1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylyltransferase thiF
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
3V8BA 1DLIA 1PSDA 1U2DA 3ZV6A 2GLXA 3LLSA 5G4KB 1NHWA 3WTCA 1DJNA 3ROKA 4I5DA 2HLPA 1BDBA 4J9VA 4FW8A 4Y6RA 5H81A 4A27A 2OXIA 2OHXA 3GN1A 1HE2A 1ARZA 1U3TA 3WSWA 4EYEA 1Q1NA 1RKXA 1C3VA 3SJUA 1F8GA 1MFZA 1Y7TA 3QA9A 4RQTA 1YO6A 1YQGA 5HS6A 4RF5A 4I5FA 3MZ0A 5A9TA 1B2LA 4J9UE 1DOHA 2YQ4A 3RUIA 2Y1EA 4K26A 4NFSA 4QT0A 4DPMA 4F46A 5F5NA 2W2LA 3E9QA 1PQPA 4J43A 4B79A 2E49A 2JKVA 2YFHA 2BGMA 5H83A 3TWOA 3WYBA 1T2CA 1P45A 4NIMA 2O48X 2Z1MA 4GX5A 4XRRA 3C1OA 2O3JA 2E37A 3DBHB 3LZ6A 2AMFA 3TFOA 4WJZA 3RCBA 3KVOA 2X8LA 2W4QA 3OBBA 2VUSA 3KEOA 4W9NC 1E77A 3GVXA 4CR6A 5JYEA 4EZBA 2QW8A 1XEAA 3C1AA 3E6AA 3G1UA 2J6IA 3RASA 1QLHA 4ALNA 1TEHA 4OHUA 1U2GA 4AJ1A 3GZNA 3NT5A 4P4NA 4ZHSA 3UH1A 2BFOA 3VPHA 1IY8A 1IHYA 3JCZA 4IPTA 2B36A 3NT2A 3HWRA 1GDHA 3RIHA 4FCCA 5CDYA 1WMAA 4NK4A 5KJFA 3QLJA 4B8WA 4FFLA 1JKIA 4LISA 4TQGA 1XQ1A 2V6MA 1PJQA 3JQFA 1PS0A 2Y67A 3COSA 5JDIA 1RPNA 1BXZA 1FDSA 2RH4A 2VRCA 1GEEA 5KVCA 1YH3A 4IZIA 2IZ0A 1N7HA 3NGXA 2PKRA 1PS8A 4QFCA 5GMOA 4R69A 4Z3DA 4EEZA 4WKGA 1B15A 1A7AA 4NU5A 5TF4A 1HETA 2QRLA 3ZHBA 4IIUA 3NAQA 4IXWA 5A04A 2ZB7A 2PGLA 3AFMA 1T2FA 2V6FA 4W7HA 2EGGA 1ZBQA 4A10A 4I9NA 1GTMA 1U28A 4CUKA 2AEJA 3BMNA 3RUAA 1FDTA 3OIGA 2B4QA 2WEKA 3F5QA 3BHJA 2I6TA 2HDHA 4ZA2A 4WCDA 4TMFA 1EDZA 5KVSA 4KUGA 3C7CB 2GZ3A 1OMOA 4ND5A 4BO7A 2WMDA 3U62A 1PGPA 4YXFA 1R4MA 4YRAA 2QIOA 4CL3A 5AXAA 4RDHA 1XIVA 4L8VA 2X6TA 3DZKA 4CQLB 4IIVA 2VTDA 2XXJA 1BW9A 2HK9A 3UICA 4BNTA 4CM8B 4IQGA 1N92A 1NPTO 2WM3A 4YVFA 2J5QA 3TZHA 3S2EA 4CQMA 4KMSA 3D5QA 2FWMX 5KJ1A 3RWBA 3PJGA 4RVFA 1T25A 5C7IO 1B7GO 2P5YA 1NAIA 4QO7A 1I8TA 4TKMA 3FTPA 1N8KA 3PJDA 2WE8A 1D8AA 1SC6A 3JQ8B 4J7CA 1P9LA 1JQBA 1SB9A 3WGIA 2A35A 4NK5A 4DUPA 2D5AA 3QV1A 1E7YA 4YDRA 3UN1A 3QIVA 4K9DA 2X58A 3P2YA 1VJ0A 3H2SA 4IS2A 1MA0A 2XF8A 5JYDA 3Q2IA 3K96A 3JD0A 3GNQA 2DQ4A 3OECA 4RF4A 1ZK2A 1HZJA 1ZVMA 7ADHA 1EUZA 4IUYA 2BRUA 1K6XA 1HDCA 3CMMA 4OXNA 2DFDA 3IAHA 2EF1A 4RLSA 2C5EA 1U7TA 4B3HA 3AM5A 3FWNA 4MO2A 1KEVA 2YY7A 1AGNA 1R12A 2QG4A 4NH4A 1S6YA 2FR8A 4NHEA 5LC1A 1LC0A 1KY5A 1SBYA 4CV1A 5A3JA 3DAPA 2PV7A 3PYMA 3I23A 1SO8A 4CM9A 1Z82A 3ONEA 4DVJA 1YB4A 4NQZA 4W7IA 1I2ZA 6LDHA 5AQ1A 2ZB8A 3CSDA 1YBVA 4RF3A 5ICMA 5DF1A 3QVWA 3KEQA 1VL8A 3D4OA 3I4FA 3AY7A 4EJMA 1YDEA 3F4LA 5DOVA 2Q1UA 1I36A 4XGKA 1NX6A 2CY0A 3DBRB 1N9GA 1OC2A 1PS9A 3C1TA 1XKQA 1HE4A 5ER9A 2JD2A 4RGBA 1E0DA 3GT0A 5HA5A 5JO9A 5JDCC 1U3UA 3KYDB 5CEJA 3U4HA 3FWZA 5DULA 5I7SA 4NFYA 1B8UA 3JQ6A 3GRKA 1HKUA 2B35A 4IJUA 1C0IA 1PIWA 1LLUA 1O8CA 3NV9A 2W2KB 3WTBA 4J1SA 4AJHA 1IOLA 3LQFA 1GQYA 1KEUA 3V2GA 1CDOA 1CQIA 2PH5A 1UXKA 1GYPA 2J8ZA 1HLPA 3PPIA 1SAYA 3HDYA 2FOIA 3B20A 1F8FA 1PQWA 4Q39A 3H8VA 1D3AA 1MX3A 2YFQA 3FCOA 1U5AA 2X9GA 4ZN6A 2VHYA 2J3JA 3DHEA 2HO5A 3ITDA 4YQZA 3WGZA 4PG5A 4ZRMA 3I9MA 2E4AA 2PK3A 4ZQEA 4BB5A 3WGGA 3BA1A 1EQUA 3MJVA 5TRTA 5EN4A 3ZNPA 3VOSA 4PZDA 3OETA 4TRRA 4D46A 3E8XA 4YAJA 3FI9A 4DL9A 4KOAA 3OHSX 4CMAA 1EK5A 1ZO8A 3L6OO 2V6GA 2Q4BA 3U9LA 5EPOA 3VH2A 3WX0A 4DMLA 4PLPA 4DIBA 4FC6A 3BYZA 1JWAB 3NRCA 3BTUA 2O2YA 4UVHA 5L51A 1WZEA 5JPIA 3DZGA 1YKFA 1FXSA 3DDNA 5TT1A 3ZNNA 3AU9A 3WGYA 1UP6A 5T67A 5CPFA 4MVJI 1I33A 1ZFNA 3RUEA 5FF9A 2CSUA 1MXHA 3G17A 1MXFA 4FD3A 4RPJA 4DBZA 4Q3NA 4AVYA 2CVOA 3KLMX 4CM6A 4TVOA 1WLYA 1ZUD1 3INGA 1JKFA 1OFGA 1KVTA 2CF5A 1E7QA 3GC6A 3OICA 1DLJA 4MINA 2F00A 3F4BA 1WP4A 4RPGA 4NI5A 3FR7A 4U0JA 4BGIA 3MJ4A 3GNTA 3C85A 3JQBA 4FB5A 2ZB3A 1PGJA 4Z6KA 3JYPA 4J6FA 1P1JA 1EVIA 4WCFA 3GDGA 3W8DA 1HDXA 1U5CA 3QE3A 4OJNA 3KTDA 5DN9A 2VNAA 2ZTLA 1YONA 3UCXA 4YPOA 3H3JA 4DLBA 3I9LA 3IOYA 4O1MA 4D42A 3GMSA 3KXDA 4M54A 1PGQA 2OZPA 3I6QA 1W4ZA 3FR8A 3D7LA 3DO5A 4BUCA 5MDHA 4UREA 1RM0A 2O4UX 4E5YA 1GAEO 1P44A 3JQEA 1A4IA 3VTZA 5IJZA 3GK3A 3BMOB 1M66A 2I76A 3MJTA 4WEOA 1KC1A 2Q2QA 2NVUB 5T8KC 4G5HA 1QG6A 3WR5A 2GPTA 3E5MA 3AUUA 4CLXA 2VUUA 4UUOA 3JQAD 4BNUA 1DJQA 1R15A 2CZCA 4R3NA 3M2PA 5ITVA 1MG0A 2G76A 3UVEA 2DT5A 3JQAB 1ENYA 2GN4A 2W98A 2ZK7A 1E5QA 4N5NA 1X14A 2Y93A 5U1PA 3S8MA 2YV2A 5BSFA 3HFSA 2I66A 1HYGA 4EGFA 4CM9D 1CEQA 1E3LA 3K8ZA 3FNEA 2DPGA 2H1SA 4BO3A 3ROMA 2FR1A 4BNFA 4BO0A 1T1RA 3T4EA 4UEKA 5KJEA 3DXFA 4Z9XA 3EZYA 3QVSA 4FBGA 3UUWA 3A14A 2RH8A 2Q50A 3PFFA 5I7EA 1HXHA 2OOSA 3W4KA 3ZU5A 3GY0A 4AG3A 2X9VA 3P2OA 1F12A 1LDGA 2IZZA 4Q3DA 1BXKA 5H82A 2Q1WA 2GRAA 4LRTB 3WIDA 5LDGA 1NPDA 3ZW9A 1A9YA 5KJ6A 3GUYA 2RIRA 2EIHA 1UXGA 3D5TA 1Q7GA 3JSAA 5IXSA 5L53A 1C0PA 1Y81A 3DOJA 1P31A 3WYEA 5U9CA 4XQ9A 4GWKA 3W6ZA 1Y5MA 3NDIA 2PKQO 4YJHB 1KBZA 5L45A 2ZJ1A 4I9UA 1NAHA 1P74A 4JQCA 3FBTA 4PLZA 4G81A 1Y9EA 4M49A 3ZHZA 4LSMA 3L9XA 4DC0A 3U0BA 3Q1LA 1L7EA 1CIVA 3DMTC 3ENNA 4D79A 4MVJP 3RC1A 3QSGA 3H9GA 3S2IA 1ZK0A 4YYZA 3VZQA 5L95A 1A9ZA 3ON5A 4ESOA 5TSDA 1PEDA 3TZ6A 5L4LA 1TT5A 1ZW1A 1NHGA 4ALIA 1E1MA 1X7DA 1XGKA 3RSHA 4CODB 1G0NA 1E3SA 3H2ZA 1HL3A 4U6SA 1JAXA 3W1VA 3LC2O 2X9NA 1YS4A 4AJOA 4U8GA 1OOEA 4HBGA 1H9BA 3JQDA 1PZGA 4QFDA 1E1NA 1GQ2A 4FJ0A 1M67A 3BXXA 2YDYA 1P1RA 2V65A 2NUAA 4EUFA 3LK7A 1M6WA 4PN3A 1I01A 2C2YA 1PU2A 4B4WA 5B12A 3JQCA 4BNGA 5I8WA 1E1LA 1SZJG 3O03A 4ROSA 3D3WA 3IQDB 4XGIA 2GNAA 3F6YA 2D1YA 3ONFA 3SVTA 3IC5A 2Y1CA 4RPLA 3D4NA 2BFMA 1LUAA 3ZHXA 2FHSA 5C37A 5KCZA 1EVYA 2GCGA 3KYBA 3LT4A 1PJLA 2IEBA 1R4NA 4FN4A 4MOWA 4XJSA 2VYNA 3N7UA 2NACA 4FGSA 4J49A 1CETA 2EJVA 3OF2A 3W4JA 2OMEA 1KIFA 5A1TA 3GVHA 2B69A 2AW5A 3RQSA 4GVLA 2O3UA 1PL7A 3JQGB 1LSUA 1H2HA 4YJDA 3RJ5A 1IPEA 1NVGA 1O9BA 1E3WA 5CAEA 4L4XA 2ZKLA 2PD6A 1XLTA 1YB1A 4CJXA 2Y0EA 2GYYA 1PJ3A 4XA8A 4CLHA 5TGDA 1Q2XA 4AJIA 2X0IA 3JTMA 3SX2A 4J16A 4AJLA 4WGGA 1R0KA 2NQ8A 4R1SA 3I3OA 4L76A 4MKRA 4E2YA 4BMVA 3KSZO 2I5PO 1BDMA 2HJSA 2EERA 1VJTA 4ITUA 4OMUA 2IDZA 4BHTA 2YHIA 4ONEA 1F17A 5DP1A 4F3YA 3F3SA 2V6BA 7MDHA 4YJGA 2Q45A 4LCEA 4O59O 5L4SA 4PCVA 4BOYA 1MUUA 4GMFA 4AJNA 4DLLA 2PR2A 3OJOA 4XYLA 3WMXA 2BH9A 3K73O 3TN7A 1EQ2A 2WJPA 3ANNA 1O0SA 2OO5A 4YJFA 4CM5A 3BHIA 3O4RA 3GG2A 3P7MA 2ZYGA 3AUAA 1B16A 1LRLA 3A28A 3MTJA 1K5HA 6ADHA 4R54A 3QW2A 4JROA 5BSGA 4RQUA 5FI5A 4R1NA 2NVBA 4OL9A 4BQRA 4E5PA 2RAFA 4RDIA 4CQMB 5T5QA 4CMCA 1PL8A 3JYLA 2Q1SA 3VKVA 5F3RA 4BNYA 3F46A 1IZ9A 4OSOA 4KQXA 3BTVA 5GY7A 3V1TC 3DWFA 1ISJA 4N5MA 2WD8A 4P8RA 2NLOA 2GF2A 1KEPA 4BNZA 1N5DA 4II2A 4YACA 3WGTA 3TZCA 3ZI0A 1LRJA 2WD7A 4PG8A 1NR1A 3E82A 2JFGA 4LSWA 3AY6A 1K0UA 2OBYA 3WYCA 2BKAA 3ZWVA 4YJFB 3RBZA 4E4YA 2ZCUA 1ENOA 3DZHA 4JP2A 1NFFA 2BF7A 4DREA 3DC2A 4BIIA 4E2XA 1I5RA 4XR4A 3DBLB 4ZQBA 1EMDA 2D5CA 3B1JA 1GZ3A 1NBOA 3E5RA 4ALKA 2GR9A 3AFNA 1UP7A 3HE3A 1N1GA 4OM8A 3VC7A 3F1KA 1E5LA 3JV7A 5ER6A 1MG5A 3I6IA 3RBXA 1Q0HA 3ETEA 1R0LA 1NQOA 3U4DA 2NU7A 1FMCA 1QKIA 3VZPA 1VSVA 4CQMD 1WMBA 1QYCA 4LCJA 1U8XX 3UW3A 1BXGB 1RJWA 3GNSA 3HADA 3JQBC 1N9GB 2A9FA 3DZBA 3EK2A 2DLDA 3NEPX 1BWSA 1E6EA 3KUXA 1EBUA 1AE1A 4J4BA 3BMNB 2P4HX 1JAYA 2HUNA 3LSYA 1V9LA 1I32A 5K9ZA 2VWQA 4ZVVA 1NVTA 2EG9A 3H65A 3I4CA 4I08A 4OH1A 3ZV4A 4IDAA 1LSOA 2AEFA 4I5GA 1NQTA 5CDGA 1A4UA 2OL4A 3I52A 4FQ8A 4FOSA 1O94A 3NTQA 4KP7A 4XYGA 2Y1GA 3CZRA 3WGHA 5JCJD 3DMTA 4BQPA 4CM4B 3IJPA 5ENDA 1DIBA 3O26A 2FSSA 5COBA 1DC6A 1ZSNA 1UH5A 2LDBA 3ORFA 3PP8A 1VRWA 5JW6A 1P1HA 2VCYA 4C4OA 2P91A 1CRWG 1NFQA 1LQUA 3BMCA 1I2BA 4TROA 3ETDA 3WB9A 2YHIB 5TNXA 3RC9A 1BMDA 2X5KO 3UCEA 1JVSA 4L0QA 2OBNA 2QYSA 4OAQA 1OC4A 2O7QA 4AL4A 2Y0DA 4K1LA 2CDCA 1EVZA 3VPGA 1LC3A 3WDSA 4XIJA 4M89A 4RLHA 4MVJG 2C82A 2NU8A 1AHHA 5FI3A 5JCXA 1W6UA 2BMAA 3ZN2A 4BNXA 3MCVA 3FN4A 4OQZA 5EMHA 4JCOA 2FN7A 4XRGA 4MVJF 4HFMA 4YB8A 4NDNE 1MV8A 1DEHA 2EXXA 3KRTA 5A3VA 4K6CA 4IMPA 1E7WA 3WMWA 4WNIA 1H0KA 4DTIA 1QRRA 3E1KA 4ND1A 3WJ7A 3H9QA 1UXJA 4CMIB 1QYVA 2O7SA 4EW6A 2DFVA 4A26A 2FMUA 1M2WA 4CLEA 5HBRA 3ZNQA 4M1QA 4BKUA 5CPBA 2VHXA 3NTRA 3KHUA 1LA2A 2BD0A 4L75A 1WW8A 1NWHA 1YGYA 3HG7A 1ZNQO 3LF1A 4PFJA 1K2WA 2W2LD 3GGGA 4RVGA 4KDEA 4CL8A 3HJAA 5DBGA 3CEAA 4QECA 3ULKA 4YJGB 4BKOA 2BGLA 5JDIC 5DNAA 4CUJA 2G1UA 3JQ8A 2B83A 4Q3CA 5BR7A 3SLGA 2Y68A 4OSPA 2PY6A 3G49A 4D43A 3OQ6A 1DC4A 1XU7A 5AXCA 2YJZA 4CMGA 2EGHA 4MP3A 4PGFA 1GCOA 1D4FA 1PZHA 1TI7A 2X23A 3C8MA 5GZ1A 5DP2A 2QHXA 4JP3A 1KOLA 3VDRA 3C3XA 3GZNB 5BQFA 3ZWYA 4NBUA 4E31A 1U1IA 2UYYA 3KSDO 4J7UA 3FD8A 1JW9B 5B4TA 1N1EA 5DOZA 2DKNA 2E6UX 2HKIA 1YE3A 4DMMA 2G17A 5L7YA 4CQLA 4A2CA 4JJGA 4MDHA 5CDUA 3QVOA 1XWFA 2X5OA 5KVQA 1I3MA 4MP8A 4N5LA 2B4TO 2C20A 2FPIA 4TRMA 2PD4A 3TZQA 1W8DA 3GGOA 1DC5A 4P4GA 4RV9A 4R1TA 2PGDA 4CR7A 4ND2A 3TSCA 5JMWA 3U09A 3STHA 1X13A 5JXWA 1Y1PA 3PVZA 4CMIA 4DQXA 3IIEA 1GR0A 4DC1A 1F0YA 3OP4A 1IUKA 1DRWA 5B1YA 4CV2A 4R16A 4DYVA 4GX0A 3CMCO 3DR3A 5IZCC 1WWKA 2UVDA 2JL1A 1NWCA 2LDXA 1ML3A 2QQ5A 4DRYA 4JK3A 2CF6A 5TJ9A 3ANMA 3T7EA 3HDHA 4FFPA 2E48A 1H2BA 4FFNA 1T24A 4UVEA 1I30A 3I9NA 5DDIP 5CG1A 3K2EA 3MJSA 1PJ2A 3OH8A 4RVDA 3UKOA 1UAGA 3EUWA 4GAEA 3ZHYA 3WGQA 4YQYA 2UDPA 1GCUA 2GASA 2YW9A 3KOUA 4OOFA 1UDBA 2ZB4A 4HKTA 5JMPA 2IEDA 1PQUA 2YYYA 1PGOA 1T26A 2ZCVA 2VYVD 3WGOA 5KNLA 4II3A 4BO4A 4L73A 2I65A 1N2SA 3B6ZA 2JCYA 1C1DB 3VDQA 2NVWA 1IULA 2VZ8A 4TKLA 1DXYA 4YCAA 1C0LA 1VM6A 1LJ8A 4GMGA 3ITKA 3G0OA 5EERA 2BHLA 5BT9A 4BO9A 1HEUA 4LK3A 3HN7A 2E82A 1SPXA 1LDBA 2G82A 2FZEA 4NBRA 2JAPA 4BMNA 1YL7A 2OP0A 2GUGA 3PLRA 1IYZA 3NJ8A 5ES3A 5L7TA 3JQ7B 4L4SA 4BKRA 1J5PA 3JQ9C 1M6HA 4OGWA 4ZRNA 1ZXLA 2ILTA 3M1AA 3GPIA 4WUVA 5K0ZA 3RU9A 4J7XA 5C7OO 4M87A 4D45A 3U49A 1WZIA 4W82A 1O89A 2ZIZA 4A03A 1LXCA 1I3KA 1C1DA 1B3RA 4MVJA 1ISHA 5L40A 4KUEA 5A9RA 4A5OA 5A9SB 3E18A 9LDBA 3ZWXA 2P9GA 1F14A 2C59A 3JYOA 1EUCA 2Y66A 1HDGO 1PWXA 5K6AA 4H16A 1H6CA 4CV3A 1YDWA 5AXBA 1U7HA 1NR7A 4CM3A 4PLVA 3DZIA 4M8SA 2AG5A 2Y1OA 1LLCA 1PX0A 1H6AA 3RBVA 4FJ2A 3RC2A 4U7WA 5KKAA 4MP6A 1Z7EA 4DQVA 2VOJA 2AEMA 5DBFA 3PHIA 4RPKA 4BNMA 5COAA 4GWGA 1DHTA 4O0LA 3ZCXA 1YVEI 3GAZA 4HNGA 4XYBA 4PLGA 3LLVA 2RHCA 4GVXA 2QZZA 5IDQA 1JLLA 1ZK1A 3GAFA 5F1KA 1GUYA 1ADBA 1ORRA 4IY1A 3OQBA 2Y99A 3OA2A 2O3SA 3BAZA 2AQKA 1YOVB 3EVTA 4XYMA 1EFLA 4PG6A 1DBVO 4B4OA 3ASVA 3OJ0A 1JTVA 1U4OA 4PG4A 2OP1A 1X7HA 3AOGA 5IDYA 4DWVA 2DTDA 5ILGA 1DIGA 3IKTA 3EY4A 3INRA 3JYQA 4GLLA 4KWIA 2YQ5A 4PIVA 4AICA 3HUDA 2ZQYA 1GEGA 4GSKA 3ZDFA 3QVXA 2P5UA 1K6JA 1H6BA 1HSZA 2PH3A 2PZKA 3S2GA 1CF2O 2HMTA 5COQA 3A06A 3EW7A 1KVSA 2HSDA 2X22A 2PLAA 3TOZA 2B4RO 3L6DA 2HMSA 1LDEA 3CIFA 1GQQA 1SNYA 1IE3A 1T1SA 2WSBA 3IJRA 4LGVA 3P5SA 3VHRA 3WWYA 4BMSA 5A9SA 3SXPA 1Y8QB 2VWHA 3ZWNA 1U4SA 1LNQA 4HWKA 1NQ5A 4BO1A 3RD5A 4PLTA 3WBFA 4BV8A 5CEEA 1DFGA 3ZWMA 4NBWA 4ZD6A 2I67A 2WE7A 3SLKA 4E5KA 4W99A 1WVGA 5KJCA 5KWEA 1Z6ZA 3L4BC 3I1JA 3FF4A 4O6VA 1QORA 3PWKA 2EV9A 2TMGA 3WG9A 3FPCA 4HNHA 2W90A 3KM0A 2FY8A 2VN8A 2NSDA 1XHLA 1O95A 1UP4A 3JQAA 2FSVA 3O38A 4S3MA 1L1FA 2OGUA 1CQJA 3IP1A 3R3SA 4ID9A 4U0KA 3D0OA 1BG6A 1E1KA 1EUDA 1JU9A 1P0FA 2P4QA 3PTZA 4B3JA 3GEGA 3ZU3A 1Y9AA 3HB5X 4CLRA 1PGNA 2H9IA 5AXDA 4UAGA 4BKPA 1A72A 1F06A 1HWYA 1SOWA 1WDKA 2YZ7A 3GN2A 3RU7A 2O3RA 1TVEA 1H9AA 1NFRA 4BNKA 1SOVA 4TVBA 4Q3AA 5JSFA 3RJ9A 1NP3A 4XQGA 1BHSA 4HUJA 4UVDA 2FRDA 3F9IA 2AXQA 4QQRA 1BXGA 1LQTA 2P9CA 3L07A 3SC6A 3OM9A 2HMWA 2OFPA 3KSUA 3INTA 4D0SA 4MIOA 1E3IA 4IXTA 4IJKA 1YJQA 1KERA 5F21A 5FYDA 3VVBA 4GI2A 4ZJUA 3GHHA 4CV0A 4YT4A 4B7XA 3PJFA 4YWJA 3TJRA 1NYTA 1B14A 2RHRA 4RL6A 2I3AA 3PIIA 3X2FA 3H3FA 4I9HA 4FS3A 4PVDA 4X54A 4PLYA 4B3IA 5JC8A 2CMDA 5DCYA 2F1KA 2PZMA 1ID1A 1MB4A 2IE0A 3AU8A 4Z0HO 2AQ8A 1J4AA 1FF9A 1NPYA 1YQDA 1YBMA 2C07A 1P1KA 1J6UA 1HF3A 3VPSA 4NU6A 1UZMA 1UDAA 5JAZA 1DAOA 1U3VA 3AI1A 5JAQA 2J5KA 2QYTA 3E9NA 3NYWA 4P38A 3X2EA 3R3JA 3H5NA 3O8QA 3PGXA 4CMHA 5KOIA 4M86A 4B7CA 5L4NA 2Q4EA 4QEDA 4AFNA 2GERA 3GLQA 4I1IA 3UGKA 1VLLA 4Y6SA 4BNNA 1D1TA 4CMEC 3EVNA 2Q1TA 3JD2A 2FR0A 4J2HA 4NR0A 5JNLA 4L9RA 1M75A 5KKCA 5KVVA 1E3WB 3AUTA 3H9JA 5G0TA 4YT8A 1A5ZA 3VPXA 2AQHA 5T64A 5T57A 3PQFA 2IXBA 1O6ZA 4G2NA 4L4RA 4WLVA 2HQ1A 5G0SA 5FEUA 4XR9A 4OXYA 4GGPA 4OYRA 1YB5A 1HYHA 4LMRA 1V3VA 3GOHA 1YXMA 5TT0A 3M2TA 3O8QB 3S2FA 3TFQA 3AI3A 1XSEA 5U4QA 3ETGA 1LDYA 3AWDA 3B1KA 4U6QA 3I9KA 1E3EA 1Z45A 3DOOA 4EEXA 1GV0A 2CDAA 3GFGA 2Y05A 5BSEA 3HDQA 4O5OA 3AY3A 3Q9UA 1C1XB 1SEVA 3KBOA 4BNVA 2O4CA 3AOEA 2CVZA 2YDXA 3L77A 3ZWCA 3MOIA 1PJTA 1ZJZA 1IZ0A 4CLOA 4JBHA 3KO8A 1NVMB 1R6DA 2AA3A 4F6CA 3PHLA 3FNFA 3RUFA 3QY9A 4MVJM 3FBGA 2VHWA 1ZEJA 3OEYA 2NWQA 1BVRA 3KETA 2D2IA 2DTEA 3NDJA 4EI2A 1IL0A 2VYND 1ADCA 2DVMA 2JFFA 2UUPA 4Z0PA 3MWDB 4R9RA 1Y5RA 5JY6A 4WLEA 2X0NA 5JFOA 4MKXA 1RM4A 2Q2WA 4IBOA 4BGEA 1D7OA 1ULUA 1JA9A 1G1AA 3QJ5A 4RO0A 4EUHA 3W4IA 1VPDA 5T6BA 2OORA 2FPGA 3KYCB 3H5AA 3BMQA 1I10A 2NVUA 3E48A 4NBVA 1AXEA 2AE2A 5F1PA 4D3DA 1Z7BA 4QUKA 4PRLA 5ICSA 3LT1A 4HFNA 4CPDA 5IAAA 1E3JA 3DBHA 4AJJA 3CUKA 3ICCA 1PJ4A 1GV1A 2XPCA 5G2OA 2G0TA 2PD3A 4R41A 1R66A 4YBZA 1LEHA 2UAGA 2VWPA 1OZAA 1T2AA 3PHJA 4DQUA 4HY3A 3RUHA 3WLFA 4UVIA 2J3KA 3DEYX 3JD3A 1CYDA 2ZTVA 3GZ4A 2NU6A 4KZPA 3VPFA 3HSKA 3DBVO 3IUPA 5EL0A 4LW8A 3S55A 1E6UA 5EQDA 2NADA 2EW2A 4DPLA 2UUOA 3OQ1A 3PQDA 2GN8A 2PWZA 4RVSA 1HT0A 1PL6A 2YV3A 4WOKA 1EZ4A 4AJEA 2FZWA 2WTBA 2NQTA 4R3WA 3PDUA 3ROQA 4ALLA 3DBRA 2V7PA 4QSMA 5HWSA 3CPSA 1H5QA 4Y8VA 4J4TA 4PLCA 4IQ0A 4B4UA 3BTOA 3K30A 3WBBA 2ZJ0A 3VH3A 3GUCA 2QX7A 3WLEA 3WNVA 4XKJA 2VRCD 2PFGA 2XXBA 3GVCA 3RVDA 4A7PA 4W6ZA 3UF0A 5EINA 3VTFA 1ZK3A 3L6EA 3GRPA 3GFBA 1YL5A 4ALJA 1UAYA 4KDFA 4RJTA 5DBIA 3BMOA 3LT2A 1DRUA 1R0SA 2ZATA 5A02A 5F1OA 2AG8A 2ZYDA 3CKYA 3OA0A 4IJVA 4UVGA 5J23A 3QWAA 3HQ4O 4NFHA 4BO2A 4Z3KA 1RM5A 1ZMTA 4B4VA 3ZGYA 1ZSVA 4KUHA 3C24A 1I3NA 4XIYA 2CFCA 1V6AA 4R5HA 4NPCA 2GN6A 2J5RA 2HMVA 2QRJA 4PG7A 3V1UA 1FK8A 2W8ZA 4XD2A 2DUWA 4FGWA 2ZQZA 4IS3A 5FWNA 3CH6A 1GYRA 3GDOA 1QR6A 1UXHA 3IS3A 2YV1A 4NJMB 4R01A 1FDUA 4E21A 4AJKA 2O50A 4JBGA 3H9EO 4YR9A 1CERA 4J1NA 2DUUA 4OXKA 1PJCA 2JCVA 4CM1A 2DBVO 2QZ9A 4PLFA 1C1XA 1P1IA 3D3WB 5KIAA 4WCFC 4GPD1 4DIFA 1HDOA 3C7DB 1S7CA 3M1LA 3DBLA 3Q9NA 2FP4A 2EKLA 3PYLA 5AOVA 5HTOA 3NKLA 5L3ZA 1V35A 4IDDA 4YAEA 3ST7A 4OOEA 5I7VA 1LRKA 5G0UA 3ADOA 1U3WA 3LC1O 2CDBA 2P2SA 5DCWA 3GDFA 4KTVE 4YEDA 4F6LA 3UHAA 2C7VA 3PK0A 3DHNA 4CM4A 2GN9A 1NXQA 3I83A 1GZ4A 4FSHA 4JBIA 2B37A 3IMFA 3WQRA 3EDMA 4DXHA 3ZZNA 1H93A 1LLQA 2JHGA 3PRJA 3S1LA 5A5EA 3L0DA 4XEHA 3UFXA 3BHMA 4BNIA 5EESA 1VL0A 4IDEA 4IDBA 1OI7A 3Q6IA 1BRMA 3HN2A 4GLOA 3WOHA 3MTGA 2D0IA 4WPGA 2HK7A 1UJMA 3CXRA 1GUZA 1X1TA 4Y6PA 2PGJA 1LTHR 1QV7A 1WXDA 4IDGA 5BNIA 4EDFA 2PNFA 3EC7A 3RKUA 4ZGWA 4GL4A 4MIYA 3R6DA 3T7CA 5JCJA 3T4XA 3QVTA 1DSSG 1XU9A 4BV9A 4J4HA 2EWMA 4I5EA 4B7UA 4E12A 1X7GA 1PJSA 2C7GA 1MP0A 4YAIA 1V3TA 2R00A 4YRDA 4XB1A 3PIDA 5G4LA 2D59A 3NUGA 4GKVA 4N18A 4ZQFA 4H7PA 5IDWA 1DFIA 5JBIA 4TRNA 2TMDA 1VKNA 2DAPA 3TL3A 5IDXA 1SB8A 1B26A 3OJEA 4NNJA 3HFGA 3K6JA 3CINA 3Q11A 2NM0A 3ZU4A 4CMBA 5THKA 3K9QO 3WWZA 1GU7A 1A7KA 4M55A 1HE5A 4TZKA 4FR5A 1B8VA 1E7RA 4PZEA 4XWYA 4H15A 4R4JA 5I8ZA 4D0RA 4UULA 1XYGA 1JN0A 3DQPA 1ZCJA 1T4BA 3JQGA 4KQWA 3A9WA 1LI4A 4IINA 3KZVA 1EK6A 4DLAA 3RFTA 5EQFA 3D1LA 1PZFA 2BFAA 3DFZA 1HE3A 5JLAA 4GX2A 3A4VA 4JLWA 2VZ9A 4Q3EA 3AM3A 1LX6A 1PJBA 2CVQA 2VRBA 2O3QA 3FPLA 5BNFA 5IN4A 1ADFA 2J3HA 1YJ8A 3NX4A 2Q99A 1V8BA 3I5MA 3P19A 3E9MA 3AJRA 1LSJA 1VSUA 3DAFA 3H7AA 4HX5A 3UXYA 3ZWAA 4C7KA 4D44A 5JS6A 5LDHA 1GFSA 3VH1A 5CP8A 5A05A 1UR5A 4H3VA 4DA9A 4J3FA 5A4DA 2YHUA 4Y67A 5IG2A 5B4UA 2IYPA 4J91A 4R51A 4UUPA 1T2EA 4YT5A 1Y8RB 3PHHA 2D8AA 4E0BA 1KEWA 3RROA 4ND4A 2GGSA 4WECA 3ZV5A 2IXAA 3CTMA 5CFZA 2BFPA 3DB2A 2NTVA 4U5QA 3AI2A 5AVOA 5CDTA 3GEDA 2C0CA 4RVHA 3DZFA 5I9LA 1YWGO 5G4KA 3V2HA 2R6JA 4IGEA 4RPHA 3IKVA 3N58A 5ADHA 2ZTUA 3OEWA 2CD9A 1L7DA 1ADGA 1VJ1A 3KLPX 4ZQGA 1FDWA 4WLFA 3DFUA 2ZTMA 3ZH2A 3TL2A 4QO8A 1GYQA 2PTGA 3PZRA 3Q0EA 4R5MA 1V0JA 1ISIA 3GGPA 1DRVA 4D3FA 3SC4A 3JQ7A 3PWSA 4XJTA 1EFKA 2VUTA 5ITWA 3EAGA 3EZLA 4HADA 1DFHA 3MJEA 3GVIA 1XA0A 1Y6JA 1YL6A 2EP5A 1DIRA 3GR6A 4DIOA 3AUSA 4RF2A 3HDJA 2Y0CA 3RAJA 4GGOA 4GBJA 4RZIA 1HRDA 3WS7A 2P68A 5AYVA 1ZEMA 4DBVO 5TLSA 1B0AA 3GQVA 2R00C 2WDZA 3ZW8A 3BZUA 2JHFA 2NNLD 3ASUA 3DTTA 3RI3A 1DIHA 5C7LO 3F1LA 3ZNOA 4IGFA 4E32A 3R1IA 3WICA 3ANLA 1DDOA 1MFPA 1QSGA 4Y98A 3DTYA 3G79A 3WFJA 1HDZA 3IL2A 1GY8A 3PEFA 4BO5A 1JWBB 2EP7A 1QMGA 4CLDA 1KVUA 1QYXA 4MVJH 4WOJA 4WCFB 1O5IA 1ISGA 3R0IA 2H6EA 1JVBA 4E2ZA 1TB4A 1WPQA 1XDWA 4IDFA 4AJ4A 2X7HA 2DC1A 4GX1A 4Q9NA 3NTOA 4TRJA 3ZWPA 2HU2A 4CM8A 1LSSA 4IMRA 4XB2A 3QRWA 4GKBA 3PWZA 2AQIA 2DPHA 2EEZA 3LF2A 1P33A 4E30A 3GMDA 4BO8A 1VL6A 3LC7O 4AJ2A 3GPDG 2IRWA 2NU9A 4LVUA 2AHRA 4CM7A 4MPDA 5C5IA 1DIAA 1RYDA 2A4KA 3W8FA 2A92A 4W4TA 4N54A 4TWRA 3H6KA 4XQCA 4N7RA 1OBFO 1E7MA 3K2BA 2RCYA 4BKQA 1Q7BA 1VI2A 5BSHA 1ZIDA 2SCUA 1JDJA 2DBRA 5A03A 1KETA 1C14A 3TZKA 4ZQHA 4FPXA 1ZJYA 1GD1O 2X1HA 2C54A 3U5TA 3ZWWA 3RUCA 5A06A 2PA3A 5ILOA 4FDAA 3PLNA 3FHLA 2VTEA 3CE6A 3QWHA 2FPPA 2DBZA 4FFOA 1G6KA 5TQVA 5CG2A 4J1QA 3ABIA 4D3SA 4KWHA 3D64A 3OFSA 1KVRA 4JN6B 2UV8A 3MOGA 1H94A 3D3EA 2Z95A 4BGUA 4R68A 1K89A 1ZH8A 1RWBA 2DBQA 3FSRA 1B8PA 2O3TA 5TX7A 4BNLA 8ADHA 2GZ2A 3PDJA 3DL2A 5B4VA 2BGKA 1SMKA 1DAPA 3NGLA 1A27A 1ZK4A 4BVAA 2EJWA 3NT4A 1Z74A 3EHEA 4RVUA 4P4LA 1HZZA 5JAMA 3AM4A 3UAGA 3QHAA 4NG5A 4NJMA 1A71A 4JX8A 1QYDA 4WNCA 4OKNA 3K5PA 4LRSB 1LU9A 1X15A 3EGOA 3G3EA 1EE9A 3H9UA 4QX6A 2DU8A 3U3XA 1EBFA 1Q0LA 1NQAO 3SBOA 1J49A 1W0CA 1Z73A 4D7AA 4BGVA 4IDCA 2PZJA 2CUKA 3I9OA 1J0XO 3E03A 4UEJA 1W73A 1FDVA 2WYWA 2HK8A 3B70A 2HRZA 4E33A 2Q46A 4FIZA 2IZ1A 4YT2A 4RZHA 4F45A 1KY4A 4CLRB 4PVCA 1GPJA 1P1FA 5I9NA 4WLUA 1FJHA 5B37A 4FC7A 3DMYA 2B5WA 3Q3CA 1YRLA 4Y9DA 4Z0TA 3ZU2A 1T2DA 2X0JA 2WYUA 1UZLA 4O63O 1DO8A 4JJIA 4K28A 4PLWA 3U4CA 1BSVA 2C2XA 1GZ6A 1K3TA 9LDTA 3GA0A 5ENVA 2VHVA 3K31A 2Z5LA 1PR3A 2C5AA 2JJYA 1WNTA 1ZKMA 3PXXA 3PFWO 4R9SA 4WLOA 2NTJA 4BNHA 3TPCA 4E3ZA 1V3UA 1LBEA 4PRKA 1OAAA 4EUEA 1SEPA 2HAEA 2I3GA 3LU1A 3VH4A 5CEFA 5KTKA 1DHRA 1Z75A 1ONNA 4HP8A 2Y1DA 2H63A 5EJ2A 2YUTA 3ADPA 1ONPA 3ENKA 4JGBA 5IZCA 1M76A 4W9NA 1EEHA 2Q3EA 3U4IA 3B1FA 3MWEB 3WSVA 1AUPA 3G1TA 1WAMA 4MIEA 3GEMA 3GH3A 3KYDA 4A0SA 3H4VA 5F5LA 3TF5A 1EE2A 1ZMOA 4CMJA 1KVQA 3IP3A 4ZICA 1JKJA 1KS9A 1NNUA 3W8EA 4MVJD 1Y8QA 3AOEC 2X5JO 1NTOA 1LDMA 1IB6A 1QYWA 4HV4A 3KB6A 4J0EA 2Y1FA 4NZ9A 4PZCA 5I9MA 5JY1A 3QP9A 2X86A 4L74A 3RFVA 3AK4A 1I24A 4NMHA 1Q0QA 2P9EA 4IZHA 1X0VA 3LYLA 3CZMA 2AE1A 1GPDG 3TQHA 3F47A 4CR8A 4DPKA 1B3BA 3Q2KA 1I2CA 3VAZA 3OJFA 1E7SA 2XAAA 3JQFC 3I9JA 4K6FA 4JXKA 1R4MB 4BL5A 1HDRA 1QV6A 2GD1O 4YAGA 5G0WA 4JNKA 4LVCA 5JO0A 1CWUA 2VQ3A 1NASA 1X0XA 2EHDA 5JC1A 1VC2A 2J3IA 1HTBA 1WDLA 3O9ZA 4XZ3A 1PTJA 3V2UA 3HB4X 1D1SA 5DT9A 4ALMA 3ZWBA 2ET6A 4A73A 1XQ6A 3PZBA 4GQAA 1CJCA 1VKOA 1DB3A 1H6DA 3ZWOA 2A94A 1MGOA 3FNHA 3WIEA 5TS3A 2Z1NA 3TRIA 2BELA 5K6AC 4CLOB 4Z9YA 2QRKA 4DGSA 3VVCA 5L7WA 2R2GA 4TSKA 3IUSA 1YQXA 4IJWA 3WQQA 2RBEA 3LDHA 4CMKA 2Q2VA 3QWBA 2O23A 3HNPA 1BTOA 1PWZA 2CNBA 3IDSA 4NJOA 4B8ZA 1Q7CA 5FFFA 3DZJA 4E6PA 4INAA 3ROPA 3TNLA 1HYEA 3NJ4A 1ISMA 3WJAA 2IYOA 1ENZA 1GUFA 2X4GA 3VKUA 1ONOA 3W6UA 1C0KA 4EJ0A 4BNWA 5LCXA 3PGJA 1IHXA 2NV6A 2VT3A 1ENPA 5GZ6A 5JE8A 3D4PA 2HCTA 4WEQA 1G0OA 1YOVA 3ONDA 2D4AA 4YTEA 1AN9A 3HZZA 3N74A 2GZ1A 1TT5B 2H5LA 4WLNA 2VOEA 3L4BA 2VT2A 2JFHA 4P22A 4WASA 3A1NA 2WD7B 2ZYAA 1XG5A 3QWFA 2B5VA 3ICPA 3JYNA 3EYWA 1HLDA 3HHPA 2VWGA 2JCXA 5CDSA 4ZU3A 1BVUA 3OJLA 1X1EA 1RYEA 4IQ8A 1QP8A 2I9PA 4E5MA 2DTXA 1DPGA 8LDHA 2VHZA 3DHYA 4D41A 1K6IA 4UEOA 1AHIA 2BI8A 4JIGA 3BMQB 1N7GA 4CUZA 4ILKA 3VZSA 5A5FA 4G65A 4PLHA 1UZNA 3RFXA 3MEQA 3PHGA 4J90A 2EW8A 4XGNA 1ZZEA 1U9JA 1WDMA 3FNGA 4DYDA 4WK6A 3MJCA 3OMLA 1HDYA 5C3MA 1NM5A 3V1YA 4URFA 5IXYA 5I7FA 2EKPA 5DCUA 1XR3A 1U8FO 3TDKA 5MGBA 2XOXA 2HRBA 1R16A 3JD1A 3K92A 3LT0A 2WYVA 4YA6A 3PQEA 1UXIA 1XCBA 3OIDA 4XDYA 4BS9A 3JD4A 1SCUA 3BMCB 3GHYA 1QXSA 4HFJA 5JDCA 5DZSA 4I8XA 2NTNA 4RCVA 1R37A 4KTTE 5G0VA 4GH5A 1TT7A 1EVJA 1P0CA 3F5SA 4J1TA 4MJLA 4LMPA 1HSOA 1GADO 1Y8RA 2VNSA 3JQ9A 3UOGA 4UUMA 1TLTA 4FFRA 4XDZA 1BW9B 3SJ7A 5T8KA 5IFLA 1UUFA 5IZ4A 4E13A 1I0ZA 1ISFA 5THQA 4XQEA 3QWIA 3H5RA 4FJ1A 2POQX 5TIIA 3FTNA 4BO6A 3PI7A 1LLDA 1MC5A 3DOCA 2GSDA 5TJHA 1R4NB 3TOXA 4E5NA 4Q3BA 3EMKA 4EBFA 1TA4A 2VZ0A 1P77A 5JAIA 2PKQP 4Z9FA 2D3TA 3RC7A 2BLLA 3V5NA 4WE3A 2GDZA 3OSUA 4YJHA 2JD0A 2B0JA 3PYXA 1QLJA 4EITA 3VZRA 1E6WA 1TXGA 2BI7A 2W2KA 1XELA 4OQYA 1RM3A 1PR9A 1LDNA 3DONA 4FFMA 2HMUA 2JAHA 3DAGA 3WFIA 2G5CA 2VYVA 3L4SO 3WQSB 4YAKA 4XX0A 5L9AA 4BNJA 5BNTA 1ZSYA 3QQPA 1P3DA 3OIFA 1E92A 4EJ6A 3SEFA 1KC3A 4OIMA 1MC4A 5GZ3A 4HXYA 4FOOA 4ND3A 3WXBA 2DM6A 1AXGA 1IPFA 4S1VA 2WWRA 1KYQA 4J0FA 4BB6A 4HFRA 3WNQA 3UCFA 4E2WA 1ULSA 4QXMA 1VE9A 2EKQA 4TZTA 2I99A 3GF4A 3M6IA 4XCVA 2GO1A 4QTZA 4UUNA 2IODA 3L9WA 2C29D 5CHEA 3AW9A 4RORA 1YBAA 1BGVA 1T4DA 3BTSA 3GG9A 3GVPA 4NBTA 4R1UA 4C7JA 2HJRA 1UDCA 3FRJA 4AJPA 3BIOA 2PZLA 5HS4A 4XYEA 4J2OA 4OKIA 3C7AA 5EIOA 2JD1A 3KV3O 4MVJE 3RKRA 3ZV3A 1DC3A 3PJEA 5IF3A 4CMEA 4OO3A 1EDOA 5HM8A 2X0RA 1MLDA 3LVFO 4IM7A 5TC4A 1PZEA 3NDRA 4LN1A 3RUDA 4GSLA 1I3LA 2Q49A 1GL3A 5HRUA 4MKZA 3KYCA 1ZXBA 2OUIA 4YRBA 2O2SA 4JJFA 5IN5A
chains in the Genus database with same CATH superfamily
4TT3A 4OATA 1PFQA 4AM8A 5G4KB 5CBPB 3HMKA 3A4IA 1NY6A 3MIIA 5CB4A 2LGJA 3GJ0A 3WTCA 1FMTA 2QD3A 2QUAA 3WLLA 3GLGB 1T1JA 3E2MA 2LIVA 4ZC1A 3MT9A 2WHRA 2CHUA 5DHFA 5KNDA 2HJVA 2J09A 3NHJA 4D8UA 5H81A 1M0WA 2ANBA 3GN1A 1QLWA 5LYJF 3NALA 4FYWA 1C4WA 1P4GA 3SJUA 1F8GA 1X1DA 4D8VA 5KPDA 3TEFA 4E51A 3W0LB 2VAMA 4K6MA 1EI9A 5C5DA 3RAFC 1N6NA 3MZ0A 2WIGA 1OFHA 2W4MA 1KMMA 1Y1RA 4F46A 1WW3A 3D02A 1OREA 2VP0A 4F3TA 3E9QA 4FFBA 4JLKA 3KHTA 4J43A 5EI5A 5TMBA 5K0BA 3AYZB 3TWOA 4Y2RA 1JGTA 2W7TA 4E5UA 1ZMRA 4Z54A 4MS1A 5DV9A 2F9MA 2FDCA 2B9EA 5F51A 1JG3A 1FLDA 4DG5A 2FUG6 1P7WA 2Z1MA 4HYEA 1RR6A 3WWDA 4XWKA 1U1GA 3QEBZ 5CFPA 4PR3A 4OBWA 1CNMA 1X7YB 1DEXA 2GEFA 2A84A 3TFOA 4WJZA 3KT3A 3A2LA 1LBSA 2CB9A 3H2YA 1S1MA 3KVOA 4LBYA 3F4KA 3KXLA 4WFIA 3KEOA 4WXMA 4ZOLA 2OA0A 4C1BA 4EZBA 1RI4A 1UC8A 1R2QA 4IEFB 3E6AA 3L43A 1DNPA 2JEOA 2Q4TA 1L7BA 2XYGA 4K86A 5TARA 3UMCA 4C88A 3EPPA 5LZ5A 4XPIA 3RBAA 3UAZA 1TEHA 2CLSA 1N2CA 2D00A 2HN9A 2HSZA 1JDBB 1BGWA 5LB4A 4AJ1A 4AWXA 4JXXA 2JLCA 3UH1A 1GPKA 5DJ5A 1QCCA 3GD5A 4JEIA 1IHYA 4OQNA 4X1KA 4JQSA 5LJLA 1AN0A 1DJLA 4KH1A 4KJZA 4Q34A 1ZLYA 3HWSA 2VP4A 3PV0A 1D5CA 2W0MA 3HWRA 3TVTA 1JP7A 2ASEA 2EEPA 5CDYA 4IAOA 1WMAA 2GQ0A 4NK4A 5EJMA 1EM8B 3R6LA 3LKZA 4C0HA 1T36B 2ZI5A 4TQGA 3OCCA 1MQAA 1RZVA 1U65A 3H2BA 3L4JA 4FINA 4QU9A 2Y67A 4J75A 5D87A 3LY9A 5DTRA 5DRTA 2J7PD 3QZUA 1Y7HA 1RPNA 4WL0A 1BXZA 2OPHA 2AJCA 3LPDA 1QPZA 3MWKA 4QG7A 4QM6A 2NAFA 3W6OA 4NZYA 4Q7MB 4WDRA 4QFCA 1L7AA 1YS2X 4TMYA 1B15A 4YIKA 4EATA 3BE4A 1H3FA 2PKEA 3CGGA 3ZHBA 4EUNA 3U1VA 3DCIA 4CKZA 5A04A 3AFMA 3FWKA 1V26A 1NW4A 2V6FA 4R0VA 5D3QA 4B34A 3O7WA 4JHLA 3AF5A 2JZOA 4L72A 2JJ2D 4X24A 2JAQA 1GTMA 2C57A 2DY0A 2CXNA 4M46A 3SYTA 4CUKA 1SY7A 1U98A 3RUAA 4QXOA 1T8UA 1LWOA 4NMXB 9ATCA 2I6TA 4O4LF 4WCDA 5TQJA 3TD2A 4EMUA 1UK9A 1MRSA 3HCDA 4KUGA 1R0ZA 1A9XB 5KVSA 1OMOA 4Z1MD 2WMDA 3DWGA 3EEBA 5AKZA 4FXOA 5CIWA 4UU7A 4MV4A 1R4MA 4GD3Q 4Q82A 2QIOA 5DYTA 5AXAA 2X5XA 4JI4B 2OHFA 1XIVA 1AQUA 4G2TA 3D8UA 3KWLA 4X0EA 1BW9A 3UICA 1QHHB 2H7YA 4IQGA 1XKLA 3ACBA 2X1VA 3CX7A 3VR4D 4KMSA 3RWBA 4AYTA 1ETHA 1G7CA 2O0LA 5KTYA 4C22A 4JJ6A 5T4HA 1AKYA 1NAIA 4FGUA 4LYJA 5TMEA 4TKMA 3AB7A 1L5LA 2NU9B 1UM9A 3RHTA 3IOCA 1G3IA 1XXHE 1DUSA 5T3YA 4OKSA 3H8JA 1KAHA 4JLAA 1JQBA 4OBBA 3A7EA 1DKRA 2A59A 1H2ZA 1K4YA 1P0IA 1S8AA 2Z8XA 3AYXB 3MUNA 4I4IA 4BNDA 1MAVA 4E2FA 3G7SA 3FGOA 2QXUA 3LIIA 4LF7B 1KQPA 1J20A 1UPAA 2WABA 2ORWA 1QVAA 2RB5A 2F4VB 1ZICA 3F98A 2BFBB 2D1SA 2ISSD 2OZEA 2C3OA 4YLGA 1IM5A 1RWWA 2R65A 3UMYA 2QMUA 4B81A 4IS2A 5KS2A 1JBQA 2BGJA 1XA4A 2E18A 5JYDA 4PSCA 2P8SA 3IP5A 3OKAA 3QXCA 4MARA 1Q92A 4DMUB 2DQ4A 3LUCA 4TZ6A 1YB7A 5EVCA 1CUIA 4IUYA 2W6ZA 1S8OA 3KOXA 1N2ZA 3RC8A 2O8FA 2BRUA 1FYVA 1K6XA 1GOTA 1XMVA 2G9ZA 4OXNA 4QJ4A 5K3SA 5IKMA 2XCLA 1RJEA 2JVJA 4GU5A 4BLWA 2ZT8A 4M1SA 2K2WA 4I19A 4ZCQA 1VIAA 2E5FA 1W19A 5BORA 3ONWA 2YYZA 4KSCA 3UHFA 4MEAA 4XD7A 2OKCA 1R12A 3V1LA 3Q5EA 4FDVA 5F73A 2QX4A 5LZ8A 1LC0A 2HRQA 5A3JA 2PUBA 2V96A 3AEXA 2BGIA 2J4CA 5K20A 2B4KA 2XD9A 1RPZA 3RS3A 1KH1A 5K3CA 4HGYA 5EJ8A 4W7IA 3EMDA 3BDVA 6LDHA 4CEJB 2QGFA 1DCKA 2HA6A 3LX5A 2BH2A 4RF3A 1YZHA 2ZIVB 3KEQA 1ID8A 1XC7A 1NN3A 2L69A 1QANA 2GKGA 2XYHA 3W2EA 2C8JA 3I4FA 5JCZA 3C7KA 1FFXB 4EJMA 3F4LA 3O4JA 2Q1UA 4QASA 2UYQA 3G13A 4OJMX 1GGNA 1OLXB 4MPRA 1CUDA 4ZYVA 5HXAA 5EXSA 1IVYA 1GTVA 1XKQA 2OY0A 5ER9A 2R79A 1E0DA 1I13A 1YZ3A 3GT0A 4KZKA 4NHOA 1C7RA 1GQOA 2GS9A 2Q0QA 5JDCC 4ASUA 5AICA 5DULA 1KJQA 4NFYA 1Z28A 2P90A 4FLEA 3B5EA 4KAAA 4AZ3B 3OZVA 1JKJB 3B13B 3K6SA 2REXB 2BCEA 1C0IA 4XVCA 1SQSA 5AQEA 1PIWA 2JLSA 1WSWA 3IEIA 4J1SA 1IOLA 2VL7A 3ORSA 4EIWA 3V2GA 3O7MA 1CDOA 3W78A 1CQIA 5A4JA 1MOZA 5GOTA 2J8ZA 1XWIA 3FNIA 5KOJB 2FOIA 3WLOA 3B20A 5C81A 4DG8A 1PQWA 2F9LA 1Y6RA 2PU5A 4RHEA 1D3AA 1MX3A 1OFIA 2FFAA 4HQ6A 2X9GA 2XR1A 2QZJA 1NDUA 4ZN6A 3QTTA 3ZJ5A 4DWWA 4FI3C 2I2WA 4G5XA 4M60A 2VHYA 4RACA 1LZLA 1NATA 2HO5A 3ITDA 3Q7TA 2IX3A 4ZRMA 1ATIA 4JUAA 4PPYA 2PK3A 1L5HB 1M8FA 2NP7A 4JCCA 4H0CA 3WGGA 1N6RA 2Z4SA 1YR1A 4B2YA 4OHKA 1NMSA 5TRTA 3JARB 4JY7A 2L18A 1XLTC 4WKOA 4KAXA 5JG7A 2WIKA 3HVHA 2YV4A 2FGKA 4YAJA 3FI9A 3RANA 3K0HA 3S1AB 3G2KA 4CMAA 4F4CA 2Y2UA 3QEMB 3K9HA 5ERXA 2WJIA 1WABA 3E3OA 1X8XA 2R87A 2V6GA 1WP9A 5EPOA 4CLEA 3NTXA 2ZIAA 2I29A 3DE1X 1GG9A 2QTFA 3AILA 3BYZA 1JWAB 4FC6A 5DTQA 5EE3A 3RWOA 3ZXUB 3BTUA 5L51A 5L6MB 1EVKA 3DZGA 3P96A 1FXSA 5TT1A 2W4IA 1G4HA 5A4AA 1Z2NX 2F62A 4DCTA 1UP6A 3AG6A 1F4LA 1I33A 4FWTA 3HUEA 1ZFNA 2DFNA 3A58B 1G19A 2XKAA 3P2IA 2ONJA 2VHTA 5FF9A 4MB2A 4DT1B 2FP4B 1CJMA 1MXHA 4AS1A 2H16A 1BMFD 3Q10A 1JKMA 3FSJX 3K5HA 4NBKA 1JA1A 4ZEWA 4DBZA 4DS3A 5FL3A 5CB8A 5D6NA 1Z0SA 1F4VA 1NYRA 1ZUD1 1JKFA 1GJRA 1U31A 1KVTA 3REOA 4HL6A 5DWQA 4YK7A 4KH0A 1E7QA 1JAIA 2H1IA 4KACA 4WRRA 2F00A 3F4BA 3W7VA 4BWYA 3PL1A 2CUZA 3ZXXA 4NI5A 2L17A 4L7QA 2QRVB 1BCSA 4BGIA 1SHZA 4L3OA 1JB1A 3U44B 3OE5A 3UJ8A 3CO0S 3BHNA 3IUYA 1AU9A 3ILYA 5INTA 1IJEA 3P52A 4DOMA 4ZK6A 4FR2A 4J6FA 4LFAB 3VI4B 3KSRA 5HOEA 5M29A 4PV7A 3QE3A 4JC5A 3TM4A 2Q9CA 1YONA 1US8A 3UCXA 4BJ5A 2J9FB 3FMPB 3KFLA 3PDIB 3H3JA 3ORRA 4UPVA 5EKSA 3R0VA 3R7FA 4FX5A 2WT9A 2WI8A 3OE7A 1Y3BE 2EFEB 4IF4A 3RC3A 1SCJA 2NSLA 3GMSA 4HB0A 2B92A 1EH5A 1PGQA 3A9RA 3AI7A 3I6QA 3KXDA 4KXQA 3Q8KA 3LHKA 4N4AA 2ZI6A 4NRDA 2O8BB 4YJ2F 4EL0A 4X94A 2OORC 1T3GA 2PCJA 2O4UX 3FUWA 3LBFA 4PC2A 2X3YA 4QJ5A 4BP9A 4EJSA 1K4KA 5C5EA 3OEHA 3VTZA 4H3SA 3W5IA 3EOBI 2JIZA 3H86A 4C06A 4EA7A 1AQLA 4IVNA 3T54A 5AW2A 2AG6A 1KC1A 2GPBA 4L8YA 3SPXA 2D7JA 1QG6A 3IT3A 3NMUF 4EJSC 4C7BA 5K0JA 2VUUA 4UUOA 2QP4A 3QELA 2Y71A 3LY8A 4RELA 5IAKA 2I2XB 4IJQA 5AM5A 1MG0A 1FMFA 3UVEA 2DT5A 4DLVA 5AIBA 2F43B 2B99A 1X14A 3R8CA 4IDOA 1IIRA 1LW6E 2YV2A 5I47A 3BSSA 4GEKA 5ES4B 1JF8A 3CNLA 3G5TA 1IUPA 1OROA 5FOSA 4EGFA 1FA9A 1T0BA 3JZMA 5EIXA 2DPGA 3A11A 2CN1A 4GOOD 3DAOA 4IIBA 4N0QA 2WQ7A 1DX6A 1T1RA 3SSNA 1XRMA 3RKSA 2GEKA 4OHRA 3DVSX 4E70A 3OX2A 2R86A 5F33A 5JXIA 1XTQA 3HPRA 3A9UA 4FBGA 3VU3A 4PBRA 4Z7OB 1EHYA 1FX1A 2F3UA 3DGEC 3HKDB 1UJ5A 3DYIA 4Y6QA 2ACKA 2QPLA 4GEGA 3WWEA 3ZU5A 4AG3A 1F12A 1W96A 3T15A 1LDGA 1UJ6A 3AH8A 2IZZA 4JI2B 3KKKA 3WIDA 1A9YA 3L5OA 4XB6B 2FETA 3CLVA 3HUUA 1Q7GA 3IERA 3ZG6A 5IXSA 3ASZA 4RMGA 3UB3A 1IK4A 3WYEA 1JIKA 1CY1A 4XQ9A 5DE3A 1IUNA 4ZI3A 2V1XA 3DT9A 2O1WA 3NDIA 3I01M 1HOXA 3OUUA 1DV2A 3VSBA 5GGYA 4CDRA 3JYHA 4X63A 2ZJ1A 3OMWA 10MHA 4MR8A 2JIRA 1P74A 1YB2A 3BG5A 3KVYA 4HG2A 4JQCA 3SR4A 3SXUA 3UEOA 1G4AE 3LOUA 1L8LA 1Y9EA 3QLTA 3ZHZA 1K0FA 2QD1A 3U0BA 5EJAA 2HWKA 4M7OA 2KHZA 1CIVA 1GAWA 2HXSA 4JI0B 1T1GA 3Q1KA 1Z22A 3S2IA 4K46A 4COKA 2WJVA 1FE8A 1AD2A 3DPIA 3H5TA 1A9ZA 1HPLA 1PNTA 5FUXA 4ETMA 4ESOA 1E2NA 1WMEA 1PEDA 4LIPD 2VYQA 3FPHA 1EUDB 4MQEA 4QRHA 4PSAA 1S9HA 3FDZB 1X7DA 4L8LA 1CUFA 1FX0B 3MMXA 4HAUA 4F5WA 2ZETA 3LW8A 4CODB 4EVRA 1QF6A 4BVEA 1G0NA 4CKEB 1E3SA 1I7NA 3P27A 1JAXA 3ZD7A 2XCSB 2X9NA 4OXQA 1CP2A 4L0DA 1Y37A 1Z4QA 4U8GA 1W30A 1R6AA 3D43A 4U2EA 4QFDA 1ZNZA 3R20A 1E1NA 4KXYA 1GDDA 1GQ2A 5EJ9A 4FJ0A 2WJ4A 4Q7JB 4YP6A 1AGRA 2GF0A 2I4MA 3BXXA 5D3KA 3GEEA 2WPDD 4M2LA 2G1PA 4EUFA 2IPLA 1XZAA 1T4MA 5EXTA 2B8NA 2GD2A 5LYYA 1I01A 3K6SB 2FFRA 3HKCB 2JGMA 1PU2A 3LXRA 4KPGA 5F76A 5B12A 5I8WA 1PE0A 1GPYA 4LYAA 1QHYA 1SHUX 1E1LA 1SZJG 3IVGA 2NO7A 1XTZA 4ROSA 1UDRA 4UQOA 3U7JA 5JZOA 5A2GA 2VJKA 2D1YA 3DAYA 1LV7A 1W88B 3IILA 2PZ8A 2BFMA 1LUAA 1LW7A 2Z2YA 3VDNB 3VPAA 5LOVF 1C2TA 4FONA 1PFVA 2GCGA 2JI6A 3KYBA 4Y1FA 2ZT6A 5TEWA 3T9AA 3ZJYA 1G2PA 4FN4A 4A8JC 1R64A 4RXUA 5BR1A 3AQIA 3N7UA 4JP5A 2EIXA 2QVZX 3ELWA 3G9ZA 4FGSA 4L78A 5ELMA 5FTKA 1IONA 3GPCA 1KSFX 2OMEA 1BOOA 2C5FA 3HJTA 1DCMA 2H65A 1VDZA 1JHXA 1YDMA 3BRWD 1ZVJA 1PL7A 3EZXA 3RVRA 5HKAA 2ZUUA 1H2HA 2AL7A 2OB1A 2XMCA 4YJDA 5K3FB 5KNDD 2UUCB 1QZXA 5P21A 4PM4A 4DNPA 3NVKI 4R7ZA 1VLZA 4UBLA 4BZZA 3UXEA 2FN9A 4B6EA 2ZKLA 1BKSB 2C9ZA 2OD7A 4PPFA 1YR9A 2Q2OA 4G0PA 4Q3LA 3ECAA 4GP9A 3VRHA 2X0IA 3JTMA 1PYDA 2W8BA 3SX2A 4AJLA 2IYUA 2W6MA 4WGGA 1R0KA 3VUEA 5ARBA 2IYWA 1T9BA 3FFBA 4G0ZA 4ZMRA 4ZZ2A 1V3QE 5HRCA 3H2KA 2DHQA 4DZRA 1AQYA 3O8LA 4MKRA 4E2YA 4L5BA 3TCXB 3LWNA 2R8OA 1JG7A 1QZTA 1BDMA 2HJSA 2IW1A 4LYYA 2VZLA 2YHIA 4ONEA 3HYNA 1SIBE 1F17A 1FDIA 4S12A 5DP1A 1ZD3A 1RRPA 4PSUA 5JT1A 4UTPA 5KB3A 4YJGA 4FR0A 2GPSA 2Q6IA 3B9QA 3I2FA 4PCVA 3NANA 1MUUA 4I1VA 1ST2A 3T5BA 4LA4A 3OJOA 3IDZA 2BH9A 4ND8A 2WICA 4HQNA 1F20A 1DP4A 1O0SA 4CM5A 3IE1A 1IEXA 3IURA 1AMUA 2O6LA 2X2PA 2HLNA 1LRLA 4YRIA 2PKCA 3DLPX 1K5HA 2EX1A 2FQXA 4AMUA 3EIFA 2D0PB 4JROA 1VHJA 1O95D 2ZI7A 1UKYA 2NVBA 2WKRA 4CTJA 1KYYA 1EE1A 2V3CC 1XFDA 5EOVA 3OZWA 2RG1A 1YFJA 2J5XA 4IXDA 4CTMA 2XJ9A 4BNYA 2O2HA 3V1TC 2RKBA 3AG5A 3GLKA 4E94A 1CJKC 1YDHA 1ISJA 2ZDHA 3BK7A 4G8JA 5K03A 3NHLA 1E58A 2WD8A 4P8RA 3DBOB 3EQ7A 2IYLD 4JLMA 4UFNA 2X0EA 2XDQB 3H6HA 4JI7B 1J0AA 5BNWA 5K09A 2IUFA 1YFKA 3PFGA 4L95C 4II2A 3WGTA 2AXNA 2HA5A 2RKWA 4PZPA 1LRJA 3K8YA 1FU4A 1R9JA 2JARA 3LKDA 4NOLA 4S35A 1WM1A 5FL7A 2WHEA 1TU3A 2O7VA 5ULLA 4CG0A 4PG8A 1U3DA 4PW0A 4JWKA 4RKWA 3IEMA 2YMMA 1K0UA 1VBKA 2RC5A 4UM9D 4YDHB 3VISA 3ZWVA 3EDRA 3DFFA 1DKPA 1WUJS 3LCMA 1ENOA 1NF2A 3DZHA 1MCZA 3SMVA 4HN9A 2BF7A 2DWOA 4TS4A 5JQGF 2B7LA 2HREA 1AURA 2WDPA 3NHRA 3NI2A 1N1DA 1I5RA 3OLYA 4QARA 2QNRA 3SHQA 3DBLB 2B78A 2C9OA 3AZQA 4MA4A 3B1JA 3HVKA 1OYVA 2OO3A 2QD4A 2OC9A 1NBEA 2GBGA 5JU6A 4AC9A 2YRWA 2P9YA 2YWDA 1GXSB 3HE3A 3WLPA 5FFMA 3F1KA 3BSWA 4R2KA 4QSHA 1IEWA 3C74A 4ZU6X 3BD8A 3AF2A 3CE9A 1TMGE 3H11A 5D86A 5DEOA 3L93A 1NQOA 2WSMA 2QTBA 2W2OA 2XDWA 4GYJA 3PRKE 3E22B 5AI8A 2XQIA 4D3YA 1U99A 4LCJA 5JWOA 4DQDA 3UW3A 3AUFA 4OUDB 3HADA 3DS8A 1N9GB 2A9FA 3DZBA 1G6Q1 1W2WB 1RFLA 2WTAA 1MAHA 4UNPA 3DCJA 3UJ6A 4URVR 4P2BA 1NUPA 2GBIA 1LPBB 4RHFA 1QH0A 4KVFA 1EBUA 1CVRA 1A4RA 4CG1A 1FVXA 5K6RA 3BMNB 2P4HX 4F4FA 5AKXA 1I32A 2B0CA 4LJ4A 2P11A 1Z4IA 2BFCA 1DO2A 2DOKA 1W35A 3IE0A 4FMCF 2ZSIA 3NLLA 5JI2E 2BHNA 1Q0TA 2JZCA 3WO1A 4D1YA 3ZY4A 4OH1A 2XNDD 4GF5A 2AEFA 1M1UA 1A4UA 1FXWA 4X8LA 5DKFA 1JEQA 1X2EA 3F67A 3KPJA 4FOSA 3W5HA 1RI1A 1SCNE 3AF1A 4XYGA 1I9CA 3B6EA 4EHAA 3DMTA 2XODA 3JZDA 5BRAA 1TQHA 4A15A 5BW8A 4QUGA 2GAOA 1GPUA 1DIBA 3PA6A 1QDLB 1XXHB 1U81A 4QPCA 4UNQA 3BE8A 1UH5A 2FSFA 3Q7QA 4KR0A 4LY3A 4YDQA 2UU9B 4B3MB 4HTFB 5JW6A 2VCYA 3AVXA 1OFUX 2P91A 5E1BA 1JG1A 3ETDA 3OKFA 3SYMA 3YASA 4K9PA 1RXVA 5TNXA 3RC9A 4LHZA 5FOWA 4B45A 2X5KO 2JH9A 3FPKA 1JVSA 1EWQA 2IYRA 4BTLA 1PFGA 1E64A 2BMFA 2OBNA 2QYSA 2WLTA 2O7QA 3BCSA 3HCPA 4I6EA 5BR4A 1FDOA 1X94A 3MWJA 3T1YB 1XD9A 5HUJA 1UEIA 4M98A 2D06A 4EG4A 1EVZA 3DE2X 1OIVA 1LC3A 2YR0A 5FOXA 3L01A 4RLHA 1A7UA 1QQTA 5JCXA 2O54A 4AUNA 4NBSA 2VTBA 3K9LA 2CYBA 2NSYA 2VJOA 4H60A 1F0PA 4BNXA 3MCVA 3FN4A 4JCOA 4WXHA 4Q6WA 3RNOA 2QK4A 4URWR 3V3KA 1TF2A 1NBIA 2IJGX 4YJ3F 1EYZA 3GPBA 3MK31 2GXUA 1E7WA 4ZU1X 5LQKA 5EKXA 4M7WA 2YYAA 1ZU5A 1KK2A 3DEJA 3EZFA 2C95A 5C7YA 4REMA 4CMIB 1H8HA 3B7PA 3P9ZA 5LVAA 4A6EA 4EI8A 1CZNA 4GR9A 2JIQA 2BJHA 4EW6A 1G21A 2DFVA 1T91A 2MSEB 4WSOA 3U3ZA 5K05A 2G8NA 1P2FA 3D6FA 3RG2A 2WWHA 4L1KA 4MWBA 2JFYA 4M1QA 2PJUA 3FZEA 4BKUA 3M5PA 5ECWA 3EZGA 5IT9A 2QGNA 1G5IA 3VVMA 1AK2A 1QQ5A 3WGIA 1IEVA 2W6QA 1Q11A 2H4YA 1HLFA 1NUAA 2FKNA 2WT4A 3E5HA 1Q3TA 1EHIA 4R40A 3G0IA 4P54A 4AQYB 4KRYA 1VIVA 4QEZA 5DLYA 1KMHA 5DGTA 1JEAA 1TTQB 2C2MA 2OESA 3PFHA 4ISBA 2PDAA 3HCWA 4BKOA 2HQBA 2BTOA 3FOAA 3GNLA 4QUJA 2FKAA 5KOJA 2W00A 3JQ8A 4W5OA 4NV3A 3OLQA 5BR7A 3ILSA 2FUG1 4YUXA 2F7SA 2MYNA 5IVPA 4YNBA 3QX8A 2D1FA 1XU7A 2PPLA 3R09A 1IZ7A 1DCFA 4DBLE 1Q5PA 4MP3A 5HVNA 4PS1A 1ZJJA 1WHSB 4CIBA 1PZHA 2AOTB 2ECPA 1JDBC 4Y6LA 2EGUA 4DM7A 1I4OA 5BQFA 2RGXA 4ESHA 1I7DA 3ZWYA 3O3MB 2UYYA 1NW5A 3QLVC 4J7UA 4UQPA 1XXLA 3FD8A 4DN6A 2VPZA 3AFGA 3FPBA 4YONB 5KCMA 3TIVA 1QTIA 3U5ZB 3CM0A 1MR3F 2HKIA 5ALXA 1RMYA 1DBIA 2ZRKA 4PYKA 4A2CA 4NAUA 1EHCA 2Q5EA 4HQLA 5AJHA 1Z47A 3FHJA 4MDHA 2PUTA 2FFBA 3GZJA 1NVBA 2X5OA 3KZCA 5KVQA 1I3MA 1JHYA 3PGLA 1MO5A 2B4TO 4MP8A 2QL5A 2B7CA 1NSYA 4TRMA 1PKXA 4E5SA 2J0SA 5JADA 1W8DA 3GGOA 1DC5A 1KHTA 3HP7A 3I6BA 2HNKA 5JYBA 3G88A 4OTZA 3TSCA 3TECE 4LXHA 3GP8A 1Q19A 5AI9A 1X13A 5BWCA 1Y1PA 4GR5A 3PVZA 3V4FA 2OECA 3KXPA 4CMIA 2BKLA 1FP4B 4N5HX 2BBOA 2P3LA 3AWIA 2NUTB 2Z56A 3NRJA 1NW9B 4Q1AA 2PPVA 1DRWA 4JL6A 3RV4A 3NOXA 5B1YA 4DYVA 3KKZA 1XTVA 1M1YE 1L5QA 2VDPB 3JQQA 4GX0A 1H2EA 3CMCO 2GCOB 1MEJA 3M70A 2JL1A 1TQ8A 3COYA 1NR5A 1NWCA 3NYRA 3HMQA 3L1VA 1MORA 2PWBA 5K3AA 2QQ5A 4L57A 2AOXA 2HSJA 1CJBA 1Y3DE 2VBFA 3HDHA 3NIFB 1FS6A 1TUBB 3GJTA 1R9NA 3ZW7A 3FTEA 1CS0A 1I30A 1AY0A 5DDIP 4M4SA 4KX3A 3T8YA 3OFJA 4OU4A 2Z8ZA 3PNKA 1EGVB 1XRJA 4H7FA 4ZI2A 2ARKA 3EUWA 3PE4A 3WGQA 4BFLA 1C30B 2AVNA 4ZXFA 2FTKE 3AO0B 3K8OE 2JS7A 1M5RA 1WXQA 3KKNA 4EO4A 3ANSA 2ZB4A 3W90A 3ZVNA 4IV5A 1QU2A 2VP9A 2UKDA 4UM7A 3G2HA 5AKKA 2BEKA 5CCBA 1A82A 1T26A 1RAGA 2DGDA 3KQSA 4UDNA 5AD1A 5IM4A 3WYAA 5FUQA 2GVNA 1U6JA 5E4FA 1I4WA 1JSXA 3UGTA 4FCTA 1N2SA 3A26A 2JCYA 3COWA 4FZRA 4HMQA 3U31A 3VDQA 2NVWA 1N36B 3UHPA 1T8YA 5IXJA 4LNHA 2VZ8A 2O1SA 5FA6A 4TKLA 2XMQA 2RH9B 4JJKA 5ESRA 4GMGA 2J6BA 5FTNA 4W9MC 1R1DA 2FUKA 2NSHA 1G2QA 4LDRA 1NMZA 2AFIA 1WTCA 5AHOA 4BO9A 4N3AA 5EJFA 4MV3A 2NTEA 4JXZA 1SPXA 2G82A 3MFQA 4LRYA 4DV3B 2FZEA 3FVVA 4NBRA 1LS6A 1X80A 2XCQA 4BMNA 4UUBA 4YJKA 4BUZA 2GUGA 3LCUA 3RTEA 3PXBA 4GBED 1WPGA 3JQ7B 1FP4A 1VLQA 2YUIA 2P3SA 4L4SA 1J5PA 1P7CA 2PAFA 3AP1A 1M6HA 3JQ9C 1B41A 1X9GA 1ESEA 1E2PA 1UJCA 2X8JB 3RDPA 1ZXLA 2FE4A 5F78A 1E4EB 2PRIA 4Z4GA 1L6IA 4LECA 3GI1A 2BN4A 2H85A 4MUGA 1RS0A 3RU9A 4J7XA 2A6PA 5C7OO 4MV6A 3SZRA 4M87A 3B5IA 3U40A 3V4LA 5ECDA 3LUFA 4N0DA 4D02A 3E7DA 1I3KA 1C1DA 3R0QA 4H3HB 4MVJA 1N0IA 3HBLA 3BD6A 4H6WA 3R74A 2ODAA 4KUEA 1E1QA 4A5OA 1ZZGA 4GOJA 4EYQA 2O0JA 1DADA 4BN4A 4V0NA 1BDHA 2A9OA 1KZ6A 1XB2A 1TD1A 1ZU4A 4KQMA 1SXQA 5BUSA 3JYOA 3CR3C 2Y66A 4BX3A 1PWXA 1M34B 1NW8A 2NZWA 2YY6A 4F0JA 4EKIA 2OGSA 3IHTA 1SD2A 4MX8A 4QUIA 3RYHB 3UMFA 4JI5B 4EKNB 4EPRA 3GU3A 1O3YA 1QJCA 3DZIA 1RRFA 3UG6A 4MXDA 1G7RA 1TECE 1D0IA 1XAGA 2H1CA 3BWDD 1WUTA 5C8VA 4FJ2A 4FDUA 4S0XA 2PR7A 1UBHS 4CL0A 4MP6A 1RQLA 4RTRA 4CNBA 4RPKA 5COAA 1KDVA 4OYLA 4O0LA 3RRBA 1IN6A 1KZ4A 4XYBA 1ZD9A 3EWAA 2D7DA 3PCRB 2IOYA 3LLVA 1V9CA 2B82A 2A3RA 4GVXA 4P33A 4V1CA 2V0CA 2DRIA 3GAFA 4LSGA 1GUYA 1QRDA 1I2MA 3F5FA 4FJ1A 4BVLA 1U9IC 4Q9DA 3MQFA 3UK2A 4BEJA 4IY1A 1CUAA 3OQBA 1M2FA 3ESDA 3OA2A 3OPYB 5EQTA 3BAZA 4FBMA 2AQKA 1L2TA 3PTLA 3GIDA 4ZQIA 1K3UB 2BI4A 3NWBA 4Y30A 5JASA 1RCTE 1U4OA 2HADA 4JV5B 1LLFA 3AOGA 3U13A 5L6LB 4AKIA 1J9GA 2W2XA 1U6KA 3P4XA 1KXJA 5ILGA 2XUIA 5BQPA 3INRA 3JYQA 1OQAA 1E96A 5JANA 4HLDA 2X14A 2ZQYA 1JHOA 1GEGA 4GSKA 3EXG1 5B1DA 3I0NA 3L1HA 3IP6A 3M89A 1K6JA 1MNQA 1H6BA 3P9SA 3QVXA 3OFNA 1HSZA 2PH3A 4JA0A 5AJUA 2CJPA 1L4MA 2AZMA 3DEIA 4PS0A 5E3IA 3WKEA 3OEEA 1X8LA 2OQRA 2XEXA 4MNTA 1KJJA 5IH7A 2ZJYA 3ZGVA 2AUTA 3WYFA 3CIFA 1GQQA 1P2SA 1IE3A 4K6GA 4LGVA 5BSUA 1BE0A 3RS8A 3DL7A 4KEAA 1KR5A 3SXPA 5DNDA 5F7OA 3P0JA 1IBRA 1QAMA 1U4SA 1XLUA 4BO1A 3LQYA 3C3JA 4REOA 1E0SA 4DGQA 3CKMA 4R6XA 4R1QA 3KSMA 3V32A 1DFGA 3ZWMA 1H23A 1JFSA 4ZD6A 2I67A 3I6MA 4KQKA 3ZQUA 3OCUA 3KJEA 4DMFA 2WAYA 1UINA 2AN1A 4OHMA 5KWEA 1L5FA 1XN1A 3CONA 4FHDA 4GBMA 1Z6ZA 2VQFB 2BEUB 3I1JA 4O6VA 4F5DA 4L0CA 3PWKA 5C8YF 2DCUA 1EJ0A 4FCWA 5AKLA 4TL9A 2XUDA 3MBIA 5FDFA 3EMVA 2NSDA 1VZ2A 1G3RA 3O1JC 3QV2A 1O95A 3GIWA 1NSTA 5G1NA 2OCKA 4LXUA 1DZIA 3RSZA 4L6AA 2H00A 1L1FA 3PNLA 4PX9A 5TQ2A 5K0GA 4F9EA 2LUOA 4TXMA 1A8HA 1EDEA 4X7RA 1ZY2A 3D0OA 3ZGOA 1DTEA 1WBBA 3GXBA 1OA1A 1E1KA 1V11A 2A7XA 1XTIA 1YZYA 4B3JA 5JFGA 1A9OA 1EG7A 2HYDA 2ZJBA 2RAVA 4IG4A 1Y9AA 1T9DA 4JITA 4GI7A 3I5AA 4RHTA 1O5TA 1XRQA 4UAGA 2QUKA 4BKPA 3RU7A 1HWYA 4TYMA 3GN2A 5HJEA 4C20A 2I7CA 2O3RA 3RODA 1H9AA 4EMSA 4BNKA 3MJHA 5JAOA 1TAQA 2B2XA 2POCA 3M6MD 4RENA 4TVBA 5HQ3A 2CLIB 4KJXA 4UDXX 2ZI3A 3IEPA 1M8JA 1GPNA 1OI2A 2AXQA 2J3QA 2J3MA 4QQRA 4Y3UA 5BP7A 4HBZA 3TTTA 3ZQ6A 1JJBA 3SC6A 4R31A 3OM9A 5B3JA 4LF4B 1M2JA 6REQB 3C4JA 1EM8A 2H9AA 2Y1WA 4U7PB 5EIFA 4MIOA 1PYOA 1AK1A 1QHSA 2Q3HA 3BGOS 2G9UA 1GFWA 1SU6A 3AMVA 1F48A 2GJAA 1Q50A 3G2MA 5FYDA 2PM8A 4WV3A 2P9JA 4U39A 4ZT2A 2OCBA 3PJFA 4YWJA 3UKJA 4JOQA 2BMEA 1FU8A 4RL6A 5AI4A 5IJWA 4N3NA 4KMRA 2BPOA 3A4MA 3IMCA 1QK4A 1VGQA 4G4IA 4I9HA 3UZUA 4ATNA 1C3OA 4PLYA 1Y98A 2FI1A 1ILEA 3O8OA 5DCYA 3GLFA 2YWFA 3LL4A 1P4RA 4GNRA 1YR3A 2O2XA 1PNRA 3NBZC 5L3QA 1CQXA 1IXRC 1H2XA 3OQIB 4HHEA 4Z4IA 4P3XA 3KLBA 1PHPA 1H1TA 4GMHA 4AY2A 2FA9A 1PFUA 4J07A 4U4AA 1AQIA 5LP6F 4YRZA 1DKUA 5GPBA 2J5KA 2QYTA 5F9MA 5BVHA 3SX4A 4S2EA 3PGXA 1PDWA 3NIBA 4TXNA 4UUAA 3T5CA 4MAAA 1JMVA 2JBAA 2RGWA 3RTCA 1Z2PX 4KQEA 5L4NA 2GJ4A 2GERA 1DS6A 4I1IA 3UGKA 4BMCA 1D2HA 1VLLA 2IY8A 4BNNA 1IN8A 2HXGA 3H9CA 2Q1TA 3JD2A 3K0FA 4QGBA 3ZE7A 1QTNA 2FR0A 2WB2A 4IHJB 4KQIA 3UC5A 5JNLA 3QX3A 1POXA 1YKGA 3H9JA 1E8DA 1A5ZA 1V7CA 3ADKA 4Q9JA 3TW0A 3WHPA 2AQHA 3ZBUA 2Z2JA 1BJRE 4MQBA 1B74A 1Q7EA 4PYMA 4UTXA 5FTWA 5TPWA 4ICIA 3HEAA 5CYPA 2IXBA 4L4RA 5HK8A 2ZW9A 3HRKA 1QTQA 4IUCS 1NKSA 4M38A 1CUHA 1E4YA 1HYHA 2PBFA 3NHSA 4F4UA 2ETXA 4LMRA 2KYRA 1Q21A 1W88A 3KJHA 3S2FA 2FZ4A 3JWPA 4HXGA 4YXWA 2MHCA 3TFQA 1NVWQ 1K8ZB 3SHFA 4ZTUB 1SCBA 2Q1YA 3D7KA 4MUFA 2QRGA 3DOOA 1R6UA 1GV0A 4N47A 4KPUB 2Y05A 1J8QA 4AXBA 3AY3A 1UPFA 3Q9UA 3T3NA 1C1XB 3A32A 1MD9A 1STOA 1N2OA 1OYWA 2BFBA 2C5SA 3W5VA 1H2WA 4BFUA 1E9BA 3ZDDA 4CLOA 4LF6B 2UVQA 3Q6MA 4H4DA 3D6JA 3KUDA 4JBHA 2HWUA 4MV9A 4X1KB 4ZO6A 1IZYA 3RYFB 3T3GA 4CCAA 3OOJA 1YASA 3REGA 5ITSA 1IATA 4XD7D 4MVJM 2EWWA 3T52A 1Z5ZA 4DR4B 2VHWA 3EY9A 1QYIA 1SR8A 2WZQA 4ZT4A 1BQ4A 3NDJA 2K4MA 1MAAA 1RYMA 1XJ0A 2CXTA 2VYND 3LUAA 1ADCA 1TGVA 2CCKA 2DVMA 4QHSA 4F60A 4CGYA 5JY6A 1FXUA 4H59A 4KGZA 1F5SA 2PH7A 2PS0A 4RNCA 1RM4A 1WU8A 4TWIA 3A1UA 1QE0A 4IBOA 1Z4NA 4CT4B 1G1AA 4D56A 3A9CA 3K4HA 4IIJF 1L5WA 1GTZA 1NJFA 1OBVA 3QOWA 4L5CA 3KYCB 3F0TA 1N5LA 1T2NA 2VP2A 4N1AA 3PC7A 2IDJA 2PXXA 1QGUB 2OHHA 2CSXA 2NP6A 2HDNB 2ATIA 3P9PA 2VF7A 1UZUA 1C3EA 2YZNA 1M2VB 3AXTA 1AF4A 4OPMA 4HFNA 4EY6A 2D0DA 2IHNA 4N03A 1DEKA 2R4TA 2BGNA 1D8TA 2REOA 3VSCA 1C7EA 2FF5A 2H0AA 1GRNA 1FFDA 1J22A 3NYIA 4GPBA 3CSUA 2G0TA 4HGQA 3M4NA 3DE7X 1W34A 1KNXA 1XZPA 2AJTA 2XYRA 5LDDC 4DQUA 4HY3A 1COZA 1M0SA 1RHMA 1RC1A 4EFNA 2FRXA 5ALOA 2FU5C 1HNWB 4H6XA 1U90A 3FOWA 4B3DA 2NU6A 4A1FA 3EW9A 4FEAA 4RK1A 1DWOA 1E6UA 4X1YA 1MOQA 2H4FA 2V5UA 2DFPA 3KKOA 1W4AA 2EW2A 2ZPUA 2WFAA 4NP6A 5FLYA 3SEZA 2OPBA 3PQDA 4Z4EA 2GN8A 2JH3A 3SF8A 2GH1A 4C4YA 1CUJA 5JOQA 5I3ZA 5BV1A 1X9HA 4BMDA 2WTBA 3W06A 3TIFA 4FSXA 3RSGA 3ROQA 4AMGA 3KKPA 3SQNA 5IFKA 3QE4A 2V7PA 3JVUA 4U9HS 4YMWA 1AIPA 1SH7A 1F8YA 4IQ0A 3BTOA 4B4UA 1FSPA 3D8NA 4IRXA 1URPA 1Y3AA 2JJ2A 3F74A 3K30A 4PTZA 1QAQA 2XECA 2QJTA 1TAUA 1HTTA 4HT3B 4TL8A 4CKYA 4GPAA 3DVLA 1WL8A 3ES9A 4G3XA 4HJRA 2HBYA 3HL0A 2QMEA 1GCGA 4G0YA 5AOBA 5LMZA 5IS2A 2B94A 2WT8A 3EJ6A 4NJEA 1TJYA 4IFTA 5FUYA 5DRYA 3LX6A 2XGJA 2J4FA 4KDFA 4MGZR 3S1AA 4P6VF 4CDGA 5HP4A 3QU5A 4CIDA 3F7NA 4DIMA 2C3UA 1V7ZA 3VNVA 5LNK1 5J23A 3U19A 4TOIA 6ABPA 2YJNA 2UZ4A 4NFHA 2ZSHA 1IOVA 4GO1A 4RD1A 3G8YA 2ZWOA 1RM5A 1ZMTA 4RH0A 4Z3KA 4V24A 3EUFA 5DLDA 2FSIA 3QBTA 5E6UB 3C24A 5ALTA 3ZGYA 2PL1A 2WF7A 1P5ZB 1H0RA 2JLQA 1H0HA 3AR3A 2G0AA 1MT0A 3E61A 2IBMA 4G1MB 2ZYWX 4Q4AA 1JMYA 2BVNA 2HMVA 2UZ1B 4PG7A 2PMFA 4RZ3A 4XARA 2O7RA 5IJXA 1M2OA 1XAHA 2W2MA 4OD0A 1JZSA 1WXWA 3U7GA 3CH6A 2QTLA 4MMZB 1HURA 1OB5A 4D98A 5KNDH 1IBCA 3IQWA 3PJRA 2I2FA 3D31A