1ZG6A

Tem1 beta lactamase mutant s70g
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Structure of the wild-type TEM-1 beta-lactamase at 1.55 A and the mutant enzyme Ser70Ala at 2.1 A suggest the mode of noncovalent catalysis for the mutant enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1zg6A00
1FQGA 1PWCA 1Q2PA 3QNBA 1LI9A 2PU4A 2Y2GA 3MXRA 4S2KA 2ZM8A 4WELA 4D2OA 2A49A 2IWDA 5CGWA 3DTMA 1DY6A 3GRJA 2FFFB 4KG5A 4JBFA 4RX2A 4JXVA 1W8QA 2Y2HA 3AGFA 5EE8A 4OOMA 3HLDA 4E3NA 5A93A 5M1AA 4WMCD 5BOHA 5HW3A 3CJMA 3AGEA 2WAFA 5EECA 1MKIA 3IWOA 3IF6A 3ZG9B 1MWTA 1SKFA 5J8XA 1GCEA 3TOIA 1KDSA 2PU2A 2Q9NA 1K57C 4HBUA 4R3BA 3IXBA 4OPYA 3W4QA 2ZJ9A 4LV0A 4EBPA 1K56A 3D4FA 3DWZA 3I7JA 3ZHHA 2Y2PA 3HLBA 3N8RA 4L0LA 3C7VA 3SOIA 1YLZA 4FH2A 4GD8A 5CTNA 4PM8A 1KGGA 2Y4AA 5FAOA 3NI9A 3G34A 5GHYA 1K57A 3E2LA 3O3VA 3C5AA 5KSHA 1NY0A 5HAIA 3IXDA 3G32A 1JWVA 4KQQA 3SS4A 1BTLA 4DXCA 3VP1A 2WUQA 2J7VA 3MZFA 1FSWA 2CC1A 1L0DA 4K0XA 5CTMA 2Y2IA 3VOYA 3MFDA 4K0WA 4OKPA 4OOLA 1W5DA 3S4XA 1MXOA 1IELA 1PZPA 2XQZA 4R0QA 1LI0A 2ZC5B 2EX9A 1ZG6A 5FQ9A 3BFDA 1KVMA 1BLHA 3BLMA 4R3JA 4ZJ2A 1WE4A 2C5WB 4PM7A 5AQBA 3NY4A 5GLCA 2B5RA 4U3TA 3UY6A 4F94A 3AGDA 2PBYA 3G35A 4M3KA 2ZQ9A 2EX8A 4KG2A 1KGEA 2JCHA 3GVBA 3ZG8B 5A92A 3M2JA 5E2HA 5KSCA 3MBZA 3P09A 5GLAA 2ZLYA 1BUEA 2XLNA 2A3UA 1IKGA 3BM6A 1CI9A 3C4OA 3E2KA 3IT9A 1PZOA 4Y0UA 4C3QA 2HDQA 4ZJ3A 4QB8A 4B4XA 1NJ4A 4JPMA 5HFOA 2DCFA 3V5MA 4S2IA 4KQRA 3BECA 4JF6A 3ITBA 2H5SA 4EWFA 4KZAA 2Y59A 4S2PA 2V2FF 4C75A 3Q1FA 2Y55A 5JYPA 3JYIA 3V39A 4WZ5A 3BFGA 3WRZA 5EVIC 1FSYA 2I72A 3IHBA 3O88A 4QHCA 4E6WA 4GB7A 3MZDA 4MLLA 1NYYA 1YLTA 2Y2KA 1FCNA 1YLJA 3Q81A 4U0XA 3PBSA 3UPNA 3FZCA 3NIAA 4XUXA 4Y7PA 4GOGA 4BQMA 2X01A 4DXBA 1K6SA 5EVIA 2V20A 2ZMAA 4OP5A 3OCLA 1K54C 1MWSA 1IYOA 1OMEA 2WKIA 5DF7A 4UA6A 3VFHA 5KMWA 2GDNA 1RP5A 1IYPA 3HREA 4R1GA 5E2FA 3WWXA 3ZVWA 5GLBA 2Y2LA 3GTCA 3PAEA 3V3SA 3W8KA 4Y0TA 2EFUA 1K56D 5DTSA 4NETA 1EI5A 4GDNA 5FI6A 3M6HA 5FQMA 3UE0A 5AQ9A 1H8ZA 2HDRA 3ITAA 3A3DA 1K54A 3G30A 1NXYA 4RA7A 1ZKJA 3BLSA 3RXXA 2XEPA 1DJBA 1ESUA 1VQQA 3V50A 3EQVA 3VOZA 3PAGA 4MNRA 1JWZA 1G6AA 5FQIA 5CEBA 3ZNYA 3VP0A 3W4OA 1CI8A 5CHUA 2QZ6A 4IEDA 4DE3A 2H0TA 2QMIA 3CMZA 1XGIA 1WYBA 3N4IA 3ZVTA 3ZNTA 2ZD8A 3HLFA 4OOYA 4OLGA 4QY5A 2UWXA 3LY4A 1H5XA 4Q8IA 3O87A 3M6BA 3VMAA 5L2FA 4YFMA 2JC7A 4N1XA 1IYQA 3A3JA 5FQQA 3SH7A 5KZHA 3MKFA 4OPQA 1L0GA 4H8RA 1N4OA 5HL1A 1TDGA 5CHJA 4QY6A 4KZ9A 4P85A 3WS2A 4P0MA 4QD4A 1HTZA 3G2YA 4X56A 2EXBA 1E3UA 1BLSA 2P74A 1K6RA 4OH0A 4WYYA 5FQKA 3HUMA 5EVLA 5DVAA 2OLUA 5I94A 1XX2A 1GHMA 2RL3A 3PBTA 5E2GA 5FAPA 1FCMA 2HP9A 3LCEA 4BL2A 4E3MA 2Y2JA 3CG5A 2EXAA 4CJNA 4A5RA 5TR7A 1W7FA 1PI4A 1KGFA 1Y54A 4Z9QA 3FKWA 3HLWA 1GHPA 4HEFA 1XA1A 2OV5A 3ZG0A 4OP8A 1CK3A 2WYXA 5HAPA 2E8IA 3HVFA 4WEKA 5F82A 1L2SA 5TFQA 5EVID 5F1FA 2BLSA 4ZJ1A 3C7UA 1S6RA 1O07A 3DWKA 1FR1A 2XR0A 1DJCA 1JTDA 4E3LA 3BFFA 5EOEA 4DE1A 1JVJA 5D3OA 1ZG4A 2WKEA 3PBOA 2WGIA 3HLCA 1NZOA 2J9OA 4DRTA 1ALQA 5HARA 2QPNA 3N8SA 5CERA 5DTTA 4GNUA 1YMXA 1I2WA 4WEJA 4R4RA 1EWZA 4KZ4A 2Y2QA 4LCLA 3BYDA 1N9BA 1Q2QA 2EFXA 5FSRA 1VM1A 2VGJA 3BRMA 2XH9A 1XXMA 4JXGA 5E43A 4O7DA 5EOOA 1PWDA 3UPOA 4IBRA 4KQOA 2ZC3B 1QMFA 1TVFA 4HBTA 2JBFA 1ES4A 1XP4A 4UA7A 4E3IA 1I5QA 1RGYA 4JLFA 3A3EA 2Y2MA 2X71A 1WYCA 2C6WB 2Z2LB 5CEDA 2WGWB 1XGJA 1SHVA 3SH9A 1HD8A 3Q7VB 2ZM0A 3IH8A 5E2EA 2WAEA 3HL9A 3WS1A 4X69A 3P98A 1L0FA 3UDIA 2P9VA 3IF5A 3IXGA 5GL9A 3RXWA 5M18A 3NC8A 4JKTA 1YLWA 1O7EA 1YT4A 4ZBEA 3GR2A 1Z6FA 1PW1A 5G18A 1FR6A 2XDMA 1SCWA 3C4PA 3UO9A 1K55C 4RX3A 3WRTA 5FA7A 4B4ZA 4LV1A 3A3FA 3FYZA 3MXSA 5TGFA 1JWPA 3VP2A 1E3UD 4S2NC 4X55A 2WADA 3BFEA 1IYSA 1YM1A 3CZDA 3HBRA 4OLDA 4DE0A 4XXRA 3G2ZA 4DDSA 5IHVA 1C3BA 3IF6B 5DF8A 3OPRA 1ESIA 3RJUA 3HUOA 2IWBA 1GA9A 1FOFA 1ONGA 1LLBA 4ZTKA 5DTKA 4BENA 4R4SA 4GN2A 1BSGA 2ZC6B 2ZQ8A 3OC2A 4WM9A 5CXWA 2G2UA 4DE2A 5F1GA 4UA9A 4P87A 5EPHA 5GHXA 1K38A 5HX9A 5CHMA 4CPKA 4E3KA 5A90A 2Z2MB 2Y2OA 3TG9A 2JE5A 2XGNA 1KE3A 4E6XA 1J9MA 2DRWA 3ISGA 1MWUA 3HLEA 4JF4A 4OQ0A 3OPHA 2XD5A 3LEZA 1BZAA 1RCJA 4Y0OA 3S22A 1KE0A 1QMEA 2XK1A 3IWQA 4EBNA 3IXHA 3UE1A 1YMSA 3IWIA 2WK0A 2J9PA 4X53A 1AXBA 3Q82A 4KZ8A 2OLVA 2V1ZA 4GD6A 1G68A 4JXSA 1ES2A 4N9LA 2WGVA 2RCXA 4HESA 4PM6A 2R9XA 3UNWA 3FWLA 3IQAA 2ZC4B 4JXWA 4LV2A 3MZEA 3PTEA 3MKEA 1RGZA 4ZDXA 1S0WA 3DW0A 2HPBA 4IBXA 2Q9MA 3UN7A 1YLPA 3G31A 2HP5A 3PBQA 4N9KA 1E4DA 2ZC7A 4MEZA 3EQUA 3LO7A 3OPLA 4OPZA 1IEMA 4RVAA 4E3JA 1K4EA 4ZAMA 3SS5A 3VP3A 2EX2A 4K91A 4OONA 5HAQA 4E3OA 1IKIA 4S2OA 3V3RA 4FSFA 1CEGA 4MBKA 2Y91A 4UHUA 2BG1A 4KENB 3S1YA 3ZDJA 2XD1A 1E25A 2XF3A 3IH9A 1BLCA 1M40A 4OQHA 3NDGA 4X68A 1ES5A 4B88A 1MPLA 1KVLA 3WS4A 1DJAA 5EUAA 1NYMA 4GKUA 4WZ4A 4NK3A 1EROA 4LV3A 4C6YA 4KZBA 4KZ7A 1M6KA 1PI5A 4UAAA 1H8YA 3NCKA 3PBNA 1TDLA 4U0TA 3PBRA 3WS0A 5GLDA 2WZZA 4X6TA 4OPRA 3ZFZA 3WS5A 1ERQA 3Q7ZA 5U47A 5JYOA 1TEMA 1ERMA 2ZM2A 4IVKA 3OZHA 4N1HA 3GQZA 1MBLA 1XKZA 4S2MA 3ZGAB 4BL3A 3N6IA 2X02A 5M19A 1NZUA 3N8LA 1I2SA 4IVIA 4WMCA 1BT5A 3VFFA 1GA0A 4PPRA 3N7WA 1L0EA 5FAQA 5EVIB 1KE4A 4KZ3A 2P9VB 2IWCA 3G4PA 5FI2A 2WKHA 2EX6A 3M2KA 3NBLA 4YINA 3ZG7B 4QJGA 4PM5A 3BEBA 1GHIA 3QHYA 3QNCA 2FFYA 1SDNA 4LCMA 4LENA 1XPBA 4S2LA 3GSGA 4OVDA 1MY8A 1CEFA 4WZ5C 3ZCZA 5DF9A 3BFCA 4PMAA 3OCNA 1PWGA 1K4FA 4N92A 3GMWA 1W79A 3UPPA 1XA7A 3HUNA 1BLPA 2VGKA 1HVBA 1PYYA 4R23A 4JF5A 1LHYA 5AQAA 4FCFA 5CRFA 2DNSA 3GV9A 2HP6A 1NRFA 4BD1A 4XUZA 5FATA 4RYEA 3VSKA 4PM9A 3SS3A 5GHZA 3O86A 4BJPA 1LL9A 1ONHA 5A91A 4QU3A 3UDXA 4EUZA 4OQGA 1ES3A 3OPPA 1HZOA 3A3IA 3HLGA 4KZ5A 4P6BA 5AQ7A 4EBLA 3B3XA 1YQSA 3LY3A 1FCOA 5F83A 1K25A 1KDWA 1PIOA 4FD8A 5CGSA 3FKVA 5CGXA 5FI7A 1K55A 3TSGA 1JTGA 4KZ6A 3Q07A 4DDYA 3VP4A 4BD0A 4S2NA 3NDEA 4DKIA 5FQJA 4FH4A 1MWRA 1W8YA 1YLYA 2H10A 4GDBA 2WGWA 2XFTA 1BULA 3UE3A 2H0YA 4MBFA 2XFSA 2OSUA 1PW8A 2HDUA 2ZQDA 3Q7VA 5CECA 4WBGA 3SH8A 1LL5A 1U60A 2ZQCA 4MBHA 1SDEA 2WZXA 4GZBA 3ZG5A 5FASA 2G2WA 4ID4A 4EQIA 5FDHA 2ZQAA 3W4PA 1ZC2A 4KG6A 3FV7A 2R9WA 2ZQ7A 3VSLA 2HDSA 4BLMA 3IF6C 4S2JA 4EV4A 2Y2NA 3UDFA 4OQIA 4DF6A 2J8YA 3IHAA
chains in the Genus database with same CATH superfamily
1FQGA 1PWCA 1LI9A 1OTBA 3MXRA 4S2KA 4D2OA 3GRJA 5A93A 4E3NA 2Y2HA 5BOHA 5J3WA 4I3AA 3CJMA 3AGEA 3ZG9B 4EU0A 1MWTA 5J8XA 1GCEA 3FPWA 1KDSA 2PU2A 5HDCA 3IXBA 3IBJA 1IFQA 3D4FA 2Y2PA 3SOIA 4FH2A 5CTNA 1HLUP 2A2LA 4EESA 5KSHA 3IXDA 1JWVA 3F1PB 4MN5A 4I38A 4KQQA 1BTLA 3E4OA 3LGOA 1FSWA 3VOYA 5L8MA 2Y79A 4II7A 4PM7A 4UEYA 4F94A 4M3KA 3ZG8B 3F1NB 5KSCA 5E2HA 3BM6A 3C4OA 1IKGA 2GZAA 4HI4A 4Z1WA 1NJ4A 3V5MA 3BECA 2VX8A 4JF6A 3VOLA 2H5SA 4EWFA 4C75A 3MQOA 5G4ZA 3V39A 5JYPA 4WZ5A 3IHBA 5HWWA 1J3WA 1XJ3A 2PYRA 1YLJA 3NIAA 2V20A 2ZMAA 4OP5A 3VFHA 1IYPA 3WWXA 3BW6A 3W8KA 3GTCA 5IT5A 3BY9A 1MZUA 1K56D 2BASA 3UE0A 5AQ9A 1H8ZA 2HDRA 3ITAA 4RA7A 5I5LA 3BLSA 3RXXA 2XEPA 1ESUA 1VQQA 3CPTA 3EQVA 2QHKA 4MNRA 4WL9A 5FQIA 2NUPC 3VP0A 4BMWA 2H0TA 2YKFA 5HWVA 4QY5A 1P9RA 4Q8IA 3VMAA 5L2FA 3R7WB 1H0MA 2JC7A 4DJ2A 2XRNA 4OPQA 1L0GA 4H8RA 2PR5A 5DFXA 4QD4A 1HTZA 3G2YA 4X56A 1K6RA 4OH0A 3UMEA 3PBTA 2RL3A 5E2GA 1FCMA 5L10A 1XFNA 2B18A 1TS8A 4P6ZM 4A5RA 1PNEA 5TR7A 1KGFA 4Z9QA 4HEFA 4GCZA 4OP8A 3K2NA 1D06A 4XT2A 4FOFA 2E8IA 4WEKA 5F82A 5TFQA 1L2SA 4X1LA 5F1FA 3LR4A 3PXPA 1O07A 4G3WA 1FR1A 1X0OA 4E3LA 1F9IA 3PBOA 4BWIA 4GLQA 5CERA 4GNUA 1EWZA 4KZ4A 4Y5FA 1N9BA 1Q2QA 3S7OA 4CLCE 4G3VA 2XH9A 2M7UA 4O7DA 2W1RA 2V1BA 4PKYA 1QMFA 2K7SA 1YSQA 1DP9A 4JLFA 3A3EA 2Y2MA 3FPVA 1WYCA 2C6WB 3HJKA 5CEDA 4E04A 1SHVA 3SH9A 4IJGA 1VETB 3H82A 5E2EA 4K08A 3UDIA 3MQ0A 2P9VA 3IF5A 5GL9A 3RXWA 3NC8A 4ZBEA 2XDMA 4MMNA 2OWJA 1JWPA 3C30A 3KYEA 4LLOB 1YM1A 1P9WA 3HBRA 2IA2A 4GHIA 3D3OA 1C3BA 5DF8A 2WKQA 2HV1A 1ESIA 1GA9A 3T1SA 4R4SA 1BSGA 2JKGA 4WM9A 4DE2A 2PDRA 5EPHA 2WKRA 1S4RA 5CHMA 1GSXA 2JE5A 4OQ0A 5IU1A 4ME4A 2OAP1 1GSWA 3UMDA 3ULFA 3LR5A 4EBNA 3KSIA 3IWIA 3UB9A 2OLVA 2V1ZA 4N9LA 2RCXA 4HESA 1K0KA 2KDKA 3D72A 3IQAA 4JXWA 4LGWA 3DW0A 2Q9MA 3UN7A 3UB5P 3LO7A 1IEMA 4LPZA 4ZAMA 4BBVA 5HSQA 3QP4A 3VP3A 5HAQA 2W1TA 4CLCB 4FSFA 4MBKA 2V8FA 2EWWA 4KENB 1BLCA 4NK3A 4LV3A 4UAAA 1H8YA 3NCKA 3PBNA 4B93A 3PBRA 3WS0A 2ZMVA 2WZZA 4X6TA 3ZFZA 3WS5A 2ZM2A 2VV8A 3GQZA 4BL3A 3LR0A 3N8LA 4CQHA 1GA0A 5FAQA 3G4PA 5FI2A 2WKHA 3NBLA 3QNCA 1SDNA 4LCMA 4LENA 4S2LA 2GJ3A 4PMAA 1PWGA 3HUNA 2VGKA 1HVBA 1PYYA 4EEPA 4BD1A 1NRFA 5A8BA 5FATA 3VSKA 3D9YA 1S1ZA 5K5BA 3NJAA 3UDXA 4QU3A 3F1NA 4EUZA 5F69A 1HZOA 3T1RA 2Z6DA 1FCOA 3U2AA 5DKKA 2PRFA 4FD8A 3OBFA 1JTGA 3IBRA 3VP4A 4S2NA 1MWRA 3UE3A 2H0YA 5J4EA 4WBGA 1U60A 2A24B 2WZXA 2JKTI 4ID4A 2ZQAA 3ZQ5A 4KG6A 5FDSA 3IF6C 4OQIA 3IHAA 2PU4A 2Y2GA 3EEHA 4KG5A 4L9EA 2X01A 1W8QA 4OOMA 4WMCD 4XT2B 5EECA 1MKIA 2OOLA 3IF6A 2VV6A 4Q0IA 2Q9NA 1K57C 2HF6A 4R3BA 3QP8A 1BYWA 4HNBA 4PM8A 5FAOA 5GHYA 5HDSA 1K57A 3R7WA 4FUWA 1VB6A 3T1XA 4K0XA 3TRCA 4NXGA 4K0WA 4OKPA 1W5DA 3S4XA 1PZPA 4R0QA 4IUKA 3G6OA 3H82B 2C5WB 2K2NA 3NY4A 5GLCA 2JKRI 1OJGA 1GSVA 3UY6A 5FEFA 3LFVA 2PBYA 3G35A 2EX8A 2JCHA 3T4LA 1IOUA 3MBZA 3P09A 2A3UA 4X25A 4WF0A 1PZOA 2FZ0A 5F68A 4C3QA 4Y2FA 4JPMA 5HFOA 2QJ5A 2Q0OA 4NXEA 2D02A 2Y59A 4I3JA 2Y55A 1NLYA 3WRZA 1FSYA 1LL8A 1W63Q 2I72A 4E6WA 1ZTUA 1NYYA 2VGLM 1S66L 2Y2KA 1WA9A 3PBSA 3FZCA 1OTIA 4XUXA 4Y7PA 3EGXC 2VJWA 2J3TD 3LIFA 1IYOA 4UA6A 1RP5A 4R1GA 3ZVWA 5GLBA 4BBTA 2Y2LA 4Y0TA 2EFUA 3UE6A 4NETA 3LICA 3F1OB 2CMNA 4R6LA 5FQMA 3DTEA 1ZKJA 3BQAA 5FL3A 2B02A 1CI8A 2J3WA 4WN5A 3R4KA 2QMIA 2KLIA 4OOYA 2W1TB 3LY4A 3O87A 4YFMA 4HQAA 5KZHA 4N1XA 1N4OA 4QWOA 5C5KA 4QY6A 4KZ9A 4P85A 1MC0A 4PHTA 2P74A 3CI6A 5FQKA 2UV0E 1GHMA 5FAPA 3LCEA 2Y2JA 1OT9A 4CJNA 1YKDA 3H7WB 1PI4A 1SKOA 1GHPA 3ZG0A 2W27A 2P08A 2VK3A 5HAPA 3HVFA 4CLCC 5EVID 2W3FA 4ZJ1A 3C7UA 2NUTC 2OAQ1 4NG2A 3NHQA 3DTIA 1JTDA 3BFFA 2WGIA 4HJ4A 4DRTA 3TJZC 1YMXA 1I2WA 4CLCA 3JPUA 2AVXA 4LCLA 2Y2QA 2V0WA 1VM1A 3BRMA 3RFBA 1XXMA 5E43A 4MCWA 3UPOA 3T12B 3B42A 2W3EA 2ZC3B 2PT7A 3LIEA 1ES4A 4E3IA 2X71A 3KYQA 1XGJA 1W63M 2ZM0A 3IH8A 2WAEA 3HJIA 4F3LB 1V9ZA 4MN7A 3KSGA 4JKTA 4G3KA 3GR2A 3DTKA 1PW1A 5G18A 1SCWA 4EUVA 2VZWA 4LV1A 1E3UD 3BWLA 2M1CA 3EGDC 4OLDA 5IHVA 3IF6B 3RJUA 3HUOA 1N9LA 1LLBA 4ZTKA 4GN2A 3OC2A 2ZC6B 5CXWA 2JN7A 3GDIA 4UA9A 4P87A 5GHXA 1K38A 1CJFA 5F5YA 3O5YA 2Y2OA 1LT0A 4E6XA 4WLAA 1MWUA 4MN6A 3OPHA 1XJ6A 4HOIA 3LEZA 1RCJA 3CLOA 1QMEA 3IWQA 3UB7A 2J3TC 3IXHA 1ODVA 3UE1A 2WK0A 4R3AA 4X53A 1F5MA 4KZ8A 1G68A 5HD5A 2WGVA 5IS1A 3FWLA 3C38A 4LV2A 3MZEA 2A24A 3UB6A 3MR0A 1RGZA 4HJ3A 4ZDXA 1S0WA 4NXBA 1YLPA 3G31A 5EVEA 2LB5A 3H9WA 1E4DA 2ZC7A 4MEZA 4OPZA 5HL6A 2ZOHA 3PHYA 4K91A 1ZHHB 4E3OA 4S2OA 3V3RA 2Y91A 3ZDJA 2XD1A 3MS6A 1LSWA 1ES5A 1MPLA 1KVLA 5EUAA 1NYMA 4C6YA 4KZBA 2P7JA 1M6KA 3DBAA 2I9VA 4S2MA 1TEMA 1ERMA 4B9OA 4N1HA 1YAXA 1MBLA 1XKZA 3N6IA 5M19A 1NZUA 2JKTM 1KE4A 4KZ3A 3M2KA 4YINA 3ZG7B 1GHIA 3QHYA 2L0WA 2XA7S 2FFYA 3GSGA 1MY8A 5DF9A 3NOUC 4N92A 4I5SA 1W79A 1XA7A 4EETB 1LHYA 4FCFA 2DNSA 2HP6A 1TS7A 4PM9A 3SS3A 4BJPA 4OQGA 2Z6CA 3A3IA 1MKMA 1K25A 3T1QB 5CGXA 4KZ6A 3NDEA 4GS9A 4DKIA 5EFWA 4ETXA 2HJ9C 4L9GA 5EM1A 2XFTA 4MBFA 3PYPA 2OSUA 2WKPA 4LRXC 3VE4A 1SDEA 4GZBA 2JKRM 4EQIA 1OTAA 1ZC2A 2R9WA 4KQDA 2ZQ7A 4S2JA 2Y2NA 3UDFA 4DF6A 3CWFA 3F1OA 4WELA 2ZM8A 4EERA 1SKOB 5CGWA 2IWDA 3PR6A 1DY6A 2FFFB 2DMWA 4JBFA 5EE8A 1STZA 4JXVA 3AGFA 3SW1A 3HLDA 5M1AA 3BQ8A 2WAFA 3UB8A 3HCYA 4HBUA 3IX3A 3W4QA 2ZJ9A 4LV0A 1K56A 3I7JA 4Q0JA 3HLBA 3N8RA 3C7VA 1YLZA 2Y4AA 3G34A 1S4SA 3RTYA 3O3VA 3C5AA 1NY0A 5HAIA 3SS4A 4ETZA 3GECA 2VEAA 4DXCA 1Y28A 3QP1A 3VP1A 3DAVA 3MZFA 5F6AA 2Y2IA 3MFDA 4OOLA 1MXOA 1IELA 4I39A 2XQZA 2ZC5B 3MQQA 2EX9A 3BLMA 5AQBA 2B5RA 4U3TA 3TE8A 3FG8A 3H7WA 4KG2A 1KGEA 5EM0A 2YKHA 3KYZA 3M2JA 1H8MA 3MSHA 4LRZE 2ZLYA 1CI9A 5G4YA 3IT9A 4KUKA 3T4SA 4QB8A 2V0UA 2GX5A 4S2IA 4LRYC 2HZ5A 2INWA 2V2FF 3MF0A 3VV4A 3JYIA 2W3DA 5HDDA 4MLLA 1YLTA 3UPNA 1K6SA 1K54C 1MWSA 2WKIA 1OMEA 2GDNA 3HREA 5E2FA 4R70A 3PAEA 5DTSA 1EI5A 4GDNA 5AJGA 1XFQA 4HIAA 1CQAA 3JVUA 1PRQA 1DP8A 1K54A 1NXYA 2QKPA 4F3LA 3VOZA 1V9YA 1G6AA 5CEBA 3ZNYA 2QZ6A 4IEDA 3CMZA 1N9NA 1XGIA 3T4JA 3ZVTA 3HLFA 2W0NA 1D1JA 1YSPA 3M6BA 3SH7A 1IYQA 3A3JA 3NOPC 3EEAA 5HL1A 1TDGA 5J7EA 5TJJA 5TBMB 3WS2A 4Y17A 4P0MA 1G6OA 2EXBA 1BLSA 4WYYA 4O01A 5EVLA 3LEQA 4M4XA 3LYXA 2HP9A 4BL2A 1TS0A 3SZTA 1G5UA 1W7FA 3K3DA 1Y54A 3FKWA 3HLWA 1TS6A 2D01A 2QWSA 3W2ZA 1S6RA 1JNUA 1JVJA 1ZG4A 3ICYA 2HGVA 1NZOA 4ZRRA 2J9OA 1ALQA 2QPNA 3N8SA 5DTTA 5DKLA 4WEJA 5L09A 3BYDA 2EFXA 3BJNA 2VGJA 2ZBBA 1VHMA 4LFUA 1FILA 3CITA 4IBRA 3P01A 2KX6A 2OWHA 4KQOA 2JHEA 3QP2A 4HBTA 2QYBA 4GS9B 1I5QA 3LUQA 3QP6A 1HD8A 3WS1A 4GJ4A 3P98A 1L0FA 2QJ7A 1SZVA 2Y8HA 3C2WA 1H3QA 4NXFA 1K55C 4RX3A 5FA7A 3A3FA 5TGFA 4X55A 1IYSA 4DE0A 4XXRA 3G2ZA 1EW0A 3OPRA 3IX4A 2V9AA 2E8JA 4CPKA 4E3KA 2Z2MB 3CHWP 3TG9A 2XGNA 1KE3A 3KX0X 3ISGA 4JF4A 2ZMFA 1BZAA 4Y0OA 1KE0A 3MMHA 2XK1A 3EWKA 1YMSA 2JKFA 2J9PA 2VA0A 1T1BA 4O8GA 4GD6A 4PM6A 2R9XA 3UNWA 2ZC4B 3A0SA 3MKEA 2HPBA 3PBQA 1N9OA 3EQUA 3OPLA 1K4EA 3SS5A 4IHQA 4RQ9A 1S1YA 2EX2A 1IKIA 5HD3A 1CEGA 3L7HA 3IS2B 2BG1A 3S1YA 3IH9A 3NDGA 4X68A 4B88A 4WZ4A 4O0PA 2V1AA 4KZ7A 1TDLA 4U0TA 5U47A 5JYOA 4BQMA 3OZHA 3ZGAB 4IVIA 1I2SA 4WMCA 1BT5A 3VFFA 4PPRA 3N7WA 1LSVA 2IWCA 2PD7A 2EX6A 4QJGA 3T4TA 3BEBA 4WZ5C 3IX8A 3MXQA 1T19A 3GMWA 3UPPA 1P0ZA 5AVEA 3GV9A 4RYEA 3O86A 4JGPA 1ONHA 5A91A 1OTEA 4MDZA 2B95A 3LI8A 1ES3A 3B47A 4KZ5A 5AQ7A 4Q0HA 4DMZA 1P97A 3VE3A 3FC7A 5FI7A 3TSGA 1L3LA 5MC7A 3TW8A 3V67A 3RH8B 4DDYA 4EEUA 4BD0A 4QPRA 5FQJA 4FH4A 1CF0A 1D7EA 1YLYA 2H10A 4GDBA 2WGWA 4KUOA 2XFSA 4YNRA 2ZQDA 2PYPA 2HDUA 3Q7VA 2XSSA 3S7NA 1KOUA 2PBDP 3SH8A 1LL5A 3ZG5A 5FDHA 3W4PA 1DP6A 1NLZA 1ACFA 3FV7A 4BLMA 2HDSA 4EV4A 3OOVA 2GNXA 1Q2PA 3QNBA 4WUJA 3MFXA 2A49A 3QP5A 3DTMA 4RX2A 5HPIA 4IUHA 5HW3A 3IWOA 1SKFA 4JGOA 3TOIA 2ACGA 1VEUA 4OPYA 4H6JB 4EBPA 3DWZA 3ZHHA 4L0LA 4EXOA 4GD8A 4HH2A 1KGGA 4BBUA 1XJ2A 1Z09A 3NI9A 3CAXA 3E2LA 5DJTA 3G32A 1DRMA 4P6ZS 2WUQA 5TBMA 2J7VA 2CC1A 1L0DA 5CTMA 2PD8A 4HY8A 5KIZA 1LI0A 1ZG6A 5FQ9A 3BFDA 1KVMA 2M7VA 1BLHA 4R3JA 4ZJ2A 1WE4A 3AGDA 1OPXA 2ZQ9A 3GVBA 5A92A 2XA7M 5HWTA 3K3CA 3T4KA 5GLAA 1BUEA 2XLNA 5HPFA 3E2KA 1UGUA 3LIDA 2ZL1A 4Y0UA 2HDQA 4ZJ3A 2BTFP 4B4XA 4AFIA 5DJUA 5HZHA 2DCFA 4JGRA 4KQRA 3ITBA 4KZAA 1G28A 4S2PA 3Q1FA 3S7QA 3BFGA 5EVIC 3O88A 4QHCA 1TF1A 4GB7A 3MZDA 5L07A 1FCNA 3Q81A 4U0XA 4ARZA 4GOGA 4DXBA 5EVIA 3OCLA 5DF7A 4YOFA 5KMWA 3V3SA 5FI6A 3M6HA 4DN0A 3L9KA 2ZOIA 1AWIA 3U4LP 2O0YA 4L9FA 3A3DA 3G30A 2L4RA 1DJBA 3V50A 1A0KA 3PAGA 3EOIA 1JWZA 3BY8A 3W4OA 5CHUA 4I3IA 1LSXA 4DE3A 3JVVA 1WYBA 3N4IA 3ZNTA 2ZD8A 4OLGA 2UWXA 3E0YA 1H5XA 2O9CA 4HJ6A 2PR6A 5FQQA 2LB9A 3MKFA 5CHJA 5FEGA 1UWNX 1T1AA 3S7PA 3C8CA 4NKPA 1E3UA 3HUMA 5DVAA 2OLUA 4NEED 5I94A 1XX2A 3KO6A 4E3MA 3CG5A 2EXAA 3MJQA 1F2KA 5EV0A 1XA1A 2O99A 2PAVP 4HH3A 2OV5A 1CK3A 1NRJA 2WYXA 1YPRA 5AVFA 2FH5A 2BLSA 4Y15A 3DWKA 2XR0A 1DJCA 5EOEA 4DE1A 5D3OA 2WKEA 3HLCA 3E4PA 5HARA 1UWPX 5DFYA 3IS2A 4R4RA 5FSRA 3T4QA 4JXGA 3F1PA 5EOOA 1PWDA 3KSFA 2VLGA 4PAUA 1TVFA 2JBFA 1XP4A 4UA7A 1RGYA 4JGQA 2Z2LB 2WGWB 4DJ3A 3Q7VB 3HL9A 4X69A 3CPTB 3IXGA 5M18A 1YLWA 1O7EA 1YT4A 1Z6FA 1FR6A 3NULA 3UO9A 3C4PA 3WRTA 3E4QA 4B4ZA 3FYZA 3MXSA 3VP2A 4S2NC 3P7NA 4GW9A 2WADA 3BFEA 3CZDA 4DDSA 2H28A 4HP9A 2IWBA 1FOFA 1ONGA 3CUEC 3T50A 4HP4A 5DTKA 4BENA 1VEUB 2ZQ8A 2G2UA 5F1GA 5HX9A 1T18A 3OLOA 5A90A 3NOTC 1J9MA 2DRWA 3LR3A 3HLEA 3CUEA 3A0RA 2VV7A 2XD5A 2J80A 3T4OA 3S22A 1OJ5A 2O9AA 2XROA 1AXBA 3Q82A 4EW7A 4CLCD 4JXSA 1ES2A 2P04A 1OT6A 4PKYG 3PTEA 3B33A 1T1CA 4IBXA 2HP5A 4N9KA 1F98A 4R38A 4RVAA 4E3JA 4HHDA 2HJEA 2VKSA 4Y13A 3ZYTA 4OONA 2W3GA 4UHUA 2ZL1B 2XF3A 1E25A 1M40A 4OQHA 1FIKA 3WS4A 1DJAA 4GKUA 4Y3IA 1EROA 2KOIA 4H6JA 1PI5A 4ESPA 2MJ6A 5GLDA 1Y4OA 4OPRA 1PFLA 1ERQA 2K31A 3Q7ZA 4D60A 4IVKA 4ARZB 2X02A 4YWZA 2W3HA 1L0EA 5EVIB 2P9VB 2EA9A 2EWVA 4PM5A 4UQIS 4UQIM 1XPBA 4OVDA 3ZCZA 1CEFA 3BFCA 3OCNA 1K4FA 3LI9A 1BLPA 4R23A 4X1MA 4JF5A 5AQAA 1NWZA 5CRFA 4GHIB 4XUZA 5GHZA 2O9BA 2L1MA 1LL9A 3KSHA 2V8CA 2VGLS 3OPPA 3NECA 2R78A 3HLGA 4P6BA 5LBRA 3E98A 4EQ1A 4EBLA 3B3XA 1YQSA 3LY3A 5F83A 1KDWA 1TD5A 1PIOA 5CGSA 3FKVA 1K55A 3Q07A 2G7UA 3LIAA 4FTXA 1W8YA 2PHYA 1BULA 1OTDA 3A0VA 1PW8A 5CECA 1VETA 2ZQCA 1S67L 4MBHA 5FASA 3LIBA 2G2WA 5CX7A 3VSLA 1XJ4A 2J8YA
chains in the Genus database with same CATH topology
1FQGA 1PWCA 1Q2PA 3QNBA 1LI9A 2PU4A 2Y2GA 3MXRA 4S2KA 2ZM8A 4WELA 4D2OA 2A49A 2IWDA 5CGWA 3DTMA 1DY6A 3GRJA 2FFFB 4KG5A 4JBFA 4RX2A 4JXVA 1W8QA 2Y2HA 3AGFA 5EE8A 4OOMA 3HLDA 4E3NA 5A93A 5M1AA 4WMCD 5BOHA 5HW3A 3CJMA 3AGEA 2WAFA 5EECA 1MKIA 3IWOA 3IF6A 3ZG9B 1MWTA 1SKFA 5J8XA 1GCEA 3TOIA 1KDSA 2PU2A 2Q9NA 1K57C 4HBUA 4R3BA 3IXBA 4OPYA 3W4QA 2ZJ9A 4LV0A 4EBPA 1K56A 3D4FA 3DWZA 3I7JA 3ZHHA 2Y2PA 3HLBA 3N8RA 4L0LA 3C7VA 3SOIA 1YLZA 4FH2A 4GD8A 5CTNA 4PM8A 1KGGA 2Y4AA 5FAOA 3NI9A 3G34A 5GHYA 1K57A 3E2LA 3O3VA 3C5AA 5KSHA 1NY0A 5HAIA 3IXDA 3G32A 1JWVA 4KQQA 3SS4A 1BTLA 4DXCA 3VP1A 2WUQA 2J7VA 3MZFA 1FSWA 2CC1A 1L0DA 4K0XA 5CTMA 2Y2IA 3VOYA 3MFDA 4K0WA 4OKPA 4OOLA 1W5DA 3S4XA 1MXOA 1IELA 1PZPA 2XQZA 4R0QA 1LI0A 2ZC5B 2EX9A 1ZG6A 5FQ9A 3BFDA 1KVMA 1BLHA 3BLMA 4R3JA 4ZJ2A 1WE4A 2C5WB 4PM7A 5AQBA 3NY4A 5GLCA 2B5RA 4U3TA 3UY6A 4F94A 3AGDA 2PBYA 3G35A 4M3KA 2ZQ9A 2EX8A 4KG2A 1KGEA 2JCHA 3GVBA 3ZG8B 5A92A 3M2JA 5E2HA 5KSCA 3MBZA 3P09A 5GLAA 2ZLYA 1BUEA 2XLNA 2A3UA 1IKGA 3BM6A 1CI9A 3C4OA 3E2KA 3IT9A 1PZOA 4Y0UA 4C3QA 2HDQA 4ZJ3A 4QB8A 4B4XA 1NJ4A 4JPMA 5HFOA 2DCFA 3V5MA 4S2IA 4KQRA 3BECA 4JF6A 3ITBA 2H5SA 4EWFA 4KZAA 2Y59A 4S2PA 2V2FF 4C75A 3Q1FA 2Y55A 5JYPA 3JYIA 3V39A 4WZ5A 3BFGA 3WRZA 5EVIC 1FSYA 2I72A 3IHBA 3O88A 4QHCA 4E6WA 4GB7A 3MZDA 4MLLA 1NYYA 1YLTA 2Y2KA 1FCNA 1YLJA 3Q81A 4U0XA 3PBSA 3UPNA 3FZCA 3NIAA 4XUXA 4Y7PA 4GOGA 4BQMA 2X01A 4DXBA 1K6SA 5EVIA 2V20A 2ZMAA 4OP5A 3OCLA 1K54C 1MWSA 1IYOA 1OMEA 2WKIA 5DF7A 4UA6A 3VFHA 5KMWA 2GDNA 1RP5A 1IYPA 3HREA 4R1GA 5E2FA 3WWXA 3ZVWA 5GLBA 2Y2LA 3GTCA 3PAEA 3V3SA 3W8KA 4Y0TA 2EFUA 1K56D 5DTSA 4NETA 1EI5A 4GDNA 5FI6A 3M6HA 5FQMA 3UE0A 5AQ9A 1H8ZA 2HDRA 3ITAA 3A3DA 1K54A 3G30A 1NXYA 4RA7A 1ZKJA 3BLSA 3RXXA 2XEPA 1DJBA 1ESUA 1VQQA 3V50A 3EQVA 3VOZA 3PAGA 4MNRA 1JWZA 1G6AA 5FQIA 5CEBA 3ZNYA 3VP0A 3W4OA 1CI8A 5CHUA 2QZ6A 4IEDA 4DE3A 2H0TA 2QMIA 3CMZA 1XGIA 1WYBA 3N4IA 3ZVTA 3ZNTA 2ZD8A 3HLFA 4OOYA 4OLGA 4QY5A 2UWXA 3LY4A 1H5XA 4Q8IA 3O87A 3M6BA 3VMAA 5L2FA 4YFMA 2JC7A 4N1XA 1IYQA 3A3JA 5FQQA 3SH7A 5KZHA 3MKFA 4OPQA 1L0GA 4H8RA 1N4OA 5HL1A 1TDGA 5CHJA 4QY6A 4KZ9A 4P85A 3WS2A 4P0MA 4QD4A 1HTZA 3G2YA 4X56A 2EXBA 1E3UA 1BLSA 2P74A 1K6RA 4OH0A 4WYYA 5FQKA 3HUMA 5EVLA 5DVAA 2OLUA 5I94A 1XX2A 1GHMA 2RL3A 3PBTA 5E2GA 5FAPA 1FCMA 2HP9A 3LCEA 4BL2A 4E3MA 2Y2JA 3CG5A 2EXAA 4CJNA 4A5RA 5TR7A 1W7FA 1PI4A 1KGFA 1Y54A 4Z9QA 3FKWA 3HLWA 1GHPA 4HEFA 1XA1A 2OV5A 3ZG0A 4OP8A 1CK3A 2WYXA 5HAPA 2E8IA 3HVFA 4WEKA 5F82A 1L2SA 5TFQA 5EVID 5F1FA 2BLSA 4ZJ1A 3C7UA 1S6RA 1O07A 3DWKA 1FR1A 2XR0A 1DJCA 1JTDA 4E3LA 3BFFA 5EOEA 4DE1A 1JVJA 5D3OA 1ZG4A 2WKEA 3PBOA 2WGIA 3HLCA 1NZOA 2J9OA 4DRTA 1ALQA 5HARA 2QPNA 3N8SA 5CERA 5DTTA 4GNUA 1YMXA 1I2WA 4WEJA 4R4RA 1EWZA 4KZ4A 2Y2QA 4LCLA 3BYDA 1N9BA 1Q2QA 2EFXA 5FSRA 1VM1A 2VGJA 3BRMA 2XH9A 1XXMA 4JXGA 5E43A 4O7DA 5EOOA 1PWDA 3UPOA 4IBRA 4KQOA 2ZC3B 1QMFA 1TVFA 4HBTA 2JBFA 1ES4A 1XP4A 4UA7A 4E3IA 1I5QA 1RGYA 4JLFA 3A3EA 2Y2MA 2X71A 1WYCA 2C6WB 2Z2LB 5CEDA 2WGWB 1XGJA 1SHVA 3SH9A 1HD8A 3Q7VB 2ZM0A 3IH8A 5E2EA 2WAEA 3HL9A 3WS1A 4X69A 3P98A 1L0FA 3UDIA 2P9VA 3IF5A 3IXGA 5GL9A 3RXWA 5M18A 3NC8A 4JKTA 1YLWA 1O7EA 1YT4A 4ZBEA 3GR2A 1Z6FA 1PW1A 5G18A 1FR6A 2XDMA 1SCWA 3C4PA 3UO9A 1K55C 4RX3A 3WRTA 5FA7A 4B4ZA 4LV1A 3A3FA 3FYZA 3MXSA 5TGFA 1JWPA 3VP2A 1E3UD 4S2NC 4X55A 2WADA 3BFEA 1IYSA 1YM1A 3CZDA 3HBRA 4OLDA 4DE0A 4XXRA 3G2ZA 4DDSA 5IHVA 1C3BA 3IF6B 5DF8A 3OPRA 1ESIA 3RJUA 3HUOA 2IWBA 1GA9A 1FOFA 1ONGA 1LLBA 4ZTKA 5DTKA 4BENA 4R4SA 4GN2A 1BSGA 2ZC6B 2ZQ8A 3OC2A 4WM9A 5CXWA 2G2UA 4DE2A 5F1GA 4UA9A 4P87A 5EPHA 5GHXA 1K38A 5HX9A 5CHMA 4CPKA 4E3KA 5A90A 2Z2MB 2Y2OA 3TG9A 2JE5A 2XGNA 1KE3A 4E6XA 1J9MA 2DRWA 3ISGA 1MWUA 3HLEA 4JF4A 4OQ0A 3OPHA 2XD5A 3LEZA 1BZAA 1RCJA 4Y0OA 3S22A 1KE0A 1QMEA 2XK1A 3IWQA 4EBNA 3IXHA 3UE1A 1YMSA 3IWIA 2WK0A 2J9PA 4X53A 1AXBA 3Q82A 4KZ8A 2OLVA 2V1ZA 4GD6A 1G68A 4JXSA 1ES2A 4N9LA 2WGVA 2RCXA 4HESA 4PM6A 2R9XA 3UNWA 3FWLA 3IQAA 2ZC4B 4JXWA 4LV2A 3MZEA 3PTEA 3MKEA 1RGZA 4ZDXA 1S0WA 3DW0A 2HPBA 4IBXA 2Q9MA 3UN7A 1YLPA 3G31A 2HP5A 3PBQA 4N9KA 1E4DA 2ZC7A 4MEZA 3EQUA 3LO7A 3OPLA 4OPZA 1IEMA 4RVAA 4E3JA 1K4EA 4ZAMA 3SS5A 3VP3A 2EX2A 4K91A 4OONA 5HAQA 4E3OA 1IKIA 4S2OA 3V3RA 4FSFA 1CEGA 4MBKA 2Y91A 4UHUA 2BG1A 4KENB 3S1YA 3ZDJA 2XD1A 1E25A 2XF3A 3IH9A 1BLCA 1M40A 4OQHA 3NDGA 4X68A 1ES5A 4B88A 1MPLA 1KVLA 3WS4A 1DJAA 5EUAA 1NYMA 4GKUA 4WZ4A 4NK3A 1EROA 4LV3A 4C6YA 4KZBA 4KZ7A 1M6KA 1PI5A 4UAAA 1H8YA 3NCKA 3PBNA 1TDLA 4U0TA 3PBRA 3WS0A 5GLDA 2WZZA 4X6TA 4OPRA 3ZFZA 3WS5A 1ERQA 3Q7ZA 5U47A 5JYOA 1TEMA 1ERMA 2ZM2A 4IVKA 3OZHA 4N1HA 3GQZA 1MBLA 1XKZA 4S2MA 3ZGAB 4BL3A 3N6IA 2X02A 5M19A 1NZUA 3N8LA 1I2SA 4IVIA 4WMCA 1BT5A 3VFFA 1GA0A 4PPRA 3N7WA 1L0EA 5FAQA 5EVIB 1KE4A 4KZ3A 2P9VB 2IWCA 3G4PA 5FI2A 2WKHA 2EX6A 3M2KA 3NBLA 4YINA 3ZG7B 4QJGA 4PM5A 3BEBA 1GHIA 3QHYA 3QNCA 2FFYA 1SDNA 4LCMA 4LENA 1XPBA 4S2LA 3GSGA 4OVDA 1MY8A 1CEFA 4WZ5C 3ZCZA 5DF9A 3BFCA 4PMAA 3OCNA 1PWGA 1K4FA 4N92A 3GMWA 1W79A 3UPPA 1XA7A 3HUNA 1BLPA 2VGKA 1HVBA 1PYYA 4R23A 4JF5A 1LHYA 5AQAA 4FCFA 5CRFA 2DNSA 3GV9A 2HP6A 1NRFA 4BD1A 4XUZA 5FATA 4RYEA 3VSKA 4PM9A 3SS3A 5GHZA 3O86A 4BJPA 1LL9A 1ONHA 5A91A 4QU3A 3UDXA 4EUZA 4OQGA 1ES3A 3OPPA 1HZOA 3A3IA 3HLGA 4KZ5A 4P6BA 5AQ7A 4EBLA 3B3XA 1YQSA 3LY3A 1FCOA 5F83A 1K25A 1KDWA 1PIOA 4FD8A 5CGSA 3FKVA 5CGXA 5FI7A 1K55A 3TSGA 1JTGA 4KZ6A 3Q07A 4DDYA 3VP4A 4BD0A 4S2NA 3NDEA 4DKIA 5FQJA 4FH4A 1MWRA 1W8YA 1YLYA 2H10A 4GDBA 2WGWA 2XFTA 1BULA 3UE3A 2H0YA 4MBFA 2XFSA 2OSUA 1PW8A 2HDUA 2ZQDA 3Q7VA 5CECA 4WBGA 3SH8A 1LL5A 1U60A 2ZQCA 4MBHA 1SDEA 2WZXA 4GZBA 3ZG5A 5FASA 2G2WA 4ID4A 4EQIA 5FDHA 2ZQAA 3W4PA 1ZC2A 4KG6A 3FV7A 2R9WA 2ZQ7A 3VSLA 2HDSA 4BLMA 3IF6C 4S2JA 4EV4A 2Y2NA 3UDFA 4OQIA 4DF6A 2J8YA 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQG A;  1PWC A;  1Q2P A;  3QNB A;  1LI9 A;  2PU4 A;  2Y2G A;  3MXR A;  4S2K A;  2ZM8 A;  4WEL A;  4D2O A;  2A49 A;  2IWD A;  5CGW A;  3DTM A;  1DY6 A;  3GRJ A;  2FFF B;  4KG5 A;  4JBF A;  4RX2 A;  4JXV A;  1W8Q A;  2Y2H A;  3AGF A;  5EE8 A;  4OOM A;  3HLD A;  4E3N A;  5A93 A;  5M1A A;  4WMC D;  5BOH A;  5HW3 A;  3CJM A;  3AGE A;  2WAF A;  5EEC A;  1MKI A;  3IWO A;  3IF6 A;  3ZG9 B;  1MWT A;  1SKF A;  5J8X A;  1GCE A;  3TOI A;  1KDS A;  2PU2 A;  2Q9N A;  1K57 C;  4HBU A;  4R3B A;  3IXB A;  4OPY A;  3W4Q A;  2ZJ9 A;  4LV0 A;  4EBP A;  1K56 A;  3D4F A;  3DWZ A;  3I7J A;  3ZHH A;  2Y2P A;  3HLB A;  3N8R A;  4L0L A;  3C7V A;  3SOI A;  1YLZ A;  4FH2 A;  4GD8 A;  5CTN A;  4PM8 A;  1KGG A;  2Y4A A;  5FAO A;  3NI9 A;  3G34 A;  5GHY A;  1K57 A;  3E2L A;  3O3V A;  3C5A A;  5KSH A;  1NY0 A;  5HAI A;  3IXD A;  3G32 A;  1JWV A;  4KQQ A;  3SS4 A;  1BTL A;  4DXC A;  3VP1 A;  2WUQ A;  2J7V A;  3MZF A;  1FSW A;  2CC1 A;  1L0D A;  4K0X A;  5CTM A;  2Y2I A;  3VOY A;  3MFD A;  4K0W A;  4OKP A;  4OOL A;  1W5D A;  3S4X A;  1MXO A;  1IEL A;  1PZP A;  2XQZ A;  4R0Q A;  1LI0 A;  2ZC5 B;  2EX9 A;  1ZG6 A;  5FQ9 A;  3BFD A;  1KVM A;  1BLH A;  3BLM A;  4R3J A;  4ZJ2 A;  1WE4 A;  2C5W B;  4PM7 A;  5AQB A;  3NY4 A;  5GLC A;  2B5R A;  4U3T A;  3UY6 A;  4F94 A;  3AGD A;  2PBY A;  3G35 A;  4M3K A;  2ZQ9 A;  2EX8 A;  4KG2 A;  1KGE A;  2JCH A;  3GVB A;  3ZG8 B;  5A92 A;  3M2J A;  5E2H A;  5KSC A;  3MBZ A;  3P09 A;  5GLA A;  2ZLY A;  1BUE A;  2XLN A;  2A3U A;  1IKG A;  3BM6 A;  1CI9 A;  3C4O A;  3E2K A;  3IT9 A;  1PZO A;  4Y0U A;  4C3Q A;  2HDQ A;  4ZJ3 A;  4QB8 A;  4B4X A;  1NJ4 A;  4JPM A;  5HFO A;  2DCF A;  3V5M A;  4S2I A;  4KQR A;  3BEC A;  4JF6 A;  3ITB A;  2H5S A;  4EWF A;  4KZA A;  2Y59 A;  4S2P A;  2V2F F;  4C75 A;  3Q1F A;  2Y55 A;  5JYP A;  3JYI A;  3V39 A;  4WZ5 A;  3BFG A;  3WRZ A;  5EVI C;  1FSY A;  2I72 A;  3IHB A;  3O88 A;  4QHC A;  4E6W A;  4GB7 A;  3MZD A;  4MLL A;  1NYY A;  1YLT A;  2Y2K A;  1FCN A;  1YLJ A;  3Q81 A;  4U0X A;  3PBS A;  3UPN A;  3FZC A;  3NIA A;  4XUX A;  4Y7P A;  4GOG A;  4BQM A;  2X01 A;  4DXB A;  1K6S A;  5EVI A;  2V20 A;  2ZMA A;  4OP5 A;  3OCL A;  1K54 C;  1MWS A;  1IYO A;  1OME A;  2WKI A;  5DF7 A;  4UA6 A;  3VFH A;  5KMW A;  2GDN A;  1RP5 A;  1IYP A;  3HRE A;  4R1G A;  5E2F A;  3WWX A;  3ZVW A;  5GLB A;  2Y2L A;  3GTC A;  3PAE A;  3V3S A;  3W8K A;  4Y0T A;  2EFU A;  1K56 D;  5DTS A;  4NET A;  1EI5 A;  4GDN A;  5FI6 A;  3M6H A;  5FQM A;  3UE0 A;  5AQ9 A;  1H8Z A;  2HDR A;  3ITA A;  3A3D A;  1K54 A;  3G30 A;  1NXY A;  4RA7 A;  1ZKJ A;  3BLS A;  3RXX A;  2XEP A;  1DJB A;  1ESU A;  1VQQ A;  3V50 A;  3EQV A;  3VOZ A;  3PAG A;  4MNR A;  1JWZ A;  1G6A A;  5FQI A;  5CEB A;  3ZNY A;  3VP0 A;  3W4O A;  1CI8 A;  5CHU A;  2QZ6 A;  4IED A;  4DE3 A;  2H0T A;  2QMI A;  3CMZ A;  1XGI A;  1WYB A;  3N4I A;  3ZVT A;  3ZNT A;  2ZD8 A;  3HLF A;  4OOY A;  4OLG A;  4QY5 A;  2UWX A;  3LY4 A;  1H5X A;  4Q8I A;  3O87 A;  3M6B A;  3VMA A;  5L2F A;  4YFM A;  2JC7 A;  4N1X A;  1IYQ A;  3A3J A;  5FQQ A;  3SH7 A;  5KZH A;  3MKF A;  4OPQ A;  1L0G A;  4H8R A;  1N4O A;  5HL1 A;  1TDG A;  5CHJ A;  4QY6 A;  4KZ9 A;  4P85 A;  3WS2 A;  4P0M A;  4QD4 A;  1HTZ A;  3G2Y A;  4X56 A;  2EXB A;  1E3U A;  1BLS A;  2P74 A;  1K6R A;  4OH0 A;  4WYY A;  5FQK A;  3HUM A;  5EVL A;  5DVA A;  2OLU A;  5I94 A;  1XX2 A;  1GHM A;  2RL3 A;  3PBT A;  5E2G A;  5FAP A;  1FCM A;  2HP9 A;  3LCE A;  4BL2 A;  4E3M A;  2Y2J A;  3CG5 A;  2EXA A;  4CJN A;  4A5R A;  5TR7 A;  1W7F A;  1PI4 A;  1KGF A;  1Y54 A;  4Z9Q A;  3FKW A;  3HLW A;  1GHP A;  4HEF A;  1XA1 A;  2OV5 A;  3ZG0 A;  4OP8 A;  1CK3 A;  2WYX A;  5HAP A;  2E8I A;  3HVF A;  4WEK A;  5F82 A;  1L2S A;  5TFQ A;  5EVI D;  5F1F A;  2BLS A;  4ZJ1 A;  3C7U A;  1S6R A;  1O07 A;  3DWK A;  1FR1 A;  2XR0 A;  1DJC A;  1JTD A;  4E3L A;  3BFF A;  5EOE A;  4DE1 A;  1JVJ A;  5D3O A;  1ZG4 A;  2WKE A;  3PBO A;  2WGI A;  3HLC A;  1NZO A;  2J9O A;  4DRT A;  1ALQ A;  5HAR A;  2QPN A;  3N8S A;  5CER A;  5DTT A;  4GNU A;  1YMX A;  1I2W A;  4WEJ A;  4R4R A;  1EWZ A;  4KZ4 A;  2Y2Q A;  4LCL A;  3BYD A;  1N9B A;  1Q2Q A;  2EFX A;  5FSR A;  1VM1 A;  2VGJ A;  3BRM A;  2XH9 A;  1XXM A;  4JXG A;  5E43 A;  4O7D A;  5EOO A;  1PWD A;  3UPO A;  4IBR A;  4KQO A;  2ZC3 B;  1QMF A;  1TVF A;  4HBT A;  2JBF A;  1ES4 A;  1XP4 A;  4UA7 A;  4E3I A;  1I5Q A;  1RGY A;  4JLF A;  3A3E A;  2Y2M A;  2X71 A;  1WYC A;  2C6W B;  2Z2L B;  5CED A;  2WGW B;  1XGJ A;  1SHV A;  3SH9 A;  1HD8 A;  3Q7V B;  2ZM0 A;  3IH8 A;  5E2E A;  2WAE A;  3HL9 A;  3WS1 A;  4X69 A;  3P98 A;  1L0F A;  3UDI A;  2P9V A;  3IF5 A;  3IXG A;  5GL9 A;  3RXW A;  5M18 A;  3NC8 A;  4JKT A;  1YLW A;  1O7E A;  1YT4 A;  4ZBE A;  3GR2 A;  1Z6F A;  1PW1 A;  5G18 A;  1FR6 A;  2XDM A;  1SCW A;  3C4P A;  3UO9 A;  1K55 C;  4RX3 A;  3WRT A;  5FA7 A;  4B4Z A;  4LV1 A;  3A3F A;  3FYZ A;  3MXS A;  5TGF A;  1JWP A;  3VP2 A;  1E3U D;  4S2N C;  4X55 A;  2WAD A;  3BFE A;  1IYS A;  1YM1 A;  3CZD A;  3HBR A;  4OLD A;  4DE0 A;  4XXR A;  3G2Z A;  4DDS A;  5IHV A;  1C3B A;  3IF6 B;  5DF8 A;  3OPR A;  1ESI A;  3RJU A;  3HUO A;  2IWB A;  1GA9 A;  1FOF A;  1ONG A;  1LLB A;  4ZTK A;  5DTK A;  4BEN A;  4R4S A;  4GN2 A;  1BSG A;  2ZC6 B;  2ZQ8 A;  3OC2 A;  4WM9 A;  5CXW A;  2G2U A;  4DE2 A;  5F1G A;  4UA9 A;  4P87 A;  5EPH A;  5GHX A;  1K38 A;  5HX9 A;  5CHM A;  4CPK A;  4E3K A;  5A90 A;  2Z2M B;  2Y2O A;  3TG9 A;  2JE5 A;  2XGN A;  1KE3 A;  4E6X A;  1J9M A;  2DRW A;  3ISG A;  1MWU A;  3HLE A;  4JF4 A;  4OQ0 A;  3OPH A;  2XD5 A;  3LEZ A;  1BZA A;  1RCJ A;  4Y0O A;  3S22 A;  1KE0 A;  1QME A;  2XK1 A;  3IWQ A;  4EBN A;  3IXH A;  3UE1 A;  1YMS A;  3IWI A;  2WK0 A;  2J9P A;  4X53 A;  1AXB A;  3Q82 A;  4KZ8 A;  2OLV A;  2V1Z A;  4GD6 A;  1G68 A;  4JXS A;  1ES2 A;  4N9L A;  2WGV A;  2RCX A;  4HES A;  4PM6 A;  2R9X A;  3UNW A;  3FWL A;  3IQA A;  2ZC4 B;  4JXW A;  4LV2 A;  3MZE A;  3PTE A;  3MKE A;  1RGZ A;  4ZDX A;  1S0W A;  3DW0 A;  2HPB A;  4IBX A;  2Q9M A;  3UN7 A;  1YLP A;  3G31 A;  2HP5 A;  3PBQ A;  4N9K A;  1E4D A;  2ZC7 A;  4MEZ A;  3EQU A;  3LO7 A;  3OPL A;  4OPZ A;  1IEM A;  4RVA A;  4E3J A;  1K4E A;  4ZAM A;  3SS5 A;  3VP3 A;  2EX2 A;  4K91 A;  4OON A;  5HAQ A;  4E3O A;  1IKI A;  4S2O A;  3V3R A;  4FSF A;  1CEG A;  4MBK A;  2Y91 A;  4UHU A;  2BG1 A;  4KEN B;  3S1Y A;  3ZDJ A;  2XD1 A;  1E25 A;  2XF3 A;  3IH9 A;  1BLC A;  1M40 A;  4OQH A;  3NDG A;  4X68 A;  1ES5 A;  4B88 A;  1MPL A;  1KVL A;  3WS4 A;  1DJA A;  5EUA A;  1NYM A;  4GKU A;  4WZ4 A;  4NK3 A;  1ERO A;  4LV3 A;  4C6Y A;  4KZB A;  4KZ7 A;  1M6K A;  1PI5 A;  4UAA A;  1H8Y A;  3NCK A;  3PBN A;  1TDL A;  4U0T A;  3PBR A;  3WS0 A;  5GLD A;  2WZZ A;  4X6T A;  4OPR A;  3ZFZ A;  3WS5 A;  1ERQ A;  3Q7Z A;  5U47 A;  5JYO A;  1TEM A;  1ERM A;  2ZM2 A;  4IVK A;  3OZH A;  4N1H A;  3GQZ A;  1MBL A;  1XKZ A;  4S2M A;  3ZGA B;  4BL3 A;  3N6I A;  2X02 A;  5M19 A;  1NZU A;  3N8L A;  1I2S A;  4IVI A;  4WMC A;  1BT5 A;  3VFF A;  1GA0 A;  4PPR A;  3N7W A;  1L0E A;  5FAQ A;  5EVI B;  1KE4 A;  4KZ3 A;  2P9V B;  2IWC A;  3G4P A;  5FI2 A;  2WKH A;  2EX6 A;  3M2K A;  3NBL A;  4YIN A;  3ZG7 B;  4QJG A;  4PM5 A;  3BEB A;  1GHI A;  3QHY A;  3QNC A;  2FFY A;  1SDN A;  4LCM A;  4LEN A;  1XPB A;  4S2L A;  3GSG A;  4OVD A;  1MY8 A;  1CEF A;  4WZ5 C;  3ZCZ A;  5DF9 A;  3BFC A;  4PMA A;  3OCN A;  1PWG A;  1K4F A;  4N92 A;  3GMW A;  1W79 A;  3UPP A;  1XA7 A;  3HUN A;  1BLP A;  2VGK A;  1HVB A;  1PYY A;  4R23 A;  4JF5 A;  1LHY A;  5AQA A;  4FCF A;  5CRF A;  2DNS A;  3GV9 A;  2HP6 A;  1NRF A;  4BD1 A;  4XUZ A;  5FAT A;  4RYE A;  3VSK A;  4PM9 A;  3SS3 A;  5GHZ A;  3O86 A;  4BJP A;  1LL9 A;  1ONH A;  5A91 A;  4QU3 A;  3UDX A;  4EUZ A;  4OQG A;  1ES3 A;  3OPP A;  1HZO A;  3A3I A;  3HLG A;  4KZ5 A;  4P6B A;  5AQ7 A;  4EBL A;  3B3X A;  1YQS A;  3LY3 A;  1FCO A;  5F83 A;  1K25 A;  1KDW A;  1PIO A;  4FD8 A;  5CGS A;  3FKV A;  5CGX A;  5FI7 A;  1K55 A;  3TSG A;  1JTG A;  4KZ6 A;  3Q07 A;  4DDY A;  3VP4 A;  4BD0 A;  4S2N A;  3NDE A;  4DKI A;  5FQJ A;  4FH4 A;  1MWR A;  1W8Y A;  1YLY A;  2H10 A;  4GDB A;  2WGW A;  2XFT A;  1BUL A;  3UE3 A;  2H0Y A;  4MBF A;  2XFS A;  2OSU A;  1PW8 A;  2HDU A;  2ZQD A;  3Q7V A;  5CEC A;  4WBG A;  3SH8 A;  1LL5 A;  1U60 A;  2ZQC A;  4MBH A;  1SDE A;  2WZX A;  4GZB A;  3ZG5 A;  5FAS A;  2G2W A;  4ID4 A;  4EQI A;  5FDH A;  2ZQA A;  3W4P A;  1ZC2 A;  4KG6 A;  3FV7 A;  2R9W A;  2ZQ7 A;  3VSL A;  2HDS A;  4BLM A;  3IF6 C;  4S2J A;  4EV4 A;  2Y2N A;  3UDF A;  4OQI A;  4DF6 A;  2J8Y A;  3IHA A; 
#chains in the Genus database with same CATH topology
 1FQG A;  1PWC A;  1LI9 A;  1OTB A;  3MXR A;  4S2K A;  4D2O A;  3GRJ A;  5A93 A;  4E3N A;  2Y2H A;  5BOH A;  5J3W A;  4I3A A;  3CJM A;  3AGE A;  3ZG9 B;  4EU0 A;  1MWT A;  5J8X A;  1GCE A;  3FPW A;  1KDS A;  2PU2 A;  5HDC A;  3IXB A;  3IBJ A;  1IFQ A;  3D4F A;  2Y2P A;  3SOI A;  4FH2 A;  5CTN A;  1HLU P;  2A2L A;  4EES A;  5KSH A;  3IXD A;  1JWV A;  3F1P B;  4MN5 A;  4I38 A;  4KQQ A;  1BTL A;  3E4O A;  3LGO A;  1FSW A;  3VOY A;  5L8M A;  2Y79 A;  4II7 A;  4PM7 A;  4UEY A;  4F94 A;  4M3K A;  3ZG8 B;  3F1N B;  5KSC A;  5E2H A;  3BM6 A;  3C4O A;  1IKG A;  2GZA A;  4HI4 A;  4Z1W A;  1NJ4 A;  3V5M A;  3BEC A;  2VX8 A;  4JF6 A;  3VOL A;  2H5S A;  4EWF A;  4C75 A;  3MQO A;  5G4Z A;  3V39 A;  5JYP A;  4WZ5 A;  3IHB A;  5HWW A;  1J3W A;  1XJ3 A;  2PYR A;  1YLJ A;  3NIA A;  2V20 A;  2ZMA A;  4OP5 A;  3VFH A;  1IYP A;  3WWX A;  3BW6 A;  3W8K A;  3GTC A;  5IT5 A;  3BY9 A;  1MZU A;  1K56 D;  2BAS A;  3UE0 A;  5AQ9 A;  1H8Z A;  2HDR A;  3ITA A;  4RA7 A;  5I5L A;  3BLS A;  3RXX A;  2XEP A;  1ESU A;  1VQQ A;  3CPT A;  3EQV A;  2QHK A;  4MNR A;  4WL9 A;  5FQI A;  2NUP C;  3VP0 A;  4BMW A;  2H0T A;  2YKF A;  5HWV A;  4QY5 A;  1P9R A;  4Q8I A;  3VMA A;  5L2F A;  3R7W B;  1H0M A;  2JC7 A;  4DJ2 A;  2XRN A;  4OPQ A;  1L0G A;  4H8R A;  2PR5 A;  5DFX A;  4QD4 A;  1HTZ A;  3G2Y A;  4X56 A;  1K6R A;  4OH0 A;  3UME A;  3PBT A;  2RL3 A;  5E2G A;  1FCM A;  5L10 A;  1XFN A;  2B18 A;  1TS8 A;  4P6Z M;  4A5R A;  1PNE A;  5TR7 A;  1KGF A;  4Z9Q A;  4HEF A;  4GCZ A;  4OP8 A;  3K2N A;  1D06 A;  4XT2 A;  4FOF A;  2E8I A;  4WEK A;  5F82 A;  5TFQ A;  1L2S A;  4X1L A;  5F1F A;  3LR4 A;  3PXP A;  1O07 A;  4G3W A;  1FR1 A;  1X0O A;  4E3L A;  1F9I A;  3PBO A;  4BWI A;  4GLQ A;  5CER A;  4GNU A;  1EWZ A;  4KZ4 A;  4Y5F A;  1N9B A;  1Q2Q A;  3S7O A;  4CLC E;  4G3V A;  2XH9 A;  2M7U A;  4O7D A;  2W1R A;  2V1B A;  4PKY A;  1QMF A;  2K7S A;  1YSQ A;  1DP9 A;  4JLF A;  3A3E A;  2Y2M A;  3FPV A;  1WYC A;  2C6W B;  3HJK A;  5CED A;  4E04 A;  1SHV A;  3SH9 A;  4IJG A;  1VET B;  3H82 A;  5E2E A;  4K08 A;  3UDI A;  3MQ0 A;  2P9V A;  3IF5 A;  5GL9 A;  3RXW A;  3NC8 A;  4ZBE A;  2XDM A;  4MMN A;  2OWJ A;  1JWP A;  3C30 A;  3KYE A;  4LLO B;  1YM1 A;  1P9W A;  3HBR A;  2IA2 A;  4GHI A;  3D3O A;  1C3B A;  5DF8 A;  2WKQ A;  2HV1 A;  1ESI A;  1GA9 A;  3T1S A;  4R4S A;  1BSG A;  2JKG A;  4WM9 A;  4DE2 A;  2PDR A;  5EPH A;  2WKR A;  1S4R A;  5CHM A;  1GSX A;  2JE5 A;  4OQ0 A;  5IU1 A;  4ME4 A;  2OAP 1;  1GSW A;  3UMD A;  3ULF A;  3LR5 A;  4EBN A;  3KSI A;  3IWI A;  3UB9 A;  2OLV A;  2V1Z A;  4N9L A;  2RCX A;  4HES A;  1K0K A;  2KDK A;  3D72 A;  3IQA A;  4JXW A;  4LGW A;  3DW0 A;  2Q9M A;  3UN7 A;  3UB5 P;  3LO7 A;  1IEM A;  4LPZ A;  4ZAM A;  4BBV A;  5HSQ A;  3QP4 A;  3VP3 A;  5HAQ A;  2W1T A;  4CLC B;  4FSF A;  4MBK A;  2V8F A;  2EWW A;  4KEN B;  1BLC A;  4NK3 A;  4LV3 A;  4UAA A;  1H8Y A;  3NCK A;  3PBN A;  4B93 A;  3PBR A;  3WS0 A;  2ZMV A;  2WZZ A;  4X6T A;  3ZFZ A;  3WS5 A;  2ZM2 A;  2VV8 A;  3GQZ A;  4BL3 A;  3LR0 A;  3N8L A;  4CQH A;  1GA0 A;  5FAQ A;  3G4P A;  5FI2 A;  2WKH A;  3NBL A;  3QNC A;  1SDN A;  4LCM A;  4LEN A;  4S2L A;  2GJ3 A;  4PMA A;  1PWG A;  3HUN A;  2VGK A;  1HVB A;  1PYY A;  4EEP A;  4BD1 A;  1NRF A;  5A8B A;  5FAT A;  3VSK A;  3D9Y A;  1S1Z A;  5K5B A;  3NJA A;  3UDX A;  4QU3 A;  3F1N A;  4EUZ A;  5F69 A;  1HZO A;  3T1R A;  2Z6D A;  1FCO A;  3U2A A;  5DKK A;  2PRF A;  4FD8 A;  3OBF A;  1JTG A;  3IBR A;  3VP4 A;  4S2N A;  1MWR A;  3UE3 A;  2H0Y A;  5J4E A;  4WBG A;  1U60 A;  2A24 B;  2WZX A;  2JKT I;  4ID4 A;  2ZQA A;  3ZQ5 A;  4KG6 A;  5FDS A;  3IF6 C;  4OQI A;  3IHA A;  2PU4 A;  2Y2G A;  3EEH A;  4KG5 A;  4L9E A;  2X01 A;  1W8Q A;  4OOM A;  4WMC D;  4XT2 B;  5EEC A;  1MKI A;  2OOL A;  3IF6 A;  2VV6 A;  4Q0I A;  2Q9N A;  1K57 C;  2HF6 A;  4R3B A;  3QP8 A;  1BYW A;  4HNB A;  4PM8 A;  5FAO A;  5GHY A;  5HDS A;  1K57 A;  3R7W A;  4FUW A;  1VB6 A;  3T1X A;  4K0X A;  3TRC A;  4NXG A;  4K0W A;  4OKP A;  1W5D A;  3S4X A;  1PZP A;  4R0Q A;  4IUK A;  3G6O A;  3H82 B;  2C5W B;  2K2N A;  3NY4 A;  5GLC A;  2JKR I;  1OJG A;  1GSV A;  3UY6 A;  5FEF A;  3LFV A;  2PBY A;  3G35 A;  2EX8 A;  2JCH A;  3T4L A;  1IOU A;  3MBZ A;  3P09 A;  2A3U A;  4X25 A;  4WF0 A;  1PZO A;  2FZ0 A;  5F68 A;  4C3Q A;  4Y2F A;  4JPM A;  5HFO A;  2QJ5 A;  2Q0O A;  4NXE A;  2D02 A;  2Y59 A;  4I3J A;  2Y55 A;  1NLY A;  3WRZ A;  1FSY A;  1LL8 A;  1W63 Q;  2I72 A;  4E6W A;  1ZTU A;  1NYY A;  2VGL M;  1S66 L;  2Y2K A;  1WA9 A;  3PBS A;  3FZC A;  1OTI A;  4XUX A;  4Y7P A;  3EGX C;  2VJW A;  2J3T D;  3LIF A;  1IYO A;  4UA6 A;  1RP5 A;  4R1G A;  3ZVW A;  5GLB A;  4BBT A;  2Y2L A;  4Y0T A;  2EFU A;  3UE6 A;  4NET A;  3LIC A;  3F1O B;  2CMN A;  4R6L A;  5FQM A;  3DTE A;  1ZKJ A;  3BQA A;  5FL3 A;  2B02 A;  1CI8 A;  2J3W A;  4WN5 A;  3R4K A;  2QMI A;  2KLI A;  4OOY A;  2W1T B;  3LY4 A;  3O87 A;  4YFM A;  4HQA A;  5KZH A;  4N1X A;  1N4O A;  4QWO A;  5C5K A;  4QY6 A;  4KZ9 A;  4P85 A;  1MC0 A;  4PHT A;  2P74 A;  3CI6 A;  5FQK A;  2UV0 E;  1GHM A;  5FAP A;  3LCE A;  2Y2J A;  1OT9 A;  4CJN A;  1YKD A;  3H7W B;  1PI4 A;  1SKO A;  1GHP A;  3ZG0 A;  2W27 A;  2P08 A;  2VK3 A;  5HAP A;  3HVF A;  4CLC C;  5EVI D;  2W3F A;  4ZJ1 A;  3C7U A;  2NUT C;  2OAQ 1;  4NG2 A;  3NHQ A;  3DTI A;  1JTD A;  3BFF A;  2WGI A;  4HJ4 A;  4DRT A;  3TJZ C;  1YMX A;  1I2W A;  4CLC A;  3JPU A;  2AVX A;  4LCL A;  2Y2Q A;  2V0W A;  1VM1 A;  3BRM A;  3RFB A;  1XXM A;  5E43 A;  4MCW A;  3UPO A;  3T12 B;  3B42 A;  2W3E A;  2ZC3 B;  2PT7 A;  3LIE A;  1ES4 A;  4E3I A;  2X71 A;  3KYQ A;  1XGJ A;  1W63 M;  2ZM0 A;  3IH8 A;  2WAE A;  3HJI A;  4F3L B;  1V9Z A;  4MN7 A;  3KSG A;  4JKT A;  4G3K A;  3GR2 A;  3DTK A;  1PW1 A;  5G18 A;  1SCW A;  4EUV A;  2VZW A;  4LV1 A;  1E3U D;  3BWL A;  2M1C A;  3EGD C;  4OLD A;  5IHV A;  3IF6 B;  3RJU A;  3HUO A;  1N9L A;  1LLB A;  4ZTK A;  4GN2 A;  3OC2 A;  2ZC6 B;  5CXW A;  2JN7 A;  3GDI A;  4UA9 A;  4P87 A;  5GHX A;  1K38 A;  1CJF A;  5F5Y A;  3O5Y A;  2Y2O A;  1LT0 A;  4E6X A;  4WLA A;  1MWU A;  4MN6 A;  3OPH A;  1XJ6 A;  4HOI A;  3LEZ A;  1RCJ A;  3CLO A;  1QME A;  3IWQ A;  3UB7 A;  2J3T C;  3IXH A;  1ODV A;  3UE1 A;  2WK0 A;  4R3A A;  4X53 A;  1F5M A;  4KZ8 A;  1G68 A;  5HD5 A;  2WGV A;  5IS1 A;  3FWL A;  3C38 A;  4LV2 A;  3MZE A;  2A24 A;  3UB6 A;  3MR0 A;  1RGZ A;  4HJ3 A;  4ZDX A;  1S0W A;  4NXB A;  1YLP A;  3G31 A;  5EVE A;  2LB5 A;  3H9W A;  1E4D A;  2ZC7 A;  4MEZ A;  4OPZ A;  5HL6 A;  2ZOH A;  3PHY A;  4K91 A;  1ZHH B;  4E3O A;  4S2O A;  3V3R A;  2Y91 A;  3ZDJ A;  2XD1 A;  3MS6 A;  1LSW A;  1ES5 A;  1MPL A;  1KVL A;  5EUA A;  1NYM A;  4C6Y A;  4KZB A;  2P7J A;  1M6K A;  3DBA A;  2I9V A;  4S2M A;  1TEM A;  1ERM A;  4B9O A;  4N1H A;  1YAX A;  1MBL A;  1XKZ A;  3N6I A;  5M19 A;  1NZU A;  2JKT M;  1KE4 A;  4KZ3 A;  3M2K A;  4YIN A;  3ZG7 B;  1GHI A;  3QHY A;  2L0W A;  2XA7 S;  2FFY A;  3GSG A;  1MY8 A;  5DF9 A;  3NOU C;  4N92 A;  4I5S A;  1W79 A;  1XA7 A;  4EET B;  1LHY A;  4FCF A;  2DNS A;  2HP6 A;  1TS7 A;  4PM9 A;  3SS3 A;  4BJP A;  4OQG A;  2Z6C A;  3A3I A;  1MKM A;  1K25 A;  3T1Q B;  5CGX A;  4KZ6 A;  3NDE A;  4GS9 A;  4DKI A;  5EFW A;  4ETX A;  2HJ9 C;  4L9G A;  5EM1 A;  2XFT A;  4MBF A;  3PYP A;  2OSU A;  2WKP A;  4LRX C;  3VE4 A;  1SDE A;  4GZB A;  2JKR M;  4EQI A;  1OTA A;  1ZC2 A;  2R9W A;  4KQD A;  2ZQ7 A;  4S2J A;  2Y2N A;  3UDF A;  4DF6 A;  3CWF A;  3F1O A;  4WEL A;  2ZM8 A;  4EER A;  1SKO B;  5CGW A;  2IWD A;  3PR6 A;  1DY6 A;  2FFF B;  2DMW A;  4JBF A;  5EE8 A;  1STZ A;  4JXV A;  3AGF A;  3SW1 A;  3HLD A;  5M1A A;  3BQ8 A;  2WAF A;  3UB8 A;  3HCY A;  4HBU A;  3IX3 A;  3W4Q A;  2ZJ9 A;  4LV0 A;  1K56 A;  3I7J A;  4Q0J A;  3HLB A;  3N8R A;  3C7V A;  1YLZ A;  2Y4A A;  3G34 A;  1S4S A;  3RTY A;  3O3V A;  3C5A A;  1NY0 A;  5HAI A;  3SS4 A;  4ETZ A;  3GEC A;  2VEA A;  4DXC A;  1Y28 A;  3QP1 A;  3VP1 A;  3DAV A;  3MZF A;  5F6A A;  2Y2I A;  3MFD A;  4OOL A;  1MXO A;  1IEL A;  4I39 A;  2XQZ A;  2ZC5 B;  3MQQ A;  2EX9 A;  3BLM A;  5AQB A;  2B5R A;  4U3T A;  3TE8 A;  3FG8 A;  3H7W A;  4KG2 A;  1KGE A;  5EM0 A;  2YKH A;  3KYZ A;  3M2J A;  1H8M A;  3MSH A;  4LRZ E;  2ZLY A;  1CI9 A;  5G4Y A;  3IT9 A;  4KUK A;  3T4S A;  4QB8 A;  2V0U A;  2GX5 A;  4S2I A;  4LRY C;  2HZ5 A;  2INW A;  2V2F F;  3MF0 A;  3VV4 A;  3JYI A;  2W3D A;  5HDD A;  4MLL A;  1YLT A;  3UPN A;  1K6S A;  1K54 C;  1MWS A;  2WKI A;  1OME A;  2GDN A;  3HRE A;  5E2F A;  4R70 A;  3PAE A;  5DTS A;  1EI5 A;  4GDN A;  5AJG A;  1XFQ A;  4HIA A;  1CQA A;  3JVU A;  1PRQ A;  1DP8 A;  1K54 A;  1NXY A;  2QKP A;  4F3L A;  3VOZ A;  1V9Y A;  1G6A A;  5CEB A;  3ZNY A;  2QZ6 A;  4IED A;  3CMZ A;  1N9N A;  1XGI A;  3T4J A;  3ZVT A;  3HLF A;  2W0N A;  1D1J A;  1YSP A;  3M6B A;  3SH7 A;  1IYQ A;  3A3J A;  3NOP C;  3EEA A;  5HL1 A;  1TDG A;  5J7E A;  5TJJ A;  5TBM B;  3WS2 A;  4Y17 A;  4P0M A;  1G6O A;  2EXB A;  1BLS A;  4WYY A;  4O01 A;  5EVL A;  3LEQ A;  4M4X A;  3LYX A;  2HP9 A;  4BL2 A;  1TS0 A;  3SZT A;  1G5U A;  1W7F A;  3K3D A;  1Y54 A;  3FKW A;  3HLW A;  1TS6 A;  2D01 A;  2QWS A;  3W2Z A;  1S6R A;  1JNU A;  1JVJ A;  1ZG4 A;  3ICY A;  2HGV A;  1NZO A;  4ZRR A;  2J9O A;  1ALQ A;  2QPN A;  3N8S A;  5DTT A;  5DKL A;  4WEJ A;  5L09 A;  3BYD A;  2EFX A;  3BJN A;  2VGJ A;  2ZBB A;  1VHM A;  4LFU A;  1FIL A;  3CIT A;  4IBR A;  3P01 A;  2KX6 A;  2OWH A;  4KQO A;  2JHE A;  3QP2 A;  4HBT A;  2QYB A;  4GS9 B;  1I5Q A;  3LUQ A;  3QP6 A;  1HD8 A;  3WS1 A;  4GJ4 A;  3P98 A;  1L0F A;  2QJ7 A;  1SZV A;  2Y8H A;  3C2W A;  1H3Q A;  4NXF A;  1K55 C;  4RX3 A;  5FA7 A;  3A3F A;  5TGF A;  4X55 A;  1IYS A;  4DE0 A;  4XXR A;  3G2Z A;  1EW0 A;  3OPR A;  3IX4 A;  2V9A A;  2E8J A;  4CPK A;  4E3K A;  2Z2M B;  3CHW P;  3TG9 A;  2XGN A;  1KE3 A;  3KX0 X;  3ISG A;  4JF4 A;  2ZMF A;  1BZA A;  4Y0O A;  1KE0 A;  3MMH A;  2XK1 A;  3EWK A;  1YMS A;  2JKF A;  2J9P A;  2VA0 A;  1T1B A;  4O8G A;  4GD6 A;  4PM6 A;  2R9X A;  3UNW A;  2ZC4 B;  3A0S A;  3MKE A;  2HPB A;  3PBQ A;  1N9O A;  3EQU A;  3OPL A;  1K4E A;  3SS5 A;  4IHQ A;  4RQ9 A;  1S1Y A;  2EX2 A;  1IKI A;  5HD3 A;  1CEG A;  3L7H A;  3IS2 B;  2BG1 A;  3S1Y A;  3IH9 A;  3NDG A;  4X68 A;  4B88 A;  4WZ4 A;  4O0P A;  2V1A A;  4KZ7 A;  1TDL A;  4U0T A;  5U47 A;  5JYO A;  4BQM A;  3OZH A;  3ZGA B;  4IVI A;  1I2S A;  4WMC A;  1BT5 A;  3VFF A;  4PPR A;  3N7W A;  1LSV A;  2IWC A;  2PD7 A;  2EX6 A;  4QJG A;  3T4T A;  3BEB A;  4WZ5 C;  3IX8 A;  3MXQ A;  1T19 A;  3GMW A;  3UPP A;  1P0Z A;  5AVE A;  3GV9 A;  4RYE A;  3O86 A;  4JGP A;  1ONH A;  5A91 A;  1OTE A;  4MDZ A;  2B95 A;  3LI8 A;  1ES3 A;  3B47 A;  4KZ5 A;  5AQ7 A;  4Q0H A;  4DMZ A;  1P97 A;  3VE3 A;  3FC7 A;  5FI7 A;  3TSG A;  1L3L A;  5MC7 A;  3TW8 A;  3V67 A;  3RH8 B;  4DDY A;  4EEU A;  4BD0 A;  4QPR A;  5FQJ A;  4FH4 A;  1CF0 A;  1D7E A;  1YLY A;  2H10 A;  4GDB A;  2WGW A;  4KUO A;  2XFS A;  4YNR A;  2ZQD A;  2PYP A;  2HDU A;  3Q7V A;  2XSS A;  3S7N A;  1KOU A;  2PBD P;  3SH8 A;  1LL5 A;  3ZG5 A;  5FDH A;  3W4P A;  1DP6 A;  1NLZ A;  1ACF A;  3FV7 A;  4BLM A;  2HDS A;  4EV4 A;  3OOV A;  2GNX A;  1Q2P A;  3QNB A;  4WUJ A;  3MFX A;  2A49 A;  3QP5 A;  3DTM A;  4RX2 A;  5HPI A;  4IUH A;  5HW3 A;  3IWO A;  1SKF A;  4JGO A;  3TOI A;  2ACG A;  1VEU A;  4OPY A;  4H6J B;  4EBP A;  3DWZ A;  3ZHH A;  4L0L A;  4EXO A;  4GD8 A;  4HH2 A;  1KGG A;  4BBU A;  1XJ2 A;  1Z09 A;  3NI9 A;  3CAX A;  3E2L A;  5DJT A;  3G32 A;  1DRM A;  4P6Z S;  2WUQ A;  5TBM A;  2J7V A;  2CC1 A;  1L0D A;  5CTM A;  2PD8 A;  4HY8 A;  5KIZ A;  1LI0 A;  1ZG6 A;  5FQ9 A;  3BFD A;  1KVM A;  2M7V A;  1BLH A;  4R3J A;  4ZJ2 A;  1WE4 A;  3AGD A;  1OPX A;  2ZQ9 A;  3GVB A;  5A92 A;  2XA7 M;  5HWT A;  3K3C A;  3T4K A;  5GLA A;  1BUE A;  2XLN A;  5HPF A;  3E2K A;  1UGU A;  3LID A;  2ZL1 A;  4Y0U A;  2HDQ A;  4ZJ3 A;  2BTF P;  4B4X A;  4AFI A;  5DJU A;  5HZH A;  2DCF A;  4JGR A;  4KQR A;  3ITB A;  4KZA A;  1G28 A;  4S2P A;  3Q1F A;  3S7Q A;  3BFG A;  5EVI C;  3O88 A;  4QHC A;  1TF1 A;  4GB7 A;  3MZD A;  5L07 A;  1FCN A;  3Q81 A;  4U0X A;  4ARZ A;  4GOG A;  4DXB A;  5EVI A;  3OCL A;  5DF7 A;  4YOF A;  5KMW A;  3V3S A;  5FI6 A;  3M6H A;  4DN0 A;  3L9K A;  2ZOI A;  1AWI A;  3U4L P;  2O0Y A;  4L9F A;  3A3D A;  3G30 A;  2L4R A;  1DJB A;  3V50 A;  1A0K A;  3PAG A;  3EOI A;  1JWZ A;  3BY8 A;  3W4O A;  5CHU A;  4I3I A;  1LSX A;  4DE3 A;  3JVV A;  1WYB A;  3N4I A;  3ZNT A;  2ZD8 A;  4OLG A;  2UWX A;  3E0Y A;  1H5X A;  2O9C A;  4HJ6 A;  2PR6 A;  5FQQ A;  2LB9 A;  3MKF A;  5CHJ A;  5FEG A;  1UWN X;  1T1A A;  3S7P A;  3C8C A;  4NKP A;  1E3U A;  3HUM A;  5DVA A;  2OLU A;  4NEE D;  5I94 A;  1XX2 A;  3KO6 A;  4E3M A;  3CG5 A;  2EXA A;  3MJQ A;  1F2K A;  5EV0 A;  1XA1 A;  2O99 A;  2PAV P;  4HH3 A;  2OV5 A;  1CK3 A;  1NRJ A;  2WYX A;  1YPR A;  5AVF A;  2FH5 A;  2BLS A;  4Y15 A;  3DWK A;  2XR0 A;  1DJC A;  5EOE A;  4DE1 A;  5D3O A;  2WKE A;  3HLC A;  3E4P A;  5HAR A;  1UWP X;  5DFY A;  3IS2 A;  4R4R A;  5FSR A;  3T4Q A;  4JXG A;  3F1P A;  5EOO A;  1PWD A;  3KSF A;  2VLG A;  4PAU A;  1TVF A;  2JBF A;  1XP4 A;  4UA7 A;  1RGY A;  4JGQ A;  2Z2L B;  2WGW B;  4DJ3 A;  3Q7V B;  3HL9 A;  4X69 A;  3CPT B;  3IXG A;  5M18 A;  1YLW A;  1O7E A;  1YT4 A;  1Z6F A;  1FR6 A;  3NUL A;  3UO9 A;  3C4P A;  3WRT A;  3E4Q A;  4B4Z A;  3FYZ A;  3MXS A;  3VP2 A;  4S2N C;  3P7N A;  4GW9 A;  2WAD A;  3BFE A;  3CZD A;  4DDS A;  2H28 A;  4HP9 A;  2IWB A;  1FOF A;  1ONG A;  3CUE C;  3T50 A;  4HP4 A;  5DTK A;  4BEN A;  1VEU B;  2ZQ8 A;  2G2U A;  5F1G A;  5HX9 A;  1T18 A;  3OLO A;  5A90 A;  3NOT C;  1J9M A;  2DRW A;  3LR3 A;  3HLE A;  3CUE A;  3A0R A;  2VV7 A;  2XD5 A;  2J80 A;  3T4O A;  3S22 A;  1OJ5 A;  2O9A A;  2XRO A;  1AXB A;  3Q82 A;  4EW7 A;  4CLC D;  4JXS A;  1ES2 A;  2P04 A;  1OT6 A;  4PKY G;  3PTE A;  3B33 A;  1T1C A;  4IBX A;  2HP5 A;  4N9K A;  1F98 A;  4R38 A;  4RVA A;  4E3J A;  4HHD A;  2HJE A;  2VKS A;  4Y13 A;  3ZYT A;  4OON A;  2W3G A;  4UHU A;  2ZL1 B;  2XF3 A;  1E25 A;  1M40 A;  4OQH A;  1FIK A;  3WS4 A;  1DJA A;  4GKU A;  4Y3I A;  1ERO A;  2KOI A;  4H6J A;  1PI5 A;  4ESP A;  2MJ6 A;  5GLD A;  1Y4O A;  4OPR A;  1PFL A;  1ERQ A;  2K31 A;  3Q7Z A;  4D60 A;  4IVK A;  4ARZ B;  2X02 A;  4YWZ A;  2W3H A;  1L0E A;  5EVI B;  2P9V B;  2EA9 A;  2EWV A;  4PM5 A;  4UQI S;  4UQI M;  1XPB A;  4OVD A;  3ZCZ A;  1CEF A;  3BFC A;  3OCN A;  1K4F A;  3LI9 A;  1BLP A;  4R23 A;  4X1M A;  4JF5 A;  5AQA A;  1NWZ A;  5CRF A;  4GHI B;  4XUZ A;  5GHZ A;  2O9B A;  2L1M A;  1LL9 A;  3KSH A;  2V8C A;  2VGL S;  3OPP A;  3NEC A;  2R78 A;  3HLG A;  4P6B A;  5LBR A;  3E98 A;  4EQ1 A;  4EBL A;  3B3X A;  1YQS A;  3LY3 A;  5F83 A;  1KDW A;  1TD5 A;  1PIO A;  5CGS A;  3FKV A;  1K55 A;  3Q07 A;  2G7U A;  3LIA A;  4FTX A;  1W8Y A;  2PHY A;  1BUL A;  1OTD A;  3A0V A;  1PW8 A;  5CEC A;  1VET A;  2ZQC A;  1S67 L;  4MBH A;  5FAS A;  3LIB A;  2G2W A;  5CX7 A;  3VSL A;  1XJ4 A;  2J8Y A; 
#chains in the Genus database with same CATH homology
 1FQG A;  1PWC A;  1Q2P A;  3QNB A;  1LI9 A;  2PU4 A;  2Y2G A;  3MXR A;  4S2K A;  2ZM8 A;  4WEL A;  4D2O A;  2A49 A;  2IWD A;  5CGW A;  3DTM A;  1DY6 A;  3GRJ A;  2FFF B;  4KG5 A;  4JBF A;  4RX2 A;  4JXV A;  1W8Q A;  2Y2H A;  3AGF A;  5EE8 A;  4OOM A;  3HLD A;  4E3N A;  5A93 A;  5M1A A;  4WMC D;  5BOH A;  5HW3 A;  3CJM A;  3AGE A;  2WAF A;  5EEC A;  1MKI A;  3IWO A;  3IF6 A;  3ZG9 B;  1MWT A;  1SKF A;  5J8X A;  1GCE A;  3TOI A;  1KDS A;  2PU2 A;  2Q9N A;  1K57 C;  4HBU A;  4R3B A;  3IXB A;  4OPY A;  3W4Q A;  2ZJ9 A;  4LV0 A;  4EBP A;  1K56 A;  3D4F A;  3DWZ A;  3I7J A;  3ZHH A;  2Y2P A;  3HLB A;  3N8R A;  4L0L A;  3C7V A;  3SOI A;  1YLZ A;  4FH2 A;  4GD8 A;  5CTN A;  4PM8 A;  1KGG A;  2Y4A A;  5FAO A;  3NI9 A;  3G34 A;  5GHY A;  1K57 A;  3E2L A;  3O3V A;  3C5A A;  5KSH A;  1NY0 A;  5HAI A;  3IXD A;  3G32 A;  1JWV A;  4KQQ A;  3SS4 A;  1BTL A;  4DXC A;  3VP1 A;  2WUQ A;  2J7V A;  3MZF A;  1FSW A;  2CC1 A;  1L0D A;  4K0X A;  5CTM A;  2Y2I A;  3VOY A;  3MFD A;  4K0W A;  4OKP A;  4OOL A;  1W5D A;  3S4X A;  1MXO A;  1IEL A;  1PZP A;  2XQZ A;  4R0Q A;  1LI0 A;  2ZC5 B;  2EX9 A;  1ZG6 A;  5FQ9 A;  3BFD A;  1KVM A;  1BLH A;  3BLM A;  4R3J A;  4ZJ2 A;  1WE4 A;  2C5W B;  4PM7 A;  5AQB A;  3NY4 A;  5GLC A;  2B5R A;  4U3T A;  3UY6 A;  4F94 A;  3AGD A;  2PBY A;  3G35 A;  4M3K A;  2ZQ9 A;  2EX8 A;  4KG2 A;  1KGE A;  2JCH A;  3GVB A;  3ZG8 B;  5A92 A;  3M2J A;  5E2H A;  5KSC A;  3MBZ A;  3P09 A;  5GLA A;  2ZLY A;  1BUE A;  2XLN A;  2A3U A;  1IKG A;  3BM6 A;  1CI9 A;  3C4O A;  3E2K A;  3IT9 A;  1PZO A;  4Y0U A;  4C3Q A;  2HDQ A;  4ZJ3 A;  4QB8 A;  4B4X A;  1NJ4 A;  4JPM A;  5HFO A;  2DCF A;  3V5M A;  4S2I A;  4KQR A;  3BEC A;  4JF6 A;  3ITB A;  2H5S A;  4EWF A;  4KZA A;  2Y59 A;  4S2P A;  2V2F F;  4C75 A;  3Q1F A;  2Y55 A;  5JYP A;  3JYI A;  3V39 A;  4WZ5 A;  3BFG A;  3WRZ A;  5EVI C;  1FSY A;  2I72 A;  3IHB A;  3O88 A;  4QHC A;  4E6W A;  4GB7 A;  3MZD A;  4MLL A;  1NYY A;  1YLT A;  2Y2K A;  1FCN A;  1YLJ A;  3Q81 A;  4U0X A;  3PBS A;  3UPN A;  3FZC A;  3NIA A;  4XUX A;  4Y7P A;  4GOG A;  4BQM A;  2X01 A;  4DXB A;  1K6S A;  5EVI A;  2V20 A;  2ZMA A;  4OP5 A;  3OCL A;  1K54 C;  1MWS A;  1IYO A;  1OME A;  2WKI A;  5DF7 A;  4UA6 A;  3VFH A;  5KMW A;  2GDN A;  1RP5 A;  1IYP A;  3HRE A;  4R1G A;  5E2F A;  3WWX A;  3ZVW A;  5GLB A;  2Y2L A;  3GTC A;  3PAE A;  3V3S A;  3W8K A;  4Y0T A;  2EFU A;  1K56 D;  5DTS A;  4NET A;  1EI5 A;  4GDN A;  5FI6 A;  3M6H A;  5FQM A;  3UE0 A;  5AQ9 A;  1H8Z A;  2HDR A;  3ITA A;  3A3D A;  1K54 A;  3G30 A;  1NXY A;  4RA7 A;  1ZKJ A;  3BLS A;  3RXX A;  2XEP A;  1DJB A;  1ESU A;  1VQQ A;  3V50 A;  3EQV A;  3VOZ A;  3PAG A;  4MNR A;  1JWZ A;  1G6A A;  5FQI A;  5CEB A;  3ZNY A;  3VP0 A;  3W4O A;  1CI8 A;  5CHU A;  2QZ6 A;  4IED A;  4DE3 A;  2H0T A;  2QMI A;  3CMZ A;  1XGI A;  1WYB A;  3N4I A;  3ZVT A;  3ZNT A;  2ZD8 A;  3HLF A;  4OOY A;  4OLG A;  4QY5 A;  2UWX A;  3LY4 A;  1H5X A;  4Q8I A;  3O87 A;  3M6B A;  3VMA A;  5L2F A;  4YFM A;  2JC7 A;  4N1X A;  1IYQ A;  3A3J A;  5FQQ A;  3SH7 A;  5KZH A;  3MKF A;  4OPQ A;  1L0G A;  4H8R A;  1N4O A;  5HL1 A;  1TDG A;  5CHJ A;  4QY6 A;  4KZ9 A;  4P85 A;  3WS2 A;  4P0M A;  4QD4 A;  1HTZ A;  3G2Y A;  4X56 A;  2EXB A;  1E3U A;  1BLS A;  2P74 A;  1K6R A;  4OH0 A;  4WYY A;  5FQK A;  3HUM A;  5EVL A;  5DVA A;  2OLU A;  5I94 A;  1XX2 A;  1GHM A;  2RL3 A;  3PBT A;  5E2G A;  5FAP A;  1FCM A;  2HP9 A;  3LCE A;  4BL2 A;  4E3M A;  2Y2J A;  3CG5 A;  2EXA A;  4CJN A;  4A5R A;  5TR7 A;  1W7F A;  1PI4 A;  1KGF A;  1Y54 A;  4Z9Q A;  3FKW A;  3HLW A;  1GHP A;  4HEF A;  1XA1 A;  2OV5 A;  3ZG0 A;  4OP8 A;  1CK3 A;  2WYX A;  5HAP A;  2E8I A;  3HVF A;  4WEK A;  5F82 A;  1L2S A;  5TFQ A;  5EVI D;  5F1F A;  2BLS A;  4ZJ1 A;  3C7U A;  1S6R A;  1O07 A;  3DWK A;  1FR1 A;  2XR0 A;  1DJC A;  1JTD A;  4E3L A;  3BFF A;  5EOE A;  4DE1 A;  1JVJ A;  5D3O A;  1ZG4 A;  2WKE A;  3PBO A;  2WGI A;  3HLC A;  1NZO A;  2J9O A;  4DRT A;  1ALQ A;  5HAR A;  2QPN A;  3N8S A;  5CER A;  5DTT A;  4GNU A;  1YMX A;  1I2W A;  4WEJ A;  4R4R A;  1EWZ A;  4KZ4 A;  2Y2Q A;  4LCL A;  3BYD A;  1N9B A;  1Q2Q A;  2EFX A;  5FSR A;  1VM1 A;  2VGJ A;  3BRM A;  2XH9 A;  1XXM A;  4JXG A;  5E43 A;  4O7D A;  5EOO A;  1PWD A;  3UPO A;  4IBR A;  4KQO A;  2ZC3 B;  1QMF A;  1TVF A;  4HBT A;  2JBF A;  1ES4 A;  1XP4 A;  4UA7 A;  4E3I A;  1I5Q A;  1RGY A;  4JLF A;  3A3E A;  2Y2M A;  2X71 A;  1WYC A;  2C6W B;  2Z2L B;  5CED A;  2WGW B;  1XGJ A;  1SHV A;  3SH9 A;  1HD8 A;  3Q7V B;  2ZM0 A;  3IH8 A;  5E2E A;  2WAE A;  3HL9 A;  3WS1 A;  4X69 A;  3P98 A;  1L0F A;  3UDI A;  2P9V A;  3IF5 A;  3IXG A;  5GL9 A;  3RXW A;  5M18 A;  3NC8 A;  4JKT A;  1YLW A;  1O7E A;  1YT4 A;  4ZBE A;  3GR2 A;  1Z6F A;  1PW1 A;  5G18 A;  1FR6 A;  2XDM A;  1SCW A;  3C4P A;  3UO9 A;  1K55 C;  4RX3 A;  3WRT A;  5FA7 A;  4B4Z A;  4LV1 A;  3A3F A;  3FYZ A;  3MXS A;  5TGF A;  1JWP A;  3VP2 A;  1E3U D;  4S2N C;  4X55 A;  2WAD A;  3BFE A;  1IYS A;  1YM1 A;  3CZD A;  3HBR A;  4OLD A;  4DE0 A;  4XXR A;  3G2Z A;  4DDS A;  5IHV A;  1C3B A;  3IF6 B;  5DF8 A;  3OPR A;  1ESI A;  3RJU A;  3HUO A;  2IWB A;  1GA9 A;  1FOF A;  1ONG A;  1LLB A;  4ZTK A;  5DTK A;  4BEN A;  4R4S A;  4GN2 A;  1BSG A;  2ZC6 B;  2ZQ8 A;  3OC2 A;  4WM9 A;  5CXW A;  2G2U A;  4DE2 A;  5F1G A;  4UA9 A;  4P87 A;  5EPH A;  5GHX A;  1K38 A;  5HX9 A;  5CHM A;  4CPK A;  4E3K A;  5A90 A;  2Z2M B;  2Y2O A;  3TG9 A;  2JE5 A;  2XGN A;  1KE3 A;  4E6X A;  1J9M A;  2DRW A;  3ISG A;  1MWU A;  3HLE A;  4JF4 A;  4OQ0 A;  3OPH A;  2XD5 A;  3LEZ A;  1BZA A;  1RCJ A;  4Y0O A;  3S22 A;  1KE0 A;  1QME A;  2XK1 A;  3IWQ A;  4EBN A;  3IXH A;  3UE1 A;  1YMS A;  3IWI A;  2WK0 A;  2J9P A;  4X53 A;  1AXB A;  3Q82 A;  4KZ8 A;  2OLV A;  2V1Z A;  4GD6 A;  1G68 A;  4JXS A;  1ES2 A;  4N9L A;  2WGV A;  2RCX A;  4HES A;  4PM6 A;  2R9X A;  3UNW A;  3FWL A;  3IQA A;  2ZC4 B;  4JXW A;  4LV2 A;  3MZE A;  3PTE A;  3MKE A;  1RGZ A;  4ZDX A;  1S0W A;  3DW0 A;  2HPB A;  4IBX A;  2Q9M A;  3UN7 A;  1YLP A;  3G31 A;  2HP5 A;  3PBQ A;  4N9K A;  1E4D A;  2ZC7 A;  4MEZ A;  3EQU A;  3LO7 A;  3OPL A;  4OPZ A;  1IEM A;  4RVA A;  4E3J A;  1K4E A;  4ZAM A;  3SS5 A;  3VP3 A;  2EX2 A;  4K91 A;  4OON A;  5HAQ A;  4E3O A;  1IKI A;  4S2O A;  3V3R A;  4FSF A;  1CEG A;  4MBK A;  2Y91 A;  4UHU A;  2BG1 A;  4KEN B;  3S1Y A;  3ZDJ A;  2XD1 A;  1E25 A;  2XF3 A;  3IH9 A;  1BLC A;  1M40 A;  4OQH A;  3NDG A;  4X68 A;  1ES5 A;  4B88 A;  1MPL A;  1KVL A;  3WS4 A;  1DJA A;  5EUA A;  1NYM A;  4GKU A;  4WZ4 A;  4NK3 A;  1ERO A;  4LV3 A;  4C6Y A;  4KZB A;  4KZ7 A;  1M6K A;  1PI5 A;  4UAA A;  1H8Y A;  3NCK A;  3PBN A;  1TDL A;  4U0T A;  3PBR A;  3WS0 A;  5GLD A;  2WZZ A;  4X6T A;  4OPR A;  3ZFZ A;  3WS5 A;  1ERQ A;  3Q7Z A;  5U47 A;  5JYO A;  1TEM A;  1ERM A;  2ZM2 A;  4IVK A;  3OZH A;  4N1H A;  3GQZ A;  1MBL A;  1XKZ A;  4S2M A;  3ZGA B;  4BL3 A;  3N6I A;  2X02 A;  5M19 A;  1NZU A;  3N8L A;  1I2S A;  4IVI A;  4WMC A;  1BT5 A;  3VFF A;  1GA0 A;  4PPR A;  3N7W A;  1L0E A;  5FAQ A;  5EVI B;  1KE4 A;  4KZ3 A;  2P9V B;  2IWC A;  3G4P A;  5FI2 A;  2WKH A;  2EX6 A;  3M2K A;  3NBL A;  4YIN A;  3ZG7 B;  4QJG A;  4PM5 A;  3BEB A;  1GHI A;  3QHY A;  3QNC A;  2FFY A;  1SDN A;  4LCM A;  4LEN A;  1XPB A;  4S2L A;  3GSG A;  4OVD A;  1MY8 A;  1CEF A;  4WZ5 C;  3ZCZ A;  5DF9 A;  3BFC A;  4PMA A;  3OCN A;  1PWG A;  1K4F A;  4N92 A;  3GMW A;  1W79 A;  3UPP A;  1XA7 A;  3HUN A;  1BLP A;  2VGK A;  1HVB A;  1PYY A;  4R23 A;  4JF5 A;  1LHY A;  5AQA A;  4FCF A;  5CRF A;  2DNS A;  3GV9 A;  2HP6 A;  1NRF A;  4BD1 A;  4XUZ A;  5FAT A;  4RYE A;  3VSK A;  4PM9 A;  3SS3 A;  5GHZ A;  3O86 A;  4BJP A;  1LL9 A;  1ONH A;  5A91 A;  4QU3 A;  3UDX A;  4EUZ A;  4OQG A;  1ES3 A;  3OPP A;  1HZO A;  3A3I A;  3HLG A;  4KZ5 A;  4P6B A;  5AQ7 A;  4EBL A;  3B3X A;  1YQS A;  3LY3 A;  1FCO A;  5F83 A;  1K25 A;  1KDW A;  1PIO A;  4FD8 A;  5CGS A;  3FKV A;  5CGX A;  5FI7 A;  1K55 A;  3TSG A;  1JTG A;  4KZ6 A;  3Q07 A;  4DDY A;  3VP4 A;  4BD0 A;  4S2N A;  3NDE A;  4DKI A;  5FQJ A;  4FH4 A;  1MWR A;  1W8Y A;  1YLY A;  2H10 A;  4GDB A;  2WGW A;  2XFT A;  1BUL A;  3UE3 A;  2H0Y A;  4MBF A;  2XFS A;  2OSU A;  1PW8 A;  2HDU A;  2ZQD A;  3Q7V A;  5CEC A;  4WBG A;  3SH8 A;  1LL5 A;  1U60 A;  2ZQC A;  4MBH A;  1SDE A;  2WZX A;  4GZB A;  3ZG5 A;  5FAS A;  2G2W A;  4ID4 A;  4EQI A;  5FDH A;  2ZQA A;  3W4P A;  1ZC2 A;  4KG6 A;  3FV7 A;  2R9W A;  2ZQ7 A;  3VSL A;  2HDS A;  4BLM A;  3IF6 C;  4S2J A;  4EV4 A;  2Y2N A;  3UDF A;  4OQI A;  4DF6 A;  2J8Y A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...