1ZFNA

Structural analysis of escherichia coli thif
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyltransferase thiF
publication title Structural Analysis of Escherichia Coli ThiF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.73: Sulfur carrier protein ThiS adenylyltransferase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zfnA00
5DZSA 2Q2VA 5DN9A 3I1JA 3JQ6A 5JAZA 1C1XA 1MC5A 2JL1A 1LLUA 1EQUA 1O95A 1YONA 2WYWA 2ZCUA 3I9JA 3N58A 3U49A 4PLHA 2NVUB 4ALKA 5BQFA 1H6AA 4K6CA 2UDPA 4AFNA 4YDRA 1NBOA 1C1DA 3KTDA 1I24A 2GO1A 3JQAD 3U9LA 2X5KO 2HSDA 3PWKA 1KERA 4OOFA 4CLDA 1J49A 1SPXA 3S2FA 3VHRA 4AJ1A 5HWSA 3CEAA 4Y6SA 1R4NB 4CM8A 1U7TA 1Y6JA 1N8KA 2RH8A 2V6MA 1VM6A 4DLAA 2C5AA 4RF3A 1ZSNA 2AG8A 2DVMA 3D64A 3INRA 4IQ8A 3HN2A 1XSEA 1CIVA 2V6FA 3LK7A 1ZXLA 3JQFA 2LDXA 1E3WB 2IDZA 3H3FA 1YO6A 1T1SA 5IJZA 1Y1PA 4CLEA 4FFLA 3GRPA 2BRUA 3F5QA 1BHSA 2EP5A 4K9DA 2Y0EA 1MA0A 1IOLA 5CFZA 4XIYA 3OA0A 3ITKA 4ONEA 2PNFA 1JQBA 2OFPA 4WLVA 4M1QA 1UXJA 3JD3A 3JQ8B 5LDHA 3O8QA 1W0CA 4GKBA 3ROKA 3ZV3A 4R1UA 5K6AC 1CQJA 4RF4A 1NQTA 5F1KA 2EHDA 4DPLA 4IXWA 3TJRA 2J3KA 4B7CA 2P91A 1YB4A 2YV1A 5DCUA 3UHAA 3TZ6A 1EEHA 1F0YA 2YDXA 1P74A 3PGXA 1B8VA 4CLXA 3I6IA 3IKVA 3RC1A 5GZ3A 4JIGA 3LF1A 2NACA 1NXQA 1P44A 1R15A 2Q45A 2RH4A 4Q3CA 3GZNB 3WLEA 3ZDFA 4FB5A 1EE2A 3NDJA 4OIMA 1JKFA 5ILOA 4WOJA 1PGPA 1SC6A 5L9AA 1ZCJA 1TI7A 3AFNA 5BSGA 1ONNA 1U9JA 2B83A 4R01A 3O26A 1DFHA 1EVIA 1Y5MA 1CERA 4RLHA 3Q3CA 3DBLA 1W4ZA 2P2SA 1PJ2A 5MGBA 3FWNA 7MDHA 1GL3A 3RWBA 4LMRA 5BNTA 3CTMA 3ON5A 4RF2A 5T67A 2Y68A 3ETEA 5L4LA 5AYVA 4PG6A 2UVDA 4GI2A 2VQ3A 3K8ZA 4NBVA 2GNAA 2J3HA 1SOVA 2VUTA 1MXFA 4XQ9A 4BO0A 4TVBA 1CWUA 3T4XA 2Y1FA 5COQA 1LC3A 1UZNA 3WTCA 4LVCA 1LDNA 3U09A 1KVTA 2IYOA 3LVFO 4OJNA 3VH3A 4BO5A 4CMBA 2X23A 3RUCA 2QIOA 3SEFA 2XF8A 4E5KA 4XKJA 3PTZA 4YJHB 1CETA 1UDCA 2G17A 3OF2A 1DEHA 4I9NA 3AOEA 3ICCA 2W2LA 3C85A 1MB4A 1UH5A 1PGOA 1U5CA 2QHXA 3AUSA 5CAEA 5JCJD 3G1TA 3ZGYA 4XYEA 1P45A 1WNTA 2GERA 2CVZA 3K9QO 4PLVA 2J3IA 4R5MA 3RJ5A 4YT8A 4WUVA 2B5VA 2VUSA 3I9KA 4ND5A 1GEEA 3DXFA 4GKVA 3RC2A 3JQBC 2JCYA 2J5KA 2X0JA 3D7LA 3FWZA 1ZZEA 3WICA 1HE3A 3U4CA 2D3TA 3NTRA 1MGOA 2IZ0A 3JD4A 4ZICA 6ADHA 1XA0A 4IJVA 4CL8A 2CUKA 3WOHA 5IDQA 2OBYA 3KHUA 5F21A 5H83A 4E33A 1FK8A 1A9ZA 3COSA 3E5MA 3W6ZA 4WCFC 1K5HA 4FFRA 3DC2A 1P1HA 4IJUA 5CP8A 3Q2IA 3X2EA 3TPCA 4FD3A 4DIFA 2DLDA 1YJQA 4MKZA 2CD9A 4MVJP 1GV1A 3D4PA 5EMHA 1NVGA 3DO5A 2NU6A 1YKFA 3W4IA 4MVJE 4IIVA 1DSSG 4KQXA 4U8GA 4CR6A 4XGNA 1M2WA 4TRJA 1UR5A 1ISFA 2C7VA 4J3FA 3E18A 2Y93A 3OIFA 3TWOA 1Q7GA 1IYZA 1EZ4A 5BSHA 1VRWA 5IZCC 4Z0PA 1KEPA 3EMKA 1NQOA 4CMJA 1DHRA 1OI7A 1JAYA 3BTOA 4F3YA 2VT3A 1V3UA 2JJYA 5EQFA 4UVIA 1GV0A 4N5NA 2AW5A 1AXGA 1HE5A 3WLFA 3WSVA 3GOHA 3ZZNA 4A7PA 1NFQA 3F4BA 3PK0A 4NR0A 3INTA 3WGYA 1U7HA 3PPIA 3JD0A 4GH5A 4W6ZA 3L6EA 4GSLA 2AG5A 4TZKA 3VC7A 1ISJA 3D5QA 2VYND 2WEKA 3M2PA 1LDMA 4QT0A 2GN8A 2ZQYA 4NZ9A 9LDTA 2AEFA 3EW7A 4FR5A 2XXBA 3ZWMA 4NI5A 5F1PA 3L6DA 2UV8A 1GYRA 4HFJA 4P4LA 1GQ2A 4DL9A 4RPKA 3OH8A 2O7QA 4BOYA 4CLRA 2AE1A 4ITUA 2FMUA 1PZFA 4BNLA 4IDFA 4BO9A 4YXFA 1IL0A 4YCAA 4FN4A 1E3SA 3VZSA 1IY8A 1YQDA 4JJFA 3STHA 3DAPA 3K5PA 1MG5A 3QSGA 4Z6KA 4XIJA 4DTIA 3I6QA 4Q3EA 1PSDA 2AEJA 1E92A 1WZEA 5KVCA 1Q7CA 4G81A 4YB8A 5B1YA 2FY8A 3LF2A 3FR8A 1EE9A 4QECA 4TRRA 4UEJA 3DFUA 4WLFA 2JD0A 2JKVA 2P4QA 4FDAA 4L4RA 3T4EA 2ZJ0A 1IPEA 1ZSYA 2B4QA 5TIIA 1NM5A 1OAAA 1LLCA 3AM5A 1U2GA 2BI7A 1JKIA 4DLLA 2I6TA 3NJ4A 1PJBA 4XD2A 4B4OA 3WBFA 4WJZA 4NFHA 1FJHA 4P4GA 4ZRNA 3SJ7A 3SC6A 4AJKA 3E6AA 5KWEA 1H93A 1ZW1A 1E3IA 4CM5A 5JDIA 1BVRA 3QWIA 1ZEMA 3H8VA 1B16A 1YE3A 1NFRA 5JYDA 2CVQA 2FN7A 4ALJA 2SCUA 3B70A 3N7UA 3ETDA 1X14A 4II2A 5T8KA 4NBUA 3GHYA 3P19A 3PIDA 2O2SA 4RZIA 1MFZA 1ULUA 1T26A 3GRKA 4AJEA 1HKUA 3GQVA 3OJLA 5JAQA 4BGIA 3VVCA 1XGKA 2VTEA 4BNTA 3ABIA 1YH3A 1KETA 4OL9A 3BMQA 1PJCA 3QIVA 1KVQA 4BKOA 4CMAA 3RU9A 1LRLA 3FHLA 5A03A 1FDUA 2EGHA 1GCUA 3LC2O 4FFOA 2F00A 2Z1NA 3JQFC 5TLSA 4A5OA 4NJMA 2C5EA 4J90A 1MLDA 1Z7EA 1WMBA 1GYQA 4IDDA 4OQYA 3GK3A 2CMDA 2J8ZA 1H9AA 1N92A 2C54A 4IGEA 5TRTA 2AQHA 5DOVA 2F1KA 1QLHA 5T6BA 3QWFA 3ZNNA 4DPMA 5CPFA 1UP7A 2RIRA 1T25A 3F5SA 1NTOA 4E2XA 1RM3A 4Z0TA 1ENOA 1BW9A 2X5OA 1JW9B 2NU7A 1G6KA 1KYQA 3A4VA 3EAGA 4H16A 4LSWA 3RC9A 5L7WA 2B35A 1ENZA 1P9LA 2CVOA 4A27A 4RCVA 5I9NA 2OOSA 5BSFA 4EJ0A 3B20A 5L40A 2WD8A 4J7XA 3SBOA 4BVAA 3TOXA 1YDEA 1P1KA 1YXMA 4JN6B 2WDZA 3WS7A 3GN2A 4U0KA 4CMKA 1GUZA 1F06A 1OC4A 3BMOB 1DC5A 3G49A 1HDYA 5U9CA 3EZYA 1DHTA 2GUGA 4IDCA 5ICMA 5JDCA 4MINA 3WIEA 3WNVA 3C7DB 4JNKA 2QRLA 4LW8A 3GEGA 4KTTE 1LLDA 3MJTA 4PG7A 4NBRA 2ZB3A 4YBZA 2Y1DA 2C20A 2O23A 4E5PA 1XKQA 4YWJA 1E6UA 2NVUA 4HADA 3RUAA 3UW3A 1HRDA 4CM9D 5JW6A 1T2FA 2BGMA 1KEVA 1GQQA 2NNLD 3TL3A 2PK3A 2I3AA 4OH1A 2J5QA 4DMLA 3Q11A 4BQPA 3TFOA 3ZWNA 5GZ6A 1I3NA 1U4OA 1SB9A 3KYCA 3VKVA 2W8ZA 1IULA 1XHLA 3DR3A 1VPDA 4D46A 3AUAA 1HYEA 2YHUA 3AM4A 3ZWVA 4XEHA 1HYHA 2X86A 4IY1A 1PZEA 2OL4A 4MP6A 4MO2A 3ZI0A 5LC1A 1E3WA 1HT0A 2WD7B 4YPOA 3AOEC 4DIOA 1C3VA 1U28A 4EJ6A 1D3AA 3WFIA 1C0KA 1Z7BA 3S1LA 4PVDA 5TGDA 3GEMA 3ST7A 3HN7A 5KJ1A 3JQ8A 1R0KA 4Y6RA 3KETA 4W7IA 4J2OA 1WDKA 3S55A 3VPXA 1CYDA 1J6UA 4YT5A 5ICSA 3FTNA 1AHIA 1UXGA 2BFPA 1H6CA 5JPIA 4F6CA 4HWKA 4M55A 1UXIA 5CG1A 4OXYA 1LUAA 4Q3AA 3KUXA 1ZIDA 4FC7A 4HXYA 3DZGA 4BUCA 1P1JA 3GMSA 3JD1A 5ENDA 4TQGA 2D4AA 2EKLA 2NLOA 4TKLA 2R00C 3H4VA 4CODB 1ENYA 3GZNA 1E7QA 4AJ4A 1E1NA 5BNFA 1GZ4A 2B4RO 2PR2A 1UXHA 5I7SA 3PLNA 3QJ5A 1E3EA 1DIBA 3AI1A 1RKXA 4NIMA 2BI8A 5HM8A 5C37A 3HDQA 4BNIA 3GVCA 4RVFA 3NX4A 4RVHA 3PQDA 1WP4A 1HSOA 5I7FA 4B4VA 3S2IA 5HS4A 2IZZA 3DBRB 3R6DA 3FBTA 5THKA 2C2YA 3WWZA 4BB5A 4R68A 3UH1A 3IUSA 4GWGA 3UFXA 2Y66A 1HDRA 2AQIA 3ZWOA 2RHRA 3DZIA 4CM3A 1PWZA 4R5HA 4YT2A 4D45A 4Z3KA 2C82A 2Q46A 4R51A 2W98A 2NU8A 3DMTA 5DULA 4B3JA 4P22A 2PD3A 5T5QA 3QQPA 2FSSA 5EIOA 2PZMA 5I9MA 1ZKMA 4W4TA 4Z9FA 1LI4A 2DBVO 2EGGA 3JQDA 2IZ1A 1TXGA 2G82A 3JQAB 1WPQA 3KSZO 3HFSA 1HDOA 2NTJA 3JYOA 2VWQA 4GL4A 3H7AA 4KDFA 4GX5A 3ASVA 1I30A 2NV6A 1SMKA 5KJFA 2WE8A 3LYLA 3TZHA 3DB2A 4XYMA 3B1KA 3WMXA 3LU1A 3F47A 3K2EA 4FOOA 4BO4A 2DAPA 1BGVA 4FJ0A 4IGFA 4A03A 4KP7A 3RFXA 1ZXBA 1HDZA 2NWQA 3AU8A 2D5AA 1R37A 2BLLA 4UULA 3PJEA 1J4AA 5I7EA 2EJVA 4YRAA 5LDGA 1UZLA 2PD6A 1U3TA 3WGTA 3VPGA 4JCOA 1X15A 3KLMX 4NK4A 3EDMA 1I3LA 1Z6ZA 3AFMA 1FDSA 3QW2A 3M6IA 4UEKA 1ZK2A 2HMUA 5KJCA 1V35A 3ANNA 1X7HA 3AUUA 2BFMA 4GGPA 3JQGA 2UAGA 4GGOA 3C1OA 2Y1OA 1JVSA 3G0OA 3MEQA 4BNUA 4PZEA 2PZKA 3AUTA 1LSJA 3DAGA 5G4LA 1M6HA 2HKIA 4BKQA 1Q0LA 4MIYA 5EJ2A 2W2KB 3WMWA 3FN4A 2P68A 3WNQA 4GMFA 2DTEA 3EYWA 3C7CB 5JDIC 5JAIA 4HV4A 5BNIA 4F6LA 5FEUA 1OMOA 3DOCA 1KC3A 1YRLA 3DBHB 1A27A 1NQAO 3Q1LA 1WDLA 3JSAA 3G17A 5T8KC 3RBVA 3QWHA 4R69A 4NQZA 1A9YA 4J0EA 1H2BA 2P5UA 3EGOA 2WYVA 4QXMA 3ROMA 2HJSA 3HZZA 1B26A 4EGFA 4BNYA 4H7PA 1GADO 5TX7A 1X7GA 1Q2XA 1QV7A 1LA2A 1NHWA 1PS9A 1HZZA 4CLOB 5TSDA 1LJ8A 3GGPA 4M89A 1D1TA 4IPTA 4RPLA 1R66A 5IXSA 2OORA 3K73O 3LC7O 4NBWA 3CZRA 1F12A 2JCXA 3H9EO 3IJPA 3HSKA 4EEXA 3ZHBA 3VZQA 2FWMX 2IXAA 3BIOA 4NK5A 2HRZA 1LRJA 2GDZA 4XQCA 1PGNA 5G0VA 1L7DA 1OBFO 3DZBA 2V6GA 1DRWA 4NU6A 5KOIA 2P9CA 2XAAA 5AXAA 4ESOA 5JFOA 1KEWA 2GD1O 3F1LA 3TRIA 1PQWA 2WTBA 4BS9A 3BHIA 4E2WA 3ONEA 1I3KA 1X1TA 3ZWPA 5B4TA 2UYYA 4BO8A 1Z45A 5FWNA 1ZFNA 3ZNQA 5DP1A 1SEPA 3MOGA 2JFGA 2WMDA 3A14A 2AEMA 4G5HA 4HKTA 2ZTMA 4CQMA 4GLOA 3LT1A 5AXDA 3WQRA 1Z75A 4FCCA 2C2XA 1ZK0A 1DC4A 3TF5A 3GF4A 4HFNA 4E6PA 4N7RA 4TZTA 1BSVA 5L3ZA 5A4DA 1DPGA 1JDJA 3VVBA 5IF3A 4I8XA 2DM6A 4JX8A 1QMGA 4FJ2A 4YT4A 3FRJA 1R0LA 3GY0A 3RSHA 3S2GA 4QSMA 2EEZA 2V6BA 3RUDA 4DYVA 1SNYA 1NWHA 1H6BA 1LDGA 5ER9A 1MG0A 4TVOA 3OBBA 2VRCD 3RI3A 3RQSA 2O50A 3MJVA 4CMEC 3O38A 1JU9A 1Y9AA 3A1NA 2BFAA 2ZATA 1H6DA 4L4SA 5JO9A 4DMMA 1GY8A 1Z74A 3E9NA 1PEDA 4XYGA 4PG5A 1PJSA 1XG5A 1I2CA 4QFCA 1SCUA 3E9MA 1YBAA 2B69A 5H82A 1PZHA 2Q3EA 4TRNA 4BNMA 3DHEA 4CUKA 3PGJA 1ISGA 2PGDA 3AK4A 4WGGA 3PHHA 1N1EA 3CZMA 1DDOA 3QWBA 1A7AA 1ZK4A 2WM3A 2DUWA 4BNJA 2GZ1A 4TWRA 1B3BA 1H9BA 1B7GO 1JKJA 3WDSA 4CV3A 2I76A 3D3EA 4BO7A 2JD2A 2PZJA 1EBFA 1DJNA 2CNBA 4D41A 5A9TA 1VE9A 4C4OA 2D8AA 4CV1A 1DIGA 4J4HA 3HFGA 4FC6A 1VL0A 4M8SA 4L74A 4LISA 4UVDA 1UZMA 3WQQA 2E49A 3SLKA 4RDHA 1CEQA 1GYPA 3TZCA 1ONPA 3MJ4A 2AQ8A 1C0LA 2O7SA 4W99A 4YJFB 3OP4A 2GCGA 3F3SA 2RAFA 4L76A 1WW8A 4RPJA 5JXWA 2YHIB 1JVBA 1V3TA 3CINA 4XRRA 3HJAA 1N9GA 1XQ1A 1YL5A 1Q0QA 2IE0A 3I52A 3QV1A 4DRYA 4BGUA 4PN3A 2IRWA 4RL6A 5KVVA 1EDOA 4R1TA 4U7WA 1YOVB 2A94A 1KVRA 4ZRMA 5IG2A 1O9BA 4E4YA 4AJNA 5TQVA 4OXKA 2HK8A 2W4QA 3PZBA 5J23A 5EQDA 1I01A 4J4TA 4GMGA 1YWGO 4GLLA 4J1NA 3KBOA 3W4JA 3PHLA 3IMFA 3KEOA 4IINA 4WCDA 5FF9A 3PJDA 4XRGA 2P9EA 4NHEA 3M2TA 2OBNA 1QP8A 3FF4A 3L9XA 4EZBA 2FZEA 1U3WA 5I8ZA 3KSDO 4RVUA 3B1JA 1DC6A 3WGGA 3GNTA 4IIUA 3T7CA 4JBGA 4XCVA 4TKMA 3RD5A 1X7DA 1EFLA 3CKYA 4J16A 4XB2A 4E0BA 2OXIA 4W82A 3V5NA 5ER6A 1MFPA 1BXGB 2CF6A 4MDHA 3BTVA 2PFGA 3DONA 4O1MA 4I5FA 3WYBA 3ZW8A 3UGKA 3O03A 2O3TA 4J1TA 1KOLA 4BV8A 1UP4A 3SXPA 2IEBA 1ENPA 4ND4A 1NP3A 3G79A 2A4KA 3QVTA 4GSKA 4J4BA 3U4DA 4KTVE 1LSSA 2LDBA 1E7SA 1QYVA 3PJGA 2WD7A 3MJCA 4LRSB 4TROA 3W8FA 2NTNA 1C0IA 1L7EA 1P77A 4K26A 4Z9YA 3MZ0A 2GN9A 1DXYA 2IEDA 2Y0CA 3OQ6A 4PLYA 1PTJA 1LU9A 2C07A 1ARZA 1YDWA 1ZK3A 2NM0A 1E3LA 4A73A 1FDTA 3P5SA 5IAAA 4BMVA 3VTFA 1WDMA 4IS3A 3RUHA 1P31A 1Y7TA 2X0NA 5A05A 4MKXA 1UDBA 1HZJA 5A1TA 4EJMA 3UOGA 4J43A 2PA3A 1ORRA 2HMWA 4L0QA 3GVXA 4D3SA 3OFSA 3PDUA 1VC2A 4M86A 3WIDA 4AJJA 2DTXA 3TZKA 3NTQA 2R6JA 5JO0A 4ILKA 3GVHA 1RM4A 3PJFA 4O5OA 5JE8A 3DBVO 2A35A 2VOJA 2D1YA 2I5PO 2QRKA 1NWCA 2EWMA 3DWFA 4BIIA 3NEPX 3PFWO 5ITVA 3WTBA 3GG2A 2FSVA 3QVWA 4AL4A 4BKPA 3WGOA 1JWAB 4QO8A 1K0UA 2O3QA 3CE6A 1HDCA 2QG4A 3DTYA 4A0SA 1HWYA 4YEDA 4P8RA 3OICA 3AOGA 4AVYA 5EN4A 1LDBA 4GVXA 4B3IA 2RHCA 1LSUA 3DBRA 3ROQA 3CPSA 2XXJA 4Q3NA 4Y9DA 1J0XO 4CQLB 3LSYA 1A72A 1E7MA 3ZV4A 4U5QA 3VKUA 5CEEA 2YUTA 3SC4A 2H5LA 2BKAA 2YFHA 1N2SA 3FTPA 1PQUA 3KB6A 3VOSA 5C5IA 4HFRA 4PRKA 1FMCA 4UUNA 1Y8RA 3P2YA 1HL3A 3MTGA 3EUWA 4OO3A 3OIGA 4GAEA 5ENVA 2VYVD 3JQAA 1IE3A 1OOEA 3GMDA 3IKTA 3V8BA 3BTUA 1IHYA 2YDYA 3HQ4O 1GZ6A 2D2IA 2VZ9A 4ND2A 1LTHR 1SZJG 1V0JA 3KVOA 3WXBA 4J91A 3MTJA 4WECA 1YJ8A 3GUCA 3KOUA 3CUKA 1P3DA 1TEHA 2X58A 3EZLA 3OHSX 4JGBA 1UJMA 1AGNA 3VDRA 2GZ3A 2HLPA 4A10A 3UCEA 1VL8A 1KVUA 3Q9NA 4JQCA 1JA9A 4B7UA 1CF2O 4QX6A 4ZHSA 5TJHA 4BMSA 5ES3A 4LN1A 1SB8A 1G0NA 1C1XB 4OAQA 1E3JA 3I9MA 2DBQA 4ZQFA 5GY7A 2YFQA 3S8MA 1KY4A 5TC4A 1I36A 2JD1A 3W1VA 1BDMA 2V65A 3F1KA 1NAHA 2PGLA 4S1VA 4EUHA 3ANMA 1HE2A 4AJPA 3IUPA 4PLTA 1PJLA 4HY3A 2HQ1A 2W2KA 3NT4A 3DAFA 3TN7A 4B7XA 4RORA 5LCXA 5BT9A 1U2DA 4H15A 1K6IA 1I33A 2CDAA 2O3RA 2Z5LA 5L4NA 3WSWA 2W90A 5DOZA 2IXBA 3FNHA 4JBIA 3RKUA 4X54A 2Y1EA 2GRAA 3DBHA 3AJRA 3G1UA 3WX0A 5DT9A 2JCVA 1U3VA 4GPD1 4IDBA 3BHMA 1GPDG 2ZK7A 3ZW9A 1O0SA 2ZQZA 2ET6A 4BNZA 1NVTA 5AVOA 3ZV6A 3TL2A 2HU2A 5H81A 3TQHA 2D0IA 4DBZA 3BMNB 4CLOA 2GF2A 5HS6A 1F14A 1HF3A 3GNQA 1AUPA 4BNFA 4UREA 1A4IA 2DU8A 4DBVO 4IXTA 1S7CA 3HDHA 3PIIA 4CM4A 3V2GA 2TMDA 2VZ0A 2RBEA 5L4SA 4DREA 3L4BA 2FRDA 3H5RA 4EUFA 4RJTA 4Q39A 1K6JA 4CV2A 4PCVA 2EF1A 3DZJA 3PYMA 5IDXA 3DEYX 5JCJA 2ILTA 4MIOA 5C3MA 5I9LA 4EYEA 3PXXA 4OKIA 1QORA 4BO3A 2H1SA 1UAGA 3K30A 5DCYA 3H9QA 4QEDA 2E6UX 3WR5A 4PVCA 1XCBA 1WLYA 5TT0A 1RWBA 5AOVA 5K0ZA 2VOEA 5JC1A 3H6KA 2ZIZA 2NTVA 3IP3A 3U4IA 1EBUA 3EVTA 4LRTB 5DCWA 5HBRA 5JLAA 3RAJA 5KJEA 4MP3A 1EQ2A 3OJ0A 3OJOA 3WGQA 3M1LA 2A9FA 5A5EA 2PZLA 4ZQGA 3PLRA 3CH6A 1GQYA 1GPJA 2D59A 3V1UA 1NAIA 2TMGA 4YA6A 4R3WA 3RU7A 1R4NA 3QA9A 4WKGA 1KVSA 2X7HA 1JTVA 1P0CA 3NKLA 4RLSA 4XA8A 4BO2A 2I9PA 4U6SA 2EKPA 4PLGA 4NFSA 2YQ5A 3F9IA 5KKAA 1HEUA 4H3VA 2Q1UA 5IZ4A 1D7OA 5L7TA 4ROSA 1EK5A 2JHGA 3BA1A 2EKQA 2ZB7A 4JXKA 5DF1A 4KWHA 1ADGA 4KUGA 4FBGA 4J9UE 4J9VA 3HG7A 4AG3A 5F5LA 1BRMA 1ADCA 3NGLA 1MV8A 5THQA 4D43A 3GZ4A 4PRLA 4B3HA 3Q6IA 4NFYA 4IDEA 5TJ9A 1OZAA 1K6XA 1CRWG 4GQAA 4AICA 4DGSA 3L0DA 2PKQO 4L73A 4BNHA 2VRBA 4D7AA 3ADOA 2VHZA 4UUOA 2EW2A 1QYDA 3IQDB 3NJ8A 1E1KA 5EERA 4XQGA 3ZH2A 1WVGA 3Q0EA 3HDJA 1GFSA 3B6ZA 3U0BA 3VDQA 3WGZA 2VYNA 3GGGA 3I9OA 4ZN6A 3H5AA 1N5DA 3AW9A 1SOWA 3CSDA 3OJEA 1BMDA 3HWRA 4URFA 4CUZA 1NFFA 2DBRA 4DQUA 5KNLA 4XYBA 4YJFA 5KVQA 2IODA 2VHYA 2YHIA 5ADHA 3DMYA 2ZJ1A 2B4TO 3C1TA 3WGIA 4RF5A 4KMSA 4YAJA 1VJ0A 3DL2A 4BHTA 3NUGA 4DPKA 3JQEA 1PJTA 1YOVA 2PTGA 2BD0A 3H3JA 4CJXA 4PLPA 4OGWA 2VN8A 1I10A 1PX0A 3I4FA 3FNGA 3OM9A 2EJWA 3KXDA 2BF7A 2Q1SA 4Y8VA 3QRWA 1HDXA 2DT5A 5HTOA 4FGWA 8LDHA 5GMOA 1OFGA 1H5QA 4YRDA 1QG6A 2OMEA 4R54A 3PWZA 2XOXA 4OYRA 3U62A 1PGJA 1D8AA 1PJQA 2OP1A 2PLAA 4YJHA 3PWSA 3M1AA 1QYXA 2FPIA 2YV3A 4G2NA 4BGVA 3P2OA 3FNFA 5KCZA 2NADA 4CMIB 4EITA 3MJSA 1RPNA 2BMAA 1NHGA 1TT5B 3GT0A 4NH4A 1AXEA 4XQEA 2OUIA 4UVHA 3LDHA 4R9SA 1L1FA 3HHPA 1O89A 4LCJA 4BNXA 2Q99A 1V9LA 1GUYA 1BWSA 4I5DA 4WE3A 5B12A 4CV0A 2ZKLA 4RVSA 3W4KA 3KYDB 1GUFA 1U5AA 1V3VA 4NPCA 3AY7A 3QVXA 1ZMTA 1HE4A 3D4NA 3WYCA 1GTMA 3ZHXA 1Y5RA 3EHEA 4RQUA 2HCTA 1JWBB 3DZFA 5FI5A 5C7OO 4J49A 1F17A 4K28A 1FXSA 4XR9A 4Y98A 1PL6A 4ND1A 1EUCA 1DAPA 1Y8QB 2G1UA 5G4KB 2X9GA 4YJDA 3GVIA 3H9JA 2CFCA 1EDZA 1ZO8A 4OHUA 3VH2A 2O3UA 3BMCB 5TF4A 3RC7A 4DIBA 3RBZA 3ZN2A 3DHYA 1BG6A 4MVJM 4JROA 1E5LA 2O4UX 1ISMA 4LCEA 1XQ6A 1YBMA 2Y1GA 4E3ZA 3TFQA 2W2LD 4Z0HO 1N7HA 1X0VA 1PZGA 3RFTA 1PGQA 1RYDA 4PLZA 1PS8A 1BDBA 1CQIA 1ZVMA 1X1EA 3ETGA 2AA3A 3UCXA 3PEFA 2P5YA 3GPDG 1UUFA 2O3JA 4YJGB 4FFPA 4AJOA 3GA0A 3PDJA 4J2HA 4D0RA 4ZVVA 4LVUA 5FYDA 3RJ9A 1A7KA 1DC3A 2G0TA 4XZ3A 3TSCA 3WBBA 4CM1A 2NUAA 1ZUD1 5JMPA 4ZQBA 4UAGA 1KC1A 4AJLA 4Z9XA 1HLPA 1MP0A 4NG5A 3PQFA 4CMGA 4IM7A 5B4VA 5G0SA 4XDZA 3PQEA 1GAEO 4M49A 2HK9A 4OSPA 2HDHA 4E12A 4AJ2A 5IDYA 2QZ9A 3NGXA 4R41A 4O6VA 4ALIA 4PFJA 4XYLA 4E30A 3GNSA 2DPHA 3E1KA 1D4FA 3HE3A 4N18A 4B4UA 3PP8A 5DP2A 4CQLA 5A9SB 1PQPA 3FCOA 5G0WA 3ZCXA 1O6ZA 1JAXA 1WWKA 1IUKA 4KUEA 1E7WA 1JLLA 1Z82A 2DFDA 1X13A 4Q3DA 4UUMA 1MC4A 3O4RA 4MPDA 2ZYGA 4PLFA 4B8WA 5IXYA 4MIEA 1BXZA 4IZHA 4BNKA 4BQRA 3JQ7B 4UVEA 5A04A 1ZJZA 2NQTA 3ROPA 1IZ0A 4IZIA 2B0JA 3DFZA 3GDGA 4CM9A 2AXQA 1TT7A 5IDWA 3PVZA 1W73A 4RGBA 4PLCA 4R16A 5ILGA 5BSEA 4GVLA 1VL6A 1R12A 1ZBQA 4NJOA 1XWFA 4JLWA 1XU7A 5U4QA 3HB5X 5IN4A 1ZMOA 1U1IA 4IJWA 3KZVA 1LXCA 3GAZA 4XR4A 3WGHA 2Y1CA 1LDEA 2Q1TA 3I23A 2RCYA 4E5NA 1HDGO 2P4HX 4FGSA 3VH1A 3L4BC 4UUPA 1ID1A 3ASUA 3L6OO 4YVFA 5AXCA 3KYBA 4EI2A 5CDUA 1EK6A 1QYWA 4WEQA 3ZWBA 2G5CA 2UUOA 2I67A 1M75A 4CM7A 5JDCC 1B14A 2H63A 2Z1MA 5DBIA 4BL5A 4JBHA 1UXKA 1XLTA 1CDOA 4JP2A 4BGEA 1LQUA 1NR1A 2P9GA 3LC1O 3H5NA 2QYSA 5IN5A 2WSBA 4A26A 1PIWA 1E1MA 1Q7BA 3A28A 3KV3O 4O0LA 3JQ9A 5KVSA 4Q3BA 4BKUA 1HTBA 1VJ1A 2X0IA 4QTZA 4XGKA 5L51A 1I8TA 1Q0HA 3MOIA 1HSZA 1T24A 2ZB8A 3QHAA 3KYCB 5K9ZA 3DZHA 3KO8A 2PKQP 4J1SA 2Z95A 5FFFA 3UXYA 2FZWA 5G2OA 1Y9EA 3PHIA 1I2BA 1P1RA 4A2CA 3AI3A 1A4UA 1I32A 3H2SA 3L9WA 1P1IA 4LK3A 4E21A 4YQYA 1FDWA 1T1RA 1LSOA 4OM8A 2HMVA 4P4NA 2C0CA 1HXHA 4IMPA 1EVYA 1PR9A 3OQ1A 4HUJA 4AJIA 4D79A 3QVSA 5KTKA 2NQ8A 1NPTO 4KWIA 3IS3A 2Y0DA 4HNHA 3QE3A 4WK6A 4E31A 2QZZA 3BMNA 2EXXA 4GX2A 1A71A 4IUYA 3AI2A 1R6DA 3ZU3A 4C7JA 3QP9A 3PRJA 4GX0A 4J6FA 5JMWA 3OEWA 2J6IA 3QWAA 5TNXA 1ZEJA 5KIAA 3ENKA 1A5ZA 3I3OA 1QLJA 3BHJA 3DQPA 3VZPA 1RJWA 2V7PA 1ONOA 3H9UA 4Y6PA 3RASA 5A3VA 4D42A 1QKIA 4KQWA 2X9VA 1R16A 1GDHA 3FR7A 1U3UA 4HFMA 1ZNQO 4ZU3A 2NSDA 4FFNA 2GPTA 2QW8A 3D3WB 4WEOA 5I8WA 1LNQA 1SBYA 1E6EA 2HUNA 1NPDA 2BFOA 3BMOA 2CDBA 1CJCA 1SAYA 4RV9A 1V8BA 5L95A 5JSFA 2WE7A 4FS3A 2VNAA 4D44A 1FDVA 5CPBA 3RUFA 3ITDA 2GSDA 1ZH8A 4WLOA 4MVJF 3WG9A 4MJLA 4LMPA 2AMFA 3LT0A 3WQSB 2BGLA 2Q50A 4BV9A 5CDSA 3PHJA 3BZUA 2AHRA 1ZK1A 3GFGA 1RM0A 1XDWA 2FPPA 4LSMA 5AXBA 2B36A 4FSHA 3PHGA 4BO6A 1E6WA 3IIEA 5C7LO 3PFFA 2B5WA 3L4SO 3JD2A 5CDYA 1R4MB 3GR6A 4PGFA 1DFGA 5FI3A 3DMTC 2ZTUA 3GAFA 2O48X 4XGIA 4CLHA 1NQ5A 4ALLA 3G3EA 4TSKA 4WASA 1NVMB 1I0ZA 1DIHA 2Q2QA 1ULSA 1G1AA 2J3JA 4YAKA 1DOHA 3ONDA 4PZCA 4WLUA 2NVWA 2CZCA 3BYZA 4WCFB 4CM6A 1B3RA 1YS4A 1AHHA 3KLPX 4EUEA 3U3XA 3BTSA 3D0OA 1DLIA 2ZTLA 1I3MA 2E82A 3PZRA 1OC2A 2EERA 4RPHA 4JP3A 3VPFA 4IBOA 1M76A 1EUDA 5B4UA 3N74A 4HBGA 3GUYA 4ZD6A 1NYTA 3EK2A 2ZYDA 3JYPA 1VI2A 5EL0A 2R00A 4R9RA 5A9RA 1SO8A 3ZU2A 5CHEA 3JQGB 4DA9A 3H9GA 3LT2A 4E5MA 3U5TA 4NMHA 2C29D 2E4AA 4M54A 5U1PA 5DNAA 1LDYA 1DJQA 4R4JA 1KEUA 2VHXA 3NRCA 3IC5A 3B1FA 4QFDA 1PL7A 9LDBA 1YVEI 2XPCA 4J1QA 5KKCA 4HP8A 4YRBA 1DLJA 4HNGA 2C7GA 3RVDA 3IP1A 2I65A 2X8LA 1MX3A 3L07A 2FR8A 1LQTA 4KOAA 4OXNA 2NU9A 1F8GA 5MDHA 3D4OA 1YL7A 4XX0A 5A3JA 1HETA 2VT2A 2BH9A 5T57A 1Q1NA 4OQZA 4RVGA 4C7KA 5A5FA 3T7EA 4QUKA 3R3SA 3WJAA 4M87A 1IZ9A 3V1TC 4R3NA 1TVEA 3FD8A 2HO5A 4N5MA 3HB4X 3K6JA 5JYEA 2E48A 4B79A 3R1IA 1O8CA 5F3RA 1EMDA 5I7VA 1PS0A 1WZIA 3K96A 3OETA 4JJIA 5COBA 1QXSA 4I5GA 4TRMA 2Q49A 4U6QA 3JYQA 4YR9A 4YQZA 4WNCA 4II3A 4JK3A 1ADBA 1KS9A 3NTOA 4E13A 4CMIA 1XIVA 5KJ6A 4RPGA 2DKNA 1TT5A 3HADA 3GDOA 3UKOA 1U8FO 2VTDA 1YBVA 4DLBA 1FF9A 3ADPA 2H6EA 4LGVA 4RQTA 3UICA 2VRCA 3KYDA 2X6TA 3GEDA 1K89A 3DTTA 4IMRA 4ND3A 4ZQEA 3ZWYA 5B37A 5JAMA 1B8PA 4K6FA 1MXHA 2OGUA 2OZPA 3RUEA 1B8UA 3GLQA 3LT4A 1GD1O 2I3GA 4B8ZA 4DC1A 2VCYA 3EC7A 5CEFA 1Y8QA 3AY3A 1JN0A 1VKNA 5G4KA 3NYWA 5JS6A 3MWDB 3I83A 3E5RA 4FOSA 2YYYA 3L77A 4BNVA 4CQMB 2VNSA 3AWDA 3BMCA 3IJRA 3KEQA 3QVOA 4MP8A 5HA5A 1C1DB 3A06A 2EG9A 4ZQHA 1E7RA 3UVEA 2VWHA 2H9IA 1R0SA 3TZQA 1PL8A 4CM8B 5IFLA 3W8DA 1LEHA 4IQ0A 2HAEA 3IOYA 3U4HA 3LLSA 4YJGA 3OJFA 3VAZA 4UEOA 4DYDA 5EESA 2Y67A 4EW6A 4ZGWA 1W6UA 2BHLA 3ZV5A 3H2ZA 1P0FA 4EBFA 3ANLA 2JHFA 3SJUA 1EVZA 3JQ9C 4IDGA 4W9NA 4R1SA 2FOIA 1E77A 1UAYA 3F4LA 2HK7A 2DC1A 1T4DA 2Q4BA 3OA2A 3GC6A 4E32A 4AJHA 1MUUA 1U8XX 2DBZA 3O8QB 1WMAA 2PWZA 4D0SA 2DQ4A 2OHXA 2NVBA 5CEJA 4MVJD 1XU9A 3VPHA 2VWGA 3UN1A 3ZWXA 3TDKA 4CMCA 7ADHA 4DWVA 2GZ2A 5A9SA 2FP4A 4MKRA 4UVGA 4U0JA 1I5RA 3JTMA 1I2ZA 2J5RA 4Z3DA 6LDHA 5JBIA 3F6YA 1E0DA 3FPCA 1LX6A 3RUIA 4R1NA 4EDFA 1YB5A 4RDIA 1NPYA 3JQ7A 2PH5A 2DPGA 2WJPA 4BMNA 2VWPA 1NR7A 4N5LA 3C8MA 3C3XA 3E9QA 4FJ1A 2IYPA 1Y81A 3MJEA 3W6UA 3AU9A 3FI9A 3GDFA 4XB1A 1LLQA 4NDNE 3VH4A 3I9LA 2PD4A 4MVJH 1DIAA 3DBLB 4MOWA 2X22A 2YJZA 1H0KA 1WAMA 1C0PA 3O9ZA 1N9GB 4INAA 1O94A 3V1YA 2DTDA 1DIRA 2PGJA 4G65A 4RO0A 4ALMA 4ID9A 3DOOA 2GYYA 4KUHA 3OECA 4IS2A 1EFKA 1K3TA 1T4BA 1VSVA 3K92A 3E03A 1QRRA 3CMMA 3H65A 4BNGA 3RROA 3D5TA 8ADHA 2Q4EA 1IB6A 4J0FA 2YY7A 4CUJA 3VTZA 4L8VA 1U4SA 5DBGA 3A9WA 2ZTVA 3D1LA 4PLWA 3TNLA 4DXHA 4BNWA 1PR3A 5COAA 5G0TA 5TS3A 4I1IA 3VPSA 1TA4A 3WWYA 1B2LA 1PJ4A 2YW9A 1LRKA 3FPLA 4YAEA 4YAIA 2JAPA 3MWEB 4CMEA 4MVJI 2X0RA 3CIFA 1T2DA 4ALNA 3TOZA 4DUPA 2O2YA 4HX5A 4QQRA 4E2YA 3NT2A 3PYXA 1E1LA 2O3SA 4NBTA 4WPGA 1GZ3A 1QR6A 1UP6A 3GG9A 1V6AA 3OSUA 4KDEA 3JQCA 1S6YA 3GVPA 3RKRA 3HUDA 2GR9A 3K2BA 4WLNA 4QO7A 3UAGA 4BKRA 3C24A 2AQKA 3OEYA 1KY5A 2Q2WA 3DDNA 3S2EA 5K6AA 3ORFA 4RVDA 1QYCA 1RM5A 1VLLA 1DB3A 4F45A 1H2HA 1O5IA 4CQMD 2BELA 1TLTA 4GBJA 4K1LA 1LC0A 3OMLA 3ICPA 3NV9A 3Q2KA 3DOJA 3ONFA 4I9UA 2X5JO 4B4WA 2EIHA 3IDSA 5CDTA 4EEZA 2QX7A 1EVJA 2A92A 4GWKA 4J7CA 4WLEA 1M67A 4FFMA 2I66A 2FHSA 2JFHA 4IQGA 3WJ7A 2YQ4A 1B0AA 1AN9A 3I5MA 1DFIA 1W8DA 1XEAA 3WYEA 1UDAA 3ZU5A 5DBFA 4N54A 5A06A 3E82A 2EV9A 1LBEA 2OP0A 2QYTA 4I08A 4DQXA 2UUPA 3CXRA 5L53A 5JY6A 2HMTA 4PZDA 2Y05A 3GFBA 3KM0A 1VKOA 1NX6A 4PIVA 1P1FA 2CF5A 3ZWWA 3C1AA 3HNPA 2VYVA 4J7UA 3GH3A 4YAGA 4WNIA 2EW8A 3EVNA 3E48A 3P7MA 3D3WA 3ZWCA 2X9NA 2BGKA 1KIFA 1EUZA 1F8FA 1PWXA 5BR7A 3GN1A 4FW8A 2JAHA 3NDIA 2VHWA 1Z73A 2Y99A 3ZHYA 1KBZA 1ISHA 3QLJA 3RFVA 4IJKA 2O4CA 3ZU4A 5L45A 5F5NA 4FQ8A 1N7GA 1XYGA 4PG4A 4L9RA 1M66A 4TMFA 4FIZA 5A02A 4S3MA 1YQGA 1P33A 1DO8A 3F46A 4CL3A 4ZA2A 4F46A 1T2EA 3FSRA 3ZNPA 1M6WA 2E37A 5JC8A 2B37A 3BXXA 4O63O 4W7HA 5JCXA 3GPIA 3PI7A 1BXGA 5GZ1A 3V2HA 3JV7A 1R4MA 1Y8RB 2OO5A 3JQBA 3NT5A 4KZPA 1IPFA 4CLRB 2X1HA 1QSGA 1GU7A 2C59A 3UUWA 2I99A 1DRVA 4YACA 5AQ1A 2HJRA 5C7IO 4BNNA 5F1OA 3RCBA 3ZNOA 5JNLA 3WFJA 1X0XA 2WWRA 3W8EA 4MVJG 1IHXA 3FNEA 4D3DA 3DZKA 4YTEA 2ZCVA 1YQXA 2ZB4A 5EINA 4I5EA 3UF0A 2DUUA 5CG2A 3UCFA 2QRJA 2CY0A 4WCFA 3INGA 3OQBA 2GLXA 2VZ8A 3MCVA 1C14A 2GN6A 5EPOA 4L75A 3ZHZA 3EY4A 2VUUA 1HYGA 1PU2A 5DDIP 3DHNA 3RBXA 2PKRA 1DRUA 1NASA 2Q1WA 2WYUA 3AY6A 4L4XA 3SVTA 4BO1A 4RZHA 2CDCA 3IAHA 2FR0A 1N1GA 3PYLA 2FPGA 3KRTA 4NU5A 1G0OA 3ZWAA 3SLGA 3KSUA 4XWYA 1HLDA 4Q9NA 3K31A 1NNUA 5IZCA 4MVJA 3CMCO 3HDYA 3LLVA 2JFFA 4ZJUA 5JY1A 2POQX 3X2FA 4WOKA 1ISIA 1K2WA 1ML3A 2GASA 3FBGA 3BAZA 1TB4A 2PH3A 5ITWA 4NNJA 1T2CA 3E8XA 3R3JA 1PJ3A 1H94A 2HRBA 4O59O 3SX2A 1RYEA 3GHHA 1QV6A 3OIDA 1DAOA 3ENNA 3LZ6A 3ULKA 3WB9A 2AE2A 4P38A 3BMQB 5TT1A 2HMSA 3R0IA 1GCOA 2X4GA 2YV2A 1BVUA 1E5QA 3C7AA 1YL6A 1YGYA 3V2UA 4CR8A 1ZSVA 4OSOA 4NJMB 1D1SA 4CMHA 1XELA 1E7YA 1ZJYA 2VHVA 2CSUA 1VSUA 3AM3A 1DBVO 3NDRA 4W9NC 5HRUA 4IDAA 4OMUA 1ADFA 2GN4A 1VJTA 2YZ7A 2FR1A 5T64A 4CR7A 4FPXA 1T2AA 4E2ZA 3JYLA 3LQFA 4I9HA 3IL2A 4YYZA 3JYNA 4D3FA 4XJSA 3QY9A 1BW9B 3NAQA 4JJGA 2QQ5A 3I4CA 3GGOA 4DQVA 4OOEA 4CPDA 4OKNA 4PG8A 2ZYAA 4CM4B 3JCZA 2R2GA 4XJTA 3I9NA 5L7YA 3Q9UA 4E5YA 2PY6A 1BTOA 1GEGA 4XDYA 1YB1A 4DC0A 4BB6A 3VZRA 2D5CA 1GR0A 1B15A 1XR3A 1SEVA 1AE1A 3RIHA 5G0UA 2G76A 4GX1A 1J5PA 5CDGA 1WXDA 2DFVA 2PV7A 2EP7A 2GGSA 1BXKA 4DVJA 4Y67A
chains in the Genus database with same CATH superfamily
2HV9A 1JT2A 2UZ1B 1H0HA 4YMVA 4Y2PA 1JIQA 2CXXA 1SHUX 1WTAA 4NZOA 4ZRDA 5DM0A 5IMBA 1C1XA 3ASZA 4KAFA 3MWDA 2JL1A 2VDWB 3A1UA 1YONA 2HN9A 3TL6A 2AZTA 4DQLA 5BXQC 4C6SA 1YS9A 1JDUA 1P5RA 3W2TA 3TH5A 4YDRA 2J9XB 1NBOA 1C1DA 3LTEA 5E0KB 3JQAD 5IU6A 2X5KO 3EG9A 3D3NA 1M1YB 4UHJA 2Z3ZA 2Q6TA 2AVNA 3CU5A 1H2WA 5K0CA 3BF8A 2VHCA 1JG4A 1X9IA 5K8UA 3IDQA 1MAAA 1CCWA 2DFTA 3NTLA 1XMJA 5B64A 2FUNB 4CM8A 3LYHA 2G83A 2V6MA 4TLCA 4H6WA 4FUQA 4DJAA 4R2WA 2I78A 2Q3JA 4RF3A 2NSYA 3EGDA 1Y3BE 5KPJA 3INRA 2VYCA 3LGAA 4IQ8A 2IS1A 1RKQA 3LK7A 1Z34A 2VXOA 4XEUA 3JQFA 4WBNF 1ZD3A 4P53A 1E3WB 4FEEA 2SBTA 3SS8A 1YO6A 1T1SA 3LXRA 1XTZA 1N0WA 4FFLA 2V54A 5EOVA 1RZVA 1SBQA 2BKEA 4LQCA 2A86A 4IHJF 1DUVG 1BHSA 3LOQA 3A2NA 2AKAB 1MA0A 3QFTA 3ROTA 1OAOC 1IRIA 3T34A 1DDIA 2EJTA 2VLBA 3ITKA 1UKEA 4WLVA 2YXDA 2JZCA 3AP3A 1UXJA 4WY2A 3JX9A 1NKSA 1XVLA 5LP6B 1ISRA 2DJIA 4C20A 5JNUA 4Q16A 4OY3A 4R1UA 3DFIA 4IV0A 1WEHA 2H2IA 4W8HA 2ZRAA 1CQJA 4OAOA 1YKSA 2Z6AA 1NQTA 2CL7X 2YV5A 2WG0A 3G9QA 4EG8A 2EHDA 1NUAA 2J3KA 1XMXA 1U9YA 2Q0HA 2QL9A 3A4TA 4B7CA 2ANBA 1YB4A 4KO3S 3UQZA 4XD7D 1EEHA 1BX3A 2YDXA 3B5JA 2O8NA 3QM1A 4RHXA 4C2BA 1XWWA 3LF1A 4G5QA 2BI4A 2ABWA 2UXBB 4DTCA 2NACA 1G2IA 3F2VA 1R15A 2J7PD 2RH4A 2AYYA 5DGCA 4CIYA 1JR3D 3K1YA 3CRW1 1PGPA 2INGX 3K8YA 1WNFA 1Z0UA 2AGVA 2VAMA 4MYCA 1D2AA 1TI7A 3RT7A 2ZCJA 5ALHA 3GJRA 5AJZA 5BSGA 1ONNA 3DP9A 3DDCA 4EY7A 5CFQA 1PYGA 2B83A 2QLTA 3N8NA 2ZYVX 3DGFC 3KQYA 4KV9A 4R01A 4RSHA 5TVGA 1ZL0A 2DF8A 1JGTA 1JIIA 5EQJB 2P2SA 2GBIA 4DQKA 1A9XA 3NWJA 1TQ8A 5KJ1A 3DE6X 3I64A 2GAOA 4LMRA 4YDSA 3G2QA 4BFTA 1XV5A 5BNTA 2WU3A 3CT6A 2HIAA 3G9XA 3IA2A 6NULA 2Y68A 4UBLA 4QU8A 5DASA 5J4HA 3IP6A 4MW5A 5GGYA 5AYVA 3L8CA 3HCWA 3UMRA 1JU3A 4GI2A 5AICA 3JARB 3KQPA 3W9SA 3K8ZA 2ZXFA 4NBVA 3M83A 4FQ5A 2BEWA 3EVZA 2RI6A 4CT5A 1E3DA 2VP9A 5H1YA 1RDFA 2VUTA 4Z9BA 2C2MA 4JODA 1U2PA 1GPBA 2R6FA 3HR8A 4XJXA 3T4XA 5COQA 1WF6A 2Q8NA 5DB4A 4G6ZA 4LVCA 4C5AA 1HV8A 1C7ZA 1VBNA 4RY0A 3KXIA 1X77A 5KSPA 3T99A 1E1DA 3AHIA 1EDEA 5MN5A 2O8DB 3HY3A 3IP8A 4CMBA 1CZOA 5JWRA 2QIOA 4XKJA 1I5OA 4YJHB 5H4HA 5CT5A 4LFAB 4B40A 3OKCA 3I3SR 2ZM5A 4FMCB 4EG0A 2WAMA 1ETUA 3KLNA 1KAHA 5ADUS 2OCAA 1MJFA 3OCCA 4GLBA 3ICCA 1E94E 2BBSA 2W2LA 3FX2A 4K03A 4J0GA 1YZVA 3RFFA 4E4TA 4AMBA 2QHXA 5CAEA 3KQTA 3G1TA 3PL1A 2I2FA 3HKEA 4FZ5A 3I1IA 2CVZA 3RJ5A 4R5MA 3EZGA 1ND5A 2P27A 3RYFB 4BTVA 1MDFA 2VUSA 3I9KA 4ND5A 5AW6A 3OLVA 1CZUA 3U0VA 2HCBA 1E0JA 2CHGA 2FSIA 2P79A 4OK3A 3W3AH 1PEYA 3RK0A 1NP6A 2QPAA 4HH1A 1RBMA 2XUFA 3CC8A 2B1JA 1F6BA 2IPAB 5EKDA 2YVUA 3WICA 1RHQA 3QUQA 3GCZA 4ZICA 1RPZA 4PS1A 1EUCB 4HRVA 4CL8A 3THSA 4EF6A 2CUKA 2G08A 2FWJA 3ZK7A 2L69A 4R2IA 5CA1B 1YMVA 1FK8A 2IHVA 5AKJA 4BLOA 5BR1A 2WZQA 1VZ3A 4WCFC 1K5HA 4FYMA 4MR8B 3DC2A 1P1HA 3K6KA 1MAVA 1UFKA 4MQMA 4DARA 2VC2B 2JLZA 1FRVA 2V0GA 4O1HA 4FD3A 4LE0A 1YJQA 2ZWAA 3DFFA 5FUVA 1VJDA 1HE8B 1TO6A 1W4AA 4F3TA 1GV1A 4Z8YA 2DOKA 3CLSD 2QSUA 1V11A 4JXJA 3CFYA 1VKHA 3I0MA 3ZE6A 1R0CA 1KFKB 4IIVA 1T8PA 3JSXA 3Q7IA 4L2IB 3PNKA 4U7PB 3NWPA 4XGNA 1UJBA 5IVHA 2OAEA 1BIFA 1GPYA 1J2TA 1IWOA 3OE1A 4EKNB 4ZK2A 5A6VA 5K09A 4OLAA 2I4IA 1TAUA 2Y93A 3OIFA 3DTVA 3NTVA 1Q7GA 5C8YF 1ESDA 1EZ4A 4OJYA 4OMDA 3SR3A 5DVZA 5FTNA 5IZCC 1QPZA 4LTNA 1KMHB 4MV8A 1DHRA 4QD3A 2C9ZA 5KYTA 1JAYA 2ZSAA 1G21E 1AZWA 2FWNA 3BTOA 3QELB 1FFEA 4F3YA 1J06A 2VT3A 2YJ3A 2H59A 2ZT6A 3M6MD 1GV0A 2ZSKA 1QRSA 2G40A 2CFRA 3DL4A 5TF0A 3NNDA 2O2CA 3WSVA 2PKCA 5IKEA 3ZZNA 5FI1B 4A7PA 1Y4ZA 3F4BA 4WACA 1P73A 1ZM3A 4HDKA 5JRJA 3WGYA 4BV2A 3JD0A 4LX0A 5IKMA 2WPNA 3KSBC 3BIXA 2WOOA 4TZKA 3VC7A 3TD6A 2E87A 3MINB 5ICEA 3EPPA 4Q24A 1AUXA 4MUIA 1NXXA 3MWFA 3CSSA 4G0UA 2JJQA 2NZYA 4ZT5A 3EW7A 3IPAA 2XXBA 5H3LA 3OX1A 3ZWMA 5JHHB 3FHTA 4W8OA 3Q3VA 5BNZA 5CVUA 1MRNA 3QVMA 1WZNA 4DL9A 1Z26A 5C7YA 3OH8A 4BOYA 1DCFA 1CUSA 3CHYA 1IMJA 3EXAA 2AE1A 4MK4A 4PBRA 4TTQA 1PZFA 4QDTA 4IDFA 3WK5A 4YXFA 3IYLW 3IAAA 3E8SA 3R20A 2QG9A 2BFWA 4ZT4A 3T15A 1E2JA 4RFLA 1IY8A 1YQDA 2Z2JA 3B6IA 4JJFA 4XLZA 3DAPA 1P4GA 3K5PA 4HL6A 4D3XA 4XSHA 3I6QA 2Z2IA 1TZKA 3CUYA 1WZEA 4YI5A 5G3ZA 2FFQA 2HMYB 3AVWA 1A4RA 5B1YA 1F3OA 4KIUA 1Z13A 1QG0A 3E05A 4UEJA 5HCIA 2JKVA 2P4QA 3R74A 4EF5A 3T4EA 5TIIA 1GAWA 4C88A 2B4QA 1V9SA 3I5UA 2GX6A 1CUEA 4JJ4A 3QW4B 2XRMA 1KYWA 2G63A 2PQ2A 4L8YA 4IF4A 3U37A 5FPQA 3NJ4A 1XDGA 1G64A 1MEJA 3V9PA 3EGXB 4XD2A 3L0OA 1QRUA 2BM1A 4RTSA 3KS9A 3LVQE 4AJKA 1QHYA 1K6MA 3SC6A 1GGVA 4RIIA 4US1R 2FX5A 3PDIB 5JSUA 1ZW1A 4TYNA 1E3IA 2BFDA 1BHO1 1ZEMA 1JUDA 5AW8A 1NFRA 2ZRLA 5C4MA 5JYDA 4A6XA 4I99A 4RK1A 1Q0RA 3B70A 3N7UA 5BSWA 4RAQA 4AYWA 2C9OA 3IDOA 1KJJA 4ZT6A 1SA0A 4C1NA 5B30A 5JZ9A 3BL5A 3LWDA 1IN5A 3QE2A 4G5FA 4NMLA 1XCOA 2OQ2A 1M10A 2P2GA 4DDVA 1MFZA 1H66A 1EWRA 1N3YA 3U44A 1HKUA 1Y1LA 2ZS8A 3VAAA 2C8LA 2V4MA 3OJLA 4D9MA 2QGFA 3FGZA 3C8HA 2G80A 3NH6A 3TI9A 2YRWA 3M5PA 3RSFA 4BNTA 1TVKA 3SBDA 3DVQX 2HU8A 4GYWA 4OL9A 5LU9A 1OH7A 4MQFA 4ZVOA 4FEGA 3QIVA 4K8RB 1KVQA 4QJ5A 1P2GA 5BV2P 3OIVA 1FRFS 5HTKA 4OYHA 3HVIA 5FTMA 4ZI7B 3IBGA 3Q7RA 4A5OA 2BGUA 4C76A 1TUGA 1NVDA 4J90A 2V3VA 1PG2A 1Z7EA 2G5GX 3O3MB 3BL6A 1GYQA 3LLUA 1AHNA 1G6OA 1X7XA 1JYEA 2EFHB 3A3PA 3NU1A 4IX1A 1FSSA 1WPRA 1IJFA 2J9YB 4OQYA 1SG6A 2HI0A 2W37A 1GZVA 3GK3A 4C5CA 1YA8A 2Q5LA 3LLCA 4IGEA 5AKIA 4BMXA 2AQHA 3ZE1B 3ESYA 3ZHTA 2C4NA 2NX2A 1CUBA 3GRAA 4HAWA 4M9QA 1DDGA 5GV7A 5KOJB 3ZNNA 1AK9A 5CPFA 4HPJB 2RIRA 1RTKA 4LOKA 1ESMA 1DAMA 2QTMA 1ENOA 1YFKA 3MG9A 4EFNA 3FLBA 4EL0A 5A2QA 3W3AA 3TG8A 1UT8A 3MSXA 3SDSA 3V7UA 5JSZB 1WMDA 3KVVA 3GGDA 2XDYA 2VDNB 4KMOA 5BSFA 5SYMA 1SC4A 1FPQA 3B20A 4EJ0A 4OHRA 4BP1A 4BKMA 3TOXA 5JNWA 5DK4A 3GN2A 1L4EA 2WJ3A 2CYCA 5IHXA 1XWIA 2WINI 1L7PA 2A59A 4OLFA 1SQ5A 1KHHA 4RK6A 4CMKA 2FLKA 5BN4B 2PUVA 4N1AA 1K8RA 1BX0A 1JR4A 4X71A 3I9V1 1HDYA 2O8EB 3IVMA 1G20A 2Y8EA 4IDCA 2I29A 3DDWA 4GP7A 4MINA 3ZDYB 4FFSA 5JDCA 2R60A 3AY0A 2GM9A 3OWOA 4RK7A 3WWEA 1I5EA 3KHSA 4Y2XA 2QN3A 2UZ1A 3PT9A 3GRYA 4PG7A 1XXLA 2XGMA 4NBRA 5LD2C 5E1MA 4ZAVA 2XVAA 2ZB3A 3UV3A 2UVPA 3IHWA 3NI2A 5J2TF 2Q0QA 5E8JA 4KN8A 2GJKA 1YIOA 3BIJA 1E6UA 3R5XA 4YAFA 1S3GA 3TLMA 4KQ9A 1JJ7A 3SVZA 1HRDA 4HWPA 4CM9D 5JW6A 2AWNA 3GX1A 1FDOA 4OREX 5G1PA 1JXMA 2C03A 1A5SB 4CTMA 2GNOA 1J0DA 2WC1A 2A2ZA 2NNLD 1PZMA 2PK3A 4MRSA 1GQFA 4JOCA 1SUIA 4M6WA 5EUBA 3EPHA 2ZRGA 2DX7A 2Y1LA 5IXJA 4EB3A 4KMRA 2WVGA 1IDOA 1Y1QA 3NBYC 3VKVA 1AHPA 2W8ZA 3ZIAA 3CQ9A 2X3YA 2HZ7A 3E8MA 2QV7A 1GRVA 1TYAE 1B0UA 3DR3A 3L84A 4H7KA 2YHUA 4EH1A 2J0UB 4XEHA 4FI3C 4IY1A 2CFOA 1PZEA 2P2YA 4KO2S 4MP6A 2QOEA 3UW1A 1E3WA 3BXOA 3PVCA 4EJ6A 1C8LA 4MWCA 5CJJA 1XCMA 2WA2A 4GMDA 2I6QA 3PEEA 3WMFA 5CDFE 4DJFC 4TTRA 1YHYA 2A9RA 3H2GA 4JAVC 4R71A 5JAOA 4BZXA 4P93A 3GUUA 3TQSA 4MQBA 4GVPA 5FNVB 4WJKB 3NUZA 1YQEA 4KJZA 3ST7A 3HN7A 3B6KA 4KK4A 1B23P 5FBKA 1EESA 3F71A 3DLIA 5ALZA 5C34B 4J2OA 5LP6A 1OHHA 1S0UA 1SD5A 3EIFA 3FTNA 1UXGA 4Q9HA 1YNOA 3R4VA 2ACEA 1H6CA 3QEKA 1CQPA 1RYHA 1UPAA 1TKBA 1UBTS 4OXYA 5J2UB 1J99A 3K5IA 3CLUC 4TTJA 3W8NA 2Q3LA 3C14C 3RYCB 5FWDA 1TU4A 3NATA 4TQGA 4KIGA 4ZI2A 1GCGA 2NLOA 4DV4B 1Z8FA 4CODB 2ECKA 1E7QA 3LCUA 1XYVA 3D54D 5BNFA 1Z4KA 3ILVA 1JI3A 2AR7A 2X42A 4LOIA 2UU9B 2E0IA 3DPSA 1FYVA 4X91A 5A62A 6PFKA 1R0RE 2PBLA 3PLNA 5IC6A 3AI1A 3W5BA 2PWBA 4Z1MA 1NW9B 4QLAA 3HDQA 1G55A 4BNIA 5C37A 4MICA 4PIMA 4YMUA 2BPOA 4RVHA 1E4EB 1WP4A 1UADA 1PNQA 1EU1A 5DHFA 3S2IA 3WBKA 3G9ZA 2C3YA 1JILA 1OA1A 2GZHA 1OUMA 3R6DA 5JVDF 4DDKA 1WVMA 4OQNA 1BJTA 2OXCA 4QVKA 1EFRA 3FFXA 4HWTA 4R68A 3IUSA 1S2IA 2VR1A 3JARA 2JHCA 1MB0A 4GBED 2Y66A 3C6BA 1HDRA 4MW9A 3FVVA 1E9DA 3ZH9B 3TE7A 2QL5A 4CKCB 1C5KA 2PX5A 4KWEA 2C82A 2V5UA 1GAQA 2PDAA 1PFYA 1TQ6A 3B7PA 3EYAA 1WKBA 1U3DA 2IY9A 4PRZA 4R2MA 3CN9A 5AVUA 2R4TA 4P22A 3B2NA 5JFTA 3EZNA 4C0KA 2E2WA 2JLCA 2PZMA 1MRZA 1XRQA 3L5KA 3MMXA 2O8DA 4ZYUA 2CUTA 2HO4A 2IYQA 4W4TA 5EJMA 1G38A 2EGGA 2B61A 4TSFA 1TXGA 4Y9SA 1NMSA 5AKEA 2YC2C 1HYQA 3DMGA 2PR7A 1WPQA 2EKBA 3KKEA 5T4HA 2WHPB 5FA5A 2VWQA 4NENB 3NO4A 3UXHA 4DWJA 3QTLA 4GL4A 4NY1A 3BBLA 3MB5A 3OZCA 3OZIA 5C1IA 3S2UA 3UJPA 5KJFA 3RC3A 4XYMA 3QLTA 1G291 1HM5A 4IX9A 1TK9A 2FYTA 3BGIA 3K2EA 4KWTA 2YZ2A 1BAPA 1KK0A 1GL9B 4KXWA 3PTLA 4FJ0A 4UMFA 4V02A 3RYFA 4EPXA 3K72B 2C92A 3TG2A 1E66A 1HDZA 4QPJC 1Q92A 3G02A 1OPRA 2CXUA 4P54A 2BLLA 2ONYA 3HJTA 2GN0A 3MN1A 3PJEA 1AGXA 1J9EA 3IRUA 3C7TA 3K9NA 3BJMA 3QMWA 4PE5B 3ZCSA 2HWUA 5LDGA 1CUDA 1EYZA 3N2EA 1GP2A 3HDGA 1S9HA 1X15A 4NK4A 2X0FA 3GOQA 1YQQA 1Z4NA 3JRNA 3Q10A 4TLEA 1W1UA 1IU9A 1SC3A 2M2IA 2Z9BA 3I04A 2E1PA 4K9KA 4EK9A 2QBYB 1N8SA 1YS1X 2ZFUA 3ANNA 1X7HA 5EAIA 4GGPA 5CA1A 1YC5A 1CJTC 2C5SA 3AMVA 1VL1A 3EJ6A 3C3DA 1IVNA 3TUIC 4B3DA 4EGCB 2P67A 4MR8A 2AJCA 4MYUA 4NARA 1CZLA 3GLHA 3SF8B 4F2GA 4OG2A 4EFMA 1JEJA 1W0JA 3G0OA 3HM2A 2PZKA 3WGVA 1MT3A 2OENG 2FPLA 3IDAA 3L79A 3WRWA 4IFTA 2ATEA 4JBNA 2R84A 1RABA 4D3YA 4Z49A 4DSUA 3AJ8A 5EMKA 4MIYA 4KQ6A 1Y42X 5A6SA 2F8SA 3FN4A 2IELA 2Y6UA 4AY3A 1FNSA 4L2IA 5HOQA 5AUQA 1U2TA 2ZUVA 1RWPA 2VF8A 3C7CB 5I3ZA 4R1QA 4REOA 4N3GA 4HV4A 3TLYA 5FPTA 4F6LA 1CU1A 3VPCA 3GLFB 3OWXA 1OMOA 3EB9A 3O1JC 2CKMA 4RXMA 1KC3A 4X94A 3RT9A 4G0VA 2X8JA 2C99A 2V6JA 2P77A 1JLRA 1U8EA 3Q1LA 3QELA 4UPDA 4QYWA 3CWZA 4Q9KA 4DB2A 4WZAB 1R8XA 4X8OA 5JECA 4AY6A 4K46A 2P5UA 4O4JA 4QWWA 5D51S 3EGOA 1EM6A 1C9NA 2HJSA 3HZZA 1B26A 1GPKA 4BNYA 4H7PA 4NEHB 5CT6A 2OYRA 3KQKA 3R9WA 1UOPA 1Q2XA 2BFNA 1LA2A 1MC1A 3BREA 1BU8A 1E0SA 4AMYA 2CNLA 2D62A 2G1JA 1LJ8A 1OB5A 1EFTA 2D2VA 2R85A 4IPTA 2JI4A 4V24A 2OORA 1MO6A 3MINA 3K73O 4HSEA 4RWZA 2GN1A 4ZAZA 4PPGA 4B73A 3X1DA 5DRTA 1UBLS 3T7TA 2JCXA 4MGZR 4QDJA 4JP8A 1T3TA 4M0EA 1KFEB 1RIIA 4ON9A 3ZHBA 2PXCA 1DQYA 2FWMX 2IXAA 1IMOA 4AWBA 4EPTA 1T3GA 3DE4X 1LRJA 4RS4A 4MS1B 4N7MA 4IMIB 5G0VA 4J3JA 1L7DA 4WY8A 3T3MB 2AF4C 3USCS 2QVLA 1DRWA 2DWPA 2P9CA 1O5TA 2IUTA 2XAAA 3E3LA 3FZEA 5G40A 2JDIA 1UPUA 2CNWA 4ESOA 3KQMA 5JFOA 1KEWA 2AJTA 1D5WA 1WM1A 2P35A 3ANXA 3SYKA 4RXUA 2YHBA 1EWYA 3IQFA 3ZXYA 3ONEA 3PXDA 4PR0A 3WLAA 1LK7A 1KBQA 1F48A 2GMWA 3AF5A 2D2XA 1S3IA 2Q5CA 3HH8A 2I7XA 2B2NA 3CLTC 2XE7A 5DXJA 5DP1A 4B31A 4X20B 2WMYA 4ZZ1A 4EQZA 2ONKA 4F9FA 1F0NA 4A15A 2P0EA 3U26A 3V80A 1YK1A 4HKTA 1FP6A 2PXHA 4CT0A 4URYR 4JDUA 5HF5A 1TM4E 1KFBB 4HGYA 5H80A 1OLUB 3GLUA 1ZK0A 5JH7B 4LF5B 1DBQA 1IXRC 1L7MA 4HDCA 3U13A 3TF5A 1MHPA 1MPXA 1V7CA 3EA5A 1DKOA 2WMOB 1RMYA 1NBAA 4N7RA 2H2FA 2YR0A 2O8BB 1DPGA 1JDJA 1ECLA 3T9BA 2Q3CA 5DGTA 5DX0A 4DDUA 2R8YA 2WIFA 5K0LA 2VQFB 2QMOA 1OZGA 3AJEA 3P9NA 4PZAA 1CUZA 3K16A 3PDIA 3SDBA 1DG3A 1XVTA 2HFKA 3QUAA 2XKJE 2V6BA 3BQMB 1C1YA 1ZBDA 3PHCA 3RUDA 4DYVA 1OLSB 2WJAA 2JIPA 4HLDA 4F04A 1H6BA 3M7IA 1SIOA 1MG0A 4TVOA 1IZ8A 4K87A 3RI3A 5L3SA 1NW3A 2AD5A 4KI0A 5FUWA 2BMEA 4DLVA 3K70D 1F1JA 1XQWA 1Y9AA 5C81A 3N2IA 2BFAA 1H6DA 4KGDA 3BA6A 4X90A 1YTLA 4JL8A 1SU7A 1YI8A 4DMMA 4BRUA 6YASA 1I4OA 1PEDA 4E4RA 3G2IA 4PG5A 1PJSA 4EVIA 1I2CA 2V3WA 3FDIA 1Q15A 4HAVA 1SCJA 1R74A 2B69A 4EGAA 3EF3A 1C9YA 4GXNA 1PZHA 2Q3EA 4O8CA 4OHXA 4TRNA 2BYTA 2CLLB 1FVHA 3DG9A 1Z2DA 3HVKA 4OQMA 3NEJA 4KXLA 3HBAA 4D98A 5BMVF 4DNOA 1L6RA 1O4WA 3GJ7A 4BLSA 2ILVA 4FW9A 1AN0A 4JJ8A 2XMZA 1A7AA 4TMVA 3AO0B 5FBZA 3WDSA 2I7CA 2UUAB 4CV3A 2Z0MA 3D3EA 4TQAA 2XVXA 4ZI7A 3BH6A 3OM1A 5A9TA 3NVDA 4M0PA 1MX5A 2HDOA 4U39A 3D7MA 4Z1OA 1JHQA 1HL7A 2D8AA 3EXEB 4HPXB 4CV1A 1ZIYA 3OPYB 4J4HA 1TA9A 2COUA 3HFGA 5KSYA 2H2WA 4CKWB 3QU2A 3SQXA 3HNRA 2XECA 2IXFA 4LCBA 4M8SA 3UO8B 2GBFA 4L74A 4TV8A 4UVDA 1YOBA 4KAJA 2VT6A 4I2NA 3Q7SA 1GYPA 1EA7A 3T5TA 4B3RB 2OQVA 1HBJA 3RSCA 4EMUA 2CVHA 3A37A 4YJFB 1MB9A 1WW8A 3ZPXA 2JA2A 3UYKA 1V3TA 3CINA 4MLCA 2HJHA 4HEA1 5B6IA 1O58A 4WZBB 5JSZA 3AUJB 1SKAA 1UEJA 1XQ1A 3NORA 2CLMB 5HE9A 2PO5A 3I52A 2VNJA 3QV1A 4WH0A 5K0BA 2C3UA 1AMNA 1LF0A 4MI9A 5KVVA 1MJGM 2A94A 1M9NA 5GTDA 1E5VA 2E1RA 3LGXA 4G1MB 4TXHA 5ECWA 5TPZD 1M7HA 4CBVA 3S5UA 2NXWA 4V3BA 4Q1AA 3PV0A 2OC9A 3M4NA 1Q84A 5CIQA 3FNRA 5BSVA 1L1EA 4NEGA 4J4TA 4BBAA 3CNHA 5DFAA 2D00A 4J1NA 1MU0A 3PHLA 3IMFA 3VPDA 4Y2QA 1K75A 2ALJA 3RRMA 1IN6A 2HXGA 2PX4A 3SCZA 1U6IA 2YC4C 2ZWVA 1U5BB 2C0PA 3CX7A 3LUAA 2H17A 3VBEA 3DMRA 2YNMC 1UIRA 2CMGA 4M9RA 5I8ZA 1KQNA 3VKGA 3WGGA 1FVFA 4A6DA 3CUSA 5JI2E 2HREA 5LA6A 2PANA 1P7WA 1T6ZA 2FN3A 5JS7A 1UQTA 1KZ9A 1NJ1A 4J16A 3H5IA 4XB2A 2CBZA 4KQIA 5GIPE 1MFPA 2CF6A 4O1MA 3WYBA 1LPNA 3ELWA 4NQRA 4I5FA 1FY2A 2QTLA 3N2NA 4YP7A 3RRZA 1ORDA 3SM3A 3UGKA 4DFDA 4UDNA 2HBQA 2X6RA 1KOLA 5JZMA 2PMWB 4RHFA 2GBGA 3V55A 5KYYB 1PQYA 1ENPA 4IIJA 1YR2A 3FCAA 3W7BA 4CKYA 2X0KA 2MYUA 4HMQA 2A4KA 4GSKA 3ZHCA 5EZQA 5FHQA 2BUAA 3V7FA 4KTVE 3WBJA 3AHJA 4F4HA 4AUMA 4K2HA 2WKWA 4WK2B 1Y4SA 1T5DX 2Q9AA 4NMXB 5EP1A 3PJGA 4YCBA 3PEUA 2W2TA 3W8FA 1QFJA 5EJ7A 2A5LA 3B78A 3BJRA 1C0IA 1YV9A 2HH9A 1L7EA 4NS1A 1SVLA 1QK5A 4DMFA 3FRHA 4CTOA 1KMCA 4R6XA 1DXYA 1PTJA 1LU9A 4KQKA 5FNVA 3HWWA 2PSFA 4J94A 1FNDA 1H2AS 5JASA 3EEIA 3WK4A 3SPXA 3WRXA 4Q9JA 5BV1A 3L02A 3LUDA 3SSMA 5B1EA 4M0LA 3VTFA 1EINA 1WDMA 3W90A 2GZSA 5JCOA 3ILHA 3RUHA 3FLEA 1VYVA 4MKXA 1DKLA 4RTNA 3FSGA 1JIJA 1UDBA 3Q8WA 3LDUA 3K09A 3LKZA 5A5VA 2FETA 1E6MA 1D04A 1Z2PX 2KHZA 3DEKA 3QYPA 4QBGB 4PCUA 4U8HA 3UOGA 4BP9A 5J2UA 3FMPB 3GVXA 1ZPDA 2Z2XA 4E88A 3OFSA 1PR2A 5BSTA 1NF9A 4ENWA 4HNRA 2DTXA 2O2GA 1LBSA 3JAWB 4CCYB 1OW3B 3BC1A 2R6JA 3AQ4A 4ACAA 5CCXA 1ECBA 1I1HA 4RA9A 1SOUA 1FLAA 5KWJA 4RMJA 2I5PO 1RPJA 5EE3A 1NWCA 4RIEA 2FW8A 1COWD 2QGNA 4LRQA 3WTBA 4ADSG 5ITVA 2DSNA 3GG2A 5E4TA 3QVWA 4AL4A 2EFJA 3IVAA 3FH0A 4A0SA 1HDCA 1HWYA 1L7VC 2EFYA 3G2NA 2QPOA 2GPSA 2WU0A 3OCJA 4YEDA 4C2UA 2GPNA 3AOGA 3FFBA 4B3IA 1HQKA 3MBKA 4ZEMA 3ROQA 2IX9A 3CPSA 2XXJA 4Q3NA 5A4FS 1XDUA 3L1IA 3DE0X 1L4HA 4FHEA 2VDUE 3WZLA 1M72A 2WFLB 1V43A 3HJUA 3Q72A 1TC2A 1JLLB 4PBTA 2H31A 4U5QA 3UA4A 1WSBA 4CKCA 2YUTA 3IIIA 1KO7A 5CB0A 1U1GA 1Z5VA 1L4MA 1E3TA 4YNBA 4DCUA 1TLFA 2BKAA 2YFHA 2GPWA 1ZM9A 4DIKA 1FBTA 4DMCA 4HFRA 2QTVB 1FMCA 3ELYA 3P2YA 2OD7A 4TZ6A 1FYWA 4IVPA 3HLTA 2QN1A 3IO3A 3OIGA 5ENVA 3LUJA 3GFFA 3S1AB 5LQSA 4TS4A 5TEVA 1J8YF 2WHPA 1IE3A 1KYTA 3CB2A 4PZLA 5K3SA 4NENA 2CJXA 3V8BA 3BTUA 5HOEA 3IKTA 4QLOA 1X9HA 2AFIA 2WIDA 2YDYA 2FN4A 3NHJA 5B6JA 3H87A 3TTWA 2GAFA 1JHDA 3KZKA 4X65B 1PNRA 4WECA 3EFEA 1YASA 3S5JA 5HUQA 2JZNA 1XZDA 1P3DA 3ECSA 3EZLA 3OHSX 4R7GA 1EGMB 1BC5A 1UM9B 1I3OA 1XTRA 1UJMA 2FA9A 2AOTA 5SZIA 1Z8NA 3TMYA 1PLJA 2GZ3A 3BIWA 2H2AA 1ZGHA 1MH1A 1VL8A 2YW2A 3RHFA 4D9HA 2GEVA 4DG8A 3FTDA 2R9VA 5CVEA 2AH5A 2M98A 3G2MA 3PC2A 4ISBA 2C88A 3K15A 4A0FA 2QDXA 4QX6A 2QX6A 4Z54A 2OHGA 4OB8A 3UJ7A 5I5GA 1ZVJA 2JFPA 2R8PA 1K98A 3H05A 2P11A 3C48A 3U17A 5J4KA 3SYTA 3HRHA 1V5WA 2O2JA 2PYIA 3K9GA 2A9QA 2QBYA 4G89A 1E3JA 2OLKA 3PQ8A 3SHVA 3OEEA 5B3JC 2DBQA 2I6GA 5K3OA 2YFQA 2PJZA 4AN1A 1CJVC 1GSAA 1FSFA 2JD1A 3QKIA 3SF8A 2JFYA 4M88A 3F1KA 3NG1A 5JSQA 4WFQA 5K20A 1Y33E 1SHKA 1XAGA 3CXUA 1KOJA 3ANMA 1ZOOA 3HXPA 4RFVA 4RTLA 4G5XA 4N01A 5BPFA 2HQ1A 1T0PA 3A4LA 4AB1A 4C14A 1YTUA 1J23A 3DAFA 4RJLA 3TN7A 2C5FA 1NJ8A 2JIQA 3IAEA 2ZYWX 4RORA 5LCXA 1U9ZA 3WHKA 1VYHA 4PCAA 5HK9A 3BGOS 1ZG3A 5IM4A 1ABFA 821PA 1CNMA 5L4NA 4NZNA 3N6RA 3ZXIA 1P2FA 3V8EA 3JALB 1E9AA 5DOZA 4LAFA 3WAKA 3GLFA 3DVSX 2JZOA 2AT1A 4JBIA 2ZJAA 3VNRA 3MCZA 2BCGY 5JMOA 3G1UA 1KI9A 4CWAA 2EZTA 4BP3A 3LX6A 4S35A 3D5EA 4WZAA 4GPD1 3CWQA 4D4HA 2AZDA 1GPDG 1YAJA 2ZK7A 1MZVA 4AYTA 2OBXA 4V0RA 1UBUS 1QK3A 2A3NA 5AVOA 5ALPA 3ZV6A 1NN5A 2ETXA 2R5WA 3OE4A 4MMYB 4UZEA 2ZTHA 4JUAA 1IUOA 2G8NA 2GF2A 3UK6A 1V5EA 1HF3A 4ZVRA 4DR2B 4BNFA 3CW8X 1A4IA 1PYOA 3GL9A 1Z0DA 2K2WA 3SQDA 4E15A 1GM5A 1W36C 3E22A 4GE0A 1CJBA 2O2IA 2V7GA 3IJEB 4RE6A 1QP7A 1U0NA 3ESBA 4LYDA 4Y2HA 4IQ4A 3LIPA 3V2GA 4GO1A 2FV8A 3UWKA 2VZ0A 2ADFA 5CFNA 1DBIA 4PR3A 1F38A 2I34A 2QDKA 2AIRA 5KQGA 2G07A 3H5RA 2AW3A 1IXKA 4RJTA 4MS1A 5BORA 3H1EA 3EIQA 4B85A 4CV2A 5K0EA 3DZJA 4TWBA 1R27A 3CO5A 2G25A 4EHHA 3CW9A 3K7EA 5C3MA 1AX9A 4EYEA 4P7KA 2XBUA 2FKAA 4PPYA 4E1VA 2PL5A 1I7PA 3MTBA 5INTA 3HR4A 2W6ID 3EEOA 2ZBGA 4WGFA 3ENWA 4GG1A 1XVVA 4EG3A 2Z5GA 3H9QA 4QPNA 1RLIA 1MO2A 1O9GA 2PGXA 4PVCA 1XCBA 3WR5A 3SHQA 4HDSA 5JRDS 3NONA 4J0CA 2FN8A 4X20A 2GPAA 2P1DA 1SG0A 2KB0A 3IP3A 3U4IA 5DCWA 1JSRA 5DYYA 1Z5UA 5JLAA 4ENUA 4DB4A 2B9EA 3HMQA 4GZ5A 3RS0A 1OLUA 3FPHA 2HSZA 3CH6A 4OGKA 1A2BA 1EE1A 3EIWA 5CW2A 1U80A 5CVJA 1GPJA 3SHOA 4XWTA 1C8BA 1YVDA 3E81A 1OT3A 1NUUA 2GQ0A 2FNAA 2J67A 3UMVA 4YECA 3SJZA 3SJBA 8OHMA 3H6HA 3PE4A 1Q3KA 4IUCS 3WKEA 3G8BA 2V8BA 4W5HA 4WKGA 3GGJA 1TJ3A 4O4LF 4QGGA 1RHUA 5FUMA 1KVSA 4XXHA 3DW1X 4FX5A 4TTSA 1JTVA 1P91A 5E7IA 1M2OB 1PFVA 4K6HA 1OLSA 4JP1A 3ITNA 1SVIA 4BO2A 3T5PA 1KEZA 2I9PA 4OJTA 2EKPA 2H85A 4PLGA 4PS0A 2Z56A 4U6SA 4EKDA 4ZIRB 1HEUA 4AKEA 2Q1UA 2QT9A 1AJEA 2C9BA 2O14A 1KE2A 1V8OA 1O9HA 5L7TA 1XX6A 2EDAA 4I1OA 3LTNC 3TB6A 2D0OB 1CUJA 2C2GA 4OGGA 2AKEA 3DYVA 1B73A 4P3KA 4WXHA 1VPTA 4JXKA 1PDOA 4FBGA 4V0QA 1NZJA 3RHSA 1JJFA 5I45A 2FQXA 5F5LA 1YGPA 4A6PA 1Q74A 2WPDD 3WZMA 3CX8A 1MV8A 2SKDA 2EFCB 4G4IA 4H4DA 4J1TC 3AI7A 3RVPA 1HTWA 3Q6IA 4FDMA 3DOUA 4NFYA 4XH9B 4PO3X 4L5YA 4QREA 3COPA 3CX6A 2W93A 3DDZX 3ZZMA 1XMPA 3KVNA 1TO1E 4GQAA 3OLZA 3ZY2A 4ZI3A 5LL6P 2W6QA 5FR1A 4DGSA 3SKYA 3R77A 4ER3A 2XB6A 4EIWA 4ENTA 1Q0TA 4PGHA 4BNHA 2VRBA 1QVVA 4Z4HA 1Z5WA 2VHZA 1TC1A 3IQDB 1CY8A 5EERA 4XSGA 3BJIC 1WVGA 3Q0EA 3HDJA 2BFFB 3QVUA 4F97A 1EXVA 4G0WA 3EXEA 3B6ZA 4WFJA 1IJKA 2BHSA 4CVNA 2DWCA 2ZRHA 4CKWA 4ZGBA 3U4QB 2WFMA 1N5DA 1NN1A 1SXJE 1U8CB 1BD3A 4LUCA 3HXMA 1RWVA 3O5AA 4URFA 3MM4A 1I1QB 1ZOIA 2NZXA 3M4JA 3RO7A 4DQUA 4YJFA 4Y18A 2IODA 4YLGA 2Z6VA 2JGRA 3D0KA 2VP3A 5AKHA 3N7TA 1E98A 1SFRA 1KQOA 5EWLA 3FG9A 4WZBA 2ECOA 2WLTA 1QF6A 1QDLB 4RKEA 2R6AA 3KJFA 5A0FA 5ARCA 4OL0A 3KAPA 4LXQA 5CNKA 4B87A 1EP9A 1IIBA 1PJTA 4JCCA 1IEVA 4UEQA 1QVRA 4BFUA 5BRAA 2BD0A 1OY1A 2RDMA 3I4FA 4NZMA 1PX0A 5DX8A 1ZHHA 3IPXA 2HEIA 3CUTA 1K3FA 3GAAA 3AIIA 3QRWA 4Y8VA 2XE6A 1HDXA 3OC6A 3NBKA 4JHXA 1IUNA 1OFGA 2CEKA 2Q1YA 3NVAA 4YRDA 1ULHA 2DY0A 3BDVA 3EPRA 1E2MA 4MAFA 2NXNA 4WK4B 4FLMA 3PWZA 4B47A 3G2LA 4DG9A 4MPTA 1D8AA 1KPHA 3WLRA 2F3UA 2HV8A 4C0WA 3TVDA 4D74A 3KVYA 3PWSA 4B9EA 3O2NA 1RWXA 4BGVA 3ZZ1A 3THRA 3ZVNA 3FNFA 2B78A 3NW9A 3COWA 3RHZA 5KCZA 4EITA 1NJ5A 3DVRX 4FVTA 4JL5A 5GJVC 4OHVA 2OHVA 1L5RA 4TL6A 3CLVA 1RKBA 4Y2YA 4UVHA 4BNXA 1IFXA 4R9SA 1C9EA 2RJ3A 1T5IA 2XCIA 4HI0E 3JATB 3UWDA 1BWSA 4WE3A 1LVGA 3OOSA 2ZKLA 4L3WA 4LZAA 4Y6GB 3Q15C 3AF2A 5KYYA 2ICAA 3AF6A 2PUWA 1V3VA 4NPCA 3H11A 2D7DA 4P58A 3QVXA 3UUFA 1J25A 5B3LA 1F8YA 4BJ1A 1HE4A 3D4NA 4MYTA 4JI6B 1AXRA 2HQRA 2DECA 3I53A 3DTNA 4GHWA 3JTEA 1KY2A 3CNOA 3S4YA 5IX8A 2HCTA 3MCUA 4D99A 5C7OO 3THWB 4J49A 4K28A 2GS9A 3W9YA 2HWWA 4Q4DA 4ND1A 1Y8QB 3F9CA 2BHNA 3L7JA 1FFDA 3NPAA 3LQQA 2X9GA 3DCJA 4FXPA 3Q7PA 4QARA 3K6SB 4NCBA 1L4BA 3I2KA 1Q83A 3EOZA 3GVIA 4JT9A 3ANYB 2CFCA 4OHUA 4YDHB 4ZCSA 4DDMA 2IPXA 3KCNA 3LFHA 4S2UA 4EJ2A 3RC7A 3OAAA 4GRIA 4ZCLA 3TPZA 1ZGZA 4LZPA 5EKTA 3ES9A 4MVJM 2OAQ1 5FOUA 5TV2A 4BYGA 3EVEA 1E5LA 4IKEA 4TV9B 1ISMA 4ATNA 4LEIA 3KKKA 5GAJA 1N0UA 1D2RA 2QMQA 3BK2A 3IVGA 1U2GC 2H0RA 3P9CA 4KXFB 1V1MB 4IVNA 1RNLA 4Z0HO 2ZI5A 1N7HA 3CWCA 3KKMA 4ER7A 4IWNA 1PZGA 4JENA 1FW6A 1W8IA 4NYJQ 4L50A 1TZCA 3UHFA 2I80A 4DR7B 1WG8A 1Z08A 3TMKA 1MPTA 1S89A 3ZBTA 3RIEA 6ABPA 2IOFK 3ZZUA 3ETGA 3LY7A 4UHHA 4YJGB 3GPDG 2O3JA 3JAWA 1NA5A 1ODTC 1X8XA 1KU6A 3GV0A 3GA0A 4CCYA 4OQ4A 4J2HA 2VP2A 5JH7F 1MX9A 2W6OA 1PLLA 2VJNA 2P2NA 3LV8A 4LVUA 3TRFA 3RJ9A 4QBTA 2OGSA 4XZ3A