1ZG1A

Narl complexed to nirb promoter non-palindromic tail-to-tail dna site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*GP*TP*AP*CP*TP*CP*CP*TP*TP*AP*AP*TP*GP*GP*GP*TP*AP*
total genus 22
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zg1A00
3G3ZA 5D4RA 4KT5C 4EJVA 5ICFA 2DPUA 3GLXA 4RB3C 1Z9CA 3CDHA 3GFMA 4MQVA 1W5TA 5DCMA 2E7WA 3KLNA 3O3KA 5KVRA 1HXDA 3HSRA 2X4HA 5J8FA 5L3DA 3BWGA 2DK5A 5F6FA 1SFUA 2M30A 1QZYA 1J5YA 2F5EA 3Q9SA 5L3EA 5BQTA 2YX7A 5LLQA 5J8CA 4WX9A 4U0WA 2LKPA 3F8FA 2IP2A 2ESHA 3GZ6A 3HSEA 3E6MA 2M45A 1XCVA 1FZPB 4N9IA 1KYWA 2KJCA 1FPQA 4HLYA 4MGRA 4U7DA 2EJRA 3BY6A 3K69A 2DW4A 3I53A 2B0LA 1TQMA 3RIRA 4P9FA 3B73A 3FMSA 1O3RA 2L3DA 2XHKA 4EQQA 3F8NA 3J80Z 1G3SA 1HBXG 1SD4A 5IT3A 1U5TC 4BXUA 4BAYA 2D1VA 4QLCU 4MHGA 3HOTA 3NQOA 3V4GA 3R61A 2DAOA 2LSOA 3ZMUA 2W84A 1TW2A 2FSWA 4ZYGA 2L4AA 4ESBA 1O57A 3HRUA 1T98A 4OIQF 1FP2A 4EM1A 5DUKA 3R4KA 3HRMA 3RKWA 4XSXF 1E2XA 2O6GE 2BGCA 5E1WA 3FMQA 3PQKA 4ENKA 5ED4A 3MWMA 6PAXA 5D6FA 4H0EA 3EYIA 3REOA 3GFLA 3ZMSA 3VB2A 3QPHA 1SMTA 2MC3A 3CTAA 1U5TB 1USTA 2OU2A 1R36A 4CYDA 2K27A 3MZHA 1ZAOA 1MKMA 4RGXA 3BJOA 4JQFA 4L9NA 4WF2A 2FMYA 4KFCA 2KIFA 1DUXC 2QBYA 3VOEA 5FB2A 3BZ6A 1SD5A 2G7UA 1O3TA 2FXAA 2Z33A 5E8GA 4I7HA 2HS5A 1V4RA 5HS7A 1J59A 1SD7A 5JFRA 4KMUX 3R0AA 3FF5A 1GXPA 3IKTA 4NHJA 2Z9OA 5BMZA 4G94A 3MZYA 2UXNA 1IXCA 2QZ8A 2P8TA 4ZH4F 5IT9K 3IKVA 2O0YA 5K1YA 3T8TA 3TKYA 5D5VB 2RC4A 2CSOA 1IZ1A 2DK8A 1ZG5A 2EA2A 2Q8KA 3MEXA 3JSPA 4P55A 4A0XA 3WE3A 1ZN2A 4M9ZA 5EEHA 2Q0OA 1G3WA 4XBFA 1LJ9A 1E17A 2J5OA 1QO0D 3RKYA 1LQ1A 4AD9A 4KIBA 2AS5F 3C7JA 4TV7A 4RB0A 4RGUA 4ESFA 1XD7A 1YQAA 5FGMA 4EGYA 1G3YA 2MD5A 3M8EA 2GXGA 3VEPA 3ZQ7A 2DLLA 3OV8A 1IW7F 3LQRA 4I01A 5DDGA 1LDDA 2A68F 2EFOA 4WXDA 3F6OA 4WWCA 2JT1A 1HW5A 2VOPA 2CG4A 2DQRA 3ABTA 4P5OA 5HS8A 5FD6A 1EH6A 2QWWA 3F8MA 4HDUA 4GCVA 3DXJF 1UHMA 3BDDA 1XMKA 2CFXA 1ZYRF 1KU7A 2NNYA 4BHCA 4O6JA 2UXXA 1BJAA 3HRSA 1YW7A 1DDNA 4EJOA 1XMAA 2D2WA 2ZNYA 3RI4A 4EM2A 2VC0A 4AIJA 3WODF 1A04A 5ERIA 2EFNA 4FX4A 5BPDA 1K78B 1PP7U 3PFIA 1R5HA 2W85A 2FBKA 2F5FA 4IF4A 3ZMZA 4AVPA 1S29A 1MZBA 2DO7A 2PFBA 5CVIA 2HFHA 3I71A 3ZMDA 3I59B 5E17F 2YX4A 4IJAA 2P6SA 1XDUA 4UVCA 1K6OA 1MDMB 4RB1A 2R3SA 2CWEA 2MBFA 2A6HF 3EQLF 2NRAC 4OIOF 5L3BA 3GEZA 4O5VA 2EV6A 2FU4A 4A0ZA 1PP8F 4WXHA 3U9GA 1DPRA 4PGGA 1HKTA 2RVCA 1SFEA 2PLYA 4ENMA 3BJ6A 2P6TA 3S2WA 1MD0A 1XN7A 1UCRA 3JW4A 4M71A 1U6GA 2MA3A 1BBYA 4DNCA 2W57A 3V7RA 2H6CA 4FT8A 5JI6A 1G6NA 3BPVA 4HAMA 3ZPLA 2IT0A 2OQGA 4O3MA 1ZARA 2Z99A 3W6KB 1TQIA 3B02A 2GAUA 4HW0A 5H6RA 2UZKA 2A6EF 5E1XA 3L2CA 3V8KA 3BPXA 3AAFA 2P5LC 4P96A 3V8JA 4BHBA 3HYIA 3LA7A 4LK0F 2FF4A 3KLOA 4AIHA 4CDGA 1J9IA 2XUBA 3TO6A 3WTWC 5LGTA 2OD5A 1JE8A 1G4DA 4YFKF 2L01A 4EJUA 4R79A 1HW1A 2ZCWA 2CGPA 3KEOA 4G8XA 4ETSA 1S7OA 5HDKA 4LB5A 2WWYA 5LRSA 2OZ6A 3CUQC 2K02A 3G73A 3K9TA 2R7DA 1MGTA 2JPCA 4ZYHA 1KU2A 4L9VA 2L02A 1KYZA 2NAZA 3WGHA 3WTSC 2OAZA 4HA8A 3TDUC 2FBHA 5DUIA 4KNYA 5DEQA 3LWFA 5ILSA 1FSEA 1QGPA 2A3SA 3IL2A 3C3WA 1TTYA 4UV9A 4G6DA 4CO8A 4CXFA 3TOBA 2O8XA 2HDCA 3ZN1A 4KYWA 4HX7A 2Z3YA 4GYIA 4RGRA 5JHUA 3CO7C 3E5UA 4L0ZB 4M9SA 2HR3A 1RI7A 4UUVA 2H09A 3KFWX 4HF2A 5ICGA 2P5VA 1T0FA 5CYVA 5HOOA 3J7AO 3WU0A 1KA8A 3ULQB 4NQWA 4L5JA 2D1HA 4IRGA 2HYFA 1I1SA 1PUEE 1BM9A 4LB6B 2EV5A 4M6XA 1XCBA 2PMHA 1KQ0A 3CUQB 4LK1F 1QBJA 1H9GA 3BROA 1R58A 5LHIA 3KP2A 2V79A 4KN7X 1WI9A 5L3CA 3GFIA 1EH8A 3F72A 1R1VA 2NNNA 3RDIA 2PMUA 3EDPA 4HDVA 2FRHA 1H0MA 5BS6A 3K0LA 1BN5A 3KE2A 1HSJA 4LLLA 4K2EA 3FXRA 5H20A 2FNPA 3IWFA 3QAHA 4LGWA 2HZTA 3RPUA 4RS8A 1P4XA 1W7PD 1TQPA 1Z05A 4EV0A 3Q9VA 2J5PA 1YW9A 2M1BA 3QRFF 2JPBA 3HHGA 3N4MA 3V7CA 3M1EA 1ZREA 1T6SA 4HQMA 4KUMA 1QZZA 3KP6A 4LFUA 2IRFG 2QUFA 2EV0A 1K78A 2MH2A 3CUOA 2IPQX 4OINF 5BOXA 3LA2A 3GVAA 1OKRA 4L0YB 5FFXA 2LF8A 3RJPA 2KRFA 1OYWA 1Z6TA 2Y48A 1KQ9A 2O61A 2R7FA 1ZH5A 3T5XA 2X0LA 4HV6A 5BPIA 3WGGA 2XKOA 4PCQA 3LAJA 3MFKA 2ISZA 2DI3A 2PN6A 2QYOA 3HTSB 1W7PB 3W6JB 5K5OA 1ZRCA 5EEGA 3K1NA 5ICEA 4I09A 4I0BA 4R8HA 2PG4A 2HTJA 3GXOA 3D0SA 3R0JA 1OYYA 1U8RA 3TGNA 4Q5SF 2VBZA 2GXBA 2VXZA 2RNJA 3H3UA 4WXCA 2LDUA 1IN8A 4HF1A 2K7LA 2C6YA 2GZWA 2IVMA 2QM3A 4LJZF 1Z91A 2V9VA 3MAJA 4GO1A 3LQQA 4HX4A 3GF2A 3ROUA 5DD4A 1QPMA 2XIGA 3LFKA 2HTSA 2P5KA 4KA4A 1LEBA 5TRDA 4M74A 4MTEA 1YIOA 1O3QA 1MJBA 4LLGF 2AXLA 4UVBA 2Y75A 2EFQA 2MLKA 3HSFA 1XGMA 5HS9A 2A5YB 3GO5A 2DPDA 2Y0MA 4A2UA 3L9FA 1LVAA 2XVCA 2H27A 1ON1A 2QENA 1FY7A 2VODA 3JTHA 2G7HA 1Z1DA 3H3ZA 4IHTA 2BE5F 1HW2A 2XAQA 1SAXA 3DFGA 5FFZA 4LG0B 4OMYA 4HZFA 1BI0A 4D0PA 3O2PE 3ZP5A 2DT5A 1L3LA 3KEQA 1WSUA 2FOKA 4HV5A 5AIPA 3I58A 4I2OA 4CICA 1SD6A 5KK1A 3J81Z 2HGCA 2IA2A 2PEXA 3LAPA 1S8NA 2EB7A 2FQ3A 3T0YA 1J7KA 3C1DA 1YFHA 3WTXC 4HX8A 4HQEA 3T1BA 1B1BA 1AWCA 2XROA 3VODA 4M73A 5H6QA 1YLFA 1XGSA 2E1NA 4FHTA 2K86A 3GWZA 4UXNA 1J2XA 2XAHA 1C0WA 2GQQA 1MDMA 1RIOH 1H9TA 5LBQA 2KIUA 2VT3A 3ZN0A 1L0OC 3CJNA 1B9MA 1XSVA 5HLHA 2CQKA 2K4BA 1AOYA 3TO9A 3FX3A 1HKSA 3HRTA 1BC7C 3IHUA 4EM0B 2VN2A 3VFZA 3NEUA 2FA5A 5L3GA 4G7OF 1BC8C 3SHFA 1FYMA 1IXSB 2M8EA 3RPQA 2ELHA 1O7FA 1D8JA 1CF7B 2P7VB 4IHSA 1GHCA 3KP4A 3F23A 1TNSA 1JHFA 4G7ZF 5CVRA 3U2RA 1IUYA 3FXUA 4M9XA 3ECOA 1FP1D 1OPCA 5FLXZ 3K1PA 4MEXF 1P92A 5HLGA 4Q4ZF 2HEOA 3KETA 2MH9A 2LNBA 1FSHA 3F8BA 4PDKA 5D5UB 4EJWA 3FHZA 2OQRA 5F1RA 2CW0F 4EMSA 4B8XA 2KJBA 3EETA 3WGIA 3Q5FA 1JHHA 5F64A 1BIAA 2A69F 1GXQA 1G3TA 3IC7A 2PJPA 1F5TA 1HKQA 5CLSA 3E5QA 3TO7A 1JGSA 1B59A 2G9WA 1IN4A 2IA0A 2XGXA 3ELKA 1KGSA 2RKHA 3JSOA 1J0RA 1ULYA 5LRRA 4U0YA 4ESJA 1J75A 4KICA 2VBXA 4G6QA 1YG2A 1Y0UA 3R6SA 3I59A 2HKXA 3J81K 3FZVA 3MCZA 4LG0A 1XDSA 4YG2F 2FNAA 4IVNA 4MNUA 2RDPA 3QPTA 4ZYDA 1K79A 1FBSA 3F3XA 1FBQA 4BNCA 3F21A 3OOPA 4Y15A 2XAJA 3TDZC 4A5NA 5HDNA 2L4MA 2H6BA 5A2QK 5ILVA 3I5UA 1U78A 1T2KA 3QU6A 5K5QA 2QQ9A 3HOSA 2FBIA 4JK1X 1EH7A 3DQVC 2DQLA 4Z2YA 5JVTA 1F9NA 1R7JA 1B4AA 2Q2EA 1LNWA 1Z7UA 1ZHFA 3HIFA 3P9IA 2LF7A 3QP5A 2DFIA 1ZGAA 3LSTA 4MTDA 1T38A 1WWXA 3ECHA 4OU0A 5E8IA 2P7CB 3HUGA 2CO5A 1DP7P 2YU3A 1YO5C 2GIVA 2XASA 1FT9A 3EUHA 3WTTC 2EA4A 4I0AA 4PGHA 4F7ZA 3GUDA 1O7LA 4LMYA 3SFZA 2OBPA 5IT9Z 3RYRA 4GXOA 1KU9A 3I0TA 4XLPF 2GA1A 1IXRC 4ZZDA 4IXAA 3L00A 4GYGA 4HOBA 1FOKA 1UFMA 5TJJA 1KQ8A 5HVQC 1ZRDA 3CO6C 3O6BB 1S6LA 4M72A 3V8LA 1RUOA 2V6CA 3IRRA 4ENNA 2COMA 4OIRF 2QVOA 1YS7A 3KZZA 4HBLA 3RTRA 5DCMB 2WC2A 2UWMA 4XRFA 4B09A 2RV8A 2NYXA 2A07F 4QWQA 3TOAA 1W4MA 2W25A 2XAGA 4NB5A 1SFXA 3DPTA 2VONA 4U0VA 1OMIA 4UVAA 4WCGA 2ZXJA 1R23A 3KCCA 4L9TA 2F5CA 4RAYA 3K1MA 2STWA 1BI3A 1DPUA 1V3FA 2XAFA 1FC3A 2VE9A 3CUQA 4A5MA 2YR2A 3KZYA 4R1HA 2WTEA 3JAMK 3SQNA 3WU1B 4L5IA 1ZG1A 1TBXA 2ZNZA 2VE8A 2ZKZA 3GZ5A 1LB2A 1CF7A 1U2WA 3SZPA 4RGSA 2FMLA 2GA2A 2ZJ2A 2QQAA 2YPRA 3HHHA 3QU3A 1NHAA 4MQ9F 5LHGA 3GYHX 2BYVE 3GX4X 2XV4S 4P9UA 2ADUA 2ZO4A 3IRQA 1BIBA 5E18F 3COAC 4A0YA 1STZA 1IF1A 1X3UA 4N0BA 4G7HF 2HQRA 4UV8A 4UNOA 4Y13A 5LEKA 3WTUC 2RGVA 3DP7A 1F4KA 2F5DA 2QBYB 2VBYA 5CVVA 4A6DA 2ZFWA 3C18A 2WV0A 1R1UA 1YS6A 1TNTA 2M5WA 1WRJA 4AIKA 1YW8A 1D5VA 5CVUA 3BP8A 3WTVC 1R5GA 1ZLJA 5AONA 4M6YA 5D8KB 4XLNF 3KP5A 2OZUA 1VTNC 2DTRA 1CGPA 2HWVA 3PQJA 4OMZA 4U7BA 1W5SA 2IW5A 5DD8A 2EFWA 3J80K 1OYIA 2RQPA 1S7AA 4A12A 1QQIA 3T8RA 2D45A 5HDGA 3FWEA 4ZZLA 3F8CA 5DCFA 2QLZA 2VC1A 2JTVA 2FE3A 2W24A 3ISPA 5A2QZ 4HF0A 3N97A 5E1ZB 2VBWA 4L9JA 1ZGJA 1EV7A 1O3SA 1USSA 1IRFA 1ON2A 1UB9A 4I02A 2JRTA 3P7NA 2HOEA 2ETHA 2GWRA 1P4AA 2KIMA 2MLGA 2P4WA 2E7XA 2M87A 2BBYA 1FX7A 3SZTA 2FEZA 4YIFA 4G9YA 2YSRA 2F2EA 3E3VA 4EGZA 4KMFA 4KIGA 4E70A 2E1CA 5ICCA 5D5WB 3E6DA 4JBAA 2V1XA 4LLNA 4EJTA 4BYYA 2DBBA 5FO5A 3M8FA 3TQNA 3FMRA 4ASNA 2TDXA 4MEYF 2JSCA 4Y17A 3LA3A 3DPLC 4YFNF 2KKOA 1T39A 3ML6A 1LDJA 3DEUA 2STTA 5J6XA 3ZMTA 4BH9A 1FNNA 1YTYA 3DV8A 1IN6A 4IPAA 4HYEA 4IRHA 4OIPF 2O3FA 2HYGD 1LEAA 3K2ZA 1HSTA 3MQ0A 3CLOA 4U88A 1YYVA 1P2FA 4I98B 1K7AA 1WQ2A 3NRVA 4BQAA 4HLXA 4EVIA 3I54A 3QP6A 4N9HA 1I5ZA 3E6CC 2ESNA 1B6AA 2VT2A 2ACJA 3GW2A 1IAWA 3I4PA 3KP3A 1D3YA 3JTGA 1MJ9A 2O03A 2ZMEB 1I27A 1ZG3A 3P9KA 2NS0A 1MJAA 2K4JA 2JZYA 1GVJA 4UHTA 3KP7A 1IRGA 1SMYF 3E6BA 3M9AA 4CZZA 1I6XA 4AWXB 4LD5A 1ZRFA 3BJAA 3L7WA 3E97A 1XSDA 2HKOA 1TW3A 4IRIA 5D5XB 5ILUA 1U5TA 4OOIA 3WTZA 3ABUA 2QQBA 1FYLA 5LGUA 1OR7A 1XGOA 5LHHA 3WG9A 2A61A 2DU9A 3U1DA 1QNTA 2IJLA 3SXYA 1W7PA 1REPC 3I64A 3F6VA 2ISYA 4S05A 2BEOA 5LGNA 4KDPA 3H92A 4CGZA 4KIFA 3ZMVA 1ODDA 3L09A 5E20A 4YFXF 3RYPA 1Z6RA 3WE2A 4L18B 1ONVA 1RUNA 5DYMA 2EFPA 1R22A 5CVJA 3F22A 5FLXK 1FBUA 4ON0A 5LEJA 5L3FA 1BOAA 2OA4A 2PQ8A 3DF8A 1UHWA 4A6EA 3QOPA 2V1DA 2H94A 4YIIA 2HQNA 4DQ2A 1IN7A 1RNLA 3IWZA 4RAZA 1S3JA 1LDKB 4ZYEA 2CYYA 1RZ4A 5FD5A 3D5LA 2PBIA 4CHUA 1P6RA 4Q47A 1FYKA 3E5XA 2V1UA 1JXSA 3EYYA 4BHPA 1D8KA 3WTYC 1XSXA 1U3EM 3R60A 4FX0A 1XGNA 5AIQA 1P4WA 4XSZF 1BI2A 2XKPA 1F1ZA 2VOOA 3GFJA 4GGGA 1BI1A 5D6EA 1KU3A 2ZMEA 2PI0A 1FLIA 3DKWA 1HQCA 4Q48A 2L54A 3V7SA 5CJ9A 4S04A 2EWNA 3RKXA 5DV5A 2ZBKA 2RN7A 3HTUA 2XRNA 5D8LB 2EK5A 1R1TA 1IN5A 1I1GA 1FWZA 1R00A 3FXQA 1Q1HA 1TLHB 2Z5UA 2IA1A 1B9NA 4PZJA 3BOQA 3M7GA 3FM3A 3ERED 5K5RA 3FM5A 4KN4X 3JAMZ 5JR3A 4ENJA 4RB2C 5D4SA 1XB4A 1ZLKA 4WK8F 1PDNC 3P9CA 5HLIA 2BV6A 1WKMA
chains in the Genus database with same CATH superfamily
3G3ZA 5D4RA 3RPUD 4CCKA 4KT5C 4EJVA 4E7LA 3H5RA 5ICFA 4A3GJ 5EG0A 2O8KA 2DPUA 3GLXA 1OCZH 4RB3C 1R6RA 1Z9CA 3L2UA 2M4KA 5FLVA 2LBFB 3CMEI 2O5RA 3CDHA 3GFMA 4MQVA 1W5TA 5DCMA 2E7WA 2GOMA 3KLNA 1IG7A 3O3KA 3LSPA 5KVRA 1HXDA 3HSRA 5HNFA 3VYUB 2X4HA 4ZC3A 3GTGJ 5J8FA 1FEXA 2LKSA 3AFHA 2IXSA 4IL6C 5L3DA 2GLOA 1QRYA 2NOGA 2VQCA 3BWGA 5F08A 2DK5A 5F6FA 3I55I 1SFUA 1ZR2A 2KL4A 3CC7I 1OFCX 2M30A 1QZYA 1Z3YA 3BCAA 3CESA 4MLOA 1ETYA 1MMAA 4E7JA 1J5YA 2F5EA 2R7OA 3Q9SA 3W2WA 2NOJB 5L3EA 5FRNA 5BQTA 1SANA 2YX7A 3QODA 5LLQA 5J4VA 5F0HA 3VYSB 5J8CA 4XOTA 3P5JA 1I3AA 4WX9A 4AYBA 4U0WA 3GTQJ 2LKPA 3F8FA 2IP2A 2ESHA 3GZ6A 1ZR4A 3HSEA 3E6MA 2M45A 3MKYB 1XCVA 1FZPB 2DA1A 4N9IA 3L2QA 1DGWY 2BHYA 1KYWA 2KJCA 1FPQA 4C3HJ 4HLYA 4A93J 3HOXJ 3K6GA 3E7LA 4MGRA 4BS9A 1YOVB 3HB9A 4U7DA 2EJRA 3BY6A 3K69A 1WPKA 2DW4A 3G1LA 3OSGA 2WAEA 4W97A 3I53A 3CJQB 2B0LA 1TQMA 2QSGX 3LOCA 3RIRA 4P9FA 3B73A 5EDNA 2NVYJ 3FMSA 1F36A 3DU6A 3A0HC 3H35A 1O3RA 2L3DA 2XHKA 3A1YA 4EQQA 2KQRA 1A5JA 3F8NA 4FISA 3RQIA 4BQOA 2VJ5A 3J80Z 1VQNI 2XPWA 1G3SA 2XF7A 1HDPA 3ZQHA 1HBXG 1TT5B 2W1OA 2ZJRF 1SD4A 1LPQA 4RAFA 3NARA 1U5TC 5IT3A 4BXUA 3S32A 4OAYA 4BAYA 5KCMA 2D1VA 4QPQA 1G2HA 4U87A 2GM4A 1GV5A 3QWLA 4XLAA 5EF6A 3OYLA 2OTJI 2X6OA 4QLCU 2V9KA 3DBLB 4MHGA 1ZK8A 3HOTA 3NQOA 3V4GA 3CMYA 3R61A 3AG2H 2DAOA 1ETXA 3M4OJ 2DCEA 4F3QA 4IHXA 2R7TA 3KX2A 2LSOA 3I56I 1UZCA 3ZMUA 1Y8RB 2W84A 1TW2A 2E71A 2F6CA 2HDWA 3A03A 4A3EJ 2FSWA 4ZYGA 1SFKA 2L4AA 1E3OC 5F0FA 1O57A 4ESBA 2PMZN 3HRUA 1T98A 1X1BA 4CH7A 4OIQF 1RR7A 4ZTJA 1FP2A 3DKXA 4ITVA 4EM1A 5DUKA 1NK3P 3R4KA 1IJWC 2HU9A 2GIZA 3HRMA 3RKWA 4XSXF 1E2XA 4DIQA 1NK2P 2O6GE 2BGCA 5E1WA 2IGNA 3OYIA 3FMQA 3PQKA 5JLWA 3VSLA 4ENKA 5ED4A 3MWMA 2ZC2A 4LOCA 1J09A 2VUMJ 6PAXA 5D6FA 3HZJA 4XKBA 4H0EA 2R4GA 1A6QA 3EYIA 3REOA 3GFLA 3ZMSA 5EYRA 3DBRB 3ONQA 1G8XA 3VB2A 3QPHA 3OYFA 1H89C 1SMTA 4IKFA 1QU3A 2MC3A 3CTAA 1U5TB 1USTA 4DYQA 2OCEA 2OU2A 2OJED 1R36A 3W2VA 4GFBA 3QQAA 4CYDA 1N77A 3OIPA 2K27A 3SJMA 3MZHA 2M2EA 1RPWA 1ZAOA 4CZCA 1BL0A 2MFZA 3N05A 1MKMA 4RGXA 2Y2ZA 3BJOA 4JQFA 2D5VA 4A3CJ 1ITYA 4L9NA 4WF2A 1X1CA 2FMYA 4KFCA 2KIFA 3QYFA 1DUXC 2QBYA 2R5YB 2KZVA 1K4TA 1MH3A 3DTKA 3VOEA 3A01A 2ZJPF 5FB2A 3BZ6A 5EEAA 3WG7H 3S1MJ 1DU6A 1SVMA 1UHSA 3NWTA 2KP6A 2R7RA 1SD5A 2L7MP 2G7UA 1O3TA 2FXAA 4HNTA 2UV1A 4CYCB 2PX9A 4Y4RA 2Z33A 2R7QA 5E8GA 3M8JA 2OTLI 2DMUA 4I7HA 4RAGA 2X6XA 2FQ4A 5KNLA 2KPMA 2HS5A 3DBHB 1V4RA 5HS7A 1OJLA 3GTJJ 1J59A 1SD7A 5JFRA 5JVGF 2IS4A 4KMUX 4J01A 3R0AA 1LKXA 3FF5A 4YRVA 1XTAA 1GXPA 4EEFG 3IKTA 4NHJA 2XB0X 2Z9OA 1TC3C 5BMZA 4G94A 2BY2A 3MZYA 3BR1A 4XLEA 2UXNA 1VQOI 1A31A 1FOXA 2QKLB 1IXCA 2DA4A 4E4HA 1NG7A 3H36A 2JA5J 3VYRB 3OYHA 2E2HJ 5HLTA 2G0EA 2CMPA 2P8TA 2QZ8A 4ZH4F 5IT9K 3IKVA 2O0YA 4QPOA 2QKMB 5K1YA 3T8TA 3TKYA 3S1RJ 3Q3SA 5D5VB 2RC4A 2CSOA 1IZ1A 2DK8A 2V6EA 1ZG5A 3GTKJ 2EA2A 2OCCH 4XKWA 1T95A 2Q8KA 4F52A 3MEXA 2WBMA 5IP6A 4XKVA 3JSPA 3TP0A 3HJEA 4P55A 4A0XA 2L0KA 1ZELA 3WE3A 1T33A 2EIMH 5B1BH 1A35A 3HEFA 1ZN2A 3FIWA 3KYCB 4M9ZA 2E35A 3KZIC 3DWLE 2Q0OA 5EEHA 1G3WA 4NNJA 2CUEA 2VIXA 4XBFA 1LJ9A 1E17A 5GPAA 1PVEA 3TP3A 2J5OA 4PJLA 1QO0D 3RKYA 1LQ1A 4AD9A 4KIBA 2AS5F 1RC9A 2QGUA 3OYGA 4Y3OA 2VJJA 3K4LA 3C7JA 4TV7A 4RB0A 4RGUA 4ESFA 1XD7A 1H88C 2F4MB 1YQAA 1T0FC 3CF5F 2YUSA 4XK4A 5FGMA 5EG0B 4EGYA 1G3YA 2VXDA 2MD5A 3M8EA 2GXGA 2JK3A 1P7IA 3FKIJ 2BW3B 5M3FJ 2LR8A 2V4JC 3VEPA 3ZQ7A 1B72B 4IX7A 2DLLA 2RNGA 1IW7F 3OV8A 3LQRA 1T08B 2W7NA 1HDDC 2EINH 1RESA 3H0GJ 4I01A 3DTIA 3X2QH 3OL4A 5DDGA 1LDDA 5GTHC 4UY8I 2A68F 2BY0A 2EFOA 4WXDA 3F6OA 4WWCA 2JT1A 4RDUA 1HW5A 1MBHA 2VOPA 1GUUA 3ABTA 2CG4A 2DQRA 4P5OA 4DW6A 3S3NA 1Z67A 5HS8A 5FD6A 4CCOA 1EH6A 3BR6A 2QWWA 3AL0B 3F8MA 5J40A 4GCVA 3DXJF 3CDLA 1UHMA 3BDDA 4HDUA 2HVQA 2DA3A 3S3OA 3LSJA 1Y39A 2Q2EB 3G2BA 1XMKA 1RKTA 3FK6A 2CFXA 3LSRA 1HCRA 1ZYRF 1KU7A 2NNYA 4BHCA 4O6JA 2UXXA 1BJAA 3GMEA 2KT0A 3H9GA 3H3VK 4HNVA 3HRSA 1YW7A 1DDNA 4IZZA 4EJOA 1YITI 1XMAA 1VQPI 2D2WA 2ZNYA 1MMDA 1T8IA 5IYCJ 3RI4A 2Y9YA 4EM2A 1WJEA 2VC0A 4AIJA 1V54H 3WODF 3LMMA 1A04A 1ZQ3P 5ERIA 2EFNA 4FX4A 5BPDA 3ZQQA 2DDAA 2AHQA 5FRMA 1K78B 1PP7U 4IQ4A 1TWGJ 3PFIA 1R5HA 2ECCA 2JWTA 2W85A 4KJZA 3TL4X 3BG9A 1MBEA 2FBKA 2HOSA 2F5FA 1TWAJ 2AO9A 2Y30A 4IF4A 3BTCA 3ZMZA 3ERMA 1WVRA 4AVPA 1MIJA 1S29A 1MZBA 3TEDA 2DO7A 2PFBA 2XGEA 5CVIA 3WHBA 4A3KJ 3H1CA 3ABLH 2HFHA 3H5NA 3KYLA 3I71A 3K2AA 3ZMDA 3OIOA 3I59B 1POGA 3FDYA 5E17F 3ASOH 3FXKA 2YX4A 4UUSA 4IJAA 3CCJI 2P6SA 1XDUA 1HOMA 4UVCA 1K6OA 1MDMB 4RB1A 1TWCJ 2R3SA 1JJ6C 3AL0C 5BNGA 4BDYA 2CWEA 2MBFA 2A6HF 3S17J 2IGOA 1Y1WJ 3EQLF 2NRAC 2M34A 5E3OA 4BKXA 3M3YJ 4OIOF 5L3BA 3GEZA 3HBLA 4O5VA 2EV6A 2XF6A 2FU4A 4A0ZA 4DBQA 3HM5A 4WXHA 1PP8F 3U9GA 3D5SC 4EATA 1E3PA 2CUFA 1DPRA 4PGGA 2DA2A 2BVLA 1HKTA 2RVCA 1SFEA 2MD0A 2CJJA 2XPVA 2PLYA 1TP4A 4ENMA 2E2IJ 3BJ6A 4IOAF 2P6TA 3S2WA 4X0GA 2AQEA 1MD0A 1XN7A 1XS9A 1WFXA 2E34A 1UCRA 3JW4A 4M71A 1U6GA 2MA3A 1FJLA 1BBYA 4OAZA 5EGOA 3K4MA 4DNCA 2W57A 1IO2A 3V7RA 1XC5A 2H6CA 2ZMEC 4FT8A 5JI6A 1G6NA 1DQUA 3BPVA 4HAMA 3ZPLA 2IT0A 5CPRB 2OQGA 1YIJI 4O3MA 1ZARA 4CCLA 2Z99A 1U0JA 1TQIA 3B02A 2M0MA 3W6KB 1AHDP 2GAUA 1MMSA 4HW0A 3BG6A 5H6RA 2UZKA 1YE9A 1D0XA 2DJNA 2DFEA 2COBA 1Z3XA 4JP0A 2A6EF 2IAIA 3TW7A 5E1XA 3FBIB 3L2CA 3V8KA 3BPXA 3AAFA 2P5LC 2R7ZJ 1MMGA 2FOWA 4P96A 4PUSA 3LSMA 3S2HJ 3SDGA 2FUG2 1OR7C 3LNQA 1W36C 3FXJA 2JA7J 3V8JA 4BHBA 1X2NA 4XONA 3HYIA 3LA7A 3BR5A 4LK0F 2VKDA 3ZCOA 2FF4A 3KLOA 4AIHA 4LIUA 4CDGA 1J9IA 4BUPA 2XUBA 3TO6A 3WTWC 5LGTA 2OD5A 1AU7A 1JE8A 1G4DA 4YFKF 2L01A 4EJUA 2KMUA 4R79A 1HW1A 3JRAA 2ZCWA 1SFOJ 3M07A 2K40A 2HOAA 4A3FJ 1X4PA 2CGPA 4XLCA 3KEOA 3FXMA 1D1CA 4G8XA 4ETSA 1S7OA 5HDKA 2V1NA 4LB5A 3OIQA 2LP0A 2WWYA 4XN3A 5LRSA 2OZ6A 3CUQC 4V2GA 2K02A 2VI6A 3G73A 2CQQA 2VQHA 4J00A 4IHYA 3K9TA 3HL2A 2R7DA 1MGTA 2JPCA 1QPIA 4ZYHA 1KU2A 1OQYA 2DYSH 4MFEA 2VLAA 3JREA 3BTJA 2E2JJ 4L9VA 1VF9A 1U8BA 2L02A 2W4SA 2XSJC 1KYZA 4G6TB 1W0UA 2NAZA 3WGHA 3WTSC 2OAZA 4JX4A 4HA8A 3TDUC 2FBHA 5DUIA 5M5XJ 4KNYA 5DEQA 4M6VA 5GADJ 3LWFA 5ILSA 1FSEA 4ZJZA 3J7AY 1QGPA 2A3SA 3IL2A 1ETKA 1QHHD 3C3WA 1TTYA 4UV9A 4G6DA 4CO8A 1UAAA 4CXFA 3TOBA 2O8XA 4XLFA 1X2MA 2HDCA 4XIDA 3ZN1A 4BEHB 4KYWA 1MW7A 3PFYA 3HOUJ 4HX7A 4XRMA 3DPUA 1JKRC 2Z3YA 4GYIA 4RGRA 3FISA 2X9DA 2ZSIB 5JHUA 2R5ZB 3CO7C 4XRSA 2V26A 3E5UA 4M3BA 4L0ZB 4M9SA 2DA6A 2HR3A 1RI7A 1UMQA 2ELJA 4UUVA 2H09A 3KFWX 4HF2A 4BU2A 2X1DA 1S5LC 5ICGA 2E1OA 3K70D 2LMDA 2P5VA 3OS2A 3L1PA 3S14J 4F55A 1WJDA 1T0FA 2X6WA 3A02A 5CYVA 5HOOA 3J7AO 3K10A 3WU0A 1TWFJ 1X3WB 2XPUA 3HPHA 4RM3A 5IY5H 2JA8J 2R7VA 2I10A 1KA8A 4DZPA 2HZDA 3ULQB 2R5ZA 3H9QA 5IYBJ 4NQWA 4HG2A 4L5JA 5IP7J 3C2HA 2D1HA 4IRGA 2HYFA 3C2BA 4BJ6C 1VQKI 1I1SA 2XRLA 2YS9A 1PUEE 1BM9A 4LB6B 2CFOA 4A3MJ 1RRJA 2HXOA 3DEEA 4XN0A 2EV5A 4AM3A 4M6XA 1A36A 2Y0SA 1XCBA 2PMHA 1KQ0A 3CUQB 4LK1F 1QBJA 1K83J 1H9GA 1QVUA 4B48A 3S2DJ 1SVOA 2W48A 2M4GA 1R58A 3BROA 2VB6A 5LHIA 3AKZA 3KP2A 2V79A 3DKYA 4KN7X 1WI9A 3HOVJ 5L3CA 3GFIA 1EH8A 2MSYA 3F72A 4B43A 2K3PA 3JRGA 1R1VA 2NNNA 1W0TA 3RDIA 2PMUA 3EDPA 4HDVA 3VDXA 2FRHA 1H0MA 3I4NJ 3OL3A 1OCTC 4I6ZA 5M5YJ 1IC8A 1OISA 1LE8A 4BJ5C 5GPCA 5BS6A 2R5YA 3MMYB 3K0LA 5IOYA 3A0BC 1BN5A 3KE2A 4B3AA 1HSJA 3K4BA 4LLLA 2NVTJ 3CDIA 4K2EA 1TT0A 3FXRA 5H20A 3CZ6A 3D5RC 1JTYA 1R5ID 3AG4H 2FNPA 3IWFA 3QAHA 4LGWA 2HZTA 2CV0A 3RPUA 4RS8A 4LIVA 4HEA2 4GRIA 1P4XA 1W7PD 1WJFA 3FHNA 2DA7A 5EZHA 1TQPA 3HOWJ 1Z05A 4EV0A 2VQGA 2XC7A 2E1MB 3Q9VA 2J5PA 2F48A 2X85A 1YW9A 2NVUB 3S15J 5FKMA 2ZXWH 2M1BA 3QRFF 3HHGA 2JPBA 3BTIA 3L2VA 2BHZA 2WAFA 3N4MA 3V7CA 3M1EA 2I8DA 5DM6F 1ZREA 2F5VA 1T6SA 2E60A 4ZYAA 2BY1A 5J1UA 4HQMA 4KUMA 1QZZA 3KP6A 3LSIA 1QZEA 2KFDA 4LFUA 1S9HA 4NC8A 4PJJA 5J3LA 3U1KA 2IRFG 1JUMA 2E5NA 2QUFA 2EV0A 1K78A 2MH2A 2KLOA 2IPQX 3CUOA 4JX5A 4OINF 3I4MJ 2WB1A 5BOXA 5J47A 3LA2A 4CA0A 4C30A 3GVAA 2VJIA 1OKRA 2V7FA 4L0YB 1E3HA 5FFXA 4IHVA 2LF8A 3RJPA 2KRFA 3IUOA 1OYWA 1Z6TA 2Y48A 1KQ9A 3HKZA 2O61A 2R7FA 1ZH5A 3T5XA 2DXIA 2EZIA 3CCVI 2X0LA 4HV6A 1Y1VJ 3CLQA 3IH2A 5BPIA 3EPZA 3WGGA 2XKOA 4PCQA 3BCBA 3LAJA 1Y6IA 3MFKA 3HUGB 2ISZA 2PJRA 2DI3A 2PN6A 2QYOA 3BQYA 1EJ9A 3HTSB 1W7PB 3W6JB 2OPTA 5K5OA 1YRNB 4ZDOA 1ZRCA 5E3MA 2LY1A 4HNUA 5EEGA 5B5EC 3K1NA 5ICEA 4I09A 4II2A 1JUPA 4I0BA 2KDZA 2DYRH 4R8HA 2PG4A 1P9QC 4M3DA 1R71A 1BA5A 2HTJA 3GXOA 4GDFA 4BXXJ 3D0SA 3QYBA 3R0JA 1W1WE 3SFIA 1OYYA 4XR6A 3TGNA 3BG3A 1U8RA 4Q5SF 2VBZA 3ZRGA 2GXBA 1LVKA 2ID6A 2VXZA 2RNJA 3H3UA 2AXTC 4WXCA 4UUSB 2LDUA 1IN8A 4HF1A 2K7LA 2C6YA 3CJRB 2GZWA 2IVMA 1ORKA 4AVZA 3HXLA 2QM3A 5GAHJ 2HVSA 3H5AA 3BR3A 1N75A 3PSFA 4LJZF 3LSGA 1Z91A 1ENHA 4D9JA 2JVHA 2V9VA 2E5ZA 3MAJA 1XX5A 3OYAA 3G6EI 5EZGA 4HSRA 5LFAA 4GO1A 3LQQA 4HX4A 3GF2A 3ROUA 1I3QJ 1BR4A 5DD4A 4CCNA 1N78A 4X1EA 1QPMA 2XIGA 3LFKA 1W36D 1A6IA 2HTSA 2P5KA 4A3JJ 2DOAA 4KA4A 2VL8A 1LEBA 5TRDA 4M74A 5EJCA 4MTEA 2MYSA 2O7OA 1YIOA 1O3QA 1MJBA 5C4XJ 2JJ7A 4LLGF 2X1EA 4PJNA 2AXLA 1YX3A 4P1WA 4UVBA 2Y75A 2EFQA 2MLKA 3HSFA 2H1LA 1XGMA 2LRDA 5GAGJ 4L5EA 5KAIC 3BLYA 5HS9A 1VQMI 2X48A 5FKOA 2A5YB 3GO5A 2DPDA 2Y0MA 2CQNA 4A2UA 3L9FA 2DMPA 1LVAA 3S1QJ 2XVCA 2H27A 2ZXHA 1ON1A 2QENA 1FY7A 3DTEA 2VODA 3JTHA 2G7HA 4XOPA 1Z1DA 3H3ZA 4IHTA 1JKQC 2BE5F 1HW2A 2XAQA 1SAXA 3DFGA 5FFZA 4LG0B 4OMYA 4HZFA 1BI0A 3OWTA 4D0PA 3O2PE 4BBRJ 3ZP5A 1G59A 2HQ5A 2DT5A 1ETWA 3PSIA 1L3LA 3KEQA 1WSUA 3G4SI 2FOKA 1APLC 4HV5A 4C2TA 5AIPA 3I58A 2DTZA 4I2OA 4CICA 4XMYA 4A3IJ 1SD6A 5KK1A 3J81Z 2HGCA 1X3ZB 2KRHA 4AYBN 2IA2A 2PEXA 4UUTA 3LAPA 1S8NA 2EB7A 2W82A 2FQ3A 1IRZA 1Y56A 3T0YA 5JHFA 1J7KA 3DU5A 2BY3A 3C1DA 1YFHA 3WTXC 3S16J 1WI3A 4HX8A 3FBNB 4HQEA 3CD6I 2CQ7A 3T1BA 1B1BA 1AWCA 4CUGA 2XROA 2BZTA 2P81A 2NVQJ 3VODA 4M73A 5H6QA 4AIDA 3JCUC 5B66C 4NC6A 1VQ5I 1YLFA 2LD5A 1XGSA 4RA2A 1MBGA 3WHCA 2E1NA 4FHTA 5CKTA 2K86A 3GWZA 4UXNA 3CCYA 3ZQIA 1DP3A 1J2XA 2XAHA 2Q1ZB 2ME6A 1BW6A 1C0WA 4I99C 3OYNA 3A2KA 1DGRM 2M7BA 2GQQA 1MDMA 5E3NA 1RIOH 1H9TA 5LBQA 4QSHA 2Z1DA 2KIUA 3GZNB 2VT3A 3ZN0A 4BL0B 1L0OC 4FE7A 3CJNA 1B9MA 1XSVA 5HLHA 2CQKA 2K4BA 1AOYA 2CW7A 3TO9A 1JTXA 3FX3A 1HKSA 4RBOA 2WAQN 3HRTA 1BC7C 3IHUA 4EM0B 3CMAI 2VN2A 4DYRA 2LTPA 2Y9ZA 1ZTRA 2PJRB 3PNTA 4ZTFA 3ABMH 1MNMC 3VFZA 4BY7J 3NEUA 3O8HA 2FA5A 5L3GA 4G7OF 2L2OA 4D5FA 1BC8C 1D0ZA 1VI0A 3SHFA 1ETVA 5C44J 1FYMA 1IXSB 3K7AJ 1BW5A 4RLFA 2M8EA 9ANTA 3MVPA 2JSPA 3RPQA 3HOYJ 5LD2C 2ELHA 1WJCA 1O7FA 1U9OA 1D8JA 4FASD 1CF7B 1MNDA 2P7VB 4IHSA 1GHCA 3KP4A 3F23A 4NC7A 2GBYA 1TNSA 4I76A 4E7SA 1JHFA 4G7ZF 3SEZA 3PIPF 5CVRA 3U2RA 4G12A 3OR2C 4XM3A 1FMWA 2BVMA 1IUYA 3FXUA 5JLXA 4M9XA 3ECOA 2VJ4A 1FP1D 1S72I 1OPCA 3W6VA 5FLXZ 1TL8A 3K1PA 4MEXF 3GCMA 1P92A 4C9YA 4PSXA 5HLGA 4Q4ZF 2HEOA 3PO2J 3KETA 5HODA 2MH9A 1MH4A 1WZ2A 2LNBA 1FSHA 3F8BA 4PDKA 5D5UB 1BJZA 4EJWA 3MKWB 3FHZA 4E7IA 1QHGA 2OQRA 4C2MJ 3BTLA 5F1RA 2CW0F 5TGTA 4EMSA 4B8XA 3UKGA 2KJBA 1WH5A 2WV1A 3EETA 3WGIA 3Q5FA 2IS2A 1JHHA 1HF0A 5F64A 1BIAA 2A69F 1GXQA 1G3TA 4LG3A 2FX0A 3SDBA 3IC7A 1LFPA 2PJPA 3EUAA 1F5TA 1HKQA 3VPRA 5CLSA 3E5QA 3TO7A 1JGSA 1B59A 2G9WA 1IN4A 2IA0A 3OYKA 3CCMI 1MBJA 2CH0A 2EBIA 3A4CA 2KIQA 3IH3A 2XGXA 3ELKA 1VQ4I 1KGSA 5B1AH 2RKHA 3M1CA 3LSKA 3JSOA 2R7UA 1J0RA 1ULYA 5LRRA 4U0YA 3OYBA 4ESJA 1J75A 4KICA 4XQFA 2VBXA 4G6QA 1Q1VA 1YG2A 1NTCA 1Y0UA 3HC7A 1I6HJ 3JRFA 2MGQA 3R6SA 2K9QA 3CCEI 1ZKGA 2GOXB 1WJAA 2QF7A 3I59A 3CCRI 2X6YA 4AC0A 4XRSG 2HKXA 3J81K 2KRCA 2E1MC 3MKZA 2R7XA 3FZVA 3E1SA 1D1AA 3MCZA 4LG0A 2M8GX 1B8IB 1XDSA 4YG2F 4XLHA 2BXZA 2FNAA 4IVNA 4KITB 5H2FC 3OYEA 2YU9J 4MNUA 3SZGA 4C3IJ 2RDPA 3QPTA 4ZYDA 1LUJB 1X1DA 1K79A 1FBSA 3FKJA 3F3XA 4YELA 1FBQA 4BNCA 3F21A 2RREA 3OOPA 4Y15A 2P0WA 5EGOB 3KIOA 4BACA 2XAJA 2DT6A 3TDZC 4A5NA 1GVDA 5HDNA 2L4MA 1QVTA 2H6BA 4IEJA 3RZOJ 5A2QK 1I50J 5ILVA 4ZDLA 3I5UA 1U78A 1T2KA 3G1OA 3QU6A 3L2WA 2VKEA 5K5QA 2QQ9A 2V9PA 2Y31A 2FBIA 3HOSA 1V55H 4JK1X 1EH7A 3DQVC 2DQLA 4Z2YA 5JVTA 2L9SA 2ZFUA 3OOUA 2CV1A 1F9NA 4B1RA 1R7JA 2DJIA 1B4AA 2Q2EA 1LNWA 1VQ9I 2DMQA 1Z7UA 1ZHFA 1SC7A 1JT6A 3HIFA 3P9IA 1H8AC 2LF7A 4BQQA 5TISC 1QA6A 2F4IA 3QP5A 3JRHA 1Z77A 1GV2A 4DZJA 2LC2A 3DLLF 4X6AJ 2DFIA 1R4NB 5C4JJ 3OSFA 1ZGAA 3LSTA 3CF2A 1YX5A 4MTDA 5GAEJ 2R0QC 2IBDA 2L5QA 1T38A 2GXAA 1WWXA 2ZJQF 3ECHA 4OU0A 5E8IA 2Y69H 3ZGKA 2P7CB 3HUGA 2CO5A 2E36A 3CCSI 2VKHA 4BE1A 3H0DA 1DP7P 1EF4A 2YU3A 1WJ5A 1YO5C 2GIVA 2XASA 1FT9A 3EUHA 2FJ1A 2DMTA 3WTTC 2EA4A 3F9KA 2VKVA 4I0AA 4PGHA 4Z6YA 3KPHA 4F7ZA 2DOEA 3K4KA 3CCUI 3CJTB 3GUDA 4RM2A 3GTPJ 1O7LA 2Z2SB 3HDDA 4LMYA 2QQ8A 2CW8A 3SFZA 4BXFA 2OBPA 3ZXSA 1HC8A 5IT9Z 1P7JA 3OY9A 1S7EA 3RYRA 4YIRX 3IP4B 1FOWA 5FKKA 2B7EA 4GXOA 1KU9A 3I0TA 4XLPF 2GA1A 2JN6A 2OUMA 5F27A 4BQNA 1HA8A 2DODA 1IXRC 4UB8C 4ZZDA 2W00A 4IXAA 3L00A 4D5CA 4GYGA 1UJ8A 4HOBA 1FOKA 1UFMA 5TJJA 1KQ8A 3PL8A 3PUBA 2BXYA 5HVQC 1ZRDA 3JR9A 5B3SH 3CO6C 3O6BB 1EA3A 1S6LA 3CCLI 2KDOA 3S3MA 3Q0UA 4M72A 3V8LA 3K70C 2NS8A 2EILH 1JI8A 1GT0C 2LYCA 1RUOA 2V6CA 3IRRA 3G1MA 3HKZN 4ENNA 2COMA 5KAFC 1Y0NA 4OIRF 2TRTA 3JRIA 3GBGA 2QVOA 5J4YA 1YS7A 3KZZA 1IDYA 1BR2A 4HBLA 3RTRA 4DYCA 1LFBA 5DCMB 1XPXA 5IP9J 2WC2A 2UWMA 4XRFA 3C2GA 4B09A 2RV8A 2NYXA 5HNHA 3EUKL 3UR3C 1SEUA 1R49A 3D1NI 1JKOC 2A07F 3QPSA 4XL9A 2WB1N 4QWQA 3TOAA 4FTHA 4JOMA 1W4MA 1ZGWA 2M7AA 3HOZJ 2W25A 5K7HA 5IYDJ 2XAGA 4NB5A 1SFXA 2QCOA 3DPTA 2LG4A 1RKWA 2OF7A 2VONA 4U0VA 2WY8Q 1OMIA 4M3EA 5DS9A 4UVAA 4ANJA 4WCGA 1X58A 2NVXJ 2H8RA 3MKLA 2ZXJA 1R23A 2BW3A 3BC8A 3KCCA 4L9TA 2F5CA 3DEWA 3K1MA 4RAYA 2STWA 3LL7A 1D1BA 3OR1C 3IAS2 1BI3A 2NXNB 1DPUA 1V3FA 2IS1A 2XAFA 2H8WA 1FC3A 2DMNA 2VE9A 3BZCA 2DN0A 3S1NJ 2WAQA 3PNVA 1ERDA 1VQ8I 3CUQA 4E6KG 3VWBA 2M0CA 2L7FP 4A5MA 2YR2A 4MFDA 4D7MA 2OV7A 4RMNA 3ABKH 1YI2I 4KISA 2VQLA 3KZYA 4R1HA 2WTEA 3JAMK 1UELB 4E7KA 3SQNA 2HOTA 3WU1B 4Y33A 1PUFA 2NS7A 4L5IA 2ZXIA 1ZG1A 1TBXA 2ZNZA 3HG9A 2VE8A 3DLAA 1V5GA 2ZKZA 4A3LJ 3GZ5A 1LB2A 1CF7A 2N8GA 1U2WA 3SZPA 4FQGA 2DOFA 4RGSA 2FMLA 2DFHA 2GA2A 2FD5A 1FIAA 3IV5A 2ZJ2A 2QQAA 2YPRA 3DCFA 1FIPA 2HI3A 2K5CA 3BQZA 2L7KA 3HHHA 1WJBA 2VASA 3QU3A 1NHAA 4MQ9F 5LHGA 3GYHX 3G71I 2BYVE 4V2FA 4BBSJ 3GX4X 3IAM2 2XV4S 3AG3H 2MC4A 4P9UA 2ADUA 2ZO4A 3IRQA 2LKXA 1BIBA 5E18F 3COAC 4RLQA 4A0YA 1STZA 3CP2A 1IF1A 4XNFA 2ZB9A 4M3GA 1X3UA 4N0BA 4G7HF 2HQRA 1JKPC 2EZHA 4UV8A 2L9VA 3FXLA 4UNOA 4Y13A 5LEKA 3WTUC 4NUBA 4BJTA 2RGVA 3DP7A 1F4KA 2F5DA 3WU2C 2QBYB 1TWHJ 2VBYA 3QPLA 2OC6A 5CVVA 4A6DA 2ZFWA 3C18A 2WV0A 1R1UA 1ETQA 4E7HA 1YS6A 1TNTA 2M5WA 1WRJA 3ESWB 2ID3A 4AIKA 3FXOA 1YW8A 1D5VA 3GTLJ 2M3AA 5CVUA 3BP8A 1B72A 1R4MB 3J7YJ 3WTVC 1R5GA 4KT6A 1VQ7I 1ZLJA 2EZKA 5AONA 2LLKA 4M6YA 4M3FA 2L9NA 4QIWN 5D8KB 4DJAA 3Q0WA 4XLNF 2JQ7A 3K4NA 4DBRA 3KP5A 1Z21A 2KZGA 2OZUA 3OS1A 3OMYA 1VTNC 3NWSA 3LFUA 2DTRA 2MG4A 1CGPA 3O8GA 2HWVA 3PQJA 4OMZA 4U7BA 3K4JA 1W5SA 2IW5A 3E0JB 3Q0VA 4II3A 5DD8A 3RKQA 1AKHA 1EKEA 2EFWA 4XORA 3J80K 1OYIA 2RQPA 1JUSA 1S7AA 2BOLA 3BG7A 4CCMA 3PM1A 4A12A 4BE0A 1V5FA 1QQIA 3T8RA 3KEYA 3JRDA 1TZLA 3KYDB 2CU7A 2D45A 1BOBA 2KHMA 5HDGA 3FWEA 4ZZLA 3F8CA 5J1YA 2IS6A 1IDZA 3B6AA 1YJ9I 3BR0A 5DCFA 4NQWB 4F93B 3CMMA 2QLZA 4XKCA 1K6YA 3ZR8X 3SYTA 1D5YA 2VC1A 3ZQGA 2JTVA 2FE3A 2WA0A 2HQAA 2K3FA 1NG6A 2W24A 3ISPA 2ECBA 5A2QZ 4HF0A 5FKLA 1MSEC 3N97A 5E1ZB 2LOOA 4C3JJ 2VBWA 4L9JA 1AKHB 1BR1A 1ZGJA 1EV7A 1O3SA 1VFCA 1SAUA 1USSA 3RSNA 1IRFA 1ON2A 1NH3A 1UB9A 4I02A 2JRTA 3P7NA 4FETA 2X51A 2HOEA 2ETHA 2GWRA 3J7ZI 1P4AA 2LH9A 2KIMA 1IGNA 3TMOA 2Y0SN 2MLGA 1OCPA 4Y7NJ 2P4WA 2E7XA 2M87A 4JYKA 4ZDPA 3F0CA 3I3LA 2BBYA 1FX7A 3SZTA 2VPRA 4CSWA 2FEZA 4YIFA 1WGXA 3IH4A 4G9YA 2YSRA 2F2EA 2XF5A 4A69C 5C3EJ 3E3VA 4EGZA 4KMFA 1PYVA 2RQQA 4LITA 2F4OB 4KIGA 4E70A 2E1CA 2AQFA 5ICCA 5D5WB 3TW6A 2L7ZA 3E6DA 4JBAA 2B9SA 2V1XA 2DFFA 4LLNA 4EJTA 5K7FA 1ETOA 2DBBA 4BYYA 3MD2A 2HDDA 5FO5A 1W5CC 5FROA 3M8FA 3TQNA 1X1PA 3FMRA 2E19A 4NBQA 4BGDA 4ASNA 4V19K 5GP9A 2JUGA 2TDXA 1IV6A 4H4KC 2B63J 1PJRA 2IGMA 1XMXA 4QTRA 4MEYF 2JSCA 4Y17A 1Y8QB 3LA3A 1JGGA 1SVLA 3DPLC 2TCTA 4BDZA 1CQTA 2H1KA 4YFNF 5GTIC 2KKOA 4IHWA 1T39A 3BR2A 3ML6A 5FKNA 1YJNI 1LDJA 3DEUA 2STTA 5J6XA 4PJ0C 2DT7B 3ZMTA 3CC2I 4BH9A 1FNNA 2VPLA 1YTYA 2QEXI 2HYJA 3GTOJ 2X1CA 3DV8A 3W2AA 1IN6A 4IPAA 5F04A 2JA6J 4HYEA 1LFUP 4IRHA 4OIPF 2O3FA 2HYGD 1LEAA 5F0CA 3K2ZA 1HSTA 4W1UA 3MQ0A 3CLOA 4U88A 1FMVA 2XGCA 1YYVA 4AU7A 4N4NB 1P2FA 2LFBA 2EIKH 4I98B 2ME0A 2MABA 4BEHA 1K7AA 1WQ2A 1VQLI 2A6TA 3NRVA 4BQAA 4HLXA 4EVIA 2LBFA 3I54A 3QP6A 5FJ8J 1D0YA 2K9LA 3UNGC 4N9HA 1I5ZA 2XGDA 3E6CC 2ESNA 1B6AA 3VSKA 1JJ8C 4S0HB 2VT2A 1HLVA 2ACJA 3GW2A 1IAWA 3I4PA 3KP3A 1D3YA 2IGKA 5IOZA 3JTGA 1MJ9A 1MBKA 3CCQI 2O03A 1MNEA 2ZMEB 1I27A 2Z16A 1ZG3A 1OCCH 3P9KA 4B44A 1RR8C 2NS0A 1VZ0A 1MJAA 1IV8A 1KZHA 1YHQI 1LE8B 2K4JA 2LK2A 5IPAA 2JZYA 2HXIA 2CUZA 1GVJA 4UHTA 3KP7A 1IRGA 1OCOH 1SMYF 3E6BA 3M9AA 4PSWA 4CZZA 2O9LA 1I6XA 1FTTA 3HGYA 4AWXB 4LD5A 5KHDA 1ZRFA 3BJAA 3RZDJ 5E79C 5DTDA 3L7WA 2K9SA 3E97A 2EH3A 3U21A 3OYDA 1XSDA 2HKOA 1TW3A 4IRIA 2M9HA 3RQ4A 2HNHA 2LY9A 3K4CA 1F43A 1T56A 1X4OA 5D5XB 5ILUA 1U5TA 4OOIA 3WTZA 3GLLA 5K7ZA 3ABUA 4HRIA 2R93J 2QQBA 1FYLA 5LGUA 1R9TJ 1OR7A 1XGOA 2LY2A 5LHHA 1MBFA 3WG9A 3ZQFA 2A61A 2DU9A 3U1DA 3V42A 2I5UA 4N4OB 3S8PA 1QNTA 3QYEA 3BZKA 2IJLA 3SXYA 1AA7A 1Z7LA 1W7PA 2JA2A 1YRNA 2PMZA 1UG2A 1O4XA 1REPC 3OYCA 3I64A 3F6VA 2ISYA 3OS0A 3I9V2 4PK4A 2K85A 4S05A 1WHUA 2EPFA 2BEOA 5E3LA 5LGNA 4KDPA 3H92A 1WH7A 4CGZA 4KIFA 2QSFX 3ZMVA 1X1AA 4NDLA 2CQXA 1ODDA 2HPMA 4Y52J 3L09A 1UG0A 3SEQA 2IEKA 4E7ZA 5E20A 4YFXF 3CQZJ 3RYPA 4A3DJ 1N25A 1K4SA 1Z6RA 3WE2A 2EQRA 4HPQA 2QA4I 4F91B 1XG1A 4L18B 1ONVA 1VQ6I 4MO7A 3ZOBA 2XDVA 3JRBA 1RUNA 4D1QA 5DYMA 2DDBA 2EFPA 1R22A 1Z0XA 5CVJA 4PFOA 4AUXA 3F22A 1PUFB 5J1RA 2R7SA 5FLXK 1FBUA 4ON0A 1YJWI 5LEJA 5L3FA 4BY1J 3HGGA 1IRXA 3NAUA 1BOAA 2OA4A 2PQ8A 2JUCA 3DF8A 4XICA 2EIJH 3W3CA 1UHWA 4A6EA 3QOPA 2V1DA 4B4CA 2RAEA 2H94A 4YIIA 2LREA 5DM7F 2HQNA 2XSDC 3PIOF 3H9JA 3HPGA 4DQ2A 1IN7A 1RNLA 3IWZA 4RAZA 1S3JA 4D7NA 3OYMA 1FTZA 1LDKB 4ZYEA 1RZ4A 2CYYA 5FD5A 3D5LA 2PBIA 3RCOA 1P6RA 3TBIA 4CHUA 4Q47A 1FYKA 3JRCA 1WCMJ 3E5XA 2V1UA 2QSHX 1JXSA 5CQEA 3EYYA 3ZQCA 3EUHC 4DOZA 2WADA 1GDTA 4BHPA 3FK7A 3GTMJ 3A01B 1K61A 1D8KA 1I39A 4CCJA 4B47A 1XSXA 3WTYC 5F1JA 4CYCA 3R60A 1U3EM 2EZLA 4FX0A 2XB5A 1ACIA 1OCRH 1XGNA 2JMWA 1X19A 2JVGA 5AIQA 1P4WA 4XSZF 4B3XA 1M1EB 4A3BJ 3PNYA 1BI2A 2XKPA 1F1ZA 2XAUA 2VOOA 2DA5A 3GFJA 3MN2A 4PJMA 3QOEA 4GGGA 3OYJA 1BI1A 2R7WA 5D6EA 1KU3A 2ZMEA 2KISA 2PI0A 1FLIA 3DKWA 3AG1H 4ABZA 3PO3J 1HQCA 4Q48A 3CP8A 1MSFC 2L54A 2MW8A 5FLMJ 3V7SA 5CJ9A 4S04A 3B6CA 5M5WJ 2EWNA 2UUZA 5CQGA 3RKXA 1B8IA 4J19A 4IQJA 5DV5A 2ZBKA 2RN7A 3HTUA 2LVSA 2XRNA 5D8LB 1RETA 2CUJA 2EK5A 1R1TA 1IN5A 2ELKA 1OLTA 2JRMA 4F92B 1I1GA 1KONA 3LSHA 4IO9F 1FWZA 1VNDA 3S93A 3PUFA 3FXQA 1R00A 2A5WA 1U9NA 3CC4I 2WY7Q 2R92J 5M3MJ 1Q1HA 1TLHB 2Z5UA 1DU0A 2IA1A 1V5EA 1B9NA 3ASNH 2CS3A 4OWRB 4PZJA 1IUFA 4JX6A 4DGWB 3ZQLA 3BOQA 1E0EA 4MIMA 3M7GA 2ICWG 4UB6C 3FM3A 3VYTB 4C2UA 2K9NA 2HPIA 2K9MA 4PFPA 3ERED 4IOCF 5K5RA 3PJRA 3FM5A 4KN4X 3JAMZ 2CRGA 5JR3A 2ZSHB 3L2RA 1GLNA 3BG5A 2L9RA 4ENJA 2HVRA 1MMNA 4HSTA 4RB2C 1JT0A 5D4SA 1XB4A 4BE2A 1ZLKA 2A05A 4WK8F 3MZ8A 1PDNC 3P9CA 2CV2A 1FOYA 3BT9A 4YEJA 5HLIA 4FE4A 2BV6A 4FCYA 1WKMA
chains in the Genus database with same CATH topology
3G3ZA 5D4RA 4KT5C 4EJVA 5ICFA 2DPUA 3GLXA 4RB3C 1Z9CA 3CDHA 3GFMA 4MQVA 1W5TA 5DCMA 2E7WA 3KLNA 3O3KA 5KVRA 1HXDA 3HSRA 2X4HA 5J8FA 5L3DA 3BWGA 2DK5A 5F6FA 1SFUA 2M30A 1QZYA 1J5YA 2F5EA 3Q9SA 5L3EA 5BQTA 2YX7A 5LLQA 5J8CA 4WX9A 4U0WA 2LKPA 3F8FA 2IP2A 2ESHA 3GZ6A 3HSEA 3E6MA 2M45A 1XCVA 1FZPB 4N9IA 1KYWA 2KJCA 1FPQA 4HLYA 4MGRA 4U7DA 2EJRA 3BY6A 3K69A 2DW4A 3I53A 2B0LA 1TQMA 3RIRA 4P9FA 3B73A 3FMSA 1O3RA 2L3DA 2XHKA 4EQQA 3F8NA 3J80Z 1G3SA 1HBXG 1SD4A 5IT3A 1U5TC 4BXUA 4BAYA 2D1VA 4QLCU 4MHGA 3HOTA 3NQOA 3V4GA 3R61A 2DAOA 2LSOA 3ZMUA 2W84A 1TW2A 2FSWA 4ZYGA 2L4AA 4ESBA 1O57A 3HRUA 1T98A 4OIQF 1FP2A 4EM1A 5DUKA 3R4KA 3HRMA 3RKWA 4XSXF 1E2XA 2O6GE 2BGCA 5E1WA 3FMQA 3PQKA 4ENKA 5ED4A 3MWMA 6PAXA 5D6FA 4H0EA 3EYIA 3REOA 3GFLA 3ZMSA 3VB2A 3QPHA 1SMTA 2MC3A 3CTAA 1U5TB 1USTA 2OU2A 1R36A 4CYDA 2K27A 3MZHA 1ZAOA 1MKMA 4RGXA 3BJOA 4JQFA 4L9NA 4WF2A 2FMYA 4KFCA 2KIFA 1DUXC 2QBYA 3VOEA 5FB2A 3BZ6A 1SD5A 2G7UA 1O3TA 2FXAA 2Z33A 5E8GA 4I7HA 2HS5A 1V4RA 5HS7A 1J59A 1SD7A 5JFRA 4KMUX 3R0AA 3FF5A 1GXPA 3IKTA 4NHJA 2Z9OA 5BMZA 4G94A 3MZYA 2UXNA 1IXCA 2QZ8A 2P8TA 4ZH4F 5IT9K 3IKVA 2O0YA 5K1YA 3T8TA 3TKYA 5D5VB 2RC4A 2CSOA 1IZ1A 2DK8A 1ZG5A 2EA2A 2Q8KA 3MEXA 3JSPA 4P55A 4A0XA 3WE3A 1ZN2A 4M9ZA 5EEHA 2Q0OA 1G3WA 4XBFA 1LJ9A 1E17A 2J5OA 1QO0D 3RKYA 1LQ1A 4AD9A 4KIBA 2AS5F 3C7JA 4TV7A 4RB0A 4RGUA 4ESFA 1XD7A 1YQAA 5FGMA 4EGYA 1G3YA 2MD5A 3M8EA 2GXGA 3VEPA 3ZQ7A 2DLLA 3OV8A 1IW7F 3LQRA 4I01A 5DDGA 1LDDA 2A68F 2EFOA 4WXDA 3F6OA 4WWCA 2JT1A 1HW5A 2VOPA 2CG4A 2DQRA 3ABTA 4P5OA 5HS8A 5FD6A 1EH6A 2QWWA 3F8MA 4HDUA 4GCVA 3DXJF 1UHMA 3BDDA 1XMKA 2CFXA 1ZYRF 1KU7A 2NNYA 4BHCA 4O6JA 2UXXA 1BJAA 3HRSA 1YW7A 1DDNA 4EJOA 1XMAA 2D2WA 2ZNYA 3RI4A 4EM2A 2VC0A 4AIJA 3WODF 1A04A 5ERIA 2EFNA 4FX4A 5BPDA 1K78B 1PP7U 3PFIA 1R5HA 2W85A 2FBKA 2F5FA 4IF4A 3ZMZA 4AVPA 1S29A 1MZBA 2DO7A 2PFBA 5CVIA 2HFHA 3I71A 3ZMDA 3I59B 5E17F 2YX4A 4IJAA 2P6SA 1XDUA 4UVCA 1K6OA 1MDMB 4RB1A 2R3SA 2CWEA 2MBFA 2A6HF 3EQLF 2NRAC 4OIOF 5L3BA 3GEZA 4O5VA 2EV6A 2FU4A 4A0ZA 1PP8F 4WXHA 3U9GA 1DPRA 4PGGA 1HKTA 2RVCA 1SFEA 2PLYA 4ENMA 3BJ6A 2P6TA 3S2WA 1MD0A 1XN7A 1UCRA 3JW4A 4M71A 1U6GA 2MA3A 1BBYA 4DNCA 2W57A 3V7RA 2H6CA 4FT8A 5JI6A 1G6NA 3BPVA 4HAMA 3ZPLA 2IT0A 2OQGA 4O3MA 1ZARA 2Z99A 3W6KB 1TQIA 3B02A 2GAUA 4HW0A 5H6RA 2UZKA 2A6EF 5E1XA 3L2CA 3V8KA 3BPXA 3AAFA 2P5LC 4P96A 3V8JA 4BHBA 3HYIA 3LA7A 4LK0F 2FF4A 3KLOA 4AIHA 4CDGA 1J9IA 2XUBA 3TO6A 3WTWC 5LGTA 2OD5A 1JE8A 1G4DA 4YFKF 2L01A 4EJUA 4R79A 1HW1A 2ZCWA 2CGPA 3KEOA 4G8XA 4ETSA 1S7OA 5HDKA 4LB5A 2WWYA 5LRSA 2OZ6A 3CUQC 2K02A 3G73A 3K9TA 2R7DA 1MGTA 2JPCA 4ZYHA 1KU2A 4L9VA 2L02A 1KYZA 2NAZA 3WGHA 3WTSC 2OAZA 4HA8A 3TDUC 2FBHA 5DUIA 4KNYA 5DEQA 3LWFA 5ILSA 1FSEA 1QGPA 2A3SA 3IL2A 3C3WA 1TTYA 4UV9A 4G6DA 4CO8A 4CXFA 3TOBA 2O8XA 2HDCA 3ZN1A 4KYWA 4HX7A 2Z3YA 4GYIA 4RGRA 5JHUA 3CO7C 3E5UA 4L0ZB 4M9SA 2HR3A 1RI7A 4UUVA 2H09A 3KFWX 4HF2A 5ICGA 2P5VA 1T0FA 5CYVA 5HOOA 3J7AO 3WU0A 1KA8A 3ULQB 4NQWA 4L5JA 2D1HA 4IRGA 2HYFA 1I1SA 1PUEE 1BM9A 4LB6B 2EV5A 4M6XA 1XCBA 2PMHA 1KQ0A 3CUQB 4LK1F 1QBJA 1H9GA 3BROA 1R58A 5LHIA 3KP2A 2V79A 4KN7X 1WI9A 5L3CA 3GFIA 1EH8A 3F72A 1R1VA 2NNNA 3RDIA 2PMUA 3EDPA 4HDVA 2FRHA 1H0MA 5BS6A 3K0LA 1BN5A 3KE2A 1HSJA 4LLLA 4K2EA 3FXRA 5H20A 2FNPA 3IWFA 3QAHA 4LGWA 2HZTA 3RPUA 4RS8A 1P4XA 1W7PD 1TQPA 1Z05A 4EV0A 3Q9VA 2J5PA 1YW9A 2M1BA 3QRFF 2JPBA 3HHGA 3N4MA 3V7CA 3M1EA 1ZREA 1T6SA 4HQMA 4KUMA 1QZZA 3KP6A 4LFUA 2IRFG 2QUFA 2EV0A 1K78A 2MH2A 3CUOA 2IPQX 4OINF 5BOXA 3LA2A 3GVAA 1OKRA 4L0YB 5FFXA 2LF8A 3RJPA 2KRFA 1OYWA 1Z6TA 2Y48A 1KQ9A 2O61A 2R7FA 1ZH5A 3T5XA 2X0LA 4HV6A 5BPIA 3WGGA 2XKOA 4PCQA 3LAJA 3MFKA 2ISZA 2DI3A 2PN6A 2QYOA 3HTSB 1W7PB 3W6JB 5K5OA 1ZRCA 5EEGA 3K1NA 5ICEA 4I09A 4I0BA 4R8HA 2PG4A 2HTJA 3GXOA 3D0SA 3R0JA 1OYYA 1U8RA 3TGNA 4Q5SF 2VBZA 2GXBA 2VXZA 2RNJA 3H3UA 4WXCA 2LDUA 1IN8A 4HF1A 2K7LA 2C6YA 2GZWA 2IVMA 2QM3A 4LJZF 1Z91A 2V9VA 3MAJA 4GO1A 3LQQA 4HX4A 3GF2A 3ROUA 5DD4A 1QPMA 2XIGA 3LFKA 2HTSA 2P5KA 4KA4A 1LEBA 5TRDA 4M74A 4MTEA 1YIOA 1O3QA 1MJBA 4LLGF 2AXLA 4UVBA 2Y75A 2EFQA 2MLKA 3HSFA 1XGMA 5HS9A 2A5YB 3GO5A 2DPDA 2Y0MA 4A2UA 3L9FA 1LVAA 2XVCA 2H27A 1ON1A 2QENA 1FY7A 2VODA 3JTHA 2G7HA 1Z1DA 3H3ZA 4IHTA 2BE5F 1HW2A 2XAQA 1SAXA 3DFGA 5FFZA 4LG0B 4OMYA 4HZFA 1BI0A 4D0PA 3O2PE 3ZP5A 2DT5A 1L3LA 3KEQA 1WSUA 2FOKA 4HV5A 5AIPA 3I58A 4I2OA 4CICA 1SD6A 5KK1A 3J81Z 2HGCA 2IA2A 2PEXA 3LAPA 1S8NA 2EB7A 2FQ3A 3T0YA 1J7KA 3C1DA 1YFHA 3WTXC 4HX8A 4HQEA 3T1BA 1B1BA 1AWCA 2XROA 3VODA 4M73A 5H6QA 1YLFA 1XGSA 2E1NA 4FHTA 2K86A 3GWZA 4UXNA 1J2XA 2XAHA 1C0WA 2GQQA 1MDMA 1RIOH 1H9TA 5LBQA 2KIUA 2VT3A 3ZN0A 1L0OC 3CJNA 1B9MA 1XSVA 5HLHA 2CQKA 2K4BA 1AOYA 3TO9A 3FX3A 1HKSA 3HRTA 1BC7C 3IHUA 4EM0B 2VN2A 3VFZA 3NEUA 2FA5A 5L3GA 4G7OF 1BC8C 3SHFA 1FYMA 1IXSB 2M8EA 3RPQA 2ELHA 1O7FA 1D8JA 1CF7B 2P7VB 4IHSA 1GHCA 3KP4A 3F23A 1TNSA 1JHFA 4G7ZF 5CVRA 3U2RA 1IUYA 3FXUA 4M9XA 3ECOA 1FP1D 1OPCA 5FLXZ 3K1PA 4MEXF 1P92A 5HLGA 4Q4ZF 2HEOA 3KETA 2MH9A 2LNBA 1FSHA 3F8BA 4PDKA 5D5UB 4EJWA 3FHZA 2OQRA 5F1RA 2CW0F 4EMSA 4B8XA 2KJBA 3EETA 3WGIA 3Q5FA 1JHHA 5F64A 1BIAA 2A69F 1GXQA 1G3TA 3IC7A 2PJPA 1F5TA 1HKQA 5CLSA 3E5QA 3TO7A 1JGSA 1B59A 2G9WA 1IN4A 2IA0A 2XGXA 3ELKA 1KGSA 2RKHA 3JSOA 1J0RA 1ULYA 5LRRA 4U0YA 4ESJA 1J75A 4KICA 2VBXA 4G6QA 1YG2A 1Y0UA 3R6SA 3I59A 2HKXA 3J81K 3FZVA 3MCZA 4LG0A 1XDSA 4YG2F 2FNAA 4IVNA 4MNUA 2RDPA 3QPTA 4ZYDA 1K79A 1FBSA 3F3XA 1FBQA 4BNCA 3F21A 3OOPA 4Y15A 2XAJA 3TDZC 4A5NA 5HDNA 2L4MA 2H6BA 5A2QK 5ILVA 3I5UA 1U78A 1T2KA 3QU6A 5K5QA 2QQ9A 3HOSA 2FBIA 4JK1X 1EH7A 3DQVC 2DQLA 4Z2YA 5JVTA 1F9NA 1R7JA 1B4AA 2Q2EA 1LNWA 1Z7UA 1ZHFA 3HIFA 3P9IA 2LF7A 3QP5A 2DFIA 1ZGAA 3LSTA 4MTDA 1T38A 1WWXA 3ECHA 4OU0A 5E8IA 2P7CB 3HUGA 2CO5A 1DP7P 2YU3A 1YO5C 2GIVA 2XASA 1FT9A 3EUHA 3WTTC 2EA4A 4I0AA 4PGHA 4F7ZA 3GUDA 1O7LA 4LMYA 3SFZA 2OBPA 5IT9Z 3RYRA 4GXOA 1KU9A 3I0TA 4XLPF 2GA1A 1IXRC 4ZZDA 4IXAA 3L00A 4GYGA 4HOBA 1FOKA 1UFMA 5TJJA 1KQ8A 5HVQC 1ZRDA 3CO6C 3O6BB 1S6LA 4M72A 3V8LA 1RUOA 2V6CA 3IRRA 4ENNA 2COMA 4OIRF 2QVOA 1YS7A 3KZZA 4HBLA 3RTRA 5DCMB 2WC2A 2UWMA 4XRFA 4B09A 2RV8A 2NYXA 2A07F 4QWQA 3TOAA 1W4MA 2W25A 2XAGA 4NB5A 1SFXA 3DPTA 2VONA 4U0VA 1OMIA 4UVAA 4WCGA 2ZXJA 1R23A 3KCCA 4L9TA 2F5CA 4RAYA 3K1MA 2STWA 1BI3A 1DPUA 1V3FA 2XAFA 1FC3A 2VE9A 3CUQA 4A5MA 2YR2A 3KZYA 4R1HA 2WTEA 3JAMK 3SQNA 3WU1B 4L5IA 1ZG1A 1TBXA 2ZNZA 2VE8A 2ZKZA 3GZ5A 1LB2A 1CF7A 1U2WA 3SZPA 4RGSA 2FMLA 2GA2A 2ZJ2A 2QQAA 2YPRA 3HHHA 3QU3A 1NHAA 4MQ9F 5LHGA 3GYHX 2BYVE 3GX4X 2XV4S 4P9UA 2ADUA 2ZO4A 3IRQA 1BIBA 5E18F 3COAC 4A0YA 1STZA 1IF1A 1X3UA 4N0BA 4G7HF 2HQRA 4UV8A 4UNOA 4Y13A 5LEKA 3WTUC 2RGVA 3DP7A 1F4KA 2F5DA 2QBYB 2VBYA 5CVVA 4A6DA 2ZFWA 3C18A 2WV0A 1R1UA 1YS6A 1TNTA 2M5WA 1WRJA 4AIKA 1YW8A 1D5VA 5CVUA 3BP8A 3WTVC 1R5GA 1ZLJA 5AONA 4M6YA 5D8KB 4XLNF 3KP5A 2OZUA 1VTNC 2DTRA 1CGPA 2HWVA 3PQJA 4OMZA 4U7BA 1W5SA 2IW5A 5DD8A 2EFWA 3J80K 1OYIA 2RQPA 1S7AA 4A12A 1QQIA 3T8RA 2D45A 5HDGA 3FWEA 4ZZLA 3F8CA 5DCFA 2QLZA 2VC1A 2JTVA 2FE3A 2W24A 3ISPA 5A2QZ 4HF0A 3N97A 5E1ZB 2VBWA 4L9JA 1ZGJA 1EV7A 1O3SA 1USSA 1IRFA 1ON2A 1UB9A 4I02A 2JRTA 3P7NA 2HOEA 2ETHA 2GWRA 1P4AA 2KIMA 2MLGA 2P4WA 2E7XA 2M87A 2BBYA 1FX7A 3SZTA 2FEZA 4YIFA 4G9YA 2YSRA 2F2EA 3E3VA 4EGZA 4KMFA 4KIGA 4E70A 2E1CA 5ICCA 5D5WB 3E6DA 4JBAA 2V1XA 4LLNA 4EJTA 4BYYA 2DBBA 5FO5A 3M8FA 3TQNA 3FMRA 4ASNA 2TDXA 4MEYF 2JSCA 4Y17A 3LA3A 3DPLC 4YFNF 2KKOA 1T39A 3ML6A 1LDJA 3DEUA 2STTA 5J6XA 3ZMTA 4BH9A 1FNNA 1YTYA 3DV8A 1IN6A 4IPAA 4HYEA 4IRHA 4OIPF 2O3FA 2HYGD 1LEAA 3K2ZA 1HSTA 3MQ0A 3CLOA 4U88A 1YYVA 1P2FA 4I98B 1K7AA 1WQ2A 3NRVA 4BQAA 4HLXA 4EVIA 3I54A 3QP6A 4N9HA 1I5ZA 3E6CC 2ESNA 1B6AA 2VT2A 2ACJA 3GW2A 1IAWA 3I4PA 3KP3A 1D3YA 3JTGA 1MJ9A 2O03A 2ZMEB 1I27A 1ZG3A 3P9KA 2NS0A 1MJAA 2K4JA 2JZYA 1GVJA 4UHTA 3KP7A 1IRGA 1SMYF 3E6BA 3M9AA 4CZZA 1I6XA 4AWXB 4LD5A 1ZRFA 3BJAA 3L7WA 3E97A 1XSDA 2HKOA 1TW3A 4IRIA 5D5XB 5ILUA 1U5TA 4OOIA 3WTZA 3ABUA 2QQBA 1FYLA 5LGUA 1OR7A 1XGOA 5LHHA 3WG9A 2A61A 2DU9A 3U1DA 1QNTA 2IJLA 3SXYA 1W7PA 1REPC 3I64A 3F6VA 2ISYA 4S05A 2BEOA 5LGNA 4KDPA 3H92A 4CGZA 4KIFA 3ZMVA 1ODDA 3L09A 5E20A 4YFXF 3RYPA 1Z6RA 3WE2A 4L18B 1ONVA 1RUNA 5DYMA 2EFPA 1R22A 5CVJA 3F22A 5FLXK 1FBUA 4ON0A 5LEJA 5L3FA 1BOAA 2OA4A 2PQ8A 3DF8A 1UHWA 4A6EA 3QOPA 2V1DA 2H94A 4YIIA 2HQNA 4DQ2A 1IN7A 1RNLA 3IWZA 4RAZA 1S3JA 1LDKB 4ZYEA 2CYYA 1RZ4A 5FD5A 3D5LA 2PBIA 4CHUA 1P6RA 4Q47A 1FYKA 3E5XA 2V1UA 1JXSA 3EYYA 4BHPA 1D8KA 3WTYC 1XSXA 1U3EM 3R60A 4FX0A 1XGNA 5AIQA 1P4WA 4XSZF 1BI2A 2XKPA 1F1ZA 2VOOA 3GFJA 4GGGA 1BI1A 5D6EA 1KU3A 2ZMEA 2PI0A 1FLIA 3DKWA 1HQCA 4Q48A 2L54A 3V7SA 5CJ9A 4S04A 2EWNA 3RKXA 5DV5A 2ZBKA 2RN7A 3HTUA 2XRNA 5D8LB 2EK5A 1R1TA 1IN5A 1I1GA 1FWZA 1R00A 3FXQA 1Q1HA 1TLHB 2Z5UA 2IA1A 1B9NA 4PZJA 3BOQA 3M7GA 3FM3A 3ERED 5K5RA 3FM5A 4KN4X 3JAMZ 5JR3A 4ENJA 4RB2C 5D4SA 1XB4A 1ZLKA 4WK8F 1PDNC 3P9CA 5HLIA 2BV6A 1WKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  5D4R A;  4KT5 C;  4EJV A;  5ICF A;  2DPU A;  3GLX A;  4RB3 C;  1Z9C A;  3CDH A;  3GFM A;  4MQV A;  1W5T A;  5DCM A;  2E7W A;  3KLN A;  3O3K A;  5KVR A;  1HXD A;  3HSR A;  2X4H A;  5J8F A;  5L3D A;  3BWG A;  2DK5 A;  5F6F A;  1SFU A;  2M30 A;  1QZY A;  1J5Y A;  2F5E A;  3Q9S A;  5L3E A;  5BQT A;  2YX7 A;  5LLQ A;  5J8C A;  4WX9 A;  4U0W A;  2LKP A;  3F8F A;  2IP2 A;  2ESH A;  3GZ6 A;  3HSE A;  3E6M A;  2M45 A;  1XCV A;  1FZP B;  4N9I A;  1KYW A;  2KJC A;  1FPQ A;  4HLY A;  4MGR A;  4U7D A;  2EJR A;  3BY6 A;  3K69 A;  2DW4 A;  3I53 A;  2B0L A;  1TQM A;  3RIR A;  4P9F A;  3B73 A;  3FMS A;  1O3R A;  2L3D A;  2XHK A;  4EQQ A;  3F8N A;  3J80 Z;  1G3S A;  1HBX G;  1SD4 A;  5IT3 A;  1U5T C;  4BXU A;  4BAY A;  2D1V A;  4QLC U;  4MHG A;  3HOT A;  3NQO A;  3V4G A;  3R61 A;  2DAO A;  2LSO A;  3ZMU A;  2W84 A;  1TW2 A;  2FSW A;  4ZYG A;  2L4A A;  4ESB A;  1O57 A;  3HRU A;  1T98 A;  4OIQ F;  1FP2 A;  4EM1 A;  5DUK A;  3R4K A;  3HRM A;  3RKW A;  4XSX F;  1E2X A;  2O6G E;  2BGC A;  5E1W A;  3FMQ A;  3PQK A;  4ENK A;  5ED4 A;  3MWM A;  6PAX A;  5D6F A;  4H0E A;  3EYI A;  3REO A;  3GFL A;  3ZMS A;  3VB2 A;  3QPH A;  1SMT A;  2MC3 A;  3CTA A;  1U5T B;  1UST A;  2OU2 A;  1R36 A;  4CYD A;  2K27 A;  3MZH A;  1ZAO A;  1MKM A;  4RGX A;  3BJO A;  4JQF A;  4L9N A;  4WF2 A;  2FMY A;  4KFC A;  2KIF A;  1DUX C;  2QBY A;  3VOE A;  5FB2 A;  3BZ6 A;  1SD5 A;  2G7U A;  1O3T A;  2FXA A;  2Z33 A;  5E8G A;  4I7H A;  2HS5 A;  1V4R A;  5HS7 A;  1J59 A;  1SD7 A;  5JFR A;  4KMU X;  3R0A A;  3FF5 A;  1GXP A;  3IKT A;  4NHJ A;  2Z9O A;  5BMZ A;  4G94 A;  3MZY A;  2UXN A;  1IXC A;  2QZ8 A;  2P8T A;  4ZH4 F;  5IT9 K;  3IKV A;  2O0Y A;  5K1Y A;  3T8T A;  3TKY A;  5D5V B;  2RC4 A;  2CSO A;  1IZ1 A;  2DK8 A;  1ZG5 A;  2EA2 A;  2Q8K A;  3MEX A;  3JSP A;  4P55 A;  4A0X A;  3WE3 A;  1ZN2 A;  4M9Z A;  5EEH A;  2Q0O A;  1G3W A;  4XBF A;  1LJ9 A;  1E17 A;  2J5O A;  1QO0 D;  3RKY A;  1LQ1 A;  4AD9 A;  4KIB A;  2AS5 F;  3C7J A;  4TV7 A;  4RB0 A;  4RGU A;  4ESF A;  1XD7 A;  1YQA A;  5FGM A;  4EGY A;  1G3Y A;  2MD5 A;  3M8E A;  2GXG A;  3VEP A;  3ZQ7 A;  2DLL A;  3OV8 A;  1IW7 F;  3LQR A;  4I01 A;  5DDG A;  1LDD A;  2A68 F;  2EFO A;  4WXD A;  3F6O A;  4WWC A;  2JT1 A;  1HW5 A;  2VOP A;  2CG4 A;  2DQR A;  3ABT A;  4P5O A;  5HS8 A;  5FD6 A;  1EH6 A;  2QWW A;  3F8M A;  4HDU A;  4GCV A;  3DXJ F;  1UHM A;  3BDD A;  1XMK A;  2CFX A;  1ZYR F;  1KU7 A;  2NNY A;  4BHC A;  4O6J A;  2UXX A;  1BJA A;  3HRS A;  1YW7 A;  1DDN A;  4EJO A;  1XMA A;  2D2W A;  2ZNY A;  3RI4 A;  4EM2 A;  2VC0 A;  4AIJ A;  3WOD F;  1A04 A;  5ERI A;  2EFN A;  4FX4 A;  5BPD A;  1K78 B;  1PP7 U;  3PFI A;  1R5H A;  2W85 A;  2FBK A;  2F5F A;  4IF4 A;  3ZMZ A;  4AVP A;  1S29 A;  1MZB A;  2DO7 A;  2PFB A;  5CVI A;  2HFH A;  3I71 A;  3ZMD A;  3I59 B;  5E17 F;  2YX4 A;  4IJA A;  2P6S A;  1XDU A;  4UVC A;  1K6O A;  1MDM B;  4RB1 A;  2R3S A;  2CWE A;  2MBF A;  2A6H F;  3EQL F;  2NRA C;  4OIO F;  5L3B A;  3GEZ A;  4O5V A;  2EV6 A;  2FU4 A;  4A0Z A;  1PP8 F;  4WXH A;  3U9G A;  1DPR A;  4PGG A;  1HKT A;  2RVC A;  1SFE A;  2PLY A;  4ENM A;  3BJ6 A;  2P6T A;  3S2W A;  1MD0 A;  1XN7 A;  1UCR A;  3JW4 A;  4M71 A;  1U6G A;  2MA3 A;  1BBY A;  4DNC A;  2W57 A;  3V7R A;  2H6C A;  4FT8 A;  5JI6 A;  1G6N A;  3BPV A;  4HAM A;  3ZPL A;  2IT0 A;  2OQG A;  4O3M A;  1ZAR A;  2Z99 A;  3W6K B;  1TQI A;  3B02 A;  2GAU A;  4HW0 A;  5H6R A;  2UZK A;  2A6E F;  5E1X A;  3L2C A;  3V8K A;  3BPX A;  3AAF A;  2P5L C;  4P96 A;  3V8J A;  4BHB A;  3HYI A;  3LA7 A;  4LK0 F;  2FF4 A;  3KLO A;  4AIH A;  4CDG A;  1J9I A;  2XUB A;  3TO6 A;  3WTW C;  5LGT A;  2OD5 A;  1JE8 A;  1G4D A;  4YFK F;  2L01 A;  4EJU A;  4R79 A;  1HW1 A;  2ZCW A;  2CGP A;  3KEO A;  4G8X A;  4ETS A;  1S7O A;  5HDK A;  4LB5 A;  2WWY A;  5LRS A;  2OZ6 A;  3CUQ C;  2K02 A;  3G73 A;  3K9T A;  2R7D A;  1MGT A;  2JPC A;  4ZYH A;  1KU2 A;  4L9V A;  2L02 A;  1KYZ A;  2NAZ A;  3WGH A;  3WTS C;  2OAZ A;  4HA8 A;  3TDU C;  2FBH A;  5DUI A;  4KNY A;  5DEQ A;  3LWF A;  5ILS A;  1FSE A;  1QGP A;  2A3S A;  3IL2 A;  3C3W A;  1TTY A;  4UV9 A;  4G6D A;  4CO8 A;  4CXF A;  3TOB A;  2O8X A;  2HDC A;  3ZN1 A;  4KYW A;  4HX7 A;  2Z3Y A;  4GYI A;  4RGR A;  5JHU A;  3CO7 C;  3E5U A;  4L0Z B;  4M9S A;  2HR3 A;  1RI7 A;  4UUV A;  2H09 A;  3KFW X;  4HF2 A;  5ICG A;  2P5V A;  1T0F A;  5CYV A;  5HOO A;  3J7A O;  3WU0 A;  1KA8 A;  3ULQ B;  4NQW A;  4L5J A;  2D1H A;  4IRG A;  2HYF A;  1I1S A;  1PUE E;  1BM9 A;  4LB6 B;  2EV5 A;  4M6X A;  1XCB A;  2PMH A;  1KQ0 A;  3CUQ B;  4LK1 F;  1QBJ A;  1H9G A;  3BRO A;  1R58 A;  5LHI A;  3KP2 A;  2V79 A;  4KN7 X;  1WI9 A;  5L3C A;  3GFI A;  1EH8 A;  3F72 A;  1R1V A;  2NNN A;  3RDI A;  2PMU A;  3EDP A;  4HDV A;  2FRH A;  1H0M A;  5BS6 A;  3K0L A;  1BN5 A;  3KE2 A;  1HSJ A;  4LLL A;  4K2E A;  3FXR A;  5H20 A;  2FNP A;  3IWF A;  3QAH A;  4LGW A;  2HZT A;  3RPU A;  4RS8 A;  1P4X A;  1W7P D;  1TQP A;  1Z05 A;  4EV0 A;  3Q9V A;  2J5P A;  1YW9 A;  2M1B A;  3QRF F;  2JPB A;  3HHG A;  3N4M A;  3V7C A;  3M1E A;  1ZRE A;  1T6S A;  4HQM A;  4KUM A;  1QZZ A;  3KP6 A;  4LFU A;  2IRF G;  2QUF A;  2EV0 A;  1K78 A;  2MH2 A;  3CUO A;  2IPQ X;  4OIN F;  5BOX A;  3LA2 A;  3GVA A;  1OKR A;  4L0Y B;  5FFX A;  2LF8 A;  3RJP A;  2KRF A;  1OYW A;  1Z6T A;  2Y48 A;  1KQ9 A;  2O61 A;  2R7F A;  1ZH5 A;  3T5X A;  2X0L A;  4HV6 A;  5BPI A;  3WGG A;  2XKO A;  4PCQ A;  3LAJ A;  3MFK A;  2ISZ A;  2DI3 A;  2PN6 A;  2QYO A;  3HTS B;  1W7P B;  3W6J B;  5K5O A;  1ZRC A;  5EEG A;  3K1N A;  5ICE A;  4I09 A;  4I0B A;  4R8H A;  2PG4 A;  2HTJ A;  3GXO A;  3D0S A;  3R0J A;  1OYY A;  1U8R A;  3TGN A;  4Q5S F;  2VBZ A;  2GXB A;  2VXZ A;  2RNJ A;  3H3U A;  4WXC A;  2LDU A;  1IN8 A;  4HF1 A;  2K7L A;  2C6Y A;  2GZW A;  2IVM A;  2QM3 A;  4LJZ F;  1Z91 A;  2V9V A;  3MAJ A;  4GO1 A;  3LQQ A;  4HX4 A;  3GF2 A;  3ROU A;  5DD4 A;  1QPM A;  2XIG A;  3LFK A;  2HTS A;  2P5K A;  4KA4 A;  1LEB A;  5TRD A;  4M74 A;  4MTE A;  1YIO A;  1O3Q A;  1MJB A;  4LLG F;  2AXL A;  4UVB A;  2Y75 A;  2EFQ A;  2MLK A;  3HSF A;  1XGM A;  5HS9 A;  2A5Y B;  3GO5 A;  2DPD A;  2Y0M A;  4A2U A;  3L9F A;  1LVA A;  2XVC A;  2H27 A;  1ON1 A;  2QEN A;  1FY7 A;  2VOD A;  3JTH A;  2G7H A;  1Z1D A;  3H3Z A;  4IHT A;  2BE5 F;  1HW2 A;  2XAQ A;  1SAX A;  3DFG A;  5FFZ A;  4LG0 B;  4OMY A;  4HZF A;  1BI0 A;  4D0P A;  3O2P E;  3ZP5 A;  2DT5 A;  1L3L A;  3KEQ A;  1WSU A;  2FOK A;  4HV5 A;  5AIP A;  3I58 A;  4I2O A;  4CIC A;  1SD6 A;  5KK1 A;  3J81 Z;  2HGC A;  2IA2 A;  2PEX A;  3LAP A;  1S8N A;  2EB7 A;  2FQ3 A;  3T0Y A;  1J7K A;  3C1D A;  1YFH A;  3WTX C;  4HX8 A;  4HQE A;  3T1B A;  1B1B A;  1AWC A;  2XRO A;  3VOD A;  4M73 A;  5H6Q A;  1YLF A;  1XGS A;  2E1N A;  4FHT A;  2K86 A;  3GWZ A;  4UXN A;  1J2X A;  2XAH A;  1C0W A;  2GQQ A;  1MDM A;  1RIO H;  1H9T A;  5LBQ A;  2KIU A;  2VT3 A;  3ZN0 A;  1L0O C;  3CJN A;  1B9M A;  1XSV A;  5HLH A;  2CQK A;  2K4B A;  1AOY A;  3TO9 A;  3FX3 A;  1HKS A;  3HRT A;  1BC7 C;  3IHU A;  4EM0 B;  2VN2 A;  3VFZ A;  3NEU A;  2FA5 A;  5L3G A;  4G7O F;  1BC8 C;  3SHF A;  1FYM A;  1IXS B;  2M8E A;  3RPQ A;  2ELH A;  1O7F A;  1D8J A;  1CF7 B;  2P7V B;  4IHS A;  1GHC A;  3KP4 A;  3F23 A;  1TNS A;  1JHF A;  4G7Z F;  5CVR A;  3U2R A;  1IUY A;  3FXU A;  4M9X A;  3ECO A;  1FP1 D;  1OPC A;  5FLX Z;  3K1P A;  4MEX F;  1P92 A;  5HLG A;  4Q4Z F;  2HEO A;  3KET A;  2MH9 A;  2LNB A;  1FSH A;  3F8B A;  4PDK A;  5D5U B;  4EJW A;  3FHZ A;  2OQR A;  5F1R A;  2CW0 F;  4EMS A;  4B8X A;  2KJB A;  3EET A;  3WGI A;  3Q5F A;  1JHH A;  5F64 A;  1BIA A;  2A69 F;  1GXQ A;  1G3T A;  3IC7 A;  2PJP A;  1F5T A;  1HKQ A;  5CLS A;  3E5Q A;  3TO7 A;  1JGS A;  1B59 A;  2G9W A;  1IN4 A;  2IA0 A;  2XGX A;  3ELK A;  1KGS A;  2RKH A;  3JSO A;  1J0R A;  1ULY A;  5LRR A;  4U0Y A;  4ESJ A;  1J75 A;  4KIC A;  2VBX A;  4G6Q A;  1YG2 A;  1Y0U A;  3R6S A;  3I59 A;  2HKX A;  3J81 K;  3FZV A;  3MCZ A;  4LG0 A;  1XDS A;  4YG2 F;  2FNA A;  4IVN A;  4MNU A;  2RDP A;  3QPT A;  4ZYD A;  1K79 A;  1FBS A;  3F3X A;  1FBQ A;  4BNC A;  3F21 A;  3OOP A;  4Y15 A;  2XAJ A;  3TDZ C;  4A5N A;  5HDN A;  2L4M A;  2H6B A;  5A2Q K;  5ILV A;  3I5U A;  1U78 A;  1T2K A;  3QU6 A;  5K5Q A;  2QQ9 A;  3HOS A;  2FBI A;  4JK1 X;  1EH7 A;  3DQV C;  2DQL A;  4Z2Y A;  5JVT A;  1F9N A;  1R7J A;  1B4A A;  2Q2E A;  1LNW A;  1Z7U A;  1ZHF A;  3HIF A;  3P9I A;  2LF7 A;  3QP5 A;  2DFI A;  1ZGA A;  3LST A;  4MTD A;  1T38 A;  1WWX A;  3ECH A;  4OU0 A;  5E8I A;  2P7C B;  3HUG A;  2CO5 A;  1DP7 P;  2YU3 A;  1YO5 C;  2GIV A;  2XAS A;  1FT9 A;  3EUH A;  3WTT C;  2EA4 A;  4I0A A;  4PGH A;  4F7Z A;  3GUD A;  1O7L A;  4LMY A;  3SFZ A;  2OBP A;  5IT9 Z;  3RYR A;  4GXO A;  1KU9 A;  3I0T A;  4XLP F;  2GA1 A;  1IXR C;  4ZZD A;  4IXA A;  3L00 A;  4GYG A;  4HOB A;  1FOK A;  1UFM A;  5TJJ A;  1KQ8 A;  5HVQ C;  1ZRD A;  3CO6 C;  3O6B B;  1S6L A;  4M72 A;  3V8L A;  1RUO A;  2V6C A;  3IRR A;  4ENN A;  2COM A;  4OIR F;  2QVO A;  1YS7 A;  3KZZ A;  4HBL A;  3RTR A;  5DCM B;  2WC2 A;  2UWM A;  4XRF A;  4B09 A;  2RV8 A;  2NYX A;  2A07 F;  4QWQ A;  3TOA A;  1W4M A;  2W25 A;  2XAG A;  4NB5 A;  1SFX A;  3DPT A;  2VON A;  4U0V A;  1OMI A;  4UVA A;  4WCG A;  2ZXJ A;  1R23 A;  3KCC A;  4L9T A;  2F5C A;  4RAY A;  3K1M A;  2STW A;  1BI3 A;  1DPU A;  1V3F A;  2XAF A;  1FC3 A;  2VE9 A;  3CUQ A;  4A5M A;  2YR2 A;  3KZY A;  4R1H A;  2WTE A;  3JAM K;  3SQN A;  3WU1 B;  4L5I A;  1ZG1 A;  1TBX A;  2ZNZ A;  2VE8 A;  2ZKZ A;  3GZ5 A;  1LB2 A;  1CF7 A;  1U2W A;  3SZP A;  4RGS A;  2FML A;  2GA2 A;  2ZJ2 A;  2QQA A;  2YPR A;  3HHH A;  3QU3 A;  1NHA A;  4MQ9 F;  5LHG A;  3GYH X;  2BYV E;  3GX4 X;  2XV4 S;  4P9U A;  2ADU A;  2ZO4 A;  3IRQ A;  1BIB A;  5E18 F;  3COA C;  4A0Y A;  1STZ A;  1IF1 A;  1X3U A;  4N0B A;  4G7H F;  2HQR A;  4UV8 A;  4UNO A;  4Y13 A;  5LEK A;  3WTU C;  2RGV A;  3DP7 A;  1F4K A;  2F5D A;  2QBY B;  2VBY A;  5CVV A;  4A6D A;  2ZFW A;  3C18 A;  2WV0 A;  1R1U A;  1YS6 A;  1TNT A;  2M5W A;  1WRJ A;  4AIK A;  1YW8 A;  1D5V A;  5CVU A;  3BP8 A;  3WTV C;  1R5G A;  1ZLJ A;  5AON A;  4M6Y A;  5D8K B;  4XLN F;  3KP5 A;  2OZU A;  1VTN C;  2DTR A;  1CGP A;  2HWV A;  3PQJ A;  4OMZ A;  4U7B A;  1W5S A;  2IW5 A;  5DD8 A;  2EFW A;  3J80 K;  1OYI A;  2RQP A;  1S7A A;  4A12 A;  1QQI A;  3T8R A;  2D45 A;  5HDG A;  3FWE A;  4ZZL A;  3F8C A;  5DCF A;  2QLZ A;  2VC1 A;  2JTV A;  2FE3 A;  2W24 A;  3ISP A;  5A2Q Z;  4HF0 A;  3N97 A;  5E1Z B;  2VBW A;  4L9J A;  1ZGJ A;  1EV7 A;  1O3S A;  1USS A;  1IRF A;  1ON2 A;  1UB9 A;  4I02 A;  2JRT A;  3P7N A;  2HOE A;  2ETH A;  2GWR A;  1P4A A;  2KIM A;  2MLG A;  2P4W A;  2E7X A;  2M87 A;  2BBY A;  1FX7 A;  3SZT A;  2FEZ A;  4YIF A;  4G9Y A;  2YSR A;  2F2E A;  3E3V A;  4EGZ A;  4KMF A;  4KIG A;  4E70 A;  2E1C A;  5ICC A;  5D5W B;  3E6D A;  4JBA A;  2V1X A;  4LLN A;  4EJT A;  4BYY A;  2DBB A;  5FO5 A;  3M8F A;  3TQN A;  3FMR A;  4ASN A;  2TDX A;  4MEY F;  2JSC A;  4Y17 A;  3LA3 A;  3DPL C;  4YFN F;  2KKO A;  1T39 A;  3ML6 A;  1LDJ A;  3DEU A;  2STT A;  5J6X A;  3ZMT A;  4BH9 A;  1FNN A;  1YTY A;  3DV8 A;  1IN6 A;  4IPA A;  4HYE A;  4IRH A;  4OIP F;  2O3F A;  2HYG D;  1LEA A;  3K2Z A;  1HST A;  3MQ0 A;  3CLO A;  4U88 A;  1YYV A;  1P2F A;  4I98 B;  1K7A A;  1WQ2 A;  3NRV A;  4BQA A;  4HLX A;  4EVI A;  3I54 A;  3QP6 A;  4N9H A;  1I5Z A;  3E6C C;  2ESN A;  1B6A A;  2VT2 A;  2ACJ A;  3GW2 A;  1IAW A;  3I4P A;  3KP3 A;  1D3Y A;  3JTG A;  1MJ9 A;  2O03 A;  2ZME B;  1I27 A;  1ZG3 A;  3P9K A;  2NS0 A;  1MJA A;  2K4J A;  2JZY A;  1GVJ A;  4UHT A;  3KP7 A;  1IRG A;  1SMY F;  3E6B A;  3M9A A;  4CZZ A;  1I6X A;  4AWX B;  4LD5 A;  1ZRF A;  3BJA A;  3L7W A;  3E97 A;  1XSD A;  2HKO A;  1TW3 A;  4IRI A;  5D5X B;  5ILU A;  1U5T A;  4OOI A;  3WTZ A;  3ABU A;  2QQB A;  1FYL A;  5LGU A;  1OR7 A;  1XGO A;  5LHH A;  3WG9 A;  2A61 A;  2DU9 A;  3U1D A;  1QNT A;  2IJL A;  3SXY A;  1W7P A;  1REP C;  3I64 A;  3F6V A;  2ISY A;  4S05 A;  2BEO A;  5LGN A;  4KDP A;  3H92 A;  4CGZ A;  4KIF A;  3ZMV A;  1ODD A;  3L09 A;  5E20 A;  4YFX F;  3RYP A;  1Z6R A;  3WE2 A;  4L18 B;  1ONV A;  1RUN A;  5DYM A;  2EFP A;  1R22 A;  5CVJ A;  3F22 A;  5FLX K;  1FBU A;  4ON0 A;  5LEJ A;  5L3F A;  1BOA A;  2OA4 A;  2PQ8 A;  3DF8 A;  1UHW A;  4A6E A;  3QOP A;  2V1D A;  2H94 A;  4YII A;  2HQN A;  4DQ2 A;  1IN7 A;  1RNL A;  3IWZ A;  4RAZ A;  1S3J A;  1LDK B;  4ZYE A;  2CYY A;  1RZ4 A;  5FD5 A;  3D5L A;  2PBI A;  4CHU A;  1P6R A;  4Q47 A;  1FYK A;  3E5X A;  2V1U A;  1JXS A;  3EYY A;  4BHP A;  1D8K A;  3WTY C;  1XSX A;  1U3E M;  3R60 A;  4FX0 A;  1XGN A;  5AIQ A;  1P4W A;  4XSZ F;  1BI2 A;  2XKP A;  1F1Z A;  2VOO A;  3GFJ A;  4GGG A;  1BI1 A;  5D6E A;  1KU3 A;  2ZME A;  2PI0 A;  1FLI A;  3DKW A;  1HQC A;  4Q48 A;  2L54 A;  3V7S A;  5CJ9 A;  4S04 A;  2EWN A;  3RKX A;  5DV5 A;  2ZBK A;  2RN7 A;  3HTU A;  2XRN A;  5D8L B;  2EK5 A;  1R1T A;  1IN5 A;  1I1G A;  1FWZ A;  1R00 A;  3FXQ A;  1Q1H A;  1TLH B;  2Z5U A;  2IA1 A;  1B9N A;  4PZJ A;  3BOQ A;  3M7G A;  3FM3 A;  3ERE D;  5K5R A;  3FM5 A;  4KN4 X;  3JAM Z;  5JR3 A;  4ENJ A;  4RB2 C;  5D4S A;  1XB4 A;  1ZLK A;  4WK8 F;  1PDN C;  3P9C A;  5HLI A;  2BV6 A;  1WKM A; 
#chains in the Genus database with same CATH topology
 3G3Z A;  5D4R A;  3RPU D;  4CCK A;  4KT5 C;  4EJV A;  4E7L A;  3H5R A;  5ICF A;  4A3G J;  5EG0 A;  2O8K A;  2DPU A;  3GLX A;  1OCZ H;  4RB3 C;  1R6R A;  1Z9C A;  3L2U A;  2M4K A;  5FLV A;  2LBF B;  3CME I;  2O5R A;  3CDH A;  3GFM A;  4MQV A;  1W5T A;  5DCM A;  2E7W A;  2GOM A;  3KLN A;  1IG7 A;  3O3K A;  3LSP A;  5KVR A;  1HXD A;  3HSR A;  5HNF A;  3VYU B;  2X4H A;  4ZC3 A;  3GTG J;  5J8F A;  1FEX A;  2LKS A;  3AFH A;  2IXS A;  4IL6 C;  5L3D A;  2GLO A;  1QRY A;  2NOG A;  2VQC A;  3BWG A;  5F08 A;  2DK5 A;  5F6F A;  3I55 I;  1SFU A;  1ZR2 A;  2KL4 A;  3CC7 I;  1OFC X;  2M30 A;  1QZY A;  1Z3Y A;  3BCA A;  3CES A;  4MLO A;  1ETY A;  1MMA A;  4E7J A;  1J5Y A;  2F5E A;  2R7O A;  3Q9S A;  3W2W A;  2NOJ B;  5L3E A;  5FRN A;  5BQT A;  1SAN A;  2YX7 A;  3QOD A;  5LLQ A;  5J4V A;  5F0H A;  3VYS B;  5J8C A;  4XOT A;  3P5J A;  1I3A A;  4WX9 A;  4AYB A;  4U0W A;  3GTQ J;  2LKP A;  3F8F A;  2IP2 A;  2ESH A;  3GZ6 A;  1ZR4 A;  3HSE A;  3E6M A;  2M45 A;  3MKY B;  1XCV A;  1FZP B;  2DA1 A;  4N9I A;  3L2Q A;  1DGW Y;  2BHY A;  1KYW A;  2KJC A;  1FPQ A;  4C3H J;  4HLY A;  4A93 J;  3HOX J;  3K6G A;  3E7L A;  4MGR A;  4BS9 A;  1YOV B;  3HB9 A;  4U7D A;  2EJR A;  3BY6 A;  3K69 A;  1WPK A;  2DW4 A;  3G1L A;  3OSG A;  2WAE A;  4W97 A;  3I53 A;  3CJQ B;  2B0L A;  1TQM A;  2QSG X;  3LOC A;  3RIR A;  4P9F A;  3B73 A;  5EDN A;  2NVY J;  3FMS A;  1F36 A;  3DU6 A;  3A0H C;  3H35 A;  1O3R A;  2L3D A;  2XHK A;  3A1Y A;  4EQQ A;  2KQR A;  1A5J A;  3F8N A;  4FIS A;  3RQI A;  4BQO A;  2VJ5 A;  3J80 Z;  1VQN I;  2XPW A;  1G3S A;  2XF7 A;  1HDP A;  3ZQH A;  1HBX G;  1TT5 B;  2W1O A;  2ZJR F;  1SD4 A;  1LPQ A;  4RAF A;  3NAR A;  1U5T C;  5IT3 A;  4BXU A;  3S32 A;  4OAY A;  4BAY A;  5KCM A;  2D1V A;  4QPQ A;  1G2H A;  4U87 A;  2GM4 A;  1GV5 A;  3QWL A;  4XLA A;  5EF6 A;  3OYL A;  2OTJ I;  2X6O A;  4QLC U;  2V9K A;  3DBL B;  4MHG A;  1ZK8 A;  3HOT A;  3NQO A;  3V4G A;  3CMY A;  3R61 A;  3AG2 H;  2DAO A;  1ETX A;  3M4O J;  2DCE A;  4F3Q A;  4IHX A;  2R7T A;  3KX2 A;  2LSO A;  3I56 I;  1UZC A;  3ZMU A;  1Y8R B;  2W84 A;  1TW2 A;  2E71 A;  2F6C A;  2HDW A;  3A03 A;  4A3E J;  2FSW A;  4ZYG A;  1SFK A;  2L4A A;  1E3O C;  5F0F A;  1O57 A;  4ESB A;  2PMZ N;  3HRU A;  1T98 A;  1X1B A;  4CH7 A;  4OIQ F;  1RR7 A;  4ZTJ A;  1FP2 A;  3DKX A;  4ITV A;  4EM1 A;  5DUK A;  1NK3 P;  3R4K A;  1IJW C;  2HU9 A;  2GIZ A;  3HRM A;  3RKW A;  4XSX F;  1E2X A;  4DIQ A;  1NK2 P;  2O6G E;  2BGC A;  5E1W A;  2IGN A;  3OYI A;  3FMQ A;  3PQK A;  5JLW A;  3VSL A;  4ENK A;  5ED4 A;  3MWM A;  2ZC2 A;  4LOC A;  1J09 A;  2VUM J;  6PAX A;  5D6F A;  3HZJ A;  4XKB A;  4H0E A;  2R4G A;  1A6Q A;  3EYI A;  3REO A;  3GFL A;  3ZMS A;  5EYR A;  3DBR B;  3ONQ A;  1G8X A;  3VB2 A;  3QPH A;  3OYF A;  1H89 C;  1SMT A;  4IKF A;  1QU3 A;  2MC3 A;  3CTA A;  1U5T B;  1UST A;  4DYQ A;  2OCE A;  2OU2 A;  2OJE D;  1R36 A;  3W2V A;  4GFB A;  3QQA A;  4CYD A;  1N77 A;  3OIP A;  2K27 A;  3SJM A;  3MZH A;  2M2E A;  1RPW A;  1ZAO A;  4CZC A;  1BL0 A;  2MFZ A;  3N05 A;  1MKM A;  4RGX A;  2Y2Z A;  3BJO A;  4JQF A;  2D5V A;  4A3C J;  1ITY A;  4L9N A;  4WF2 A;  1X1C A;  2FMY A;  4KFC A;  2KIF A;  3QYF A;  1DUX C;  2QBY A;  2R5Y B;  2KZV A;  1K4T A;  1MH3 A;  3DTK A;  3VOE A;  3A01 A;  2ZJP F;  5FB2 A;  3BZ6 A;  5EEA A;  3WG7 H;  3S1M J;  1DU6 A;  1SVM A;  1UHS A;  3NWT A;  2KP6 A;  2R7R A;  1SD5 A;  2L7M P;  2G7U A;  1O3T A;  2FXA A;  4HNT A;  2UV1 A;  4CYC B;  2PX9 A;  4Y4R A;  2Z33 A;  2R7Q A;  5E8G A;  3M8J A;  2OTL I;  2DMU A;  4I7H A;  4RAG A;  2X6X A;  2FQ4 A;  5KNL A;  2KPM A;  2HS5 A;  3DBH B;  1V4R A;  5HS7 A;  1OJL A;  3GTJ J;  1J59 A;  1SD7 A;  5JFR A;  5JVG F;  2IS4 A;  4KMU X;  4J01 A;  3R0A A;  1LKX A;  3FF5 A;  4YRV A;  1XTA A;  1GXP A;  4EEF G;  3IKT A;  4NHJ A;  2XB0 X;  2Z9O A;  1TC3 C;  5BMZ A;  4G94 A;  2BY2 A;  3MZY A;  3BR1 A;  4XLE A;  2UXN A;  1VQO I;  1A31 A;  1FOX A;  2QKL B;  1IXC A;  2DA4 A;  4E4H A;  1NG7 A;  3H36 A;  2JA5 J;  3VYR B;  3OYH A;  2E2H J;  5HLT A;  2G0E A;  2CMP A;  2P8T A;  2QZ8 A;  4ZH4 F;  5IT9 K;  3IKV A;  2O0Y A;  4QPO A;  2QKM B;  5K1Y A;  3T8T A;  3TKY A;  3S1R J;  3Q3S A;  5D5V B;  2RC4 A;  2CSO A;  1IZ1 A;  2DK8 A;  2V6E A;  1ZG5 A;  3GTK J;  2EA2 A;  2OCC H;  4XKW A;  1T95 A;  2Q8K A;  4F52 A;  3MEX A;  2WBM A;  5IP6 A;  4XKV A;  3JSP A;  3TP0 A;  3HJE A;  4P55 A;  4A0X A;  2L0K A;  1ZEL A;  3WE3 A;  1T33 A;  2EIM H;  5B1B H;  1A35 A;  3HEF A;  1ZN2 A;  3FIW A;  3KYC B;  4M9Z A;  2E35 A;  3KZI C;  3DWL E;  2Q0O A;  5EEH A;  1G3W A;  4NNJ A;  2CUE A;  2VIX A;  4XBF A;  1LJ9 A;  1E17 A;  5GPA A;  1PVE A;  3TP3 A;  2J5O A;  4PJL A;  1QO0 D;  3RKY A;  1LQ1 A;  4AD9 A;  4KIB A;  2AS5 F;  1RC9 A;  2QGU A;  3OYG A;  4Y3O A;  2VJJ A;  3K4L A;  3C7J A;  4TV7 A;  4RB0 A;  4RGU A;  4ESF A;  1XD7 A;  1H88 C;  2F4M B;  1YQA A;  1T0F C;  3CF5 F;  2YUS A;  4XK4 A;  5FGM A;  5EG0 B;  4EGY A;  1G3Y A;  2VXD A;  2MD5 A;  3M8E A;  2GXG A;  2JK3 A;  1P7I A;  3FKI J;  2BW3 B;  5M3F J;  2LR8 A;  2V4J C;  3VEP A;  3ZQ7 A;  1B72 B;  4IX7 A;  2DLL A;  2RNG A;  1IW7 F;  3OV8 A;  3LQR A;  1T08 B;  2W7N A;  1HDD C;  2EIN H;  1RES A;  3H0G J;  4I01 A;  3DTI A;  3X2Q H;  3OL4 A;  5DDG A;  1LDD A;  5GTH C;  4UY8 I;  2A68 F;  2BY0 A;  2EFO A;  4WXD A;  3F6O A;  4WWC A;  2JT1 A;  4RDU A;  1HW5 A;  1MBH A;  2VOP A;  1GUU A;  3ABT A;  2CG4 A;  2DQR A;  4P5O A;  4DW6 A;  3S3N A;  1Z67 A;  5HS8 A;  5FD6 A;  4CCO A;  1EH6 A;  3BR6 A;  2QWW A;  3AL0 B;  3F8M A;  5J40 A;  4GCV A;  3DXJ F;  3CDL A;  1UHM A;  3BDD A;  4HDU A;  2HVQ A;  2DA3 A;  3S3O A;  3LSJ A;  1Y39 A;  2Q2E B;  3G2B A;  1XMK A;  1RKT A;  3FK6 A;  2CFX A;  3LSR A;  1HCR A;  1ZYR F;  1KU7 A;  2NNY A;  4BHC A;  4O6J A;  2UXX A;  1BJA A;  3GME A;  2KT0 A;  3H9G A;  3H3V K;  4HNV A;  3HRS A;  1YW7 A;  1DDN A;  4IZZ A;  4EJO A;  1YIT I;  1XMA A;  1VQP I;  2D2W A;  2ZNY A;  1MMD A;  1T8I A;  5IYC J;  3RI4 A;  2Y9Y A;  4EM2 A;  1WJE A;  2VC0 A;  4AIJ A;  1V54 H;  3WOD F;  3LMM A;  1A04 A;  1ZQ3 P;  5ERI A;  2EFN A;  4FX4 A;  5BPD A;  3ZQQ A;  2DDA A;  2AHQ A;  5FRM A;  1K78 B;  1PP7 U;  4IQ4 A;  1TWG J;  3PFI A;  1R5H A;  2ECC A;  2JWT A;  2W85 A;  4KJZ A;  3TL4 X;  3BG9 A;  1MBE A;  2FBK A;  2HOS A;  2F5F A;  1TWA J;  2AO9 A;  2Y30 A;  4IF4 A;  3BTC A;  3ZMZ A;  3ERM A;  1WVR A;  4AVP A;  1MIJ A;  1S29 A;  1MZB A;  3TED A;  2DO7 A;  2PFB A;  2XGE A;  5CVI A;  3WHB A;  4A3K J;  3H1C A;  3ABL H;  2HFH A;  3H5N A;  3KYL A;  3I71 A;  3K2A A;  3ZMD A;  3OIO A;  3I59 B;  1POG A;  3FDY A;  5E17 F;  3ASO H;  3FXK A;  2YX4 A;  4UUS A;  4IJA A;  3CCJ I;  2P6S A;  1XDU A;  1HOM A;  4UVC A;  1K6O A;  1MDM B;  4RB1 A;  1TWC J;  2R3S A;  1JJ6 C;  3AL0 C;  5BNG A;  4BDY A;  2CWE A;  2MBF A;  2A6H F;  3S17 J;  2IGO A;  1Y1W J;  3EQL F;  2NRA C;  2M34 A;  5E3O A;  4BKX A;  3M3Y J;  4OIO F;  5L3B A;  3GEZ A;  3HBL A;  4O5V A;  2EV6 A;  2XF6 A;  2FU4 A;  4A0Z A;  4DBQ A;  3HM5 A;  4WXH A;  1PP8 F;  3U9G A;  3D5S C;  4EAT A;  1E3P A;  2CUF A;  1DPR A;  4PGG A;  2DA2 A;  2BVL A;  1HKT A;  2RVC A;  1SFE A;  2MD0 A;  2CJJ A;  2XPV A;  2PLY A;  1TP4 A;  4ENM A;  2E2I J;  3BJ6 A;  4IOA F;  2P6T A;  3S2W A;  4X0G A;  2AQE A;  1MD0 A;  1XN7 A;  1XS9 A;  1WFX A;  2E34 A;  1UCR A;  3JW4 A;  4M71 A;  1U6G A;  2MA3 A;  1FJL A;  1BBY A;  4OAZ A;  5EGO A;  3K4M A;  4DNC A;  2W57 A;  1IO2 A;  3V7R A;  1XC5 A;  2H6C A;  2ZME C;  4FT8 A;  5JI6 A;  1G6N A;  1DQU A;  3BPV A;  4HAM A;  3ZPL A;  2IT0 A;  5CPR B;  2OQG A;  1YIJ I;  4O3M A;  1ZAR A;  4CCL A;  2Z99 A;  1U0J A;  1TQI A;  3B02 A;  2M0M A;  3W6K B;  1AHD P;  2GAU A;  1MMS A;  4HW0 A;  3BG6 A;  5H6R A;  2UZK A;  1YE9 A;  1D0X A;  2DJN A;  2DFE A;  2COB A;  1Z3X A;  4JP0 A;  2A6E F;  2IAI A;  3TW7 A;  5E1X A;  3FBI B;  3L2C A;  3V8K A;  3BPX A;  3AAF A;  2P5L C;  2R7Z J;  1MMG A;  2FOW A;  4P96 A;  4PUS A;  3LSM A;  3S2H J;  3SDG A;  2FUG 2;  1OR7 C;  3LNQ A;  1W36 C;  3FXJ A;  2JA7 J;  3V8J A;  4BHB A;  1X2N A;  4XON A;  3HYI A;  3LA7 A;  3BR5 A;  4LK0 F;  2VKD A;  3ZCO A;  2FF4 A;  3KLO A;  4AIH A;  4LIU A;  4CDG A;  1J9I A;  4BUP A;  2XUB A;  3TO6 A;  3WTW C;  5LGT A;  2OD5 A;  1AU7 A;  1JE8 A;  1G4D A;  4YFK F;  2L01 A;  4EJU A;  2KMU A;  4R79 A;  1HW1 A;  3JRA A;  2ZCW A;  1SFO J;  3M07 A;  2K40 A;  2HOA A;  4A3F J;  1X4P A;  2CGP A;  4XLC A;  3KEO A;  3FXM A;  1D1C A;  4G8X A;  4ETS A;  1S7O A;  5HDK A;  2V1N A;  4LB5 A;  3OIQ A;  2LP0 A;  2WWY A;  4XN3 A;  5LRS A;  2OZ6 A;  3CUQ C;  4V2G A;  2K02 A;  2VI6 A;  3G73 A;  2CQQ A;  2VQH A;  4J00 A;  4IHY A;  3K9T A;  3HL2 A;  2R7D A;  1MGT A;  2JPC A;  1QPI A;  4ZYH A;  1KU2 A;  1OQY A;  2DYS H;  4MFE A;  2VLA A;  3JRE A;  3BTJ A;  2E2J J;  4L9V A;  1VF9 A;  1U8B A;  2L02 A;  2W4S A;  2XSJ C;  1KYZ A;  4G6T B;  1W0U A;  2NAZ A;  3WGH A;  3WTS C;  2OAZ A;  4JX4 A;  4HA8 A;  3TDU C;  2FBH A;  5DUI A;  5M5X J;  4KNY A;  5DEQ A;  4M6V A;  5GAD J;  3LWF A;  5ILS A;  1FSE A;  4ZJZ A;  3J7A Y;  1QGP A;  2A3S A;  3IL2 A;  1ETK A;  1QHH D;  3C3W A;  1TTY A;  4UV9 A;  4G6D A;  4CO8 A;  1UAA A;  4CXF A;  3TOB A;  2O8X A;  4XLF A;  1X2M A;  2HDC A;  4XID A;  3ZN1 A;  4BEH B;  4KYW A;  1MW7 A;  3PFY A;  3HOU J;  4HX7 A;  4XRM A;  3DPU A;  1JKR C;  2Z3Y A;  4GYI A;  4RGR A;  3FIS A;  2X9D A;  2ZSI B;  5JHU A;  2R5Z B;  3CO7 C;  4XRS A;  2V26 A;  3E5U A;  4M3B A;  4L0Z B;  4M9S A;  2DA6 A;  2HR3 A;  1RI7 A;  1UMQ A;  2ELJ A;  4UUV A;  2H09 A;  3KFW X;  4HF2 A;  4BU2 A;  2X1D A;  1S5L C;  5ICG A;  2E1O A;  3K70 D;  2LMD A;  2P5V A;  3OS2 A;  3L1P A;  3S14 J;  4F55 A;  1WJD A;  1T0F A;  2X6W A;  3A02 A;  5CYV A;  5HOO A;  3J7A O;  3K10 A;  3WU0 A;  1TWF J;  1X3W B;  2XPU A;  3HPH A;  4RM3 A;  5IY5 H;  2JA8 J;  2R7V A;  2I10 A;  1KA8 A;  4DZP A;  2HZD A;  3ULQ B;  2R5Z A;  3H9Q A;  5IYB J;  4NQW A;  4HG2 A;  4L5J A;  5IP7 J;  3C2H A;  2D1H A;  4IRG A;  2HYF A;  3C2B A;  4BJ6 C;  1VQK I;  1I1S A;  2XRL A;  2YS9 A;  1PUE E;  1BM9 A;  4LB6 B;  2CFO A;  4A3M J;  1RRJ A;  2HXO A;  3DEE A;  4XN0 A;  2EV5 A;  4AM3 A;  4M6X A;  1A36 A;  2Y0S A;  1XCB A;  2PMH A;  1KQ0 A;  3CUQ B;  4LK1 F;  1QBJ A;  1K83 J;  1H9G A;  1QVU A;  4B48 A;  3S2D J;  1SVO A;  2W48 A;  2M4G A;  1R58 A;  3BRO A;  2VB6 A;  5LHI A;  3AKZ A;  3KP2 A;  2V79 A;  3DKY A;  4KN7 X;  1WI9 A;  3HOV J;  5L3C A;  3GFI A;  1EH8 A;  2MSY A;  3F72 A;  4B43 A;  2K3P A;  3JRG A;  1R1V A;  2NNN A;  1W0T A;  3RDI A;  2PMU A;  3EDP A;  4HDV A;  3VDX A;  2FRH A;  1H0M A;  3I4N J;  3OL3 A;  1OCT C;  4I6Z A;  5M5Y J;  1IC8 A;  1OIS A;  1LE8 A;  4BJ5 C;  5GPC A;  5BS6 A;  2R5Y A;  3MMY B;  3K0L A;  5IOY A;  3A0B C;  1BN5 A;  3KE2 A;  4B3A A;  1HSJ A;  3K4B A;  4LLL A;  2NVT J;  3CDI A;  4K2E A;  1TT0 A;  3FXR A;  5H20 A;  3CZ6 A;  3D5R C;  1JTY A;  1R5I D;  3AG4 H;  2FNP A;  3IWF A;  3QAH A;  4LGW A;  2HZT A;  2CV0 A;  3RPU A;  4RS8 A;  4LIV A;  4HEA 2;  4GRI A;  1P4X A;  1W7P D;  1WJF A;  3FHN A;  2DA7 A;  5EZH A;  1TQP A;  3HOW J;  1Z05 A;  4EV0 A;  2VQG A;  2XC7 A;  2E1M B;  3Q9V A;  2J5P A;  2F48 A;  2X85 A;  1YW9 A;  2NVU B;  3S15 J;  5FKM A;  2ZXW H;  2M1B A;  3QRF F;  3HHG A;  2JPB A;  3BTI A;  3L2V A;  2BHZ A;  2WAF A;  3N4M A;  3V7C A;  3M1E A;  2I8D A;  5DM6 F;  1ZRE A;  2F5V A;  1T6S A;  2E60 A;  4ZYA A;  2BY1 A;  5J1U A;  4HQM A;  4KUM A;  1QZZ A;  3KP6 A;  3LSI A;  1QZE A;  2KFD A;  4LFU A;  1S9H A;  4NC8 A;  4PJJ A;  5J3L A;  3U1K A;  2IRF G;  1JUM A;  2E5N A;  2QUF A;  2EV0 A;  1K78 A;  2MH2 A;  2KLO A;  2IPQ X;  3CUO A;  4JX5 A;  4OIN F;  3I4M J;  2WB1 A;  5BOX A;  5J47 A;  3LA2 A;  4CA0 A;  4C30 A;  3GVA A;  2VJI A;  1OKR A;  2V7F A;  4L0Y B;  1E3H A;  5FFX A;  4IHV A;  2LF8 A;  3RJP A;  2KRF A;  3IUO A;  1OYW A;  1Z6T A;  2Y48 A;  1KQ9 A;  3HKZ A;  2O61 A;  2R7F A;  1ZH5 A;  3T5X A;  2DXI A;  2EZI A;  3CCV I;  2X0L A;  4HV6 A;  1Y1V J;  3CLQ A;  3IH2 A;  5BPI A;  3EPZ A;  3WGG A;  2XKO A;  4PCQ A;  3BCB A;  3LAJ A;  1Y6I A;  3MFK A;  3HUG B;  2ISZ A;  2PJR A;  2DI3 A;  2PN6 A;  2QYO A;  3BQY A;  1EJ9 A;  3HTS B;  1W7P B;  3W6J B;  2OPT A;  5K5O A;  1YRN B;  4ZDO A;  1ZRC A;  5E3M A;  2LY1 A;  4HNU A;  5EEG A;  5B5E C;  3K1N A;  5ICE A;  4I09 A;  4II2 A;  1JUP A;  4I0B A;  2KDZ A;  2DYR H;  4R8H A;  2PG4 A;  1P9Q C;  4M3D A;  1R71 A;  1BA5 A;  2HTJ A;  3GXO A;  4GDF A;  4BXX J;  3D0S A;  3QYB A;  3R0J A;  1W1W E;  3SFI A;  1OYY A;  4XR6 A;  3TGN A;  3BG3 A;  1U8R A;  4Q5S F;  2VBZ A;  3ZRG A;  2GXB A;  1LVK A;  2ID6 A;  2VXZ A;  2RNJ A;  3H3U A;  2AXT C;  4WXC A;  4UUS B;  2LDU A;  1IN8 A;  4HF1 A;  2K7L A;  2C6Y A;  3CJR B;  2GZW A;  2IVM A;  1ORK A;  4AVZ A;  3HXL A;  2QM3 A;  5GAH J;  2HVS A;  3H5A A;  3BR3 A;  1N75 A;  3PSF A;  4LJZ F;  3LSG A;  1Z91 A;  1ENH A;  4D9J A;  2JVH A;  2V9V A;  2E5Z A;  3MAJ A;  1XX5 A;  3OYA A;  3G6E I;  5EZG A;  4HSR A;  5LFA A;  4GO1 A;  3LQQ A;  4HX4 A;  3GF2 A;  3ROU A;  1I3Q J;  1BR4 A;  5DD4 A;  4CCN A;  1N78 A;  4X1E A;  1QPM A;  2XIG A;  3LFK A;  1W36 D;  1A6I A;  2HTS A;  2P5K A;  4A3J J;  2DOA A;  4KA4 A;  2VL8 A;  1LEB A;  5TRD A;  4M74 A;  5EJC A;  4MTE A;  2MYS A;  2O7O A;  1YIO A;  1O3Q A;  1MJB A;  5C4X J;  2JJ7 A;  4LLG F;  2X1E A;  4PJN A;  2AXL A;  1YX3 A;  4P1W A;  4UVB A;  2Y75 A;  2EFQ A;  2MLK A;  3HSF A;  2H1L A;  1XGM A;  2LRD A;  5GAG J;  4L5E A;  5KAI C;  3BLY A;  5HS9 A;  1VQM I;  2X48 A;  5FKO A;  2A5Y B;  3GO5 A;  2DPD A;  2Y0M A;  2CQN A;  4A2U A;  3L9F A;  2DMP A;  1LVA A;  3S1Q J;  2XVC A;  2H27 A;  2ZXH A;  1ON1 A;  2QEN A;  1FY7 A;  3DTE A;  2VOD A;  3JTH A;  2G7H A;  4XOP A;  1Z1D A;  3H3Z A;  4IHT A;  1JKQ C;  2BE5 F;  1HW2 A;  2XAQ A;  1SAX A;  3DFG A;  5FFZ A;  4LG0 B;  4OMY A;  4HZF A;  1BI0 A;  3OWT A;  4D0P A;  3O2P E;  4BBR J;  3ZP5 A;  1G59 A;  2HQ5 A;  2DT5 A;  1ETW A;  3PSI A;  1L3L A;  3KEQ A;  1WSU A;  3G4S I;  2FOK A;  1APL C;  4HV5 A;  4C2T A;  5AIP A;  3I58 A;  2DTZ A;  4I2O A;  4CIC A;  4XMY A;  4A3I J;  1SD6 A;  5KK1 A;  3J81 Z;  2HGC A;  1X3Z B;  2KRH A;  4AYB N;  2IA2 A;  2PEX A;  4UUT A;  3LAP A;  1S8N A;  2EB7 A;  2W82 A;  2FQ3 A;  1IRZ A;  1Y56 A;  3T0Y A;  5JHF A;  1J7K A;  3DU5 A;  2BY3 A;  3C1D A;  1YFH A;  3WTX C;  3S16 J;  1WI3 A;  4HX8 A;  3FBN B;  4HQE A;  3CD6 I;  2CQ7 A;  3T1B A;  1B1B A;  1AWC A;  4CUG A;  2XRO A;  2BZT A;  2P81 A;  2NVQ J;  3VOD A;  4M73 A;  5H6Q A;  4AID A;  3JCU C;  5B66 C;  4NC6 A;  1VQ5 I;  1YLF A;  2LD5 A;  1XGS A;  4RA2 A;  1MBG A;  3WHC A;  2E1N A;  4FHT A;  5CKT A;  2K86 A;  3GWZ A;  4UXN A;  3CCY A;  3ZQI A;  1DP3 A;  1J2X A;  2XAH A;  2Q1Z B;  2ME6 A;  1BW6 A;  1C0W A;  4I99 C;  3OYN A;  3A2K A;  1DGR M;  2M7B A;  2GQQ A;  1MDM A;  5E3N A;  1RIO H;  1H9T A;  5LBQ A;  4QSH A;  2Z1D A;  2KIU A;  3GZN B;  2VT3 A;  3ZN0 A;  4BL0 B;  1L0O C;  4FE7 A;  3CJN A;  1B9M A;  1XSV A;  5HLH A;  2CQK A;  2K4B A;  1AOY A;  2CW7 A;  3TO9 A;  1JTX A;  3FX3 A;  1HKS A;  4RBO A;  2WAQ N;  3HRT A;  1BC7 C;  3IHU A;  4EM0 B;  3CMA I;  2VN2 A;  4DYR A;  2LTP A;  2Y9Z A;  1ZTR A;  2PJR B;  3PNT A;  4ZTF A;  3ABM H;  1MNM C;  3VFZ A;  4BY7 J;  3NEU A;  3O8H A;  2FA5 A;  5L3G A;  4G7O F;  2L2O A;  4D5F A;  1BC8 C;  1D0Z A;  1VI0 A;  3SHF A;  1ETV A;  5C44 J;  1FYM A;  1IXS B;  3K7A J;  1BW5 A;  4RLF A;  2M8E A;  9ANT A;  3MVP A;  2JSP A;  3RPQ A;  3HOY J;  5LD2 C;  2ELH A;  1WJC A;  1O7F A;  1U9O A;  1D8J A;  4FAS D;  1CF7 B;  1MND A;  2P7V B;  4IHS A;  1GHC A;  3KP4 A;  3F23 A;  4NC7 A;  2GBY A;  1TNS A;  4I76 A;  4E7S A;  1JHF A;  4G7Z F;  3SEZ A;  3PIP F;  5CVR A;  3U2R A;  4G12 A;  3OR2 C;  4XM3 A;  1FMW A;  2BVM A;  1IUY A;  3FXU A;  5JLX A;  4M9X A;  3ECO A;  2VJ4 A;  1FP1 D;  1S72 I;  1OPC A;  3W6V A;  5FLX Z;  1TL8 A;  3K1P A;  4MEX F;  3GCM A;  1P92 A;  4C9Y A;  4PSX A;  5HLG A;  4Q4Z F;  2HEO A;  3PO2 J;  3KET A;  5HOD A;  2MH9 A;  1MH4 A;  1WZ2 A;  2LNB A;  1FSH A;  3F8B A;  4PDK A;  5D5U B;  1BJZ A;  4EJW A;  3MKW B;  3FHZ A;  4E7I A;  1QHG A;  2OQR A;  4C2M J;  3BTL A;  5F1R A;  2CW0 F;  5TGT A;  4EMS A;  4B8X A;  3UKG A;  2KJB A;  1WH5 A;  2WV1 A;  3EET A;  3WGI A;  3Q5F A;  2IS2 A;  1JHH A;  1HF0 A;  5F64 A;  1BIA A;  2A69 F;  1GXQ A;  1G3T A;  4LG3 A;  2FX0 A;  3SDB A;  3IC7 A;  1LFP A;  2PJP A;  3EUA A;  1F5T A;  1HKQ A;  3VPR A;  5CLS A;  3E5Q A;  3TO7 A;  1JGS A;  1B59 A;  2G9W A;  1IN4 A;  2IA0 A;  3OYK A;  3CCM I;  1MBJ A;  2CH0 A;  2EBI A;  3A4C A;  2KIQ A;  3IH3 A;  2XGX A;  3ELK A;  1VQ4 I;  1KGS A;  5B1A H;  2RKH A;  3M1C A;  3LSK A;  3JSO A;  2R7U A;  1J0R A;  1ULY A;  5LRR A;  4U0Y A;  3OYB A;  4ESJ A;  1J75 A;  4KIC A;  4XQF A;  2VBX A;  4G6Q A;  1Q1V A;  1YG2 A;  1NTC A;  1Y0U A;  3HC7 A;  1I6H J;  3JRF A;  2MGQ A;  3R6S A;  2K9Q A;  3CCE I;  1ZKG A;  2GOX B;  1WJA A;  2QF7 A;  3I59 A;  3CCR I;  2X6Y A;  4AC0 A;  4XRS G;  2HKX A;  3J81 K;  2KRC A;  2E1M C;  3MKZ A;  2R7X A;  3FZV A;  3E1S A;  1D1A A;  3MCZ A;  4LG0 A;  2M8G X;  1B8I B;  1XDS A;  4YG2 F;  4XLH A;  2BXZ A;  2FNA A;  4IVN A;  4KIT B;  5H2F C;  3OYE A;  2YU9 J;  4MNU A;  3SZG A;  4C3I J;  2RDP A;  3QPT A;  4ZYD A;  1LUJ B;  1X1D A;  1K79 A;  1FBS A;  3FKJ A;  3F3X A;  4YEL A;  1FBQ A;  4BNC A;  3F21 A;  2RRE A;  3OOP A;  4Y15 A;  2P0W A;  5EGO B;  3KIO A;  4BAC A;  2XAJ A;  2DT6 A;  3TDZ C;  4A5N A;  1GVD A;  5HDN A;  2L4M A;  1QVT A;  2H6B A;  4IEJ A;  3RZO J;  5A2Q K;  1I50 J;  5ILV A;  4ZDL A;  3I5U A;  1U78 A;  1T2K A;  3G1O A;  3QU6 A;  3L2W A;  2VKE A;  5K5Q A;  2QQ9 A;  2V9P A;  2Y31 A;  2FBI A;  3HOS A;  1V55 H;  4JK1 X;  1EH7 A;  3DQV C;  2DQL A;  4Z2Y A;  5JVT A;  2L9S A;  2ZFU A;  3OOU A;  2CV1 A;  1F9N A;  4B1R A;  1R7J A;  2DJI A;  1B4A A;  2Q2E A;  1LNW A;  1VQ9 I;  2DMQ A;  1Z7U A;  1ZHF A;  1SC7 A;  1JT6 A;  3HIF A;  3P9I A;  1H8A C;  2LF7 A;  4BQQ A;  5TIS C;  1QA6 A;  2F4I A;  3QP5 A;  3JRH A;  1Z77 A;  1GV2 A;  4DZJ A;  2LC2 A;  3DLL F;  4X6A J;  2DFI A;  1R4N B;  5C4J J;  3OSF A;  1ZGA A;  3LST A;  3CF2 A;  1YX5 A;  4MTD A;  5GAE J;  2R0Q C;  2IBD A;  2L5Q A;  1T38 A;  2GXA A;  1WWX A;  2ZJQ F;  3ECH A;  4OU0 A;  5E8I A;  2Y69 H;  3ZGK A;  2P7C B;  3HUG A;  2CO5 A;  2E36 A;  3CCS I;  2VKH A;  4BE1 A;  3H0D A;  1DP7 P;  1EF4 A;  2YU3 A;  1WJ5 A;  1YO5 C;  2GIV A;  2XAS A;  1FT9 A;  3EUH A;  2FJ1 A;  2DMT A;  3WTT C;  2EA4 A;  3F9K A;  2VKV A;  4I0A A;  4PGH A;  4Z6Y A;  3KPH A;  4F7Z A;  2DOE A;  3K4K A;  3CCU I;  3CJT B;  3GUD A;  4RM2 A;  3GTP J;  1O7L A;  2Z2S B;  3HDD A;  4LMY A;  2QQ8 A;  2CW8 A;  3SFZ A;  4BXF A;  2OBP A;  3ZXS A;  1HC8 A;  5IT9 Z;  1P7J A;  3OY9 A;  1S7E A;  3RYR A;  4YIR X;  3IP4 B;  1FOW A;  5FKK A;  2B7E A;  4GXO A;  1KU9 A;  3I0T A;  4XLP F;  2GA1 A;  2JN6 A;  2OUM A;  5F27 A;  4BQN A;  1HA8 A;  2DOD A;  1IXR C;  4UB8 C;  4ZZD A;  2W00 A;  4IXA A;  3L00 A;  4D5C A;  4GYG A;  1UJ8 A;  4HOB A;  1FOK A;  1UFM A;  5TJJ A;  1KQ8 A;  3PL8 A;  3PUB A;  2BXY A;  5HVQ C;  1ZRD A;  3JR9 A;  5B3S H;  3CO6 C;  3O6B B;  1EA3 A;  1S6L A;  3CCL I;  2KDO A;  3S3M A;  3Q0U A;  4M72 A;  3V8L A;  3K70 C;  2NS8 A;  2EIL H;  1JI8 A;  1GT0 C;  2LYC A;  1RUO A;  2V6C A;  3IRR A;  3G1M A;  3HKZ N;  4ENN A;  2COM A;  5KAF C;  1Y0N A;  4OIR F;  2TRT A;  3JRI A;  3GBG A;  2QVO A;  5J4Y A;  1YS7 A;  3KZZ A;  1IDY A;  1BR2 A;  4HBL A;  3RTR A;  4DYC A;  1LFB A;  5DCM B;  1XPX A;  5IP9 J;  2WC2 A;  2UWM A;  4XRF A;  3C2G A;  4B09 A;  2RV8 A;  2NYX A;  5HNH A;  3EUK L;  3UR3 C;  1SEU A;  1R49 A;  3D1N I;  1JKO C;  2A07 F;  3QPS A;  4XL9 A;  2WB1 N;  4QWQ A;  3TOA A;  4FTH A;  4JOM A;  1W4M A;  1ZGW A;  2M7A A;  3HOZ J;  2W25 A;  5K7H A;  5IYD J;  2XAG A;  4NB5 A;  1SFX A;  2QCO A;  3DPT A;  2LG4 A;  1RKW A;  2OF7 A;  2VON A;  4U0V A;  2WY8 Q;  1OMI A;  4M3E A;  5DS9 A;  4UVA A;  4ANJ A;  4WCG A;  1X58 A;  2NVX J;  2H8R A;  3MKL A;  2ZXJ A;  1R23 A;  2BW3 A;  3BC8 A;  3KCC A;  4L9T A;  2F5C A;  3DEW A;  3K1M A;  4RAY A;  2STW A;  3LL7 A;  1D1B A;  3OR1 C;  3IAS 2;  1BI3 A;  2NXN B;  1DPU A;  1V3F A;  2IS1 A;  2XAF A;  2H8W A;  1FC3 A;  2DMN A;  2VE9 A;  3BZC A;  2DN0 A;  3S1N J;  2WAQ A;  3PNV A;  1ERD A;  1VQ8 I;  3CUQ A;  4E6K G;  3VWB A;  2M0C A;  2L7F P;  4A5M A;  2YR2 A;  4MFD A;  4D7M A;  2OV7 A;  4RMN A;  3ABK H;  1YI2 I;  4KIS A;  2VQL A;  3KZY A;  4R1H A;  2WTE A;  3JAM K;  1UEL B;  4E7K A;  3SQN A;  2HOT A;  3WU1 B;  4Y33 A;  1PUF A;  2NS7 A;  4L5I A;  2ZXI A;  1ZG1 A;  1TBX A;  2ZNZ A;  3HG9 A;  2VE8 A;  3DLA A;  1V5G A;  2ZKZ A;  4A3L J;  3GZ5 A;  1LB2 A;  1CF7 A;  2N8G A;  1U2W A;  3SZP A;  4FQG A;  2DOF A;  4RGS A;  2FML A;  2DFH A;  2GA2 A;  2FD5 A;  1FIA A;  3IV5 A;  2ZJ2 A;  2QQA A;  2YPR A;  3DCF A;  1FIP A;  2HI3 A;  2K5C A;  3BQZ A;  2L7K A;  3HHH A;  1WJB A;  2VAS A;  3QU3 A;  1NHA A;  4MQ9 F;  5LHG A;  3GYH X;  3G71 I;  2BYV E;  4V2F A;  4BBS J;  3GX4 X;  3IAM 2;  2XV4 S;  3AG3 H;  2MC4 A;  4P9U A;  2ADU A;  2ZO4 A;  3IRQ A;  2LKX A;  1BIB A;  5E18 F;  3COA C;  4RLQ A;  4A0Y A;  1STZ A;  3CP2 A;  1IF1 A;  4XNF A;  2ZB9 A;  4M3G A;  1X3U A;  4N0B A;  4G7H F;  2HQR A;  1JKP C;  2EZH A;  4UV8 A;  2L9V A;  3FXL A;  4UNO A;  4Y13 A;  5LEK A;  3WTU C;  4NUB A;  4BJT A;  2RGV A;  3DP7 A;  1F4K A;  2F5D A;  3WU2 C;  2QBY B;  1TWH J;  2VBY A;  3QPL A;  2OC6 A;  5CVV A;  4A6D A;  2ZFW A;  3C18 A;  2WV0 A;  1R1U A;  1ETQ A;  4E7H A;  1YS6 A;  1TNT A;  2M5W A;  1WRJ A;  3ESW B;  2ID3 A;  4AIK A;  3FXO A;  1YW8 A;  1D5V A;  3GTL J;  2M3A A;  5CVU A;  3BP8 A;  1B72 A;  1R4M B;  3J7Y J;  3WTV C;  1R5G A;  4KT6 A;  1VQ7 I;  1ZLJ A;  2EZK A;  5AON A;  2LLK A;  4M6Y A;  4M3F A;  2L9N A;  4QIW N;  5D8K B;  4DJA A;  3Q0W A;  4XLN F;  2JQ7 A;  3K4N A;  4DBR A;  3KP5 A;  1Z21 A;  2KZG A;  2OZU A;  3OS1 A;  3OMY A;  1VTN C;  3NWS A;  3LFU A;  2DTR A;  2MG4 A;  1CGP A;  3O8G A;  2HWV A;  3PQJ A;  4OMZ A;  4U7B A;  3K4J A;  1W5S A;  2IW5 A;  3E0J B;  3Q0V A;  4II3 A;  5DD8 A;  3RKQ A;  1AKH A;  1EKE A;  2EFW A;  4XOR A;  3J80 K;  1OYI A;  2RQP A;  1JUS A;  1S7A A;  2BOL A;  3BG7 A;  4CCM A;  3PM1 A;  4A12 A;  4BE0 A;  1V5F A;  1QQI A;  3T8R A;  3KEY A;  3JRD A;  1TZL A;  3KYD B;  2CU7 A;  2D45 A;  1BOB A;  2KHM A;  5HDG A;  3FWE A;  4ZZL A;  3F8C A;  5J1Y A;  2IS6 A;  1IDZ A;  3B6A A;  1YJ9 I;  3BR0 A;  5DCF A;  4NQW B;  4F93 B;  3CMM A;  2QLZ A;  4XKC A;  1K6Y A;  3ZR8 X;  3SYT A;  1D5Y A;  2VC1 A;  3ZQG A;  2JTV A;  2FE3 A;  2WA0 A;  2HQA A;  2K3F A;  1NG6 A;  2W24 A;  3ISP A;  2ECB A;  5A2Q Z;  4HF0 A;  5FKL A;  1MSE C;  3N97 A;  5E1Z B;  2LOO A;  4C3J J;  2VBW A;  4L9J A;  1AKH B;  1BR1 A;  1ZGJ A;  1EV7 A;  1O3S A;  1VFC A;  1SAU A;  1USS A;  3RSN A;  1IRF A;  1ON2 A;  1NH3 A;  1UB9 A;  4I02 A;  2JRT A;  3P7N A;  4FET A;  2X51 A;  2HOE A;  2ETH A;  2GWR A;  3J7Z I;  1P4A A;  2LH9 A;  2KIM A;  1IGN A;  3TMO A;  2Y0S N;  2MLG A;  1OCP A;  4Y7N J;  2P4W A;  2E7X A;  2M87 A;  4JYK A;  4ZDP A;  3F0C A;  3I3L A;  2BBY A;  1FX7 A;  3SZT A;  2VPR A;  4CSW A;  2FEZ A;  4YIF A;  1WGX A;  3IH4 A;  4G9Y A;  2YSR A;  2F2E A;  2XF5 A;  4A69 C;  5C3E J;  3E3V A;  4EGZ A;  4KMF A;  1PYV A;  2RQQ A;  4LIT A;  2F4O B;  4KIG A;  4E70 A;  2E1C A;  2AQF A;  5ICC A;  5D5W B;  3TW6 A;  2L7Z A;  3E6D A;  4JBA A;  2B9S A;  2V1X A;  2DFF A;  4LLN A;  4EJT A;  5K7F A;  1ETO A;  2DBB A;  4BYY A;  3MD2 A;  2HDD A;  5FO5 A;  1W5C C;  5FRO A;  3M8F A;  3TQN A;  1X1P A;  3FMR A;  2E19 A;  4NBQ A;  4BGD A;  4ASN A;  4V19 K;  5GP9 A;  2JUG A;  2TDX A;  1IV6 A;  4H4K C;  2B63 J;  1PJR A;  2IGM A;  1XMX A;  4QTR A;  4MEY F;  2JSC A;  4Y17 A;  1Y8Q B;  3LA3 A;  1JGG A;  1SVL A;  3DPL C;  2TCT A;  4BDZ A;  1CQT A;  2H1K A;  4YFN F;  5GTI C;  2KKO A;  4IHW A;  1T39 A;  3BR2 A;  3ML6 A;  5FKN A;  1YJN I;  1LDJ A;  3DEU A;  2STT A;  5J6X A;  4PJ0 C;  2DT7 B;  3ZMT A;  3CC2 I;  4BH9 A;  1FNN A;  2VPL A;  1YTY A;  2QEX I;  2HYJ A;  3GTO J;  2X1C A;  3DV8 A;  3W2A A;  1IN6 A;  4IPA A;  5F04 A;  2JA6 J;  4HYE A;  1LFU P;  4IRH A;  4OIP F;  2O3F A;  2HYG D;  1LEA A;  5F0C A;  3K2Z A;  1HST A;  4W1U A;  3MQ0 A;  3CLO A;  4U88 A;  1FMV A;  2XGC A;  1YYV A;  4AU7 A;  4N4N B;  1P2F A;  2LFB A;  2EIK H;  4I98 B;  2ME0 A;  2MAB A;  4BEH A;  1K7A A;  1WQ2 A;  1VQL I;  2A6T A;  3NRV A;  4BQA A;  4HLX A;  4EVI A;  2LBF A;  3I54 A;  3QP6 A;  5FJ8 J;  1D0Y A;  2K9L A;  3UNG C;  4N9H A;  1I5Z A;  2XGD A;  3E6C C;  2ESN A;  1B6A A;  3VSK A;  1JJ8 C;  4S0H B;  2VT2 A;  1HLV A;  2ACJ A;  3GW2 A;  1IAW A;  3I4P A;  3KP3 A;  1D3Y A;  2IGK A;  5IOZ A;  3JTG A;  1MJ9 A;  1MBK A;  3CCQ I;  2O03 A;  1MNE A;  2ZME B;  1I27 A;  2Z16 A;  1ZG3 A;  1OCC H;  3P9K A;  4B44 A;  1RR8 C;  2NS0 A;  1VZ0 A;  1MJA A;  1IV8 A;  1KZH A;  1YHQ I;  1LE8 B;  2K4J A;  2LK2 A;  5IPA A;  2JZY A;  2HXI A;  2CUZ A;  1GVJ A;  4UHT A;  3KP7 A;  1IRG A;  1OCO H;  1SMY F;  3E6B A;  3M9A A;  4PSW A;  4CZZ A;  2O9L A;  1I6X A;  1FTT A;  3HGY A;  4AWX B;  4LD5 A;  5KHD A;  1ZRF A;  3BJA A;  3RZD J;  5E79 C;  5DTD A;  3L7W A;  2K9S A;  3E97 A;  2EH3 A;  3U21 A;  3OYD A;  1XSD A;  2HKO A;  1TW3 A;  4IRI A;  2M9H A;  3RQ4 A;  2HNH A;  2LY9 A;  3K4C A;  1F43 A;  1T56 A;  1X4O A;  5D5X B;  5ILU A;  1U5T A;  4OOI A;  3WTZ A;  3GLL A;  5K7Z A;  3ABU A;  4HRI A;  2R93 J;  2QQB A;  1FYL A;  5LGU A;  1R9T J;  1OR7 A;  1XGO A;  2LY2 A;  5LHH A;  1MBF A;  3WG9 A;  3ZQF A;  2A61 A;  2DU9 A;  3U1D A;  3V42 A;  2I5U A;  4N4O B;  3S8P A;  1QNT A;  3QYE A;  3BZK A;  2IJL A;  3SXY A;  1AA7 A;  1Z7L A;  1W7P A;  2JA2 A;  1YRN A;  2PMZ A;  1UG2 A;  1O4X A;  1REP C;  3OYC A;  3I64 A;  3F6V A;  2ISY A;  3OS0 A;  3I9V 2;  4PK4 A;  2K85 A;  4S05 A;  1WHU A;  2EPF A;  2BEO A;  5E3L A;  5LGN A;  4KDP A;  3H92 A;  1WH7 A;  4CGZ A;  4KIF A;  2QSF X;  3ZMV A;  1X1A A;  4NDL A;  2CQX A;  1ODD A;  2HPM A;  4Y52 J;  3L09 A;  1UG0 A;  3SEQ A;  2IEK A;  4E7Z A;  5E20 A;  4YFX F;  3CQZ J;  3RYP A;  4A3D J;  1N25 A;  1K4S A;  1Z6R A;  3WE2 A;  2EQR A;  4HPQ A;  2QA4 I;  4F91 B;  1XG1 A;  4L18 B;  1ONV A;  1VQ6 I;  4MO7 A;  3ZOB A;  2XDV A;  3JRB A;  1RUN A;  4D1Q A;  5DYM A;  2DDB A;  2EFP A;  1R22 A;  1Z0X A;  5CVJ A;  4PFO A;  4AUX A;  3F22 A;  1PUF B;  5J1R A;  2R7S A;  5FLX K;  1FBU A;  4ON0 A;  1YJW I;  5LEJ A;  5L3F A;  4BY1 J;  3HGG A;  1IRX A;  3NAU A;  1BOA A;  2OA4 A;  2PQ8 A;  2JUC A;  3DF8 A;  4XIC A;  2EIJ H;  3W3C A;  1UHW A;  4A6E A;  3QOP A;  2V1D A;  4B4C A;  2RAE A;  2H94 A;  4YII A;  2LRE A;  5DM7 F;  2HQN A;  2XSD C;  3PIO F;  3H9J A;  3HPG A;  4DQ2 A;  1IN7 A;  1RNL A;  3IWZ A;  4RAZ A;  1S3J A;  4D7N A;  3OYM A;  1FTZ A;  1LDK B;  4ZYE A;  1RZ4 A;  2CYY A;  5FD5 A;  3D5L A;  2PBI A;  3RCO A;  1P6R A;  3TBI A;  4CHU A;  4Q47 A;  1FYK A;  3JRC A;  1WCM J;  3E5X A;  2V1U A;  2QSH X;  1JXS A;  5CQE A;  3EYY A;  3ZQC A;  3EUH C;  4DOZ A;  2WAD A;  1GDT A;  4BHP A;  3FK7 A;  3GTM J;  3A01 B;  1K61 A;  1D8K A;  1I39 A;  4CCJ A;  4B47 A;  1XSX A;  3WTY C;  5F1J A;  4CYC A;  3R60 A;  1U3E M;  2EZL A;  4FX0 A;  2XB5 A;  1ACI A;  1OCR H;  1XGN A;  2JMW A;  1X19 A;  2JVG A;  5AIQ A;  1P4W A;  4XSZ F;  4B3X A;  1M1E B;  4A3B J;  3PNY A;  1BI2 A;  2XKP A;  1F1Z A;  2XAU A;  2VOO A;  2DA5 A;  3GFJ A;  3MN2 A;  4PJM A;  3QOE A;  4GGG A;  3OYJ A;  1BI1 A;  2R7W A;  5D6E A;  1KU3 A;  2ZME A;  2KIS A;  2PI0 A;  1FLI A;  3DKW A;  3AG1 H;  4ABZ A;  3PO3 J;  1HQC A;  4Q48 A;  3CP8 A;  1MSF C;  2L54 A;  2MW8 A;  5FLM J;  3V7S A;  5CJ9 A;  4S04 A;  3B6C A;  5M5W J;  2EWN A;  2UUZ A;  5CQG A;  3RKX A;  1B8I A;  4J19 A;  4IQJ A;  5DV5 A;  2ZBK A;  2RN7 A;  3HTU A;  2LVS A;  2XRN A;  5D8L B;  1RET A;  2CUJ A;  2EK5 A;  1R1T A;  1IN5 A;  2ELK A;  1OLT A;  2JRM A;  4F92 B;  1I1G A;  1KON A;  3LSH A;  4IO9 F;  1FWZ A;  1VND A;  3S93 A;  3PUF A;  3FXQ A;  1R00 A;  2A5W A;  1U9N A;  3CC4 I;  2WY7 Q;  2R92 J;  5M3M J;  1Q1H A;  1TLH B;  2Z5U A;  1DU0 A;  2IA1 A;  1V5E A;  1B9N A;  3ASN H;  2CS3 A;  4OWR B;  4PZJ A;  1IUF A;  4JX6 A;  4DGW B;  3ZQL A;  3BOQ A;  1E0E A;  4MIM A;  3M7G A;  2ICW G;  4UB6 C;  3FM3 A;  3VYT B;  4C2U A;  2K9N A;  2HPI A;  2K9M A;  4PFP A;  3ERE D;  4IOC F;  5K5R A;  3PJR A;  3FM5 A;  4KN4 X;  3JAM Z;  2CRG A;  5JR3 A;  2ZSH B;  3L2R A;  1GLN A;  3BG5 A;  2L9R A;  4ENJ A;  2HVR A;  1MMN A;  4HST A;  4RB2 C;  1JT0 A;  5D4S A;  1XB4 A;  4BE2 A;  1ZLK A;  2A05 A;  4WK8 F;  3MZ8 A;  1PDN C;  3P9C A;  2CV2 A;  1FOY A;  3BT9 A;  4YEJ A;  5HLI A;  4FE4 A;  2BV6 A;  4FCY A;  1WKM A; 
#chains in the Genus database with same CATH homology
 3G3Z A;  5D4R A;  4KT5 C;  4EJV A;  5ICF A;  2DPU A;  3GLX A;  4RB3 C;  1Z9C A;  3CDH A;  3GFM A;  4MQV A;  1W5T A;  5DCM A;  2E7W A;  3KLN A;  3O3K A;  5KVR A;  1HXD A;  3HSR A;  2X4H A;  5J8F A;  5L3D A;  3BWG A;  2DK5 A;  5F6F A;  1SFU A;  2M30 A;  1QZY A;  1J5Y A;  2F5E A;  3Q9S A;  5L3E A;  5BQT A;  2YX7 A;  5LLQ A;  5J8C A;  4WX9 A;  4U0W A;  2LKP A;  3F8F A;  2IP2 A;  2ESH A;  3GZ6 A;  3HSE A;  3E6M A;  2M45 A;  1XCV A;  1FZP B;  4N9I A;  1KYW A;  2KJC A;  1FPQ A;  4HLY A;  4MGR A;  4U7D A;  2EJR A;  3BY6 A;  3K69 A;  2DW4 A;  3I53 A;  2B0L A;  1TQM A;  3RIR A;  4P9F A;  3B73 A;  3FMS A;  1O3R A;  2L3D A;  2XHK A;  4EQQ A;  3F8N A;  3J80 Z;  1G3S A;  1HBX G;  1SD4 A;  5IT3 A;  1U5T C;  4BXU A;  4BAY A;  2D1V A;  4QLC U;  4MHG A;  3HOT A;  3NQO A;  3V4G A;  3R61 A;  2DAO A;  2LSO A;  3ZMU A;  2W84 A;  1TW2 A;  2FSW A;  4ZYG A;  2L4A A;  4ESB A;  1O57 A;  3HRU A;  1T98 A;  4OIQ F;  1FP2 A;  4EM1 A;  5DUK A;  3R4K A;  3HRM A;  3RKW A;  4XSX F;  1E2X A;  2O6G E;  2BGC A;  5E1W A;  3FMQ A;  3PQK A;  4ENK A;  5ED4 A;  3MWM A;  6PAX A;  5D6F A;  4H0E A;  3EYI A;  3REO A;  3GFL A;  3ZMS A;  3VB2 A;  3QPH A;  1SMT A;  2MC3 A;  3CTA A;  1U5T B;  1UST A;  2OU2 A;  1R36 A;  4CYD A;  2K27 A;  3MZH A;  1ZAO A;  1MKM A;  4RGX A;  3BJO A;  4JQF A;  4L9N A;  4WF2 A;  2FMY A;  4KFC A;  2KIF A;  1DUX C;  2QBY A;  3VOE A;  5FB2 A;  3BZ6 A;  1SD5 A;  2G7U A;  1O3T A;  2FXA A;  2Z33 A;  5E8G A;  4I7H A;  2HS5 A;  1V4R A;  5HS7 A;  1J59 A;  1SD7 A;  5JFR A;  4KMU X;  3R0A A;  3FF5 A;  1GXP A;  3IKT A;  4NHJ A;  2Z9O A;  5BMZ A;  4G94 A;  3MZY A;  2UXN A;  1IXC A;  2QZ8 A;  2P8T A;  4ZH4 F;  5IT9 K;  3IKV A;  2O0Y A;  5K1Y A;  3T8T A;  3TKY A;  5D5V B;  2RC4 A;  2CSO A;  1IZ1 A;  2DK8 A;  1ZG5 A;  2EA2 A;  2Q8K A;  3MEX A;  3JSP A;  4P55 A;  4A0X A;  3WE3 A;  1ZN2 A;  4M9Z A;  5EEH A;  2Q0O A;  1G3W A;  4XBF A;  1LJ9 A;  1E17 A;  2J5O A;  1QO0 D;  3RKY A;  1LQ1 A;  4AD9 A;  4KIB A;  2AS5 F;  3C7J A;  4TV7 A;  4RB0 A;  4RGU A;  4ESF A;  1XD7 A;  1YQA A;  5FGM A;  4EGY A;  1G3Y A;  2MD5 A;  3M8E A;  2GXG A;  3VEP A;  3ZQ7 A;  2DLL A;  3OV8 A;  1IW7 F;  3LQR A;  4I01 A;  5DDG A;  1LDD A;  2A68 F;  2EFO A;  4WXD A;  3F6O A;  4WWC A;  2JT1 A;  1HW5 A;  2VOP A;  2CG4 A;  2DQR A;  3ABT A;  4P5O A;  5HS8 A;  5FD6 A;  1EH6 A;  2QWW A;  3F8M A;  4HDU A;  4GCV A;  3DXJ F;  1UHM A;  3BDD A;  1XMK A;  2CFX A;  1ZYR F;  1KU7 A;  2NNY A;  4BHC A;  4O6J A;  2UXX A;  1BJA A;  3HRS A;  1YW7 A;  1DDN A;  4EJO A;  1XMA A;  2D2W A;  2ZNY A;  3RI4 A;  4EM2 A;  2VC0 A;  4AIJ A;  3WOD F;  1A04 A;  5ERI A;  2EFN A;  4FX4 A;  5BPD A;  1K78 B;  1PP7 U;  3PFI A;  1R5H A;  2W85 A;  2FBK A;  2F5F A;  4IF4 A;  3ZMZ A;  4AVP A;  1S29 A;  1MZB A;  2DO7 A;  2PFB A;  5CVI A;  2HFH A;  3I71 A;  3ZMD A;  3I59 B;  5E17 F;  2YX4 A;  4IJA A;  2P6S A;  1XDU A;  4UVC A;  1K6O A;  1MDM B;  4RB1 A;  2R3S A;  2CWE A;  2MBF A;  2A6H F;  3EQL F;  2NRA C;  4OIO F;  5L3B A;  3GEZ A;  4O5V A;  2EV6 A;  2FU4 A;  4A0Z A;  1PP8 F;  4WXH A;  3U9G A;  1DPR A;  4PGG A;  1HKT A;  2RVC A;  1SFE A;  2PLY A;  4ENM A;  3BJ6 A;  2P6T A;  3S2W A;  1MD0 A;  1XN7 A;  1UCR A;  3JW4 A;  4M71 A;  1U6G A;  2MA3 A;  1BBY A;  4DNC A;  2W57 A;  3V7R A;  2H6C A;  4FT8 A;  5JI6 A;  1G6N A;  3BPV A;  4HAM A;  3ZPL A;  2IT0 A;  2OQG A;  4O3M A;  1ZAR A;  2Z99 A;  3W6K B;  1TQI A;  3B02 A;  2GAU A;  4HW0 A;  5H6R A;  2UZK A;  2A6E F;  5E1X A;  3L2C A;  3V8K A;  3BPX A;  3AAF A;  2P5L C;  4P96 A;  3V8J A;  4BHB A;  3HYI A;  3LA7 A;  4LK0 F;  2FF4 A;  3KLO A;  4AIH A;  4CDG A;  1J9I A;  2XUB A;  3TO6 A;  3WTW C;  5LGT A;  2OD5 A;  1JE8 A;  1G4D A;  4YFK F;  2L01 A;  4EJU A;  4R79 A;  1HW1 A;  2ZCW A;  2CGP A;  3KEO A;  4G8X A;  4ETS A;  1S7O A;  5HDK A;  4LB5 A;  2WWY A;  5LRS A;  2OZ6 A;  3CUQ C;  2K02 A;  3G73 A;  3K9T A;  2R7D A;  1MGT A;  2JPC A;  4ZYH A;  1KU2 A;  4L9V A;  2L02 A;  1KYZ A;  2NAZ A;  3WGH A;  3WTS C;  2OAZ A;  4HA8 A;  3TDU C;  2FBH A;  5DUI A;  4KNY A;  5DEQ A;  3LWF A;  5ILS A;  1FSE A;  1QGP A;  2A3S A;  3IL2 A;  3C3W A;  1TTY A;  4UV9 A;  4G6D A;  4CO8 A;  4CXF A;  3TOB A;  2O8X A;  2HDC A;  3ZN1 A;  4KYW A;  4HX7 A;  2Z3Y A;  4GYI A;  4RGR A;  5JHU A;  3CO7 C;  3E5U A;  4L0Z B;  4M9S A;  2HR3 A;  1RI7 A;  4UUV A;  2H09 A;  3KFW X;  4HF2 A;  5ICG A;  2P5V A;  1T0F A;  5CYV A;  5HOO A;  3J7A O;  3WU0 A;  1KA8 A;  3ULQ B;  4NQW A;  4L5J A;  2D1H A;  4IRG A;  2HYF A;  1I1S A;  1PUE E;  1BM9 A;  4LB6 B;  2EV5 A;  4M6X A;  1XCB A;  2PMH A;  1KQ0 A;  3CUQ B;  4LK1 F;  1QBJ A;  1H9G A;  3BRO A;  1R58 A;  5LHI A;  3KP2 A;  2V79 A;  4KN7 X;  1WI9 A;  5L3C A;  3GFI A;  1EH8 A;  3F72 A;  1R1V A;  2NNN A;  3RDI A;  2PMU A;  3EDP A;  4HDV A;  2FRH A;  1H0M A;  5BS6 A;  3K0L A;  1BN5 A;  3KE2 A;  1HSJ A;  4LLL A;  4K2E A;  3FXR A;  5H20 A;  2FNP A;  3IWF A;  3QAH A;  4LGW A;  2HZT A;  3RPU A;  4RS8 A;  1P4X A;  1W7P D;  1TQP A;  1Z05 A;  4EV0 A;  3Q9V A;  2J5P A;  1YW9 A;  2M1B A;  3QRF F;  2JPB A;  3HHG A;  3N4M A;  3V7C A;  3M1E A;  1ZRE A;  1T6S A;  4HQM A;  4KUM A;  1QZZ A;  3KP6 A;  4LFU A;  2IRF G;  2QUF A;  2EV0 A;  1K78 A;  2MH2 A;  3CUO A;  2IPQ X;  4OIN F;  5BOX A;  3LA2 A;  3GVA A;  1OKR A;  4L0Y B;  5FFX A;  2LF8 A;  3RJP A;  2KRF A;  1OYW A;  1Z6T A;  2Y48 A;  1KQ9 A;  2O61 A;  2R7F A;  1ZH5 A;  3T5X A;  2X0L A;  4HV6 A;  5BPI A;  3WGG A;  2XKO A;  4PCQ A;  3LAJ A;  3MFK A;  2ISZ A;  2DI3 A;  2PN6 A;  2QYO A;  3HTS B;  1W7P B;  3W6J B;  5K5O A;  1ZRC A;  5EEG A;  3K1N A;  5ICE A;  4I09 A;  4I0B A;  4R8H A;  2PG4 A;  2HTJ A;  3GXO A;  3D0S A;  3R0J A;  1OYY A;  1U8R A;  3TGN A;  4Q5S F;  2VBZ A;  2GXB A;  2VXZ A;  2RNJ A;  3H3U A;  4WXC A;  2LDU A;  1IN8 A;  4HF1 A;  2K7L A;  2C6Y A;  2GZW A;  2IVM A;  2QM3 A;  4LJZ F;  1Z91 A;  2V9V A;  3MAJ A;  4GO1 A;  3LQQ A;  4HX4 A;  3GF2 A;  3ROU A;  5DD4 A;  1QPM A;  2XIG A;  3LFK A;  2HTS A;  2P5K A;  4KA4 A;  1LEB A;  5TRD A;  4M74 A;  4MTE A;  1YIO A;  1O3Q A;  1MJB A;  4LLG F;  2AXL A;  4UVB A;  2Y75 A;  2EFQ A;  2MLK A;  3HSF A;  1XGM A;  5HS9 A;  2A5Y B;  3GO5 A;  2DPD A;  2Y0M A;  4A2U A;  3L9F A;  1LVA A;  2XVC A;  2H27 A;  1ON1 A;  2QEN A;  1FY7 A;  2VOD A;  3JTH A;  2G7H A;  1Z1D A;  3H3Z A;  4IHT A;  2BE5 F;  1HW2 A;  2XAQ A;  1SAX A;  3DFG A;  5FFZ A;  4LG0 B;  4OMY A;  4HZF A;  1BI0 A;  4D0P A;  3O2P E;  3ZP5 A;  2DT5 A;  1L3L A;  3KEQ A;  1WSU A;  2FOK A;  4HV5 A;  5AIP A;  3I58 A;  4I2O A;  4CIC A;  1SD6 A;  5KK1 A;  3J81 Z;  2HGC A;  2IA2 A;  2PEX A;  3LAP A;  1S8N A;  2EB7 A;  2FQ3 A;  3T0Y A;  1J7K A;  3C1D A;  1YFH A;  3WTX C;  4HX8 A;  4HQE A;  3T1B A;  1B1B A;  1AWC A;  2XRO A;  3VOD A;  4M73 A;  5H6Q A;  1YLF A;  1XGS A;  2E1N A;  4FHT A;  2K86 A;  3GWZ A;  4UXN A;  1J2X A;  2XAH A;  1C0W A;  2GQQ A;  1MDM A;  1RIO H;  1H9T A;  5LBQ A;  2KIU A;  2VT3 A;  3ZN0 A;  1L0O C;  3CJN A;  1B9M A;  1XSV A;  5HLH A;  2CQK A;  2K4B A;  1AOY A;  3TO9 A;  3FX3 A;  1HKS A;  3HRT A;  1BC7 C;  3IHU A;  4EM0 B;  2VN2 A;  3VFZ A;  3NEU A;  2FA5 A;  5L3G A;  4G7O F;  1BC8 C;  3SHF A;  1FYM A;  1IXS B;  2M8E A;  3RPQ A;  2ELH A;  1O7F A;  1D8J A;  1CF7 B;  2P7V B;  4IHS A;  1GHC A;  3KP4 A;  3F23 A;  1TNS A;  1JHF A;  4G7Z F;  5CVR A;  3U2R A;  1IUY A;  3FXU A;  4M9X A;  3ECO A;  1FP1 D;  1OPC A;  5FLX Z;  3K1P A;  4MEX F;  1P92 A;  5HLG A;  4Q4Z F;  2HEO A;  3KET A;  2MH9 A;  2LNB A;  1FSH A;  3F8B A;  4PDK A;  5D5U B;  4EJW A;  3FHZ A;  2OQR A;  5F1R A;  2CW0 F;  4EMS A;  4B8X A;  2KJB A;  3EET A;  3WGI A;  3Q5F A;  1JHH A;  5F64 A;  1BIA A;  2A69 F;  1GXQ A;  1G3T A;  3IC7 A;  2PJP A;  1F5T A;  1HKQ A;  5CLS A;  3E5Q A;  3TO7 A;  1JGS A;  1B59 A;  2G9W A;  1IN4 A;  2IA0 A;  2XGX A;  3ELK A;  1KGS A;  2RKH A;  3JSO A;  1J0R A;  1ULY A;  5LRR A;  4U0Y A;  4ESJ A;  1J75 A;  4KIC A;  2VBX A;  4G6Q A;  1YG2 A;  1Y0U A;  3R6S A;  3I59 A;  2HKX A;  3J81 K;  3FZV A;  3MCZ A;  4LG0 A;  1XDS A;  4YG2 F;  2FNA A;  4IVN A;  4MNU A;  2RDP A;  3QPT A;  4ZYD A;  1K79 A;  1FBS A;  3F3X A;  1FBQ A;  4BNC A;  3F21 A;  3OOP A;  4Y15 A;  2XAJ A;  3TDZ C;  4A5N A;  5HDN A;  2L4M A;  2H6B A;  5A2Q K;  5ILV A;  3I5U A;  1U78 A;  1T2K A;  3QU6 A;  5K5Q A;  2QQ9 A;  3HOS A;  2FBI A;  4JK1 X;  1EH7 A;  3DQV C;  2DQL A;  4Z2Y A;  5JVT A;  1F9N A;  1R7J A;  1B4A A;  2Q2E A;  1LNW A;  1Z7U A;  1ZHF A;  3HIF A;  3P9I A;  2LF7 A;  3QP5 A;  2DFI A;  1ZGA A;  3LST A;  4MTD A;  1T38 A;  1WWX A;  3ECH A;  4OU0 A;  5E8I A;  2P7C B;  3HUG A;  2CO5 A;  1DP7 P;  2YU3 A;  1YO5 C;  2GIV A;  2XAS A;  1FT9 A;  3EUH A;  3WTT C;  2EA4 A;  4I0A A;  4PGH A;  4F7Z A;  3GUD A;  1O7L A;  4LMY A;  3SFZ A;  2OBP A;  5IT9 Z;  3RYR A;  4GXO A;  1KU9 A;  3I0T A;  4XLP F;  2GA1 A;  1IXR C;  4ZZD A;  4IXA A;  3L00 A;  4GYG A;  4HOB A;  1FOK A;  1UFM A;  5TJJ A;  1KQ8 A;  5HVQ C;  1ZRD A;  3CO6 C;  3O6B B;  1S6L A;  4M72 A;  3V8L A;  1RUO A;  2V6C A;  3IRR A;  4ENN A;  2COM A;  4OIR F;  2QVO A;  1YS7 A;  3KZZ A;  4HBL A;  3RTR A;  5DCM B;  2WC2 A;  2UWM A;  4XRF A;  4B09 A;  2RV8 A;  2NYX A;  2A07 F;  4QWQ A;  3TOA A;  1W4M A;  2W25 A;  2XAG A;  4NB5 A;  1SFX A;  3DPT A;  2VON A;  4U0V A;  1OMI A;  4UVA A;  4WCG A;  2ZXJ A;  1R23 A;  3KCC A;  4L9T A;  2F5C A;  4RAY A;  3K1M A;  2STW A;  1BI3 A;  1DPU A;  1V3F A;  2XAF A;  1FC3 A;  2VE9 A;  3CUQ A;  4A5M A;  2YR2 A;  3KZY A;  4R1H A;  2WTE A;  3JAM K;  3SQN A;  3WU1 B;  4L5I A;  1ZG1 A;  1TBX A;  2ZNZ A;  2VE8 A;  2ZKZ A;  3GZ5 A;  1LB2 A;  1CF7 A;  1U2W A;  3SZP A;  4RGS A;  2FML A;  2GA2 A;  2ZJ2 A;  2QQA A;  2YPR A;  3HHH A;  3QU3 A;  1NHA A;  4MQ9 F;  5LHG A;  3GYH X;  2BYV E;  3GX4 X;  2XV4 S;  4P9U A;  2ADU A;  2ZO4 A;  3IRQ A;  1BIB A;  5E18 F;  3COA C;  4A0Y A;  1STZ A;  1IF1 A;  1X3U A;  4N0B A;  4G7H F;  2HQR A;  4UV8 A;  4UNO A;  4Y13 A;  5LEK A;  3WTU C;  2RGV A;  3DP7 A;  1F4K A;  2F5D A;  2QBY B;  2VBY A;  5CVV A;  4A6D A;  2ZFW A;  3C18 A;  2WV0 A;  1R1U A;  1YS6 A;  1TNT A;  2M5W A;  1WRJ A;  4AIK A;  1YW8 A;  1D5V A;  5CVU A;  3BP8 A;  3WTV C;  1R5G A;  1ZLJ A;  5AON A;  4M6Y A;  5D8K B;  4XLN F;  3KP5 A;  2OZU A;  1VTN C;  2DTR A;  1CGP A;  2HWV A;  3PQJ A;  4OMZ A;  4U7B A;  1W5S A;  2IW5 A;  5DD8 A;  2EFW A;  3J80 K;  1OYI A;  2RQP A;  1S7A A;  4A12 A;  1QQI A;  3T8R A;  2D45 A;  5HDG A;  3FWE A;  4ZZL A;  3F8C A;  5DCF A;  2QLZ A;  2VC1 A;  2JTV A;  2FE3 A;  2W24 A;  3ISP A;  5A2Q Z;  4HF0 A;  3N97 A;  5E1Z B;  2VBW A;  4L9J A;  1ZGJ A;  1EV7 A;  1O3S A;  1USS A;  1IRF A;  1ON2 A;  1UB9 A;  4I02 A;  2JRT A;  3P7N A;  2HOE A;  2ETH A;  2GWR A;  1P4A A;  2KIM A;  2MLG A;  2P4W A;  2E7X A;  2M87 A;  2BBY A;  1FX7 A;  3SZT A;  2FEZ A;  4YIF A;  4G9Y A;  2YSR A;  2F2E A;  3E3V A;  4EGZ A;  4KMF A;  4KIG A;  4E70 A;  2E1C A;  5ICC A;  5D5W B;  3E6D A;  4JBA A;  2V1X A;  4LLN A;  4EJT A;  4BYY A;  2DBB A;  5FO5 A;  3M8F A;  3TQN A;  3FMR A;  4ASN A;  2TDX A;  4MEY F;  2JSC A;  4Y17 A;  3LA3 A;  3DPL C;  4YFN F;  2KKO A;  1T39 A;  3ML6 A;  1LDJ A;  3DEU A;  2STT A;  5J6X A;  3ZMT A;  4BH9 A;  1FNN A;  1YTY A;  3DV8 A;  1IN6 A;  4IPA A;  4HYE A;  4IRH A;  4OIP F;  2O3F A;  2HYG D;  1LEA A;  3K2Z A;  1HST A;  3MQ0 A;  3CLO A;  4U88 A;  1YYV A;  1P2F A;  4I98 B;  1K7A A;  1WQ2 A;  3NRV A;  4BQA A;  4HLX A;  4EVI A;  3I54 A;  3QP6 A;  4N9H A;  1I5Z A;  3E6C C;  2ESN A;  1B6A A;  2VT2 A;  2ACJ A;  3GW2 A;  1IAW A;  3I4P A;  3KP3 A;  1D3Y A;  3JTG A;  1MJ9 A;  2O03 A;  2ZME B;  1I27 A;  1ZG3 A;  3P9K A;  2NS0 A;  1MJA A;  2K4J A;  2JZY A;  1GVJ A;  4UHT A;  3KP7 A;  1IRG A;  1SMY F;  3E6B A;  3M9A A;  4CZZ A;  1I6X A;  4AWX B;  4LD5 A;  1ZRF A;  3BJA A;  3L7W A;  3E97 A;  1XSD A;  2HKO A;  1TW3 A;  4IRI A;  5D5X B;  5ILU A;  1U5T A;  4OOI A;  3WTZ A;  3ABU A;  2QQB A;  1FYL A;  5LGU A;  1OR7 A;  1XGO A;  5LHH A;  3WG9 A;  2A61 A;  2DU9 A;  3U1D A;  1QNT A;  2IJL A;  3SXY A;  1W7P A;  1REP C;  3I64 A;  3F6V A;  2ISY A;  4S05 A;  2BEO A;  5LGN A;  4KDP A;  3H92 A;  4CGZ A;  4KIF A;  3ZMV A;  1ODD A;  3L09 A;  5E20 A;  4YFX F;  3RYP A;  1Z6R A;  3WE2 A;  4L18 B;  1ONV A;  1RUN A;  5DYM A;  2EFP A;  1R22 A;  5CVJ A;  3F22 A;  5FLX K;  1FBU A;  4ON0 A;  5LEJ A;  5L3F A;  1BOA A;  2OA4 A;  2PQ8 A;  3DF8 A;  1UHW A;  4A6E A;  3QOP A;  2V1D A;  2H94 A;  4YII A;  2HQN A;  4DQ2 A;  1IN7 A;  1RNL A;  3IWZ A;  4RAZ A;  1S3J A;  1LDK B;  4ZYE A;  2CYY A;  1RZ4 A;  5FD5 A;  3D5L A;  2PBI A;  4CHU A;  1P6R A;  4Q47 A;  1FYK A;  3E5X A;  2V1U A;  1JXS A;  3EYY A;  4BHP A;  1D8K A;  3WTY C;  1XSX A;  1U3E M;  3R60 A;  4FX0 A;  1XGN A;  5AIQ A;  1P4W A;  4XSZ F;  1BI2 A;  2XKP A;  1F1Z A;  2VOO A;  3GFJ A;  4GGG A;  1BI1 A;  5D6E A;  1KU3 A;  2ZME A;  2PI0 A;  1FLI A;  3DKW A;  1HQC A;  4Q48 A;  2L54 A;  3V7S A;  5CJ9 A;  4S04 A;  2EWN A;  3RKX A;  5DV5 A;  2ZBK A;  2RN7 A;  3HTU A;  2XRN A;  5D8L B;  2EK5 A;  1R1T A;  1IN5 A;  1I1G A;  1FWZ A;  1R00 A;  3FXQ A;  1Q1H A;  1TLH B;  2Z5U A;  2IA1 A;  1B9N A;  4PZJ A;  3BOQ A;  3M7G A;  3FM3 A;  3ERE D;  5K5R A;  3FM5 A;  4KN4 X;  3JAM Z;  5JR3 A;  4ENJ A;  4RB2 C;  5D4S A;  1XB4 A;  1ZLK A;  4WK8 F;  1PDN C;  3P9C A;  5HLI A;  2BV6 A;  1WKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...