1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylyltransferase thiF
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
3VKVA 1HSZA 1VL0A 4E21A 4I9NA 3VC7A 2J3JA 3ZWXA 4BNYA 3GFGA 4EUFA 1E7RA 4IBOA 1O6ZA 3DHEA 2I65A 4IM7A 3ZCXA 4BV9A 3GDGA 3RBZA 2X23A 4YB8A 3K2EA 3L4BA 1I3MA 3V8BA 4BGEA 1BW9B 2IDZA 2HLPA 2OORA 2X9VA 3F46A 4D79A 1L7EA 4J9VA 4CMBA 4WNCA 2D59A 3H8VA 3U62A 1DPGA 1E3SA 2O3UA 3HSKA 5C7IO 5L4SA 2BH9A 4BO4A 3IL2A 2GSDA 4CMEA 2Q2WA 2PGJA 5C37A 2XOXA 2GZ1A 1E3LA 4PVCA 1ENZA 4J2HA 4UUNA 3UUWA 5L45A 2X0IA 3OH8A 5DCYA 1GYQA 1O9BA 3FI9A 4YJHB 5CP8A 4CV0A 4CMHA 1DSSG 3UCFA 2Q3EA 5HWSA 1M6HA 5TNXA 4AICA 5A9SB 2VYVA 2ZTUA 3MOGA 3VPXA 4NJOA 3U4IA 4XYLA 1J4AA 4OL9A 1EE9A 1BVRA 1M67A 4DIFA 1HYEA 2VYND 1F14A 3O26A 3VPFA 2RIRA 1Q0LA 3H9JA 5JCJA 1OC4A 4M89A 1VM6A 2FR8A 4R54A 1E6WA 4XD2A 5JS6A 3IKTA 4BHTA 1MUUA 3PDJA 4IJWA 2I9PA 5KVQA 2VWPA 2V6MA 3GRPA 1DHTA 2IYPA 1F17A 2G1UA 4IJVA 2UAGA 5DP1A 1H6CA 1LRKA 2PA3A 4BQPA 1LRJA 4GAEA 2VOEA 1H6BA 1DBVO 3FPCA 4FFPA 5CDUA 5DULA 1KVSA 1I36A 1LA2A 3RC1A 1PL6A 4BIIA 1ZCJA 1HETA 2R00C 4YDRA 4I9UA 1EQUA 1I2BA 3O4RA 4OOFA 5IDYA 1I32A 2JCYA 4PG8A 3PQFA 3CIFA 4GMGA 4A5OA 4YT2A 3EHEA 2HU2A 1ZK0A 3EC7A 3NGLA 4YWJA 1D3AA 1TT7A 1WPQA 3ZH2A 3DL2A 5BR7A 3UFXA 5IZCA 2GPTA 2X0JA 3DEYX 3JD1A 3P2YA 3ZV6A 2BD0A 3EVTA 3K96A 1M2WA 3JD2A 3DAGA 5TS3A 3IMFA 4FFLA 3N58A 4OKNA 1HLPA 3Q3CA 3FNHA 3GK3A 2BI8A 3WBBA 2PNFA 2WTBA 3HN7A 5JO9A 1CJCA 1U3UA 4ALNA 5DN9A 2R00A 3D4NA 3ZI0A 1O0SA 1H0KA 3WMXA 5T57A 4UAGA 4KUHA 1WZEA 2BGLA 2DBZA 2VRBA 2ZQYA 3BHMA 1Q1NA 3RWBA 2VRCD 1VLLA 1N7GA 4ALJA 1PGNA 2NU6A 3PWSA 4F46A 1YB5A 3NGXA 2EW2A 4M1QA 4NU6A 3IDSA 3JQ7B 4XQGA 1L1FA 4O59O 1X15A 5B37A 1RYDA 2FOIA 4NHEA 4R16A 4QO7A 4QT0A 2W90A 1VL6A 3G3EA 3OIFA 1X13A 1H6DA 2P9CA 4J90A 2DQ4A 5COAA 3GVXA 3CXRA 1G6KA 4Y6PA 1MC5A 3QWBA 2Y1EA 3GFBA 2NWQA 5CPBA 5THKA 2B4TO 3DZJA 1HWYA 3PZRA 3WYCA 4J16A 5L4LA 1YJ8A 3NTRA 2Z95A 4N5MA 2EGGA 4WCFB 4JN6B 5T5QA 4WLFA 2GN4A 5CDYA 3ZV3A 4AFNA 1H93A 2HMSA 4D3DA 3OA0A 4J6FA 3H3JA 2BGMA 2OBNA 1K6JA 3A28A 2YDYA 2QRLA 4A03A 2OP0A 4B7CA 5MDHA 1E3WA 2CDAA 4E5YA 4UEKA 4PG7A 3G79A 3I9MA 5F1PA 4XYMA 2BGKA 3GPDG 5DCUA 3VH2A 2P4QA 4YJFA 1E7QA 3H5NA 2DBVO 2JKVA 3BTSA 4TZTA 2EG9A 1B3RA 2YV2A 4RV9A 1UZMA 1VRWA 1DIBA 2QQ5A 2NU9A 1TT5B 4ZICA 4QEDA 3OJLA 2EKLA 1S7CA 2O48X 4TKMA 1I24A 1NX6A 4IINA 4K1LA 4CV2A 5HS4A 1ENYA 4YACA 3TPCA 1D8AA 4KWHA 2GR9A 4PLYA 4XYGA 5HM8A 1JWAB 2JD2A 4CV1A 1PGOA 1U2GA 2HAEA 4J1TA 3HDQA 1C0LA 3H65A 4CQMB 3KO8A 3LT2A 4QECA 3S2FA 3FHLA 4FQ8A 4CMIB 2YV3A 2I67A 3LT0A 1Z82A 1JW9B 2AHRA 3OHSX 4NPCA 1YB1A 2ZK7A 4ZRNA 4M87A 3PP8A 2HUNA 2ZTVA 1B16A 3SXPA 4GSKA 3MJ4A 3U49A 5JMWA 5EPOA 4BQRA 1PIWA 4QFDA 2H6EA 1GPJA 3CZRA 1J5PA 5TRTA 5H81A 1VSVA 1QKIA 3GMDA 3W4KA 1H94A 2EXXA 4IIVA 5C7LO 2ZTMA 5G0UA 5FF9A 3N7UA 2FR0A 3R6DA 4DVJA 3DBRA 3D1LA 2X9NA 3BMCB 2G82A 3EZYA 2I5PO 2Y0DA 4U7WA 1DOHA 4Y6SA 4A26A 3B1FA 5BT9A 4E33A 4WCFC 3RFTA 1JDJA 3FWZA 3GHHA 3UVEA 2HQ1A 1E3IA 2FRDA 3MCVA 4HBGA 4WLOA 1EMDA 5IFLA 1V8BA 4DPLA 1QXSA 3OIGA 3Q0EA 3I9OA 2C29D 3QWIA 1IHYA 4NQZA 3ICCA 2VHZA 4IS2A 1CQJA 1DAOA 1OAAA 3L0DA 2Q45A 4JQCA 1MC4A 1E7YA 1P74A 4E3ZA 1L7DA 3TN7A 4CMJA 1Y9EA 4I8XA 2B5VA 2BFMA 1IULA 1PTJA 3HB4X 1RWBA 5ENDA 2RH4A 2B69A 1NAIA 4FJ2A 3TOXA 1ADBA 4NK4A 3RVDA 2DFVA 2DTDA 2FZEA 4OH1A 4O5OA 2PLAA 3OETA 2WD7A 3ULKA 2FPIA 1PQUA 1I3KA 3D3WA 3WTBA 1SNYA 4GKBA 9LDBA 1R12A 1U9JA 4RDHA 4DXHA 3CEAA 3SJUA 4D0SA 1UXHA 1PQPA 3QV1A 3RKUA 1LSSA 3NRCA 4O63O 2VWHA 2IE0A 2O3RA 3GGOA 3M2TA 3PVZA 2B4RO 4DWVA 2ZQZA 3AUSA 3JYOA 5AVOA 4YYZA 4MJLA 5CG1A 1HE2A 5IJZA 4F6LA 2J8ZA 1VJTA 4J0EA 2O2SA 1PGJA 2YHIB 1GYRA 5CEJA 1TVEA 3ZNOA 2WYVA 3C7AA 3KEQA 3PIDA 5TT1A 3GEDA 3PDUA 1J49A 4IDDA 3WWZA 3E9NA 1EDOA 1EVJA 4XQCA 2IODA 3QVOA 1LDBA 4KZPA 3DONA 4OYRA 3O8QA 2Q2VA 4TVBA 3VDRA 1U7TA 1FDWA 4LMPA 4AJJA 5KWEA 4Y98A 3I1JA 3H9UA 4CM8B 3RBXA 5EL0A 1PWZA 4FBGA 1HKUA 5IAAA 3ADPA 2BF7A 3JQGB 1MG0A 4YAEA 4IDEA 4GX0A 1XGKA 2AMFA 1UDCA 3WSVA 1PL8A 4DYDA 4NFHA 3HE3A 1PJLA 2BRUA 1DB3A 5ILOA 3I9LA 4RVSA 4BOYA 4PGFA 4CMKA 2Y0EA 3QW2A 3CKYA 4FN4A 4CMCA 3CPSA 4WCDA 1JWBB 3V1YA 1E1LA 3JQBA 1XLTA 3OJOA 1DJQA 2YFQA 4BO2A 3ITDA 3BMQB 1PGPA 3ZWNA 1NFFA 1T2FA 4CUZA 3KSZO 3VZPA 2Y05A 2Y68A 2ET6A 1BGVA 4E2WA 4P8RA 3BTOA 2H9IA 3FF4A 1ZFNA 3KBOA 1FDVA 2UDPA 4K28A 1XU7A 2O2YA 2NACA 3U5TA 4I5EA 3I4FA 4DQXA 1E7SA 1RM5A 1LI4A 1CDOA 3EAGA 3DB2A 4FFNA 2EV9A 5FFFA 3L6EA 1CIVA 2IXAA 3RFVA 4GX2A 3E8XA 1TB4A 3C8MA 4LVCA 3D5TA 4BO3A 4BNKA 1RKXA 1I3NA 1UP4A 4CJXA 1X7DA 3I4CA 3ON5A 1I01A 3FD8A 3C85A 4CQMA 5B12A 4Z9YA 4P38A 4ND1A 3AW9A 3TNLA 5K6AC 3EVNA 4UUPA 3DBLB 1YS4A 4WEQA 1NBOA 3AJRA 5GZ6A 4I9HA 2FZWA 4BGVA 4WLVA 4EI2A 4YT8A 2I3GA 3HUDA 3OJ0A 3PWKA 4Q3EA 1NVTA 4MP3A 4FSHA 2E49A 2X5KO 3S2EA 3T7EA 1LDYA 3TZKA 3IS3A 2NSDA 5G2OA 1T26A 5AXDA 5JAZA 3NAQA 4WE3A 1B14A 4NBWA 1K2WA 1YL7A 4YRAA 1I10A 3EYWA 4OXNA 4GI2A 2ZB4A 1SOWA 2JL1A 3F4LA 3WSWA 1A72A 1WZIA 3UCXA 2RHRA 2IYOA 3MTJA 4PVDA 5JXWA 1GFSA 5TJHA 2WD8A 4CLDA 4NBRA 1GZ3A 2WJPA 4B8WA 3GZ4A 3ASVA 1FMCA 1O95A 3VAZA 4RLSA 1BXGA 4D3FA 3WXBA 4BO1A 1LC3A 1XWFA 4D45A 3L4SO 2OMEA 1Q0QA 2JD0A 4J0FA 1A7KA 3DOJA 4QTZA 1GADO 4HFNA 4JLWA 1FXSA 4KQWA 5B1YA 5MGBA 1EVYA 3E9QA 1Y5RA 2ILTA 2Y99A 1T2EA 4MVJF 3QHAA 4XJTA 5U1PA 3ROKA 1BHSA 3GAZA 3RBVA 3L9XA 4CR8A 3DZGA 2CVZA 3KRTA 3R3SA 2FR1A 4Q9NA 1WMBA 4J3FA 2EKPA 1O94A 4QSMA 1X0VA 1I8TA 3PHHA 4M49A 3OA2A 3TF5A 3TJRA 3GY0A 4O1MA 2WEKA 4DBVO 4WOKA 1WDMA 4B4WA 3P5SA 1X0XA 4FPXA 1F8FA 2W8ZA 1PL7A 4XDYA 2HMWA 4RVDA 5F5LA 3WIEA 5IDQA 5EN4A 3TFQA 4L8VA 3BIOA 2D1YA 4RORA 1GL3A 4HY3A 2CF5A 3QWHA 2CD9A 3I83A 4CM6A 4CODB 1G1AA 2WM3A 4RF2A 3GPIA 1N7HA 1IE3A 2BFAA 3JYNA 3RUEA 2B37A 4AJ2A 1IYZA 2WYUA 5EQFA 3FWNA 3S2IA 4JXKA 2FSSA 4UUOA 4EJ0A 4JK3A 5H83A 1IHXA 4NBTA 1P0CA 3KSDO 3QWFA 4ILKA 2HMVA 3GLQA 4OO3A 4BO9A 2PZLA 1EE2A 4RPLA 3AY3A 4U0KA 3KYCA 4QUKA 4L4SA 1SC6A 3MWDB 1OBFO 1BXZA 1E7MA 1UAGA 4MVJI 3DR3A 4EUHA 4R9RA 4GBJA 2VNSA 3VVCA 1OC2A 2C2XA 3AI3A 4FFRA 1JA9A 1XDWA 4E4YA 3GQVA 1Z73A 2JFFA 2J5RA 3RROA 2CZCA 2PH5A 5U4QA 3ZU3A 1I3LA 5JSFA 5DDIP 2VT2A 2QYSA 3WQSB 3GGGA 4CM3A 4JBIA 3AU9A 4BKRA 1TXGA 4CM1A 5BNIA 4XJSA 4AG3A 4LCJA 4O6VA 2YZ7A 2D2IA 2ZIZA 4RZHA 1HRDA 2ZJ1A 4B3HA 2DKNA 4KDFA 1P1KA 2X9GA 1IZ0A 1LLDA 3OMLA 5EMHA 3IKVA 4GSLA 3VH4A 5B4UA 2GN6A 1A4IA 1CYDA 3Q9NA 2A94A 1R6DA 4FFOA 3V2UA 1V6AA 1EK5A 3NKLA 3DBHA 1B8PA 4TRJA 4BO8A 1P31A 1KC3A 4JP2A 5JY6A 4WLNA 4GPD1 1HE5A 4YAJA 3DHYA 4R01A 1A27A 5JDIC 1ZH8A 3T4EA 1ZXLA 1PEDA 2Y0CA 4RPJA 1X7HA 5IN5A 5THQA 2P5YA 4YA6A 2NM0A 3JQCA 4Z9FA 3F5QA 5I7SA 1CQIA 3ZWMA 3BMCA 1YRLA 1HT0A 3JYQA 4GX5A 4MIEA 4YRDA 3I3OA 1TA4A 3QJ5A 3A9WA 1ZW1A 4A7PA 4MVJE 1MFZA 3B1KA 1I2CA 3KM0A 2JFGA 4E6PA 1E92A 1VJ0A 3UHAA 1DAPA 2Y66A 1OFGA 2B35A 3CZMA 3LK7A 5EJ2A 2Y67A 4IQ8A 4UREA 2O7QA 1E3WB 2X8LA 3AUTA 1BXGB 3DZKA 1UP7A 2Q49A 4J9UE 1O5IA 3WR5A 4PLCA 3GDFA 2O3JA 2P68A 2PKQO 4BNZA 2JCVA 4BGUA 5DNAA 5EERA 5KKAA 4D7AA 5DBIA 3LZ6A 2ZYDA 2GCGA 4BKOA 4J4HA 2X4GA 3C7DB 4FJ1A 3MEQA 5HA5A 4HUJA 3CH6A 4B4UA 5I7EA 1ORRA 3WG9A 5JYEA 2A92A 1IY8A 2DAPA 2DPGA 5EIOA 3L77A 4PLZA 5IF3A 3G49A 1AUPA 1J6UA 4UVHA 3DOCA 1KC1A 3NDJA 1QP8A 4W6ZA 5L53A 4NJMB 2FP4A 3DMYA 4N5NA 1ULSA 1T24A 1ZK1A 2Q99A 5A9RA 1DC5A 5COBA 1LQTA 1M75A 2NTJA 4FGSA 3PTZA 2X86A 2VHWA 2X22A 1SB9A 2V65A 5CDSA 2VTEA 5I7FA 2JAPA 4XQEA 4M54A 1DFGA 3DQPA 3MTGA 3K92A 2WE7A 4ZVVA 8ADHA 1SBYA 4JROA 1T2CA 1KVRA 1UH5A 3NTQA 3ETDA 3ZNQA 1EFLA 4OM8A 5I7VA 2E37A 5A4DA 3OP4A 1KERA 2YW9A 3PHLA 3UW3A 3E5MA 4JBHA 1YB4A 1QR6A 1A9YA 1AXGA 3QWAA 1V3VA 4RPKA 1QYVA 3RCBA 1ULUA 2JD1A 4BNUA 1Y5MA 4CUJA 1HSOA 1ZK2A 5A9TA 1JKIA 1GZ6A 4XYBA 3PQEA 2UUPA 3W6UA 5CDGA 3ZW8A 4RQUA 1Y8QA 4Y9DA 1WWKA 1TLTA 1EBUA 2GDZA 5HBRA 5IXYA 2DBRA 2VT3A 1E5LA 4IDBA 4WLEA 4XX0A 4DPMA 4WECA 4NH4A 1EZ4A 3FNGA 1QLHA 3ZV4A 1C1DB 1DRUA 3UCEA 3AU8A 1YXMA 3LF1A 4W9NA 1GUZA 1G0NA 4P22A 3WGZA 1V3UA 1HE3A 4PG6A 2GF2A 1CWUA 1BW9A 4RGBA 2YFHA 3K30A 3BMNA 4CM7A 1BRMA 3BA1A 4RDIA 4E13A 2BI7A 1SMKA 4EW6A 1QV6A 1B8VA 2NNLD 4ZHSA 4DMLA 1NVMB 4AJLA 3K5PA 1BWSA 1F06A 2PZKA 4W4TA 4DPKA 3KSUA 1ADFA 3OECA 1Y1PA 2WSBA 3G1UA 3W4JA 4RQTA 4BO0A 3CE6A 2DC1A 2FN7A 9LDTA 5ADHA 4WNIA 4L75A 2NU8A 2PH3A 3PIIA 3RJ9A 4Q3DA 3LT4A 4URFA 1H2BA 4WJZA 4J1SA 2BKAA 3O03A 4MVJH 2ZCVA 2H1SA 1NASA 1NWCA 2JAHA 2PKQP 2EW8A 2W2KA 3K8ZA 4NIMA 4E32A 4W7IA 1NM5A 1ZSNA 1XQ6A 1GEGA 2A35A 2J6IA 3ZDFA 4AJPA 1CERA 3JQ7A 5A3JA 2H5LA 4TSKA 2EIHA 4R5MA 4JIGA 3HWRA 3HNPA 2P4HX 2XAAA 3PYMA 1H5QA 3ZWYA 4E2ZA 5ICSA 4CM5A 1VJ1A 2LDXA 5JE8A 4R1NA 3FNFA 3WWYA 3DAPA 1RM0A 3TZQA 1SEPA 1PZGA 2VOJA 3M1AA 4HNGA 5G0SA 2QYTA 3QLJA 4EJMA 3QE3A 2VZ0A 2J3HA 4OQYA 1KY5A 3E9MA 1C3VA 3BXXA 3ZHZA 3RASA 2NTNA 4GKVA 4NMHA 4B3IA 3WS7A 4D44A 5JNLA 3Q2KA 3SEFA 4J2OA 1NR1A 3HDHA 3D0OA 3GVPA 4YAIA 5A02A 5IDXA 4AL4A 4I1IA 3RFXA 4CL8A 3GHYA 4HADA 3LLVA 5JAIA 2GD1O 2PD3A 1AXEA 3I9KA 3DHNA 3PPIA 5DZSA 2WE8A 8LDHA 4P4NA 3PHGA 4L4XA 2LDBA 3JQ9C 5AXBA 4PRLA 1LDGA 2P2SA 1UXKA 1PSDA 3I9JA 5KTKA 4IXTA 1RPNA 3RJ5A 3PZBA 1RM4A 3D3EA 3GMSA 4CM9A 2J5KA 3BMQA 3DWFA 1PS0A 3RQSA 5ITWA 4OGWA 1ISFA 3X2EA 4GH5A 3JSAA 3WYBA 4CV3A 3C24A 5ILGA 1U3TA 1RJWA 3V2GA 3VOSA 3RC9A 5K9ZA 1T25A 3GT0A 4FW8A 3KHUA 2HJRA 2HSDA 4FJ0A 1HXHA 3AK4A 1ISMA 4C7JA 1SPXA 1DRWA 2UV8A 2AG8A 4BMNA 3M6IA 4UULA 4Z0TA 3LU1A 1PJ3A 3EMKA 3HB5X 4LSMA 4XA8A 3DXFA 5KCZA 1UDBA 3C1TA 1B0AA 2AE1A 5KVVA 4EDFA 2WDZA 4CM4B 4YT4A 1Y8RA 3LVFO 1IOLA 2AW5A 4IQGA 4E5MA 1NVGA 3MJTA 3RKRA 2AEFA 1LDEA 3DFZA 4GVXA 3CMCO 1WMAA 1I0ZA 4YQZA 4FC7A 4UVDA 1PU2A 2Q2QA 3KTDA 3JQDA 5FI5A 3WNQA 5AQ1A 1HZZA 1MX3A 1Q0HA 1LRLA 4MIOA 4PG5A 2JHFA 4YJFB 5JMPA 2CSUA 1A7AA 5KJFA 4RPHA 1ZBQA 4ZRMA 1BXKA 1YDWA 2ZYGA 2C0CA 4EJ6A 2AEMA 3VPHA 1U2DA 3GNQA 1DLIA 3OF2A 3HG7A 1C1DA 3E5RA 1BDMA 4J7XA 2POQX 3VPSA 3ZHBA 3ICPA 3DMTA 4BNXA 1PGQA 4PRKA 6LDHA 3UAGA 3WJ7A 4P4GA 2HO5A 1Q7GA 2O7SA 4BO5A 4CQLB 3OIDA 1J0XO 3AOEC 4IPTA 4YEDA 4A27A 3LSYA 1P1JA 2W2KB 3BYZA 1BG6A 3FSRA 4Z9XA 1ZJYA 4CLEA 4QX6A 2QIOA 1SCUA 1LUAA 5A5EA 1R4MA 3LF2A 1VKOA 2E82A 3NX4A 4OXKA 4BB6A 2B36A 1N9GA 3WICA 5KOIA 2DTXA 4IDFA 4L74A 2HJSA 1HTBA 1ARZA 3GDOA 4WK6A 1HDOA 3R0IA 2DVMA 3JCZA 3AFNA 1IL0A 1PQWA 5G4LA 3NT2A 2JHGA 3AUAA 3QY9A 4MKZA 5I9MA 4TWRA 3DOOA 4MVJM 2JFHA 2DBQA 2NTVA 3VTFA 3D7LA 4RJTA 5TIIA 1MXFA 4PLHA 4AJEA 4BNLA 3CINA 4H3VA 3SLGA 1EUDA 3VPGA 1P9LA 1R0KA 3DAFA 1AN9A 1GU7A 5JY1A 3IUSA 1PJ2A 1BMDA 1Y9AA 4YJGB 5I9NA 4II3A 2BHLA 1S6YA 1CETA 4CLOB 5C7OO 1U3VA 4Q3BA 3INRA 1NXQA 2O4UX 1Y8RB 3TQHA 4B4OA 4AVYA 3A14A 3TZHA 1Q7BA 3LQFA 3WB9A 3I6IA 3U4DA 1Z75A 4J7UA 4EEXA 2X7HA 4GLLA 3U0BA 3MJSA 4IJKA 2C7VA 3WGTA 3MWEB 4W99A 5CEFA 4R41A 3JQAA 4CM8A 1D1SA 1KYQA 3PJEA 1LDMA 1I2ZA 1QV7A 3E03A 3BMOB 1XG5A 1GYPA 1W6UA 4ITUA 5KNLA 2O3SA 3UF0A 4E31A 1DLJA 2XF8A 5CHEA 4XR4A 1QSGA 5ENVA 3HJAA 2B83A 2IRWA 1MFPA 4ID9A 3EW7A 5ER6A 1UXGA 3L4BC 3MJCA 5DBFA 1NPDA 4PG4A 3FR7A 2J3IA 1QG6A 3WGYA 5IG2A 1LBEA 3B70A 4YBZA 3C3XA 4ZQBA 3VH1A 4B79A 5CG2A 1IPEA 4IGFA 4R5HA 5ES3A 5JC8A 4WLUA 1JKJA 4MINA 1B15A 2AQKA 2PZMA 1LC0A 2NVUA 4C4OA 4DIBA 3G1TA 2PV7A 1HDGO 4OKIA 4XR9A 4PZDA 3WLFA 2ZJ0A 5A1TA 3H9EO 3GEGA 4J43A 4HX5A 4CR6A 3KLPX 5CFZA 1R0SA 1B7GO 3KYBA 1P1IA 2FPPA 3SC4A 1ZMOA 4BNGA 2D5AA 4ZQEA 3RUCA 2AEJA 1ZK3A 4R68A 4GVLA 5LC1A 3R1IA 1XA0A 3VZQA 3KZVA 2YUTA 1YKFA 3G0OA 2GASA 4CLRB 1H6AA 4F45A 4K9DA 4RL6A 5A9SA 2EKQA 4PLVA 2Y1FA 2CMDA 2BFOA 4R1TA 4U8GA 2OO5A 4TRMA 1GZ4A 4INAA 2CVQA 4H15A 4IQ0A 2EP5A 1U8XX 3GR6A 4Q3AA 1GTMA 1U28A 2NU7A 1NQOA 1DRVA 1GCOA 1ONNA 3BTVA 3EK2A 3F5SA 1M6WA 3PJDA 1T4DA 1IZ9A 4EUEA 4DTIA 1JKFA 3IIEA 3H5AA 1R16A 1ZUD1 4D43A 1Z74A 3PXXA 2J3KA 4KTVE 4RVHA 3WGOA 4AJNA 5B4TA 3DBLA 3IC5A 4EZBA 1BVUA 3KB6A 3GH3A 3OQBA 2DPHA 1DDOA 4DMMA 5F1OA 2I99A 3TDKA 5KVCA 3H6KA 3GZNB 3PYLA 1GY8A 5HTOA 2HMTA 4L4RA 1I5RA 1P0FA 1QYWA 3DTTA 4HNHA 3KV3O 2NQ8A 1EQ2A 3GNTA 3B20A 5AOVA 1P33A 1K3TA 4BKUA 4IS3A 5DOZA 5L7TA 1NFRA 3JQAB 2VUTA 2OHXA 3RU9A 1LLQA 2I76A 1UZNA 2D0IA 2OP1A 1M66A 2GYYA 4MP8A 3DDNA 3KLMX 3BMOA 2UYYA 4TRNA 4ND3A 1YL6A 2VHYA 3BTUA 1TT5A 5IZCC 2DUUA 4CLHA 4E0BA 2G0TA 2P91A 2X58A 3ZNNA 3JD0A 4XRRA 4TVOA 4KTTE 2X1HA 3NT4A 3WGGA 4XEHA 3SLKA 3PQDA 3CMMA 3WIDA 1IB6A 3B6ZA 5F1KA 4JJFA 1IUKA 1KVUA 3GUYA 1MGOA 4X54A 4D46A 3ZGYA 3FPLA 4MIYA 5KJ6A 5JLAA 2EEZA 2BELA 3PK0A 4Q39A 3WFIA 4CMIA 4RVGA 4EEZA 4KDEA 2I3AA 3JV7A 3ANLA 1DXYA 4MKXA 4L76A 5TQVA 4CLXA 2FPGA 2VZ9A 3CSDA 4FCCA 4GMFA 2PD6A 3BAZA 3P2OA 4BNWA 5T64A 5HS6A 1P77A 3K73O 1H2HA 1DC6A 4RLHA 4WOJA 5TLSA 4AJIA 2OGUA 3PFWO 3LLSA 4CMAA 1V0JA 2D3TA 3PHJA 3HQ4O 4H16A 3A1NA 4N54A 5BSFA 3W8FA 1K89A 5JDCC 4B4VA 1R4NA 3TSCA 3F47A 4UVIA 1Y8QB 5KVSA 2FHSA 4GLOA 3S2GA 1YQXA 3RC2A 1CF2O 3E48A 1EK6A 4I5DA 3I23A 2HK8A 4WPGA 1N8KA 1X14A 3ONFA 4QO8A 4ALLA 2EGHA 1BTOA 2ZCUA 4YJGA 1VE9A 4E2XA 1ADGA 2O23A 2CVOA 1U4OA 1ISHA 1N92A 2HMUA 2OFPA 1ZO8A 1AE1A 2DU8A 4BMVA 5L51A 3RUFA 4OQZA 4BO7A 3QVWA 1TEHA 1NHGA 4ND4A 3VVBA 3BMNB 1XKQA 5G4KB 2Q1UA 3JQ6A 4DUPA 1YBMA 4NZ9A 3PI7A 4IDCA 3UKOA 2NVUB 1U8FO 2NLOA 2DM6A 2BLLA 2GN8A 1RM3A 3BHIA 4BNVA 4GWGA 1XR3A 3ADOA 1BSVA 1JN0A 4OIMA 4J7CA 5L4NA 4R4JA 4UVGA 2W4QA 4WEOA 1HEUA 2FMUA 1O8CA 1UJMA 2P9EA 3ENKA 1ZVMA 3GVIA 3ZU5A 4Z6KA 4RO0A 4DYVA 2C54A 1T4BA 5G0VA 1LNQA 4XKJA 3H9QA 3RUHA 4ZA2A 2CY0A 3V1UA 4IUYA 1MG5A 5CAEA 4CLRA 5JDCA 3Q6IA 1LSOA 2VYNA 3HDJA 3V5NA 4HV4A 1D7OA 3P7MA 4LRTB 5COQA 5IDWA 1N2SA 4NBVA 3H2SA 3HFSA 4JJIA 3AY7A 1ZIDA 1NNUA 1MLDA 2Y1GA 2E4AA 1MXHA 1HDZA 2DLDA 3WTCA 5FEUA 1NYTA 1T2DA 1V9LA 2O4CA 3UICA 3EZLA 1NTOA 4EGFA 1PX0A 4R1SA 5GZ3A 4BNMA 1A9ZA 3ZV5A 4AJ1A 5F21A 3E1KA 1EBFA 2JCXA 2YHIA 3QQPA 1GDHA 2PZJA 3UN1A 1ZMTA 1F8GA 3DBHB 1ZEMA 3AI2A 5TSDA 2VCYA 1K0UA 1RYEA 2PK3A 2QRKA 3W8EA 2DTEA 2IXBA 1JTVA 4G65A 5G0WA 2Q1WA 4IIUA 3VHRA 2X6TA 3NYWA 3UGKA 1E3JA 4ALKA 5TJ9A 4H7PA 5JYDA 2OL4A 4NFYA 1PJQA 4KMSA 4OJNA 1R37A 1ZJZA 3D5QA 3FBGA 3ZWPA 4O0LA 4E5NA 4E5KA 1DC3A 4I5FA 3IOYA 3Q11A 4GGPA 5EINA 1ZNQO 2QHXA 3K9QO 5JAQA 1SZJG 1R4NB 2BFPA 2HRBA 3KYCB 4JJGA 1XEAA 2DUWA 4A73A 3GRKA 2QRJA 4DL9A 2QG4A 2E48A 5L9AA 2IEDA 2X0RA 4Z0PA 4BL5A 3DBRB 3GOHA 1H9AA 1R15A 5JW6A 1Q2XA 3WLEA 1U4SA 4ZGWA 3I9NA 3K6JA 1E0DA 2VTDA 1MA0A 3QRWA 3CTMA 3JQEA 4LGVA 1HDRA 3S8MA 4KOAA 1DIGA 5TX7A 4BV8A 3VKUA 2HK9A 3WMWA 5KJ1A 1AHIA 4RF5A 4IXWA 4PCVA 1I33A 4FR5A 4BNHA 4MKRA 1PJSA 5L95A 1C0PA 4BMSA 3RI3A 3DBVO 2IZ1A 3KYDB 2GLXA 3RU7A 1EFKA 1KEWA 2UVDA 2HCTA 4OSPA 3ZNPA 3GGPA 1E77A 1GAEO 3ITKA 3OQ6A 1NP3A 4QXMA 2Y1CA 2VHXA 4LK3A 4M8SA 3TZCA 2GRAA 3IAHA 4Y8VA 4RVUA 2CNBA 1JU9A 5JPIA 4IY1A 3NT5A 4L0QA 3QP9A 4Y6RA 2CDCA 4FDAA 4NNJA 3F4BA 1P1RA 2PWZA 4ND2A 4HFJA 3RIHA 3DMTC 2VWQA 1GQ2A 3GNSA 5DBGA 5CPFA 5GZ1A 2AE2A 4MVJA 2V6GA 4ZD6A 3B1JA 3FN4A 3L6DA 2PGLA 2SCUA 2GUGA 3PLRA 4UVEA 5DCWA 1Q7CA 3FTPA 4R3NA 4G81A 3RUIA 1UDAA 4YAGA 1YVEI 1LQUA 4LN1A 4GL4A 2B5WA 3CUKA 4LVUA 1ONPA 4NG5A 3H7AA 2GZ3A 6ADHA 1KEVA 4JCOA 3EUWA 1JAXA 1WP4A 4IMRA 2HDHA 3H9GA 3ZU2A 5JCXA 4TMFA 4TZKA 1XIVA 3KVOA 2V6FA 4R9SA 2WYWA 1SOVA 3RD5A 4RF4A 1VKNA 1GEEA 1UUFA 1YO6A 3ZWOA 2GGSA 1YQDA 4DREA 3O8QB 2EP7A 4L9RA 4F6CA 3RC7A 1A4UA 3ONEA 1EUZA 1Z45A 4B7UA 1YQGA 3GUCA 1XYGA 4W7HA 3PJFA 1NFQA 2B0JA 1KVTA 2C7GA 3JQBC 3JQGA 1ZZEA 5LDGA 1LX6A 3F1KA 1YH3A 3ENNA 3DO5A 3RSHA 4DQVA 4HKTA 4YT5A 1NWHA 2RHCA 3LT1A 3ZHYA 4FOOA 3WQRA 2IEBA 3FTNA 2NVWA 3QVXA 2J5QA 3AM3A 3AY6A 3NTOA 4S3MA 3FBTA 4B7XA 5CDTA 3X2FA 3NDIA 1DIRA 2EF1A 4PLTA 4NBUA 1FK8A 2EJVA 1P1HA 1PZFA 3ROQA 3WNVA 3H2ZA 2R2GA 2D4AA 3U9LA 4CQLA 5C5IA 1QLJA 4NU5A 3NJ4A 4PLWA 4YRBA 5TT0A 2JJYA 5KJEA 4XB2A 4A10A 4MO2A 1XELA 2E6UX 3S1LA 3T7CA 3ZWCA 1JAYA 4JX8A 2NQTA 4S1VA 1OZAA 3K2BA 4KUEA 1K6IA 2A4KA 1R4MB 3GVCA 4WASA 4XGKA 3EDMA 2P5UA 2DT5A 4NR0A 4ZN6A 2DFDA 5FYDA 4FFMA 3ZN2A 2VWGA 1OI7A 3D4PA 3EGOA 1DC4A 1N9GB 3E82A 3AWDA 3VZRA 1H9BA 4YPOA 4YXFA 5KKCA 2Y1DA 3JQAD 3TL2A 5DP2A 3U4HA 1YE3A 3C7CB 1HDCA 1DO8A 1YL5A 2GNAA 4R3WA 4B3JA 2NUAA 4FC6A 5CEEA 3S55A 3UXYA 3C1OA 3DFUA 3ETEA 1U7HA 7ADHA 4L73A 2Q4EA 3V2HA 4K6FA 3ZWBA 1X1TA 5ITVA 3GAFA 3RUAA 1G0OA 3OSUA 2GERA 1LXCA 1KEPA 1P3DA 1N5DA 4EBFA 2EWMA 1ISGA 4U6QA 1GUYA 4RPGA 3OFSA 2ZKLA 3PWZA 5TGDA 5A04A 2C5AA 1B2LA 3GG9A 1QYXA 3KXDA 1UAYA 3KEOA 2C5EA 2EJWA 5JO0A 2WWRA 4YCAA 2Z1MA 1T2AA 4UEOA 4YQYA 3HDYA 2C20A 1NQ5A 2PKRA 5G0TA 3ANMA 4AJOA 2EHDA 3ZWVA 4RVFA 1QYDA 3ABIA 3SVTA 1LLCA 1YDEA 1ZEJA 3QA9A 5BSGA 3KYDA 5A06A 3R3JA 1DFHA 4U0JA 4ZU3A 4WUVA 1K6XA 3NUGA 1KOLA 2R6JA 3OBBA 2D5CA 5EESA 2AG5A 3ROPA 3KUXA 3UH1A 4DC1A 4HFRA 1PS8A 4YTEA 2YV1A 4F3YA 3WGIA 1N1EA 4EYEA 4CMGA 2Y93A 4FGWA 4KP7A 4BGIA 4DBZA 3GF4A 4ND5A 4N7RA 3IP1A 4AJ4A 1U3WA 2IZZA 2Q50A 4CR7A 1HDXA 1F12A 2X0NA 2C07A 3W6ZA 4J4BA 5GMOA 1SO8A 2NVBA 1FDTA 1V3TA 3JQFA 1DJNA 2OBYA 2X5OA 2PGDA 3NJ8A 1WW8A 1KY4A 3OJFA 5A05A 4LSWA 2OZPA 1O89A 2IZ0A 5FI3A 4GGOA 5EQDA 3O9ZA 4BKPA 1KVQA 1ZXBA 1KIFA 2W2LD 1D4FA 2PFGA 3DC2A 1FDSA 1P44A 1NR7A 2WD7B 3GN2A 3M1LA 4MVJD 1C14A 1JQBA 2FSVA 3D3WB 1CRWG 1R66A 4A0SA 5AXCA 5T67A 1DHRA 3DTYA 5JDIA 3PYXA 1U5CA 1W0CA 3AM5A 5HRUA 3WGHA 4RZIA 5A3VA 2QZZA 4XZ3A 2PTGA 3E6AA 3OEYA 4HFMA 1UP6A 2I6TA 5BNFA 4YAKA 1GR0A 2TMGA 3IQDB 4I08A 3L07A 3FNEA 1GUFA 1JVSA 3JQFC 3OICA 1AHHA 3STHA 2BMAA 4XIJA 3PGJA 1LJ8A 5L3ZA 3ZHXA 3I5MA 3WDSA 4ZQHA 2VRCA 4BNIA 1U1IA 2I66A 1E1MA 5C3MA 3AUUA 2Z5LA 4OOEA 1EEHA 3N74A 2CDBA 1DIAA 2XXJA 3VZSA 4XGIA 2FY8A 3LDHA 3LC7O 2A9FA 4JBGA 4XDZA 1F0YA 1DEHA 3AFMA 4BNTA 2FWMX 1ZK4A 3WYEA 5KJCA 3P19A 4BKQA 3IUPA 5IXSA 3PJGA 1YOVA 4CUKA 1E5QA 4MPDA 3HFGA 3JQ8A 4ZQFA 1DFIA 3JYPA 1Y81A 3HHPA 4TKLA 2VZ8A 4NJMA 3WBFA 3ZZNA 3FR8A 4I5GA 2YHUA 1HE4A 1LU9A 4TROA 1HYHA 4Q3NA 2VN8A 1OMOA 1XU9A 1Z6ZA 2O50A 1YBVA 4DC0A 1BDBA 1ISIA 1HYGA 2HRZA 1WVGA 3C1AA 1W8DA 2AQ8A 1P45A 5T8KC 1C1XA 3PFFA 7MDHA 1EDZA 2RAFA 2PY6A 2PR2A 5K0ZA 3JD4A 1GCUA 3BHJA 1E6EA 1GPDG 3OQ1A 4R69A 4YJHA 4AJKA 1VC2A 1Z7EA 3KETA 1SAYA 1JVBA 2X5JO 4J1NA 4XWYA 3MZ0A 1NHWA 1XCBA 1YGYA 4OAQA 2OUIA 4RCVA 4ZJUA 3UOGA 2G5CA 4ESOA 1HZJA 3INGA 4E2YA 3TRIA 2NADA 2OXIA 4DLAA 4HP8A 1PR9A 3OJEA 1VPDA 1XQ1A 3A4VA 4NDNE 3AI1A 5ER9A 3GN1A 3PHIA 4J49A 4MVJP 4NI5A 1UXJA 3QIVA 4WCFA 3MJEA 4DQUA 2AA3A 1E7WA 1YJQA 1KS9A 1LEHA 5I8WA 4JGBA 4D41A 4BUCA 2C82A 3O38A 1MV8A 3PRJA 1T1SA 3ZWWA 4QFCA 1EUCA 1EVIA 5T8KA 4DA9A 3FCOA 4OMUA 3RUDA 2AQHA 5BNTA 5G4KA 1VI2A 4IDAA 4XRGA 1SB8A 2B4QA 5BQFA 3I6QA 1NQTA 3ZW9A 5K6AA 1PZHA 5U9CA 2CUKA 2F00A 1K5HA 3SBOA 5ICMA 4BNNA 5A03A 1ZSYA 3GA0A 3M2PA 5IN4A 3QVSA 3W4IA 1UXIA 4GQAA 2CFCA 2ZB7A 4Y67A 2HK7A 3JYLA 1D1TA 1QORA 1W73A 4CL3A 4DGSA 5FWNA 3W1VA 1VL8A 2EERA 4PFJA 2AXQA 3INTA 4WKGA 3VTZA 3WFJA 4DIOA 1QRRA 4MOWA 3ROMA 4XQ9A 1EVZA 4PIVA 1E6UA 1A5ZA 4CMEC 4XGNA 5F5NA 3K31A 4ALIA 4EITA 3MJVA 1NQAO 2Q4BA 1U5AA 3JQ9A 4II2A 3D64A 4U5QA 5IZ4A 1VSUA 2G76A 2QX7A 3PEFA 5BSEA 3NDRA 1Y6JA 3QSGA 2P9GA 1QMGA 5F3RA 1YWGO 5TC4A 4XB1A 3ONDA 5JC1A 3L9WA 1YBAA 3H4VA 3ASUA 4NK5A 1PJCA 1PR3A 2HKIA 4R1UA 3A06A 4HWKA 3AOEA 1N1GA 5DF1A 1Y7TA 1ID1A 2UUOA 2C2YA 3COSA 3GEMA 2WMDA 4ZQGA 4C7KA 5I8ZA 1M76A 1P1FA 2VUSA 2Q1SA 5L7WA 3HADA 3NEPX 3HN2A 1JLLA 3NV9A 1FDUA 3OEWA 4OXYA 4KQXA 5LDHA 1B3BA 4E12A 1KBZA 3U3XA 1UR5A 4M86A 1YOVB 4BNFA 4DRYA 4CQMD 1KETA 4R51A 1LLUA 4J1QA 2YYYA 1ZSVA 4ROSA 3PLNA 1GV0A 4Z0HO 4GX1A 4FIZA 2RH8A 3F3SA 4JP3A 3GG2A 4FS3A 3D4OA 3TOZA 3WOHA 4PN3A 4CM9D 2VHVA 1HL3A 3ORFA 3LYLA 3RAJA 1GD1O 2QW8A 4MP6A 1WXDA 2F1KA 1HLDA 2O3TA 3DZBA 3V1TC 4IMPA 4DLBA 4TRRA 1I30A 3SJ7A 1C0KA 3W8DA 1HDYA 3JD3A 3Q9UA 1E3EA 2D8AA 2RBEA 4K6CA 3Q2IA 4UEJA 5LCXA 4PZEA 2VUUA 1A71A 1LSJA 3TWOA 1IPFA 1B8UA 2ZATA 4AJHA 2ZB8A 3JQ8B 3IJPA 2XPCA 3SC6A 1GV1A 1YONA 1LSUA 3IP3A 2G17A 1TI7A 3WQQA 1QYCA 4A2CA 1LTHR 5GY7A 4BO6A 3HZZA 1PS9A 3TFOA 3ETGA 4K26A 4G5HA 5JAMA 4XYEA 2GO1A 2VYVD 3BZUA 2RCYA 1NAHA 4RF3A 1NPTO 2NV6A 2ZTLA 3Q1LA 1C1XB 1XHLA 4OSOA 4W9NC 2Z1NA 4FD3A 4LRSB 4TQGA 4KUGA 4E5PA 1PJBA 2OOSA 1MB4A 1CEQA 1PZEA 3KOUA 1PJTA 4CM4A 4HXYA 3DZIA 3GZNA 2V6BA 4LW8A 4J4TA 4WGGA 3U09A 3TZ6A 1ONOA 5B4VA 2YQ4A 1PJ4A 5J23A 1E1NA 4PLPA 2ZYAA 4LMRA 4YR9A 5H82A 2CF6A 4P4LA 1WNTA 3EY4A 1ISJA 1WDLA 4XCVA 3DZFA 4U6SA 1W4ZA 4Q3CA 4D0RA 4PZCA 2PD4A 4IJUA 3JTMA 5TF4A 2GZ2A 3GC6A 5JBIA 3AOGA 1X7GA 2W98A 3G17A 1C0IA 5T6BA 1FJHA 3MOIA 3QVTA 2VNAA 4BS9A 1Z7BA 2VQ3A 5JCJD 1GQQA 3T4XA 3H5RA 5A5FA 2XXBA 1ZKMA 2O3QA 5JFOA 4PLFA 4N5LA 4UUMA 3SX2A 4FOSA 4W82A 3ZU4A 1X1EA 2YQ5A 3ANNA 1WLYA 3F1LA 5BSHA 5KIAA 4N18A 4M55A 1HF3A 4D3SA 2QZ9A 1AGNA 4DLLA 4NFSA 4MDHA 4IDGA 3TL3A 5AYVA 2TMDA 2C59A 3WX0A 4PLGA 4YVFA 1SEVA 4GWKA 4JNKA 1GQYA 4BB5A 1E1KA 4IGEA 4Z3KA 2V7PA 1DIHA 4MVJG 4QQRA 5DT9A 4D42A 3FRJA 4ONEA 5L40A 5L7YA 1B26A 2YY7A 3AM4A 2H63A 1ENPA 1ML3A 2AQIA 5DOVA 3ST7A 1FF9A 4ALMA 4YJDA 2YJZA 3F9IA 1XSEA 3F6YA 1MP0A 2Q1TA 2Y1OA 1PWXA 3LC2O 3OM9A 4BVAA 1ENOA 1V35A 2GN9A 4FB5A 3IJRA 1NPYA 4Z3DA 4XIYA 1LDNA 1UZLA 3VH3A 4CPDA 5I9LA 3PGXA 1OOEA 4B8ZA 4KWIA 1WAMA 4CLOA 3I52A 4LISA 5AXAA 1KEUA 4OHUA 1R0LA 1ADCA 3H3FA 3ZWAA 3U4CA 2ZB3A 2YDXA 4BNJA 4E30A 3L6OO 3LC1O 2Q46A 4IZHA 1WDKA 2W2LA 3DZHA 3GVHA 4LCEA 4IZIA 3VDQA 3WGQA 3E18A 4G2NA 3WJAA 4J91A 1T1RA
chains in the Genus database with same CATH superfamily
2C1EA 1PSZA 2RI6A 3ZHOA 1BH2A 2CC2A 3VKVA 1TVMA 4O4IA 1VL0A 4CKXA 4E21A 1MTOA 4EGJA 2ONZA 4CEJB 1NG9A 2R4UA 1G8FA 2F62A 3DDCA 3AKDA 3I42A 4EFMA 1HMPA 2FEOA 3H05A 5LQNA 1QAQA 3M34A 4F6RA 3LW8A 4BV9A 2AR0A 3T4UA 3ZD9A 1A7JA 1QF6A 1M3SA 4MS3A 2Q3BA 4MUAA 1NOIA 4O4HA 1E94E 3K2EA 3ZW7A 5J59A 3DDZX 4C3UA 5B3LA 3M6MD 1XQWA 1Y6QA 2CLKB 4H7KA 1OBVA 2O0MA 3I8SA 4HYTA 5D3QA 2IDZA 2HLPA 4D79A 4DA0A 5K03A 4NSNA 1H4SA 3ZVNA 2V96A 1SQFA 1CHDA 1N25A 3O95A 4S1PA 5AQEA 3RNLA 1DCMA 1D7AA 3IAXA 3JVDA 3A1EA 4TV9F 3CZCA 2ONJA 5BURA 4DSTA 3AM1A 4RULA 5EP2A 3CX8A 4LSZA 2JDID 1E3LA 1VHWA 2X41A 3GEBA 4EHAA 3ELBA 1RI2A 5ELMA 1OV4A 4UDOA 3UUWA 3Q6NA 1B8OA 4FE4A 5L45A 1M74A 2X0IA 1IUOA 2DWUA 2D2VA 1GYQA 1KJWA 1O9BA 3VA7A 1RRCA 2YINC 3AGPA 5IPFA 2AJDA 3B1YA 2PPVA 5GVSA 1DSSG 3UATA 2J41A 4UM8B 5HILA 2A7XA 5TNXA 4ZIRB 5FUMA 1DT5A 3MOGA 1GTZA 3VPXA 4A6EA 3U4IA 2BUBA 4IIXA 5FPYA 1AZWA 2FEAA 2OO7A 3WJ2A 3ZXSA 2BR4A 4FDVA 1BVRA 1M67A 1QH9A 2L42A 3CUVA 4Q9HA 4DLYA 3D6NB 2NP7A 1HYEA 2VYND 4WY2A 4WI1A 4IJMA 4OHBA 5JCJA 5JHHB 1SQ6A 5GIPE 4U7GA 5KYVA 4HQ0A 2HA0A 3ORRA 1Z16A 2I6FA 3II6X 3IKTA 4I7EA 4KH0A 1IK4A 1Q0TA 3K4PA 5CURA 4IJWA 2I9PA 3GLHE 4M60A 2VWPA 3GRPA 4M0PA 1JIXA 2V8OA 4B9AA 4ZZIA 2IYPA 4DKXA 4E51A 3UQYS 1ORTA 1X70A 2G1UA 3E8SA 3IQXA 1A50B 4MHTA 5DP1A 1WY7A 1H6CA 2A5DA 4TMVA 3G0HA 1NJ5A 1T29A 3FI0A 3AILA 4DMHA 1LRJA 1M34B 2PZGA 2VP2A 2VNJA 3P71T 1MC1A 4GAEA 5JUWA 1MRNA 1H6BA 3G7NA 3SQDA 4PZ0A 1MB2A 3FPCA 5JSYA 1R0WA 5DULA 4P3PA 1YDFA 3I2JA 3IE0A 2FPXA 1L6RA 2Q3FA 1ZUIA 3RC1A 4MWBA 1PL6A 1V9CA 3EQ9A 4BIIA 1HETA 3SYRA 2BFFA 3H0EA 2Y4OA 3OWOA 3PR1A 4YDRA 3ENZA 4ZP1A 4O4IB 1CEYA 2JCYA 1FYDA 4PG8A 1MW8X 3L93A 4OXQA 4YT2A 4O2RA 1O6GA 1V8PA 2HU2A 3QTLA 2XUAA 1D3AA 2AUMA 2FB9A 3CHYA 4ZC8A 2RGNC 2A9KA 1LS6A 4K9RA 3RQIA 3RNOA 4YMWA 4DM4A 3ZV6A 4RSRA 4B5LA 3DAGA 1P7WA 4DB4A 1MJFA 1YCHA 3K0BA 1FTNA 1JDVA 2BZ0A 3GK3A 3L4EA 5EC8A 4ZVOA 4XCVA 1UQRA 4LBYA 2HK6A 2CLEB 3HN7A 4JGGA 3B60A 2R5NA 2QTVB 4IIYA 1CJCA 4KFUA 4ND8A 5AHWA 1BKSB 4UM9D 5DN9A 3AINA 1DZ3A 3EQ2A 1FNSA 1SBNE 1J24A 3MLBA 2G09A 1KWKA 2GWHA 3KPWA 4G23A 3QXSA 5FOWA 2OV6A 2DFNA 1LVHA 2Y71A 2ZQYA 3BHMA 3LPDA 4HNAA 3BMXA 3E4DA 3FYDA 2VRCD 4WZAE 2C88A 4RD6A 4WOBA 1W0KD 3UA4A 3ESQA 3AC0A 3IDSA 3OOJA 2ZZKA 3QX9A 4IVPA 3LHKA 4O59O 4AXXA 3UANA 4AKGA 4KXNA 4UFNA 5I4BA 3ZEIA 3PR3A 4YS6A 1VL6A 1M6YA 1SUCA 1T36B 3BWEA 5E38A 3PE6A 5SYAA 2PRJA 3FCCA 1WUKS 2P9CA 5BQPA 1VBNA 4J90A 5DNYB 2WG1A 2D3WA 4NYMR 3RODA 1UINA 3QMPA 2Y1EA 4DXDA 5TQ0A 2Q6KA 1K3UB 1SXJC 1BXRA 4LZPA 4AIIA 2B4TO 1XU4A 1KMCA 3PZRA 3ABSB 1LZKA 1LGYA 2ORIA 5L4LA 4KODA 4K9NA 5BNZA 4N5MA 3DR5A 3P94A 1UFQA 2EGGA 1TZMA 2H8KA 5T5QA 4WLFA 3DO8A 2ZYWX 4UM9B 1B1AA 4IIEA 5LOVB 2E4ZA 4DTCA 3I39X 2TYSB 4DM3A 4KHZA 2YN0A 3OA0A 5A3QA 5KYWB 1BH6A 2OBNA 4P3YA 1K6JA 4IG4A 4J03A 3DVAA 5CGZA 1CUSA 4B7CA 5MDHA 1T43A 1XDSA 2D54A 1JIKA 4GM4A 4HLDA 3H8WA 3M6AA 4UEKA 4PG7A 1TTTA 3FYCA 4IAOA 3E7DA 5JD5A 1UPFA 1TM3E 1CJUC 5F1PA 1N8NA 1RVV1 1WETA 3AL2A 3NOXA 1VRVA 4X6UA 3ZIAD 1LPOA 2WJJA 2CNDA 4MLPA 1II9A 1ZUNA 2DBVO 2A1UB 4OBWA 2GPBA 2ZS7A 5CGQB 2FG7C 4DDTA 2PT5A 1HK7A 5DHSA 2NAFA 4N01A 1VRWA 5B1DA 1T9BA 4L3WA 4GRAA 4ZICA 2CZQA 2ZJZA 1THZA 1WQ4A 1L7VC 1M1ZA 3IIKA 4L78A 2QB5A 4C76A 4BBJA 3BWVA 4XIIA 1NX6A 4G0MA 4JOQA 3TX2A 4K1LA 1ENYA 3E9CA 2FDXA 5IARA 4Z9BA 3TPCA 4ZGBA 5HM8A 5HKAA 5CCDA 2IHYA 2CNNA 1E2HA 3GJYA 5ITZA 3OJWA 1P19A 2JD2A 4A0RA 1XUOA 2PWBA 4WAUA 4CV1A 2NO0A 2PUVA 2HAEA 4TWIA 1S2IA 4I50A 3H65A 4CQMB 3KO8A 3Q3JB 1NW9B 2X8WA 2XMPA 4RQAA 4AKEA 2YV3A 2RJNA 5BYKA 2DHEA 1PYGA 2JGDA 1TMOA 3KZKA 5FUYA 1JW9B 2AI1A 1M1YA 4NPCA 1DINA 5I51A 3RSZA 1QHIA 2J30A 3BBLA 2F2TA 1DBIA 2BT4A 2VXOA 3C0KA 2EX4A 3L7BA 1GNRA 2ZTVA 3RTAA 3DAYA 4GSKA 4UTXA 3ND8A 3LKVA 4XLZA 1V26A 5EPOA 5GINE 4YMTA 5D3MB 1PIWA 2CUTA 3BN3A 4DHEA 4DJAA 1UBNA 4J0HA 1Z06A 3CZRA 4IHJB 1E0SA 1J5PA 3I32A 3HI6A 5CHYA 3E1GA 1TZ2A 5TRTA 4D6PA 2IDKA 3JWGA 1H94A 3THXA 2EXXA 4IIVA 3EXIB 1SN7A 3KCQA 1HOXA 4I19A 5TPWA 3SLRA 4AG6A 1CUUA 4LGCA 2PV0A 4L22A 1Q22A 3MJHA 1PHRA 2O1SA 3LGXA 2QPTA 3SDSA 5GADl 2HNKA 2YV4A 4QC2A 1H3FA 3EW9A 1XXHE 2IEGA 3NXSA 4S12A 5AKJA 4CI0B 1TM1E 4C0AC 2IHZA 1NX9A 1R00A 5BT9A 1WE2A 2JKZA 4B82A 3JVUA 4MR8A 1U0RA 1S2MA 4BEJA 1JDJA 4G1CA 3GHHA 1Y98A 2C2WA 2QLBA 3DVQX 5FX2A 1DAFA 2GK6A 2M6LA 4HBGA 1KBQA 4WLOA 1EMDA 4I99A 3QH4A 3OIGA 4KZKA 4S05A 3I9OA 3E9RA 1JSCA 1CQJA 1DAOA 1OAAA 2Q45A 1MC4A 1Q3KA 1E7YA 1P74A 3MWEA 5EZQA 4E3ZA 1VGVA 3T5BA 3K9CA 1VLZA 3TN7A 2WIJA 3Q3IA 1Y9EA 4DJEC 1JZQA 1OB2A 3COJA 1OWPA 2WF8A 3L8YA 4G0ZA 1SCUB 4I8XA 5GIOE 2GNPA 1RWBA 4R1OA 1QWSA 1G5QA 4XB6B 3L1UA 4NK4A 4RLQA 3RVLA 1Z4OA 2F17A 1YTUA 3CLRD 2ZWMA 4XCXA 1U8CB 1UMBA 1C9YA 2P0YA 1XTVA 1CZKA 2XVZA 3F2IA 3OETA 2PA0A 3IR7A 4HI0E 3ULKA 1PQUA 3UJ8A 3MERA 2V8BA 4QXPA 3R44A 4U02A 3VHXB 1MTZA 1RLTA 4GKBA 1KDYA 4LVOA 3URKA 3SOPA 1YUNA 1V39A 2OAP1 5E9JA 1Q12A 5ITZB 3STUA 3KHSA 4BE4A 3I0NA 1SPBS 2CXSA 1Z0AA 2HWXA 2IFTA 1LSSA 2YXDA 3FLBA 3E4CA 3QHPA 1GZDA 1R9NA 1KI4A 1MO2A 1Y42X 4GPAA 2O3RA 4LRUA 3V4FA 4W5QA 2KPOA 1G21E 2ZQZA 3MQFA 1TM5E 3G0IA 1LBHA 4ISBA 4YYZA 3CX3A 2FFQA 4DLZA 4AI6A 3A7DA 4F6LA 2OG1A 1YZVA 3WK9A 4QRDA 3C8DA 3L01A 4UTVA 4I4TF 3F7TA 1UFOA 1YQUA 1KPIA 2D1RA 5CEJA 1NVAA 1JIIA 5ARBA 3C7AA 2YJ4A 1DAHA 1JDUA 2VHTA 5A0VA 2HEGA 2LZ0A 1ZQ1A 2HDOA 2QN3A 3E9NA 4TPKA 1D09A 1I5OA 5ESDA 2C9YA 1YZLA 2GEUA 2YASA 3B78A 4LJ4A 4UUBA 3VDRA 1OXUA 1U7TA 1FS6A 1OF1A 1SXGA 3DM5A 3TR5A 3SQXA 1BX0A 3RFUA 4RFVA 2Z0MA 3T95A 4G5YA 5TMPA 3ZHVA 2OV8A 1I4LD 4Y2XA 4F2GA 1PWZA 4Q24A 3R7AA 5IAAA 2V58A 2FFBA 4TV8B 3HS3A 1OXSC 2I54A 1GZUA 2JFPA 4L5CA 4GX0A 4YREA 2I7DA 1UDCA 1A0OA 1U3GA 2R1TA 3G85A 3UAOA 4UNNA 1FTWA 1M1NB 3AVXA 4NFHA 2P3OA 3BIFA 4OATA 3F6PA 2PBZA 1ST2A 5E4JA 1RQNA 4LNAA 1C2YA 3UT5A 2PGIA 4YO7A 3TLGA 2AOWA 2BCJQ 1FSZA 3RC3A 5DLPA 4HRXA 4FN4A 5EHIA 1JQ3A 3KKMA 1N0WA 4CMCA 1P2GA 3CPSA 3ISTA 3IURA 4K9MA 1E1LA 3JQBA 2WHEA 3RWMB 3AR7A 3OJOA 4IR7A 1DJQA 5D8DA 1ILEA 4NYJR 1BOFA 3ZWNA 1PGPA 1K7FB 2XUOA 5DXJA 3NWEA 5HYVA 2J46A 3KSZO 2C42A 3X1KA 1EZZA 3CR8A 2OAGA 3W05A 3DSRA 3ZY6A 1BMTA 2Y68A 3KKKA 1E3MA 2PS3A 3LFHA 1QIDA 3LZDA 3BF7A 4IIJF 1XO1A 4WY8A 5K3EA 1FDVA 2I4OA 4I55A 1W87A 3CZ4A 4K28A 1XU7A 2FAXA 3F5MA 3P97A 3BRWA 5EWJB 3E3MA 2OM6A 3P9YA 4R2JA 5KNCH 4DQXA 1GWNA 2GD6A 3ASZA 1H23A 1N6LA 2FOXA 3SXUB 5FFFA 1S2LA 4A6XA 3L6EA 5M2QA 1JGTA 1YK1A 2YFYA 4EI8A 3MWJA 4LYEA 3W06A 2OD9A 5TMEA 4DR6B 2G1PA 1I3NA 2A86A 3N6XA 4FOLA 4ID3A 2X7XA 5CM2Z 1XI2A 1Y1RA 2Y1LA 3C85A 1M1UA 4JJKA 1SXJB 4P38A 1IJBA 4PIMA 4HXFB 1C8KA 4X6YA 3R09A 3H3XA 4CHTA 3OPYB 4XD7D 1Z37A 2PJDA 5CT6A 3AHHA 4LQCA 1MIOA 3DBLB 1YS4A 1FTYA 4LJ9A 1NBOA 1XB2A 4YV7A 2WOOA 4V24A 1G5HA 3DHWC 5BOSB 4I9HA 4PPGA 4EI2A 2EYQA 3HUDA 3OJ0A 3TPZA 4FD2A 5L4SA 2OBXA 2YOGA 1FPQA 1M2JA 3D0QA 3H2IA 3A1FA 4QJ4A 5CW2A 4QTTB 4BNTA 4YMGA 5IVKA 2C83A 3A1CA 5AM3A 3W78A 2RARA 5G2OA 2PX5A 3IXMA 3PC8C 4N3GA 4RSHA 2ZSBA 5I48A 3R4VA 4ZU6X 4CF6A 1I10A 2P1ZA 3TKLA 2XYQA 3TRJA 4EGQA 5FAKA 4TMTA 1HE1C 2VDPB 2KBEA 4JKYA 1JG2A 2B8TA 4ZFNA 1UKYA 3TIXB 3EFOA 5JAOA 1SOWA 2JL1A 1QCZA 2ZDHA 4NENB 1G6OA 4NCAA 1DAMA 4B73A 1OZ0A 1FRNA 1W85B 5K0TA 2FMIA 3V8EA 4PVDA 4HX9A 4RY0A 4AF8A 2QMYA 1WXXA 2SHKA 3UTDA 1D9ZA 2WD8A 3M1YA 3G9UA 3IVMA 4KYIB 4N39A 3P1JA 3KWJA 4TWJA 4DCPA 1TE2A 1ZN8A 3SS9X 4EKDA 2W70A 2LR0A 5M34A 1O95A 1HQKA 1YIOA 4V0RA 1HFJA 1BXGA 1CZHA 4C4XA 3QUTA 4D3FA 1ODIA 2PLRA 4KO4S 2ZI5A 1EKXA 1T3SA 5CVCA 4Z4HA 3L4SO 3SICE 4YJ2A 1UMDB 2G67A 3A9VA 1GADO 5BYAA 1HNNA 1M33A 2W6ID 4M1EA 2E2WA 3O73A 3WAJA 2IYAA 5B1YA 4H3SA 2W43A 1VHTA 3R7SA 2ILTA 3I45A 3IV7A 1T2EA 1CX9B 2PZEA 3CG4A 4M7RA 3NRBA 4XJTA 5U1PA 3RBVA 4YMUA 4CR8A 4ECAA 6ABPA 4CIDA 5EWJA 3AJDA 4F3RA 4WERA 5HQJA 2OCIA 4AIRA 5FIUA 3ICOA 3QPVA 4GZMA 1OI3A 1X0VA 3OFJA 2I22A 1VKZA 1YMQA 1JQAA 5AM0A 4Z0NA 4YP1A 5KU1A 4W8HA 3TJRA 3GZJA 1CY8A 1GZ5A 2WEKA 2NUAB 4GI1A 4PYNA 2ZUWA 4A0QA 2WWWA 3G2MA 2WWFA 1A5TA 1WDMA 4H0FA 1JLHA 2YC4C 2RHOA 2HA7A 2VJQA 3NLLA 3OU6A 5ALGA 3DVRX 1PL7A 3IDAA 5C3UA 3HYCA 4GZLA 3Q0IA 5FYQA 2RG7A 3TFQA 1VLMA 1TIBA 4K3VA 1RRPA 2IHTA 4PU0A 4Q7JB 3RSCA 2PYZA 4NS1A 3QWHA 2ZIWB 1U0OC 2H9AA 5FQNA 3B12A 5FWAA 2VPYA 5BOSA 2JFZA 1WSBA 3GPIA 3JYNA 1IE3A 2O5EA 4GEKA 3LI2A 4O4JA 2B37A 1C7EA 1M34A 4AUNA 5BT8A 1W88A 4JC8A 5JROA 2WYUA 3BCSA 3FWNA 3OCZA 2FSSA 3BBPA 1LPPA 4EJ0A 3UHPA 5HJ7A 3RAPR 4Z54A 3F2VA 3U60B 2JLRA 3RV4A 1S2DA 4OO3A 3NASA 5K6RA 5FA6A 2IH4A 2GM5A 3FM9A 2XB8A 4JLKA 4BE9A 4U0KA 2PL9A 4LZAA 2A1IA 2CJWA 4ZT5A 3U7EB 4GPTA 1WLSA 2HA2A 5AVXA 1XL0A 1OREA 1MORA 5EE0A 4LGYA 4OI4A 3GJ6A 2XECA 3GWGA 1YDHA 1WCIA 3WKDA 3OURA 3VVCA 2H7XA 4BC0A 1P3Y1 2I8LA 1YR6A 3TG2A 1G7RA 5IEBA 2HGSA 4H7EA 1CRPA 3MG9A 5HXAA 1VPEA 1JHRA 1S8FA 2JFFA 4M1KA 5LYJA 1G1MA 4HYEA 4JQOA 1P9OA 2Z4SA 2Q28A 5DDIP 4J3NA 4C6HA 2QN9A 1NXSA 4CM3A 1GQOA 3KEFA 1QRAA 4RW0A 4PBSA 1JKJB 1VDZA 1TJPB 3DTVB 5E0OA 4ZAXA 4CM1A 4AG3A 1XMOB 1M5RA 4YPFA 2GKSA 2H48A 4X8HA 3GV0A 1C9JA 4GICA 5FTJA 1XD2B 2D2IA 2J3EA 2DQKA 2V4ZA 4X44A 2OFFA 4RC9A 3ZY4A 4KQKA 1IZ0A 1KZ6A 1LLDA 4PNEA 3GBVA 4WKNA 3IKVA 4EHBA 1O5OA 2PSSA 5EJFA 1T0UA 2YHBA 1V6AA 2QLJA 4WL0A 3SX0A 1UMCB 3UWKA 3G1WA 3R75A 3PJDA 4BUZA 1O5TA 4AP5A 2CK3A 4WLNA 3WLPA 1R0RE 5AW3A 3DHYA 3N6VA 4JOBA 4RY2A 1VI5A 1Q2UA 1PYOA 2E55A 1SZCA 4YCLA 3A31A 1PFWA 1W1UA 1Z4KA 3PR2B 5AVUA 5JDIC 4IF4A 5HKKA 3A9TA 4MB2A 4O4LF 1W4BA 5HJ5A 2P5YA 2NM0A 5AW8A 1T5HX 3HVUA 4HDKB 3WGUA 2CLOB 3URMA 4YRNA 1VMEA 5FLYA 3EIFA 2O8CB 1HH4A 3TOCA 5GJBA 1TA4A 3QJ5A 3A9WA 1ZW1A 3SR4A 1A88A 3R3YA 4FILA 1J09A 1D1QA 4EJSC 2JFGA 5DIFA 5FPSA 1KFEB 4GKJB 2BSQA 2Q0QA 4FOTA 1VJ0A 3AB8A 1NF9A 2JBWA 3PXDA 2FZGA 2B35A 4F9GA 3CURA 4M88A 4O4JB 5DTIA 5EJ2A 3DMPA 1EUCB 4DMKA 4IQ8A 5KWVA 5DM4A 1PW7A 2O7QA 3NIFB 2X8LA 2NO4A 3E58A 3RT9A 2R87A 1DJMA 3AEKA 5WRFA 3HEMA 1IG3A 3CS3A 1QOZA 1EFVA 3WR5A 1G8KA 3R41A 3IBYA 1ZJWA 5DNAA 2G72A 5IXJA 4QHTA 2QTBA 2J59A 3R77A 2HNAA 3NTLA 4YX9A 1VMDA 1OZFA 3M1IA 3O3MB 2OVBA 1F4LA 3IIJA 3N8GA 2GCGA 4L5YA 3GRYA 3R9KA 4H59A 1IY9A 3PTAA 2DZDA 3CRW1 3C7DB 3GUVA 4E11A 2WHPA 5JV5A 1FW6A 3PEYA 4W63A 3MEQA 4DADA 1JXMA 4EKIA 4B4UA 5EJ6A 1X38A 5I7EA 3F6EX 1TLLA 2A92A 2C77A 3QEMB 5BWLA 4PLZA 3DUFA 3EY9A 1Q44A 2ZSKA 4UVHA 4JV5B 3DOCA 1RBZA 4YXWD 3T5PA 2WB4A 4RMHA 4MRMB 1NN3A 3K7EA 3T4PA 4ODIA 3LPCA 2PBRA 4X3CA 3SSAA 1ZK1A 2Q99A 3CKKA 3F7OA 3L1IA 3FJYA 3UEOA 4F60A 4ZZ0A 4FGSA 4I3GA 3PTZA 1XTTA 1W2WB 4UW9A 1M5TA 1R6XA 5IFKA 4IFIA 3MILA 4I50B 121PA 1UJ4A 5DIZA 5K3CA 3PXGA 4C0LA 4RTLA 5CDSA 3MTGA 1Y6RA 5BVHA 3A7EA 5CFPA 2WE7A 3GJQA 1RHJA 4EG4A 1QOQB 1SXIA 4N03A 3RVPA 4LOAA 2Q07A 2VI5A 3B9RA 4OHXA 2VP6A 3V3KA 4QM7A 1I9CA 2I91A 2VZEA 2COUA 2V4UA 3CH4B 5KOYA 2JAWA 3IVAA 1KERA 2I55A 2YW9A 3OP4A 3PHLA 5H70A 3UW3A 5IWCA 2R0QC 1X19A 3GA5A 4WXYB 1QHHA 3WHPA 3H5TA 3PQCA 3ZVMA 4NZMA 3HY4A 4Q01A 3K20A 2FVYA 3B1VA 1P4AA 4CUJA 2R1VA 4QM6A 4BMPB 1GIAA 2RGDA 2ZBVA 1CVRA 3M4NA 7GPBA 4GLFA 4TYWA 2UUPA 3RVJA 4YRMA 1FRFS 1S3FA 3ZW8A 3Q8KA 1Y8QA 2QMQA 1DKMA 1TK2A 5DYIA 1WWKA 2BEUB 3R5SA 5JG7A 3CLHA 3Q3HA 1Y82A 4N47A 2KB0A 5D87A 2DBRA 3IE1A 1H9CA 1ZOIA 1P91A 3HY3A 5EKDA 4J16C 2DPMA 1WMEA 4WECA 3W5IA 4YMHA 1E60A 5K51A 1DRUA 3JARA 4HQ6A 4OHFA 3UCEA 3U4QB 1XZIA 2AOUB 2L69A 4G37A 5KQSA 5H9VA 5TS2A 2BEVB 1H4TA 1RWNA 1CSEE 1EA7A 4K87A 1CWUA 1IXSB 2FF5A 3GD7A 2WSSD 1L7XA 2GJSA 3BMNA 2YZ2A 4B5KA 4JY7A 4RDIA 1XXHB 4IJ6A 2A4MA 3N7TA 2IY8A 2M6RA 2ECFA 3MXOA 4F9FA 3T06B 2ETXA 3HBAA 3S1AB 1F4VA 1UOEA 2WTEA 1FP4B 3H0CA 3HY6A 1IH8A 4MR9A 4TYPA 2QQFA 4RPCA 1J23A 1NI4B 4W4TA 3A1VA 1ADFA 3PF8A 4DDKA 1G9SA 1V7ZA 1YNOA 3G2PA 4FQ7A 3PX7A 1VL1A 2VJLA 3CE6A 1Y1LA 2FN7A 3OZBA 1C3EA 5AP9A 1MMFB 3RJ9A 1CBUA 3H6GA 4M9CA 1QVZA 2GF0A 2QX8A 3A25A 3E3OA 4OEHA 3CONA 5DYNA 5TARA 1NXWA 4URFA 5B30A 4CKBB 3TQCA 3IEPA 1XJ0A 2PBLA 4ND8B 5I4KA 5K2OA 4O3FA 4A8JA 3C43A 4MVJH 4JA2A 4EHHA 1OFIA 1SK9A 1FFXB 4CN9A 2FFAA 2GPNA 4KE9A 1JSXA 1M83A 1ICIA 1NWCA 2JAHA 1UC5B 3K8ZA 2EBWA 4MQ6A 3ME5A 4REMA 1PO7A 4ESHA 5EIEA 1Z0FA 5JEDA 1QF9A 3TLXA 4LC9A 3IKJA 4GI3A 1EI9A 2A35A 4TYQA 4N5DA 3P0JA 5CFQA 2OXTA 5E6SB 2MYTA 4TSKA 1ZMRA 3EXHC 4IDQA 2IYUA 4YDSA 3TBFA 1T13A 3UK0A 2I6GA 3JALA 3G88A 4YMSA 3ZH9B 5ICSA 4Z9AA 3VZDA 1D6MA 4GMHA 4P81A 5FBRB 5JE8A 3UAXA 3WLQA 4JP8A 1VB3A 3SZUA 4B6JA 3K6SB 1P75A 2YYZA 1WSDA 2NVOA 3MNFA 2WYHA 1PZGA 3EDYA 3IR6A 2PH1A 3F98A 4RJKA 5G0SA 4D9BA 5E9QA 3PB3A 2W37A 5JADA 2ATXA 4NBKA 4PR3A 1IWOA 3QE3A 3RLFA 1MJHA 1J9GA 2CJYA 3DE3X 1FDOA 2Q1XA 1JPNA 4C5BA 1HNZB 4GKVA 4V2IA 4DV6B 3FRHA 3Q9LA 4D44A 4GC5A 5A5GA 4D0LB 3SEFA 2ZBRA 2OHHA 3I92A 5I9BA 3ZLBA 1L5MA 4GPZA 2R1TB 3O91A 3DE2X 2IPXA 2AX3A 1G19A 1WJGA 1GZ7A 3GHYA 4I1IA 3LLVA 3GBSA 3Q15C 4OFZA 4UNSA 3VU3A 3PPIA 5DZSA 1USVA 1ZM2A 1A04A 5LZ5A 1GKYA 4ZDIA 2J5XA 4DSOA 2QTCA 1MAVA 2MT9A 4ND7A 1LDGA 2CBZA 2AJLI 4LHSA 2NUPB 3IPAA 5FTNA 5DYTA 4QDOA 5CJ2A 2P3QA 1POXA 2XNJA 2E89A 3FSJX 2DCUA 1MOZA 3GEHA 4WDQA 5KCMA 4ERXA 4Z5XA 1B42A 1KP3A 3PXEA 3ZK8A 3Q5DA 5ALDA 3ND6A 2FEKA 5SICE 2NZUG 5LJLA 1N2CE 3FDJA 4GYYA 3AUJB 2W6JD 1PS0A 5ETJA 3RQSA 4RCZA 3ZXXA 4P3XA 1Y6GA 1SUFA 1PJRA 4OGWA 3X2EA 3T3HA 1KOFA 1YVDA 3U2QA 3BGVA 3R2JA 4BBPA 2HY7A 4R2MA 5BUZA 4KRFA 5FA5A 2AYXA 3RC9A 5K9ZA 2O2JA 3I34X 5C1DA 5J4YA 2ZIGA 4MRSA 3KHUA 5KTYA 4BXOB 1KO5A 2QM0A 5TE9A 1HXHA 4AYXA 4PICA 4J29A 1XVLA 1ISMA 4C7JA 5F23A 3HJFA 2XQGA 2I3DA 1SPXA 3GLSA 1WSWA 3M6IA 1A76A 1OW3B 2DBYA 4JUBA 5IUJC 1YJCA 3LU1A 1PJ3A 3EMKA 5TR9A 1AHPA 2GMWA 3EMVA 3FPFA 4HYYA 4CFYA 5CLQA 2OCXA 1E1CB 3UHJA 4LSMA 2FWNA 2NSLA 2XQIA 5JJKA 4B6SA 1YULA 4K8RB 1OFHA 2GZHA 3MMSA 4ZHQF 3C1TA 1ZA1A 3P0EA 3R9XB 4M9UA 2VDNB 2F43A 3P2MA 1KQGA 4H6WA 2SECE 5IAKA 3AR6A 5FNVF 1OX6A 3OZUA 3TTWA 3LVFO 3QX3A 2QTAA 3HCWA 2ZAOA 1N6OA 4E5MA 4JBYA 1INLA 2R8ZA 2M6KA 1LDEA 4NYJQ 1SUSA 4R8LA 1I0ZA 5KQRA 3S70A 2XE6A 3BUSA 1CY1A 1PU2A 2X3YA 1LK0A 2O8EA 4L02A 2WKPA 3IVRA 3IXLA 1QQTA 3ZLVA 5FI5A 5TQ2B 3QUSA 4GI7A 4WFIA 5BR1A 5ICGA 3BOSA 5CH3A 1MX3A 1Z88A 3LQKA 3I1FA 5BN4A 4P5EA 5AJZA 4RTOA 1A7AA 1E2LA 1Z4JA 3I2FA 4B43A 5KJFA 4ZRMA 4DCMA 3IRUA 1AQNA 3ZZTA 3L7AA 3ZIUA 3DEJA 1MAAA 1IQRA 2C0CA 4YQFA 4S0XA 3VU0A 2DERA 4AQYB 1U2DA 3KZNA 2QLFA 3OF2A 4J7XA 2WOJA 5AMXA 4F72A 3CJQA 3RSOA 4CDRA 2WVJA 1U6KA 1PG2A 2G70A 3GMIA 2ZE5A 4ZARA 4ASUA 1AQYA 1TPYA 2HO5A 4XIFA 4DLNA 3T1VA 4CQLB 3OIDA 2V6JA 1J0XO 1DEAA 4IPTA 3F9RA 4YEDA 5HZGA 3G9ZA 2H16A 2W2KB 3ILHA 3ZQKA 2WSSA 4CLEA 4MA0A 2DHQA 2JLXA 1SCUA 5GJVC 1DG3A 5A5EA 3LF2A 4HF7A 4N0MA 4FSXA 3NX4A 1AM4D 4BB6A 1JYSA 1X1SA 4EZEA 2IYWA 1BX1A 1OXTA 3AP3A 4HDQB 3CX7A 3CFYA 3QBDA 3WHKA 3SNKA 1N9GA 2BR3A 3KR2A 3ROTA 1G98A 1DAKA 2IEIA 2YJ5A 2Z83A 5D00A 1ZAYA 1SD5A 1WTCA 3JWIA 4LE0A 2G0NA 1ARZA 4IJ5A 3UAVA 1E20A 1FS4A 2REOA 4IMJB 4PYOA 4WK6A 4AWAA 5JPCA 3GFPA 4B3GA 1T10A 2ZGVA 5MN4A 1X8KA 4ESEA 5AW7A 1LBIA 3NT2A 4M9RA 3NWPA 1T5OA 1BA3A 2ZUSA 1U04A 3AVQA 5BW4A 1RI1A 2UVQA 3L5OA 2I2CA 1NMEA 3VV3A 4CEIB 1X1CA 4OI2A 1OU0A 5JS2A 4Z4QA 4RSMA 3J81A 1P5RA 1QH1B 4AJEA 5K1ZA 4QNRA 4H6XA 1EUDA 1GPAA 2X0DA 5I7VA 3C6QA 1TADA 2O2CA 4Y30A 3VR5A 5JY1A 3N39C 2HLHA 5K4AA 2AN1A 5FWXB 4DRXA 2AXNA 3NBUA 3ZBPA 3P0HA 2NNWB 3E7WA 4CLOB 2Q4TA 5C7OO 4FNMA 3W7BA 2ATCA 1OXBB 2YVUA 4L0DA 4AVYA 3A14A 4AQ7A 1DQYA 1W88B 3EIXA 3I6IA 2PYDA 4G07A 3U4DA 2C3MA 1GFIA 1G8YA 2PKXA 1Z75A 3WWCA 4URZR 5F98A 2Q0HA 3ZKAA 4EARA 2VJMB 1PBTA 1S3SA 3MJSA 3LUFA 3N05A 4NJEB 4PAMA 4PSKA 3OX2A 3BFKA 3K4QA 4CM8A 3WNZA 3HABA 2PUAA 1KYQA 1OY1A 1LDMA 1XYYA 1D03A 3E03A 1QBGA 1U5BB 5FHRA 3P45A 4UBJA 1R6VA 2RGRA 2RGGA 5CHEA 1RWQA 4A0HA 5BXQC 2AMJA 3K9FC 4ID9A 3TZBA 1E4YA 1V48A 3V4LA 5ER6A 4DR3B 3FFXA 3OMWA 4EYOA 1JSLA 4X85A 4BY9E 1GP2A 4B2IA 2IX3A 5KSOA 2I2DA 2ZRIA 1UOQA 4RVCA 4Y1GA 3T7KA 4C6SA 5CG2A 3T3EA 2ASVA 3M3DA 2VDOB 4YR7A 4WLUA 1JKJA 3DULA 1GTG1 1TKAA 2P6PA 2VKTA 2JI4A 2AMLA 2NVUA 1Y7LA 1I6MA 3LWZA 4URUR 2PV7A 1HDGO 1XA4A 4OKIA 1MB3A 4Q21A 4PNHA 5KINB 2PUFA 4BRSA 3WLFA 4D3YA 3ROGA 5A1TA 2GARA 1JYEA 3GEGA 4HX5A 1YE5A 5CFZA 3FVTA 4N12A 1PUJA 2IYZA 1AVTA 4UMEA 4FFVA 1P1IA 1ZMOA 4FHGA 2IUSA 3O7MA 1T9CA 1XDBA 1ZXXA 2PVPA 4R68A 4PCAA 5HF9A 4DJDC 3VZQA 1ZC4A 1ZCZA 2D0OB 2VSQA 3N0RA 3OQPA 4GOOD 4ZCTA 1YKFA 4CLRB 1H6AA 5E8JA 3LGAA 3G82C 1W34A 5EZYF 2EKQA 3ZJ5A 3ICWA 4FYWA 2RFLA 2Q3HA 4V39A 2WA1A 4N0PA 2K87A 4RENA 2BFOA 3AZOA 3C5WP 5H3CA 5JLJA 2A78A 2GTIA 1JLKA 1JEQB 1TJNA 2C00A 1QIEA 1V4VA 4IQ0A 3GR6A 4Q3AA 4YP0A 4YP6A 5CLHA 2BKEA 1NQOA 3BICA 1CUAA 1ONNA 1YASA 1U6IA 3EK2A 3D81A 2QTGA 1NVWQ 3EVDA 3F5SA 1F8UA 4UPEA 3DZ8A 3IIEA 3U3DA 1EYZA 1DXOA 1DQRA 4H7IA 3TMAA 3S4YA 4D43A 3WYGA 2LKCA 1AV7A 2QL6A 2ZVQX 4CTNA 5EWMB 2WTAA 4MB0A 1AK9A 1MIOB 2P2ZA 3DBLA 5J5VA 3FFBA 4UAJA 4NS4A 1DDOA 1IEWA 1TIPA 3W5BA 5EJGA 4RE6A 3COYA 4HWRA 5DRYA 4JYAB 5CU7A 1L4KA 2HMTA 2FG5A 3DDUA 2CBGA 5GVRA 8ABPA 2IEYA 1SQSA 4HNHA 2RGWA 2P40A 3C7KA 1VG9B 3QG5A 2F7SA 4MWOA 4ZOAA 1UM9A 5AM4A 4QBKA 1V37A 3ZWKA 4YO8A 4FU0A 4YMIA 1ZNZA 1M2OA 3JQAB 3L6RA 5IANA 3HGTA 4R83A 2I76A 3Q7TA 2FE4A 1SU4A 1AUQA 1UZNA 1VE7A 2OP1A 3RU9A 4MP8A 4BFTA 4DB2A 1KAGA 4UQLA 1W4CA 4F06A 1CP3A 1YL6A 2BTQB 3RVNA 3QXGA 5IZCC 4V02A 5T3YA 4URWR 3G8DA 4QGBA 5A6SB 5JH7B 1I4WA 2G0TA 4JOSA 4W1RA 3MQ2A 1MVNA 4G0UA 1CR6A 3LX5A 2C4HA 2HHCA 2YVQA 3HEAA 4I9GA 3Q4GA 4TL6A 2JGLA 3RLIA 3SLKA 3T3IA 1C9KA 3TLBA 3WIDA 1IB6A 3L8FA 4MRMA 4KR2A 3GOQA 2CKDA 1KVUA 2X14A 3MINA 3PG5A 3L1JA 4X54A 4BWGA 4OJTA 3FPLA 1VJGA 5KQLA 1KEKA 3FVQA 2FOLA 1V4NA 1NOJA 5D7BA 4ZI7F 2WUFA 2C9DA 1UPCA 2C0PA 3LW7A 1KJ9A 2PSDA 1LWOA 4C08A 2BUAA 3EASA 5JI3E 5CITA 1OH7A 1ZH2A 3IPLA 3ANLA 4MKXA 2FPPB 5TQVA 2QTTA 3I37X 3KAQA 4FYKA 3C3WA 3H5LA 1MEJA 5JU6A 1T5SA 1ZVJA 2B7LA 2P9JA 4GMFA 1CT9A 4IGKA 4MITA 3LQQA 1E1YA 1HG1A 5HS6A 2EVWX 5IT9A 4KXYA 1JT2A 1YUMA 4JD5A 3VPCA 3U4MA 1ZL2A 2QA5A 2FUG1 4Z8XA 2MDTA 1QJCA 2R1VB 1KMIY 1CZLA 1ST3A 3HQ4O 3QHQA 4H16A 4Q00A 4B3SB 5TEVA 2FXVA 3BEOA 1U81A 3VC2A 1DO0A 1PDOA 2WQZA 3M33A 3L8ZA 4DQ0A 2QUJA 5EE1A 4I4LA 1RXWA 1Y8QB 1C0EA 2FW9A 1EXWA 5BOVA 1AGYA 3CIOA 4MAFA 1KR5A 1NSYA 4ZTBA 3RC2A 1L7BA 4BJ6A 1EK2A 1EK6A 3DLPX 2H0AA 2YXNA 4XVUA 2DLCX 3KX2A 1N2CA 3A3KA 5HDBB 3ONFA 4QO8A 2IV7A 1OCEA 3GJ0A 1BTOA 4YJGA 4E2XA 3NORA 1SUAA 2XVYA 4TLCA 2J0VA 4EHKA 1U4OA 3FHCB 2I7VA 4IVNA 2ZRMA 1ZO8A 2DU8A 2G9QA 1GCAA 3PUWA 4R9VA 2FETA 4OQZA 3RUFA 3V6LA 5L51A 4CL2A 4X7BA 1YS9A 3LD9A 2BY4A 3HKEA 5G4KB 3JQ6A 5HNKA 4IP0A 2O54A 2AFIA 3CG0A 3PI7A 3O0TA 4IDCA 5LUAA 3EGXA 4RWZA 5BVGA 3NATA 4AKIA 1RM3A 5F7XA 1JALA 3BHIA 2ZBPA 3TB4A 3KEMA 1JN0A 3HO8A 4OIMA 4BNVA 1S2OA 4R4JA 2FMUA 1JQ5A 3H97A 2GK7A 1FE8A 1URPA 1L5HA 4X7PA 4DYVA 1SVMA 1M72A 1NBEA 4PYJA 1T4BA 2R2AA 3TNDA 2C31A 1V6CA 2AG0A 2W6ZA 2ZI4A 2FMHA 3F4KA 3LRPA 4KBFA 4XKJA 3VBCA 4F4JA 3OCUA 1XZ8A 5I6DA 1MG5A 2GILA 2I6QA 3CRNA 4HB4A 1LSOA 4I6EA 4HV4A 2HRCA 3L3BA 5C18A 1SHJA 3P7MA 4LRTB 3CPJB 4M0CA 4M7PA 4X8MA 4ZODA 2GPYA 4IDOA 4RABA 4J3JA 4ABYA 3AUKA 5IDWA 3FCXA 4NBVA 3U7HB 3ZD7A 3KT0A 4LXYA 5CLFA 1ZIDA 1NDHA 1NNUA 2Q5QA 1AX9A 4MV6A 4OQFA 3EMBA 3SXJA 1SVUA 1L5OA 2CK3D 1GKIA 1NYTA 3GLHB 1J8VA 3UICA 3U1TA 3Q7SA 3RHZA 4EGFA 2PUCA 4Q3LA 1PX0A 1W5AA 2ROQA 3BGIA 1WKBA 2YMPA 2V9CA 2ZR8A 3INYA 5F21A 4AJ1A 1JT9A 2C96A 4D9JA 4MUXA 4X3OA 1EBFA 1V1MA 2YVAA 4QUEA 1ZMTA 1F8GA 1RJEA 2C8VA 1KRXA 5TSDA 2VCYA 2H06A 1WBDA 1BDJA 4JL5A 1QO0A 3HUFA 1B74A 2Q1WA 5FFNA 2X6TA 3UGKA 1E3JA 2R68A 2HJVA 5TJ9A 1TU0A 3DEIA 3WRYC 4OJNA 3Q8MA 3FBGA 4E5NA 1U8YA 1VLJA 2NSHA 4ZDJA 3K2QA