA 4OI2A 1LTQA 4G89A 3S5UA 4LGMA 1WNTA 3IALA 2CBZA 4RD4A 1ULBA 5JH7F 1J1ZA 2RGEA 1HTBA 1N3IA 1YB7A 3MD0A 5GPBA 3T15A 3ZLTA 4C0HA 5A9TA 5B58C 3WAGA 4K0KB 1B14A 1EYZA 3F73A 1EUYA 3N6RA 4O0MA 3KVVA 3SZ3A 1LPSA 1AA9A 1KFJB 3BD7A 5EAIA 3ZHUA 1J33A 4KEAA 1UXGA 2PD3A 2JA1A 1SGWA 4OHWA 4CIDA 3VHXB 1WF3A 4HHEA 2CFCA 2RGUA 4JFAA 1B42A 4CT4B 1HDRA 1Y4AE 2AE2A 3WAJA 1NF3A 4R98A 2UYCA 2Z5LA 3IEVA 4CEHA 1MB3A 1YF3A 4OV6B 5DYWA 4DJ5X 4E08A 2IOFA 2ZW9A 1W73A 3LQ2A 2HEIA 1HSOA 3OAAD 1CV2A 1ETHA 5G4KA 4ZOQI 4AMGA 1XX6A 1XZCA 4YQEA 3S28A 1ILWA 4LTDA 3CZQA 4MI9A 2J9FB 3ITKA 1QE0A 3E82A 1L8LA 4OLAA 3W7VA 5GJBA 3EGDB 3TS1A 2BJHA 3PL5A 2CVOA 2IDJA 2BHSA 2IW1A 3DHVA 4WA8A 4YJ2A 3R0JA 4BKUA 1V1RB 3G2OA 1J8VA 3A6JA 1CZUA 1DKMA 4BLWA 3K0EA 3WGVA 1FJGB 3U5ZB 4QTUB 3IPXA 1P7PA 2YDYA 2J08A 2XT9A 4ARZA 1KK1A 3L9XA 1MOZA 1J5XA 1P7CA 4IF4A 3T99A 1QLWA 2PQMA 3OZWA 5T3UA 5E4TA 3BFKA 3EGXB 1P2FA 3P4UA 4NJOA 2DE0X 5M3BA 1K75A 1V11A 1P91A 1VBFA 3RSGA 3DE0X 1EFKA 1F38A 2E4XA 1G6KA 4Q3EA 1WIWA 2O4UX 4HN9A 2BBWA 5DBEX 5FWXA 2AV6A 4UTXA 5GJCA 1YRQA 3FSGA 1X80A 1DAEA 4JUAA 4EB6A 5AVZA 2IF0A 1M6NA 1MX9A 3I53A 3PNSA 4H4DA 5LP6B 3U31A 3BCUA 5A4AA 4O3MA 4X62B 3BMCA 5EHZA 1CX9B 1D9ZA 1U2DA 4YASA 5FWDA 3YASA 4CV1A 5JCZA 5K0JA 4QKQA 1T10A 4QBKA 4P7JA 4DLTA 1IN5A 4MRPA 7REQB 1L7PA 3B3GA 3NEJA 2HN9A 1NBMD 2ZBGA 3NH9A 3PUHA 4J1TA 2IWRA 3TGWA 4QASA 4AZTA 2ERYA 4YT2A 2CEKA 5EVCA 5F1OA 2WJVA 2H5LA 4R3NA 3QYJA 4H0FA 4IZ6A 2AI1A 4F1WA 2VT7A 5FNVF 4ODIA 4F7WA 5IKMA 2MWMA 4HNSA 4RLSA 5HF9A 3EPLA 4I6EA 4E2ZA 3FYTA 4XUGB 1TRKA 2WJWA 3PQDA 3P9IA 521PA 3KLPX 3W8RA 4O4IA 4ZCRA 1QIJA 4LXTA 3G8DA 3E2IA 4A1OA 2PXXA 1VJCA 3L8YA 3PD0A 3MSXA 1WDTA 3JAKA 3QLVC 3QJYA 4JVLA 4DIBA 3HTXA 2YUIA 4BV8A 3OQMA 1Q1GA 3P9SA 4YJDA 1SCKA 1PT6A 5DGDA 4LGVA 1JR3E 3BWCA 4G0UA 2AFVA 4BXOB 2WYIA 4QU5A 1IM8A 1V8PA 1WHTB 3WDKA 1Q21A 1AMUA 1HG0A 1E1NA 4GR5A 5FOSA 3NTOA 4R2XA 1Q2XA 4RQBA 1SULA 1OI3A 5KREA 3ES9A 3TEJA 3SM3A 1T6NA 1Y1KE 4NYMR 1D0IA 3RR2A 2ZT6A 5LL6P 2G17A 1YBFA 3NIFB 3WNDA 1VLVA 4AXXA 2M1XA 1INLA 3NV7A 4HY3A 1VMAA 2XE7A 3T3PB 2EP7A 3OCVA 3WYNA 2VT6A 1J39A 3RVKA 3WADA 4BB9A 3WJ1A 4N5DA 4DJAA 2HQ1A 5E7QA 2AI2A 2JARA 3VMFA 4HB2A 2OL4A 2LBPA 3ZY3A 1AUXA 3CVJA 1NW3A 2WEKA 3COYA 2C1ZA 4XWOA 1DMSA 2JIOA 4QGSA 2WVGA 1FLDA 3OURA 1OIWA 3VUFA 4OQDA 4KRYA 4BMZA 1FS5A 4QBHA 2PGJA 3NMUF 2PU7A 5HZMA 3LBNA 4Y6SA 2QMYA 4B7XA 3MWDA 2OFPA 5CM2Z 3NVMB 4X54A 4N3BA 1WXHA 4UOQA 2C95A 2H7XA 2GPWA 1U7XA 4DHEA 3ZG6A 2UUOA 3O03A 3P2KA 2WTAA 5EY5B 3GUCA 4AF7A 3L1HA 5G1NA 5AVOA 2AMJA 1O9BA 3LY5A 4HTFB 4RV9A 2W2PA 2WG2A 4HDNA 1PGOA 3UWMA 4AN4A 4B4VA 3C8UA 1W9HA 1CUZA 3F4KA 4MO2A 5TPWA 3MHTA 3GLHB 2O0HA 3GLRA 4I99A 3UUFA 4MV5A 4RDHA 2ZVPX 3EIUA 2HLPA 1N1GA 1NRXA 2DPGA 4IFEA 1G7CA 1M75A 3DE4X 3LPAA 3A37A 2XI4A 2AKAB 2GPJA 3GPLA 3VO2A 4PLPA 3K16A 1N2OA 5FEUA 1T15A 2XUPA 2D1RA 4BAZA 2MYTA 2QDKA 2ZT5A 2EFHB 3TLYA 4F6CA 1XEXA 4P81A 1EK0A 1GG8A 4EJSA 2H31A 2VXYA 4QO8A 4GAEA 5I3ZA 3DR3A 2OKCA 5AVWA 4BNTA 5AI0A 1GEGA 1MJHA 1VKJA 1SC6A 1DIGA 3FDZB 2P0AA 4WWHA 1J2YA 2V0NA 2YWHA 1TM3E 1M54A 2VN8A 3D0RA 4BRWA 1KMHB 1L5GB 5BWOA 5C37A 4FONA 4JXXA 4KGZA 1IZZA 4ZT2A 1I4LD 1L8QA 2JW5A 1CETA 4WKOA 4Z4FA 1JNYA 1KSHA 2H9IA 1G5IA 5A7FA 2GZAA 3LQ4A 4ARBA 1SWWA 3MIIA 4ZWNA 3WDLA 5EMNA 4ICIA 5AICA 3SC2B 3UWSA 2HYIC 3EIHA 4S1OA 3GLUA 4L5CA 3I6ZA 5A4JA 3LQYA 4C0BA 1VA5A 1B41A 1T1JA 2ACKA 3KBBA 1V7PC 3EWAA 3RKUA 5I9BA 2LR0A 5ADVA 2DSTA 4KJXA 1K5GA 1U3FA 4XX1A 1WQ1R 2JJMA 1NFFA 1SPXA 3OQIB 5KMGA 3L6DA 2WD7A 4ZANA 5EEHA 1AS3A 1XNHA 4RSMA 1CCWA 3OX1A 2Q3MA 4M7OA 2GZDA 3UW3A 1LSOA 1CJCA 1NW7A 4LJ4A 4B6FA 1CQJA 1RWVA 2CVHA 4QNNA 4P38A 2BTQA 1MXHA 2JIQA 3H4VA 4KIJA 3OFNA 4QLBA 3EUWA 5JNLA 4ARIA 1KMNA 2W2TA 2BUBA 1YIDA 3FPJA 5C4IA 1E4OA 1FP2A 1LJLA 4X60A 4Y18A 3ZGLA 1ECBA 1QVZA 2IZOA 4C87A 4Z9YA 2R87A 5TS2A 3GLTA 5LVAA 4FLMA 4IIJA 2WAXA 3KOZA 3BIWA 3FOZA 1OI2A 2R6FA 1DWPA 1WQ3A 3DBVO 1TMOA 4KRGA 1F7UA 3ETJA 1NBIA 3TAXA 4X7PA 2J0VA 1VPLA 2AJCA 5HSGA 2Q8PA 4YAFA 4PRKA 2OBNA 2IYUA 1N0WA 2HHLA 2ZYVX 1RXWA 1N9ZA 4HSGA 3QVSA 1EMDA 1Y8ZA 1RWBA 3TBKA 3U3ZA 4KQCA 4R2KA 1OFHA 3L0OA 5CIWA 2FPGB 1ZGCA 2QTTA 1DAKA 2JEOA 3ZHXA 1G4AE 2R8PA 3TF5A 10MHA 5CPFA 4BMSA 7MDHA 1EDDA 3N5CA 3ZV5A 1A3CA 4U3JA 5BY2A 3LZDA 4XARA 4XASA 1ZM2A 2NZJA 2OBFA 2G7MC 2IUTA 3FPBA 1CPYA 1OGJA 3R3ZA 1KAQA 3C5WP 3MSCA 4D97A 4OOEA 1XLTA 2YC2C 4S3MA 4JJ8A 5K8JB 1I8TA 1L8AA 2J3JA 2QLMA 4OSPA 1F0KA 2JFNA 2GEDA 5EKDA 2CNNA 4WECA 1S02A 3V5NA 3HFSA 2G3YA 3DB1A 2QQ5A 4B8YA 1N0HA 2WTXA 4X44A 2FQYA 2O2EA 3KPUA 1IZ7A 1JLMA 1W1IA 3HCRA 3RTCA 3NDIA 3Q11A 3MYRA 4RBNA 2G9NA 4LRYA 4FEGA 1IEQA 2UYQA 1A9ZA 1XK6A 3FF1A 3L0DA 1DHTA 3CW9A 3EVNA 1NQTA 2VPTA 5LZ5A 4QARA 3WLFA 3ZCXA 3C16C 1XL0A 1HETA 4FXPA 3ZXUB 1L7MA 1UAAA 3L4BC 4M46A 2PFGA 3W6NA 2CK3A 4MV7A 1YUMA 5BVHB 3GNLA 1IBSA 4LRTB 4N47A 2QTGA 4HFMA 2DVMA 3B2QA 3RFCA 3Q0EA 4N12A 1JR6A 1CKEA 4MA5A 1DI0A 1W85A 3D81A 3HLYA 3V2GA 4D42A 3DKIA 2VP6A 4FYJA 3CR3C 4LOIA 1I7DA 3REFA 4I50A 1KPHA 3CFYA 1IK6A 4ENUA 5LOVF 4G1UC 3E5NA 5C8YB 3TFOA 1YDWA 3F7NA 3AKEA 1DC3A 1T3LA 2ZPAA 3HY6A 4PQYA 3OZ7A 2J3LA 4B84A 5JD6A 1CQZA 1XMVA 2YMQA 3M1LA 2XNCA 2YHIB 1EK1A 2XF8A 4NYIR 4BN0A 2QN9A 4NENA 3LLVA 2C83A 1L7DA 4DQLA 1ULSA 3U19A 3RYCA 1C5KA 4X90A 5AH0A 1K7EB 4XFDA 2FMKA 2E6UX 3M83A 1OTHA 4JC4A 3FBTA 3IILA 4HLQB 1DBWA 2OCXA 1C3LA 4JYCA 4DA4A 2BF7A 1IJFA 2W71A 5IBPA 1TJ5A 4PC1A 4UAJA 5JO9A 4KXLA 2QUBA 4ERNA 3FCUB 4Q7JB 2OV8A 4YPVA 3VAYA 3G1WA 3MJRA 5CAEB 2Q0SA 2BEJA 4F38A 2R8ZA 4LV8B 3WWEA 5A5EA 2JAOA 1MB0A 2TRSB 2Z6AA 2VUTA 4F2PA 1KSFX 1MO2A 1Q77A 3FNBA 4HK4A 4B44A 4CNQA 1NLFA 5CDUA 2OTCA 3LX8A 4WXRA 2VF8A 3H86A 4RE5A 3L1KA 3UJCA 1JILA 4ZEXA 2XQKA 2Q5EA 4IGIA 4P36A 4D0NA 1X1DA 2GN0A 5JS6A 1JDJA 1XD2B 4NFHA 3IOYA 4LNUB 4F3YA 4YAJA 4LEIA 2ANCA 2RH5A 1MX5A 1ODSA 5CBPA 2FFBA 1L1EA 3CGWA 1J5EB 1Z07A 5AVXA 5B53A 4HGQA 2PWZA 1UCFA 2HQBA 1QV7A 4FJ0A 4KPGA 4XM0A 5TJHA 4C1NA 4JCOA 4RKQA 5IF9A 1DJMA 1H2AS 2A7XA 5EJEA 3NYRA 5LQCA 1XDUA 2NTYC 1OV6A 4MQFB 3E2PA 3ZVLA 3DOOA 2Y99A 3C4VA 4YRTA 1US8A 3VU3A 5KQMA 2HZBA 1VLHA 4F3NA 5LWQA 1DX4A 1QZTA 5J5AA 1XJ0A 2IX9A 5DHFA 3IHKA 3PNYA 4WN3A 3SHWA 5AUPB 3KV3O 5FOQA 1IN1A 4L2IB 3R2JA 1SC1A 1WXGA 5ALDA 3G2IA 2M9MA 1XDZA 2BFFA 2DWOA 2EZTA 3FCSB 4LYGA 4MJXA 3JCZA 3RFFA 3TQIA 1CF4A 3DL7A 3WWZA 2OQVA 1JKJB 2DTDA 2PQ2A 1PEAA 2ZI7A 3IMCA 3Q3JB 4YALA 1BHO1 4KNWA 2J31A 4OB8A 5TMDA 3HXOA 4OSOA 4LF4B 2ZSIA 3H7AA 3JQAA 1J5PA 4HNTA 3PGA1 2AYZA 2OAQ1 1MA0A 3IEKA 3KQUA 3KE8A 4HDRA 3RSLA 2TMKA 3WWOA 2V7PA 3UK1A 4WY2A 1NLMA 2GAAA 5M29A 4F06A 4Q9IA 3QG5A 3AUFA 1ZIOA 3O8RA 5COBA 1DIRA 4XGIA 5HGXA 2YNMC 4HMPA 2CXNA 4R1OA 3FTFA 3A27A 5ESXA 4ZKDA 1JBQA 2WI8A 1HE2A 1QHFA 2PGAA 4AL4A 1XEFA 4W99A 2CMKA 4XDYA 4TQGA 1GN9A 1K8XB 3Q7TA 4HFRA 4XIIA 2ZR7A 4ZZ0A 2R8OA 1DEOA 3RC2A 4Y1FA 3E3OA 3E27A 4RENA 1GKKA 1O6FA 2X7HA 4BTEA 1II9A 3A9WA 3D7NA 3GPIA 3ZIDA 5F5LA 1XZMA 5HW0A 3L2OB 2ZE5A 4IWXA 4AJNA 1LXCA 2R86A 3NJRA 1X1BA 2FYTA 3O31A 3AL2A 1WZCA 1OPRA 2ZDHA 4NMLA 4IDAA 4ESOA 3DDCA 2H16A 4ZREA 1E9FA 4BNMA 5KU7A 3AESA 1R3UA 1K08A 4MS4B 3A2NA 4F8YA 3BXFA 3KKQA 3TQSA 4OJKA 1XKXA 3IOEA 4FIZA 3X1MA 5A4KA 3G23A 5KTNA 1U0TA 2NVOA 3A4TA 3QIVA 1C1DB 1GPBA 2BN4A 4FX2A 4J7XA 4ZYLA 5FH9A 3EIQA 2LW7A 3ZDRA 4KSCA 5K99A 2K7FA 2XD9A 4JP2A 1FP4B 1Q1QA 3I6BA 4GMFA 3WSVA 3JAMA 2ATVA 3C1UA 3KYIB 5F76A 5TLSA 1RPTA 4HWOA 3WKBA 3N6VA 1Z73A 1RM5A 3G9XA 4GI1A 3X1WA 4NZYA 4A5SA 1VPTA 3KAQA 1RW4A 3VOTA 1CJTC 1TGVA 1VRCA 4JJAA 4FDMA 4TROA 1AUVA 4KV9A 1VL5A 3OOHA 3IAUA 2WVJA 4ZVPA 3EMVA 1JKXA 1OR8A 1CYDA 1LWOA 1P2UA 1W0JD 2HRQA 1YA4A 2J9ZB 3GT0A 2PVSA 1T6YA 3DE6X 4CMAA 2FG5A 4E3ZA 3GLIB 3ABOB 3T1HB 2RAPA 2RFLA 1U0RA 3DOUA 4EY3A 3UHPA 2PZBA 4UVGA 2SCUB 2H11A 5G41A 2VRBA 3KQVA 1DZIA 1ENYA 3QENA 2PUTA 2AQHA 3OZEA 4LJ7A 3GLQA 1HLPA 4MV0A 4PZEA 4IAOA 3NASA 3IGFA 4E4YA 1FF9A 1EM6A 5K8UA 3ULKA 4KYIB 1LI5A 1YMQA 3TMAA 3OD5A 2ZZKA 2N1MA 2W8BA 5CT6A 2AW5A 2FUKA 3TDKA 3GLGA 4DR7B 1UDBA 1IL0A 3I32A 1ONOA 3PRKE 4WOPA 2XRZA 3W77A 3MJTA 4KMOA 2L19A 3G9UA 2EFJA 1VPDA 3NR2A 3UJ6A 3U7HB 3H17A 1AU9A 3NIDB 3ETNA 3DPUA 3KQLA 1R66A 3A70A 2HF7A 1OXUA 3FFBA 5U1PA 1PQPA 3OJWA 4MGIR 2Q45A 4EW3A 2PMWB 2ZRPA 3OZUA 2GHQA 2HL6A 1GFSA 2NW6A 4MKIA 2IPLA 3BN3A 4K6MA 3RV4A 5BWLA 5JUWA 3SJZA 3WMWA 5EGSA 4QGAA 1JVSA 2ZJ7A 4JBIA 1BNCA 2WZDA 4KGDA 1Z2EA 4WZBB 5ESDA 3ZW8A 2LWIA 5CJ2A 5L3ZA 4ZYYA 3R0XA 1IOVA 2OA0A 3B1ZA 2RGXA 4EGQA 1C9KA 3PIIA 4U1RA 4PAQA 4WVLA 3ZWBA 5GVSA 2AN5A 3IKLA 2VWPA 2PH7A 3OQBA 3R3HA 4I0WB 4JK3A 4Z3DA 3UHJA 4RNDB 3QTBA 5J23A 1I3NA 2GZ3A 3FCEA 4BCBA 3TTTA 4BAGA 3BS4A 3E2MA 3R7DA 4TTRA 2OHJA 4JVOA 4U7JA 2IVFA 2K87A 3GRRA 4KPEC 3EZFA 4MLZA 2XRMA 3CYFA 3UMCA 4YLGA 4MYRA 1BXRA 4TLEA 2D1YA 1ODFA 2PA3A 3JQBA 1J25A 1VE5A 1X13A 2P2SA 3SBEA 1UPCA 1U31A 3EVFA 3TZBA 2ZZMA 3W1EA 5IDXA 2O54A 5DO9A 2UV8A 4QQKA 1YNOA 2IFTA 3I6YA 4LXIA 2ACVA 2VDNB 3UGTA 4DCMA 1IULA 4QL3A 5JWRA 4F9FA 1Z2OX 3L4KA 1GM5A 2P8JA 4C4RA 3FOEC 1D6SA 1KMIY 3HBLA 3ZWAA 1XDDA 1ISSA 1LW7A 1U3DA 4BUCA 4EATA 4PX9A 5JXWA 1JFTA 1EFHA 1AHPA 3R7AA 4UZSA 4R31A 3G5UA 1FTGA 1MVNA 4KYTA 4OGWA 4ZOLA 1ESNA 2OXTA 4UHFA 2IKSA 4OAQA 3V46A 4E1BA 4PN7A 4KLZA 2ZIFA 1JTVA 2H0QA 3C97A 1ENOA 2A1TR 3EG9A 3JQDA 3N58A 4LXGA 3W3AD 4B2IA 4YRQA 4QYIB 2JLZA 5C34B 1AQNA 4M9UA 4F4UA 1F3LA 1JLLA 4ZV9A 2EW1A 4A0RA 1UANA 3M3DA 2H65A 5I9NA 3L77A 2B8NA 4TZTA 5ITSA 1I10A 4E5NA 1BW9A 3MQ2A 1P5JA 1XIVA 2E4YA 3DBRA 3QOWA 5BO5A 3AQ4A 2VDWA 3OG9A 4URZR 3F6SA 3O7WA 4UBKA 2YKGA 4R8LA 1QDUA 3AZOA 2O07A 2FZLA 1JWLA 3T7IA 3W5HA 2E1RA 1QIDA 2OLJA 3ELUA 1SUSA 4IGEA 4G4SO 3UT5B 1P9WA 2AOTB 2ZS7A 2A1TS 1X1AA 3LFTA 4QEDA 1R12A 2R3SA 5B36A 3MT8A 1ZRMA 4IEIA 4WSOA 4C9BA 3UWKA 3WJ2A 4OL9A 1E0JA 2X86A 2UXDB 1OBFO 3WRYA 3K4HA 3A58B 4LYHA 5EJ2A 4RVHA 1ZAYA 4EGCB 4QGBA 3LF1A 4GSLA 3FYCA 4AMUA 5BYKA 1CS4C 4MLCA 3KEFA 5DU2A 2VAPA 4IMIB 1IM5A 5KQRA 4JXJA 4PHGA 3PJGA 1ODJA 1GL6A 5BSGA 1YK1A 2HQSA 3QM1A 3TCKA 4CLRB 3OHMA 5K2MA 2IEIA 1VXRA 2VKQA 1XAIA 1B0UA 1PZXA 1R4NB 4BWGA 4D57A 4X65B 4WCVA 4FYPA 5FQOA 5ES4B 4P4LA 2G5GX 3NWOA 1XTUA 4RD0A 1KYYA 3UJNA 1YB2A 5K9ZA 3UMJA 1Z28A 4S2EA 4B43A 3F7TA 1U0NA 4I9HA 1N6LA 3H2GA 3RTGA 1PNTA 1C81A 1QP8A 3PKIA 4H1VA 4XB2A 3RFXA 1G8PA 1ELOA 5EXXA 5CB4A 3FZQA 4Q02A 3QX8A 2GJKA 3NQ41 3OQ6A 4BVJA 1DKLA 1GZSA 1U7PA 3LFUA 4MK4A 4MWZA 3OTGA 4B3MB 2ARKA 1SFRA 4YO7A 2ZWOA 1ZI8A 2C8LA 2X3UA 3L0ZA 3QWAA 5B4UA 1YV9A 4RK4A 1P0FA 1U4SA 3D6AA 5DBHX 4C3UA 1MX3A 5LIPA 2YZKA 3EA0A 4DMFA 4EJ0A 3SZOA 4K9KA 4MYSA 2HWUA 5E7JA 1NVMB 3CEMA 5I8WA 4NF2A 4PRYA 4MINA 1WD5A 4D43A 2GFQA 4WW0A 4ENQA 4ITUA 2OV6A 2ZREA 2ZSJA 1R9NA 2G71A 1G5PA 3LD9A 1EFRD 1JJIA 1LK0A 2V97A 1KZYC 1SVLA 1WW3A 5EXEA 1GG9A 1AURA 2GD6A 2JGMA 2QRJA 2Y66A 3AWDA 2DQZA 3I3SR 3P5SA 3PC8A 4RZ3A 3VJRA 3ZI7A 2EV9A 4P7FA 1LF5A 4GT1A 5EMJA 2QMQA 1IZ9A 4EF5A 4R0VA 3ZXYA 1UKCA 1PSZA 1VBKA 4J91A 4DE5A 1X1QA 4I6GA 4M7RA 3SI7A 1ZS9A 1D04A 1A4UA 1NJ8A 3O90A 4PBRA 5KTYA 2UKDA 5GINE 5DW3A 2BF4A 4IHJF 2RAFA 1IE3A 3PU6A 3Q7SA 1JKMA 3OUUA 2C1EA 1LSSA 2O52A 2YR0A 2BFOA 1Z38A 4IG9A 4RFVA 1HYBA 1Q6YA 3BHJA 3LRPA 4Z7NB 3KTFA 1ZJJA 1KEPA 5DTJA 5LP1A 2HHJA 5EVJA 4CL3A 2HDWA 5TVKA 1HORA 1R0ZA 3RVDA 4BX0A 4DEVA 2KM1A 1S9DA 4HMOA 4FMDB 2B4RO 2H4FA 1L5ZA 3WLSA 4J43A 4EBBA 1KZ9A 2EG9A 1GQOA 1V3QE 5AKJA 1DOAA 3DW3X 3RTDA 1AUOA 1ABFA 2ZATA 4ZZ1A 5EGNA 1FX1A 3E48A 2ZBRA 1A50B 2E21A 1R8YA 2PZ8A 2Q99A 2FR8C 3DMFA 2NSHA 5L40A 4DLZA 1JH9A 2ABWA 4RPHA 1Y6GA 1WKVA 1CP2A 4QEZA 4ZC8A 3PXEA 2IYAA 3B53X 4R54A 5H9WA 2AYXA 3HNOA 1RYHA 1SIOA 3HDJA 3O84A 2GEFA 3I3OA 3QZUA 4Z2AA 3IAAA 2ASEA 2CZGA 5LA6F 1WXWA 3B7WA 4RCYA 3RBXA 5LD2B 4FI3F 2HSEA 3NFYA 3UN1A 4UCQA 5EHXA 3OOWA 1CQIA 1KP2A 1HUQA 3FPAA 4AZ3B 1WEHA 2I78A 3OX2A 5CG1A 3U61B 1P6XA 2RIPA 3GGPA 4Q0MA 5P21A 1OXVA 1LPMA 4FGSA 1JAXA 1XUOA 3OLQA 5E38A 4MR7A 1UBEA 2N47A 5BW8A 6REQA 3KPVA 4RA6B 5E6UB 1SBHA 2Y77A 1HEUA 5IVIA 2VK1A 4JUBA 5INTA 2PH3A 5G4LA 2X1MA 4RJKA 2WDPA 3CPSA 3H1FA 2I67A 3JQGB 2QUKA 2ZTMA 5H0IA 2WKQA 4DSUA 1L7AA 2HCFA 3OPYB 3MBOA 4PZZA 2G63A 3HR4A 2WFZA 1E7SA 1T8WA 2JH3A 1GO2A 2X13A 4JEHA 3NOVA 2NSLA 1ODLA 4ZARA 2FEKA 4IV5A 1N9GB 5D00A 1JR4A 4HWSA 3IJRA 1E3EA 2JJ1D 1GUYA 2HK7A 3TM5A 2C07A 1WA5A 2V7GA 1QCZA 1FFEA 1UJMA 4FFVA 4J0JA 5HMLA 1L5OA 1XVIA 2W2KA 2CXTA 3WYFA 3DV0A 4IS3A 4Q1AA 4EUFA 3ZHQA 4F85A 3AI7A 2XMDA 4BC1A 1CF9A 3KYDA 4KO8A 2O59A 2IZ0A 3UMSA 4F4HA 5L9AA 4KVGA 3ND5A 2C42A 1NVEA 3ANNA 1PFGA 2D2IA 3C6XA 5GVRA 4EYSA 4B5LA 4XVRA 3RUHA 1NP6A 2GTPA 3P8ZA 4HGNA 2OSVA 5TXGA 2EW8A 1BHJA 1J9GA 1D7OA 3D1VA 3H2SA 1J90A 1YS2X 3OZAA 4TKLA 5AJUA 1C8BA 1O96A 4ZAZA 1QK4A 3RUDA 3OMWA 2CL5A 1I7SB 1Z62A 3FPEA 5IM4F 4HV4A 3BRQA 1EBFA 2FW1A 2WZBA 1LRKA 2XH8A 2VLIA 4DF3A 2AG0A 1NJSA 2TMDA 3HYLA 1N7GA 1VE7A 2PS3A 4GGOA 1T0IA 2ZQYA 5YASA 5JHGB 5AM0A 1B0ZA 1YI8A 3PFFA 3RVNA 2IY8A 2B5WA 3A3OA 3H16A 2HDOA 4YPOA 4CDGA 2ORWA 4LCBA 5AW4A 2XCUA 3ACDA 4XSHA 3O3NB 5HKAA 5JWHA 1FDSA 1KI9A 3R5TA 4ZMRA 3HMKA 1Q57A 2HLDA 3GMTA 1A98A 2HA6A 4GI2A 4OXQA 4DRXA 2FN7A 2OMEA 2ZRJA 1Z0UA 2ZSDA 3HI4A 2ZPTX 3RS5A 2MYPA 4EPYA 4PPGA 3FRHA 3LCMA 3S2GA 3RG8A 3VR4H 4WINA 1SHLA 3CWQA 2EQAA 1MP0A 2XNSA 5C0OE 2A5LA 3ZNPA 1UIRA 1VLJA 1WO8A 3R24A 2WJ3A 3N2KB 4CG2A 5DGIA 1KI6A 2D74A 1PTKA 1G2QA 1JQAA 2CNDA 3C4JA 4GXQA 4Y2YA 5KQGA 4GDFA 1BWSA 3IEUA 3QHPA 4KPUB 2VEDA 4RETA 2QR5A 4Y0AA 1Z83A 2CLHB 3CX4A 4GVLA 1SUEA 3NLLA 4HUTA 5AVVA 5BUZA 4KR6A 4ROTA 4MGYR 4M7WA 1RWXA 2D0IA 2PT7A 3C4QA 2B1JA 3MJHA 1XGKA 2A0YA 1RAFA 5FUMA 4TVKA 5LA6A 2ZAIA 3HA2A 3KZXA 5ALUA 3K96A 1VL2A 3R5FA 4IJQA 4C43A 3GG2A 3JWJA 1BKDR 4CE6A 5EHQA 3LQKA 8GPBA 3KVNA 1RLJA 4DLPA 2O5RA 1SQGA 3NHLA 5ALOA 3DLBA 1XMOB 2B4KA 4JJZA 1XAHA 2OZLB 1PFUA 2VZ8A 4UUNA 5AVJA 1EK5A 1ZP6A 4FCVA 2AE1A 1IUOA 4L7VA 4UDNA 3EFOB 3O8BA 4BUJA 3N8NA 4KXWA 4CQLA 1ZBDA 4RD3A 3IBSA 4MIOA 4ZOCA 2WSLA 2O23A 3VC3A 1PKXA 2PMCA 3OEEA 3KVRA 4YBZA 4OA5A 3IHWA 1IOWA 4IY1A 1OYWA 2QV0A 1G6OA 4OK5A 4P8RA 4ENRA 1WS6A 3LT2A 6LDHA 1P1RA 3CR8A 1DEAA 2YVKA 1S96A 5LXTF 4QM6A 4B7ZA 1DEHA 4QEKA 4QHTA 1JKFA 2EZ4A 3ZV7A 2EAUA 2QUJA 2IYWA 4XM1A 1QVWA 2PO5A 3Q72A 2J09A 4JI4B 1K97A 1H65A 1UWCA 1NVAA 1TQDA 4MVJH 3CLUC 2AD1A 3DKPA 5TQ2A 2ILTA 2PYDA 4LF6B 2CJXA 3DVAA 1QSGA 4UBOA 1MORA 3RI3A 1IEXA 2GPAA 3I9OA 2VWQA 1C3OA 2Z56A 1QRAA 1II8B 1XXHA 1HDZA 3EGVA 2CDRA 4GVXA 2FCAA 2Z1DA 3CB4A 2IELA 4I5DA 2XKAA 1L3IA 3RKRA 5SZJA 4RVCA 2HMSA 3QSGA 2VTVA 4YV1A 1QFZA 3ROKA 4ZJPA 2HJVA 3NHJA 1K0UA 2VJAA 3GGGA 4J9VA 4JLWA 5DYNA 4E46A 2P9BA 1ECFA 2V4MA 2W9XA 3JWGA 1GSIA 3DLPX 1L5FA 2BFMA 2NN3C 3D4NA 3EIXA 3LUBA 4B46A 2AN4A 4BNFA 5IM4A 1VL8A 3LUHA 1LPBB 1YHZA 1ZOPA 2HK9A 1XQVA 3AWIA 1F4PA 1C4KA 1AGNA 4GYWA 3TRJA 2D5BA 5K05A 2PIDA 2PUGA 3CZ9A 3RABA 4B0OA 3CEPB 2SNIE 5U9CA 4G5GA 3UKOA 8OHMA 2UZ1B 5KYKA 1OXSC 2OAP1 4CEIA 4TWIA 2HW8A 3OIDA 5ADUS 1NZDA 1QIHA 2ZVJA 3TZHA 1F8XA 1UMKA 2ZTLA 5I3CA 4U9HS 4GUAA 2JD1A 2ZJYA 2P78A 1O58A 2DUJA 4LK2A 4MPPA 3V1YA 4OSEA 3AJAA 3IQIX 4Q4AB 5KSOA 3TFQA 1BCSB 1GIAA 5B3KA 1ID1A 3KKKA 1AVTA 2OUIA 1KEEB 4IF6A 1GN8A 3WTCA 4N0DA 5KAPA 2QAIA 3B9BA 2BJVA 4ZRMA 1U8UA 5F5XA 3R9WA 4QATA 2Q62A 2X4GA 1NBHA 1YFLA 4IH9A 4GSYA 4AJPA 1JG3A 1ZG3A 3VHRA 1NXXA 3D5TA 3O1HB 2I4LA 2JIDA 1SHKA 4KQJA 4LYYA 5EUMA 3VR6A 4DEXA 2QLNA 4RDXA 2Q27A 4U2KA 5HQ3A 4C4SA 5K0LA 4W5NA 1ZJYA 1EG2A 3LIPA 3OOEA 2EVWX 2PX4A 1U0HC 2GYWA 1QRRA 3DOFA 2FZ4A 3L0CA 3EZNA 4IFBA 4LX0A 5IABA 2V6BA 4KITB 2XHEA 1UJ2A 1EI9A 1D7AA 2WHEA 5EYPB 1JEEA 3VVMA 3HZZA 1HDGO 1EVIA 2IYRA 3SFVA 3KSDO 3UJ8A 2WFAA 1NXOA 1CQPA 1SAYA 1JFFA 1UWKA 2GZ1A 2JAXA 2WU3A 3HXLA 4EB8A 5SZKB 5DP2A 4WBNF 5IZCC 4AMYA 2M6RA 3FWNA 4TSRA 2WV9A 1SVIA 3I6IA 1ABEA 3BXZA 1M2EA 2EDAA 2H3EA 3GA5A 3G2LA 3K9WA 4FFNA 4Y6RA 5FFNA 4NFLA 3DF9A 2OHFA 5B3AA 1V1JA 3NTLA 5JT1A 2QN1A 1U0OC 1P9NA 2JC3A 4G6ZA 3OZGA 1GPH1 1WHSB 1A9XB 1ZMBA 2I4MA 2PZEA 5LXTA 1E89A 3NZEA 2RC5A 1V2GA 5BN3A 4KIUA 4AURA 1WM1A 4TN5A 5CNKA 4WAUA 3BAZA 4FZJA 2AYYA 1XD8A 4BWFB 1KNXA 3JALA 1TZMA 1KK3A 4FFMA 3LVBA 1NBEA 4X84A 4BQIA 4RY9A 4C4TA 5JAMA 2O8EB 4L4ZA 4YRRA 1SOVA 4JHLA 2GN4A 3ZIAA 1NI4A 3OE1A 1TEXA 4RADA 2FE1A 4TKMA 5TMEA 2WF6A 1JYEA 3DFFA 1NW5A 3OM1A 3NKLA 4MV1A 5A6SA 2WV7A 1A9RA 3LY7A 3ZDAA 4Y98A 4AYTA 1DNPA 1EAMA 1RWNA 2PBRA 3UIEA 3WK4A 1K5DA 3SBXA 1ISFA 1F20A 3CURA 4ZQHA 2OO7A 5AUNB 1N2EA 2EIHA 5AJVB 3EEBA 1EK2A 1KVSA 2OR3A 4JOQA 4XB6B 2FQXA 4DV5B 4F5YA 1DC5A 1YONA 5KX5F 4CKZA 1N8NA 1D1TA 5ALJA 1TKAA 1X1EA 4GRAA 4B45A 5LKRA 4BLTA 1DCTA 3AVWA 2VP4A 1G17A 1ZIPA 1PQWA 5FR2A 5A9SB 1KH3A 4YMHA