1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyltransferase thiF
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
2OP0A 1J49A 4Y67A 1YJ8A 1ISIA 3SLKA 1WMBA 1D8AA 4OH1A 5CG2A 5EL0A 1YQDA 4P4NA 4C7JA 1M2WA 4FJ2A 3RUAA 4O5OA 4PLGA 4WCDA 1PGOA 2OOSA 4NFYA 2JL1A 3KSUA 2PNFA 4G65A 4I8XA 1NP3A 1LC3A 4EUHA 3MJ4A 4YAEA 2AMFA 2HRBA 2XOXA 4BO9A 4HADA 2J8ZA 1O94A 3GRKA 3BTSA 1WXDA 1Y9EA 3WX0A 1V0JA 4I5EA 5CEJA 3PEFA 2VRBA 2HMVA 3E82A 3HFSA 4IUYA 8LDHA 3WMXA 3VZSA 3WICA 2A9FA 4M87A 4UULA 2E4AA 3TFQA 4BNKA 4BMSA 3MOGA 4UVGA 4EITA 1EDZA 4XWYA 1RJWA 1JLLA 3ITDA 4R1NA 2Z1MA 2DUUA 4ND5A 3PK0A 3MWEB 5EN4A 3EK2A 4BB6A 1GZ4A 1A4UA 4WLNA 2C20A 4ALNA 1D3AA 1PJBA 4A03A 5CAEA 1NM5A 1YDEA 5G0WA 4MPDA 4LN1A 5KNLA 4MIEA 1T2EA 2ZK7A 4J2HA 4R9RA 3L9WA 5KVVA 3PJFA 5B37A 3UKOA 1KVTA 4UVIA 4JLWA 1PTJA 3KYBA 2FRDA 5TC4A 3SC4A 4K28A 4WKGA 1PEDA 3OECA 4D0SA 1XR3A 3PFWO 4CL8A 3KYDB 4NI5A 4NBVA 3UGKA 1F14A 2RAFA 5FI3A 4ZN6A 5JPIA 4EEZA 4LRTB 3PYXA 4XQCA 1E0DA 1PS8A 3F4LA 1QORA 2CZCA 4UVHA 4F45A 1DRUA 4ZRNA 1WWKA 3GH3A 2IRWA 4PN3A 4W82A 1N8KA 5ILOA 4B7XA 5A4DA 5A3JA 3LT1A 1E3IA 1ONOA 1P31A 4XX0A 1PQUA 2ZYDA 4FFLA 4GWGA 1P1HA 1TT7A 2PTGA 3WG9A 3WB9A 2O2YA 5L4NA 2V7PA 2PLAA 1LQTA 1GUYA 2HK7A 4MVJH 3JQGB 2NLOA 1E1MA 5K6AA 4QTZA 4GLLA 3I9LA 1NASA 2B5WA 1I10A 4JXKA 1MC5A 4BNGA 2SCUA 4CM4A 4E5YA 5CEFA 3DO5A 1HYHA 4N5NA 4BHTA 4FBGA 4DBVO 1GTMA 3SEFA 3STHA 4BO8A 3HDJA 2HLPA 4CM1A 1W0CA 2X23A 5TSDA 4D0RA 1B7GO 2CF6A 1N1EA 4ND4A 3KSZO 3AUAA 3OJLA 1P1RA 4ZJUA 4FFRA 1O6ZA 2JFFA 2O4CA 1I3NA 2Q4BA 4HBGA 1JW9B 1N92A 5TT1A 1HF3A 3ITKA 3R3JA 1MX3A 2HAEA 4BO0A 5B4VA 4G5HA 4QQRA 5IXYA 3EHEA 3GOHA 3RC2A 3CH6A 1NFFA 5DCWA 4Q3BA 1HDRA 3I9OA 4YDRA 1HSOA 4PVCA 1LSUA 2QIOA 4FQ8A 1ZK3A 2P4QA 5B12A 2X9NA 2FR8A 1LXCA 3PJEA 1NXQA 4XYGA 1LDEA 1GQYA 5DP1A 2GZ2A 1DIBA 1MG5A 1DAOA 1PIWA 2AHRA 3K6JA 3OSUA 4GL4A 2ZTUA 4AFNA 2PR2A 1DBVO 3WWYA 4AJ1A 1DRWA 4RL6A 3LF2A 3D4OA 1KC3A 4CV3A 4O0LA 3OP4A 2V6BA 3O4RA 1PS9A 2FY8A 3AOEA 3H9EO 5BSGA 2VYNA 1GQ2A 3FCOA 3DZJA 3QJ5A 1HKUA 1V6AA 3M1LA 3R1IA 4BGEA 2Y67A 3U4DA 4M1QA 1VPDA 1N1GA 4JROA 3FN4A 1UDAA 2YJZA 3ONFA 3D7LA 1PJSA 4N5LA 3DTYA 3ZNPA 3G49A 4YWJA 1NQAO 2PGJA 3ZWMA 4KWHA 1ZXLA 5GY7A 2GNAA 2LDXA 4JN6B 2HSDA 3WGHA 1OFGA 4NFHA 5JFOA 2NU9A 1C0IA 1AXEA 4FDAA 5EIOA 4B79A 4B3IA 2QZ9A 3ZWAA 1PZFA 5IAAA 3QRWA 4Z0PA 3DBLA 3O8QA 5CFZA 1E7MA 1PL7A 5A05A 1H6CA 2RIRA 1GD1O 2W2KA 4LSMA 4YJGB 4N18A 4DQVA 3TZQA 3JQFC 4YTEA 3BMQB 3WLFA 3DBVO 1IB6A 1T1RA 1YOVB 3E9QA 3QVSA 4NH4A 5DNAA 4XQEA 3DWFA 3IC5A 4JBGA 3KLMX 3JD3A 3C7AA 1I2ZA 3VPXA 3UICA 4K26A 4NNJA 1QYVA 3UW3A 2BFMA 3GQVA 4XEHA 1MP0A 3DR3A 3BMOB 4Z6KA 3IQDB 5IJZA 5FEUA 5C7OO 3ZCXA 1HXHA 4OO3A 4E30A 3M2PA 5KJ1A 1F12A 2NVWA 1YQXA 1IULA 1CJCA 3EZLA 4XIYA 5ER6A 3KEQA 2ZKLA 2PKQP 3OEYA 3QWIA 1QLJA 2F00A 1EE9A 1S7CA 2JCXA 3VHRA 5ITVA 5KKCA 2EW2A 1J5PA 1M76A 4P38A 5TGDA 2IZZA 4I1IA 4BO4A 3TN7A 3C8MA 4A73A 1B2LA 1LDBA 4XA8A 1JA9A 2B36A 2WYVA 2ILTA 4GKVA 4OMUA 1VL6A 1KOLA 1Z74A 4CMJA 3AI2A 4NJMA 2EJVA 4TRMA 3BYZA 2Q1WA 4NG5A 3V2UA 4ZRMA 5A5FA 5KWEA 4AICA 4F6LA 1GL3A 1C1DA 4FFPA 3S2FA 4IS3A 4CLOA 4R69A 2I5PO 4LISA 3LLSA 3ZW8A 3WNVA 5JC1A 4BO3A 2POQX 5AQ1A 4DPLA 4JQCA 3D4NA 3ROKA 4CV0A 1C0KA 4AJ2A 1LJ8A 4CV2A 3OQBA 3QY9A 3RFTA 2VWQA 4G2NA 3CMCO 3TZHA 1QXSA 2NADA 4IPTA 4DIOA 1XGKA 2B37A 3FD8A 1KYQA 1XDWA 4OQYA 4M54A 1UZNA 3L6DA 4JK3A 4RDIA 4R5MA 4Y8VA 3HDQA 4CLXA 2NTNA 2CNBA 5DBFA 4Y6PA 2WMDA 2RH4A 1H0KA 2O3UA 1E77A 3LC7O 4R1SA 1KEPA 3QWHA 4DLBA 3RFXA 4YEDA 5AOVA 1ONNA 2D0IA 4ESOA 5KOIA 4MO2A 3F5QA 3KUXA 2QRJA 3QIVA 2ZIZA 3DBRA 3JQFA 4FD3A 2VWHA 4B8ZA 4FFMA 1N9GB 2ZYAA 3HZZA 5GZ6A 2TMDA 4GQAA 1DFIA 1BXGB 3V1TC 1DIHA 1XYGA 3GA0A 4IJVA 4MVJM 1GUFA 3PI7A 3X2EA 2G17A 4II3A 4CLHA 3FF4A 1RM3A 4CM3A 2GSDA 3L6EA 1R0LA 3TPCA 1OBFO 4GX0A 4U7WA 2QG4A 4PG7A 3BTOA 4BUCA 1YBVA 1V3VA 4RF4A 1UJMA 4ZQGA 4CMGA 1GCOA 1DC6A 3U4IA 4L75A 2ZATA 1BWSA 2C0CA 2VT2A 3ZN2A 4IMRA 3U0BA 3CINA 4NZ9A 5DP2A 5IZ4A 5A9SB 5A03A 1T2AA 2C59A 3OH8A 3DTTA 1A4IA 3W4KA 2CMDA 2E6UX 1EMDA 1NPDA 5AXBA 1ENOA 1I32A 3V8BA 3WGQA 2PGLA 5ENVA 2Y93A 1HEUA 2FPGA 2UAGA 3VZRA 1LRJA 4WCFB 1YONA 3RUFA 4DXHA 1LSSA 1R4NB 1XCBA 4M55A 3DXFA 3WJ7A 1JWBB 3UF0A 1MFZA 3NJ4A 4Q3NA 1DLJA 5I9LA 2WE8A 1AE1A 4QXMA 1LX6A 1H6DA 3ANNA 2Y0DA 2PZLA 1HDCA 3SC6A 2D59A 3ZV6A 2OORA 2Q2VA 1MA0A 4EUEA 4KDFA 1EE2A 4JP2A 3V1UA 5F1PA 3OF2A 2JFGA 2EKPA 3JD2A 4YJDA 1WP4A 1ENZA 1JKJA 4EI2A 4FC6A 4QFDA 1A27A 4URFA 1EBUA 3HN7A 2GDZA 4F46A 5JMWA 2PV7A 3PPIA 2OHXA 3UVEA 1U7HA 1Y1PA 1DXYA 4OHUA 2GO1A 1M75A 4K9DA 4YQYA 3AI3A 3ASUA 3WR5A 1NVMB 5T8KC 4ZQBA 4RPJA 1C1XB 1X13A 1CIVA 3SXPA 1K6JA 3NX4A 3GG2A 3H5RA 1BW9A 4Q3AA 3SJUA 2HCTA 2NWQA 3GT0A 4MVJF 3H3JA 4PVDA 3CUKA 3MWDB 2P2SA 2ZB4A 1LDGA 4GI2A 4UAGA 1A9YA 1LBEA 2IEBA 1OAAA 1ZSNA 1H6BA 3GAZA 3PDJA 1CDOA 1QYCA 5FI5A 1H93A 2HDHA 2BGKA 3A1NA 3E5MA 1DSSG 1T1SA 4XKJA 5ES3A 1DDOA 5EJ2A 3UOGA 4BOYA 2NQ8A 1L7EA 2X58A 2Z95A 2TMGA 3GVCA 1U2GA 3OICA 3QHAA 4BKUA 2YQ4A 1ZEJA 1E6WA 2X0JA 3RWBA 2BI8A 4RLSA 3CXRA 1EVIA 4IDGA 2FSSA 3K30A 4XR9A 4IQGA 5KJEA 4E4YA 1ZVMA 1GU7A 2OZPA 3HFGA 4XQ9A 3VVCA 1ZSVA 3BTUA 3FTNA 3LU1A 1WVGA 5JAMA 2NVUA 2PH5A 4R41A 3EY4A 4B7CA 3GUCA 1VC2A 4MVJG 3KLPX 5DOVA 4RCVA 1I2BA 3A06A 3F1KA 1HE5A 1B0AA 4U6QA 4CQLB 1I3MA 1XELA 3JQ6A 3PP8A 4MVJI 5ICMA 7MDHA 1KEWA 2NVUB 3F4BA 4YJHA 3KV3O 5BNFA 3ICPA 2ZTLA 2DFVA 2JCVA 2P9CA 3P19A 1P1IA 1VJTA 2DBZA 3ADPA 3VDQA 1Y9AA 1YJQA 4BNYA 3BHMA 1SAYA 3WWZA 3UHAA 1KVQA 4PLFA 2DC1A 4J1TA 2X0RA 1UP6A 2H9IA 3I9NA 3KTDA 3BXXA 4GX1A 3EUWA 3NUGA 1MXFA 1G6KA 1XEAA 4TKLA 4AVYA 2CVOA 4YJFA 1UXGA 3DOJA 5IDYA 4J0FA 3WGTA 2PWZA 2O3RA 5J23A 3FTPA 4ZGWA 5JNLA 4PG5A 1JWAB 1YDWA 3OIDA 4J1QA 1T2CA 1HRDA 4U0JA 1R4MA 4ZQHA 1E3LA 1LLQA 4E5PA 4WNIA 3F47A 4CPDA 2HMTA 4X54A 2VUTA 1GEEA 3QVOA 3JQ7A 3C85A 1V9LA 3Q1LA 2V6FA 3HDHA 3VPSA 2YY7A 1X0XA 5JDIA 4BS9A 3WGYA 2YUTA 3MJTA 2EKQA 5KVQA 1EUCA 3BIOA 5T8KA 2G76A 3JQBA 4RPLA 4RV9A 3Q11A 2IXBA 3N7UA 4XB1A 3PWZA 2V6MA 4DQXA 3DZGA 2WTBA 4E12A 3C3XA 1U7TA 2VWGA 1RM4A 2OUIA 2Q46A 1JU9A 1U3VA 3G17A 1QV6A 1SB8A 1VJ1A 1O5IA 3GVIA 1PJQA 2YZ7A 1FJHA 3NTRA 4MIOA 5JE8A 4KWIA 2OMEA 3ASVA 2AG5A 3SBOA 1EZ4A 1CQIA 2FPPA 1EK5A 3L77A 1LTHR 1MV8A 3NYWA 2X0NA 3JQAB 4CMKA 4YT4A 3KOUA 1TB4A 1I5RA 1UDBA 3AI1A 3H65A 4E3ZA 4BNTA 3DAFA 2GZ1A 3PJGA 5MGBA 1JTVA 5U4QA 2Q4EA 1LUAA 5L4LA 3IAHA 3HJAA 3DBHB 4S3MA 2RCYA 1M67A 3PLNA 4PLZA 5DOZA 3TZCA 1ZCJA 1X14A 2PZJA 3DFUA 3AUUA 3P2OA 4B4UA 4XRGA 3RKUA 5MDHA 2VOJA 5CDGA 2XXJA 4PLVA 2OFPA 5H81A 2GN6A 3QW2A 5H83A 1PJCA 4OSOA 1O8CA 3JYNA 1Q2XA 4NBRA 4MP3A 5DT9A 1LQUA 2Y1EA 2ZB7A 2UUOA 2YFQA 3ONEA 1J0XO 4IDFA 2Y68A 2DBRA 3CKYA 1ZK1A 2X9VA 4H7PA 4JJIA 1B8VA 1Z73A 3A4VA 4L9RA 3BMCB 3GPIA 3DAPA 4BNZA 3ZI0A 1E6UA 1LLDA 3S2EA 3W8EA 1LRKA 3IKVA 4Q3EA 1VL8A 4TSKA 5C5IA 1XIVA 4ILKA 2O48X 3GEDA 3DZBA 1ADGA 3PHIA 4J3FA 1KY5A 3ZWOA 4XB2A 1QV7A 4CLRB 1HWYA 2EKLA 2OGUA 1SMKA 1U8FO 4AJNA 1ZZEA 2GGSA 1NX6A 2DLDA 4BNLA 1E6EA 1Z7EA 1VRWA 1EVJA 1F0YA 2YV3A 3I1JA 2I99A 4ZQEA 4BMVA 4PG6A 3RFVA 4YQZA 3RCBA 1IY8A 3DC2A 4YBZA 3R6DA 4MOWA 4RPKA 1EQ2A 1DC5A 1H9AA 2Q45A 1GFSA 2PK3A 1EBFA 2HRZA 1B3BA 2HUNA 4L73A 3TF5A 2BELA 4L4XA 2VUSA 1DIGA 1PWZA 4B4OA 2QRLA 3ENKA 4YT2A 1Y5RA 4JJGA 3AOEC 3C7CB 1YH3A 4XDZA 4BMNA 3H5AA 4A0SA 4PLCA 3HUDA 3DONA 4I5GA 5THKA 2VHVA 1D1SA 3VPHA 5HBRA 3UCEA 3JCZA 1PS0A 2Y99A 1EDOA 5DN9A 4TZTA 4RF3A 4RVHA 1YB4A 5DBIA 5F21A 4CMIB 3C7DB 3KYDA 4BNFA 4WK6A 4WCFC 2VWPA 4LMPA 2VYND 3HNPA 2RHRA 2O7SA 3DMYA 3PGJA 1NNUA 2CY0A 4YRAA 1RPNA 1BVRA 5CHEA 5EQFA 1LRLA 1E92A 5LCXA 5KVCA 1Z6ZA 4YA6A 2P68A 1EUDA 1HZJA 3I9KA 1UXKA 4FSHA 3D3WB 2O3TA 2QHXA 4ROSA 3HB4X 2VYVD 1LLUA 1ML3A 1RYEA 4BQRA 3F46A 1PR9A 3D5TA 4J7UA 5C7IO 3JQGA 3KEOA 2FN7A 3IJRA 3ZNQA 4MVJP 4E2YA 4FJ0A 4AG3A 2BH9A 2NU7A 4NR0A 3NT4A 1ZIDA 1B8UA 1Y6JA 1LSOA 3JSAA 3WSVA 1DC4A 4QECA 5L7TA 4BVAA 1JAXA 1DFGA 2IEDA 4DC1A 3DOOA 4W7IA 3JQ8B 4H16A 1Y5MA 3KYCB 3TDKA 3HE3A 1HDYA 2H1SA 2NACA 3TFOA 4NBTA 2O50A 3H9QA 4EBFA 4WASA 2NM0A 2X22A 2PGDA 2ZJ0A 4GSLA 4J6FA 1E7WA 1W6UA 1HDGO 3JTMA 4R54A 2X5OA 4CL3A 3DQPA 4RF5A 4NDNE 3HB5X 2PD4A 3GDOA 1HYGA 1PR3A 5FFFA 3WFJA 4TVOA 1MUUA 3NKLA 4B4WA 4DQUA 4D7AA 3ZWNA 1WDMA 5T57A 3QWBA 4NMHA 1VKOA 3MEQA 4ND3A 4XYBA 3NT2A 4YXFA 3B6ZA 3C1TA 3K9QO 3EMKA 1WMAA 1QYXA 2O3QA 5TT0A 3O26A 3UFXA 1NR1A 2NSDA 4IDBA 4PRLA 3LYLA 4KOAA 3NJ8A 3LF1A 4CM5A 3DOCA 2WE7A 2Q3EA 3ZHBA 3JD4A 2B4RO 1K5HA 3AM4A 1KS9A 2B0JA 3IOYA 4M89A 5T67A 3PIIA 4E2ZA 3GF4A 1ZSYA 5JO9A 3QE3A 1VM6A 5COBA 1PX0A 1IUKA 3FWNA 1Q7GA 3U3XA 4JX8A 2R2GA 3GLQA 2FHSA 3HWRA 3OIGA 4JIGA 2NNLD 1GQQA 1V3UA 2ZYGA 5I7EA 3KB6A 2VNSA 1KETA 4P4GA 1QKIA 1P33A 1MFPA 2W4QA 3AFMA 4CR7A 1K2WA 1CWUA 3ZHYA 3PQEA 3HG7A 3ZGYA 3PHLA 4R1UA 2A92A 2VYVA 3R3SA 2BGLA 4HXYA 5DDIP 5I7FA 5I8ZA 4BO6A 1MB4A 4D44A 4YJGA 1EVYA 1O89A 2EGGA 2FSVA 2VN8A 1QG6A 1VE9A 1JKFA 1ZK0A 4BNHA 1BXKA 2ZCUA 3AUSA 4DC0A 3BMQA 3IMFA 3N74A 4CV1A 1EK6A 1YOVA 4NJOA 1QR6A 4RO0A 4DWVA 3AU9A 1DFHA 1H2HA 2D5AA 1Y8QB 3MTGA 4PRKA 4RVUA 2VZ8A 4O59O 2LDBA 3E9NA 4ALLA 1U8XX 3PTZA 2YYYA 4R5HA 5FWNA 4A5OA 5TLSA 3ORFA 1R12A 2H6EA 2DTXA 3E1KA 4UREA 5G4KB 3BMOA 3GFGA 3IS3A 2FZEA 4CM8B 1ZMTA 1GY8A 4RVDA 3T7CA 4W7HA 1WDKA 3QSGA 2R6JA 4J1SA 3I52A 2I6TA 4XIJA 2HQ1A 2Q1SA 2E49A 2D2IA 1K6IA 1U2DA 2VNAA 3P2YA 3GVHA 3PVZA 4J1NA 2PFGA 1ZO8A 1N2SA 1YL7A 1NYTA 1Z82A 2I9PA 2NQTA 2DVMA 2X5KO 1JQBA 3BHJA 3ON5A 1F17A 4UEJA 4NFSA 4NPCA 4TVBA 4GMFA 4W99A 1YL5A 3RVDA 3ONDA 1IOLA 4TKMA 3ZNNA 1BMDA 3GHYA 4PZCA 1OC4A 1DHRA 4IDEA 3FBTA 3AJRA 4CMBA 2CFCA 3HDYA 3EGOA 5F1OA 3GY0A 3MJEA 3GEMA 2CD9A 4FFOA 1BGVA 1BVUA 1DC3A 1T2DA 2EGHA 1H9BA 2WJPA 1JKIA 4PLYA 4U8GA 3ZWWA 1W73A 3JYQA 3DMTA 4E5MA 4IZIA 3FR8A 2E82A 4OJNA 3H7AA 3IJPA 3O9ZA 3ZWBA 1DPGA 1Q7CA 3K8ZA 4J4TA 4FN4A 5A5EA 3CZMA 2XF8A 1CEQA 4E21A 3PLRA 2V6GA 3GMDA 4XJSA 3F9IA 4AJPA 2EHDA 3GZNB 4YAJA 2VTEA 3DAGA 4ALJA 3RASA 1TT5B 2PH3A 2EXXA 3GN1A 4XR4A 4HNGA 2Y1OA 1ADBA 5K9ZA 3HADA 4BNJA 4IZHA 4AJHA 2BFPA 1B16A 4QFCA 4BKRA 1PU2A 4XGNA 4JCOA 1A7KA 1YRLA 2I67A 4FC7A 2AEFA 2CSUA 1ZK4A 3NDRA 1X1TA 3VTZA 5BSHA 1ULUA 3B70A 3DZKA 1PL8A 5JCXA 2DUWA 2RH8A 4EYEA 5C7LO 3KVOA 4A27A 3DEYX 1BTOA 4OIMA 4CM6A 3VPGA 5JY1A 1ULSA 3UUWA 1U9JA 3W4IA 5L51A 1PJ3A 1I33A 3F5SA 3Q9UA 2X5JO 2ZQYA 4LCEA 1LDYA 1E1NA 4FGSA 1XG5A 5HM8A 2UYYA 5TIIA 2FZWA 1N9GA 4PZEA 5ER9A 2HJRA 3PYLA 2DFDA 3T4EA 1B3RA 4D3DA 1NR7A 1BXGA 5CP8A 4BO1A 5CDYA 3RUDA 4S1VA 4DTIA 4I9UA 5COAA 3QLJA 2P5UA 4RVFA 3KHUA 1ARZA 2HJSA 1Y8RA 3W4JA 1YWGO 3ANMA 4J49A 4IGFA 3NTOA 1ZKMA 3M6IA 2Y1DA 3OA0A 5KJ6A 1WAMA 3R0IA 1HLPA 3NEPX 1IE3A 4U0KA 3LK7A 5JAZA 1A72A 4BGUA 1JDJA 1GZ3A 1Y8RB 3TJRA 2BLLA 1SEPA 1NPYA 3Q3CA 2GERA 4DYDA 5A9SA 4WE3A 3E6AA 3W1VA 3TL2A 1TXGA 3S2IA 3PRJA 3FNHA 3G79A 3RBXA 4E2WA 2GASA 4RJTA 1CRWG 2A94A 4WNCA 3AOGA 1YBMA 5G4LA 3GN2A 4WCFA 2P91A 4UEKA 2QQ5A 1E3WB 1R4NA 3IDSA 5JXWA 2QRKA 4WPGA 2DAPA 3GFBA 3ABIA 2PZMA 5COQA 2J5KA 1P44A 2B4TO 4IXWA 3LQFA 4A26A 1YXMA 2O2SA 3DZIA 2OL4A 1P1JA 1A5ZA 3AUTA 4ID9A 4BO7A 3BA1A 2AQ8A 3I6QA 1J6UA 3COSA 4D41A 3WGZA 3T4XA 2OO5A 4CMEC 1UAGA 4FJ1A 1M6WA 5GZ1A 4IS2A 4LCJA 5H82A 5BNIA 3VKVA 3C24A 1EUZA 1OZAA 2IDZA 4L0QA 3ANLA 4IDAA 4I9HA 4DVJA 1QYWA 2C7VA 4XGIA 1UXJA 4LW8A 4Z0HO 5DBGA 4PIVA 1D4FA 3U49A 2EG9A 2IE0A 2XAAA 1PJLA 4NU5A 3QA9A 4PFJA 2X1HA 3TZ6A 4ZA2A 4ALKA 3E8XA 4J91A 3D1LA 1X0VA 1C1XA 4BNXA 4BGIA 3VH4A 6ADHA 3WBFA 1E5LA 1UXIA 5JDIC 3H5NA 4P22A 1E3EA 4ITUA 2C54A 3G1UA 3WSWA 3JQBC 4QUKA 3ZWVA 4FPXA 4EZBA 2WD7A 4XRRA 4Z9XA 2AQKA 3FNFA 1TEHA 1IYZA 1U3WA 4RF2A 4RDHA 2V65A 4BKQA 4DREA 1KY4A 4D45A 4KTTE 5L7YA 3PZBA 4PCVA 2CDBA 4YCAA 3WQQA 2VQ3A 5IXSA 1YVEI 2WD7B 1ISGA 1MLDA 3OA2A 4JBIA 3BMNB 3TRIA 3DL2A 3U62A 2UVDA 1YB5A 4TRRA 1Q0QA 1TVEA 4PGFA 4WUVA 4KQWA 1PQPA 4IY1A 4DYVA 3JQ9A 4RGBA 3JQAD 3MJVA 1UXHA 1VSUA 4J16A 4WLFA 4BKOA 5BR7A 1GR0A 3QWFA 3UN1A 4MDHA 3VH3A 4GVXA 1TA4A 3ZWPA 4JJFA 3DZHA 4LVCA 4FS3A 4GSKA 5JDCC 4FOOA 3B1FA 1ENYA 1FXSA 3GGPA 3D64A 3PIDA 4TWRA 2AEMA 5TRTA 2X86A 3LDHA 1RWBA 3U4CA 3NV9A 4UVEA 4GX2A 4CQMB 4CQLA 4DPMA 4YRDA 4E33A 5A02A 3WLEA 3INTA 1XU7A 1I01A 3EC7A 3VC7A 4J7CA 4O63O 4KTVE 2G0TA 3L4BC 1R37A 5A04A 2NU6A 3WDSA 1BDBA 2NU8A 4QO7A 5JW6A 4AJJA 1ONPA 5U1PA 1TI7A 1DJQA 3EW7A 4CUJA 4LGVA 2I3GA 1LEHA 1NWCA 1I2CA 1OOEA 1UH5A 3L6OO 4J0EA 2BMAA 1DAPA 2HKIA 1E7YA 1Q7BA 2EWMA 1HZZA 4LSWA 1HE4A 2DU8A 2IZ1A 4I08A 1UZMA 1SO8A 2Y1GA 5L9AA 5T64A 2JAPA 3INGA 1HSZA 3WXBA 4DIBA 1NTOA 1PGJA 5JSFA 2GYYA 1MXHA 1SOVA 1VKNA 2FMUA 3KM0A 3OM9A 3V1YA 4QT0A 2VHWA 4CMEA 4J43A 3RBZA 5JAIA 3GK3A 1ISMA 1K3TA 2D1YA 3FNGA 4YB8A 2X4GA 4ND2A 1JN0A 1MG0A 4W9NA 4PLPA 4RVSA 4HP8A 1QLHA 3MCVA 2NTVA 3GC6A 1I0ZA 1KC1A 1U28A 1EEHA 3WOHA 5I7SA 5IF3A 1UR5A 4DA9A 1CF2O 2BFOA 1IZ0A 1NFRA 1DJNA 4FIZA 3ZWXA 2YHIB 3Q6IA 5EPOA 3VH1A 1WNTA 2OBYA 3QQPA 4R9SA 4R3NA 4J4BA 2VHYA 1P1FA 2IXAA 1FDSA 2PA3A 4GGOA 3TQHA 2QX7A 3DHYA 3SJ7A 4J90A 3G1TA 1BRMA 3FPCA 1QMGA 2C07A 3KXDA 5L7WA 3JQAA 4Q9NA 4RQUA 2YDXA 4YR9A 3DHNA 3I9JA 3I83A 1DO8A 5F5NA 3GUYA 5KIAA 1YBAA 2I65A 2WEKA 2B5VA 3UAGA 4BNVA 3JYLA 3CSDA 3GVPA 5KTKA 4L4SA 3AY3A 4IDDA 1FDVA 2R00C 4ZU3A 3DBHA 1L1FA 1F06A 4UUOA 3K31A 1VLLA 3V5NA 8ADHA 2C5AA 4IQ0A 3HHPA 4RPGA 1E1KA 3CEAA 3CIFA 3GGOA 1NHWA 4DPKA 3VTFA 2BFAA 5T6BA 4NIMA 5EERA 1NVGA 4LRSB 4OSPA 5TX7A 3ZU5A 1IZ9A 1KVRA 1SBYA 2FPIA 2Y1FA 3KZVA 1U4OA 3CZRA 4YAKA 5JDCA 4OOEA 1ADFA 1P1KA 1P0CA 3P5SA 4HNHA 2VHXA 1FDWA 3GRPA 3S2GA 4EDFA 1C0PA 3JD0A 3L9XA 2VTDA 3RI3A 3Q0EA 2QW8A 3VZQA 4G81A 4L8VA 4TROA 3WGOA 5A9RA 2CUKA 4EEXA 1AXGA 5IZCC 3ZWYA 4GH5A 3BMCA 3PYMA 4WECA 4YAIA 4W6ZA 2QZZA 3L4BA 4TMFA 1I24A 4MKRA 4Z0TA 3WGIA 3QP9A 1E7SA 4IM7A 4CLRA 4HFMA 2HU2A 4U5QA 3RBVA 3MTJA 1ZNQO 5ILGA 5GMOA 5KVSA 2Q1TA 3Q9NA 5A06A 3ZNOA 5JCJD 4J7XA 4Y9DA 3WGGA 3JD1A 2HK8A 4B7UA 2GN8A 1HL3A 1I3KA 2O3JA 4N54A 5CPFA 3M2TA 1DOHA 3GNQA 1WZEA 4NBUA 1R0KA 2Q49A 2FR1A 3K2EA 5JAQA 1ZJYA 3GR6A 3LT4A 1YL6A 2BD0A 3MOIA 2G1UA 4CODB 3EDMA 4BNIA 2B69A 4H15A 1AGNA 1O9BA 2EEZA 2E37A 3H4VA 4E32A 4OXYA 4IIUA 3IP3A 3WYEA 2W98A 3RQSA 4BNWA 1QSGA 2Q50A 1TLTA 3AK4A 3H6KA 4K1LA 3ZDFA 5IDWA 1T26A 2X0IA 4M86A 5L4SA 3W6ZA 2IODA 4NK4A 3C1OA 3WTBA 4OGWA 4DMMA 3RC1A 4D46A 4AJLA 4ZQFA 1KVUA 5KJCA 1SEVA 1HT0A 3AM3A 1SB9A 4ZD6A 4CMIA 5HRUA 5TNXA 3PWSA 1VI2A 4N5MA 1X7HA 2C82A 1ZMOA 4QEDA 3OHSX 4MP8A 4OOFA 5FYDA 1NWHA 2B35A 5I9MA 5CDSA 3VPFA 1ZBQA 3PZRA 3RUHA 5F5LA 3X2FA 1GADO 2VUUA 4GKBA 4K6CA 4RORA 4R51A 3TZKA 3ZHZA 1GZ6A 3ZHXA 5C3MA 1B14A 1HDZA 2GZ3A 3JQCA 4OKNA 3AWDA 3RUCA 3ZV3A 4IGEA 3W8DA 4E5NA 3S1LA 5A3VA 1HE2A 2GN4A 3D3WA 4MVJD 2ZB3A 3PWKA 3OBBA 2CDCA 3BAZA 1ZUD1 2C7GA 4PLHA 5JMPA 3NDJA 3I6IA 4CM9D 3RJ5A 4DLAA 4GBJA 2RHCA 1Z7BA 2R00A 1D1TA 1XLTA 2IZ0A 4MJLA 4XJTA 2PD6A 1C0LA 3JYPA 5BT9A 4DL9A 2IYPA 4AJKA 1RM0A 4D79A 3ROPA 3WQSB 1GV1A 2BI7A 5ENDA 5I8WA 4OXNA 1PJTA 3G3EA 5TF4A 3L4SO 1U5CA 4YRBA 3L0DA 2J5QA 4PLWA 4WLUA 3H2SA 3JQ8A 3ZU3A 4EJ0A 1GDHA 3KYCA 4HUJA 2CDAA 2P9GA 1NAIA 4BKPA 3F6YA 1E3JA 4XGKA 5KCZA 1DEHA 5IDQA 2NTJA 4QO8A 3TNLA 4CUKA 1J4AA 3H2ZA 3RUIA 3RU7A 4P8RA 2YQ5A 5THQA 4BB5A 1DIRA 3SLGA 3G0OA 4OL9A 5IZCA 2EP5A 3PFFA 5EMHA 3IL2A 3S8MA 5JCJA 2Y0CA 1NQOA 2FOIA 4FCCA 2JD1A 4NQZA 2ZTVA 4XCVA 3E03A 4PLTA 4XQGA 5JYEA 1KEVA 4UUNA 3CMMA 4JBHA 4YAGA 1HLDA 2YV1A 3RJ9A 2D3TA 3BTVA 4CLEA 1L7DA 3JQDA 3DDNA 4II2A 1RM5A 4UVDA 2AQHA 2HO5A 3Q2KA 4IQ8A 3H8VA 3TWOA 1ZJZA 2EP7A 3WBBA 4BO2A 4IJWA 4ALIA 3MJCA 1UZLA 4DUPA 2H63A 3DMTC 1PSDA 1YE3A 2DKNA 5K0ZA 4CM4B 3RU9A 1HETA 4DGSA 3ZU4A 5IN4A 3CTMA 3GAFA 4P4LA 1PZEA 9LDTA 5ITWA 4JGBA 3WYCA 5AXCA 5IFLA 3RSHA 3P7MA 4XD2A 2EW8A 3NT5A 5BNTA 1ZH8A 3RKRA 2W2LD 4BV8A 3TSCA 3JQEA 5TJHA 1U3UA 2D4AA 4ZHSA 2GR9A 4AJEA 1V35A 3FWZA 2P9EA 1B26A 3RC7A 2O7QA 2JD2A 2WYWA 1PJ2A 2JJYA 2AW5A 2BKAA 2I66A 3I9MA 1VL0A 3UCXA 3WQRA 3E9MA 4MVJA 4HWKA 3UXYA 4Z3KA 1BG6A 2BGMA 4CM9A 2WYUA 1D7OA 2ET6A 4B4VA 4LMRA 5B4TA 1X1EA 1T24A 3FR7A 3GMSA 1FF9A 3PQFA 4IMPA 1Q0LA 1T2FA 2IYOA 4IINA 1LC0A 3HSKA 4DRYA 2AEJA 4FFNA 5L45A 1N7GA 2WSBA 1SC6A 1Y7TA 4U6SA 2AG8A 5DULA 2UDPA 4F3YA 3UH1A 3ST7A 2JHGA 3EVNA 4N7RA 1Y8QA 5EESA 1PZGA 3A9WA 3NAQA 2VRCD 1F8GA 1A7AA 1LDMA 1Q1NA 3GGGA 3N58A 4Z3DA 5ADHA 4ALMA 3GDGA 1N7HA 1UAYA 4RLHA 4TZKA 5G4KA 1K6XA 5G0VA 4CM8A 3CPSA 1H94A 4JNKA 1IPFA 4IJKA 3AU8A 4ONEA 1HDOA 5AXDA 1LLCA 1T25A 4R1TA 3RC9A 5HS4A 1IHXA 4ND1A 4GAEA 5L95A 1P0FA 1P3DA 3PHHA 1M6HA 3PXXA 2P4HX 2PKRA 4MVJE 1PZHA 3ZZNA 2J3HA 1YB1A 4MKZA 3OJ0A 3GNTA 5G0UA 3PGXA 2PY6A 4KDEA 5LC1A 1GPDG 1FK8A 3U9LA 3D3EA 1HE3A 3DBLB 3EYWA 1CQJA 1X7GA 3O8QB 2ZCVA 1P9LA 2BRUA 1ZEMA 2W2KB 3QVWA 1VSVA 3OJEA 4XYMA 5HWSA 4XYEA 1JVSA 3KRTA 3GZ4A 4OYRA 2WD8A 5JY6A 1M66A 2DPHA 2GLXA 3WJAA 3QWAA 4Q3DA 1DLIA 3FI9A 4CLDA 5B1YA 3ZW9A 3JV7A 3B1JA 2X6TA 3E18A 2JHFA 4QX6A 1KERA 4TRNA 5KJFA 4RQTA 4R68A 1CYDA 4QSMA 4R4JA 2W2LA 3D5QA 2B4QA 3FHLA 4HFNA 5TJ9A 4R16A 3GZNA 1O0SA 4IXTA 5IN5A 4OQZA 1ZK2A 4M8SA 2VOEA 1TT5A 3H9GA 4OM8A 1MC4A 4L4RA 4TRJA 1UDCA 3ZV4A 4GGPA 4CUZA 1I8TA 1OI7A 4GPD1 3ROQA 4Q39A 4WGGA 1AN9A 3ENNA 3CE6A 2UV8A 4YT5A 4FB5A 4CMHA 2DPGA 5BSFA 2XPCA 4GMGA 4D42A 4UUMA 2A4KA 1ADCA 2J3JA 3FBGA 4HFJA 4KQXA 4CR8A 1R6DA 3ETEA 4HV4A 2Y66A 3AM5A 3EVTA 3EZYA 4A10A 3TOXA 3NTQA 1ZW1A 4WLVA 2GN9A 3JYOA 4NHEA 2OXIA 5JYDA 3C1AA 2YHUA 3I23A 3OJFA 4FGWA 4F6CA 3OJOA 4GWKA 4DLLA 3W8FA 1KIFA 1E7RA 3HN2A 3NDIA 4UEOA 4Y98A 3NGLA 3OEWA 4PG4A 2YV2A 3WMWA 3VDRA 2D8AA 2NV6A 4CM7A 3GHHA 4NJMB 2VRCA 4E2XA 4ZICA 5A9TA 1AHIA 1JVBA 3IIEA 2WDZA 3KBOA 4FR5A 2QYSA 5FF9A 1XQ6A 1GCUA 2G82A 4J9VA 4RZHA 1H6AA 1C1DB 4YYZA 4A2CA 3FRJA 2Q2WA 4BGVA 2VT3A 4CLOB 2I76A 3JQ9C 4E31A 4BNUA 4KUGA 1DHTA 5JO0A 1QYDA 1FDTA 4IJUA 3GDFA 3NGXA 1ISHA 3I4FA 1BDMA 3PHJA 3GVXA 1CERA 2DTEA 2GCGA 2ZTMA 1ID1A 5CG1A 2BHLA 2DBQA 2HK9A 2J5RA 4CMCA 1F8FA 3Q2IA 1PGPA 2I3AA 1UP4A 3GG9A 4MKXA 4BIIA 5L40A 1XSEA 3M1AA 1A71A 1U4SA 4WOJA 4A7PA 4YT8A 3ULKA 1GYRA 2EJWA 3A28A 3LLVA 3ETDA 1MGOA 2C5EA 4Y6SA 5L53A 1XWFA 3I3OA 4CQMD 4BL5A 1E7QA 2DBVO 2E48A 3K2BA 3PQDA 4AL4A 3K73O 3U5TA 4M49A 2NUAA 2EIHA 1E3WA 4O6VA 3RIHA 1WZIA 3BHIA 3WIEA 3FSRA 2EF1A 3QVTA 1YO6A 5I9NA 3WFIA 1V8BA 3U4HA 1ORRA 1PGNA 5B4UA 3K5PA 3DBRB 3WNQA 2ZJ1A 4B3JA 1R0SA 2Z5LA 5AVOA 3V2HA 3VVBA 5DF1A 1PWXA 1ZFNA 1PL6A 1GUZA 1V3TA 3FPLA 2B83A 3RAJA 1XKQA 5CEEA 3OQ6A 2X9GA 3VAZA 5F3RA 1GYQA 3OMLA 4DIFA 4KMSA 1YS4A 4BV9A 1H2BA 4AJOA 1Z75A 1FMCA 2RBEA 4EGFA 1NQ5A 3KSDO 4R3WA 4W9NC 4D3FA 1GEGA 2FR0A 3LC1O 1X15A 2OP1A 5HTOA 4NU6A 1DB3A 2DM6A 2YDYA 1S6YA 5TS3A 2QYTA 4EJMA 1E5QA 3A14A 2JFHA 1SNYA 4EUFA 1FDUA 3H9UA 4L74A 3ZWCA 4BNMA 1P74A 2DTDA 2WWRA 3IKTA 4Z9FA 1NBOA 1YGYA 4JP3A 1YQGA 2UUPA 3NRCA 4YPOA 4NBWA 4IBOA 4OAQA 3I4CA 2AE2A 4NK5A 4WOKA 3HQ4O 1LU9A 1DIAA 4WLOA 1U5AA 3TOZA 6LDHA 1OMOA 4E13A 3SX2A 1G1AA 3BMNA 4L76A 3LZ6A 3O38A 1NFQA 2X7HA 1EQUA 1PQWA 2W90A 1WW8A 4CJXA 3B20A 4E6PA 3WS7A 3IUPA 1U3TA 3LT2A 3ICCA 1H5QA 4INAA 5IDXA 1HDXA 4W4TA 1A9ZA 1NPTO 1C14A 1SPXA 1LA2A 3QV1A 2C29D 3ADOA 4H3VA 5DCYA 2X8LA 4RPHA 1K0UA 4FW8A 4MIYA 1RKXA 2XXBA 2Q99A 5T5QA 4HX5A 1QRRA 1HTBA 3LVFO 4PZDA 2ZB8A 3O03A 2GRAA 1Y81A 4TQGA 1RYDA 1E3SA 3EAGA 4LK3A 3WYBA 1ENPA 4CQMA 5GZ3A 2O23A 1XHLA 3L07A 1XQ1A 4Y6RA 1BW9B 2H5LA 1Q0HA 1XU9A 4GLOA 4I5FA 3V2GA 1R16A 4FOSA 2PD3A 4KUHA 5CDUA 1LSJA 2NVBA 2JAHA 3E5RA 1EFKA 1GPJA 2JCYA 4Q3CA 4PG8A 4DMLA 3OFSA 3AY7A 3IP1A 1OC2A 5DZSA 4AJIA 5G2OA 3K92A 2CVZA 1ZXBA 1XA0A 3VH2A 2F1KA 4WEOA 1VJ0A 3VZPA 4J2OA 9LDBA 4BQPA 1NHGA 4GX5A 4AJ4A 4GVLA 3WTCA 1NVTA 4YACA 2J6IA 3K96A 3I5MA 1QP8A 2O4UX 1I30A 3U09A 2YW9A 1LI4A 3GNSA 2AA3A 3PHGA 2OBNA 5IG2A 3GPDG 1KEUA 3WIDA 1PGQA 2EERA 4MINA 5A1TA 4E0BA 1AUPA 5U9CA 2J3KA 1B8PA 1I36A 2VZ0A 4HFRA 1UUFA 4D3SA 3RROA 3T7EA 3KETA 1KVSA 2FP4A 4BO5A 1X7DA 3AW9A 5LDHA 2PZKA 3ETGA 2HMWA 4XZ3A 1I3LA 1SOWA 4XDYA 3F3SA 3LT0A 4HKTA 4YJHB 5DCUA 3FNEA 1E1LA 3E48A 4KZPA 5EQDA 4HY3A 3VKUA 2YHIA 1LDNA 1JAYA 4I5DA 2G5CA 4WJZA 3RD5A 1DRVA 2O3SA 1C3VA 5JC8A 4DBZA 3GEGA 4ZVVA 1BXZA 2ZQZA 1UP7A 4RZIA 5CPBA 5AXAA 1GAEO 4CR6A 2AE1A 2CF5A 1SZJG 2J3IA 3SVTA 5G0SA 3ROMA 1NAHA 3OQ1A 3MJSA 1ISFA 1EFLA 4KUEA 5KKAA 4R01A 1G0OA 2CVQA 3DZFA 4EW6A 4BNNA 4YJFB 2GD1O 3D0OA 1IHYA 3H3FA 2C2YA 1T4BA 4C7KA 4IDCA 2VHZA 2C2XA 2HMUA 4I9NA 1GV0A 5G0TA 5ICSA 2A35A 2DT5A 4WEQA 3AFNA 1R66A 2GUGA 3D4PA 1R4MB 2JKVA 3OETA 4LVUA 4RVGA 3TL3A 3H9JA 5AYVA 1BSVA 1P77A 5F1KA 3VOSA 5CDTA 5C37A 3JQ7B 1K89A 4D43A 1YKFA 2BF7A 2EV9A 3DFZA 1IPEA 3KO8A 1ISJA 1B15A 1GYPA 1WDLA 1BHSA 3RUEA 1W4ZA 5EINA 2AXQA 3B1KA 5L3ZA 5HA5A 4EJ6A 2Y05A 3INRA 1P45A 2VCYA 2PKQO 3ZU2A 1LNQA 2FWMX 1NQTA 3F1LA 4IIVA 4UUPA 5LDGA 2GPTA 1WLYA 1T4DA 1EVZA 5BQFA 1G0NA 2VZ9A 3S55A 5I7VA 1KBZA 5JS6A 5TQVA 4B3HA 3LC2O 1O95A 3AY6A 3DB2A 4O1MA 3BZUA 3W6UA 3ZH2A 3IUSA 4J4HA 4MP6A 2YFHA 5BSEA 1WPQA 2Z1NA 3QVXA 5K6AC 2HMSA 1CETA 3OIFA 4OXKA 4J9UE 2Q1UA 4K6FA 4OKIA 3ZV5A 1N5DA 3LSYA 2DQ4A 1IL0A 4XYLA 4Z9YA 2Y1CA 4B8WA 2JD0A 1HYEA 2WM3A 2Q2QA 2AQIA 1SCUA 4YVFA 2D5CA 7ADHA 3DHEA 2W8ZA 2Y0EA 1U1IA 1R15A 3MZ0A 1W8DA 1PJ4A 3PJDA 5JBIA 4KP7A 5JLAA 4CMAA 4E5KA 2GF2A 2P5YA 3UCFA 4WLEA 4C4OA 1Z45A 3PDUA 1AHHA 5HS6A
chains in the Genus database with same CATH superfamily
3V42A 3VBCA 2OP0A 1J49A 4AWAA 3THRA 5LYJB 1ISIA 1CSEE 1NVVR 2P9BA 2ZRGA 4RADA 3SLKA 3UPDA 4CKWA 1TAUA 2FZ5A 5CG2A 1I80A 1RYYA 3CBGA 3PE4A 3NXKA 2FW1A 2GEUA 3JZMA 4P4NA 3SWWA 2X1LA 3FLAA 1E4YA 3R5SA 1P4SA 3GJXC 1VPEA 4NF2A 4PLGA 3RUAA 4B3TB 1WSDA 3WRXA 2JL1A 3H86A 2B8WA 3KSUA 3DV2A 2PNFA 4G65A 1NP3A 3OO1A 4P9NA 5JXIA 4UTPA 2IJGX 1KSHA 3A1CA 4JC0A 4DZTA 2IUSA 3AQ4A 4F6RB 2AYXA 2OC9A 4HADA 4QOGA 1FVXA 1IU9A 1DCKA 3H1PA 4RBNA 2J8ZA 2GVNA 1O94A 3GRKA 4OV6B 2C3OA 3BTSA 2YXNA 4REQA 2A5YB 2RAUA 1N5KA 1Q91A 3DFMA 4I5EA 5DI3B 3RARA 1Z12A 4HQRA 2HMVA 1C30A 1SC4A 2OCBA 2NSLA 1KAHA 1DADA 3QPWA 3TQTA 1Z4MA 3PEWA 3VZSA 3OJWA 2A9FA 5DBHX 3N28A 4UZFA 5JD3A 2M98A 2E4AA 4XLLA 2YWXA 2JG3A 2UUAB 4TLBA 5TMEA 5J2UF 2AF4C 3MOGA 1YZUA 2WLSA 3QXJA 4FQ7A 2IPOA 4EITA 4M7RA 2J7KA 4XARA 5H8WA 2Y1LA 3MWEB 1MQAA 3EK2A 3OZGA 4I66A 5EN4A 5FWAA 1A4UA 4O4IF 1ZM9A 3BSWA 1USKA 3M6AA 4UM8B 2Z2XA 1OREA 5H16A 5SYMA 1AM4D 2YWEA 5DH9A 1M34E 2VNJA 1NM5A 2RB4A 3F7NA 1RJGA 5A62A 5HKOA 4AQYB 4LN1A 1T6YA 3IR5A 1T2EA 2XZOA 3GDHA 1T0PA 2OZKA 3L9WA 4I55B 4OF4A 5B37A 3C3CA 4FOPA 2QRQA 4KQIA 3UKOA 3ZY6A 4FMCB 1CZLA 1PTJA 1COWA 1W75A 2FRDA 1CX9B 2NZ2A 2PMKA 2QORA 2EFGA 2HCBA 1K5PA 3G9TA 3KTFA 4CL8A 1YIOA 4JYBA 4ZJYA 3FTFA 1CUUA 1KDOA 4LY0A 4MRMB 1ACJA 4PPYA 1KP3A 2FK8A 2PX6A 3T5CA 3W3AH 2E9SA 1MTOA 3NWOA 4HH1A 2G63A 5EHGA 2VI5A 2XZDA 3V33A 3MF4A 4LRTB 9ABPA 2E4UA 2R6DA 2GBFA 4M2LA 4GR9A 3RAPR 3RS4A 3QMVA 1P9OA 1QORA 3CKKA 3EOBI 3QTBA 2Y2VA 4PYIA 5AKGA 1RKUA 3IAUA 4OIFA 3A1DA 3V97A 4W82A 4ARVA 1PWEA 4ZEWA 5CCEA 5DW3A 4AXBA 1V6CA 3A2MA 1XLWA 5LKRA 4OP3A 3BXOA 5ISMA 2A9PA 1GUAA 3NDPA 1Y5NA 1EUDB 3FUUA 3WE7A 4DA6A 4A2QA 4DV5B 1TZCA 2WUDA 2UZAA 4EI9A 1UPBA 1GTSA 3G8YA 3DMNA 1HRKA 3P9SA 1N6KA 4ZI5A 2WHPA 3K9FC 2O2YA 2JK0A 1ZD8A 1TAHA 3QFHA 3ZY5A 5HRAA 1DOZA 1SBZA 1B00A 3FRHA 2J41A 5FV4A 2H4WA 4HJXA 2QSJA 3F8WA 3OLXA 3S1AA 1N2OA 1NASA 1T5SA 2B5WA 4MWSA 2I8LA 4EAAA 4Q1AA 1BX1A 3F97A 5EMLA 5KC9A 1GPYA 1K6MA 1HYHA 1H4VB 4TS4A 4G0MA 3W6OA 1GTMA 3SEFA 3STHA 4EHBA 1OD6A 4AXXA 3L3BA 1A9XA 1AIPA 2YJTD 3GPBA 1KZGB 2WFMA 1VXOA 2JKZA 2GNOA 3Q7EA 4EWLA 5TSDA 2IT1A 3SHQA 1B7GO 2SCUB 1BCRB 5YASA 4BVBA 4ENTA 1W85B 2YR0A 1N1EA 2OWEA 2COKA 4ND4A 3AUAA 4YCSA 1XQ9A 3OJLA 2ARKA 3EE6A 1P1RA 4ZJUA 4UE6A 2V4ZA 3WLQA 2VJMA 5DW0A 3ITKA 3R3JA 1BHQ1 4O29A 2IYYA 2OB1A 1OBCA 2OFXA 4G5HA 4IO1A 3TQFA 2YXPX 4Z49A 2HBRA 3DKIA 1RWVA 4KAJA 1IN5A 2X5XA 3CH6A 4L8WB 1TJPB 1FFXB 2DGDA 4EYGA 1LFAA 2WKQA 3PE3A 1HDRA 1CU1A 3DM9B 4IIBA 2ORVA 2Y9MB 1PFKA 1E1CB 2P4QA 4Q6WA 5G1OA 4FVTA 1QOQB 2B5OA 2X9NA 3EPHA 2XGOA 3SS9X 1UK6A 3V6LA 1TA0A 2FETA 4UFNA 2BSXA 3AHJA 2GZ2A 4Q1EA 1MG5A 4MRAA 3EGCA 2R60A 2ZTUA 4X44A 2GH1A 4X7RA 5AVUA 5ICEA 2IIBA 5DN6A 3DTNA 3LF2A 1MENA 4HVAA 3K94A 3NC4A 4YX9A 1JZTA 4Q1VA 1RS0A 1JHRA 1JRLA 1U8CB 3ACBA 3OP4A 1WR8A 1E20A 3BB4A 1HYQA 4ZVTA 4AWXA 2EU8A 2NN3C 2D2FA 3G0HA 1PS9A 1V8FA 1VDZA 2VP2A 1AKYA 2PCLA 1MAUA 2QZ4A 2SKEA 1GQ2A 1VB5A 3WP1B 3QJ5A 1V6AA 3R1IA 2XW6A 4Q19A 4BGEA 4EI8A 5M7EA 4P81A 4TS3A 2BCGY 1MO6A 2YZMA 1U2TA 4XLZA 2C31A 1KJNA 4D02A 1PDVA 2YJZA 5T3UA 1IHOA 3OE7A 4KRGA 3G49A 4MNTA 2HL6A 4KWHA 4KU4A 1ZGGA 3D0KA 4MRVA 4OCZA 3MTAA 5JSZB 1P5JA 1U98A 1OFGA 3OIYA 4PFQA 4Y0NA 2NU9A 5GGXA 5GOTA 4D5GA 5JFOA 1PHPA 2P7IA 4D9HA 4B3IA 2QZ9A 1DO0A 1QV9A 1PVOA 1GAWA 1L4MA 5IAAA 4WA8A 2GYWA 1WXHA 3GLHA 3LCJA 4HATA 1KI6B 2OXRA 1IY0A 4MW2A 4KKVA 3GRUA 1BE1A 5A05A 1ZA2A 1GD1O 2W2KA 4FUTA 4LSMA 5E38A 5BN4B 5A3SA 2VPQA 3T7KA 3TOSA 1PT7A 3R9XB 3OLCX 4NYJQ 1G8JA 2AFHA 1E79D 3BXEA 2H4YA 3A32A 4AIIA 1IB6A 5DM60 5BUCA 4NH4A 1KWKA 4FWTA 3DWFA 1PNRA 3ZGLA 1UCFA 2AR7A 3JD3A 3PDIA 4AYTA 2JIOA 1RP7A 4FI3C 1N7JA 2FNAA 5ALMA 2O1SA 4S24A 1LBIA 1YE8A 4K26A 3UICA 4BRWA 3LRPA 3O90A 3NHFA 4XEHA 3W5UA 1YC5A 3QZUA 4RH3A 2GBIA 4FDLA 4FTWA 4D9IA 3N3AC 3DR3A 1PYDA 2BTQA 4F3TA 4LHYA 3HSSA 3PC4A 5IULC 2X2EA 5IJZA 2FFRA 2EBUA 1L7NA 3KR0A 3IUEA 4ZRDA 4ARIA 4OO3A 3UOWA 5FNVA 3M2PA 4EQ6B 1XRQA 3RWOA 2BM0A 4QOHA 4XE5A 2AFIB 2J9FB 5ER6A 4KQEA 1OLSA 5JEDA 5KINB 1PJ8A 2PKQP 3IPCA 3OEYA 3T9AA 5B57C 1HK7A 4OUDB 1JT2A 1S7CA 4NZZA 3K0HA 1OV4A 4ZMSA 2JCXA 2QPAA 1NBMA 3VHRA 4G8DA 4B45A 5BW5A 5ITVA 3KBBA 3COPA 1ZBDA 5JARA 3U0VA 4EY8A 2P69A 1NNEA 1Z6PA 3E9RA 4TUYB 1Z36A 1IK4A 4V3BA 3DWGA 2HNKA 3LS2A 2P35A 3CN7A 3IOMA 1X8XA 1JLSA 1XZHA 1M1YB 3PUHA 4BO4A 5NLLA 3GLIA 1D0SA 3WO0A 5KO2A 1B2LA 1U0SY 3EVDA 1G20B 3GCZA 1LDBA 3U56A 2B36A 4RJLA 3RFCA 5HSGA 2W6MA 3FAZA 5E4YA 4P82A 4NJMA 2P6RA 2ECOA 2EJVA 3QLVA 4QPPA 4BU1A 3LBFA 3BYZA 5DMXA 2VSFA 3UGJA 4C0LA 3K4PA 3AF2A 5KWEA 5EXEA 1US8B 1XVTA 4XI9A 2I80A 1GL3A 1LZLA 4YROA 5ECYA 1C1DA 2I62A 4F6LA 3S2FA 4IS3A 2JFUA 3LX6A 3NHYA 3R6GA 1A9QA 4CU2A 4TTJA 5ALZA 3UUEA 3ZW8A 2ISCA 4BASA 4PR0A 5J4YA 4FGZA 1YRAA 1B74A 4PYLA 4P53A 3ZVMA 1SQSA 3E70C 1RLOA 5FPPA 3KL4A 5HE8A 4JQCA 3BE6A 3G2MA 4ZZ0A 1C0KA 4AJ2A 1LJ8A 3R7SA 2PDAA 4EGQA 2HA0A 4TV8A 4ZI7A 3HLTA 5AVYA 1I6LA 4G2NA 4RCYA 1MBZA 3WLMA 2QA5A 4JUAA 1EHYA 2AWNA 2WPDD 4JYMA 3ORSA 1JQEA 2I4MA 1KYQA 3G2PA 4RGVA 1XMQB 2FEOA 2AG6A 2Z04A 3KQOA 1L5QA 2N47A 2ZI5A 4MB6A 1Z5UA 1OT5A 3DE4X 3HL0A 3NOXA 2VP5A 3L6DA 3PUKA 1M1ZA 3QOYA 4JLMA 3OZBA 4LSZA 4RDIA 3HDQA 4I8IA 4R5MA 8MHTA 1H22A 2OKGA 5LU9A 1KAMA 1A9TA 4YGXB 1AMUA 4CXMA 2RH4A 2IY8A 3R3WA 1H0KA 4KE7A 2O3UA 4ZYVA 3LC7O 4KWTA 2UXBB 3QWHA 4DLBA 4MQ5A 1Z0DA 2NT4A 3CRZA 3EGDB 2E18A 3I6ZA 4YEDA 1JPVA 1ZVQA 3ELUA 1ONNA 1OI4A 5TV2A 1R9JA 3BWEA 1C3JA 5JXJA 1WMDA 5KOIA 1HNXB 3PL1A 3KUXA 4G56A 3HXOA 2OZEA 4I2NA 3NETA 4H3HB 3OUTA 4N1AA 3JQFA 5CDFA 5KX5A 1L1EA 2J67A 5EP1A 3B85A 1FZQA 2ZYAA 1JKXA 1Z9BA 3HZZA 3MQ4A 5K3AA 1Y1QA 4GQAA 4Q15A 4DM7A 3GRVA 1UOEA 5BSRA 2B7CA 2PWBA 3VYWA 1XDBA 2DT8A 4HAIA 4II3A 4PE5B 4CLHA 5KNDD 2I6QA 3HY3A 3STVA 2GSDA 3E5NA 2HLDD 1DE0A 3AV3A 1E9EA 4Q4CA 3BTOA 2BYTA 2WT9A 3ZLVA 1KJQA 1CK4A 1NW7A 3LWNA 4ZQGA 1JWLA 4LF9B 1U0GA 1P0PA 2M6RA 2D54A 1IWOA 1DC6A 1IEVA 4EMSA 1NZFA 1KDPA 4L75A 4RHEA 2ZATA 1I4EB 2R85A 4TWBA 1XUOA 3U0BA 1MTZA 3FHOA 3DXXA 2FMTA 5IZ4A 1USWA 4Q1DA 5A9SB 1XTPA 3COYA 3N9IA 3IVRA 5I9IA 1W5BA 2GKGA 1SELA 2V9PA 4C7MA 3FTEA 5K3DA 3UENA 2BHSA 2JIBA 1KGDA 1JR3D 2W22A 3EEBA 1K8YB 4OB6A 2CMDA 1LJLA 3W4KA 1OXKB 4YUAA 1GT6A 5FTLA 3GLFA 1EMDA 2P1ZA 4WXEA 4MUFA 4ZTZB 5AXBA 2O06A 4HXEB 2PGLA 3GRYA 3OKAA 1AMOA 1SUEA 2WG0A 1THZA 3STUA 4DXHA 5KKCA 4WCFB 1QYRA 1YONA 2VCHA 4J1TC 5LA6F 1R4NB 4LHVA 3ASZA 4G09A 5CX1B 3RUFA 4BWGA 1X7ZA 5SYNA 1ZUWA 2Q3LA 4MAAA 2QPOA 3LUFA 4D80A 4M8NE 2C0PA 3GJRA 3AC0A 2WE8A 1XMSA 2H2AA 1ZVVA 2PMBA 2PQ2A 1ELOA 1X77A 1EGMB 3AETB 4NVRA 1LX6A 4J8PA 4OI4A 3WK4A 3ANNA 2PZLA 4EZIA 4I1PA 4NH0A 3GDWA 1G291 3SC6A 3MWFA 1M2VA 1T2NA 4HF7A 4A8JA 2PJRA 2A2ZA 3ZKWA 1XL0A 2JVJA 2BZ1A 3M1IA 1AGXA 4KDFA 3V1UA 4EUEA 1V95A 3Q72A 4NYIQ 1CEXA 4DLPA 3R7WB 2V3WA 3E0XA 5AHRA 5BSWA 4ZZ1A 2NP6A 1F6DA 2R1VA 3ABSB 4RXMA 3K5WA 4AG5A 3EG5A 1Q3HA 4Q34A 1VZ2A 3MFYA 2GO1A 1QRTA 1M75A 4U4AA 4YQYA 2R1ZA 2XVYA 2IPXA 1S0UA 2QTZA 3KSBC 4RPJA 3NBMA 3ANXA 2DR2A 4JI0B 1AKWA 3IAXA 3G2NA 1K6JA 1Q84A 3NX4A 2C2OA 2HA5A 3OLYA 1BW9A 4HC4A 3UK0A 2VNIA 4XM0A 4DCVA 4HDAA 3UB4A 3CE9A 3AHFA 3KKOA 2PPLA 2VPZA 2OENG 1OKKD 1Q83A 2P2SA 4KVFA 4D4HA 1LDGA 1R18A 3CNHA 5IS2A 2IH4A 2X2FA 2CFIA 5ALOA 2AXNA 3CBQA 2C4NA 4DLKA 4OFXA 5DWQA 4ZYTA 1QYCA 4ER7A 1L5SA 4JLDA 4M7OA 2HDHA 1OLXB 4P2GA 5I48A 3VAYA 4QM6A 3AQIA 1FU4A 3L0ZA 1DSSG 1T1SA 4FN5A 2FE4A 4XKJA 5EJ2A 1ZRSA 2NQ8A 1L7EA 4LV5B 2OG1A 1G18A 2REXB 2TMGA 1QVVA 1U2GA 3GVCA 3HB0A 4GEGA 5EFZA 4BKUA 3LWDA 2X0JA 4BMXA 4EG0A 5CB4A 3PC3A 1WQ1R 4Q1CA 3PFGA 3WA6A 3DJFA 2VJPA 3BWCA 4IDGA 3HYLA 4IFTA 4D9MA 5JZOA 4XR9A 5JU6A 1GTVA 4IQGA 5KJEA 4E4YA 5BSVA 5LJLA 4AY4A 3E9YA 1GU7A 3K3PA 4WTOA 3GJQA 1NNI1 2GM9A 4KC0A 3PD0A 3K20A 5DNUA 2QU7A 3FTNA 5B58T 3BE5A 1DKMA 4KCGA 4RK4A 3LU1A 3LUCA 1CUBA 4CN8A 5T7BA 3SU8A 4C7OA 1I2DA 3KSAC 3KCQA 4BTEA 2GF0A 3N2EA 3PX2A 3ZPXA 2PQ6A 1G42A 3DBIA 4R41A 5IWAB 1H4SA 2BM8A 3QMWA 4B7CA 4LJ4A 1VC2A 5I4IA 4W5RA 3KQKA 5DOVA 1TZ2A 1P5HA 4RCVA 4ZOLA 1I2BA 3F1KA 2B61A 1HE5A 4K03A 5C1IA 1I3MA 3JQ6A 2QN2A 3QX7A 3B52X 4WUTA 1LPNA 3EHDA 3F4BA 1TGVA 2Z4TA 3A3KA 4HDOB 2HSWA 3ICPA 1GNRA 4YJHA 4MWEA 5BNFA 3UG6A 3B82A 5ADVA 4K3VA 3P19A 4P92A 3X1XA 1VJTA 1SG6A 1XJQA 3L7NA 1YJQA 3SXUB 4BNYA 1MVNA 2MYTA 1QPZA 4WINA 2DFNA 2XVZA 3PGLA 4OA5A 2FWJA 4B75A 2R97A 4FYXA 1TADA 2MR6A 1DP4A 4ZVSA 3LH5A 4RD4A 2JGLA 3EUWA 1PV4A 2I4OA 3M3PA 3QG5A 4TKLA 5EMMA 4WXRA 4AVYA 3ELWA 2JLVA 3EIHA 4YJFA 3DOJA 2NP7A 1CUJA 2UVPB 3JQQA 2FFAA 5J23A 5EIFA 4ZCPA 4MI3A 1KYXA 2WU8A 5FNVF 1MJHA 3JTEA 4WOPA 621PA 3Q12A 4J1QA 1GRVA 3A1WA 5CHYA 2YVLA 1IJKA 1EH5A 2ZFUA 1HRDA 5K0EA 1JYEA 2X8JA 5I7RA 3ND9A 4W8OA 5EOVA 2JLUA 3V00A 1XXLA 3FCAA 2PX3A 4O8ZA 3OWOA 3SQLA 4E5PA 4O02B 4J0JA 3EBOA 1BXRA 1S3SA 4WNIA 1T8RA 3RYCA 1QO0D 3CZ5A 2F3QA 2A5GA 3H8SA 2OV8A 2OZVA 3O0DA 1GEEA 2VBFA 4IICA 4FEAA 3C85A 1KEEA 2G9QA 2ZWOA 2JJMA 3S7ZA 1HM5A 1JNYA 3RDPA 3UC9A 2YY7A 1NM5C 3VPSA 4F4UA 1XRJA 5JDIA 3R2JA 1EK0A 3KK0A 5U4XA 4AZ0B 2YUTA 1Z0JA 3MJTA 4TTAA 4PO1A 3CUWA 1QPGA 1X6VA 3PFIA 3KOYA 1WY7A 5EHNA 1H4TA 2HA3A 4OQDA 4DQXA 5LQRA 3IT1A 1PTJC 3DZGA 2WTBA 2JLXA 3LP8A 1U7TA 4BDSA 5AVQA 2CHVA 1JU9A 2PRKA 5FV7A 3G17A 3I6BA 1QV6A 4DLNA 1VJ1A 2KPOA 3GVIA 4PNPA 2YZ7A 1FJHA 4MIOA 3FKJA 3WGLA 1NI3A 3DMGA 5H4HA 2AI2A 1VIYA 4LWPA 3PXBA 1A8IA 1U2QA 4GHWA 1CQIA 2FPPA 2QN6A 4G0YA 3W7VA 1EK5A 3KT0A 1W1IA 3L77A 5CVTA 1MV8A 4EY5A 2H0AA 1ZHFA 3SZRA 1RLUA 3A6LA 4G84A 4M88A 2BBOA 5IKMA 3PNQA 2P75A 3H2YA 3VR2A 3GBPA 2GZ1A 2BEKA 3PJGA 1P0MA 1ODKA 4RIHA 1YGPA 2R65A 5U4QA 1H1DA 1VMDA 2H7YA 5ADWA 1G5QA 1LUAA 5GIOE 4UOZA 4ZI7F 3GIDA 4TV8F 3UHFA 5E4TA 1R0ZA 2WJWA 3NATA 4A1FA 2ZWAA 4N03A 1GGNA 3SYTA 2PUEA 2QNRA 4XRGA 4QXPA 4B76A 2HXYA 3H6GA 2X1VA 1EPUA 2XIQA 4LOIA 4PLVA 3THXA 2GN6A 4GPAA 3TL6A 3MGAA 4DV6B 2Y4OA 3NBFA 1ULTA 1U5BB 2FFHA 4KI7A 3FZYA 4HTAA 4NBRA 3W1EA 3C3AA 4MP3A 2WU0A 2ZBQA 1YRHA 2ODPA 5KSZA 3THSA 1F2TA 2MYPA 3AF5A 2ZB7A 2UUOA 2YFQA 5E6RB 3R7AA 2QE7D 3BILA 1J0XO 5AW1A 3D7KA 2QYHA 2XMBA 4JEUA 4NJEA 1QVAA 3FOCA 4C7OB 4NAUA 4OTZA 3CUUA 3H2IA 5LYJA 1JDZA 3K6SB 2ZUBA 4RFVA 1B8VA 1OZ0A 2RG7A 1CV2A 5FX2A 4EJ2A 2ACWA 1Q15A 2PZEA 1AKMA 1E6UA 1NXVA 1YACA 3AUKA 3P9ZA 3L8GA 4MYTA 4RD1A 3QLUA 5AP9A 3S2EA 2IWRA 3IKVA 3U13A 4Q3EA 3DMDA 5T41A 5T6MA 2RBKA 2O48X 4Z4CA 4E4TA 4V0KA 4XB2A 5HRCA 2EKLA 4F6RA 5LR6A 3UMMA 1U8FO 2J9YB 1ZZEA 4AJNA 4PNZA 2DLDA 4BNLA 5DI3A 3RTEA 4E15A 4F2PA 2B7LA 3IEVA 2F90A 4EB0A 1IMJA 5A4FS 2WU4A 2YV3A 3VI4B 1I2MA 1QG2A 4KSYA 2I99A 3OOSA 3ZHTA 1JMVA 3RFVA 3M6FA 1KK3A 1IY8A 4P4UA 4YBZA 1EFHA 2G04A 5ALKA 3R6DA 4RPKA 3ZOZA 3ETNA 5KPDA 3EVZA 2Q45A 4H6PA 1EBFA 1JEJA 1PR1A 4XVHA 2HRZA 1E9CA 1P0IA 1RWPA 3MWEA 3WAKA 4ABYA 3LPMA 3IMGA 1OF1A 2F9MA 2VUSA 1UZAA 3IXQA 3T6KA 1DIGA 1NJ5A 5DTQA 1JEYB 3ES9A 2W6NA 1AJEA 1Y5RA 1GTRA 2DYKA 1RTTA 2OKCA 3HL4A 3LT5A 2PZAA 3Q2OA 4IRMA 4MW1A 4ZVRA 1KI2A 2PRIA 1Z47A 3HUDA 1EFPB 1ZJ5A 2HU8A 4I55A 2ZBFA 2VHVA 4L0DA 1XVAA 3HRHA 4UDOA 1E8DA 5HBRA 1RHRA 4CHTA 1YZQA 5ELXA 1EDOA 2B0CA 4JOSA 3TSAA 4RVHA 3IEPA 4MXDA 1KQOA 2QUJA 3TUJC 3C7DB 1EI9A 2AC7A 1U2EA 4GE0A 4LZLA 1U0HC 4MRMA 1I7PA 3PR3A 3FOFC 3D0QA 2AMLA 4UEWA 1UJ6A 2XUFA 4AI6A 1EXWA 1GCAA 1W4BA 2BE9A 2XRFA 2AYYA 4YRAA 2Y1KA 1RPNA 3E84A 3JVDA 2Z6QA 3IDAA 3F7TA 1N34B 1E99A 4E5MA 2ZZMA 2OV2A 3ROZA 4B6JA 1LRLA 5JNUA 1KAEA 3LOPA 4B3RB 3NHBA 1E32A 1XNRB 1RAHA 1Z6ZA 1B73A 2ADFA 2YVAA 4YA6A 1Q1EA 1AQUA 1EUDA 3F98A 2P4UA 1W0KA 1U0NA 4LJRA 4FS8A 4V38A 5CM8B 4L8YA 5JS2A 1E5VA 1IZ7A 2V9ZA 1RRFA 3LOQA 1T6NA 3HB4X 1RYEA 1USGA 3N8GA 4BQRA 1K27A 3JRWA 3FE2A 1TM4E 1PR9A 4EKGA 5CA0F 3IJRA 1Y4ZA 3NC0C 1CPYA 3TPZA 3ZZMA 2I33A 3MA0A 3GT4A 1ZG3A 2UZ1B 1Y6JA 1Z5WA 3U16A 3JSAA 2NO7A 1E1QD 2JZOA 2QUZA 3B7WA 4DJFC 5LWHA 4NBKA 4FDTA 4OBWA 4ZU1X 4MO9A 3S29A 2Z4SA 4EG7A 5LQSA 5CFNA 4B1FA 2Q9CA 2IELA 2JS7A 4PO3X 3WIVA 4BJ5A 3DOOA 3EWNA 3UFBA 1N25A 1Y5MA 2W6ID 1BCRA 1PT6A 1SUIA 4KV9A 1XRRA 1W85A 3PX3A 3HE3A 4G01B 3DE6X 4E2FA 3VSCA 2BV3A 2I1QA 1U2DC 1LZKA 1Z5ZA 2NACA 2DFLA 1G59A 3AM1A 4NBTA 2W42A 3ETJA 5EKUA 4D3ZA 2ZLBA 3QE0A 4OJYA 4EBFA 1ZRNA 2GKSA 2QUIA 3OPVA 1Q1GA 3RKSA 1W6UA 4HPXB 1KQNA 2ZVDA 4E09A 2GBLA 4IIYA 4U02A 3DLIA 5EIHA 4D92A 3EF1A 4N6GA 3SHOA 4ZKDA 4NDNE 3QKWA 1SPBS 4KYVA 2PD4A 1FFXA 2WINI 4UATA 4X97A 3WFJA 2XGMA 4CGYA 4AURA 2J4CA 3AUFA 1XTSA 2OAEA 4MHSA 4KQ9A 3BS4A 1L7OA 1IM5A 1E1CA 3NKLA 4IVQA 3USES 4YGYA 4D7AA 2XI4A 3T12A 5AVTA 1UFVA 5FUMA 1L5GB 4XVUA 4XGQA 1CRZA 5JH7F 3A9VA 3A58B 5ED4A 3PS9A 1CBUA 2VQ6A 3GGJA 3Q6MA 4RENA 1CXZA 1CUDA 3MEQA 4XYBA 4RTQA 3H04A 2VP3A 3NYQA 2W6CX 3B6ZA 5C34B 3EMKA 2F8SA 4ENQA 3L1IA 5BR8B 1WMAA 1QYXA 2O3QA 3DE2X 1IC6A 3QKUA 4LYAA 1LPBB 3URMA 5CJ2A 2PS1A 3LDAA 3H2JA 4DMMA 1LNZA 2A57A 2OZLB 3KYIB 4NAHA 5B1SA 4JI4B 4RKQA 5H4GA 4PSDA 4ZCTA 2B4RO 2WSSA 1TEZA 1FFDA 3ZY2A 3E5HA 2B0JA 2F1HA 4DGSA 5HF5A 3I8OA 1M2GA 4GZ6A 2QG9A 2KB0A 2WIAA 3CSUA 5MFZA 1VM6A 1WL8A 1RQGA 2YJ3A 2F48A 3I9FA 1Z17A 4R1PA 1Q7GA 4JJ7A 1VI5A 4FYVA 2K6GA 4GXNA 2R2GA 4JX8A 3GJYA 3GLQA 2FHSA 1JXAA 4JIGA 2NNLD 1URPA 1V3UA 4W9RA 3RVQA 1GFIA 1KETA 5KPJA 1ZNWA 2OHIA 3OM8A 2V59A 4EUKA 4DA4A 1B76A 4ROTA 5JSZA 3Q5DA 1D4AA 1V96A 4B0PA 2BKLA 4CF3A 3AFMA 1HC7A 4EPVA 5JAHA 2XY4A 1UPCA 2YWFA 1ZU5A 5A6SB 2YWBA 3HG7A 1LPOA 3AJ8A 3CN9A 4RNCA 2O2JA 2FQYA 2B7BA 1KI6A 4R1UA 3JASB 3BE8A 3R3SA 5DDIP 3A10A 5I8ZA 2WJ3A 1MB4A 4D44A 4KITB 2EGGA 3R9XA 5BN4A 2FSVA 2JZCA 5DLDA 1JKFA 4JENA 4TSFD 4EFKA 1BXKA 4B6RA 4AKEA 5EHQA 1DAMA 3AUSA 2WQZA 3EIQA 1KDYA 3N74A 3T3EA 4HAZA 2CCKA 1PR0A 3SYMA 1FLNA 3IERA 4LQLA 2Q6KA 3R7NA 2NO0A 2BPOA 3L7KA 1DFHA 2D5AA 2FW9A 1Y8QB 1SHZA 2CWWA 2NV0A 3FJ1A 1JG2A 3DCIA 5HIAA 4ALLA 3P0HA 1DC7A 1Q6YA 1FP1D 1KPHA 1W4CA 2JH9A 3BRWA 3NRBA 1YUBA 4R5HA 4AP9A 1Z83A 3PNOA 2HDWA 3HYSA 3VX3A 5I7WA 3RRMA 1WV0A 1NQXA 3C4VA 1USVA 2FMKA 3IQHX 3V8QA 3T15A 2A9KA 2JFPA 2QX8A 3ZVRA 3T7CA 2M6SA 1JG7A 1S2GA 4QDKA 4EQ6A 5H80A 3ZHSA 3HJNA 1EFAA 3AR5A 3KVYA 4RKRA 3ZDDA 3I39X 1A1VA 1AF4A 2AFIA 2J9FA 1XBTA 3BB1A 2E49A 4XIJA 2D2IA 3WB2A 4MCHA 3ZE6A 2ZPUA 5KAPA 5NULA 1K6IA 2XDYA 2IHJA 3QNWA 2AZTA 5AKEA 3P2YA 2XA1A 2CFOA 4OUDA 2O2XA 3PVZA 4J1NA 4WVLA 1YL7A 1ECJA 2I9PA 5AQEA 3BHJA 4TWIA 4P33A 4P0QB 4YCJA 1A8QA 1BHJA 4FT4A 3HEMA 4H4DA 1NV8A 3D54D 4LQCA 4X6XA 4PGGA 4TVBA 2Z2YA 3FZNA 4GMFA 4TUYA 1CQJB 2WG2A 2ZYVX 4Z4IA 1IOLA 2CMHA 4AZTA 2AOWA 1AA6A 1BMDA 3O9VA 4KV7A 1RRVA 1M1YA 1E0JA 1OC4A 4PZCA 1JAIA 3ZVLA 4I19A 4CMBA 5ALWA 1G20A 1E4VA 2M6KA 2CJFA 3PX7A 5AHOA 1DC3A 2ZPTX 1S5PA 3D81A 2EGHA 3OCCA 4H17A 1JKIA 3GGCA 3X1WA 1HMYA 2J07A 3MPUA 1L9XA 4QWWA 5HYVA 1JX6A 4JWTA 5AICA 2UUBB 3B7PA 3X1MA 3BRCA 4IZIA 2QQEA 3ETCA 1W0JA 3NTLA 1US8A 2F3RA 3H7AA 1XZBA 3KPJA 3O9ZA 4A8JC 3UYLA 1GTZA 3AGQA 4GOND 4F8JA 2OXFA 4K9MA 4Y1EA 4E21A 5KOYA 1B4DA 1OPRA 1XTVA 3F9IA 2K4MA 2EHDA 2P5SA 1MB9A 1RCTE 2VTEA 2C1XA 2W2TA 2XGSA 1TT5B 4ZAVA 3HWWA 2EXXA 3DS8A 3ZUGA 4MYHA 3JWHA 4TXNA 5K9ZA 3A4MA 1EB9A 1ULHA 4NG4A 4LJ9A 4AJHA 2ECQA 5HIMA 4ZEXA 5A7GA 4PX3A 3TB6A 3UWOA 4G9EA 3TTWA 4FU0A 3L8FA 1AUOA 2NMVA 4XGNA 3HRKA 4DRXB 2A3NA 2JFVA 2VJBA 4EATA 3GRAA 5BWMA 4EH1A 1Q7RA 2R79A 1IXSB 4EFDA 3Q8WA 2IU0A 1X1TA 1ZM4A 3LBYA 5DTIA 5DLYA 2RH8A 2FZVA 4D4GA 3IPLA 1FSSA 3U7GA 1L8AA 3DG9A 2JGRA 3DEYX 4IVNA 4YRGA 4XFDA 1MQ9A 3PD7A 3FOBA 1L7BA 1NOKA 1VE6A 3QVVA 3EGDA 4IXNA 3S2SA 1LDYA 5K0LA 4F91B 3QYJA 3B6IA 1OA0A 1NYLA 3E22B 2N42A 5JS1A 2BKEA 3Q3IA 2FZWA 2PHZA 3PEEA 4PWYA 1R5BA 4PZEA 1NURA 4P0PB 1B3RA 4PANA 4D3DA 3DJYA 4CHGA 4URZR 1YVRA 5CDYA 3RUDA 3P0EA 4FMCF 4DTIA 3PE6A 2P5UA 1J8YF 4RVFA 2FXIA 3FY4A 2QTBA 1C29B 1PDOA 4Q03A 1KMCA 4DR2B 4IGFA 2GILA 4MTCA 5IAOA 3QF7A 1EVEA 3OA0A 5EJ6A 3R0QA 1NP7A 2H18A 3FDJA 1WAMA 2O7VA 3F90A 3R0IA 1CP3A 1HLPA 3NORA 4INJA 1IE3A 2WYHA 4A92A 3LK7A 1A72A 3OFVA 4BGUA 3TJRA 3K32A 3OMXA 3MIIA 5DGCA 1Z26A 5A9SA 3RADC 2Q5QA 3SY8A 3U3OA 4Y2QA 1XZ8A 4LY6A 2Z57A 3JARB 4EAQA 3CRRA 1WMFA 3PRJA 3DAYA 3FNHA 2BDEA 2DKOA 4ILEA 3S44A 1R6XA 2IOQA 3RBXA 4UTVA 2N1BA 1FNBA 3N7AA 4DV3B 1CRWG 3G8BA 2A94A 3K8OE 4HGOA 1K75A 1YBMA 3I1IA 3EG9B 4IYJA 4MX8A 5FP0A 4ZT3A 1M83A 4WCFA 4E1AA 1UFOA 4N5HX 3BFPA 1R4NA 2Z6VA 3HB7A 4OYHA 4UEKA 1W581 2QRKA 2DAPA 4IHKA 5CX1A 1EK2A 5DFAA 1ECLA 1FYDA 2PZMA 1KBQA 2IY9A 3VKWA 3MW8A 2DCMA 4A26A 5K0TA 1EA5A 2WWWA 2OL4A 1B93A 3CA8A 4TZ0A 3AETA 4X5OA 2AQ8A 3I6QA 1J6UA 4F4JA 4AN1A 3LW7A 4D41A 4CMEC 2BFFB 1NDQA 5F4ZA 5FO1A 5AKJA 1VMEA 1M6WA 2IGBA 3FTDA 3MSXA 5D7NA 3Q6NA 1UJNA 4PBTA 5H82A 1SN7A 3VKVA 1CY8A 4M7PA 4JBLA 2IDZA 2RKBA 4KXMA 2FZGA 4Y0AA 3EC2A 2O5VA 4MUGA 3R7WA 4AMBA 3AF6A 3LVQE 4XGIA 5KNDH 2JIQA 3B7GA 4LW8A 5BYJA 4XOIA 3A4LA 5DBGA 5BSUA 4PIVA 2ZRQA 3FYUA 2P6MA 2HV8A 3CEMA 2EG9A 2IQIA 3ICVA 7YASA 2O8NA 2OAQ1 1KK2A 2OVBA 3QA9A 4II7A 3KTAA 4CTKA 3MWYW 2AJLI 5IW8A 3HXKA 1WZCA 3L41A 1VYUA 3G9XA 4J91A 4ZA2A 1W36C 3HWSA 1X0VA 3IIIA 1BEEA 4BNXA 3I8XA 1BYUA 2I7XA 5EYPB 1SBIA 2K87A 3UAYA 3WBFA 2RONA 4F9EA 5JDIC 3L1UA 4QL3A 3H5NA 2QQFA 1E3EA 3DVRX 4HQFA 2OD7A 3KWMA 3UGTA 2BY4A 3WSWA 1GZ7A 2IHTA 4QUKA 4BC0A 2QVZX 1MNQA 3L7DA 1NMQA 2WD7A 4LTMA 4WOBA 5GINE 4PS1A 3RSSA 5IKEA 1TEHA 5EIBC 5K03A 4PGMA 2G72A 1U3WA 2OCKA 1CR4A 4RF2A 1W36D 3OESA 3H5TA 1KY4A 1XFAA 1L3CA 2FW8A 4J75A 1WBJB 1EJ6A 4NHOA 4EPTA 3PZBA 2CDBA 1LBHA 1H65A 2VQ3A 5T4BA 3WQQA 5C7LO 5IXSA 2QTNA 4YMHA 1ISGA 1OLXA 1PZMA 1JFRA 5L3VA 4JBIA 4GKJB 4JOQA 5KNBA 5CVEA 5IH7A 1ZW6A 1TVEA 2JEOA 2HSEA 4UE3S 4M9RA 1R88A 1HOTA 4HRYA 4IY1A 3QX3A 1NN1A 2Z2ZA 4Q66C 2II6A 1YKSA 2VP4A 2AFRA 4J16A 3OCZA 4WLFA 2CLMB 5BR7A 4CFYA 4RTPA 1GNTA 8LDHA 4KAAA 2F2TA 1YS6A 4JOCA 4C01A 6CHYA 4DABA 2NYAA 3M3HA 4JI5B 4B82A 4FS3A 2XBLA 4GSKA 4MS3B 4KK3A 3S1SA 2VDQB 3FLBA 1ENYA 1Y7PA 3WVNA 4K6GA 3LIIA 5FA6A 5J9FA 1XZCA 1XTJA 1KIAA 1SKUA 5JSKA 4M0CA 4UUAA 4L51A 1J20A 1N2GA 4GX2A 1M8FA 2GPAA 3EA4A 4UVEA 3SK0A 3AR4A 4UJ5A 3RG2A 3WLEA 3B8HA 3EEYA 3PFKA 1I01A 2WWHA 3FGOA 3IGFA 1E66A 2HA6A 4J7CA 3PL5A 4IMIB 4E14A 3IPAA 4KTVE 4RY2A 2HBQA 3HJTA 3L4BC 4UNQA 2Z3VA 2ZE7A 2JGDB 2HT1A 1BU8A 1BDBA 3LPDA 2JFQA 1P73A 4MARA 4NTZA 4QO7A 5LPNA 1IVYA 2IYLD 2YRFA 3SXUA 2EW1A 1TI7A 1DJQA 3G5MA 5AJYA 3OCUA 2O8EB 2I3GA 4H27A 3L01A 1I2CA 1Y6FA 2XNDA 2BMAA 1XCGB 2W2XA 4DG9A 4TT3A 2HKIA 5DV9A 3A70A 1DKOA 1UODA 1KO5A 2IZ1A 3OFKA 1UZMA 2QOEA 1MF7A 2D4HA 3BD7A 4L9AA 3BXGA 3NOOA 1AK1A 3EZFA 2FP3A 5I7OA 2UVPA 1SBNE 3CNLA 2XE8A 2Q29A 3EGXB 3AYZB 4HAWA 1YTLA 5EE9A 1QRDA 4KXUA 1IK6A 4QT0A 2I55A 4J43A 4YMVA 5DYWA 1K3TA 3FHCB 3FNGA 1QIGA 4D6YA 2QMHA 4M8KA 1U7DA 1OY1A 2YV4A 3T8YA 4EPYA 1AB5A 1V4VA 3T5MA 2H5IA 2NW6A 3ZUPA 3ORYA 3PR2B 4TMXA 4CF6A 2RDMA 5FLEX 1ZD2P 2CXHA 3MCVA 2NTVA 3GC6A 2NZJA 1SG9A 1I0ZA 1KC1A 2FMXA 4J07A 4TUYF 3VOTA 3WOHA 5BQ3A 1UR5A 3SG0A 2FDXA 1CF2O 3C74A 4LOAA 4JODA 1H2FA 3VR6D 3NAZA 1FLAA 4AZ0A 2BFOA 4MUKA 4QSHA 3RTDA 5JZBA 5LLTA 5ALXA 1M33A 1M5RA 4BVEA 2IYNA 2TECE 3UT0A 4QIHA 1DAFA 3UAVA 3UMBA 1B6SA 2YHIB 5AW8A 3UWPA 1H0RA 3VH1A 3FB1A 1WNTA 4R9SA 3L46A 3LWZA 3ELBA 4X45A 1L7RA 3HUFA 3IEUA 4J4BA 2IXAA 3CO0S 2YIMA 2PA3A 3BL8A 4GGOA 1YNOA 2QX7A 2DHQA 3SJ7A 3BGWA 3LKZA 3UMFA 1PR4A 4MRNA 1J24A 3VNUA 2C07A 3OQPA 3KXDA 1NATA 1W4LA 3BWVA 4Q9NA 4DNPA 3DHNA 3I9JA 5F5NA 5KIAA 4DJEC 4BNVA 1G38A 1FX1A 4XWWA 4NYMQ 3HJUA 4ZCIA 3SDSA 2F64A 4Q9JA 3GVPA 3M9XA 2M6LA 2HSZA 2R6AA 1YK0A 1BS9A 3N2YA 4GP7A 5BWCA 4PYQA 4MB0A 4OBBA 4OPMA 3HHPA 1UMDA 1Y1RA 4B7ZA 3QENA 4PBRA 2AJBA 4OSPA 4AUMA 3ZK9A 2BCJQ 4UQOA 1A8SA 3T52A 1U4OA 1U5BA 1NR5A 3Q87B