1ZG1A

Narl complexed to nirb promoter non-palindromic tail-to-tail dna site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
b'RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*GP*TP*AP*CP*TP*CP*CP*TP*TP*AP*AP*TP*GP*GP*GP*TP*AP*
publication title Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 22
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zg1A00
1YQAA 4HQEA 2FF4A 4I98B 2IP2A 1QZYA 3L09A 3SQNA 2HGCA 2V79A 1LDDA 2QBYA 3M9AA 4FX0A 1MGTA 3QRFF 1FPQA 4L0YB 5BMZA 4CHUA 3MZYA 4ENMA 2FMLA 3I5UA 1G3YA 4U0WA 4XLNF 1XGSA 4EGZA 5E17F 1R00A 3P9IA 1UCRA 4ESBA 1LQ1A 3DPLC 2CGPA 4LJZF 4IHTA 1PUEE 5D8LB 3E5XA 1ZRDA 1I27A 1P2FA 4R1HA 5E18F 4Q5SF 5JR3A 3ZMDA 1VTNC 4Y17A 2GXBA 2QM3A 3QP5A 4RGRA 1D5VA 2HFHA 1KA8A 1IW7F 2V1XA 1ZARA 2RNJA 1DPUA 3FMRA 5DCFA 2MC3A 1T2KA 1FBUA 2O03A 2PQ8A 1W4MA 1X3UA 1T98A 4AIHA 2P4WA 4ETSA 3E6DA 4YIIA 5E1ZB 1ODDA 1ZGAA 4M6XA 2EWNA 3TOAA 4HV6A 3B73A 4I02A 3RDIA 1KYWA 1YLFA 1ZREA 1AOYA 1J75A 2X4HA 1OPCA 2ADUA 1J7KA 6PAXA 3DV8A 2VODA 5LEJA 2EK5A 2A69F 2M30A 1KU9A 4JQFA 2A6HF 4A0XA 4RB1A 5D6FA 2EFNA 3R6SA 5L3BA 3V7SA 3IHUA 3R4KA 3L00A 4MNUA 1J9IA 2IRFG 2V6CA 1W7PD 1HW1A 2ZBKA 2A5YB 5K5OA 1W7PA 1O3QA 2HOEA 2JRTA 4Q48A 1ZHFA 2OQGA 2JTVA 2FSWA 3K1PA 1MDMB 1ZG3A 1XDSA 1O3TA 2XIGA 2QQAA 2HQRA 4GYIA 4MQVA 4UVCA 2HYFA 1K78B 5CYVA 2H27A 1B9MA 2RC4A 3BJ6A 5K5QA 1Z9CA 2UWMA 3WTVC 3LA2A 1CF7A 1KQ8A 1HBXG 1XSDA 3KP4A 2VE9A 4MQ9F 4LG0B 1BM9A 1FYKA 3HOSA 1PDNC 3NEUA 1SMYF 3DKWA 4EM1A 3EYIA 5DCMB 2XAHA 2HTSA 4PGGA 3RYRA 1YIOA 5L3FA 3J80K 5HS8A 4IRHA 1ZLKA 2KIFA 3FXUA 3KP5A 2P6TA 3KLOA 2DQRA 2K27A 2RVCA 2P6SA 4PDKA 2FA5A 1G3TA 2HKXA 4OOIA 5D5VB 1XD7A 1WRJA 4XRFA 1MJAA 2D2WA 5CVJA 3JAMK 1JXSA 4L9JA 4KT5C 5F1RA 2ZXJA 2M87A 3CLOA 3FXQA 2W57A 2RQPA 4HQMA 1LB2A 4MEYF 5FGMA 4OIOF 3R60A 2B0LA 4YG2F 2XUBA 4JBAA 1ZG5A 1U3EM 2KJBA 1Z7UA 2E7WA 4HX8A 1IN4A 4EM2A 2FQ3A 2PBIA 1U5TA 3HUGA 1YYVA 1ZGJA 2GA1A 4HX7A 1U8RA 3F23A 1ON1A 2E1NA 1P4XA 2Y48A 2QVOA 3TDUC 5E1XA 2PJPA 3BPVA 2ISYA 1HKSA 1Z05A 2PFBA 1JGSA 2NNYA 4I01A 2DLLA 3LQRA 3WG9A 5CVUA 4P96A 1BI2A 1U78A 2G7HA 4A2UA 3BWGA 3M8FA 2IW5A 2YSRA 3GEZA 2RGVA 4UHTA 5HDKA 1S29A 3KP3A 1T0FA 5H6RA 1R23A 1SMTA 4B09A 3GZ5A 2FNPA 2DPUA 4L5JA 1Z6RA 3EUHA 5BPDA 1BI0A 2EFQA 2C6YA 1R1UA 2VBWA 3P9CA 3WTZA 4N9HA 1HSTA 2F5EA 3I53A 1SD4A 4WK8F 1DPRA 1ZH5A 3ROUA 3HHGA 5E1WA 3J81K 1J2XA 1RZ4A 1G4DA 3IKTA 1IZ1A 2DI3A 1FSEA 5LGTA 3IRQA 3F72A 2NAZA 1YG2A 1DP7P 3WE3A 4WWCA 2X0LA 3T0YA 3R0AA 4KIBA 2RDPA 4ZZDA 5DD4A 1FSHA 4E70A 1BIAA 3T8RA 5AONA 5F6FA 5D5WB 4OU0A 1ZG1A 1O7LA 3HHHA 4EMSA 3TOBA 1RI7A 2VC0A 3KZZA 4FT8A 1QGPA 3BY6A 2LDUA 5CLSA 1R1VA 5DUIA 2D1VA 4XSZF 2M5WA 2V1DA 5CVVA 2DFIA 4P5OA 2WV0A 3RTRA 1I5ZA 1LNWA 5KK1A 3KFWX 4KN7X 3MEXA 4TV7A 3GFMA 2YR2A 2NYXA 2NNNA 3GF2A 1D8JA 2D45A 5IT9K 1KU2A 3K1NA 2V1UA 1WQ2A 4RGXA 1F9NA 1WWXA 2H09A 3CUOA 3ZMSA 1Y0UA 4NQWA 5HDNA 2XV4S 2EV5A 3CUQC 1FZPB 3VOEA 1R22A 2GA2A 2P7CB 1BJAA 2XAGA 4OIRF 1IN6A 4A5MA 3BZ6A 3WGGA 1FNNA 4RB2C 4UXNA 5LRRA 2OZUA 4HZFA 1IXSB 5HVQC 3J7AO 3HRSA 2YPRA 4K2EA 4M72A 5FFXA 3N97A 2A07F 1H9TA 4BAYA 5ICGA 3E6CC 1FX7A 5DEQA 3J80Z 5BQTA 2JT1A 2KIMA 1W5TA 2QBYB 1USSA 3MQ0A 4MTEA 4M9XA 3M7GA 4MEXF 4ESJA 1P6RA 3EQLF 5ILUA 2LF8A 4HX4A 4KIGA 3R61A 5CVRA 1NHAA 3WU0A 3E6MA 2VBZA 1ZLJA 3JAMZ 2FOKA 1KGSA 2CW0F 1FWZA 1G3SA 4CO8A 3ZPLA 2QENA 2O8XA 3FHZA 1P4AA 1D3YA 5D5XB 2K4BA 2O0YA 1IN7A 1SD7A 5L3EA 2JPCA 1G6NA 1R7JA 3LAJA 3K69A 5JI6A 4ESFA 1R5HA 1MD0A 3K0LA 2NS0A 4N0BA 2GAUA 2KJCA 1BN5A 1LJ9A 3Q9SA 1Z6TA 3V8LA 2FBIA 2XASA 1T6SA 3TDZC 5L3DA 2PLYA 1REPC 3B02A 2FMYA 4HAMA 3D5LA 3ZMVA 1LDKB 3I58A 3F21A 5LEKA 2DK5A 1FBQA 2OD5A 3E5UA 4BHBA 1XMKA 3GO5A 2BGCA 3ZN0A 2A3SA 3K1MA 1RUNA 1MJ9A 4U7BA 3KEOA 1OYIA 1T39A 5F64A 1S8NA 1ULYA 3WTXC 1S7AA 4IJAA 3IRRA 1TTYA 2BV6A 3HRUA 3HOTA 4Y13A 2VN2A 4LLNA 3I71A 4ENJA 2VT2A 1EH6A 4BQAA 2EFOA 4WX9A 2QZ8A 2EA4A 2QUFA 3I59A 3KEQA 1UFMA 2XAJA 5FD5A 4HV5A 1R36A 3U9GA 1TNSA 3P9KA 4ENNA 4HYEA 2FBHA 1JHFA 2EV6A 5CVIA 1U2WA 5AIQA 2OU2A 4ENKA 3RKYA 4AIJA 3J81Z 4KMUX 1PP7U 1W7PB 5FD6A 3F22A 2Z3YA 1L0OC 4XBFA 4EJVA 3ELKA 3REOA 1Z1DA 3E3VA 2Q2EA 4A6DA 1G3WA 4B8XA 2LNBA 4UV8A 4OMYA 1KYZA 3BPXA 5K5RA 1FBSA 3T5XA 2E1CA 2IA0A 2A68F 4LLLA 3RYPA 2XROA 4KMFA 3FM5A 4G7ZF 3U1DA 4KYWA 2F5CA 1HSJA 1STZA 1V3FA 2FNAA 1F4KA 2R7FA 4HDVA 4EGYA 2Y0MA 1J59A 4JK1X 4GO1A 3NQOA 3WGIA 1O57A 2HDCA 1CF7B 2FBKA 2RV8A 2XAQA 2VE8A 3VODA 2QQBA 5DUKA 1BI3A 3VFZA 4HBLA 4KNYA 3BP8A 1WSUA 4LD5A 5IT9Z 1YW7A 1K6OA 2R7DA 2K02A 4WF2A 3IWZA 3V7RA 1K79A 3EYYA 1HKTA 2Z9OA 1B9NA 4M6YA 1HKQA 3F8MA 3KLNA 4CGZA 3VEPA 3PFIA 3JSPA 3M8EA 4BNCA 4S04A 3H92A 1FOKA 4LB6B 4PGHA 3C1DA 5LHGA 4OIQF 4KUMA 1T38A 1IAWA 3I64A 3GFLA 2P8TA 2ISZA 4I0BA 4G6QA 4P9UA 1EH8A 4BXUA 1XSVA 1YTYA 2PI0A 5EEGA 3LSTA 4N9IA 3KETA 3CJNA 3NRVA 1KQ9A 3PQKA 2J5PA 3ABUA 3CTAA 3W6KB 1U5TB 1YW8A 3WTSC 3HRMA 4OMZA 4A6EA 4NB5A 5FO5A 4ZYDA 5JHUA 1YFHA 3BDDA 4MHGA 1FP2A 3V8KA 3W6JB 1RIOH 1EV7A 5LHHA 4P55A 5FLXZ 4U0YA 3WE2A 2ACJA 5E20A 2H94A 1C0WA 1F5TA 4HOBA 1F1ZA 3PQJA 2OBPA 5D4RA 2ZO4A 2BYVE 2Z33A 3F8BA 2ZKZA 4AVPA 1FYMA 4O5VA 3GXOA 1QNTA 2QQ9A 1TNTA 4U88A 1LEBA 3FMQA 2UXNA 2XRNA 1ON2A 3CUQB 3FMSA 1RNLA 1IN5A 2VBXA 3GW2A 4EJWA 2DU9A 4YFKF 3CUQA 3FX3A 4M71A 1AWCA 2LSOA 2PMHA 3L7WA 3WTTC 3GWZA 1J0RA 5AIPA 1H0MA 4EQQA 3QPTA 2ZMEA 3O2PE 2ETHA 4KDPA 1ZAOA 4EV0A 5ILSA 1TBXA 4IVNA 4HLYA 4GGGA 3ZQ7A 4ZYGA 3IWFA 3ZMUA 3GVAA 2CFXA 2AS5F 4DQ2A 5HS9A 1YS6A 4EVIA 3MZHA 4FHTA 3FM3A 4Q47A 3V8JA 3TO7A 3E5QA 5ICEA 2VONA 1UHMA 2DW4A 4IRGA 4UVAA 4DNCA 1JE8A 5LGUA 1IXCA 3HSFA 3LQQA 1HXDA 1Z91A 2WTEA 4QLCU 2AXLA 3H3ZA 2GXGA 4PZJA 2V9VA 4Z2YA 2D1HA 3TKYA 4D0PA 3EETA 4HDUA 3D0SA 3IL2A 4G7OF 1BBYA 1J5YA 3GZ6A 1XGMA 2P5KA 3V4GA 2DPDA 2GIVA 2FXAA 1XN7A 1IN8A 1TQIA 4Q4ZF 3F6VA 4G6DA 3BJAA 5HLGA 1SFXA 1TW2A 3RKXA 3ECOA 5LGNA 4I2OA 2H6CA 4RAYA 2YU3A 5L3CA 3ERED 2G7UA 4AIKA 3OOPA 3EDPA 2L01A 2XKOA 2XAFA 3RKWA 1OKRA 3QAHA 2STTA 3KP7A 2Y75A 2L54A 2OAZA 4EJUA 2XHKA 5D6EA 3G73A 3HYIA 2L4MA 3KP2A 2YX7A 2BEOA 2RKHA 4U0VA 5K1YA 1XCVA 2HZTA 3HSEA 3K2ZA 5ERIA 3HSRA 1O3RA 1I6XA 2HTJA 2UXXA 4P9FA 1XGOA 4M74A 3WODF 3ZMTA 3HRTA 5J6XA 1S3JA 3BJOA 1A04A 3ML6A 5DD8A 4HA8A 5D4SA 4LLGF 3CO7C 2ZCWA 4RS8A 3FWEA 5ICFA 5BOXA 3I4PA 1ZRCA 3Q5FA 1U6GA 1V4RA 2QLZA 3F6OA 4G94A 1DUXC 3IKVA 1W5SA 2PMUA 5FLXK 1I1GA 3RPUA 2P5LC 1ZYRF 5LBQA 5E8IA 1HW5A 2W25A 1K7AA 2VOOA 2FE3A 2W85A 3SZTA 2F5FA 2PEXA 2L4AA 4G9YA 4RB0A 2ZNYA 2OQRA 3RJPA 1YS7A 1WI9A 5FB2A 3DFGA 3FZVA 4H0EA 3C18A 2VT3A 3WGHA 1UHWA 1O3SA 2ZFWA 3F3XA 2M8EA 4ZZLA 2STWA 1UB9A 3ZN1A 2BE5F 1O7FA 4BH9A 4ON0A 2QWWA 1XMAA 5IT3A 3F8NA 2G9WA 1QQIA 2W24A 1P4WA 1SD6A 1LDJA 1FT9A 2O3FA 3MAJA 2H6BA 4HF1A 3WU1B 3E97A 4QWQA 3JW4A 1OYYA 1RUOA 1FP1D 2HKOA 5J8FA 2XKPA 3F8CA 1WKMA 4F7ZA 1KU7A 2UZKA 2QYOA 2W84A 2IVMA 3VB2A 3TGNA 4KIFA 3JTGA 1YO5C 3I59B 2LF7A 2EJRA 2HYGD 3CDHA 3AAFA 1XCBA 1BC8C 4M9ZA 3ULQB 3I0TA 4O3MA 2VOPA 2TDXA 4XSXF 2HS5A 3LWFA 5H20A 4EJTA 1GXQA 3LAPA 2JSCA 3FF5A 4O6JA 3KE2A 4IHSA 1H9GA 5TJJA 5ILVA 2COMA 4L9TA 3BROA 2HEOA 2DK8A 3HTUA 1BOAA 3RI4A 2IT0A 3Q9VA 4S05A 4MGRA 2YX4A 1GXPA 1OMIA 2FU4A 2ELHA 2F2EA 5JVTA 5DDGA 3V7CA 3GYHX 3CO6C 1YW9A 2CWEA 4KICA 4OINF 3COAC 5E8GA 3DQVC 1IRFA 1JHHA 2Q0OA 4GXOA 2CQKA 2K7LA 4A5NA 5DYMA 4A0ZA 2XVCA 2CSOA 1FLIA 5DV5A 4CDGA 4I09A 4CICA 3SXYA 3DP7A 1MDMA 1XGNA 3GFIA 1QBJA 3ECHA 3BOQA 3ISPA 5BPIA 1KQ0A 1OYWA 1GHCA 2VC1A 4KN4X 2VXZA 3DEUA 1K78A 3E6BA 4MTDA 1KU3A 1IRGA 4WXHA 4ASNA 1TLHB 1B4AA 2CO5A 2WC2A 3KZYA 5A2QK 4R79A 1HW2A 4CZZA 1QZZA 2DT5A 1R1TA 2M1BA 4A0YA 2EV0A 3TO6A 1S6LA 1E17A 4ZYHA 4LG0A 4IRIA 5DCMA 4GYGA 2GWRA 2MH2A 2EFWA 2RN7A 3WTYC 4I0AA 4CYDA 1FYLA 2NRAC 1SAXA 2EFPA 3O6BB 3GX4X 5CJ9A 5HLIA 3LA3A 3ABTA 2IPQX 4A12A 2GZWA 2KRFA 3OV8A 4AWXB 4UV9A 2O6GE 4L9VA 3C7JA 2ESHA 2OZ6A 2R3SA 4EJOA 3L2CA 1HQCA 2MD5A 2Z99A 4HLXA 4UVBA 2CYYA 1BIBA 2VBYA 4CXFA 2HWVA 4FX4A 5HOOA 1USTA 3N4MA 4G7HF 4GCVA 3K9TA 4HW0A 2IJLA 2FRHA 2A6EF 1B6AA 1P92A 2Q8KA 4YFXF 5H6QA 5KVRA 2DQLA 3SHFA 2E7XA 3T1BA 2P5VA 3GUDA 5LRSA 2EA2A 2FEZA 3S2WA 4KFCA 2F5DA 2K86A 3RPQA 2MBFA 1B59A 2KKOA 2BBYA 1DDNA 3O3KA 5EEHA 2ZMEB 4PCQA 1IF1A 1D8KA 2A61A 3KP6A 4YIFA 1I1SA 3WTWC 1Q1HA 4IPAA 3ZP5A 2O61A 2IA2A 2P7VB 3JSOA 2MLGA 1LEAA 3DF8A 3L9FA 4ZH4F 4LMYA 1E2XA 2DO7A 2DAOA 3QU3A 2MLKA 3IC7A 4L5IA 3QP6A 4IXAA 4L0ZB 4RGSA 4EM0B 3QU6A 3MCZA 1MJBA 2JPBA 5HLHA 2GQQA 4NHJA 4HF0A 2K4JA 4M9SA 2MA3A 3I54A 4BHCA 1BI1A 3QOPA 2DBBA 2M45A 1SFEA 2LKPA 1SFUA 3M1EA 2PG4A 4L18B 3F8FA 2XGXA 3T8TA 4BHPA 3G3ZA 1FC3A 2IA1A 1B1BA 2ESNA 2Z5UA 1XB4A 2ZNZA 1R58A 4IF4A 3SFZA 4LK1F 3TO9A 5BS6A 3MFKA 4I7HA 2HR3A 1TQMA 4ZYEA 5ED4A 2HQNA 1U5TC 1SD5A 3LFKA 4WXCA 3DPTA 4M73A 2ZJ2A 5D5UB 1L3LA 3GLXA 2OA4A 4RAZA 5ICCA 4WXDA 1ONVA 1EH7A 5TRDA 1FY7A 4AD9A 2CG4A 3MWMA 1XDUA 5JFRA 1TQPA 3SZPA 4XLPF 1QO0D 2JZYA 3U2RA 3JTHA 1LVAA 2L3DA 1QPMA 4G8XA 3WTUC 4UUVA 3H3UA 1S7OA 1MKMA 5J8CA 1R5GA 1BC7C 1IXRC 4LK0F 4YFNF 4LGWA 2WWYA 5FFZA 2EB7A 1GVJA 4OIPF 4UNOA 1PP8F 1ZRFA 4KA4A 4R8HA 1IUYA 4U7DA 3R0JA 3HIFA 3KCCA 2KIUA 4L9NA 4WCGA 4RB3C 3DXJF 5A2QZ 4Y15A 3RIRA 3FXRA 4LB5A 5LHIA 4HF2A 3P7NA 2PN6A 3C3WA 5HDGA 4RGUA 1OR7A 2DTRA 3TQNA 5HS7A 2MH9A 3ZMZA 2J5OA 4LFUA 1MZBA 3QPHA 1TW3A 2L02A 1XSXA 1CGPA 3HTSB 3LA7A 5D8KB 1ZN2A 5L3GA 5LLQA 3GFJA 4BYYA
chains in the Genus database with same CATH superfamily
4ZC3A 1YQAA 4ZDOA 3HOUJ 4HQEA 2FF4A 3QQAA 1S9HA 3A0BC 4I98B 2IP2A 1QZYA 3L09A 4DBQA 4HG2A 2ZXHA 3SQNA 1MBJA 2HGCA 5JVGF 1SC7A 2LLKA 2V79A 1LDDA 5M3FJ 2QBYA 2JMWA 3M9AA 3CCEI 1K6YA 2MC4A 4FX0A 1VQPI 1MGTA 1JKQC 3QRFF 1FPQA 2X6OA 3MMYB 4GRIA 4L0YB 5BMZA 2GIZA 4NDLA 4CHUA 3MZYA 4UB6C 4ENMA 2H1KA 1MMSA 3GBGA 4E7HA 2FMLA 3I5UA 5F04A 2R7XA 1G3YA 2R7QA 4U0WA 1XGSA 4XLNF 2KDZA 4ANJA 4EGZA 1TT5B 3CLQA 2Y30A 4BDZA 5E17F 1R00A 3P9IA 4DYCA 1WJBA 4Y3OA 2HPIA 1UCRA 4ESBA 4XONA 1HDDC 1LQ1A 1JJ8C 1H89C 2NVTJ 2WBMA 5E3LA 3DPLC 2CGPA 4LJZF 4IHTA 2XF6A 1PUEE 5D8LB 5B5EC 3E5XA 1ZRDA 4YIRX 2ID3A 1S5LC 4G6TB 2IGNA 4Y33A 1I27A 2XF7A 1P2FA 4R1HA 4C30A 5E18F 2X6XA 2F48A 5FRMA 4QPOA 4Q5SF 5FKLA 3S16J 1JTYA 5JR3A 3ZMDA 4CCJA 3P5JA 3V42A 5DS9A 3PIOF 1VTNC 2Q1ZB 2L9RA 1LFBA 4Y17A 5EGOB 2QM3A 2GXBA 3MZ8A 1MIJA 2ECCA 3ZQCA 3QP5A 1W5CC 1D0XA 4RGRA 3SYTA 1D5VA 2HFHA 1KA8A 1IW7F 1OCZH 2V1XA 1Y56A 2I10A 1TWGJ 4BACA 2OTLI 1ZARA 2RNJA 1D1BA 4CCOA 1DPUA 5KCMA 5FJ8J 3FMRA 1UAAA 4RA2A 3HOYJ 5DCFA 2MC3A 4M3DA 1T2KA 1X1PA 3GMEA 4I99C 1FBUA 1YX3A 2O03A 2PQ8A 3FKJA 1W4MA 1X3UA 1T98A 2OC6A 2LY1A 4AIHA 2BY3A 2P4WA 3GTJJ 1X58A 2LTPA 4ETSA 5HODA 3E6DA 2CS3A 4YIIA 5E1ZB 1ODDA 1ZGAA 1I50J 4M6XA 2EWNA 3BLYA 3TOAA 2FX0A 4HV6A 1TP4A 3B73A 4I02A 3RDIA 4PJJA 1KYWA 9ANTA 1YLFA 1ZREA 1SFOJ 2VQLA 1AOYA 3H0DA 1J75A 2X4HA 1D5YA 1OPCA 2ADUA 3A2KA 4PFOA 3LSIA 3BR2A 3HEFA 1RKWA 1J7KA 4PFPA 6PAXA 3LOCA 3DV8A 2VODA 1Z3YA 2LFBA 5LEJA 1ZKGA 2EK5A 1VQ6I 2A69F 3CD6I 2M30A 1KU9A 3GZNB 1JKOC 2R0QC 1VQMI 4JQFA 2A6HF 4PK4A 4A0XA 3OYCA 2XPWA 4XRSA 4XK4A 4RB1A 1JT0A 5D6FA 3DKYA 4F92B 1J09A 2EFNA 3R6SA 5L3BA 1MMAA 2ELJA 3IHUA 3V7SA 3X2QH 3R4KA 3L00A 3VDXA 1MSEC 4MNUA 1J9IA 3DEWA 2IRFG 2V6CA 1W7PD 1HW1A 4JX4A 3HOZJ 1VQKI 2EBIA 3PUBA 4YRVA 2CU7A 1OCTC 2ZBKA 2A5YB 5K5OA 1W7PA 1O3QA 2HOEA 4QSHA 5F27A 2Y9YA 2JRTA 3I3LA 4Q48A 2WAQA 1ZHFA 1FIAA 1Y6IA 2OQGA 4JP0A 5F1JA 4M3FA 3ZQQA 4AIDA 2JTVA 1Q1VA 1WH7A 4RM3A 4AU7A 3OYHA 1JKPC 1UELB 2FSWA 3K1PA 1MDMB 1ZG3A 1XDSA 2FJ1A 1O3TA 2R4GA 3VYRB 2XIGA 1UJ8A 2QQAA 2HQRA 2OV7A 5LFAA 4BS9A 3OYMA 4XLHA 2LP0A 4GYIA 4MQVA 4E7JA 2WA0A 3G1MA 1EF4A 4UVCA 2HYFA 1K78B 2RREA 1FOXA 2L9SA 3QOEA 1SFKA 5CYVA 4IO9F 4BDYA 2H27A 1B9MA 3HOVJ 1W36D 2CUZA 3FXKA 1TWHJ 2RC4A 3TP0A 2CW7A 3BJ6A 5K5QA 3TL4X 1Z9CA 1XC5A 1QA6A 2UWMA 4F52A 1ETQA 5F0FA 5JLXA 3WTVC 2EH3A 2EIJH 2TRTA 3QPLA 3TMOA 3LA2A 3VYTB 2LC2A 2LBFB 5K7HA 5B66C 1CF7A 1KQ8A 1HBXG 2ZSHB 3TW7A 2L9NA 1YOVB 1XSDA 3KP4A 1OCRH 2VE9A 4MQ9F 3GTLJ 3HGGA 4LG0B 3ABLH 4LG3A 5EYRA 1BM9A 4A93J 1FYKA 3HOSA 5J1YA 3NEUA 1PDNC 1SMYF 3DKWA 4EM1A 5TISC 3EYIA 5DCMB 1A31A 3OL3A 2XAHA 4X6AJ 3DLLF 2LH9A 2GOXB 3S3NA 4D7MA 3HC7A 2HTSA 3KYDB 4PGGA 3RYRA 5FLVA 1QVTA 1YIOA 5L3FA 2XPUA 4FQGA 2E2IJ 3HG9A 3J80K 2XRLA 2NVUB 1BOBA 2IS6A 3DU5A 5HS8A 2K85A 3CF2A 2CQ7A 5KAFC 3GTKJ 2CMPA 3MVPA 4Y4RA 2MFZA 2CUJA 4IRHA 3CMYA 1BJZA 1ZLKA 2KIFA 2EPFA 3FXUA 4BQNA 2L2OA 3ZXSA 5J1UA 3KP5A 2P6TA 3KLOA 2DQRA 2K27A 4NUBA 2RVCA 2P6SA 4QTRA 4PDKA 2FA5A 1G3TA 2HKXA 4OOIA 1W0UA 2VJ4A 5D5VB 2DYRH 2BVMA 1WRJA 1XD7A 2E1OA 4XRFA 4XLFA 3K4MA 1F36A 1MJAA 2D2WA 3OIPA 2IS4A 5CVJA 5J3LA 3JAMK 4PJNA 2WAQN 2AQEA 1JXSA 1T8IA 2DYSH 2XAUA 3DWLE 4L9JA 4KT5C 4A3EJ 3CC2I 5F1RA 2ZXJA 2M87A 3CLOA 3FXQA 2MD0A 2W57A 2RQPA 5GTIC 3W2VA 4HQMA 1LB2A 4MEYF 5FGMA 4OIOF 2QKMB 1T95A 2F4OB 1FMVA 2B0LA 3R60A 3PFYA 2XB5A 4YG2F 2LR8A 3IAM2 1FTZA 2XUBA 1YRNA 4JBAA 3VYSB 3HOXJ 1ZG5A 1RR7A 2MG4A 2M0MA 1MBKA 1U3EM 2QSGX 4J19A 2KJBA 3HDDA 1Z7UA 2E7WA 4HX8A 1IN4A 2DMPA 2W48A 5CPRB 1IUFA 4EM2A 2FQ3A 2IGOA 1WJDA 2PBIA 4RLFA 5IOYA 2XGEA 1U5TA 5C4JJ 3HUGA 3LSRA 1YYVA 3HZJA 2KRCA 5F0CA 3OS2A 1ZGJA 2GA1A 4HX7A 1U8RA 3F23A 1ON1A 2E1NA 1P4XA 3A01B 5EEAA 4B44A 2PX9A 5IP7J 2X6WA 2Y48A 2QVOA 2ZJRF 3TDUC 3OY9A 5E1XA 4JYKA 1Z77A 2PJPA 2R7ZJ 3QODA 3BPVA 3UKGA 3H9GA 4QPQA 3DTEA 2ISYA 1HKSA 1QHHD 1Z05A 2PFBA 3HB9A 4H4KC 1NK2P 1JGSA 2NNYA 4I01A 2DLLA 3LQRA 3Q0WA 3WG9A 3BQYA 5CVUA 4P96A 2E5ZA 1BI2A 1U78A 2G7HA 1Z3XA 4A2UA 3BWGA 3M8FA 3DBHB 2IW5A 2K9MA 2YSRA 4NBQA 4UB8C 3GEZA 3H3VK 2M34A 5DTDA 2RGVA 4UHTA 2M2EA 5HDKA 3S15J 1S29A 3KP3A 1T0FA 4BUPA 3AL0B 5H6RA 1R23A 1SMTA 4B09A 1FOYA 1VQ5I 4ZTJA 2KLOA 4BE2A 3GZ5A 2FNPA 2DPUA 1BW5A 3K4KA 4L5JA 1E3HA 1Z6RA 3EUHA 5BPDA 1BI0A 3JR9A 2Y9ZA 2EFQA 2C6YA 2JN6A 2KT0A 1R1UA 2VBWA 5EZHA 4IZZA 4V2GA 3P9CA 3WTZA 4DOZA 4N9HA 2LYCA 1HSTA 1PJRA 2F5EA 2V9KA 3CCYA 3I53A 5IYCJ 1SD4A 1MMNA 4WK8F 1DPRA 1Y39A 1WH5A 1ZH5A 1VQ9I 2I8DA 1OCPA 2MABA 3ROUA 2QSFX 3HHGA 5E1WA 3J81K 2ZXWH 1I3AA 1J2XA 1RZ4A 1G4DA 2IGMA 3IKTA 1IZ1A 2DI3A 5EG0A 1FSEA 1GV5A 4XNFA 5LGTA 3IRQA 2JA6J 3F72A 2NAZA 1YG2A 1WCMJ 2L5QA 1DP7P 3WE3A 4WWCA 4IOAF 2X0LA 4DZPA 3OYAA 3T0YA 3R0AA 2NOGA 4I6ZA 4KIBA 2RDPA 3N05A 4ZZDA 5DD4A 1FSHA 4E70A 1BIAA 3T8RA 2P0WA 4PJLA 2K3FA 1RR8C 5AONA 5F6FA 5D5WB 4OU0A 4HRIA 2DOEA 2E34A 2VB6A 1GT0C 1ZG1A 3L2WA 1O7LA 2OPTA 4XN3A 3HHHA 4EMSA 1R4MB 3CP2A 1RI7A 3TOBA 2VC0A 3KZZA 2BHZA 4FT8A 1QGPA 1TL8A 2HDWA 2IS2A 3SEZA 2JJ7A 1X2NA 2LDUA 3BY6A 1HC8A 5CLSA 1R1VA 5DUIA 1FOWA 4CYCB 2HI3A 1CQTA 4II2A 5LD2C 2D1VA 5M5XJ 2JA7J 2V6EA 4XSZF 4XKWA 2M5WA 3E0JB 1EJ9A 2V1DA 5CVVA 2VXDA 2JWTA 3L2RA 2Z2SB 2DFIA 4P5OA 2WV0A 1H88C 3RTRA 1I5ZA 1ENHA 1OFCX 1LNWA 4HNTA 5KK1A 3GCMA 3KFWX 2BW3A 4KN7X 3MEXA 4CA0A 1SEUA 2QKLB 5FKOA 4TV7A 3GFMA 1V5EA 4CCMA 2YR2A 2NYXA 1RESA 2NNNA 3GF2A 1D8JA 2D45A 5IT9K 1FTTA 1KU2A 3K1NA 2V1UA 3BCAA 1WQ2A 4CSWA 4ZJZA 4RGXA 1F9NA 1WWXA 1VFCA 2DMQA 3RQIA 2HQ5A 1ORKA 2H09A 2H8WA 3BZCA 2F4MB 1Z0XA 4XMYA 4E7SA 2XDVA 3CUOA 3ZMSA 1Y0UA 4NQWA 3JRHA 5HDNA 2CH0A 2XV4S 3VPRA 2EV5A 2DDBA 2IGKA 3CUQC 3FXLA 1FZPB 3VOEA 1R22A 2GA2A 2ME6A 3ZQHA 3H36A 3RZDJ 1BJAA 2Y2ZA 2P7CB 5H2FC 2XAGA 4OIRF 1XPXA 1IN6A 4A5MA 3BZ6A 2ZMEC 4DBRA 2HOTA 3WGGA 1I6HJ 4X0GA 4IHYA 1FNNA 4A3LJ 4RB2C 4UXNA 4U87A 5LRRA 2OZUA 2VASA 2X1CA 3FXJA 4HZFA 1IXSB 2VQGA 1SVOA 4FE7A 4D9JA 5HVQC 2K9NA 3J7AO 1LE8B 2PJRB 4B3XA 2WY8Q 3HRSA 2BVLA 2QSHX 2YPRA 4K2EA 4M72A 5FFXA 2LKXA 3N97A 2A07F 5CQEA 3KZIC 1H9TA 4BAYA 1OJLA 3E7LA 2X9DA 1FX7A 5ICGA 1SVMA 3E6CC 5DEQA 2MW8A 5BQTA 3J80Z 2ZSIB 2JT1A 1S72I 2VKEA 2KIMA 3K4NA 1W5TA 2EQRA 5BNGA 2QBYB 1BA5A 1USSA 4F91B 3MQ0A 2LREA 4MTEA 2DT7B 3BTIA 5KHDA 1ETVA 2GOMA 4M9XA 3M7GA 5J40A 2LD5A 4ESJA 4MEXF 2KISA 3W6VA 1YE9A 1P6RA 3EQLF 5ILUA 2LF8A 2A05A 4HX4A 1A6QA 4KIGA 1V55H 2Y0SA 4HSTA 3R61A 5CVRA 3RPUD 2DMUA 3RSNA 2EZIA 4A69C 4XORA 3MKLA 3S1RJ 1NHAA 3WU0A 3E6MA 2VBZA 1WJ5A 1ZLJA 3KYLA 3JAMZ 2FOKA 3CMMA 1KGSA 2ZC2A 2DA2A 2CW0F 1FWZA 1I39A 3S3OA 1G3SA 3G1OA 4CO8A 3LSMA 3H5RA 4S0HB 3ZPLA 2NOJB 3JRBA 2QENA 4PUSA 4L5EA 2O8XA 2DODA 2X48A 3FHZA 1P4AA 4HSRA 1D3YA 2CQXA 2JSPA 3VWBA 5D5XB 4Y52J 1BW6A 2K4BA 2LOOA 3RKQA 1MSFC 2O0YA 1IN7A 1SD7A 5L3EA 5M5WJ 2JPCA 1G6NA 1R7JA 3TBIA 1S7EA 2EZHA 3LAJA 3K69A 5JI6A 2MSYA 1P9QC 3S1MJ 5KAIC 4BE1A 4ESFA 1R5HA 1MD0A 3K0LA 2NS0A 3PM1A 4N0BA 3OYEA 2GAUA 2KJCA 1BN5A 2CRGA 3U21A 1LJ9A 3S2DJ 3OOUA 1MMDA 3Q9SA 3HBLA 3CMAI 1Z6TA 3H35A 3V8LA 2E60A 2FBIA 1UMQA 2XASA 1T6SA 3TDZC 5L3DA 2PLYA 1REPC 3B02A 2FMYA 4HAMA 2OCCH 2DA1A 2HOSA 1WVRA 3D5LA 3ZQFA 3ZMVA 1LDKB 3I58A 4AUXA 2CJJA 3F21A 5LEKA 2DK5A 2H1LA 3OWTA 1FBQA 2OD5A 3E5UA 4BHBA 1XMKA 3GO5A 2BGCA 2IS1A 3ZN0A 2A3SA 3HPGA 4N4OB 3K1MA 1RUNA 1MJ9A 1YIJI 4U7BA 3KEOA 5EF6A 1OYIA 1T39A 2B63J 3JRGA 1Y1VJ 4C9YA 4A3KJ 5F64A 2DFHA 1S8NA 4DYRA 3H5AA 1ULYA 3IP4B 3VSKA 3WTXC 1S7AA 4IJAA 3IRRA 2VPLA 1TTYA 4E7ZA 1NTCA 2M7BA 2BV6A 3HRUA 3HOTA 4Y13A 2VN2A 4IEJA 3BG3A 2XF5A 3ZGKA 1V5FA 2NS8A 4OAYA 4LLNA 3I71A 4ENJA 4FISA 2VT2A 1EH6A 3C2HA 3EUAA 3IH3A 4BQAA 1OLTA 4BKXA 2OTJI 2EFOA 4M6VA 4WX9A 5E3OA 2QZ8A 1NG6A 2EA4A 2QUFA 2DT6A 1G59A 3I59A 3KEQA 3CCMI 1ITYA 1UFMA 2XAJA 2Y0SN 4EATA 1XTAA 5FD5A 4HV5A 3TEDA 1R36A 2L9VA 3M4OJ 3U9GA 1TNSA 4J01A 3P9KA 3OS0A 1VQOI 4X1EA 4HYEA 4ENNA 3RZOJ 2FBHA 5EJCA 1JHFA 3PL8A 3GLLA 2EV6A 5CVIA 4XN0A 2VQHA 3OYLA 2R7UA 1U2WA 5AIQA 3DPUA 2ME0A 2OU2A 2A6TA 4Y7NJ 3RKYA 4AIJA 4ENKA 1FJLA 3J81Z 4KMUX 3DBLB 2QQ8A 3UR3C 1PP7U 1W7PB 2H8RA 3BT9A 5FD6A 3F22A 2YU9J 2Z3YA 1L0OC 2OF7A 3MKWB 1Z67A 4XBFA 4B48A 3M3YJ 3BC8A 4EJVA 1IC8A 3BG5A 3ELKA 3IV5A 1WPKA 3REOA 4J00A 3LSHA 4BEHA 2XC7A 4XKCA 4W1UA 1Z1DA 3E3VA 1O4XA 1X1AA 2Q2EA 4A6DA 1G3WA 2LG4A 2A5WA 3BR5A 3H5NA 1DGWY 3GTMJ 1T08B 4B8XA 2LNBA 2WB1A 3DLAA 4UV8A 1X1BA 4OMYA 1KYZA 1FMWA 3BPXA 5K5RA 3TW6A 1FBSA 3T5XA 2R7TA 2E1CA 3JRAA 4HNUA 4MIMA 2IA0A 3PSFA 5GPCA 3WHBA 2A68F 1X3ZB 4LLLA 3RYPA 2XROA 4KMFA 1DGRM 5M3MJ 3FM5A 2BY2A 4G7ZF 3U1DA 3CZ6A 2F5CA 2UV1A 4KYWA 1HSJA 1STZA 1V3FA 2KFDA 1AU7A 2ZFUA 2FNAA 1F4KA 3BTJA 2R7FA 4HDVA 4EGYA 1GLNA 1UG2A 4D7NA 2Y0MA 4RAFA 3G1LA 3ONQA 3SZGA 1SVLA 2R7OA 5GADJ 1J59A 3H9QA 4JK1X 3L2VA 4GO1A 3JRIA 3NQOA 2VKHA 3WGIA 1O57A 2HDDA 2LMDA 2HDCA 1CF7B 2FBKA 1V54H 2JUGA 3I56I 3OYDA 1M1EB 1AKHA 2RV8A 2XAQA 2VE8A 2DJNA 2IBDA 4E7LA 3VODA 3M8JA 2QQBA 5DUKA 1BI3A 3SEQA 2DCEA 3VFZA 4HBLA 2R5YA 4A3MJ 4KNYA 3BP8A 3IH2A 1IV8A 3B6AA 2R93J 1K4SA 1WSUA 1FEXA 1EA3A 4LD5A 3CCSI 1QPIA 5IT9Z 1YW7A 1WJCA 1K6OA 2R7DA 1JTXA 2F4IA 2E2HJ 4XLCA 3S2HJ 1OCOH 2K02A 3CP8A 3IWZA 4WF2A 3V7RA 4UY8I 4JOMA 1K79A 1I3QJ 2DFFA 4GDFA 4NC8A 3EYYA 1HKTA 4B3AA 2Z9OA 4DZJA 1B9NA 3FXOA 4M6YA 1HKQA 3F8MA 3KLNA 4CGZA 3VEPA 4A3GJ 1R5ID 5FROA 3OYKA 3PFIA 3JSPA 3M8EA 3C2GA 1RKTA 4BNCA 1TZLA 2HOAA 3S32A 4S04A 3Q0UA 1JT6A 3H92A 3NARA 1FOKA 4LB6B 2R7VA 4PGHA 3C1DA 5LHGA 3JRFA 1D0YA 3K10A 2E71A 4OIQF 4KUMA 4BGDA 1PYVA 1T38A 3ZQGA 1IJWC 1IAWA 3I64A 2M3AA 3GFLA 2P8TA 2ISZA 4I0BA 4G6QA 1ETKA 3OIOA 3G2BA 4P9UA 1EH8A 2FOWA 4DW6A 4BXUA 1KONA 2F5VA 4IHVA 2RAEA 3HL2A 1XSVA 3OYFA 1RRJA 1YTYA 2E19A 2WB1N 2L7KA 2IAIA 2XPVA 2PI0A 5EEGA 1YRNB 3LSTA 2P81A 5B1BH 5DM7F 4N9IA 3KETA 3U1KA 2E1MB 3CJNA 3NRVA 2EIKH 1T33A 1KQ9A 4DIQA 3OIQA 3PQKA 5IYBJ 5M5YJ 2J5PA 3ABUA 1X1CA 3CTAA 1OISA 3W6KB 1U5TB 4BU2A 3ASOH 1YW8A 1E0EA 2L7FP 2VKVA 3HUGB 3WTSC 1VQ7I 2KPMA 3HRMA 4OMZA 4A6EA 2NVXJ 1VNDA 3M07A 1W1WE 2MYSA 2KMUA 4NB5A 5FO5A 4D5FA 4ZYDA 5JHUA 3OYIA 1YFHA 5J4VA 4XR6A 4BXXJ 3OYGA 1R71A 3BDDA 4MHGA 1IO2A 1FP2A 3V8KA 4F3QA 3W6JB 1RIOH 1EV7A 2KQRA 5LHHA 4P55A 1KZHA 5FLXZ 4U0YA 2LRDA 1ZR2A 4JX6A 4KISA 4LIVA 3WE2A 2DA3A 2ACJA 4ITVA 5E20A 2X51A 1QHGA 2GM4A 2H94A 2EINH 5GAGJ 1C0WA 1F5TA 1EKEA 4HOBA 1F1ZA 2CW8A 2ICWG 2M9HA 2OBPA 2EIMH 3PQJA 5D4RA 2GXAA 2ZO4A 3CCUI 2BYVE 2ZJQF 2Z33A 1A5JA 1QU3A 3CJRB 2X6YA 3F8BA 3OYBA 3PNYA 2ZKZA 3PIPF 2ZXIA 2OCEA 4AVPA 1FYMA 4O5VA 2HXIA 3GXOA 1QNTA 2QQ9A 1TNTA 4U88A 1LEBA 3FMQA 2UXNA 2JA5J 2DDAA 2ELKA 2QCOA 4II3A 3MN2A 2XRNA 3DU6A 1N78A 1ON2A 3CUQB 3FMSA 1RNLA 2JVHA 1IN5A 2VBXA 2WAFA 3ZR8X 1OQYA 3GW2A 2KIQA 4XRSG 4RDUA 2JA2A 3S93A 1VQLI 3WHCA 4EJWA 5B1AH 2DU9A 4YFKF 2I5UA 3BZKA 3CCVI 1HA8A 5GPAA 3OS1A 1E3OC 3CUQA 3FX3A 4M71A 1AWCA 2LSOA 2PMHA 3L7WA 3WTTC 3GWZA 4BQQA 1J0RA 5AIPA 4Z6YA 1H0MA 3W3CA 1R4NB 2W82A 4EQQA 3QPTA 4A3CJ 4PSXA 2ZMEA 3O2PE 2ETHA 4KDPA 1ZAOA 4EV0A 5ILSA 5EG0B 1TBXA 1TT0A 1XMXA 4IVNA 4HLYA 2W7NA 1QZEA 4GGGA 2R7RA 3DTKA 4C3HJ 3ZQ7A 1ETXA 4ZYGA 3AG1H 3IWFA 3ZMUA 4CZCA 3GVAA 2CFXA 2COBA 1TWFJ 2AS5F 1G8XA 4DQ2A 5HS9A 1YS6A 4EVIA 4PJMA 3K7AJ 2K9SA 3H0GJ 1X3WB 3MZHA 3CC4I 3F0CA 4FHTA 3FM3A 2HVQA 4Q47A 4XL9A 3V8JA 3TO7A 3E5QA 3BTLA 5ICEA 1H8AC 2VONA 1UHMA 3K2AA 2DW4A 4IRGA 4UVAA 4DNCA 1XS9A 3NAUA 2VJ5A 1JE8A 5LGUA 1ZK8A 1IXCA 1YJWI 3TP3A 4FETA 3HGYA 3HSFA 3FK6A 3LQQA 3ERMA 1HXDA 1Z91A 4IOCF 2WTEA 4QLCU 1N25A 1XX5A 2AXLA 3H3ZA 1QVUA 2FQ4A 2GXGA 1K83J 4AM3A 4PZJA 2CV2A 2WADA 3BR6A 2V9VA 4Z2YA 3GTPJ 2D1HA 5E3NA 4MFEA 3TKYA 3D5RC 4D0PA 1GUUA 3EETA 4HDUA 3D0SA 2AXTC 2BOLA 3IL2A 2VUMJ 4G7OF 3KEYA 4D5CA 3I55I 1BBYA 5HLTA 1J5YA 5C3EJ 2BW3B 4HEA2 3GZ6A 2KZVA 1ZTRA 1XGMA 2P5KA 1IDYA 3V4GA 1N77A 3ZOBA 2DPDA 2GIVA 2FXAA 2R5ZA 3CCRI 1XN7A 4AYBA 2LY2A 1IN8A 1TQIA 4UUSA 4AC0A 4Q4ZF 3F6VA 4G6DA 2L7MP 3BJAA 5HLGA 2CFOA 1SFXA 1TW2A 4CCLA 3RKXA 1Z21A 3ECOA 5LGNA 1U8BA 4BY1J 4BJ6C 1B8IA 4I2OA 2H6CA 2BXYA 2Z16A 4RAYA 4NQWB 1HOMA 1JUMA 5GTHC 2YU3A 5L3CA 1GVDA 4LITA 5TGTA 3ERED 4B1RA 2G7UA 4AIKA 3PO3J 3OOPA 3EDPA 2M4KA 2OJED 3FDYA 1NH3A 2L01A 2XKOA 4XKBA 5JHFA 4NC6A 1DQUA 1RC9A 4RBOA 1MW7A 2XAFA 3RKWA 4F55A 3Q3SA 1OKRA 3QAHA 2STTA 3KP7A 3S14J 2VQCA 2Y75A 4C3JJ 2L54A 1PUFA 2KHMA 2OAZA 3J7YJ 3PJRA 4EJUA 1LVKA 2XHKA 5D6EA 3CCQI 3G73A 5CQGA 3HYIA 2L4MA 4BJ5C 3JREA 2NS7A 3GTOJ 2HZDA 3KP2A 2LK2A 1UG0A 2YX7A 2B9SA 3FKIJ 2BEOA 3ASNH 2RKHA 4U0VA 5K1YA 1XCVA 3AL0C 2HZTA 3HSEA 3K2ZA 4KJZA 2O9LA 2VLAA 5ERIA 1RETA 1MH3A 3HSRA 1D0ZA 1HLVA 1O3RA 3PO2J 1I6XA 2HTJA 2KDOA 2UXXA 4P9FA 1XGOA 3FBNB 2IEKA 4M74A 3O8GA 1W0TA 3WODF 1B72A 3ZMTA 2HXOA 3HRTA 5J6XA 2NVQJ 1S3JA 3BJOA 1A04A 3AFHA 4C2TA 2EZLA 3ML6A 2RNGA 5DD8A 1U9OA 1X4OA 1F43A 4HA8A 5D4SA 4LLGF 3IAS2 1VZ0A 5E3MA 3CO7C 2ZCWA 1HDPA 4RS8A 3FWEA 5ICFA 5BOXA 3I4PA 1ZRCA 3Q5FA 4E7IA 1LKXA 1MNDA 1LFUP 2ECBA 3K70D 1U6GA 1V4RA 2JK3A 2M8GX 2QLZA 3F6OA 3G4SI 3W2AA 1DP3A 4G94A 1DUXC 3IKVA 2IXSA 1W5SA 2PMUA 4XRMA 1TWAJ 5FLXK 1I1GA 3RPUA 2P5LC 3IUOA 1ZYRF 4AYBN 5LBQA 5E8IA 1HW5A 4BE0A 1LFPA 2W25A 1K7AA 2VOOA 2DA5A 3DBRB 2FE3A 4CH7A 1Y8QB 1PVEA 4A3FJ 4E6KG 2W85A 3SZTA 1VQNI 4XM3A 2CQNA 4ZTFA 1X19A 2DA7A 2F5FA 1WI3A 2PEXA 2L4AA 4G9YA 4RB0A 1JKRC 1DU0A 2ZNYA 5F08A 2OQRA 3RJPA 3CC7I 1YS7A 5JLWA 1WI9A 5FB2A 3DFGA 3CQZJ 3FZVA 1MBHA 1Z7LA 4H0EA 3C18A 2VT3A 2EZKA 3WGHA 1UHWA 4NC7A 2K5CA 2ZFWA 1BR4A 3F3XA 1O3SA 2M8EA 3NWSA 3I4MJ 3J7ZI 1HF0A 4ZZLA 2STWA 2MGQA 1NG7A 2VKDA 1MBGA 1JI8A 1UB9A 3ZN1A 2BE5F 1ZGWA 1O7FA 1JUPA 4ABZA 2V1NA 4BH9A 4ON0A 2EILH 2QWWA 1XMAA 5IT3A 1WZ2A 1XG1A 2E35A 3F8NA 3FBIB 2VJJA 5FKNA 2DA4A 2G9WA 3DEEA 1QQIA 1JGGA 2W24A 2M7AA 1YI2I 4BBSJ 1P4WA 1SD6A 1LDJA 1FT9A 2O3FA 2DN0A 5EZGA 3BQZA 2K9QA 3GTQJ 3MAJA 2H6BA 2HPMA 4HF1A 3WU1B 3E97A 2AHQA 4QWQA 3A4CA 3JW4A 3PUFA 1LUJB 3S8PA 2Y31A 1OYYA 1RUOA 1FP1D 4CCKA 2HKOA 5J8FA 3BR0A 3HXLA 2XKPA 2O5RA 3F8CA 4JX5A 5EGOA 5J47A 1WKMA 3D1NI 2L0KA 4V19K 2M4GA 4F7ZA 1KU7A 3JRDA 2UZKA 2QYOA 1BL0A 4A3DJ 2W84A 2IVMA 3VB2A 3TGNA 1D1AA 2FD5A 2YS9A 2DOFA 2E5NA 3C2BA 4KIFA 3JTGA 4E7KA 2HVRA 2B7EA 3KX2A 3I59B 2LF7A 3PNTA 1YO5C 2EJRA 2HYGD 3CDHA 2E36A 3AAFA 1XCBA 1YJNI 2R92J 2DJIA 4M9ZA 1BC8C 1WHUA 1U0JA 3A0HC 3I0TA 3ULQB 1VQ4I 4O3MA 2VOPA 4BXFA 2DA6A 2TDXA 2V26A 4RLQA 4XICA 5FRNA 4N4NB 4XSXF 2HS5A 3LWFA 3IH4A 2M0CA 5H20A 5EDNA 1GXQA 4EJTA 3LAPA 1WJEA 2CUFA 1OR7C 2JSCA 3FF5A 4O6JA 3ESWB 3KE2A 4IHSA 1H9GA 3RCOA 5TJJA 3G71I 5IP6A 2LVSA 1IDZA 5ILVA 2COMA 4I76A 4L9TA 3BROA 2HEOA 4LIUA 4NNJA 4UUTA 4IHXA 3LSJA 2DK8A 3HTUA 1BOAA 1ZQ3P 3SDGA 3RI4A 2XGCA 4BEHB 2IT0A 5FKMA 3S1QJ 3Q9VA 3L2QA 2Q2EB 4S05A 4MGRA 2YX4A 1GXPA 2D5VA 3LFUA 4C2UA 3K70C 1OMIA 2OUMA 3GTGJ 2FU4A 1ACIA 4D1QA 1R6RA 2ELHA 2F2EA 1MBFA 3LSGA 3JCUC 3V7CA 5DDGA 5E79C 4KITB 5IOZA 1LPQA 2W1OA 3KYCB 3I4NJ 3D5SC 3GYHX 1SAUA 2F6CA 4RAGA 3CO6C 5IPAA 1YW9A 2AO9A 2CWEA 4KICA 4OINF 3LMMA 1MNEA 3COAC 2WAEA 4B43A 3BR3A 4IQJA 5E8GA 3BR1A 1WJFA 2QF7A 1P7JA 1K61A 3DQVC 1IRFA 2JQ7A 1T56A 1JHHA 2QA4I 2Q0OA 4GXOA 2CQKA 1AKHB 3HM5A 4XKVA 2K7LA 4A5NA 5DYMA 3CMEI 3BG6A 2AQFA 3HOWJ 4A0ZA 2XVCA 1N75A 4IL6C 2R5YB 2DTZA 2PMZA 2CSOA 1FLIA 3SJMA 5DV5A 1A35A 3H9JA 4CDGA 4I09A 5HNHA 4XOTA 4A3JJ 3LNQA 4CICA 3SXYA 3DP7A 3LSKA 1MDMA 5K7ZA 1XGNA 3VYUB 3GFIA 3CF5F 2DMTA 1QBJA 3ECHA 3BOQA 2LKSA 4G12A 3ISPA 2HYJA 3Q0VA 5BPIA 4IX7A 4W97A 1KQ0A 1YJ9I 2BXZA 1R49A 3K4LA 3L1PA 1X4PA 1OYWA 1GHCA 3CESA 5FLMJ 3WG7H 2VC1A 3EPZA 3J7AY 5KNLA 4FTHA 3LSPA 3FK7A 4KN4X 3DEUA 2VXZA 1MMGA 3AG2H 3E6BA 4OWRB 1KU3A 4MTDA 1K78A 1IRGA 3EUKL 3JRCA 3CJTB 1IRZA 3FIWA 4WXHA 4DJAA 4ASNA 1TLHB 1B4AA 2CO5A 2RQQA 2WC2A 3KZYA 2BY1A 4V2FA 4XOPA 5A2QK 4R79A 5GAHJ 4CZZA 3CCLI 1HW2A 1QZZA 4XIDA 2LBFA 3CJQB 4MO7A 2DT5A 2HNHA 5JVTA 5DM6F 3A1YA 1R1TA 3K6GA 2M1BA 4A0YA 5IP9J 2EV0A 2WV1A 3TO6A 1S6LA 2KZGA 1E17A 2X1EA 4ZYHA 1POGA 4LG0A 3M1CA 2JUCA 2KRHA 4IRIA 4BL0B 3S3MA 5DCMA 2JVGA 4GYGA 2GWRA 2MH2A 5FKKA 2EFWA 1RPWA 2CUEA 4PJ0C 1UHSA 2RN7A 3WTYC 4CUGA 3OYJA 2CQQA 1A36A 4I0AA 4CYDA 1FYLA 2NRAC 3ZRGA 2R7SA 1SAXA 5IYDJ 2EFPA 3O6BB 2QGUA 3GX4X 5CJ9A 5HLIA 3LA3A 4DYQA 2E2JJ 3CDLA 1U9NA 2O8KA 3ABTA 4B4CA 2IPQX 4A12A 2GZWA 2FUG2 2KRFA 3OV8A 2K9LA 4IHWA 4AWXB 3H1CA 4YELA 2KL4A 4UV9A 2O6GE 4M3GA 4L9VA 4BY7J 2KP6A 4MFDA 3ZQLA 3C7JA 2ESHA 2OZ6A 1MH4A 3BG7A 2R3SA 4EJOA 3L2CA 1HQCA 3OYNA 2MD5A 3KIOA 2Z99A 2N8GA 2V4JC 4HLXA 3AG4H 2PMZN 2VL8A 3KPHA 4UVBA 2CYYA 1ZELA 1BIBA 2VBYA 2BHYA 2HWVA 3BCBA 4ZDLA 4CXFA 5IY5H 3ABKH 3QYEA 4FX4A 5HOOA 1USTA 3N4MA 4G7HF 4GCVA 3CDIA 5K7FA 3K9TA 4HW0A 2IJLA 2FRHA 5C44J 2O7OA 1APLC 2V7FA 2A6EF 1B6AA 4HPQA 1P92A 2Q8KA 4RM2A 4YFXF 2HQAA 1ETYA 4CCNA 2K40A 3MD2A 5H6QA 5KVRA 2DQLA 3SHFA 2E7XA 5J4YA 3T1BA 4F93B 2P5VA 3GUDA 5F0HA 3WU2C 2YUSA 5LRSA 1K4TA 2EA2A 2FEZA 1ZR4A 2W4SA 3S2WA 4AVZA 2X1DA 4KFCA 2LY9A 2XGDA 1VQ8I 4HNVA 3OR2C 2F5DA 2K86A 2NXNB 2X85A 3A01A 3RPQA 2MBFA 2JRMA 4C3IJ 3E1SA 3CCJI 1B59A 2QEXI 1W36C 2KKOA 2BBYA 1X2MA 1DDNA 4KT6A 1TC3C 2ZJPF 3O3KA 5EEHA 2ZMEB 4PCQA 1IF1A 2BZTA 1WJAA 3NWTA 4E4HA 1D8KA 2HVSA 2VI6A 2A61A 3KP6A 4BJTA 5C4XJ 4YIFA 1VF9A 3OSFA 1I1SA 2DXIA 3WTWC 4BQOA 4IKFA 1Q1HA 4IPAA 3ZP5A 2O61A 2IA2A 2P7VB 3JSOA 5GP9A 2VPRA 2MLGA 1LEAA 3HKZA 3O8HA 3DF8A 4FE4A 3L9FA 1FIPA 3DCFA 1Y0NA 4ZH4F 4LMYA 3OR1C 1TWCJ 2CV0A 3FXMA 3ZCOA 1E2XA 2DO7A 2HU9A 2DFEA 2DAOA 3QU3A 3BG9A 3S1NJ 2G0EA 2MLKA 3IC7A 1ERDA 4L5IA 3QP6A 3PNVA 4A3BJ 4IXAA 3OSGA 4L0ZB 4RGSA 4EM0B 1P7IA 4PSWA 2DMNA 3QU6A 3MCZA 1MJBA 3DTIA 2JPBA 5HLHA 1Y1WJ 2GQQA 4NHJA 3SFIA 5GAEJ 1UZCA 4HF0A 1BR1A 3L2UA 3ABMH 4IQ4A 2K4JA 4M9SA 2MA3A 3I54A 4BHCA 1BI1A 3QOPA 2DBBA 2M45A 1HCRA 1SFEA 2LKPA 1SFUA 3M1EA 1X1DA 2PG4A 4B47A 3UNGC 2K3PA 1G2HA 4L18B 2UUZA 3F8FA 4QIWN 2BY0A 2XGXA 3T8TA 4BHPA 1MNMC 4OAZA 3G3ZA 1FC3A 2IA1A 1B1BA 2Y69H 2GBYA 2ESNA 2Z5UA 2E1MC 2R5ZB 1XB4A 2GLOA 2ZNZA 2Z1DA 4UUSB 1R58A 4IF4A 4ZYAA 3SFZA 4C2MJ 3K4BA 4LK1F 3TO9A 5BS6A 2CV1A 3MFKA 4ZDPA 3AG3H 1DU6A 3I9V2 2HR3A 1VI0A 3PSIA 4I7HA 1TQMA 1V5GA 2V9PA 4DGWB 4ZYEA 5ED4A 2HQNA 3MKZA 1SD5A 1U5TC 3LFKA 4M3EA 4WXCA 1B8IB 4P1WA 1MBEA 3DPTA 4M73A 2ZJ2A 5D5UB 1NK3P 1L3LA 3GLXA 2OA4A 5CKTA 1SANA 2NVYJ 4XQFA 4RAZA 3S17J 5ICCA 4CYCA 2R7WA 1E3PA 4WXDA 1ONVA 1EH7A 1AA7A 3W2WA 5TRDA 1Y8RB 4XLAA 4FCYA 1FY7A 4AD9A 1OCCH 3QYBA 2CG4A 1IG7A 3BTCA 3MWMA 1XDUA 5JFRA 1TQPA 1A6IA 3SZPA 4BBRJ 4XLPF 1PUFB 1QO0D 2JZYA 3RQ4A 1GV2A 2VJIA 5HNFA 3OL4A 3U2RA 2L7ZA 2XB0X 2XSJC 3JTHA 1LVAA 1IGNA 2L3DA 3HJEA 3HKZN 1YHQI 1QPMA 4A3IJ 4G8XA 3WTUC 4UUVA 3H3UA 1YITI 1S7OA 3QWLA 1MKMA 5J8CA 3B6CA 1R5GA 1BC7C 3DKXA 1T0FC 1WGXA 1IXRC 4LK0F 3QPSA 4YFNF 4LGWA 3SDBA 2WWYA 1IV6A 5FFZA 1R9TJ 2EB7A 1GVJA 2WY7Q 4EEFG 1YX5A 3K4CA 3AKZA 4OIPF 3HPHA 4RMNA 4UNOA 2ID6A 3K4JA 1PP8F 1ZRFA 1GDTA 4KA4A 3EUHC 4LOCA 4R8HA 1IUYA 4U7DA 3R0JA 1B72B 3HIFA 3KCCA 3A02A 2KIUA 4L9NA 3OMYA 4WCGA 1ETOA 2TCTA 4RB3C 1JJ6C 3DXJF 5A2QZ 4Y15A 1ETWA 3RIRA 4MLOA 3FXRA 4LB5A 3VSLA 3FHNA 5LHIA 3ZQIA 4HF2A 3P7NA 1WFXA 3MKYB 2PN6A 3C3WA 5HDGA 3FISA 4GFBA 2JA8J 3LL7A 4RGUA 4FASD 2ZB9A 1JUSA 1OR7A 2DTRA 5J1RA 4XLEA 3F9KA 3TQNA 4YEJA 3QYFA 5HS7A 1QRYA 2MH9A 4M3BA 3ZMZA 2VIXA 2J5OA 4LFUA 1MZBA 3QPHA 1TW3A 5B3SH 2DOAA 1LE8A 2PJRA 2L02A 1XSXA 3G6EI 1CGPA 3HTSB 3LA7A 1IRXA 1BR2A 3A03A 1D1CA 5D8KB 1ZN2A 5L3GA 1AHDP 2XSDC 5LLQA 3GFJA 2W00A 4BYYA
chains in the Genus database with same CATH topology
1YQAA 4HQEA 2FF4A 4I98B 2IP2A 1QZYA 3L09A 3SQNA 2HGCA 2V79A 1LDDA 2QBYA 3M9AA 4FX0A 1MGTA 3QRFF 1FPQA 4L0YB 5BMZA 4CHUA 3MZYA 4ENMA 2FMLA 3I5UA 1G3YA 4U0WA 4XLNF 1XGSA 4EGZA 5E17F 1R00A 3P9IA 1UCRA 4ESBA 1LQ1A 3DPLC 2CGPA 4LJZF 4IHTA 1PUEE 5D8LB 3E5XA 1ZRDA 1I27A 1P2FA 4R1HA 5E18F 4Q5SF 5JR3A 3ZMDA 1VTNC 4Y17A 2GXBA 2QM3A 3QP5A 4RGRA 1D5VA 2HFHA 1KA8A 1IW7F 2V1XA 1ZARA 2RNJA 1DPUA 3FMRA 5DCFA 2MC3A 1T2KA 1FBUA 2O03A 2PQ8A 1W4MA 1X3UA 1T98A 4AIHA 2P4WA 4ETSA 3E6DA 4YIIA 5E1ZB 1ODDA 1ZGAA 4M6XA 2EWNA 3TOAA 4HV6A 3B73A 4I02A 3RDIA 1KYWA 1YLFA 1ZREA 1AOYA 1J75A 2X4HA 1OPCA 2ADUA 1J7KA 6PAXA 3DV8A 2VODA 5LEJA 2EK5A 2A69F 2M30A 1KU9A 4JQFA 2A6HF 4A0XA 4RB1A 5D6FA 2EFNA 3R6SA 5L3BA 3V7SA 3IHUA 3R4KA 3L00A 4MNUA 1J9IA 2IRFG 2V6CA 1W7PD 1HW1A 2ZBKA 2A5YB 5K5OA 1W7PA 1O3QA 2HOEA 2JRTA 4Q48A 1ZHFA 2OQGA 2JTVA 2FSWA 3K1PA 1MDMB 1ZG3A 1XDSA 1O3TA 2XIGA 2QQAA 2HQRA 4GYIA 4MQVA 4UVCA 2HYFA 1K78B 5CYVA 2H27A 1B9MA 2RC4A 3BJ6A 5K5QA 1Z9CA 2UWMA 3WTVC 3LA2A 1CF7A 1KQ8A 1HBXG 1XSDA 3KP4A 2VE9A 4MQ9F 4LG0B 1BM9A 1FYKA 3HOSA 1PDNC 3NEUA 1SMYF 3DKWA 4EM1A 3EYIA 5DCMB 2XAHA 2HTSA 4PGGA 3RYRA 1YIOA 5L3FA 3J80K 5HS8A 4IRHA 1ZLKA 2KIFA 3FXUA 3KP5A 2P6TA 3KLOA 2DQRA 2K27A 2RVCA 2P6SA 4PDKA 2FA5A 1G3TA 2HKXA 4OOIA 5D5VB 1XD7A 1WRJA 4XRFA 1MJAA 2D2WA 5CVJA 3JAMK 1JXSA 4L9JA 4KT5C 5F1RA 2ZXJA 2M87A 3CLOA 3FXQA 2W57A 2RQPA 4HQMA 1LB2A 4MEYF 5FGMA 4OIOF 3R60A 2B0LA 4YG2F 2XUBA 4JBAA 1ZG5A 1U3EM 2KJBA 1Z7UA 2E7WA 4HX8A 1IN4A 4EM2A 2FQ3A 2PBIA 1U5TA 3HUGA 1YYVA 1ZGJA 2GA1A 4HX7A 1U8RA 3F23A 1ON1A 2E1NA 1P4XA 2Y48A 2QVOA 3TDUC 5E1XA 2PJPA 3BPVA 2ISYA 1HKSA 1Z05A 2PFBA 1JGSA 2NNYA 4I01A 2DLLA 3LQRA 3WG9A 5CVUA 4P96A 1BI2A 1U78A 2G7HA 4A2UA 3BWGA 3M8FA 2IW5A 2YSRA 3GEZA 2RGVA 4UHTA 5HDKA 1S29A 3KP3A 1T0FA 5H6RA 1R23A 1SMTA 4B09A 3GZ5A 2FNPA 2DPUA 4L5JA 1Z6RA 3EUHA 5BPDA 1BI0A 2EFQA 2C6YA 1R1UA 2VBWA 3P9CA 3WTZA 4N9HA 1HSTA 2F5EA 3I53A 1SD4A 4WK8F 1DPRA 1ZH5A 3ROUA 3HHGA 5E1WA 3J81K 1J2XA 1RZ4A 1G4DA 3IKTA 1IZ1A 2DI3A 1FSEA 5LGTA 3IRQA 3F72A 2NAZA 1YG2A 1DP7P 3WE3A 4WWCA 2X0LA 3T0YA 3R0AA 4KIBA 2RDPA 4ZZDA 5DD4A 1FSHA 4E70A 1BIAA 3T8RA 5AONA 5F6FA 5D5WB 4OU0A 1ZG1A 1O7LA 3HHHA 4EMSA 3TOBA 1RI7A 2VC0A 3KZZA 4FT8A 1QGPA 3BY6A 2LDUA 5CLSA 1R1VA 5DUIA 2D1VA 4XSZF 2M5WA 2V1DA 5CVVA 2DFIA 4P5OA 2WV0A 3RTRA 1I5ZA 1LNWA 5KK1A 3KFWX 4KN7X 3MEXA 4TV7A 3GFMA 2YR2A 2NYXA 2NNNA 3GF2A 1D8JA 2D45A 5IT9K 1KU2A 3K1NA 2V1UA 1WQ2A 4RGXA 1F9NA 1WWXA 2H09A 3CUOA 3ZMSA 1Y0UA 4NQWA 5HDNA 2XV4S 2EV5A 3CUQC 1FZPB 3VOEA 1R22A 2GA2A 2P7CB 1BJAA 2XAGA 4OIRF 1IN6A 4A5MA 3BZ6A 3WGGA 1FNNA 4RB2C 4UXNA 5LRRA 2OZUA 4HZFA 1IXSB 5HVQC 3J7AO 3HRSA 2YPRA 4K2EA 4M72A 5FFXA 3N97A 2A07F 1H9TA 4BAYA 5ICGA 3E6CC 1FX7A 5DEQA 3J80Z 5BQTA 2JT1A 2KIMA 1W5TA 2QBYB 1USSA 3MQ0A 4MTEA 4M9XA 3M7GA 4MEXF 4ESJA 1P6RA 3EQLF 5ILUA 2LF8A 4HX4A 4KIGA 3R61A 5CVRA 1NHAA 3WU0A 3E6MA 2VBZA 1ZLJA 3JAMZ 2FOKA 1KGSA 2CW0F 1FWZA 1G3SA 4CO8A 3ZPLA 2QENA 2O8XA 3FHZA 1P4AA 1D3YA 5D5XB 2K4BA 2O0YA 1IN7A 1SD7A 5L3EA 2JPCA 1G6NA 1R7JA 3LAJA 3K69A 5JI6A 4ESFA 1R5HA 1MD0A 3K0LA 2NS0A 4N0BA 2GAUA 2KJCA 1BN5A 1LJ9A 3Q9SA 1Z6TA 3V8LA 2FBIA 2XASA 1T6SA 3TDZC 5L3DA 2PLYA 1REPC 3B02A 2FMYA 4HAMA 3D5LA 3ZMVA 1LDKB 3I58A 3F21A 5LEKA 2DK5A 1FBQA 2OD5A 3E5UA 4BHBA 1XMKA 3GO5A 2BGCA 3ZN0A 2A3SA 3K1MA 1RUNA 1MJ9A 4U7BA 3KEOA 1OYIA 1T39A 5F64A 1S8NA 1ULYA 3WTXC 1S7AA 4IJAA 3IRRA 1TTYA 2BV6A 3HRUA 3HOTA 4Y13A 2VN2A 4LLNA 3I71A 4ENJA 2VT2A 1EH6A 4BQAA 2EFOA 4WX9A 2QZ8A 2EA4A 2QUFA 3I59A 3KEQA 1UFMA 2XAJA 5FD5A 4HV5A 1R36A 3U9GA 1TNSA 3P9KA 4ENNA 4HYEA 2FBHA 1JHFA 2EV6A 5CVIA 1U2WA 5AIQA 2OU2A 4ENKA 3RKYA 4AIJA 3J81Z 4KMUX 1PP7U 1W7PB 5FD6A 3F22A 2Z3YA 1L0OC 4XBFA 4EJVA 3ELKA 3REOA 1Z1DA 3E3VA 2Q2EA 4A6DA 1G3WA 4B8XA 2LNBA 4UV8A 4OMYA 1KYZA 3BPXA 5K5RA 1FBSA 3T5XA 2E1CA 2IA0A 2A68F 4LLLA 3RYPA 2XROA 4KMFA 3FM5A 4G7ZF 3U1DA 4KYWA 2F5CA 1HSJA 1STZA 1V3FA 2FNAA 1F4KA 2R7FA 4HDVA 4EGYA 2Y0MA 1J59A 4JK1X 4GO1A 3NQOA 3WGIA 1O57A 2HDCA 1CF7B 2FBKA 2RV8A 2XAQA 2VE8A 3VODA 2QQBA 5DUKA 1BI3A 3VFZA 4HBLA 4KNYA 3BP8A 1WSUA 4LD5A 5IT9Z 1YW7A 1K6OA 2R7DA 2K02A 4WF2A 3IWZA 3V7RA 1K79A 3EYYA 1HKTA 2Z9OA 1B9NA 4M6YA 1HKQA 3F8MA 3KLNA 4CGZA 3VEPA 3PFIA 3JSPA 3M8EA 4BNCA 4S04A 3H92A 1FOKA 4LB6B 4PGHA 3C1DA 5LHGA 4OIQF 4KUMA 1T38A 1IAWA 3I64A 3GFLA 2P8TA 2ISZA 4I0BA 4G6QA 4P9UA 1EH8A 4BXUA 1XSVA 1YTYA 2PI0A 5EEGA 3LSTA 4N9IA 3KETA 3CJNA 3NRVA 1KQ9A 3PQKA 2J5PA 3ABUA 3CTAA 3W6KB 1U5TB 1YW8A 3WTSC 3HRMA 4OMZA 4A6EA 4NB5A 5FO5A 4ZYDA 5JHUA 1YFHA 3BDDA 4MHGA 1FP2A 3V8KA 3W6JB 1RIOH 1EV7A 5LHHA 4P55A 5FLXZ 4U0YA 3WE2A 2ACJA 5E20A 2H94A 1C0WA 1F5TA 4HOBA 1F1ZA 3PQJA 2OBPA 5D4RA 2ZO4A 2BYVE 2Z33A 3F8BA 2ZKZA 4AVPA 1FYMA 4O5VA 3GXOA 1QNTA 2QQ9A 1TNTA 4U88A 1LEBA 3FMQA 2UXNA 2XRNA 1ON2A 3CUQB 3FMSA 1RNLA 1IN5A 2VBXA 3GW2A 4EJWA 2DU9A 4YFKF 3CUQA 3FX3A 4M71A 1AWCA 2LSOA 2PMHA 3L7WA 3WTTC 3GWZA 1J0RA 5AIPA 1H0MA 4EQQA 3QPTA 2ZMEA 3O2PE 2ETHA 4KDPA 1ZAOA 4EV0A 5ILSA 1TBXA 4IVNA 4HLYA 4GGGA 3ZQ7A 4ZYGA 3IWFA 3ZMUA 3GVAA 2CFXA 2AS5F 4DQ2A 5HS9A 1YS6A 4EVIA 3MZHA 4FHTA 3FM3A 4Q47A 3V8JA 3TO7A 3E5QA 5ICEA 2VONA 1UHMA 2DW4A 4IRGA 4UVAA 4DNCA 1JE8A 5LGUA 1IXCA 3HSFA 3LQQA 1HXDA 1Z91A 2WTEA 4QLCU 2AXLA 3H3ZA 2GXGA 4PZJA 2V9VA 4Z2YA 2D1HA 3TKYA 4D0PA 3EETA 4HDUA 3D0SA 3IL2A 4G7OF 1BBYA 1J5YA 3GZ6A 1XGMA 2P5KA 3V4GA 2DPDA 2GIVA 2FXAA 1XN7A 1IN8A 1TQIA 4Q4ZF 3F6VA 4G6DA 3BJAA 5HLGA 1SFXA 1TW2A 3RKXA 3ECOA 5LGNA 4I2OA 2H6CA 4RAYA 2YU3A 5L3CA 3ERED 2G7UA 4AIKA 3OOPA 3EDPA 2L01A 2XKOA 2XAFA 3RKWA 1OKRA 3QAHA 2STTA 3KP7A 2Y75A 2L54A 2OAZA 4EJUA 2XHKA 5D6EA 3G73A 3HYIA 2L4MA 3KP2A 2YX7A 2BEOA 2RKHA 4U0VA 5K1YA 1XCVA 2HZTA 3HSEA 3K2ZA 5ERIA 3HSRA 1O3RA 1I6XA 2HTJA 2UXXA 4P9FA 1XGOA 4M74A 3WODF 3ZMTA 3HRTA 5J6XA 1S3JA 3BJOA 1A04A 3ML6A 5DD8A 4HA8A 5D4SA 4LLGF 3CO7C 2ZCWA 4RS8A 3FWEA 5ICFA 5BOXA 3I4PA 1ZRCA 3Q5FA 1U6GA 1V4RA 2QLZA 3F6OA 4G94A 1DUXC 3IKVA 1W5SA 2PMUA 5FLXK 1I1GA 3RPUA 2P5LC 1ZYRF 5LBQA 5E8IA 1HW5A 2W25A 1K7AA 2VOOA 2FE3A 2W85A 3SZTA 2F5FA 2PEXA 2L4AA 4G9YA 4RB0A 2ZNYA 2OQRA 3RJPA 1YS7A 1WI9A 5FB2A 3DFGA 3FZVA 4H0EA 3C18A 2VT3A 3WGHA 1UHWA 1O3SA 2ZFWA 3F3XA 2M8EA 4ZZLA 2STWA 1UB9A 3ZN1A 2BE5F 1O7FA 4BH9A 4ON0A 2QWWA 1XMAA 5IT3A 3F8NA 2G9WA 1QQIA 2W24A 1P4WA 1SD6A 1LDJA 1FT9A 2O3FA 3MAJA 2H6BA 4HF1A 3WU1B 3E97A 4QWQA 3JW4A 1OYYA 1RUOA 1FP1D 2HKOA 5J8FA 2XKPA 3F8CA 1WKMA 4F7ZA 1KU7A 2UZKA 2QYOA 2W84A 2IVMA 3VB2A 3TGNA 4KIFA 3JTGA 1YO5C 3I59B 2LF7A 2EJRA 2HYGD 3CDHA 3AAFA 1XCBA 1BC8C 4M9ZA 3ULQB 3I0TA 4O3MA 2VOPA 2TDXA 4XSXF 2HS5A 3LWFA 5H20A 4EJTA 1GXQA 3LAPA 2JSCA 3FF5A 4O6JA 3KE2A 4IHSA 1H9GA 5TJJA 5ILVA 2COMA 4L9TA 3BROA 2HEOA 2DK8A 3HTUA 1BOAA 3RI4A 2IT0A 3Q9VA 4S05A 4MGRA 2YX4A 1GXPA 1OMIA 2FU4A 2ELHA 2F2EA 5JVTA 5DDGA 3V7CA 3GYHX 3CO6C 1YW9A 2CWEA 4KICA 4OINF 3COAC 5E8GA 3DQVC 1IRFA 1JHHA 2Q0OA 4GXOA 2CQKA 2K7LA 4A5NA 5DYMA 4A0ZA 2XVCA 2CSOA 1FLIA 5DV5A 4CDGA 4I09A 4CICA 3SXYA 3DP7A 1MDMA 1XGNA 3GFIA 1QBJA 3ECHA 3BOQA 3ISPA 5BPIA 1KQ0A 1OYWA 1GHCA 2VC1A 4KN4X 2VXZA 3DEUA 1K78A 3E6BA 4MTDA 1KU3A 1IRGA 4WXHA 4ASNA 1TLHB 1B4AA 2CO5A 2WC2A 3KZYA 5A2QK 4R79A 1HW2A 4CZZA 1QZZA 2DT5A 1R1TA 2M1BA 4A0YA 2EV0A 3TO6A 1S6LA 1E17A 4ZYHA 4LG0A 4IRIA 5DCMA 4GYGA 2GWRA 2MH2A 2EFWA 2RN7A 3WTYC 4I0AA 4CYDA 1FYLA 2NRAC 1SAXA 2EFPA 3O6BB 3GX4X 5CJ9A 5HLIA 3LA3A 3ABTA 2IPQX 4A12A 2GZWA 2KRFA 3OV8A 4AWXB 4UV9A 2O6GE 4L9VA 3C7JA 2ESHA 2OZ6A 2R3SA 4EJOA 3L2CA 1HQCA 2MD5A 2Z99A 4HLXA 4UVBA 2CYYA 1BIBA 2VBYA 4CXFA 2HWVA 4FX4A 5HOOA 1USTA 3N4MA 4G7HF 4GCVA 3K9TA 4HW0A 2IJLA 2FRHA 2A6EF 1B6AA 1P92A 2Q8KA 4YFXF 5H6QA 5KVRA 2DQLA 3SHFA 2E7XA 3T1BA 2P5VA 3GUDA 5LRSA 2EA2A 2FEZA 3S2WA 4KFCA 2F5DA 2K86A 3RPQA 2MBFA 1B59A 2KKOA 2BBYA 1DDNA 3O3KA 5EEHA 2ZMEB 4PCQA 1IF1A 1D8KA 2A61A 3KP6A 4YIFA 1I1SA 3WTWC 1Q1HA 4IPAA 3ZP5A 2O61A 2IA2A 2P7VB 3JSOA 2MLGA 1LEAA 3DF8A 3L9FA 4ZH4F 4LMYA 1E2XA 2DO7A 2DAOA 3QU3A 2MLKA 3IC7A 4L5IA 3QP6A 4IXAA 4L0ZB 4RGSA 4EM0B 3QU6A 3MCZA 1MJBA 2JPBA 5HLHA 2GQQA 4NHJA 4HF0A 2K4JA 4M9SA 2MA3A 3I54A 4BHCA 1BI1A 3QOPA 2DBBA 2M45A 1SFEA 2LKPA 1SFUA 3M1EA 2PG4A 4L18B 3F8FA 2XGXA 3T8TA 4BHPA 3G3ZA 1FC3A 2IA1A 1B1BA 2ESNA 2Z5UA 1XB4A 2ZNZA 1R58A 4IF4A 3SFZA 4LK1F 3TO9A 5BS6A 3MFKA 4I7HA 2HR3A 1TQMA 4ZYEA 5ED4A 2HQNA 1U5TC 1SD5A 3LFKA 4WXCA 3DPTA 4M73A 2ZJ2A 5D5UB 1L3LA 3GLXA 2OA4A 4RAZA 5ICCA 4WXDA 1ONVA 1EH7A 5TRDA 1FY7A 4AD9A 2CG4A 3MWMA 1XDUA 5JFRA 1TQPA 3SZPA 4XLPF 1QO0D 2JZYA 3U2RA 3JTHA 1LVAA 2L3DA 1QPMA 4G8XA 3WTUC 4UUVA 3H3UA 1S7OA 1MKMA 5J8CA 1R5GA 1BC7C 1IXRC 4LK0F 4YFNF 4LGWA 2WWYA 5FFZA 2EB7A 1GVJA 4OIPF 4UNOA 1PP8F 1ZRFA 4KA4A 4R8HA 1IUYA 4U7DA 3R0JA 3HIFA 3KCCA 2KIUA 4L9NA 4WCGA 4RB3C 3DXJF 5A2QZ 4Y15A 3RIRA 3FXRA 4LB5A 5LHIA 4HF2A 3P7NA 2PN6A 3C3WA 5HDGA 4RGUA 1OR7A 2DTRA 3TQNA 5HS7A 2MH9A 3ZMZA 2J5OA 4LFUA 1MZBA 3QPHA 1TW3A 2L02A 1XSXA 1CGPA 3HTSB 3LA7A 5D8KB 1ZN2A 5L3GA 5LLQA 3GFJA 4BYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQA A;  4HQE A;  2FF4 A;  4I98 B;  2IP2 A;  1QZY A;  3L09 A;  3SQN A;  2HGC A;  2V79 A;  1LDD A;  2QBY A;  3M9A A;  4FX0 A;  1MGT A;  3QRF F;  1FPQ A;  4L0Y B;  5BMZ A;  4CHU A;  3MZY A;  4ENM A;  2FML A;  3I5U A;  1G3Y A;  4U0W A;  4XLN F;  1XGS A;  4EGZ A;  5E17 F;  1R00 A;  3P9I A;  1UCR A;  4ESB A;  1LQ1 A;  3DPL C;  2CGP A;  4LJZ F;  4IHT A;  1PUE E;  5D8L B;  3E5X A;  1ZRD A;  1I27 A;  1P2F A;  4R1H A;  5E18 F;  4Q5S F;  5JR3 A;  3ZMD A;  1VTN C;  4Y17 A;  2GXB A;  2QM3 A;  3QP5 A;  4RGR A;  1D5V A;  2HFH A;  1KA8 A;  1IW7 F;  2V1X A;  1ZAR A;  2RNJ A;  1DPU A;  3FMR A;  5DCF A;  2MC3 A;  1T2K A;  1FBU A;  2O03 A;  2PQ8 A;  1W4M A;  1X3U A;  1T98 A;  4AIH A;  2P4W A;  4ETS A;  3E6D A;  4YII A;  5E1Z B;  1ODD A;  1ZGA A;  4M6X A;  2EWN A;  3TOA A;  4HV6 A;  3B73 A;  4I02 A;  3RDI A;  1KYW A;  1YLF A;  1ZRE A;  1AOY A;  1J75 A;  2X4H A;  1OPC A;  2ADU A;  1J7K A;  6PAX A;  3DV8 A;  2VOD A;  5LEJ A;  2EK5 A;  2A69 F;  2M30 A;  1KU9 A;  4JQF A;  2A6H F;  4A0X A;  4RB1 A;  5D6F A;  2EFN A;  3R6S A;  5L3B A;  3V7S A;  3IHU A;  3R4K A;  3L00 A;  4MNU A;  1J9I A;  2IRF G;  2V6C A;  1W7P D;  1HW1 A;  2ZBK A;  2A5Y B;  5K5O A;  1W7P A;  1O3Q A;  2HOE A;  2JRT A;  4Q48 A;  1ZHF A;  2OQG A;  2JTV A;  2FSW A;  3K1P A;  1MDM B;  1ZG3 A;  1XDS A;  1O3T A;  2XIG A;  2QQA A;  2HQR A;  4GYI A;  4MQV A;  4UVC A;  2HYF A;  1K78 B;  5CYV A;  2H27 A;  1B9M A;  2RC4 A;  3BJ6 A;  5K5Q A;  1Z9C A;  2UWM A;  3WTV C;  3LA2 A;  1CF7 A;  1KQ8 A;  1HBX G;  1XSD A;  3KP4 A;  2VE9 A;  4MQ9 F;  4LG0 B;  1BM9 A;  1FYK A;  3HOS A;  1PDN C;  3NEU A;  1SMY F;  3DKW A;  4EM1 A;  3EYI A;  5DCM B;  2XAH A;  2HTS A;  4PGG A;  3RYR A;  1YIO A;  5L3F A;  3J80 K;  5HS8 A;  4IRH A;  1ZLK A;  2KIF A;  3FXU A;  3KP5 A;  2P6T A;  3KLO A;  2DQR A;  2K27 A;  2RVC A;  2P6S A;  4PDK A;  2FA5 A;  1G3T A;  2HKX A;  4OOI A;  5D5V B;  1XD7 A;  1WRJ A;  4XRF A;  1MJA A;  2D2W A;  5CVJ A;  3JAM K;  1JXS A;  4L9J A;  4KT5 C;  5F1R A;  2ZXJ A;  2M87 A;  3CLO A;  3FXQ A;  2W57 A;  2RQP A;  4HQM A;  1LB2 A;  4MEY F;  5FGM A;  4OIO F;  3R60 A;  2B0L A;  4YG2 F;  2XUB A;  4JBA A;  1ZG5 A;  1U3E M;  2KJB A;  1Z7U A;  2E7W A;  4HX8 A;  1IN4 A;  4EM2 A;  2FQ3 A;  2PBI A;  1U5T A;  3HUG A;  1YYV A;  1ZGJ A;  2GA1 A;  4HX7 A;  1U8R A;  3F23 A;  1ON1 A;  2E1N A;  1P4X A;  2Y48 A;  2QVO A;  3TDU C;  5E1X A;  2PJP A;  3BPV A;  2ISY A;  1HKS A;  1Z05 A;  2PFB A;  1JGS A;  2NNY A;  4I01 A;  2DLL A;  3LQR A;  3WG9 A;  5CVU A;  4P96 A;  1BI2 A;  1U78 A;  2G7H A;  4A2U A;  3BWG A;  3M8F A;  2IW5 A;  2YSR A;  3GEZ A;  2RGV A;  4UHT A;  5HDK A;  1S29 A;  3KP3 A;  1T0F A;  5H6R A;  1R23 A;  1SMT A;  4B09 A;  3GZ5 A;  2FNP A;  2DPU A;  4L5J A;  1Z6R A;  3EUH A;  5BPD A;  1BI0 A;  2EFQ A;  2C6Y A;  1R1U A;  2VBW A;  3P9C A;  3WTZ A;  4N9H A;  1HST A;  2F5E A;  3I53 A;  1SD4 A;  4WK8 F;  1DPR A;  1ZH5 A;  3ROU A;  3HHG A;  5E1W A;  3J81 K;  1J2X A;  1RZ4 A;  1G4D A;  3IKT A;  1IZ1 A;  2DI3 A;  1FSE A;  5LGT A;  3IRQ A;  3F72 A;  2NAZ A;  1YG2 A;  1DP7 P;  3WE3 A;  4WWC A;  2X0L A;  3T0Y A;  3R0A A;  4KIB A;  2RDP A;  4ZZD A;  5DD4 A;  1FSH A;  4E70 A;  1BIA A;  3T8R A;  5AON A;  5F6F A;  5D5W B;  4OU0 A;  1ZG1 A;  1O7L A;  3HHH A;  4EMS A;  3TOB A;  1RI7 A;  2VC0 A;  3KZZ A;  4FT8 A;  1QGP A;  3BY6 A;  2LDU A;  5CLS A;  1R1V A;  5DUI A;  2D1V A;  4XSZ F;  2M5W A;  2V1D A;  5CVV A;  2DFI A;  4P5O A;  2WV0 A;  3RTR A;  1I5Z A;  1LNW A;  5KK1 A;  3KFW X;  4KN7 X;  3MEX A;  4TV7 A;  3GFM A;  2YR2 A;  2NYX A;  2NNN A;  3GF2 A;  1D8J A;  2D45 A;  5IT9 K;  1KU2 A;  3K1N A;  2V1U A;  1WQ2 A;  4RGX A;  1F9N A;  1WWX A;  2H09 A;  3CUO A;  3ZMS A;  1Y0U A;  4NQW A;  5HDN A;  2XV4 S;  2EV5 A;  3CUQ C;  1FZP B;  3VOE A;  1R22 A;  2GA2 A;  2P7C B;  1BJA A;  2XAG A;  4OIR F;  1IN6 A;  4A5M A;  3BZ6 A;  3WGG A;  1FNN A;  4RB2 C;  4UXN A;  5LRR A;  2OZU A;  4HZF A;  1IXS B;  5HVQ C;  3J7A O;  3HRS A;  2YPR A;  4K2E A;  4M72 A;  5FFX A;  3N97 A;  2A07 F;  1H9T A;  4BAY A;  5ICG A;  3E6C C;  1FX7 A;  5DEQ A;  3J80 Z;  5BQT A;  2JT1 A;  2KIM A;  1W5T A;  2QBY B;  1USS A;  3MQ0 A;  4MTE A;  4M9X A;  3M7G A;  4MEX F;  4ESJ A;  1P6R A;  3EQL F;  5ILU A;  2LF8 A;  4HX4 A;  4KIG A;  3R61 A;  5CVR A;  1NHA A;  3WU0 A;  3E6M A;  2VBZ A;  1ZLJ A;  3JAM Z;  2FOK A;  1KGS A;  2CW0 F;  1FWZ A;  1G3S A;  4CO8 A;  3ZPL A;  2QEN A;  2O8X A;  3FHZ A;  1P4A A;  1D3Y A;  5D5X B;  2K4B A;  2O0Y A;  1IN7 A;  1SD7 A;  5L3E A;  2JPC A;  1G6N A;  1R7J A;  3LAJ A;  3K69 A;  5JI6 A;  4ESF A;  1R5H A;  1MD0 A;  3K0L A;  2NS0 A;  4N0B A;  2GAU A;  2KJC A;  1BN5 A;  1LJ9 A;  3Q9S A;  1Z6T A;  3V8L A;  2FBI A;  2XAS A;  1T6S A;  3TDZ C;  5L3D A;  2PLY A;  1REP C;  3B02 A;  2FMY A;  4HAM A;  3D5L A;  3ZMV A;  1LDK B;  3I58 A;  3F21 A;  5LEK A;  2DK5 A;  1FBQ A;  2OD5 A;  3E5U A;  4BHB A;  1XMK A;  3GO5 A;  2BGC A;  3ZN0 A;  2A3S A;  3K1M A;  1RUN A;  1MJ9 A;  4U7B A;  3KEO A;  1OYI A;  1T39 A;  5F64 A;  1S8N A;  1ULY A;  3WTX C;  1S7A A;  4IJA A;  3IRR A;  1TTY A;  2BV6 A;  3HRU A;  3HOT A;  4Y13 A;  2VN2 A;  4LLN A;  3I71 A;  4ENJ A;  2VT2 A;  1EH6 A;  4BQA A;  2EFO A;  4WX9 A;  2QZ8 A;  2EA4 A;  2QUF A;  3I59 A;  3KEQ A;  1UFM A;  2XAJ A;  5FD5 A;  4HV5 A;  1R36 A;  3U9G A;  1TNS A;  3P9K A;  4ENN A;  4HYE A;  2FBH A;  1JHF A;  2EV6 A;  5CVI A;  1U2W A;  5AIQ A;  2OU2 A;  4ENK A;  3RKY A;  4AIJ A;  3J81 Z;  4KMU X;  1PP7 U;  1W7P B;  5FD6 A;  3F22 A;  2Z3Y A;  1L0O C;  4XBF A;  4EJV A;  3ELK A;  3REO A;  1Z1D A;  3E3V A;  2Q2E A;  4A6D A;  1G3W A;  4B8X A;  2LNB A;  4UV8 A;  4OMY A;  1KYZ A;  3BPX A;  5K5R A;  1FBS A;  3T5X A;  2E1C A;  2IA0 A;  2A68 F;  4LLL A;  3RYP A;  2XRO A;  4KMF A;  3FM5 A;  4G7Z F;  3U1D A;  4KYW A;  2F5C A;  1HSJ A;  1STZ A;  1V3F A;  2FNA A;  1F4K A;  2R7F A;  4HDV A;  4EGY A;  2Y0M A;  1J59 A;  4JK1 X;  4GO1 A;  3NQO A;  3WGI A;  1O57 A;  2HDC A;  1CF7 B;  2FBK A;  2RV8 A;  2XAQ A;  2VE8 A;  3VOD A;  2QQB A;  5DUK A;  1BI3 A;  3VFZ A;  4HBL A;  4KNY A;  3BP8 A;  1WSU A;  4LD5 A;  5IT9 Z;  1YW7 A;  1K6O A;  2R7D A;  2K02 A;  4WF2 A;  3IWZ A;  3V7R A;  1K79 A;  3EYY A;  1HKT A;  2Z9O A;  1B9N A;  4M6Y A;  1HKQ A;  3F8M A;  3KLN A;  4CGZ A;  3VEP A;  3PFI A;  3JSP A;  3M8E A;  4BNC A;  4S04 A;  3H92 A;  1FOK A;  4LB6 B;  4PGH A;  3C1D A;  5LHG A;  4OIQ F;  4KUM A;  1T38 A;  1IAW A;  3I64 A;  3GFL A;  2P8T A;  2ISZ A;  4I0B A;  4G6Q A;  4P9U A;  1EH8 A;  4BXU A;  1XSV A;  1YTY A;  2PI0 A;  5EEG A;  3LST A;  4N9I A;  3KET A;  3CJN A;  3NRV A;  1KQ9 A;  3PQK A;  2J5P A;  3ABU A;  3CTA A;  3W6K B;  1U5T B;  1YW8 A;  3WTS C;  3HRM A;  4OMZ A;  4A6E A;  4NB5 A;  5FO5 A;  4ZYD A;  5JHU A;  1YFH A;  3BDD A;  4MHG A;  1FP2 A;  3V8K A;  3W6J B;  1RIO H;  1EV7 A;  5LHH A;  4P55 A;  5FLX Z;  4U0Y A;  3WE2 A;  2ACJ A;  5E20 A;  2H94 A;  1C0W A;  1F5T A;  4HOB A;  1F1Z A;  3PQJ A;  2OBP A;  5D4R A;  2ZO4 A;  2BYV E;  2Z33 A;  3F8B A;  2ZKZ A;  4AVP A;  1FYM A;  4O5V A;  3GXO A;  1QNT A;  2QQ9 A;  1TNT A;  4U88 A;  1LEB A;  3FMQ A;  2UXN A;  2XRN A;  1ON2 A;  3CUQ B;  3FMS A;  1RNL A;  1IN5 A;  2VBX A;  3GW2 A;  4EJW A;  2DU9 A;  4YFK F;  3CUQ A;  3FX3 A;  4M71 A;  1AWC A;  2LSO A;  2PMH A;  3L7W A;  3WTT C;  3GWZ A;  1J0R A;  5AIP A;  1H0M A;  4EQQ A;  3QPT A;  2ZME A;  3O2P E;  2ETH A;  4KDP A;  1ZAO A;  4EV0 A;  5ILS A;  1TBX A;  4IVN A;  4HLY A;  4GGG A;  3ZQ7 A;  4ZYG A;  3IWF A;  3ZMU A;  3GVA A;  2CFX A;  2AS5 F;  4DQ2 A;  5HS9 A;  1YS6 A;  4EVI A;  3MZH A;  4FHT A;  3FM3 A;  4Q47 A;  3V8J A;  3TO7 A;  3E5Q A;  5ICE A;  2VON A;  1UHM A;  2DW4 A;  4IRG A;  4UVA A;  4DNC A;  1JE8 A;  5LGU A;  1IXC A;  3HSF A;  3LQQ A;  1HXD A;  1Z91 A;  2WTE A;  4QLC U;  2AXL A;  3H3Z A;  2GXG A;  4PZJ A;  2V9V A;  4Z2Y A;  2D1H A;  3TKY A;  4D0P A;  3EET A;  4HDU A;  3D0S A;  3IL2 A;  4G7O F;  1BBY A;  1J5Y A;  3GZ6 A;  1XGM A;  2P5K A;  3V4G A;  2DPD A;  2GIV A;  2FXA A;  1XN7 A;  1IN8 A;  1TQI A;  4Q4Z F;  3F6V A;  4G6D A;  3BJA A;  5HLG A;  1SFX A;  1TW2 A;  3RKX A;  3ECO A;  5LGN A;  4I2O A;  2H6C A;  4RAY A;  2YU3 A;  5L3C A;  3ERE D;  2G7U A;  4AIK A;  3OOP A;  3EDP A;  2L01 A;  2XKO A;  2XAF A;  3RKW A;  1OKR A;  3QAH A;  2STT A;  3KP7 A;  2Y75 A;  2L54 A;  2OAZ A;  4EJU A;  2XHK A;  5D6E A;  3G73 A;  3HYI A;  2L4M A;  3KP2 A;  2YX7 A;  2BEO A;  2RKH A;  4U0V A;  5K1Y A;  1XCV A;  2HZT A;  3HSE A;  3K2Z A;  5ERI A;  3HSR A;  1O3R A;  1I6X A;  2HTJ A;  2UXX A;  4P9F A;  1XGO A;  4M74 A;  3WOD F;  3ZMT A;  3HRT A;  5J6X A;  1S3J A;  3BJO A;  1A04 A;  3ML6 A;  5DD8 A;  4HA8 A;  5D4S A;  4LLG F;  3CO7 C;  2ZCW A;  4RS8 A;  3FWE A;  5ICF A;  5BOX A;  3I4P A;  1ZRC A;  3Q5F A;  1U6G A;  1V4R A;  2QLZ A;  3F6O A;  4G94 A;  1DUX C;  3IKV A;  1W5S A;  2PMU A;  5FLX K;  1I1G A;  3RPU A;  2P5L C;  1ZYR F;  5LBQ A;  5E8I A;  1HW5 A;  2W25 A;  1K7A A;  2VOO A;  2FE3 A;  2W85 A;  3SZT A;  2F5F A;  2PEX A;  2L4A A;  4G9Y A;  4RB0 A;  2ZNY A;  2OQR A;  3RJP A;  1YS7 A;  1WI9 A;  5FB2 A;  3DFG A;  3FZV A;  4H0E A;  3C18 A;  2VT3 A;  3WGH A;  1UHW A;  1O3S A;  2ZFW A;  3F3X A;  2M8E A;  4ZZL A;  2STW A;  1UB9 A;  3ZN1 A;  2BE5 F;  1O7F A;  4BH9 A;  4ON0 A;  2QWW A;  1XMA A;  5IT3 A;  3F8N A;  2G9W A;  1QQI A;  2W24 A;  1P4W A;  1SD6 A;  1LDJ A;  1FT9 A;  2O3F A;  3MAJ A;  2H6B A;  4HF1 A;  3WU1 B;  3E97 A;  4QWQ A;  3JW4 A;  1OYY A;  1RUO A;  1FP1 D;  2HKO A;  5J8F A;  2XKP A;  3F8C A;  1WKM A;  4F7Z A;  1KU7 A;  2UZK A;  2QYO A;  2W84 A;  2IVM A;  3VB2 A;  3TGN A;  4KIF A;  3JTG A;  1YO5 C;  3I59 B;  2LF7 A;  2EJR A;  2HYG D;  3CDH A;  3AAF A;  1XCB A;  1BC8 C;  4M9Z A;  3ULQ B;  3I0T A;  4O3M A;  2VOP A;  2TDX A;  4XSX F;  2HS5 A;  3LWF A;  5H20 A;  4EJT A;  1GXQ A;  3LAP A;  2JSC A;  3FF5 A;  4O6J A;  3KE2 A;  4IHS A;  1H9G A;  5TJJ A;  5ILV A;  2COM A;  4L9T A;  3BRO A;  2HEO A;  2DK8 A;  3HTU A;  1BOA A;  3RI4 A;  2IT0 A;  3Q9V A;  4S05 A;  4MGR A;  2YX4 A;  1GXP A;  1OMI A;  2FU4 A;  2ELH A;  2F2E A;  5JVT A;  5DDG A;  3V7C A;  3GYH X;  3CO6 C;  1YW9 A;  2CWE A;  4KIC A;  4OIN F;  3COA C;  5E8G A;  3DQV C;  1IRF A;  1JHH A;  2Q0O A;  4GXO A;  2CQK A;  2K7L A;  4A5N A;  5DYM A;  4A0Z A;  2XVC A;  2CSO A;  1FLI A;  5DV5 A;  4CDG A;  4I09 A;  4CIC A;  3SXY A;  3DP7 A;  1MDM A;  1XGN A;  3GFI A;  1QBJ A;  3ECH A;  3BOQ A;  3ISP A;  5BPI A;  1KQ0 A;  1OYW A;  1GHC A;  2VC1 A;  4KN4 X;  2VXZ A;  3DEU A;  1K78 A;  3E6B A;  4MTD A;  1KU3 A;  1IRG A;  4WXH A;  4ASN A;  1TLH B;  1B4A A;  2CO5 A;  2WC2 A;  3KZY A;  5A2Q K;  4R79 A;  1HW2 A;  4CZZ A;  1QZZ A;  2DT5 A;  1R1T A;  2M1B A;  4A0Y A;  2EV0 A;  3TO6 A;  1S6L A;  1E17 A;  4ZYH A;  4LG0 A;  4IRI A;  5DCM A;  4GYG A;  2GWR A;  2MH2 A;  2EFW A;  2RN7 A;  3WTY C;  4I0A A;  4CYD A;  1FYL A;  2NRA C;  1SAX A;  2EFP A;  3O6B B;  3GX4 X;  5CJ9 A;  5HLI A;  3LA3 A;  3ABT A;  2IPQ X;  4A12 A;  2GZW A;  2KRF A;  3OV8 A;  4AWX B;  4UV9 A;  2O6G E;  4L9V A;  3C7J A;  2ESH A;  2OZ6 A;  2R3S A;  4EJO A;  3L2C A;  1HQC A;  2MD5 A;  2Z99 A;  4HLX A;  4UVB A;  2CYY A;  1BIB A;  2VBY A;  4CXF A;  2HWV A;  4FX4 A;  5HOO A;  1UST A;  3N4M A;  4G7H F;  4GCV A;  3K9T A;  4HW0 A;  2IJL A;  2FRH A;  2A6E F;  1B6A A;  1P92 A;  2Q8K A;  4YFX F;  5H6Q A;  5KVR A;  2DQL A;  3SHF A;  2E7X A;  3T1B A;  2P5V A;  3GUD A;  5LRS A;  2EA2 A;  2FEZ A;  3S2W A;  4KFC A;  2F5D A;  2K86 A;  3RPQ A;  2MBF A;  1B59 A;  2KKO A;  2BBY A;  1DDN A;  3O3K A;  5EEH A;  2ZME B;  4PCQ A;  1IF1 A;  1D8K A;  2A61 A;  3KP6 A;  4YIF A;  1I1S A;  3WTW C;  1Q1H A;  4IPA A;  3ZP5 A;  2O61 A;  2IA2 A;  2P7V B;  3JSO A;  2MLG A;  1LEA A;  3DF8 A;  3L9F A;  4ZH4 F;  4LMY A;  1E2X A;  2DO7 A;  2DAO A;  3QU3 A;  2MLK A;  3IC7 A;  4L5I A;  3QP6 A;  4IXA A;  4L0Z B;  4RGS A;  4EM0 B;  3QU6 A;  3MCZ A;  1MJB A;  2JPB A;  5HLH A;  2GQQ A;  4NHJ A;  4HF0 A;  2K4J A;  4M9S A;  2MA3 A;  3I54 A;  4BHC A;  1BI1 A;  3QOP A;  2DBB A;  2M45 A;  1SFE A;  2LKP A;  1SFU A;  3M1E A;  2PG4 A;  4L18 B;  3F8F A;  2XGX A;  3T8T A;  4BHP A;  3G3Z A;  1FC3 A;  2IA1 A;  1B1B A;  2ESN A;  2Z5U A;  1XB4 A;  2ZNZ A;  1R58 A;  4IF4 A;  3SFZ A;  4LK1 F;  3TO9 A;  5BS6 A;  3MFK A;  4I7H A;  2HR3 A;  1TQM A;  4ZYE A;  5ED4 A;  2HQN A;  1U5T C;  1SD5 A;  3LFK A;  4WXC A;  3DPT A;  4M73 A;  2ZJ2 A;  5D5U B;  1L3L A;  3GLX A;  2OA4 A;  4RAZ A;  5ICC A;  4WXD A;  1ONV A;  1EH7 A;  5TRD A;  1FY7 A;  4AD9 A;  2CG4 A;  3MWM A;  1XDU A;  5JFR A;  1TQP A;  3SZP A;  4XLP F;  1QO0 D;  2JZY A;  3U2R A;  3JTH A;  1LVA A;  2L3D A;  1QPM A;  4G8X A;  3WTU C;  4UUV A;  3H3U A;  1S7O A;  1MKM A;  5J8C A;  1R5G A;  1BC7 C;  1IXR C;  4LK0 F;  4YFN F;  4LGW A;  2WWY A;  5FFZ A;  2EB7 A;  1GVJ A;  4OIP F;  4UNO A;  1PP8 F;  1ZRF A;  4KA4 A;  4R8H A;  1IUY A;  4U7D A;  3R0J A;  3HIF A;  3KCC A;  2KIU A;  4L9N A;  4WCG A;  4RB3 C;  3DXJ F;  5A2Q Z;  4Y15 A;  3RIR A;  3FXR A;  4LB5 A;  5LHI A;  4HF2 A;  3P7N A;  2PN6 A;  3C3W A;  5HDG A;  4RGU A;  1OR7 A;  2DTR A;  3TQN A;  5HS7 A;  2MH9 A;  3ZMZ A;  2J5O A;  4LFU A;  1MZB A;  3QPH A;  1TW3 A;  2L02 A;  1XSX A;  1CGP A;  3HTS B;  3LA7 A;  5D8K B;  1ZN2 A;  5L3G A;  5LLQ A;  3GFJ A;  4BYY A; 
#chains in the Genus database with same CATH topology
 4ZC3 A;  1YQA A;  4ZDO A;  3HOU J;  4HQE A;  2FF4 A;  3QQA A;  1S9H A;  3A0B C;  4I98 B;  2IP2 A;  1QZY A;  3L09 A;  4DBQ A;  4HG2 A;  2ZXH A;  3SQN A;  1MBJ A;  2HGC A;  5JVG F;  1SC7 A;  2LLK A;  2V79 A;  1LDD A;  5M3F J;  2QBY A;  2JMW A;  3M9A A;  3CCE I;  1K6Y A;  2MC4 A;  4FX0 A;  1VQP I;  1MGT A;  1JKQ C;  3QRF F;  1FPQ A;  2X6O A;  3MMY B;  4GRI A;  4L0Y B;  5BMZ A;  2GIZ A;  4NDL A;  4CHU A;  3MZY A;  4UB6 C;  4ENM A;  2H1K A;  1MMS A;  3GBG A;  4E7H A;  2FML A;  3I5U A;  5F04 A;  2R7X A;  1G3Y A;  2R7Q A;  4U0W A;  1XGS A;  4XLN F;  2KDZ A;  4ANJ A;  4EGZ A;  1TT5 B;  3CLQ A;  2Y30 A;  4BDZ A;  5E17 F;  1R00 A;  3P9I A;  4DYC A;  1WJB A;  4Y3O A;  2HPI A;  1UCR A;  4ESB A;  4XON A;  1HDD C;  1LQ1 A;  1JJ8 C;  1H89 C;  2NVT J;  2WBM A;  5E3L A;  3DPL C;  2CGP A;  4LJZ F;  4IHT A;  2XF6 A;  1PUE E;  5D8L B;  5B5E C;  3E5X A;  1ZRD A;  4YIR X;  2ID3 A;  1S5L C;  4G6T B;  2IGN A;  4Y33 A;  1I27 A;  2XF7 A;  1P2F A;  4R1H A;  4C30 A;  5E18 F;  2X6X A;  2F48 A;  5FRM A;  4QPO A;  4Q5S F;  5FKL A;  3S16 J;  1JTY A;  5JR3 A;  3ZMD A;  4CCJ A;  3P5J A;  3V42 A;  5DS9 A;  3PIO F;  1VTN C;  2Q1Z B;  2L9R A;  1LFB A;  4Y17 A;  5EGO B;  2QM3 A;  2GXB A;  3MZ8 A;  1MIJ A;  2ECC A;  3ZQC A;  3QP5 A;  1W5C C;  1D0X A;  4RGR A;  3SYT A;  1D5V A;  2HFH A;  1KA8 A;  1IW7 F;  1OCZ H;  2V1X A;  1Y56 A;  2I10 A;  1TWG J;  4BAC A;  2OTL I;  1ZAR A;  2RNJ A;  1D1B A;  4CCO A;  1DPU A;  5KCM A;  5FJ8 J;  3FMR A;  1UAA A;  4RA2 A;  3HOY J;  5DCF A;  2MC3 A;  4M3D A;  1T2K A;  1X1P A;  3GME A;  4I99 C;  1FBU A;  1YX3 A;  2O03 A;  2PQ8 A;  3FKJ A;  1W4M A;  1X3U A;  1T98 A;  2OC6 A;  2LY1 A;  4AIH A;  2BY3 A;  2P4W A;  3GTJ J;  1X58 A;  2LTP A;  4ETS A;  5HOD A;  3E6D A;  2CS3 A;  4YII A;  5E1Z B;  1ODD A;  1ZGA A;  1I50 J;  4M6X A;  2EWN A;  3BLY A;  3TOA A;  2FX0 A;  4HV6 A;  1TP4 A;  3B73 A;  4I02 A;  3RDI A;  4PJJ A;  1KYW A;  9ANT A;  1YLF A;  1ZRE A;  1SFO J;  2VQL A;  1AOY A;  3H0D A;  1J75 A;  2X4H A;  1D5Y A;  1OPC A;  2ADU A;  3A2K A;  4PFO A;  3LSI A;  3BR2 A;  3HEF A;  1RKW A;  1J7K A;  4PFP A;  6PAX A;  3LOC A;  3DV8 A;  2VOD A;  1Z3Y A;  2LFB A;  5LEJ A;  1ZKG A;  2EK5 A;  1VQ6 I;  2A69 F;  3CD6 I;  2M30 A;  1KU9 A;  3GZN B;  1JKO C;  2R0Q C;  1VQM I;  4JQF A;  2A6H F;  4PK4 A;  4A0X A;  3OYC A;  2XPW A;  4XRS A;  4XK4 A;  4RB1 A;  1JT0 A;  5D6F A;  3DKY A;  4F92 B;  1J09 A;  2EFN A;  3R6S A;  5L3B A;  1MMA A;  2ELJ A;  3IHU A;  3V7S A;  3X2Q H;  3R4K A;  3L00 A;  3VDX A;  1MSE C;  4MNU A;  1J9I A;  3DEW A;  2IRF G;  2V6C A;  1W7P D;  1HW1 A;  4JX4 A;  3HOZ J;  1VQK I;  2EBI A;  3PUB A;  4YRV A;  2CU7 A;  1OCT C;  2ZBK A;  2A5Y B;  5K5O A;  1W7P A;  1O3Q A;  2HOE A;  4QSH A;  5F27 A;  2Y9Y A;  2JRT A;  3I3L A;  4Q48 A;  2WAQ A;  1ZHF A;  1FIA A;  1Y6I A;  2OQG A;  4JP0 A;  5F1J A;  4M3F A;  3ZQQ A;  4AID A;  2JTV A;  1Q1V A;  1WH7 A;  4RM3 A;  4AU7 A;  3OYH A;  1JKP C;  1UEL B;  2FSW A;  3K1P A;  1MDM B;  1ZG3 A;  1XDS A;  2FJ1 A;  1O3T A;  2R4G A;  3VYR B;  2XIG A;  1UJ8 A;  2QQA A;  2HQR A;  2OV7 A;  5LFA A;  4BS9 A;  3OYM A;  4XLH A;  2LP0 A;  4GYI A;  4MQV A;  4E7J A;  2WA0 A;  3G1M A;  1EF4 A;  4UVC A;  2HYF A;  1K78 B;  2RRE A;  1FOX A;  2L9S A;  3QOE A;  1SFK A;  5CYV A;  4IO9 F;  4BDY A;  2H27 A;  1B9M A;  3HOV J;  1W36 D;  2CUZ A;  3FXK A;  1TWH J;  2RC4 A;  3TP0 A;  2CW7 A;  3BJ6 A;  5K5Q A;  3TL4 X;  1Z9C A;  1XC5 A;  1QA6 A;  2UWM A;  4F52 A;  1ETQ A;  5F0F A;  5JLX A;  3WTV C;  2EH3 A;  2EIJ H;  2TRT A;  3QPL A;  3TMO A;  3LA2 A;  3VYT B;  2LC2 A;  2LBF B;  5K7H A;  5B66 C;  1CF7 A;  1KQ8 A;  1HBX G;  2ZSH B;  3TW7 A;  2L9N A;  1YOV B;  1XSD A;  3KP4 A;  1OCR H;  2VE9 A;  4MQ9 F;  3GTL J;  3HGG A;  4LG0 B;  3ABL H;  4LG3 A;  5EYR A;  1BM9 A;  4A93 J;  1FYK A;  3HOS A;  5J1Y A;  3NEU A;  1PDN C;  1SMY F;  3DKW A;  4EM1 A;  5TIS C;  3EYI A;  5DCM B;  1A31 A;  3OL3 A;  2XAH A;  4X6A J;  3DLL F;  2LH9 A;  2GOX B;  3S3N A;  4D7M A;  3HC7 A;  2HTS A;  3KYD B;  4PGG A;  3RYR A;  5FLV A;  1QVT A;  1YIO A;  5L3F A;  2XPU A;  4FQG A;  2E2I J;  3HG9 A;  3J80 K;  2XRL A;  2NVU B;  1BOB A;  2IS6 A;  3DU5 A;  5HS8 A;  2K85 A;  3CF2 A;  2CQ7 A;  5KAF C;  3GTK J;  2CMP A;  3MVP A;  4Y4R A;  2MFZ A;  2CUJ A;  4IRH A;  3CMY A;  1BJZ A;  1ZLK A;  2KIF A;  2EPF A;  3FXU A;  4BQN A;  2L2O A;  3ZXS A;  5J1U A;  3KP5 A;  2P6T A;  3KLO A;  2DQR A;  2K27 A;  4NUB A;  2RVC A;  2P6S A;  4QTR A;  4PDK A;  2FA5 A;  1G3T A;  2HKX A;  4OOI A;  1W0U A;  2VJ4 A;  5D5V B;  2DYR H;  2BVM A;  1WRJ A;  1XD7 A;  2E1O A;  4XRF A;  4XLF A;  3K4M A;  1F36 A;  1MJA A;  2D2W A;  3OIP A;  2IS4 A;  5CVJ A;  5J3L A;  3JAM K;  4PJN A;  2WAQ N;  2AQE A;  1JXS A;  1T8I A;  2DYS H;  2XAU A;  3DWL E;  4L9J A;  4KT5 C;  4A3E J;  3CC2 I;  5F1R A;  2ZXJ A;  2M87 A;  3CLO A;  3FXQ A;  2MD0 A;  2W57 A;  2RQP A;  5GTI C;  3W2V A;  4HQM A;  1LB2 A;  4MEY F;  5FGM A;  4OIO F;  2QKM B;  1T95 A;  2F4O B;  1FMV A;  2B0L A;  3R60 A;  3PFY A;  2XB5 A;  4YG2 F;  2LR8 A;  3IAM 2;  1FTZ A;  2XUB A;  1YRN A;  4JBA A;  3VYS B;  3HOX J;  1ZG5 A;  1RR7 A;  2MG4 A;  2M0M A;  1MBK A;  1U3E M;  2QSG X;  4J19 A;  2KJB A;  3HDD A;  1Z7U A;  2E7W A;  4HX8 A;  1IN4 A;  2DMP A;  2W48 A;  5CPR B;  1IUF A;  4EM2 A;  2FQ3 A;  2IGO A;  1WJD A;  2PBI A;  4RLF A;  5IOY A;  2XGE A;  1U5T A;  5C4J J;  3HUG A;  3LSR A;  1YYV A;  3HZJ A;  2KRC A;  5F0C A;  3OS2 A;  1ZGJ A;  2GA1 A;  4HX7 A;  1U8R A;  3F23 A;  1ON1 A;  2E1N A;  1P4X A;  3A01 B;  5EEA A;  4B44 A;  2PX9 A;  5IP7 J;  2X6W A;  2Y48 A;  2QVO A;  2ZJR F;  3TDU C;  3OY9 A;  5E1X A;  4JYK A;  1Z77 A;  2PJP A;  2R7Z J;  3QOD A;  3BPV A;  3UKG A;  3H9G A;  4QPQ A;  3DTE A;  2ISY A;  1HKS A;  1QHH D;  1Z05 A;  2PFB A;  3HB9 A;  4H4K C;  1NK2 P;  1JGS A;  2NNY A;  4I01 A;  2DLL A;  3LQR A;  3Q0W A;  3WG9 A;  3BQY A;  5CVU A;  4P96 A;  2E5Z A;  1BI2 A;  1U78 A;  2G7H A;  1Z3X A;  4A2U A;  3BWG A;  3M8F A;  3DBH B;  2IW5 A;  2K9M A;  2YSR A;  4NBQ A;  4UB8 C;  3GEZ A;  3H3V K;  2M34 A;  5DTD A;  2RGV A;  4UHT A;  2M2E A;  5HDK A;  3S15 J;  1S29 A;  3KP3 A;  1T0F A;  4BUP A;  3AL0 B;  5H6R A;  1R23 A;  1SMT A;  4B09 A;  1FOY A;  1VQ5 I;  4ZTJ A;  2KLO A;  4BE2 A;  3GZ5 A;  2FNP A;  2DPU A;  1BW5 A;  3K4K A;  4L5J A;  1E3H A;  1Z6R A;  3EUH A;  5BPD A;  1BI0 A;  3JR9 A;  2Y9Z A;  2EFQ A;  2C6Y A;  2JN6 A;  2KT0 A;  1R1U A;  2VBW A;  5EZH A;  4IZZ A;  4V2G A;  3P9C A;  3WTZ A;  4DOZ A;  4N9H A;  2LYC A;  1HST A;  1PJR A;  2F5E A;  2V9K A;  3CCY A;  3I53 A;  5IYC J;  1SD4 A;  1MMN A;  4WK8 F;  1DPR A;  1Y39 A;  1WH5 A;  1ZH5 A;  1VQ9 I;  2I8D A;  1OCP A;  2MAB A;  3ROU A;  2QSF X;  3HHG A;  5E1W A;  3J81 K;  2ZXW H;  1I3A A;  1J2X A;  1RZ4 A;  1G4D A;  2IGM A;  3IKT A;  1IZ1 A;  2DI3 A;  5EG0 A;  1FSE A;  1GV5 A;  4XNF A;  5LGT A;  3IRQ A;  2JA6 J;  3F72 A;  2NAZ A;  1YG2 A;  1WCM J;  2L5Q A;  1DP7 P;  3WE3 A;  4WWC A;  4IOA F;  2X0L A;  4DZP A;  3OYA A;  3T0Y A;  3R0A A;  2NOG A;  4I6Z A;  4KIB A;  2RDP A;  3N05 A;  4ZZD A;  5DD4 A;  1FSH A;  4E70 A;  1BIA A;  3T8R A;  2P0W A;  4PJL A;  2K3F A;  1RR8 C;  5AON A;  5F6F A;  5D5W B;  4OU0 A;  4HRI A;  2DOE A;  2E34 A;  2VB6 A;  1GT0 C;  1ZG1 A;  3L2W A;  1O7L A;  2OPT A;  4XN3 A;  3HHH A;  4EMS A;  1R4M B;  3CP2 A;  1RI7 A;  3TOB A;  2VC0 A;  3KZZ A;  2BHZ A;  4FT8 A;  1QGP A;  1TL8 A;  2HDW A;  2IS2 A;  3SEZ A;  2JJ7 A;  1X2N A;  2LDU A;  3BY6 A;  1HC8 A;  5CLS A;  1R1V A;  5DUI A;  1FOW A;  4CYC B;  2HI3 A;  1CQT A;  4II2 A;  5LD2 C;  2D1V A;  5M5X J;  2JA7 J;  2V6E A;  4XSZ F;  4XKW A;  2M5W A;  3E0J B;  1EJ9 A;  2V1D A;  5CVV A;  2VXD A;  2JWT A;  3L2R A;  2Z2S B;  2DFI A;  4P5O A;  2WV0 A;  1H88 C;  3RTR A;  1I5Z A;  1ENH A;  1OFC X;  1LNW A;  4HNT A;  5KK1 A;  3GCM A;  3KFW X;  2BW3 A;  4KN7 X;  3MEX A;  4CA0 A;  1SEU A;  2QKL B;  5FKO A;  4TV7 A;  3GFM A;  1V5E A;  4CCM A;  2YR2 A;  2NYX A;  1RES A;  2NNN A;  3GF2 A;  1D8J A;  2D45 A;  5IT9 K;  1FTT A;  1KU2 A;  3K1N A;  2V1U A;  3BCA A;  1WQ2 A;  4CSW A;  4ZJZ A;  4RGX A;  1F9N A;  1WWX A;  1VFC A;  2DMQ A;  3RQI A;  2HQ5 A;  1ORK A;  2H09 A;  2H8W A;  3BZC A;  2F4M B;  1Z0X A;  4XMY A;  4E7S A;  2XDV A;  3CUO A;  3ZMS A;  1Y0U A;  4NQW A;  3JRH A;  5HDN A;  2CH0 A;  2XV4 S;  3VPR A;  2EV5 A;  2DDB A;  2IGK A;  3CUQ C;  3FXL A;  1FZP B;  3VOE A;  1R22 A;  2GA2 A;  2ME6 A;  3ZQH A;  3H36 A;  3RZD J;  1BJA A;  2Y2Z A;  2P7C B;  5H2F C;  2XAG A;  4OIR F;  1XPX A;  1IN6 A;  4A5M A;  3BZ6 A;  2ZME C;  4DBR A;  2HOT A;  3WGG A;  1I6H J;  4X0G A;  4IHY A;  1FNN A;  4A3L J;  4RB2 C;  4UXN A;  4U87 A;  5LRR A;  2OZU A;  2VAS A;  2X1C A;  3FXJ A;  4HZF A;  1IXS B;  2VQG A;  1SVO A;  4FE7 A;  4D9J A;  5HVQ C;  2K9N A;  3J7A O;  1LE8 B;  2PJR B;  4B3X A;  2WY8 Q;  3HRS A;  2BVL A;  2QSH X;  2YPR A;  4K2E A;  4M72 A;  5FFX A;  2LKX A;  3N97 A;  2A07 F;  5CQE A;  3KZI C;  1H9T A;  4BAY A;  1OJL A;  3E7L A;  2X9D A;  1FX7 A;  5ICG A;  1SVM A;  3E6C C;  5DEQ A;  2MW8 A;  5BQT A;  3J80 Z;  2ZSI B;  2JT1 A;  1S72 I;  2VKE A;  2KIM A;  3K4N A;  1W5T A;  2EQR A;  5BNG A;  2QBY B;  1BA5 A;  1USS A;  4F91 B;  3MQ0 A;  2LRE A;  4MTE A;  2DT7 B;  3BTI A;  5KHD A;  1ETV A;  2GOM A;  4M9X A;  3M7G A;  5J40 A;  2LD5 A;  4ESJ A;  4MEX F;  2KIS A;  3W6V A;  1YE9 A;  1P6R A;  3EQL F;  5ILU A;  2LF8 A;  2A05 A;  4HX4 A;  1A6Q A;  4KIG A;  1V55 H;  2Y0S A;  4HST A;  3R61 A;  5CVR A;  3RPU D;  2DMU A;  3RSN A;  2EZI A;  4A69 C;  4XOR A;  3MKL A;  3S1R J;  1NHA A;  3WU0 A;  3E6M A;  2VBZ A;  1WJ5 A;  1ZLJ A;  3KYL A;  3JAM Z;  2FOK A;  3CMM A;  1KGS A;  2ZC2 A;  2DA2 A;  2CW0 F;  1FWZ A;  1I39 A;  3S3O A;  1G3S A;  3G1O A;  4CO8 A;  3LSM A;  3H5R A;  4S0H B;  3ZPL A;  2NOJ B;  3JRB A;  2QEN A;  4PUS A;  4L5E A;  2O8X A;  2DOD A;  2X48 A;  3FHZ A;  1P4A A;  4HSR A;  1D3Y A;  2CQX A;  2JSP A;  3VWB A;  5D5X B;  4Y52 J;  1BW6 A;  2K4B A;  2LOO A;  3RKQ A;  1MSF C;  2O0Y A;  1IN7 A;  1SD7 A;  5L3E A;  5M5W J;  2JPC A;  1G6N A;  1R7J A;  3TBI A;  1S7E A;  2EZH A;  3LAJ A;  3K69 A;  5JI6 A;  2MSY A;  1P9Q C;  3S1M J;  5KAI C;  4BE1 A;  4ESF A;  1R5H A;  1MD0 A;  3K0L A;  2NS0 A;  3PM1 A;  4N0B A;  3OYE A;  2GAU A;  2KJC A;  1BN5 A;  2CRG A;  3U21 A;  1LJ9 A;  3S2D J;  3OOU A;  1MMD A;  3Q9S A;  3HBL A;  3CMA I;  1Z6T A;  3H35 A;  3V8L A;  2E60 A;  2FBI A;  1UMQ A;  2XAS A;  1T6S A;  3TDZ C;  5L3D A;  2PLY A;  1REP C;  3B02 A;  2FMY A;  4HAM A;  2OCC H;  2DA1 A;  2HOS A;  1WVR A;  3D5L A;  3ZQF A;  3ZMV A;  1LDK B;  3I58 A;  4AUX A;  2CJJ A;  3F21 A;  5LEK A;  2DK5 A;  2H1L A;  3OWT A;  1FBQ A;  2OD5 A;  3E5U A;  4BHB A;  1XMK A;  3GO5 A;  2BGC A;  2IS1 A;  3ZN0 A;  2A3S A;  3HPG A;  4N4O B;  3K1M A;  1RUN A;  1MJ9 A;  1YIJ I;  4U7B A;  3KEO A;  5EF6 A;  1OYI A;  1T39 A;  2B63 J;  3JRG A;  1Y1V J;  4C9Y A;  4A3K J;  5F64 A;  2DFH A;  1S8N A;  4DYR A;  3H5A A;  1ULY A;  3IP4 B;  3VSK A;  3WTX C;  1S7A A;  4IJA A;  3IRR A;  2VPL A;  1TTY A;  4E7Z A;  1NTC A;  2M7B A;  2BV6 A;  3HRU A;  3HOT A;  4Y13 A;  2VN2 A;  4IEJ A;  3BG3 A;  2XF5 A;  3ZGK A;  1V5F A;  2NS8 A;  4OAY A;  4LLN A;  3I71 A;  4ENJ A;  4FIS A;  2VT2 A;  1EH6 A;  3C2H A;  3EUA A;  3IH3 A;  4BQA A;  1OLT A;  4BKX A;  2OTJ I;  2EFO A;  4M6V A;  4WX9 A;  5E3O A;  2QZ8 A;  1NG6 A;  2EA4 A;  2QUF A;  2DT6 A;  1G59 A;  3I59 A;  3KEQ A;  3CCM I;  1ITY A;  1UFM A;  2XAJ A;  2Y0S N;  4EAT A;  1XTA A;  5FD5 A;  4HV5 A;  3TED A;  1R36 A;  2L9V A;  3M4O J;  3U9G A;  1TNS A;  4J01 A;  3P9K A;  3OS0 A;  1VQO I;  4X1E A;  4HYE A;  4ENN A;  3RZO J;  2FBH A;  5EJC A;  1JHF A;  3PL8 A;  3GLL A;  2EV6 A;  5CVI A;  4XN0 A;  2VQH A;  3OYL A;  2R7U A;  1U2W A;  5AIQ A;  3DPU A;  2ME0 A;  2OU2 A;  2A6T A;  4Y7N J;  3RKY A;  4AIJ A;  4ENK A;  1FJL A;  3J81 Z;  4KMU X;  3DBL B;  2QQ8 A;  3UR3 C;  1PP7 U;  1W7P B;  2H8R A;  3BT9 A;  5FD6 A;  3F22 A;  2YU9 J;  2Z3Y A;  1L0O C;  2OF7 A;  3MKW B;  1Z67 A;  4XBF A;  4B48 A;  3M3Y J;  3BC8 A;  4EJV A;  1IC8 A;  3BG5 A;  3ELK A;  3IV5 A;  1WPK A;  3REO A;  4J00 A;  3LSH A;  4BEH A;  2XC7 A;  4XKC A;  4W1U A;  1Z1D A;  3E3V A;  1O4X A;  1X1A A;  2Q2E A;  4A6D A;  1G3W A;  2LG4 A;  2A5W A;  3BR5 A;  3H5N A;  1DGW Y;  3GTM J;  1T08 B;  4B8X A;  2LNB A;  2WB1 A;  3DLA A;  4UV8 A;  1X1B A;  4OMY A;  1KYZ A;  1FMW A;  3BPX A;  5K5R A;  3TW6 A;  1FBS A;  3T5X A;  2R7T A;  2E1C A;  3JRA A;  4HNU A;  4MIM A;  2IA0 A;  3PSF A;  5GPC A;  3WHB A;  2A68 F;  1X3Z B;  4LLL A;  3RYP A;  2XRO A;  4KMF A;  1DGR M;  5M3M J;  3FM5 A;  2BY2 A;  4G7Z F;  3U1D A;  3CZ6 A;  2F5C A;  2UV1 A;  4KYW A;  1HSJ A;  1STZ A;  1V3F A;  2KFD A;  1AU7 A;  2ZFU A;  2FNA A;  1F4K A;  3BTJ A;  2R7F A;  4HDV A;  4EGY A;  1GLN A;  1UG2 A;  4D7N A;  2Y0M A;  4RAF A;  3G1L A;  3ONQ A;  3SZG A;  1SVL A;  2R7O A;  5GAD J;  1J59 A;  3H9Q A;  4JK1 X;  3L2V A;  4GO1 A;  3JRI A;  3NQO A;  2VKH A;  3WGI A;  1O57 A;  2HDD A;  2LMD A;  2HDC A;  1CF7 B;  2FBK A;  1V54 H;  2JUG A;  3I56 I;  3OYD A;  1M1E B;  1AKH A;  2RV8 A;  2XAQ A;  2VE8 A;  2DJN A;  2IBD A;  4E7L A;  3VOD A;  3M8J A;  2QQB A;  5DUK A;  1BI3 A;  3SEQ A;  2DCE A;  3VFZ A;  4HBL A;  2R5Y A;  4A3M J;  4KNY A;  3BP8 A;  3IH2 A;  1IV8 A;  3B6A A;  2R93 J;  1K4S A;  1WSU A;  1FEX A;  1EA3 A;  4LD5 A;  3CCS I;  1QPI A;  5IT9 Z;  1YW7 A;  1WJC A;  1K6O A;  2R7D A;  1JTX A;  2F4I A;  2E2H J;  4XLC A;  3S2H J;  1OCO H;  2K02 A;  3CP8 A;  3IWZ A;  4WF2 A;  3V7R A;  4UY8 I;  4JOM A;  1K79 A;  1I3Q J;  2DFF A;  4GDF A;  4NC8 A;  3EYY A;  1HKT A;  4B3A A;  2Z9O A;  4DZJ A;  1B9N A;  3FXO A;  4M6Y A;  1HKQ A;  3F8M A;  3KLN A;  4CGZ A;  3VEP A;  4A3G J;  1R5I D;  5FRO A;  3OYK A;  3PFI A;  3JSP A;  3M8E A;  3C2G A;  1RKT A;  4BNC A;  1TZL A;  2HOA A;  3S32 A;  4S04 A;  3Q0U A;  1JT6 A;  3H92 A;  3NAR A;  1FOK A;  4LB6 B;  2R7V A;  4PGH A;  3C1D A;  5LHG A;  3JRF A;  1D0Y A;  3K10 A;  2E71 A;  4OIQ F;  4KUM A;  4BGD A;  1PYV A;  1T38 A;  3ZQG A;  1IJW C;  1IAW A;  3I64 A;  2M3A A;  3GFL A;  2P8T A;  2ISZ A;  4I0B A;  4G6Q A;  1ETK A;  3OIO A;  3G2B A;  4P9U A;  1EH8 A;  2FOW A;  4DW6 A;  4BXU A;  1KON A;  2F5V A;  4IHV A;  2RAE A;  3HL2 A;  1XSV A;  3OYF A;  1RRJ A;  1YTY A;  2E19 A;  2WB1 N;  2L7K A;  2IAI A;  2XPV A;  2PI0 A;  5EEG A;  1YRN B;  3LST A;  2P81 A;  5B1B H;  5DM7 F;  4N9I A;  3KET A;  3U1K A;  2E1M B;  3CJN A;  3NRV A;  2EIK H;  1T33 A;  1KQ9 A;  4DIQ A;  3OIQ A;  3PQK A;  5IYB J;  5M5Y J;  2J5P A;  3ABU A;  1X1C A;  3CTA A;  1OIS A;  3W6K B;  1U5T B;  4BU2 A;  3ASO H;  1YW8 A;  1E0E A;  2L7F P;  2VKV A;  3HUG B;  3WTS C;  1VQ7 I;  2KPM A;  3HRM A;  4OMZ A;  4A6E A;  2NVX J;  1VND A;  3M07 A;  1W1W E;  2MYS A;  2KMU A;  4NB5 A;  5FO5 A;  4D5F A;  4ZYD A;  5JHU A;  3OYI A;  1YFH A;  5J4V A;  4XR6 A;  4BXX J;  3OYG A;  1R71 A;  3BDD A;  4MHG A;  1IO2 A;  1FP2 A;  3V8K A;  4F3Q A;  3W6J B;  1RIO H;  1EV7 A;  2KQR A;  5LHH A;  4P55 A;  1KZH A;  5FLX Z;  4U0Y A;  2LRD A;  1ZR2 A;  4JX6 A;  4KIS A;  4LIV A;  3WE2 A;  2DA3 A;  2ACJ A;  4ITV A;  5E20 A;  2X51 A;  1QHG A;  2GM4 A;  2H94 A;  2EIN H;  5GAG J;  1C0W A;  1F5T A;  1EKE A;  4HOB A;  1F1Z A;  2CW8 A;  2ICW G;  2M9H A;  2OBP A;  2EIM H;  3PQJ A;  5D4R A;  2GXA A;  2ZO4 A;  3CCU I;  2BYV E;  2ZJQ F;  2Z33 A;  1A5J A;  1QU3 A;  3CJR B;  2X6Y A;  3F8B A;  3OYB A;  3PNY A;  2ZKZ A;  3PIP F;  2ZXI A;  2OCE A;  4AVP A;  1FYM A;  4O5V A;  2HXI A;  3GXO A;  1QNT A;  2QQ9 A;  1TNT A;  4U88 A;  1LEB A;  3FMQ A;  2UXN A;  2JA5 J;  2DDA A;  2ELK A;  2QCO A;  4II3 A;  3MN2 A;  2XRN A;  3DU6 A;  1N78 A;  1ON2 A;  3CUQ B;  3FMS A;  1RNL A;  2JVH A;  1IN5 A;  2VBX A;  2WAF A;  3ZR8 X;  1OQY A;  3GW2 A;  2KIQ A;  4XRS G;  4RDU A;  2JA2 A;  3S93 A;  1VQL I;  3WHC A;  4EJW A;  5B1A H;  2DU9 A;  4YFK F;  2I5U A;  3BZK A;  3CCV I;  1HA8 A;  5GPA A;  3OS1 A;  1E3O C;  3CUQ A;  3FX3 A;  4M71 A;  1AWC A;  2LSO A;  2PMH A;  3L7W A;  3WTT C;  3GWZ A;  4BQQ A;  1J0R A;  5AIP A;  4Z6Y A;  1H0M A;  3W3C A;  1R4N B;  2W82 A;  4EQQ A;  3QPT A;  4A3C J;  4PSX A;  2ZME A;  3O2P E;  2ETH A;  4KDP A;  1ZAO A;  4EV0 A;  5ILS A;  5EG0 B;  1TBX A;  1TT0 A;  1XMX A;  4IVN A;  4HLY A;  2W7N A;  1QZE A;  4GGG A;  2R7R A;  3DTK A;  4C3H J;  3ZQ7 A;  1ETX A;  4ZYG A;  3AG1 H;  3IWF A;  3ZMU A;  4CZC A;  3GVA A;  2CFX A;  2COB A;  1TWF J;  2AS5 F;  1G8X A;  4DQ2 A;  5HS9 A;  1YS6 A;  4EVI A;  4PJM A;  3K7A J;  2K9S A;  3H0G J;  1X3W B;  3MZH A;  3CC4 I;  3F0C A;  4FHT A;  3FM3 A;  2HVQ A;  4Q47 A;  4XL9 A;  3V8J A;  3TO7 A;  3E5Q A;  3BTL A;  5ICE A;  1H8A C;  2VON A;  1UHM A;  3K2A A;  2DW4 A;  4IRG A;  4UVA A;  4DNC A;  1XS9 A;  3NAU A;  2VJ5 A;  1JE8 A;  5LGU A;  1ZK8 A;  1IXC A;  1YJW I;  3TP3 A;  4FET A;  3HGY A;  3HSF A;  3FK6 A;  3LQQ A;  3ERM A;  1HXD A;  1Z91 A;  4IOC F;  2WTE A;  4QLC U;  1N25 A;  1XX5 A;  2AXL A;  3H3Z A;  1QVU A;  2FQ4 A;  2GXG A;  1K83 J;  4AM3 A;  4PZJ A;  2CV2 A;  2WAD A;  3BR6 A;  2V9V A;  4Z2Y A;  3GTP J;  2D1H A;  5E3N A;  4MFE A;  3TKY A;  3D5R C;  4D0P A;  1GUU A;  3EET A;  4HDU A;  3D0S A;  2AXT C;  2BOL A;  3IL2 A;  2VUM J;  4G7O F;  3KEY A;  4D5C A;  3I55 I;  1BBY A;  5HLT A;  1J5Y A;  5C3E J;  2BW3 B;  4HEA 2;  3GZ6 A;  2KZV A;  1ZTR A;  1XGM A;  2P5K A;  1IDY A;  3V4G A;  1N77 A;  3ZOB A;  2DPD A;  2GIV A;  2FXA A;  2R5Z A;  3CCR I;  1XN7 A;  4AYB A;  2LY2 A;  1IN8 A;  1TQI A;  4UUS A;  4AC0 A;  4Q4Z F;  3F6V A;  4G6D A;  2L7M P;  3BJA A;  5HLG A;  2CFO A;  1SFX A;  1TW2 A;  4CCL A;  3RKX A;  1Z21 A;  3ECO A;  5LGN A;  1U8B A;  4BY1 J;  4BJ6 C;  1B8I A;  4I2O A;  2H6C A;  2BXY A;  2Z16 A;  4RAY A;  4NQW B;  1HOM A;  1JUM A;  5GTH C;  2YU3 A;  5L3C A;  1GVD A;  4LIT A;  5TGT A;  3ERE D;  4B1R A;  2G7U A;  4AIK A;  3PO3 J;  3OOP A;  3EDP A;  2M4K A;  2OJE D;  3FDY A;  1NH3 A;  2L01 A;  2XKO A;  4XKB A;  5JHF A;  4NC6 A;  1DQU A;  1RC9 A;  4RBO A;  1MW7 A;  2XAF A;  3RKW A;  4F55 A;  3Q3S A;  1OKR A;  3QAH A;  2STT A;  3KP7 A;  3S14 J;  2VQC A;  2Y75 A;  4C3J J;  2L54 A;  1PUF A;  2KHM A;  2OAZ A;  3J7Y J;  3PJR A;  4EJU A;  1LVK A;  2XHK A;  5D6E A;  3CCQ I;  3G73 A;  5CQG A;  3HYI A;  2L4M A;  4BJ5 C;  3JRE A;  2NS7 A;  3GTO J;  2HZD A;  3KP2 A;  2LK2 A;  1UG0 A;  2YX7 A;  2B9S A;  3FKI J;  2BEO A;  3ASN H;  2RKH A;  4U0V A;  5K1Y A;  1XCV A;  3AL0 C;  2HZT A;  3HSE A;  3K2Z A;  4KJZ A;  2O9L A;  2VLA A;  5ERI A;  1RET A;  1MH3 A;  3HSR A;  1D0Z A;  1HLV A;  1O3R A;  3PO2 J;  1I6X A;  2HTJ A;  2KDO A;  2UXX A;  4P9F A;  1XGO A;  3FBN B;  2IEK A;  4M74 A;  3O8G A;  1W0T A;  3WOD F;  1B72 A;  3ZMT A;  2HXO A;  3HRT A;  5J6X A;  2NVQ J;  1S3J A;  3BJO A;  1A04 A;  3AFH A;  4C2T A;  2EZL A;  3ML6 A;  2RNG A;  5DD8 A;  1U9O A;  1X4O A;  1F43 A;  4HA8 A;  5D4S A;  4LLG F;  3IAS 2;  1VZ0 A;  5E3M A;  3CO7 C;  2ZCW A;  1HDP A;  4RS8 A;  3FWE A;  5ICF A;  5BOX A;  3I4P A;  1ZRC A;  3Q5F A;  4E7I A;  1LKX A;  1MND A;  1LFU P;  2ECB A;  3K70 D;  1U6G A;  1V4R A;  2JK3 A;  2M8G X;  2QLZ A;  3F6O A;  3G4S I;  3W2A A;  1DP3 A;  4G94 A;  1DUX C;  3IKV A;  2IXS A;  1W5S A;  2PMU A;  4XRM A;  1TWA J;  5FLX K;  1I1G A;  3RPU A;  2P5L C;  3IUO A;  1ZYR F;  4AYB N;  5LBQ A;  5E8I A;  1HW5 A;  4BE0 A;  1LFP A;  2W25 A;  1K7A A;  2VOO A;  2DA5 A;  3DBR B;  2FE3 A;  4CH7 A;  1Y8Q B;  1PVE A;  4A3F J;  4E6K G;  2W85 A;  3SZT A;  1VQN I;  4XM3 A;  2CQN A;  4ZTF A;  1X19 A;  2DA7 A;  2F5F A;  1WI3 A;  2PEX A;  2L4A A;  4G9Y A;  4RB0 A;  1JKR C;  1DU0 A;  2ZNY A;  5F08 A;  2OQR A;  3RJP A;  3CC7 I;  1YS7 A;  5JLW A;  1WI9 A;  5FB2 A;  3DFG A;  3CQZ J;  3FZV A;  1MBH A;  1Z7L A;  4H0E A;  3C18 A;  2VT3 A;  2EZK A;  3WGH A;  1UHW A;  4NC7 A;  2K5C A;  2ZFW A;  1BR4 A;  3F3X A;  1O3S A;  2M8E A;  3NWS A;  3I4M J;  3J7Z I;  1HF0 A;  4ZZL A;  2STW A;  2MGQ A;  1NG7 A;  2VKD A;  1MBG A;  1JI8 A;  1UB9 A;  3ZN1 A;  2BE5 F;  1ZGW A;  1O7F A;  1JUP A;  4ABZ A;  2V1N A;  4BH9 A;  4ON0 A;  2EIL H;  2QWW A;  1XMA A;  5IT3 A;  1WZ2 A;  1XG1 A;  2E35 A;  3F8N A;  3FBI B;  2VJJ A;  5FKN A;  2DA4 A;  2G9W A;  3DEE A;  1QQI A;  1JGG A;  2W24 A;  2M7A A;  1YI2 I;  4BBS J;  1P4W A;  1SD6 A;  1LDJ A;  1FT9 A;  2O3F A;  2DN0 A;  5EZG A;  3BQZ A;  2K9Q A;  3GTQ J;  3MAJ A;  2H6B A;  2HPM A;  4HF1 A;  3WU1 B;  3E97 A;  2AHQ A;  4QWQ A;  3A4C A;  3JW4 A;  3PUF A;  1LUJ B;  3S8P A;  2Y31 A;  1OYY A;  1RUO A;  1FP1 D;  4CCK A;  2HKO A;  5J8F A;  3BR0 A;  3HXL A;  2XKP A;  2O5R A;  3F8C A;  4JX5 A;  5EGO A;  5J47 A;  1WKM A;  3D1N I;  2L0K A;  4V19 K;  2M4G A;  4F7Z A;  1KU7 A;  3JRD A;  2UZK A;  2QYO A;  1BL0 A;  4A3D J;  2W84 A;  2IVM A;  3VB2 A;  3TGN A;  1D1A A;  2FD5 A;  2YS9 A;  2DOF A;  2E5N A;  3C2B A;  4KIF A;  3JTG A;  4E7K A;  2HVR A;  2B7E A;  3KX2 A;  3I59 B;  2LF7 A;  3PNT A;  1YO5 C;  2EJR A;  2HYG D;  3CDH A;  2E36 A;  3AAF A;  1XCB A;  1YJN I;  2R92 J;  2DJI A;  4M9Z A;  1BC8 C;  1WHU A;  1U0J A;  3A0H C;  3I0T A;  3ULQ B;  1VQ4 I;  4O3M A;  2VOP A;  4BXF A;  2DA6 A;  2TDX A;  2V26 A;  4RLQ A;  4XIC A;  5FRN A;  4N4N B;  4XSX F;  2HS5 A;  3LWF A;  3IH4 A;  2M0C A;  5H20 A;  5EDN A;  1GXQ A;  4EJT A;  3LAP A;  1WJE A;  2CUF A;  1OR7 C;  2JSC A;  3FF5 A;  4O6J A;  3ESW B;  3KE2 A;  4IHS A;  1H9G A;  3RCO A;  5TJJ A;  3G71 I;  5IP6 A;  2LVS A;  1IDZ A;  5ILV A;  2COM A;  4I76 A;  4L9T A;  3BRO A;  2HEO A;  4LIU A;  4NNJ A;  4UUT A;  4IHX A;  3LSJ A;  2DK8 A;  3HTU A;  1BOA A;  1ZQ3 P;  3SDG A;  3RI4 A;  2XGC A;  4BEH B;  2IT0 A;  5FKM A;  3S1Q J;  3Q9V A;  3L2Q A;  2Q2E B;  4S05 A;  4MGR A;  2YX4 A;  1GXP A;  2D5V A;  3LFU A;  4C2U A;  3K70 C;  1OMI A;  2OUM A;  3GTG J;  2FU4 A;  1ACI A;  4D1Q A;  1R6R A;  2ELH A;  2F2E A;  1MBF A;  3LSG A;  3JCU C;  3V7C A;  5DDG A;  5E79 C;  4KIT B;  5IOZ A;  1LPQ A;  2W1O A;  3KYC B;  3I4N J;  3D5S C;  3GYH X;  1SAU A;  2F6C A;  4RAG A;  3CO6 C;  5IPA A;  1YW9 A;  2AO9 A;  2CWE A;  4KIC A;  4OIN F;  3LMM A;  1MNE A;  3COA C;  2WAE A;  4B43 A;  3BR3 A;  4IQJ A;  5E8G A;  3BR1 A;  1WJF A;  2QF7 A;  1P7J A;  1K61 A;  3DQV C;  1IRF A;  2JQ7 A;  1T56 A;  1JHH A;  2QA4 I;  2Q0O A;  4GXO A;  2CQK A;  1AKH B;  3HM5 A;  4XKV A;  2K7L A;  4A5N A;  5DYM A;  3CME I;  3BG6 A;  2AQF A;  3HOW J;  4A0Z A;  2XVC A;  1N75 A;  4IL6 C;  2R5Y B;  2DTZ A;  2PMZ A;  2CSO A;  1FLI A;  3SJM A;  5DV5 A;  1A35 A;  3H9J A;  4CDG A;  4I09 A;  5HNH A;  4XOT A;  4A3J J;  3LNQ A;  4CIC A;  3SXY A;  3DP7 A;  3LSK A;  1MDM A;  5K7Z A;  1XGN A;  3VYU B;  3GFI A;  3CF5 F;  2DMT A;  1QBJ A;  3ECH A;  3BOQ A;  2LKS A;  4G12 A;  3ISP A;  2HYJ A;  3Q0V A;  5BPI A;  4IX7 A;  4W97 A;  1KQ0 A;  1YJ9 I;  2BXZ A;  1R49 A;  3K4L A;  3L1P A;  1X4P A;  1OYW A;  1GHC A;  3CES A;  5FLM J;  3WG7 H;  2VC1 A;  3EPZ A;  3J7A Y;  5KNL A;  4FTH A;  3LSP A;  3FK7 A;  4KN4 X;  3DEU A;  2VXZ A;  1MMG A;  3AG2 H;  3E6B A;  4OWR B;  1KU3 A;  4MTD A;  1K78 A;  1IRG A;  3EUK L;  3JRC A;  3CJT B;  1IRZ A;  3FIW A;  4WXH A;  4DJA A;  4ASN A;  1TLH B;  1B4A A;  2CO5 A;  2RQQ A;  2WC2 A;  3KZY A;  2BY1 A;  4V2F A;  4XOP A;  5A2Q K;  4R79 A;  5GAH J;  4CZZ A;  3CCL I;  1HW2 A;  1QZZ A;  4XID A;  2LBF A;  3CJQ B;  4MO7 A;  2DT5 A;  2HNH A;  5JVT A;  5DM6 F;  3A1Y A;  1R1T A;  3K6G A;  2M1B A;  4A0Y A;  5IP9 J;  2EV0 A;  2WV1 A;  3TO6 A;  1S6L A;  2KZG A;  1E17 A;  2X1E A;  4ZYH A;  1POG A;  4LG0 A;  3M1C A;  2JUC A;  2KRH A;  4IRI A;  4BL0 B;  3S3M A;  5DCM A;  2JVG A;  4GYG A;  2GWR A;  2MH2 A;  5FKK A;  2EFW A;  1RPW A;  2CUE A;  4PJ0 C;  1UHS A;  2RN7 A;  3WTY C;  4CUG A;  3OYJ A;  2CQQ A;  1A36 A;  4I0A A;  4CYD A;  1FYL A;  2NRA C;  3ZRG A;  2R7S A;  1SAX A;  5IYD J;  2EFP A;  3O6B B;  2QGU A;  3GX4 X;  5CJ9 A;  5HLI A;  3LA3 A;  4DYQ A;  2E2J J;  3CDL A;  1U9N A;  2O8K A;  3ABT A;  4B4C A;  2IPQ X;  4A12 A;  2GZW A;  2FUG 2;  2KRF A;  3OV8 A;  2K9L A;  4IHW A;  4AWX B;  3H1C A;  4YEL A;  2KL4 A;  4UV9 A;  2O6G E;  4M3G A;  4L9V A;  4BY7 J;  2KP6 A;  4MFD A;  3ZQL A;  3C7J A;  2ESH A;  2OZ6 A;  1MH4 A;  3BG7 A;  2R3S A;  4EJO A;  3L2C A;  1HQC A;  3OYN A;  2MD5 A;  3KIO A;  2Z99 A;  2N8G A;  2V4J C;  4HLX A;  3AG4 H;  2PMZ N;  2VL8 A;  3KPH A;  4UVB A;  2CYY A;  1ZEL A;  1BIB A;  2VBY A;  2BHY A;  2HWV A;  3BCB A;  4ZDL A;  4CXF A;  5IY5 H;  3ABK H;  3QYE A;  4FX4 A;  5HOO A;  1UST A;  3N4M A;  4G7H F;  4GCV A;  3CDI A;  5K7F A;  3K9T A;  4HW0 A;  2IJL A;  2FRH A;  5C44 J;  2O7O A;  1APL C;  2V7F A;  2A6E F;  1B6A A;  4HPQ A;  1P92 A;  2Q8K A;  4RM2 A;  4YFX F;  2HQA A;  1ETY A;  4CCN A;  2K40 A;  3MD2 A;  5H6Q A;  5KVR A;  2DQL A;  3SHF A;  2E7X A;  5J4Y A;  3T1B A;  4F93 B;  2P5V A;  3GUD A;  5F0H A;  3WU2 C;  2YUS A;  5LRS A;  1K4T A;  2EA2 A;  2FEZ A;  1ZR4 A;  2W4S A;  3S2W A;  4AVZ A;  2X1D A;  4KFC A;  2LY9 A;  2XGD A;  1VQ8 I;  4HNV A;  3OR2 C;  2F5D A;  2K86 A;  2NXN B;  2X85 A;  3A01 A;  3RPQ A;  2MBF A;  2JRM A;  4C3I J;  3E1S A;  3CCJ I;  1B59 A;  2QEX I;  1W36 C;  2KKO A;  2BBY A;  1X2M A;  1DDN A;  4KT6 A;  1TC3 C;  2ZJP F;  3O3K A;  5EEH A;  2ZME B;  4PCQ A;  1IF1 A;  2BZT A;  1WJA A;  3NWT A;  4E4H A;  1D8K A;  2HVS A;  2VI6 A;  2A61 A;  3KP6 A;  4BJT A;  5C4X J;  4YIF A;  1VF9 A;  3OSF A;  1I1S A;  2DXI A;  3WTW C;  4BQO A;  4IKF A;  1Q1H A;  4IPA A;  3ZP5 A;  2O61 A;  2IA2 A;  2P7V B;  3JSO A;  5GP9 A;  2VPR A;  2MLG A;  1LEA A;  3HKZ A;  3O8H A;  3DF8 A;  4FE4 A;  3L9F A;  1FIP A;  3DCF A;  1Y0N A;  4ZH4 F;  4LMY A;  3OR1 C;  1TWC J;  2CV0 A;  3FXM A;  3ZCO A;  1E2X A;  2DO7 A;  2HU9 A;  2DFE A;  2DAO A;  3QU3 A;  3BG9 A;  3S1N J;  2G0E A;  2MLK A;  3IC7 A;  1ERD A;  4L5I A;  3QP6 A;  3PNV A;  4A3B J;  4IXA A;  3OSG A;  4L0Z B;  4RGS A;  4EM0 B;  1P7I A;  4PSW A;  2DMN A;  3QU6 A;  3MCZ A;  1MJB A;  3DTI A;  2JPB A;  5HLH A;  1Y1W J;  2GQQ A;  4NHJ A;  3SFI A;  5GAE J;  1UZC A;  4HF0 A;  1BR1 A;  3L2U A;  3ABM H;  4IQ4 A;  2K4J A;  4M9S A;  2MA3 A;  3I54 A;  4BHC A;  1BI1 A;  3QOP A;  2DBB A;  2M45 A;  1HCR A;  1SFE A;  2LKP A;  1SFU A;  3M1E A;  1X1D A;  2PG4 A;  4B47 A;  3UNG C;  2K3P A;  1G2H A;  4L18 B;  2UUZ A;  3F8F A;  4QIW N;  2BY0 A;  2XGX A;  3T8T A;  4BHP A;  1MNM C;  4OAZ A;  3G3Z A;  1FC3 A;  2IA1 A;  1B1B A;  2Y69 H;  2GBY A;  2ESN A;  2Z5U A;  2E1M C;  2R5Z B;  1XB4 A;  2GLO A;  2ZNZ A;  2Z1D A;  4UUS B;  1R58 A;  4IF4 A;  4ZYA A;  3SFZ A;  4C2M J;  3K4B A;  4LK1 F;  3TO9 A;  5BS6 A;  2CV1 A;  3MFK A;  4ZDP A;  3AG3 H;  1DU6 A;  3I9V 2;  2HR3 A;  1VI0 A;  3PSI A;  4I7H A;  1TQM A;  1V5G A;  2V9P A;  4DGW B;  4ZYE A;  5ED4 A;  2HQN A;  3MKZ A;  1SD5 A;  1U5T C;  3LFK A;  4M3E A;  4WXC A;  1B8I B;  4P1W A;  1MBE A;  3DPT A;  4M73 A;  2ZJ2 A;  5D5U B;  1NK3 P;  1L3L A;  3GLX A;  2OA4 A;  5CKT A;  1SAN A;  2NVY J;  4XQF A;  4RAZ A;  3S17 J;  5ICC A;  4CYC A;  2R7W A;  1E3P A;  4WXD A;  1ONV A;  1EH7 A;  1AA7 A;  3W2W A;  5TRD A;  1Y8R B;  4XLA A;  4FCY A;  1FY7 A;  4AD9 A;  1OCC H;  3QYB A;  2CG4 A;  1IG7 A;  3BTC A;  3MWM A;  1XDU A;  5JFR A;  1TQP A;  1A6I A;  3SZP A;  4BBR J;  4XLP F;  1PUF B;  1QO0 D;  2JZY A;  3RQ4 A;  1GV2 A;  2VJI A;  5HNF A;  3OL4 A;  3U2R A;  2L7Z A;  2XB0 X;  2XSJ C;  3JTH A;  1LVA A;  1IGN A;  2L3D A;  3HJE A;  3HKZ N;  1YHQ I;  1QPM A;  4A3I J;  4G8X A;  3WTU C;  4UUV A;  3H3U A;  1YIT I;  1S7O A;  3QWL A;  1MKM A;  5J8C A;  3B6C A;  1R5G A;  1BC7 C;  3DKX A;  1T0F C;  1WGX A;  1IXR C;  4LK0 F;  3QPS A;  4YFN F;  4LGW A;  3SDB A;  2WWY A;  1IV6 A;  5FFZ A;  1R9T J;  2EB7 A;  1GVJ A;  2WY7 Q;  4EEF G;  1YX5 A;  3K4C A;  3AKZ A;  4OIP F;  3HPH A;  4RMN A;  4UNO A;  2ID6 A;  3K4J A;  1PP8 F;  1ZRF A;  1GDT A;  4KA4 A;  3EUH C;  4LOC A;  4R8H A;  1IUY A;  4U7D A;  3R0J A;  1B72 B;  3HIF A;  3KCC A;  3A02 A;  2KIU A;  4L9N A;  3OMY A;  4WCG A;  1ETO A;  2TCT A;  4RB3 C;  1JJ6 C;  3DXJ F;  5A2Q Z;  4Y15 A;  1ETW A;  3RIR A;  4MLO A;  3FXR A;  4LB5 A;  3VSL A;  3FHN A;  5LHI A;  3ZQI A;  4HF2 A;  3P7N A;  1WFX A;  3MKY B;  2PN6 A;  3C3W A;  5HDG A;  3FIS A;  4GFB A;  2JA8 J;  3LL7 A;  4RGU A;  4FAS D;  2ZB9 A;  1JUS A;  1OR7 A;  2DTR A;  5J1R A;  4XLE A;  3F9K A;  3TQN A;  4YEJ A;  3QYF A;  5HS7 A;  1QRY A;  2MH9 A;  4M3B A;  3ZMZ A;  2VIX A;  2J5O A;  4LFU A;  1MZB A;  3QPH A;  1TW3 A;  5B3S H;  2DOA A;  1LE8 A;  2PJR A;  2L02 A;  1XSX A;  3G6E I;  1CGP A;  3HTS B;  3LA7 A;  1IRX A;  1BR2 A;  3A03 A;  1D1C A;  5D8K B;  1ZN2 A;  5L3G A;  1AHD P;  2XSD C;  5LLQ A;  3GFJ A;  2W00 A;  4BYY A; 
#chains in the Genus database with same CATH homology
 1YQA A;  4HQE A;  2FF4 A;  4I98 B;  2IP2 A;  1QZY A;  3L09 A;  3SQN A;  2HGC A;  2V79 A;  1LDD A;  2QBY A;  3M9A A;  4FX0 A;  1MGT A;  3QRF F;  1FPQ A;  4L0Y B;  5BMZ A;  4CHU A;  3MZY A;  4ENM A;  2FML A;  3I5U A;  1G3Y A;  4U0W A;  4XLN F;  1XGS A;  4EGZ A;  5E17 F;  1R00 A;  3P9I A;  1UCR A;  4ESB A;  1LQ1 A;  3DPL C;  2CGP A;  4LJZ F;  4IHT A;  1PUE E;  5D8L B;  3E5X A;  1ZRD A;  1I27 A;  1P2F A;  4R1H A;  5E18 F;  4Q5S F;  5JR3 A;  3ZMD A;  1VTN C;  4Y17 A;  2GXB A;  2QM3 A;  3QP5 A;  4RGR A;  1D5V A;  2HFH A;  1KA8 A;  1IW7 F;  2V1X A;  1ZAR A;  2RNJ A;  1DPU A;  3FMR A;  5DCF A;  2MC3 A;  1T2K A;  1FBU A;  2O03 A;  2PQ8 A;  1W4M A;  1X3U A;  1T98 A;  4AIH A;  2P4W A;  4ETS A;  3E6D A;  4YII A;  5E1Z B;  1ODD A;  1ZGA A;  4M6X A;  2EWN A;  3TOA A;  4HV6 A;  3B73 A;  4I02 A;  3RDI A;  1KYW A;  1YLF A;  1ZRE A;  1AOY A;  1J75 A;  2X4H A;  1OPC A;  2ADU A;  1J7K A;  6PAX A;  3DV8 A;  2VOD A;  5LEJ A;  2EK5 A;  2A69 F;  2M30 A;  1KU9 A;  4JQF A;  2A6H F;  4A0X A;  4RB1 A;  5D6F A;  2EFN A;  3R6S A;  5L3B A;  3V7S A;  3IHU A;  3R4K A;  3L00 A;  4MNU A;  1J9I A;  2IRF G;  2V6C A;  1W7P D;  1HW1 A;  2ZBK A;  2A5Y B;  5K5O A;  1W7P A;  1O3Q A;  2HOE A;  2JRT A;  4Q48 A;  1ZHF A;  2OQG A;  2JTV A;  2FSW A;  3K1P A;  1MDM B;  1ZG3 A;  1XDS A;  1O3T A;  2XIG A;  2QQA A;  2HQR A;  4GYI A;  4MQV A;  4UVC A;  2HYF A;  1K78 B;  5CYV A;  2H27 A;  1B9M A;  2RC4 A;  3BJ6 A;  5K5Q A;  1Z9C A;  2UWM A;  3WTV C;  3LA2 A;  1CF7 A;  1KQ8 A;  1HBX G;  1XSD A;  3KP4 A;  2VE9 A;  4MQ9 F;  4LG0 B;  1BM9 A;  1FYK A;  3HOS A;  1PDN C;  3NEU A;  1SMY F;  3DKW A;  4EM1 A;  3EYI A;  5DCM B;  2XAH A;  2HTS A;  4PGG A;  3RYR A;  1YIO A;  5L3F A;  3J80 K;  5HS8 A;  4IRH A;  1ZLK A;  2KIF A;  3FXU A;  3KP5 A;  2P6T A;  3KLO A;  2DQR A;  2K27 A;  2RVC A;  2P6S A;  4PDK A;  2FA5 A;  1G3T A;  2HKX A;  4OOI A;  5D5V B;  1XD7 A;  1WRJ A;  4XRF A;  1MJA A;  2D2W A;  5CVJ A;  3JAM K;  1JXS A;  4L9J A;  4KT5 C;  5F1R A;  2ZXJ A;  2M87 A;  3CLO A;  3FXQ A;  2W57 A;  2RQP A;  4HQM A;  1LB2 A;  4MEY F;  5FGM A;  4OIO F;  3R60 A;  2B0L A;  4YG2 F;  2XUB A;  4JBA A;  1ZG5 A;  1U3E M;  2KJB A;  1Z7U A;  2E7W A;  4HX8 A;  1IN4 A;  4EM2 A;  2FQ3 A;  2PBI A;  1U5T A;  3HUG A;  1YYV A;  1ZGJ A;  2GA1 A;  4HX7 A;  1U8R A;  3F23 A;  1ON1 A;  2E1N A;  1P4X A;  2Y48 A;  2QVO A;  3TDU C;  5E1X A;  2PJP A;  3BPV A;  2ISY A;  1HKS A;  1Z05 A;  2PFB A;  1JGS A;  2NNY A;  4I01 A;  2DLL A;  3LQR A;  3WG9 A;  5CVU A;  4P96 A;  1BI2 A;  1U78 A;  2G7H A;  4A2U A;  3BWG A;  3M8F A;  2IW5 A;  2YSR A;  3GEZ A;  2RGV A;  4UHT A;  5HDK A;  1S29 A;  3KP3 A;  1T0F A;  5H6R A;  1R23 A;  1SMT A;  4B09 A;  3GZ5 A;  2FNP A;  2DPU A;  4L5J A;  1Z6R A;  3EUH A;  5BPD A;  1BI0 A;  2EFQ A;  2C6Y A;  1R1U A;  2VBW A;  3P9C A;  3WTZ A;  4N9H A;  1HST A;  2F5E A;  3I53 A;  1SD4 A;  4WK8 F;  1DPR A;  1ZH5 A;  3ROU A;  3HHG A;  5E1W A;  3J81 K;  1J2X A;  1RZ4 A;  1G4D A;  3IKT A;  1IZ1 A;  2DI3 A;  1FSE A;  5LGT A;  3IRQ A;  3F72 A;  2NAZ A;  1YG2 A;  1DP7 P;  3WE3 A;  4WWC A;  2X0L A;  3T0Y A;  3R0A A;  4KIB A;  2RDP A;  4ZZD A;  5DD4 A;  1FSH A;  4E70 A;  1BIA A;  3T8R A;  5AON A;  5F6F A;  5D5W B;  4OU0 A;  1ZG1 A;  1O7L A;  3HHH A;  4EMS A;  3TOB A;  1RI7 A;  2VC0 A;  3KZZ A;  4FT8 A;  1QGP A;  3BY6 A;  2LDU A;  5CLS A;  1R1V A;  5DUI A;  2D1V A;  4XSZ F;  2M5W A;  2V1D A;  5CVV A;  2DFI A;  4P5O A;  2WV0 A;  3RTR A;  1I5Z A;  1LNW A;  5KK1 A;  3KFW X;  4KN7 X;  3MEX A;  4TV7 A;  3GFM A;  2YR2 A;  2NYX A;  2NNN A;  3GF2 A;  1D8J A;  2D45 A;  5IT9 K;  1KU2 A;  3K1N A;  2V1U A;  1WQ2 A;  4RGX A;  1F9N A;  1WWX A;  2H09 A;  3CUO A;  3ZMS A;  1Y0U A;  4NQW A;  5HDN A;  2XV4 S;  2EV5 A;  3CUQ C;  1FZP B;  3VOE A;  1R22 A;  2GA2 A;  2P7C B;  1BJA A;  2XAG A;  4OIR F;  1IN6 A;  4A5M A;  3BZ6 A;  3WGG A;  1FNN A;  4RB2 C;  4UXN A;  5LRR A;  2OZU A;  4HZF A;  1IXS B;  5HVQ C;  3J7A O;  3HRS A;  2YPR A;  4K2E A;  4M72 A;  5FFX A;  3N97 A;  2A07 F;  1H9T A;  4BAY A;  5ICG A;  3E6C C;  1FX7 A;  5DEQ A;  3J80 Z;  5BQT A;  2JT1 A;  2KIM A;  1W5T A;  2QBY B;  1USS A;  3MQ0 A;  4MTE A;  4M9X A;  3M7G A;  4MEX F;  4ESJ A;  1P6R A;  3EQL F;  5ILU A;  2LF8 A;  4HX4 A;  4KIG A;  3R61 A;  5CVR A;  1NHA A;  3WU0 A;  3E6M A;  2VBZ A;  1ZLJ A;  3JAM Z;  2FOK A;  1KGS A;  2CW0 F;  1FWZ A;  1G3S A;  4CO8 A;  3ZPL A;  2QEN A;  2O8X A;  3FHZ A;  1P4A A;  1D3Y A;  5D5X B;  2K4B A;  2O0Y A;  1IN7 A;  1SD7 A;  5L3E A;  2JPC A;  1G6N A;  1R7J A;  3LAJ A;  3K69 A;  5JI6 A;  4ESF A;  1R5H A;  1MD0 A;  3K0L A;  2NS0 A;  4N0B A;  2GAU A;  2KJC A;  1BN5 A;  1LJ9 A;  3Q9S A;  1Z6T A;  3V8L A;  2FBI A;  2XAS A;  1T6S A;  3TDZ C;  5L3D A;  2PLY A;  1REP C;  3B02 A;  2FMY A;  4HAM A;  3D5L A;  3ZMV A;  1LDK B;  3I58 A;  3F21 A;  5LEK A;  2DK5 A;  1FBQ A;  2OD5 A;  3E5U A;  4BHB A;  1XMK A;  3GO5 A;  2BGC A;  3ZN0 A;  2A3S A;  3K1M A;  1RUN A;  1MJ9 A;  4U7B A;  3KEO A;  1OYI A;  1T39 A;  5F64 A;  1S8N A;  1ULY A;  3WTX C;  1S7A A;  4IJA A;  3IRR A;  1TTY A;  2BV6 A;  3HRU A;  3HOT A;  4Y13 A;  2VN2 A;  4LLN A;  3I71 A;  4ENJ A;  2VT2 A;  1EH6 A;  4BQA A;  2EFO A;  4WX9 A;  2QZ8 A;  2EA4 A;  2QUF A;  3I59 A;  3KEQ A;  1UFM A;  2XAJ A;  5FD5 A;  4HV5 A;  1R36 A;  3U9G A;  1TNS A;  3P9K A;  4ENN A;  4HYE A;  2FBH A;  1JHF A;  2EV6 A;  5CVI A;  1U2W A;  5AIQ A;  2OU2 A;  4ENK A;  3RKY A;  4AIJ A;  3J81 Z;  4KMU X;  1PP7 U;  1W7P B;  5FD6 A;  3F22 A;  2Z3Y A;  1L0O C;  4XBF A;  4EJV A;  3ELK A;  3REO A;  1Z1D A;  3E3V A;  2Q2E A;  4A6D A;  1G3W A;  4B8X A;  2LNB A;  4UV8 A;  4OMY A;  1KYZ A;  3BPX A;  5K5R A;  1FBS A;  3T5X A;  2E1C A;  2IA0 A;  2A68 F;  4LLL A;  3RYP A;  2XRO A;  4KMF A;  3FM5 A;  4G7Z F;  3U1D A;  4KYW A;  2F5C A;  1HSJ A;  1STZ A;  1V3F A;  2FNA A;  1F4K A;  2R7F A;  4HDV A;  4EGY A;  2Y0M A;  1J59 A;  4JK1 X;  4GO1 A;  3NQO A;  3WGI A;  1O57 A;  2HDC A;  1CF7 B;  2FBK A;  2RV8 A;  2XAQ A;  2VE8 A;  3VOD A;  2QQB A;  5DUK A;  1BI3 A;  3VFZ A;  4HBL A;  4KNY A;  3BP8 A;  1WSU A;  4LD5 A;  5IT9 Z;  1YW7 A;  1K6O A;  2R7D A;  2K02 A;  4WF2 A;  3IWZ A;  3V7R A;  1K79 A;  3EYY A;  1HKT A;  2Z9O A;  1B9N A;  4M6Y A;  1HKQ A;  3F8M A;  3KLN A;  4CGZ A;  3VEP A;  3PFI A;  3JSP A;  3M8E A;  4BNC A;  4S04 A;  3H92 A;  1FOK A;  4LB6 B;  4PGH A;  3C1D A;  5LHG A;  4OIQ F;  4KUM A;  1T38 A;  1IAW A;  3I64 A;  3GFL A;  2P8T A;  2ISZ A;  4I0B A;  4G6Q A;  4P9U A;  1EH8 A;  4BXU A;  1XSV A;  1YTY A;  2PI0 A;  5EEG A;  3LST A;  4N9I A;  3KET A;  3CJN A;  3NRV A;  1KQ9 A;  3PQK A;  2J5P A;  3ABU A;  3CTA A;  3W6K B;  1U5T B;  1YW8 A;  3WTS C;  3HRM A;  4OMZ A;  4A6E A;  4NB5 A;  5FO5 A;  4ZYD A;  5JHU A;  1YFH A;  3BDD A;  4MHG A;  1FP2 A;  3V8K A;  3W6J B;  1RIO H;  1EV7 A;  5LHH A;  4P55 A;  5FLX Z;  4U0Y A;  3WE2 A;  2ACJ A;  5E20 A;  2H94 A;  1C0W A;  1F5T A;  4HOB A;  1F1Z A;  3PQJ A;  2OBP A;  5D4R A;  2ZO4 A;  2BYV E;  2Z33 A;  3F8B A;  2ZKZ A;  4AVP A;  1FYM A;  4O5V A;  3GXO A;  1QNT A;  2QQ9 A;  1TNT A;  4U88 A;  1LEB A;  3FMQ A;  2UXN A;  2XRN A;  1ON2 A;  3CUQ B;  3FMS A;  1RNL A;  1IN5 A;  2VBX A;  3GW2 A;  4EJW A;  2DU9 A;  4YFK F;  3CUQ A;  3FX3 A;  4M71 A;  1AWC A;  2LSO A;  2PMH A;  3L7W A;  3WTT C;  3GWZ A;  1J0R A;  5AIP A;  1H0M A;  4EQQ A;  3QPT A;  2ZME A;  3O2P E;  2ETH A;  4KDP A;  1ZAO A;  4EV0 A;  5ILS A;  1TBX A;  4IVN A;  4HLY A;  4GGG A;  3ZQ7 A;  4ZYG A;  3IWF A;  3ZMU A;  3GVA A;  2CFX A;  2AS5 F;  4DQ2 A;  5HS9 A;  1YS6 A;  4EVI A;  3MZH A;  4FHT A;  3FM3 A;  4Q47 A;  3V8J A;  3TO7 A;  3E5Q A;  5ICE A;  2VON A;  1UHM A;  2DW4 A;  4IRG A;  4UVA A;  4DNC A;  1JE8 A;  5LGU A;  1IXC A;  3HSF A;  3LQQ A;  1HXD A;  1Z91 A;  2WTE A;  4QLC U;  2AXL A;  3H3Z A;  2GXG A;  4PZJ A;  2V9V A;  4Z2Y A;  2D1H A;  3TKY A;  4D0P A;  3EET A;  4HDU A;  3D0S A;  3IL2 A;  4G7O F;  1BBY A;  1J5Y A;  3GZ6 A;  1XGM A;  2P5K A;  3V4G A;  2DPD A;  2GIV A;  2FXA A;  1XN7 A;  1IN8 A;  1TQI A;  4Q4Z F;  3F6V A;  4G6D A;  3BJA A;  5HLG A;  1SFX A;  1TW2 A;  3RKX A;  3ECO A;  5LGN A;  4I2O A;  2H6C A;  4RAY A;  2YU3 A;  5L3C A;  3ERE D;  2G7U A;  4AIK A;  3OOP A;  3EDP A;  2L01 A;  2XKO A;  2XAF A;  3RKW A;  1OKR A;  3QAH A;  2STT A;  3KP7 A;  2Y75 A;  2L54 A;  2OAZ A;  4EJU A;  2XHK A;  5D6E A;  3G73 A;  3HYI A;  2L4M A;  3KP2 A;  2YX7 A;  2BEO A;  2RKH A;  4U0V A;  5K1Y A;  1XCV A;  2HZT A;  3HSE A;  3K2Z A;  5ERI A;  3HSR A;  1O3R A;  1I6X A;  2HTJ A;  2UXX A;  4P9F A;  1XGO A;  4M74 A;  3WOD F;  3ZMT A;  3HRT A;  5J6X A;  1S3J A;  3BJO A;  1A04 A;  3ML6 A;  5DD8 A;  4HA8 A;  5D4S A;  4LLG F;  3CO7 C;  2ZCW A;  4RS8 A;  3FWE A;  5ICF A;  5BOX A;  3I4P A;  1ZRC A;  3Q5F A;  1U6G A;  1V4R A;  2QLZ A;  3F6O A;  4G94 A;  1DUX C;  3IKV A;  1W5S A;  2PMU A;  5FLX K;  1I1G A;  3RPU A;  2P5L C;  1ZYR F;  5LBQ A;  5E8I A;  1HW5 A;  2W25 A;  1K7A A;  2VOO A;  2FE3 A;  2W85 A;  3SZT A;  2F5F A;  2PEX A;  2L4A A;  4G9Y A;  4RB0 A;  2ZNY A;  2OQR A;  3RJP A;  1YS7 A;  1WI9 A;  5FB2 A;  3DFG A;  3FZV A;  4H0E A;  3C18 A;  2VT3 A;  3WGH A;  1UHW A;  1O3S A;  2ZFW A;  3F3X A;  2M8E A;  4ZZL A;  2STW A;  1UB9 A;  3ZN1 A;  2BE5 F;  1O7F A;  4BH9 A;  4ON0 A;  2QWW A;  1XMA A;  5IT3 A;  3F8N A;  2G9W A;  1QQI A;  2W24 A;  1P4W A;  1SD6 A;  1LDJ A;  1FT9 A;  2O3F A;  3MAJ A;  2H6B A;  4HF1 A;  3WU1 B;  3E97 A;  4QWQ A;  3JW4 A;  1OYY A;  1RUO A;  1FP1 D;  2HKO A;  5J8F A;  2XKP A;  3F8C A;  1WKM A;  4F7Z A;  1KU7 A;  2UZK A;  2QYO A;  2W84 A;  2IVM A;  3VB2 A;  3TGN A;  4KIF A;  3JTG A;  1YO5 C;  3I59 B;  2LF7 A;  2EJR A;  2HYG D;  3CDH A;  3AAF A;  1XCB A;  1BC8 C;  4M9Z A;  3ULQ B;  3I0T A;  4O3M A;  2VOP A;  2TDX A;  4XSX F;  2HS5 A;  3LWF A;  5H20 A;  4EJT A;  1GXQ A;  3LAP A;  2JSC A;  3FF5 A;  4O6J A;  3KE2 A;  4IHS A;  1H9G A;  5TJJ A;  5ILV A;  2COM A;  4L9T A;  3BRO A;  2HEO A;  2DK8 A;  3HTU A;  1BOA A;  3RI4 A;  2IT0 A;  3Q9V A;  4S05 A;  4MGR A;  2YX4 A;  1GXP A;  1OMI A;  2FU4 A;  2ELH A;  2F2E A;  5JVT A;  5DDG A;  3V7C A;  3GYH X;  3CO6 C;  1YW9 A;  2CWE A;  4KIC A;  4OIN F;  3COA C;  5E8G A;  3DQV C;  1IRF A;  1JHH A;  2Q0O A;  4GXO A;  2CQK A;  2K7L A;  4A5N A;  5DYM A;  4A0Z A;  2XVC A;  2CSO A;  1FLI A;  5DV5 A;  4CDG A;  4I09 A;  4CIC A;  3SXY A;  3DP7 A;  1MDM A;  1XGN A;  3GFI A;  1QBJ A;  3ECH A;  3BOQ A;  3ISP A;  5BPI A;  1KQ0 A;  1OYW A;  1GHC A;  2VC1 A;  4KN4 X;  2VXZ A;  3DEU A;  1K78 A;  3E6B A;  4MTD A;  1KU3 A;  1IRG A;  4WXH A;  4ASN A;  1TLH B;  1B4A A;  2CO5 A;  2WC2 A;  3KZY A;  5A2Q K;  4R79 A;  1HW2 A;  4CZZ A;  1QZZ A;  2DT5 A;  1R1T A;  2M1B A;  4A0Y A;  2EV0 A;  3TO6 A;  1S6L A;  1E17 A;  4ZYH A;  4LG0 A;  4IRI A;  5DCM A;  4GYG A;  2GWR A;  2MH2 A;  2EFW A;  2RN7 A;  3WTY C;  4I0A A;  4CYD A;  1FYL A;  2NRA C;  1SAX A;  2EFP A;  3O6B B;  3GX4 X;  5CJ9 A;  5HLI A;  3LA3 A;  3ABT A;  2IPQ X;  4A12 A;  2GZW A;  2KRF A;  3OV8 A;  4AWX B;  4UV9 A;  2O6G E;  4L9V A;  3C7J A;  2ESH A;  2OZ6 A;  2R3S A;  4EJO A;  3L2C A;  1HQC A;  2MD5 A;  2Z99 A;  4HLX A;  4UVB A;  2CYY A;  1BIB A;  2VBY A;  4CXF A;  2HWV A;  4FX4 A;  5HOO A;  1UST A;  3N4M A;  4G7H F;  4GCV A;  3K9T A;  4HW0 A;  2IJL A;  2FRH A;  2A6E F;  1B6A A;  1P92 A;  2Q8K A;  4YFX F;  5H6Q A;  5KVR A;  2DQL A;  3SHF A;  2E7X A;  3T1B A;  2P5V A;  3GUD A;  5LRS A;  2EA2 A;  2FEZ A;  3S2W A;  4KFC A;  2F5D A;  2K86 A;  3RPQ A;  2MBF A;  1B59 A;  2KKO A;  2BBY A;  1DDN A;  3O3K A;  5EEH A;  2ZME B;  4PCQ A;  1IF1 A;  1D8K A;  2A61 A;  3KP6 A;  4YIF A;  1I1S A;  3WTW C;  1Q1H A;  4IPA A;  3ZP5 A;  2O61 A;  2IA2 A;  2P7V B;  3JSO A;  2MLG A;  1LEA A;  3DF8 A;  3L9F A;  4ZH4 F;  4LMY A;  1E2X A;  2DO7 A;  2DAO A;  3QU3 A;  2MLK A;  3IC7 A;  4L5I A;  3QP6 A;  4IXA A;  4L0Z B;  4RGS A;  4EM0 B;  3QU6 A;  3MCZ A;  1MJB A;  2JPB A;  5HLH A;  2GQQ A;  4NHJ A;  4HF0 A;  2K4J A;  4M9S A;  2MA3 A;  3I54 A;  4BHC A;  1BI1 A;  3QOP A;  2DBB A;  2M45 A;  1SFE A;  2LKP A;  1SFU A;  3M1E A;  2PG4 A;  4L18 B;  3F8F A;  2XGX A;  3T8T A;  4BHP A;  3G3Z A;  1FC3 A;  2IA1 A;  1B1B A;  2ESN A;  2Z5U A;  1XB4 A;  2ZNZ A;  1R58 A;  4IF4 A;  3SFZ A;  4LK1 F;  3TO9 A;  5BS6 A;  3MFK A;  4I7H A;  2HR3 A;  1TQM A;  4ZYE A;  5ED4 A;  2HQN A;  1U5T C;  1SD5 A;  3LFK A;  4WXC A;  3DPT A;  4M73 A;  2ZJ2 A;  5D5U B;  1L3L A;  3GLX A;  2OA4 A;  4RAZ A;  5ICC A;  4WXD A;  1ONV A;  1EH7 A;  5TRD A;  1FY7 A;  4AD9 A;  2CG4 A;  3MWM A;  1XDU A;  5JFR A;  1TQP A;  3SZP A;  4XLP F;  1QO0 D;  2JZY A;  3U2R A;  3JTH A;  1LVA A;  2L3D A;  1QPM A;  4G8X A;  3WTU C;  4UUV A;  3H3U A;  1S7O A;  1MKM A;  5J8C A;  1R5G A;  1BC7 C;  1IXR C;  4LK0 F;  4YFN F;  4LGW A;  2WWY A;  5FFZ A;  2EB7 A;  1GVJ A;  4OIP F;  4UNO A;  1PP8 F;  1ZRF A;  4KA4 A;  4R8H A;  1IUY A;  4U7D A;  3R0J A;  3HIF A;  3KCC A;  2KIU A;  4L9N A;  4WCG A;  4RB3 C;  3DXJ F;  5A2Q Z;  4Y15 A;  3RIR A;  3FXR A;  4LB5 A;  5LHI A;  4HF2 A;  3P7N A;  2PN6 A;  3C3W A;  5HDG A;  4RGU A;  1OR7 A;  2DTR A;  3TQN A;  5HS7 A;  2MH9 A;  3ZMZ A;  2J5O A;  4LFU A;  1MZB A;  3QPH A;  1TW3 A;  2L02 A;  1XSX A;  1CGP A;  3HTS B;  3LA7 A;  5D8K B;  1ZN2 A;  5L3G A;  5LLQ A;  3GFJ A;  4BYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...