1ZG6A

Tem1 beta lactamase mutant s70g
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Structure of the wild-type TEM-1 beta-lactamase at 1.55 A and the mutant enzyme Ser70Ala at 2.1 A suggest the mode of noncovalent catalysis for the mutant enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1zg6A00
4JLFA 4GDBA 3HUNA 4KENB 4B4XA 2ZM8A 4KZ4A 1RGZA 4DDSA 2OLVA 1K57C 1GA0A 1MBLA 1VM1A 1E3UD 3NC8A 1G68A 5AQAA 4C6YA 4MBKA 4OOYA 1BLHA 4P0MA 3IHBA 1BTLA 4N1HA 3FKWA 2PU2A 1I2SA 3CZDA 1KVLA 5CHUA 2J9PA 3HLEA 1Q2QA 5FQMA 1K54C 1WYBA 2VGJA 3NDEA 3V50A 4OVDA 4JF5A 4N9KA 3SS4A 1YT4A 1IKGA 1EWZA 4JXGA 5HAQA 4HEFA 4KZ8A 1Z6FA 1LHYA 5HX9A 2ZC5B 3Q7VA 5TR7A 2ZQCA 1YLYA 3HUMA 4Q8IA 1WYCA 2WYXA 3DWZA 3WS0A 2WZZA 4JF6A 4OPQA 3VP1A 2P9VA 1HTZA 2XD1A 2Q9NA 2V1ZA 4KZBA 4B88A 2ZC4B 4E6WA 5G18A 2ZQAA 3HLBA 4LV1A 1DJAA 2GDNA 4FH4A 5GHZA 2Y2KA 4GD8A 4OLDA 3MZDA 3C7UA 3S22A 4IBXA 3HUOA 1K57A 1ONHA 3GVBA 4E6XA 4DDYA 1KGGA 2WAEA 4OH0A 5I94A 2WZXA 3LO7A 2ZC6B 4CJNA 2G2WA 5F83A 2WK0A 1N9BA 2OSUA 3NDGA 4KZ9A 4KQOA 5KSHA 3MXRA 2Y91A 3DW0A 3BLMA 3WWXA 2Q9MA 3SH8A 1E3UA 3HLCA 3HLDA 4E3OA 1JTDA 1YLZA 1K54A 1XXMA 4KG2A 4BJPA 3GRJA 1BUEA 2WGWA 4EBNA 4PPRA 1MXOA 3S4XA 4ZDXA 1CI9A 1FSYA 3Q7ZA 3PBNA 5TFQA 5U47A 1ALQA 3IHAA 3TOIA 1NZOA 4UA6A 2OV5A 3IXDA 4L0LA 2EFXA 4OOMA 3MKFA 3GTCA 3SH7A 2Y2JA 3NY4A 3OC2A 1ZKJA 4QD4A 3RXWA 1TDGA 4U0XA 3UDIA 2V2FF 4K0WA 3ZG8B 3ZNYA 3UPNA 1Y54A 3N7WA 1U60A 4MBFA 1G6AA 4OKPA 2HDRA 1IELA 2EX9A 4E3IA 4FSFA 1SDNA 5F1FA 1EROA 3PBTA 5DF8A 4R0QA 5DF7A 2Y2IA 3UDFA 3BM6A 3VFHA 3M6HA 2P74A 3IXGA 5CGXA 4OQ0A 3G34A 3ITBA 4GOGA 4K91A 1PZOA 2FFFB 3CG5A 3BFCA 4R4RA 5EVIB 5FI7A 4DXBA 5HL1A 3A3DA 4DRTA 3ZG7B 2ZLYA 3AGDA 2HP6A 4S2LA 1TVFA 2ZC3B 4WEKA 1CK3A 2R9WA 3I7JA 4N9LA 5FQJA 1SKFA 1FOFA 3NIAA 4U3TA 5L2FA 1GHMA 1FCNA 1KE0A 1IKIA 4CPKA 3GR2A 1ZC2A 5GL9A 1H8YA 3IT9A 5FAPA 4KZ7A 1GA9A 3A3FA 1KGFA 3BYDA 5CRFA 1XX2A 3FV7A 4IEDA 3BRMA 1MWTA 2VGKA 1XA1A 1H8ZA 2ZQ8A 2H10A 2BLSA 4MNRA 5EE8A 2HP9A 3UDXA 1SDEA 2G2UA 5HFOA 4GB7A 2XK1A 3S1YA 4XXRA 5JYOA 4DE1A 3PTEA 4S2NC 1HZOA 1SCWA 3GV9A 4S2OA 5E43A 4GDNA 4PMAA 1S6RA 3HREA 1GCEA 1SHVA 5FI2A 3SS5A 1I2WA 1W8QA 2QZ6A 3NCKA 3QNCA 3UE3A 3V39A 1W5DA 4OQHA 4WBGA 3A3EA 4WYYA 3Q7VB 2Y55A 3AGEA 2X02A 1YLPA 4JPMA 4K0XA 5AQ9A 3WRZA 4FCFA 3OPLA 4WZ4A 2EFUA 4X55A 3RXXA 3B3XA 1K6RA 2QPNA 1XGIA 5E2EA 2UWXA 1RP5A 2J8YA 4GNUA 2A3UA 3P98A 4WELA 3C4PA 4YINA 2RCXA 5HAIA 3WS4A 3OCLA 1FSWA 4PM5A 3D4FA 5AQBA 1FR6A 3MXSA 4MBHA 3IF6B 1MPLA 1JVJA 1ZG4A 4PM7A 4BL2A 2WGIA 1HVBA 1PZPA 2EX6A 4MEZA 3W4QA 4KZ6A 3CMZA 3EQUA 1YLJA 3TG9A 3VOYA 3FYZA 2A49A 5F82A 3W4PA 1J9MA 2HP5A 4P6BA 4PM8A 2I72A 4LCMA 5EECA 2JCHA 3ZCZA 5KZHA 1GHIA 1XKZA 2Y2MA 4KQQA 2IWCA 4NK3A 4WEJA 5FDHA 2C5WB 2ZMAA 2OLUA 2QMIA 1PW8A 3ZNTA 3WRTA 3BFDA 1KE3A 3SH9A 3HLWA 2XFSA 4WMCA 4S2NA 1PI4A 4Y0TA 5A91A 1NRFA 3BFFA 4DKIA 1FR1A 4C75A 5DTTA 2H0TA 4DXCA 3IXHA 3UN7A 4KG6A 2X71A 5DF9A 3QHYA 5CGSA 5DTKA 3OPRA 4C3QA 1BULA 5HW3A 4GZBA 4NETA 1IYSA 1KVMA 1QMFA 1MWSA 4UA7A 3RJUA 1YM1A 3ISGA 5FASA 1XPBA 1K56D 1ESUA 4JXVA 1O07A 1FQGA 4RX2A 1BT5A 1IYOA 1QMEA 4ID4A 4LV3A 3LEZA 5A92A 3G2ZA 4B4ZA 3OCNA 1DJBA 2DCFA 1XGJA 4LCLA 4BL3A 5DVAA 4F94A 2HPBA 3FWLA 1IYQA 2WKEA 3O88A 3IQAA 4JBFA 3O86A 3VP2A 1L0DA 4ZJ3A 1PIOA 5D3OA 1O7EA 1NYMA 3N8SA 1OMEA 1CEFA 5E2HA 3LY3A 1HD8A 3JYIA 3LCEA 3MBZA 4KZAA 5A93A 3C4OA 4BQMA 3SS3A 4OPYA 4WM9A 3QNBA 5FQQA 4IVIA 4QHCA 1ES4A 4OQIA 5EVID 3ZHHA 2DNSA 3PAEA 3SOIA 5A90A 4BENA 4X53A 3IWOA 1TDLA 4S2KA 2XF3A 3N8RA 5GLCA 4ZAMA 3VOZA 5CTMA 1BZAA 2BG1A 4OP5A 2PU4A 5EVIC 5J8XA 1LL9A 1MKIA 2J9OA 4P85A 4OONA 4N1XA 2J7VA 2R9XA 3HVFA 3Q81A 4M3KA 1NZUA 3ZG0A 4R23A 4E3LA 4E3KA 2HDSA 5FQKA 4GN2A 4OP8A 4OOLA 5CEDA 1BSGA 1JWZA 4FH2A 1ESIA 1MY8A 3BLSA 4QY6A 5HAPA 1YLTA 5EVLA 2EX2A 4R3BA 2Y2PA 1BLCA 3G30A 3E2LA 4R4SA 4DF6A 1K4FA 5AQ7A 4Y7PA 3BECA 1K6SA 4EWFA 1CEGA 3DWKA 3HL9A 3PBRA 3V5MA 3MZEA 4Z9QA 1PWCA 1K56A 3IXBA 4WMCD 4PM9A 4KZ3A 3N6IA 4JKTA 4X6TA 5EPHA 4GD6A 1ERQA 1M40A 2RL3A 4R3JA 4UHUA 4ZBEA 1K55C 1EI5A 1PWGA 3PBOA 5JYPA 2Y2OA 5FAQA 2V20A 5M1AA 3ZFZA 3G4PA 2Y2HA 3OZHA 3IWQA 3G2YA 4X68A 4IBRA 3VP3A 1RGYA 3M2KA 1BLPA 1AXBA 1W7FA 1YMSA 3G31A 5F1GA 4Y0UA 4OLGA 1LL5A 2E8IA 3Q1FA 5EVIA 3Q82A 4A5RA 3G32A 2PBYA 2P9VB 4R1GA 1PI5A 1DJCA 3O3VA 4KQRA 4UA9A 4EV4A 4FD8A 5TGFA 1W8YA 3UY6A 3V3SA 3IF6C 1L2SA 3ZGAB 1MWRA 1PYYA 3G35A 2FFYA 2WADA 3MFDA 4S2PA 3C5AA 3GQZA 1IEMA 1CI8A 3FKVA 3HLFA 3HLGA 5FI6A 3UNWA 4D2OA 4EBPA 4EUZA 2XFTA 5FA7A 5EOOA 4HBTA 3OPHA 1GHPA 4LV0A 1DY6A 3TSGA 3ZG9B 4BLMA 1LI9A 4DE3A 1JWPA 5GLDA 5FATA 1PWDA 1LI0A 2XGNA 2X01A 4HESA 2XD5A 4WZ5C 5CERA 1K55A 1W79A 1K4EA 3AGFA 3VFFA 5GLBA 1JWVA 5IHVA 2ZQDA 4RX3A 2WGWB 1I5QA 3P09A 1VQQA 4E3JA 4S2MA 4QY5A 2WAFA 4ZJ1A 5EOEA 4QB8A 3ZVTA 4DE2A 1Q2PA 1L0EA 1ZG6A 4ZTKA 1NYYA 4H8RA 5KSCA 1XP4A 5GLAA 3IH8A 4E3NA 2WGVA 4EBLA 4XUXA 2EXBA 5DTSA 3W4OA 5E2FA 2ZD8A 4UAAA 2ZC7A 2C6WB 3HBRA 3PBQA 2JBFA 3CJMA 2Y4AA 2Y59A 3MKEA 3EQVA 3NBLA 1KDWA 3IF5A 1WE4A 3FZCA 5CTNA 3ZDJA 3IF6A 3VSLA 5CHMA 1ONGA 1XA7A 1C3BA 4JF4A 2ZM2A 3C7VA 4PM6A 5CGWA 3E2KA 2XQZA 2XDMA 3A3JA 1LLBA 4JXSA 3BFEA 4KG5A 3DTMA 4XUZA 4E3MA 2JE5A 4EQIA 1E25A 4LV2A 2WUQA 5CXWA 3IH9A 5CEBA 2WKIA 2HDUA 5M18A 1ES2A 3OPPA 4BD1A 3UE1A 1H5XA 1KE4A 1RCJA 4HBUA 3NI9A 3M6BA 4WZ5A 1YLWA 1FCMA 3PAGA 1ERMA 4X56A 2CC1A 4LENA 3V3RA 1YMXA 3VMAA 2ZM0A 2XLNA 1PW1A 2JC7A 5FQ9A 1YQSA 3UPOA 4KZ5A 2Y2LA 4YFMA 5GHYA 1KDSA 4O7DA 1BLSA 3UE0A 4QJGA 2WKHA 3PBSA 1JTGA 2EXAA 3Q07A 1IYPA 4BD0A 3WS5A 4N92A 5M19A 1NY0A 3VP4A 4OPZA 3BEBA 2EX8A 3O87A 2H5SA 4P87A 3GMWA 1K38A 1N4OA 4ZJ2A 4U0TA 3BFGA 3M2JA 2XEPA 4OPRA 2Y2GA 5E2GA 1MWUA 4GKUA 1TEMA 5BOHA 1S0WA 2Y2QA 5KMWA 2ZQ9A 2XH9A 1L0FA 1M6KA 2Z2LB 4IVKA 3LY4A 1NJ4A 4RA7A 3UPPA 1KGEA 3N8LA 4S2IA 3VSKA 4X69A 3ZVWA 5GHXA 1E4DA 3MZFA 3UO9A 4RVAA 4DE0A 1NXYA 5FQIA 2HDQA 2ZJ9A 4QU3A 4JXWA 4RYEA 2IWDA 3W8KA 3GSGA 4MLLA 2IWBA 2DRWA 3N4IA 3IWIA 3ITAA 5EUAA 5FSRA 3ZG5A 5HARA 2ZQ7A 3WS1A 5FAOA 5CECA 1ES3A 1K25A 4S2JA 1FCOA 2Z2MB 2XR0A 3A3IA 4OQGA 1L0GA 3WS2A 5CHJA 2Y2NA 3VP0A 2H0YA 2B5RA 4Y0OA 1ES5A
chains in the Genus database with same CATH superfamily
4JLFA 4KENB 4DDSA 1K57C 1GA0A 1VM1A 1E3UD 1XJ3A 3FKWA 3FPVA 2PU2A 1I2SA 4LFUA 1XFNA 4GLQA 4X1LA 2VGJA 3TE8A 3VE4A 4GS9B 1EWZA 2HJ9C 1Z6FA 2IA2A 5L10A 3MF0A 5HX9A 3JVVA 3HUMA 1V9ZA 3MR0A 3DWZA 3L9KA 2P9VA 2XD1A 2LB5A 3PHYA 2ZQAA 2GDNA 4IBXA 1ONHA 2QHKA 3GVBA 4E6XA 1NLYA 3LI8A 4WLAA 3CITA 2WZXA 2ZC6B 4CJNA 2WK0A 3NDGA 4KZ9A 4KQOA 1XJ4A 3NJAA 2Y91A 3BLMA 3LIEA 1JTDA 4BJPA 3G6OA 4PPRA 3S4XA 4HJ4A 3R7WA 5U47A 4IJGA 3IXDA 2O9AA 4OOMA 2Y2JA 4QD4A 1ZKJA 4U0XA 3UDIA 3ZG8B 1Y54A 4MBFA 4LRZE 4H6JA 2HDRA 4E3IA 5F1FA 1EROA 2KDKA 5J3WA 3U4LP 3T1RA 3G34A 3ITBA 4K91A 1PZOA 2W1RA 4CLCA 3BFCA 2QJ7A 4S2LA 4WEKA 1WA9A 4KUKA 2PBDP 4ME4A 2EA9A 4KQDA 1FOFA 1KE0A 3DAVA 3A3FA 3FV7A 4WF0A 3UDXA 1SDEA 1XFQA 2G7UA 2Z6CA 3PTEA 1GCEA 3SS5A 1W8QA 2QZ6A 3NCKA 4NXEA 3UE3A 4OQHA 4WBGA 4LPZA 3AGEA 4JPMA 1W63Q 3WRZA 4FCFA 2EFUA 3P7NA 4MN5A 2QPNA 2J3WA 1VETA 2A3UA 4GW9A 3C4PA 1FIKA 4BMWA 4PM5A 5AQBA 1FR6A 4MBHA 3KYQA 4BL2A 2EX6A 3ZQ5A 3CMZA 1YLJA 3VOYA 3FYZA 1J3WA 4PM8A 4JGPA 3H82B 2YKHA 3QP2A 2JCHA 3H9WA 2IWCA 2C5WB 2ZMAA 1CJFA 1KE3A 3EGXC 3LGOA 4M4XA 3LR4A 2H0TA 4NG2A 3SZTA 5FEFA 3T4QA 4UA7A 1O07A 1FQGA 4IUKA 4GS9A 4YNRA 4ID4A 3G2ZA 1P97A 5F68A 3FWLA 5DFYA 1IYQA 3O88A 4JBFA 5D3OA 2A2LA 3O5YA 2B02A 3QNBA 3DBAA 2VV7A 3PAEA 3CUEC 5TJJA 4S2KA 4G3WA 3N8RA 4UEYA 2BG1A 4OP5A 2PU4A 1MKIA 4HNBA 3H7WB 2J7VA 2BASA 2OWJA 5I5LA 2P04A 3ZG0A 4R23A 4GN2A 1BSGA 3BLSA 1YLTA 4R3BA 1TS0A 3HCYA 1BLCA 3G30A 4LGWA 5AQ7A 4HI4A 1CEGA 3DWKA 3HL9A 4PAUA 1OPXA 3LEQA 4L9FA 5IT5A 3UB8A 4UHUA 3EOIA 4HJ3A 1K55C 3OLOA 1NWZA 5JYPA 2GJ3A 3OBFA 3LR0A 2B18A 3G2YA 2CMNA 3JVUA 3VP3A 1W7FA 3G31A 4Y0UA 1T18A 4OLGA 1LL5A 3Q1FA 2W3HA 1KOUA 3Q82A 3G32A 3K3DA 2PBYA 4R1GA 1GSXA 4KQRA 4EV4A 4FD8A 1DP6A 3IF6C 5FDSA 1PYYA 2FFYA 2WADA 4ARZB 1TS6A 4EUZA 5EOOA 2HF6A 4Y13A 3ZG9B 1ZHHB 4I3AA 1LI9A 5GLDA 5FATA 1PWDA 4WUJA 2X01A 4HESA 4YWZA 4EEPA 2WGWB 3C8CA 3P09A 5AVFA 5HD5A 1VQQA 4S2MA 2OOLA 4QB8A 4DE2A 1YSQA 5DJTA 4YOFA 5GLAA 4EBLA 2JKTM 2EXBA 3W4OA 4UAAA 2ZC7A 5F5YA 4EETB 1YKDA 2Y4AA 4QWOA 3FZCA 4AFIA 3VOLA 1XA7A 1C3BA 3C7VA 2VA0A 2ZMVA 4E3MA 5A8BA 4EQIA 3BY8A 4HP4A 1LSXA 5CXWA 5G4ZA 5EV0A 1ES2A 3OPPA 4B93A 4BD1A 1H5XA 3NI9A 2VJWA 1ERMA 3GDIA 3C38A 2CC1A 1XJ6A 3UB6A 3UB7A 2YKFA 2UV0E 2W0NA 2Y2LA 1KDSA 3ZYTA 2XA7M 4KUOA 2V8FA 1IYPA 3WS5A 2Q0OA 4N92A 5K5BA 3BEBA 2WKQA 2H5SA 4P87A 4B9OA 3GMWA 3A0VA 1N4OA 3M2JA 3NECA 5E2GA 1MWUA 1S0WA 3IBJA 4P6ZS 2W1TB 2XH9A 1JNUA 4EESA 1M6KA 4IVKA 1KGEA 1MZUA 4X69A 4FUWA 3F1NB 2VGLS 3MZFA 4F3LB 1NXYA 2IWDA 4I3IA 3GSGA 3IWIA 3FC7A 3EGDC 4K08A 5HARA 4ZRRA 4S2JA 3VP0A 2H0YA 2B5RA 2V0WA 5F83A 5CX7A 3HUNA 3CPTB 2ZM8A 4KZ4A 2OLVA 1MBLA 5FEGA 4C6YA 5AQAA 4OOYA 2W3FA 1BLHA 2KX6A 5DJUA 1KVLA 5CHUA 2LB9A 5FQMA 1WYBA 2JKRI 2A24A 2D02A 1YT4A 4HEFA 3KX0X 3Q7VA 4Q8IA 2J80A 1WYCA 2JKFA 2WYXA 4OPQA 4R38A 1HTZA 3E98A 5HPIA 5L09A 2ZC4B 4R70A 3HLBA 4LV1A 1DJAA 4FH4A 4HIAA 4OLDA 3MZDA 3S22A 3HUOA 2PYPA 4HJ6A 2VV6A 4DDYA 4OH0A 3LO7A 1YAXA 2GNXA 5KSHA 5HSQA 2PD7A 2W3DA 3QP8A 3DW0A 5EFWA 3HLCA 1YLZA 1K54A 2WGWA 1CI9A 3PBNA 2O99A 3IHAA 4UA6A 1G5UA 3MKFA 3SH7A 2HV1A 2QKPA 3TRCA 2V2FF 5IU1A 3N7WA 1U60A 1LL8A 5EM0A 4FSFA 4R0QA 1CF0A 3V67A 3M6HA 4EW7A 1S4RA 3IXGA 3CI6A 2OAP1 3C2WA 5CGXA 5KIZA 5HDDA 5FI7A 2JN7A 2ZLYA 2HGVA 3I7JA 1SKFA 4O0PA 3MS6A 3UMDA 2GX5A 5L2FA 3GR2A 4KZ7A 3BYDA 5CRFA 2ZQ8A 3C30A 2HP9A 3D9YA 2EWVA 5JYOA 2XK1A 3S1YA 4XXRA 4S2NC 4S2OA 2NUPC 3V5MA 4WYYA 4K0XA 3KYZA 3OPLA 3T1QB 4WZ4A 2I9VA 4X55A 3RXXA 3B3XA 1K6RA 1XGIA 2UWXA 3D72A 4YINA 3F1NA 4F3LA 1FSWA 3D4FA 4MEZA 3TG9A 3EQUA 3FG8A 1PRQA 3KO6A 5EECA 3T4LA 3ZCZA 3F1PA 1GHIA 4NK3A 4KQQA 4WEJA 2OLUA 3ZNTA 3BFDA 2VX8A 3BWLA 1PI4A 4Y0TA 5A91A 2PR6A 3RH8B 3BFFA 3NULA 5DTTA 4DXCA 3UN7A 4KG6A 2X71A 4C3QA 5HW3A 1MWSA 2L0WA 1YM1A 3ISGA 1ESUA 4RX2A 3RTYA 4LV3A 1DJBA 4XT2B 4LCLA 4BL3A 3LIDA 1IFQA 2WKEA 3IQAA 2HZ5A 3O86A 3QP1A 5EM1A 1CEFA 3MBZA 3SS3A 4WM9A 4QHCA 5EVID 4OQIA 2DNSA 3SOIA 4X53A 4D60A 1N9LA 1TDLA 4LLOB 3T50A 3VOZA 3UE6A 1BZAA 5EVIC 4N1XA 2R9XA 2E8JA 4E3LA 2HDSA 4OP8A 4FH2A 5HDSA 4QY6A 5EVLA 2EX2A 4R4SA 3E2LA 3BECA 4Z9QA 1K56A 1OJGA 3QP4A 4KZ3A 5EPHA 4JGQA 4GD6A 1ERQA 2RL3A 2PHYA 4ZBEA 3PBOA 2V20A 1PFLA 3G4PA 2Y2HA 5DFXA 3IWQA 4X68A 3IS2A 2E8IA 4A5RA 1SZVA 3CLOA 1DJCA 5J4EA 1OT6A 1W8YA 3G35A 3MFDA 4GHIB 2Z6DA 4D2OA 2XFTA 1GHPA 3TSGA 2FZ0A 4MN7A 3MMHA 2XD5A 4WZ5C 5CERA 2INWA 3AGFA 4Z1WA 5MC7A 2WAFA 1Q2PA 1L0EA 4ZTKA 4H8RA 1SKOB 3IH8A 3BJNA 2C6WB 3HBRA 3CJMA 2Y59A 4PKYG 3EQVA 1T1CA 3IF5A 1ONGA 4JF4A 1ODVA 3E2KA 2XDMA 3BFEA 3DTMA 2NUTC 1K0KA 4I38A 1E25A 2WUQA 2L1MA 2VEAA 1XJ2A 3UE1A 1KE4A 1RCJA 4UQIS 4HBUA 2Y79A 2R78A 1OTEA 4X56A 2O0YA 1F98A 4LENA 4MN6A 2JC7A 2BTFP 1YQSA 3QP6A 5HZHA 4QJGA 1FILA 3MXQA 3Q07A 3PYPA 3TW8A 4BD0A 2L4RA 5M19A 1NY0A 1T19A 4OPZA 2VZWA 3K2NA 3O87A 4ZJ2A 4U0TA 3BFGA 3OOVA 4NKPA 5KMWA 1S1ZA 5EVEA 1H8MA 4R3AA 4JGRA 2JKGA 3UPPA 1NJ4A 4S2IA 3ZVWA 5GHXA 2JHEA 4DE0A 5FQIA 2HDQA 2ZJ9A 3LIFA 3KSGA 1Z09A 5FAOA 1ES3A 1K25A 1FCOA 5CHJA 2Y2NA 4X25A 4BWIA 3T4SA 1RGZA 4NXGA 4RQ9A 2H28A 3NC8A 3IHBA 1BTLA 4NEED 5J7EA 3CZDA 3HLEA 1Q2QA 1NLZA 3SS4A 5HWVA 3VE3A 1TS8A 4JXGA 5HAQA 1LHYA 4EU0A 1W63M 1YLYA 1DP9A 2WZZA 4KZBA 4E6WA 5G18A 3T12B 4CLCD 2Y2KA 1DP8A 4GD8A 4GHIA 3C7UA 1K57A 4CLCC 1KGGA 5I94A 2G2WA 1N9BA 3H82A 3UMEA 2Q9MA 3SH8A 1E3UA 3HLDA 2PDRA 1BUEA 4EBNA 1MKMA 1MXOA 4ZDXA 1FSYA 1ALQA 4P6ZM 1NZOA 2OV5A 3DTIA 2EFXA 1SKOA 1D7EA 4HH2A 3GTCA 3LYXA 3OC2A 3RXWA 1TDGA 2VGLM 4K0WA 3UPNA 1IELA 3IX8A 1SDNA 5DF7A 3UDFA 1N9NA 4OQ0A 4GOGA 2FFFB 4Y17A 2XROA 4R4RA 4DXBA 1VHMA 3MQQA 2HP6A 1CK3A 2R9WA 3HJKA 1GHMA 1FCNA 4CPKA 1ZC2A 5GL9A 3IT9A 5FAPA 3H7WA 1KGFA 1XX2A 4IEDA 1XA1A 2BLSA 4MNRA 5EE8A 1OTDA 3MQ0A 4GB7A 2B95A 3MQOA 4DE1A 4GCZA 1HZOA 1SCWA 5E43A 5HPFA 4GDNA 2PYRA 1SHVA 5FI2A 3V39A 1W5DA 3A3EA 2Y55A 1YLPA 5AQ9A 1LSVA 2VK3A 4GNUA 3P98A 5L8MA 5AJGA 3WS4A 1D06A 3OCLA 1ACFA 2J3TD 3MXSA 1OT9A 3IF6B 1MPLA 1JVJA 4PM7A 2WGIA 1HVBA 2PD8A 2A49A 5F82A 2J3TC 3EEAA 4P6BA 2I72A 4LCMA 2PT7A 1XKZA 1UGUA 1PW8A 3WRTA 3SH9A 3HLWA 2XFSA 4ARZA 1FR1A 3IXHA 5DF9A 5DTKA 3B47A 3HJIA 3BQAA 1KVMA 1QMFA 3RJUA 5FASA 4JXVA 2O9CA 3T4TA 1QMEA 4EERA 4H6JB 1OTIA 4B4ZA 1XGJA 3VV4A 4F94A 2ZMFA 2HPBA 3NOPC 1L0DA 1PIOA 4Q0HA 4MDZA 1NYMA 3N8SA 1OMEA 4HP9A 3LY3A 1HD8A 3LCEA 3C4OA 3E4OA 4BQMA 1GSVA 4OPYA 5FQQA 4IVIA 3ZHHA 1S4SA 4Y3IA 5FL3A 3EEHA 4BENA 1VB6A 4MCWA 2XF3A 5J8XA 4P85A 4OONA 4EEUA 3HVFA 3Q81A 1NZUA 5FQKA 2WKPA 2OWHA 4HOIA 1JWZA 5L07A 2V0UA 1MY8A 5DKLA 2Y2PA 1K4FA 1AWIA 4I5SA 1PWCA 1X0OA 3GECA 4WMCD 1YPRA 2P7JA 4JKTA 4X6TA 1F2KA 1M40A 4R3JA 4WN5A 1PWGA 1VETB 1V9YA 5M1AA 3ZFZA 3U2AA 4IBRA 3BQ8A 3M2KA 1AXBA 3P01A 4BBUA 3CUEA 1YMSA 4L9GA 5F6AA 2V8CA 2W1TA 2EWWA 3S7NA 4UA9A 2WKRA 5TGFA 2W3EA 3UY6A 3V3SA 1L2SA 3L7HA 1H3QA 4S2PA 1Y4OA 5HD3A 3C5AA 3GQZA 4HHDA 1CI8A 3FKVA 4EBPA 5FA7A 4HBTA 3OPHA 4LV0A 1DY6A 4QPRA 4BLMA 2XGNA 4FTXA 1K55A 3CPTA 1W79A 1K4EA 5IHVA 2ZQDA 2DMWA 4FOFA 4IUHA 4X1MA 4QY5A 4ZJ1A 2KOIA 2JKTI 1ZG6A 1NYYA 5KSCA 1XP4A 1T1BA 4II7A 5E2FA 2ZD8A 1EW0A 5HWTA 1KDWA 3ZDJA 3IF6A 3VSLA 5CHMA 2ZOHA 1T1AA 1CQAA 4NXBA 4PM6A 2XQZA 2HJEA 3A3JA 4JXSA 1LLBA 2V9AA 4KG5A 2JE5A 4LV2A 1DRMA 3IH9A 5CEBA 2HDUA 5M18A 3M6BA 1FCMA 3PAGA 3T1XA 2MJ6A 3V3RA 1F9IA 5FQ9A 3RFBA 4I39A 5GHYA 4O7DA 1BLSA 5DKKA 2WKHA 1JTGA 2QJ5A 4Y15A 1OJ5A 1UWNX 4OPRA 2Y2GA 4GKUA 2ZL1B 4Y2FA 2Y2QA 4BBTA 2KLIA 2ZQ9A 3LY4A 4RA7A 1E4DA 2XRNA 2M7VA 4CQHA 4O8GA 2DRWA 3N4IA 3MFXA 3S7PA 5FSRA 1GSWA 5CECA 1TF1A 3A3IA 3WS2A 4Y0OA 1ES5A 3E4QA 3CWFA 4GDBA 1NRJA 3LUQA 3W2ZA 4B4XA 3LFVA 3LR5A 3MJQA 3LR3A 1IOUA 1G68A 4MBKA 4P0MA 4N1HA 2J9PA 1K54C 3NDEA 3V50A 4OVDA 4JF5A 4N9KA 1OTBA 3F1OB 1IKGA 1H0MA 2JKRM 4KZ8A 2ZC5B 5TR7A 2ZQCA 4UQIM 3WS0A 4JF6A 3VP1A 2AVXA 3T4KA 2Q9NA 2V1ZA 4B88A 4EQ1A 4HY8A 2PRFA 5GHZA 1MC0A 3LI9A 5TBMB 2WAEA 3JPUA 2OSUA 3MXRA 3UB9A 3WWXA 4MMNA 4E3OA 1XXMA 4KG2A 3GRJA 2QWSA 1G28A 5TFQA 3Q7ZA 3NOUC 3B33A 3TOIA 4G3KA 3IBRA 4HH3A 4L0LA 3IX4A 1P0ZA 3NY4A 3ICYA 3UB5P 5HL6A 3ZNYA 1G6AA 4OKPA 4XT2A 2EX9A 3FPWA 3PXPA 3IX3A 3PBTA 5DF8A 2Y2IA 3PR6A 3BM6A 3VFHA 2P74A 3LICA 3CG5A 5HL1A 5EVIB 3A3DA 4DRTA 3ZG7B 3AGDA 1TVFA 2ZC3B 3A0RA 4N9LA 5FQJA 3KSFA 3NIAA 4U3TA 1HLUP 4ETZA 4LRXC 3LIAA 1IKIA 1P9WA 1H8YA 4O01A 1GA9A 3BRMA 1MWTA 1L3LA 2VGKA 4LRYC 5HDCA 1H8ZA 2H10A 3B42A 2G2UA 5HFOA 3D3OA 4IHQA 2A24B 3GV9A 3SW1A 4PMAA 1S6RA 3HREA 1D1JA 4G3VA 1I2WA 3QNCA 3Q7VB 2X02A 5HWWA 2ZL1A 3BY9A 4E04A 3R4KA 1TD5A 5E2EA 1RP5A 2J8YA 3MSHA 2O9BA 4WELA 2RCXA 2VLGA 5HAIA 4WL9A 4L9EA 1ZG4A 1PZPA 3W4QA 4C75A 4KZ6A 2FH5A 3W4PA 1J9MA 2HP5A 4ETXA 5KZHA 2V1AA 2Y2MA 5FDHA 2QMIA 4WMCA 3CAXA 4S2NA 3LIBA 3KSHA 1NRFA 4DKIA 2VKSA 2P08A 3QHYA 4Q0JA 5CGSA 3OPRA 4CLCE 1BULA 4GZBA 4NETA 1IYSA 4DJ3A 1XPBA 1K56D 3KSIA 5IS1A 1ZTUA 3F1OA 1BT5A 1IYOA 4DMZA 3LEZA 5A92A 2QYBA 3OCNA 2DCFA 5DVAA 1BYWA 3VP2A 4ZJ3A 4I3JA 1O7EA 5E2HA 5A93A 4KZAA 3JYIA 3NOTC 1S67L 3S7OA 1ES4A 4PKYA 3T4OA 4DJ2A 5A90A 3IWOA 5TBMA 5GLCA 4ZAMA 5CTMA 1LL9A 1VEUB 2J9OA 4HQAA 4M3KA 4E3KA 2K2NA 4OOLA 5CEDA 2OAQ1 1ESIA 5HAPA 4DF6A 1STZA 4Y7PA 1K6SA 4EWFA 4ESPA 3PBRA 3MZEA 4Y5FA 3IXBA 4PM9A 3N6IA 5C5KA 2V1BA 3T4JA 1EI5A 2Y2OA 5FAQA 1LSWA 2XA7S 3OZHA 1RGYA 1BLPA 1N9OA 5F1GA 2K7SA 5EVIA 1P9RA 2K31A 2P9VB 1PI5A 1TS7A 2ZBBA 3O3VA 2PAVP 3T1SA 3F1PB 4NXFA 1MWRA 3ZGAB 1IEMA 3HLGA 3HLFA 5FI6A 3UNWA 4GJ4A 4DE3A 1JWPA 1LI0A 1LT0A 2D01A 3VFFA 3BW6A 1JWVA 5GLBA 4RX3A 1I5QA 1PNEA 3S7QA 3R7WB 4E3JA 2PR5A 3E4PA 5EOEA 1G6OA 4EXOA 3ZVTA 2ACGA 3NHQA 4E3NA 1S66L 2WGVA 5AVEA 4XUXA 4BBVA 3A0SA 5DTSA 3PBQA 2JBFA 1YSPA 3MKEA 3EWKA 3NBLA 3TJZC 1WE4A 5CTNA 4PHTA 3QP5A 2W3GA 2ZM2A 4Q0IA 5CGWA 5LBRA 4XUZA 2Y8HA 4CLCB 2WKIA 3E0YA 3K3CA 4WZ5A 1YLWA 2M1CA 1YMXA 3DTKA 3VMAA 2ZM0A 2XLNA 1PW1A 4DN0A 3ULFA 1UWPX 4KZ5A 3UPOA 4YFMA 3UE0A 3CHWP 2W27A 5F69A 3PBSA 2VV8A 2ZOIA 2EXAA 3VP4A 2EX8A 3KYEA 1K38A 3IS2B 2XEPA 1TEMA 3DTEA 5BOHA 4JGOA 4R6LA 2GZAA 1F5MA 1L0FA 2M7UA 2Z2LB 5G4YA 3N8LA 3VSKA 1A0KA 3UO9A 4RVAA 1S1YA 4QU3A 1Y28A 2XSSA 4JXWA 4RYEA 3W8KA 4MLLA 2IWBA 3ITAA 5EUAA 1VEUA 3ZG5A 2ZQ7A 3WS1A 2Z2MB 2XR0A 4OQGA 1L0GA 1OTAA 4EUVA
chains in the Genus database with same CATH topology
4JLFA 4GDBA 3HUNA 4KENB 4B4XA 2ZM8A 4KZ4A 1RGZA 4DDSA 2OLVA 1K57C 1GA0A 1MBLA 1VM1A 1E3UD 3NC8A 1G68A 5AQAA 4C6YA 4MBKA 4OOYA 1BLHA 4P0MA 3IHBA 1BTLA 4N1HA 3FKWA 2PU2A 1I2SA 3CZDA 1KVLA 5CHUA 2J9PA 3HLEA 1Q2QA 5FQMA 1K54C 1WYBA 2VGJA 3NDEA 3V50A 4OVDA 4JF5A 4N9KA 3SS4A 1YT4A 1IKGA 1EWZA 4JXGA 5HAQA 4HEFA 4KZ8A 1Z6FA 1LHYA 5HX9A 2ZC5B 3Q7VA 5TR7A 2ZQCA 1YLYA 3HUMA 4Q8IA 1WYCA 2WYXA 3DWZA 3WS0A 2WZZA 4JF6A 4OPQA 3VP1A 2P9VA 1HTZA 2XD1A 2Q9NA 2V1ZA 4KZBA 4B88A 2ZC4B 4E6WA 5G18A 2ZQAA 3HLBA 4LV1A 1DJAA 2GDNA 4FH4A 5GHZA 2Y2KA 4GD8A 4OLDA 3MZDA 3C7UA 3S22A 4IBXA 3HUOA 1K57A 1ONHA 3GVBA 4E6XA 4DDYA 1KGGA 2WAEA 4OH0A 5I94A 2WZXA 3LO7A 2ZC6B 4CJNA 2G2WA 5F83A 2WK0A 1N9BA 2OSUA 3NDGA 4KZ9A 4KQOA 5KSHA 3MXRA 2Y91A 3DW0A 3BLMA 3WWXA 2Q9MA 3SH8A 1E3UA 3HLCA 3HLDA 4E3OA 1JTDA 1YLZA 1K54A 1XXMA 4KG2A 4BJPA 3GRJA 1BUEA 2WGWA 4EBNA 4PPRA 1MXOA 3S4XA 4ZDXA 1CI9A 1FSYA 3Q7ZA 3PBNA 5TFQA 5U47A 1ALQA 3IHAA 3TOIA 1NZOA 4UA6A 2OV5A 3IXDA 4L0LA 2EFXA 4OOMA 3MKFA 3GTCA 3SH7A 2Y2JA 3NY4A 3OC2A 1ZKJA 4QD4A 3RXWA 1TDGA 4U0XA 3UDIA 2V2FF 4K0WA 3ZG8B 3ZNYA 3UPNA 1Y54A 3N7WA 1U60A 4MBFA 1G6AA 4OKPA 2HDRA 1IELA 2EX9A 4E3IA 4FSFA 1SDNA 5F1FA 1EROA 3PBTA 5DF8A 4R0QA 5DF7A 2Y2IA 3UDFA 3BM6A 3VFHA 3M6HA 2P74A 3IXGA 5CGXA 4OQ0A 3G34A 3ITBA 4GOGA 4K91A 1PZOA 2FFFB 3CG5A 3BFCA 4R4RA 5EVIB 5FI7A 4DXBA 5HL1A 3A3DA 4DRTA 3ZG7B 2ZLYA 3AGDA 2HP6A 4S2LA 1TVFA 2ZC3B 4WEKA 1CK3A 2R9WA 3I7JA 4N9LA 5FQJA 1SKFA 1FOFA 3NIAA 4U3TA 5L2FA 1GHMA 1FCNA 1KE0A 1IKIA 4CPKA 3GR2A 1ZC2A 5GL9A 1H8YA 3IT9A 5FAPA 4KZ7A 1GA9A 3A3FA 1KGFA 3BYDA 5CRFA 1XX2A 3FV7A 4IEDA 3BRMA 1MWTA 2VGKA 1XA1A 1H8ZA 2ZQ8A 2H10A 2BLSA 4MNRA 5EE8A 2HP9A 3UDXA 1SDEA 2G2UA 5HFOA 4GB7A 2XK1A 3S1YA 4XXRA 5JYOA 4DE1A 3PTEA 4S2NC 1HZOA 1SCWA 3GV9A 4S2OA 5E43A 4GDNA 4PMAA 1S6RA 3HREA 1GCEA 1SHVA 5FI2A 3SS5A 1I2WA 1W8QA 2QZ6A 3NCKA 3QNCA 3UE3A 3V39A 1W5DA 4OQHA 4WBGA 3A3EA 4WYYA 3Q7VB 2Y55A 3AGEA 2X02A 1YLPA 4JPMA 4K0XA 5AQ9A 3WRZA 4FCFA 3OPLA 4WZ4A 2EFUA 4X55A 3RXXA 3B3XA 1K6RA 2QPNA 1XGIA 5E2EA 2UWXA 1RP5A 2J8YA 4GNUA 2A3UA 3P98A 4WELA 3C4PA 4YINA 2RCXA 5HAIA 3WS4A 3OCLA 1FSWA 4PM5A 3D4FA 5AQBA 1FR6A 3MXSA 4MBHA 3IF6B 1MPLA 1JVJA 1ZG4A 4PM7A 4BL2A 2WGIA 1HVBA 1PZPA 2EX6A 4MEZA 3W4QA 4KZ6A 3CMZA 3EQUA 1YLJA 3TG9A 3VOYA 3FYZA 2A49A 5F82A 3W4PA 1J9MA 2HP5A 4P6BA 4PM8A 2I72A 4LCMA 5EECA 2JCHA 3ZCZA 5KZHA 1GHIA 1XKZA 2Y2MA 4KQQA 2IWCA 4NK3A 4WEJA 5FDHA 2C5WB 2ZMAA 2OLUA 2QMIA 1PW8A 3ZNTA 3WRTA 3BFDA 1KE3A 3SH9A 3HLWA 2XFSA 4WMCA 4S2NA 1PI4A 4Y0TA 5A91A 1NRFA 3BFFA 4DKIA 1FR1A 4C75A 5DTTA 2H0TA 4DXCA 3IXHA 3UN7A 4KG6A 2X71A 5DF9A 3QHYA 5CGSA 5DTKA 3OPRA 4C3QA 1BULA 5HW3A 4GZBA 4NETA 1IYSA 1KVMA 1QMFA 1MWSA 4UA7A 3RJUA 1YM1A 3ISGA 5FASA 1XPBA 1K56D 1ESUA 4JXVA 1O07A 1FQGA 4RX2A 1BT5A 1IYOA 1QMEA 4ID4A 4LV3A 3LEZA 5A92A 3G2ZA 4B4ZA 3OCNA 1DJBA 2DCFA 1XGJA 4LCLA 4BL3A 5DVAA 4F94A 2HPBA 3FWLA 1IYQA 2WKEA 3O88A 3IQAA 4JBFA 3O86A 3VP2A 1L0DA 4ZJ3A 1PIOA 5D3OA 1O7EA 1NYMA 3N8SA 1OMEA 1CEFA 5E2HA 3LY3A 1HD8A 3JYIA 3LCEA 3MBZA 4KZAA 5A93A 3C4OA 4BQMA 3SS3A 4OPYA 4WM9A 3QNBA 5FQQA 4IVIA 4QHCA 1ES4A 4OQIA 5EVID 3ZHHA 2DNSA 3PAEA 3SOIA 5A90A 4BENA 4X53A 3IWOA 1TDLA 4S2KA 2XF3A 3N8RA 5GLCA 4ZAMA 3VOZA 5CTMA 1BZAA 2BG1A 4OP5A 2PU4A 5EVIC 5J8XA 1LL9A 1MKIA 2J9OA 4P85A 4OONA 4N1XA 2J7VA 2R9XA 3HVFA 3Q81A 4M3KA 1NZUA 3ZG0A 4R23A 4E3LA 4E3KA 2HDSA 5FQKA 4GN2A 4OP8A 4OOLA 5CEDA 1BSGA 1JWZA 4FH2A 1ESIA 1MY8A 3BLSA 4QY6A 5HAPA 1YLTA 5EVLA 2EX2A 4R3BA 2Y2PA 1BLCA 3G30A 3E2LA 4R4SA 4DF6A 1K4FA 5AQ7A 4Y7PA 3BECA 1K6SA 4EWFA 1CEGA 3DWKA 3HL9A 3PBRA 3V5MA 3MZEA 4Z9QA 1PWCA 1K56A 3IXBA 4WMCD 4PM9A 4KZ3A 3N6IA 4JKTA 4X6TA 5EPHA 4GD6A 1ERQA 1M40A 2RL3A 4R3JA 4UHUA 4ZBEA 1K55C 1EI5A 1PWGA 3PBOA 5JYPA 2Y2OA 5FAQA 2V20A 5M1AA 3ZFZA 3G4PA 2Y2HA 3OZHA 3IWQA 3G2YA 4X68A 4IBRA 3VP3A 1RGYA 3M2KA 1BLPA 1AXBA 1W7FA 1YMSA 3G31A 5F1GA 4Y0UA 4OLGA 1LL5A 2E8IA 3Q1FA 5EVIA 3Q82A 4A5RA 3G32A 2PBYA 2P9VB 4R1GA 1PI5A 1DJCA 3O3VA 4KQRA 4UA9A 4EV4A 4FD8A 5TGFA 1W8YA 3UY6A 3V3SA 3IF6C 1L2SA 3ZGAB 1MWRA 1PYYA 3G35A 2FFYA 2WADA 3MFDA 4S2PA 3C5AA 3GQZA 1IEMA 1CI8A 3FKVA 3HLFA 3HLGA 5FI6A 3UNWA 4D2OA 4EBPA 4EUZA 2XFTA 5FA7A 5EOOA 4HBTA 3OPHA 1GHPA 4LV0A 1DY6A 3TSGA 3ZG9B 4BLMA 1LI9A 4DE3A 1JWPA 5GLDA 5FATA 1PWDA 1LI0A 2XGNA 2X01A 4HESA 2XD5A 4WZ5C 5CERA 1K55A 1W79A 1K4EA 3AGFA 3VFFA 5GLBA 1JWVA 5IHVA 2ZQDA 4RX3A 2WGWB 1I5QA 3P09A 1VQQA 4E3JA 4S2MA 4QY5A 2WAFA 4ZJ1A 5EOEA 4QB8A 3ZVTA 4DE2A 1Q2PA 1L0EA 1ZG6A 4ZTKA 1NYYA 4H8RA 5KSCA 1XP4A 5GLAA 3IH8A 4E3NA 2WGVA 4EBLA 4XUXA 2EXBA 5DTSA 3W4OA 5E2FA 2ZD8A 4UAAA 2ZC7A 2C6WB 3HBRA 3PBQA 2JBFA 3CJMA 2Y4AA 2Y59A 3MKEA 3EQVA 3NBLA 1KDWA 3IF5A 1WE4A 3FZCA 5CTNA 3ZDJA 3IF6A 3VSLA 5CHMA 1ONGA 1XA7A 1C3BA 4JF4A 2ZM2A 3C7VA 4PM6A 5CGWA 3E2KA 2XQZA 2XDMA 3A3JA 1LLBA 4JXSA 3BFEA 4KG5A 3DTMA 4XUZA 4E3MA 2JE5A 4EQIA 1E25A 4LV2A 2WUQA 5CXWA 3IH9A 5CEBA 2WKIA 2HDUA 5M18A 1ES2A 3OPPA 4BD1A 3UE1A 1H5XA 1KE4A 1RCJA 4HBUA 3NI9A 3M6BA 4WZ5A 1YLWA 1FCMA 3PAGA 1ERMA 4X56A 2CC1A 4LENA 3V3RA 1YMXA 3VMAA 2ZM0A 2XLNA 1PW1A 2JC7A 5FQ9A 1YQSA 3UPOA 4KZ5A 2Y2LA 4YFMA 5GHYA 1KDSA 4O7DA 1BLSA 3UE0A 4QJGA 2WKHA 3PBSA 1JTGA 2EXAA 3Q07A 1IYPA 4BD0A 3WS5A 4N92A 5M19A 1NY0A 3VP4A 4OPZA 3BEBA 2EX8A 3O87A 2H5SA 4P87A 3GMWA 1K38A 1N4OA 4ZJ2A 4U0TA 3BFGA 3M2JA 2XEPA 4OPRA 2Y2GA 5E2GA 1MWUA 4GKUA 1TEMA 5BOHA 1S0WA 2Y2QA 5KMWA 2ZQ9A 2XH9A 1L0FA 1M6KA 2Z2LB 4IVKA 3LY4A 1NJ4A 4RA7A 3UPPA 1KGEA 3N8LA 4S2IA 3VSKA 4X69A 3ZVWA 5GHXA 1E4DA 3MZFA 3UO9A 4RVAA 4DE0A 1NXYA 5FQIA 2HDQA 2ZJ9A 4QU3A 4JXWA 4RYEA 2IWDA 3W8KA 3GSGA 4MLLA 2IWBA 2DRWA 3N4IA 3IWIA 3ITAA 5EUAA 5FSRA 3ZG5A 5HARA 2ZQ7A 3WS1A 5FAOA 5CECA 1ES3A 1K25A 4S2JA 1FCOA 2Z2MB 2XR0A 3A3IA 4OQGA 1L0GA 3WS2A 5CHJA 2Y2NA 3VP0A 2H0YA 2B5RA 4Y0OA 1ES5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLF A;  4GDB A;  3HUN A;  4KEN B;  4B4X A;  2ZM8 A;  4KZ4 A;  1RGZ A;  4DDS A;  2OLV A;  1K57 C;  1GA0 A;  1MBL A;  1VM1 A;  1E3U D;  3NC8 A;  1G68 A;  5AQA A;  4C6Y A;  4MBK A;  4OOY A;  1BLH A;  4P0M A;  3IHB A;  1BTL A;  4N1H A;  3FKW A;  2PU2 A;  1I2S A;  3CZD A;  1KVL A;  5CHU A;  2J9P A;  3HLE A;  1Q2Q A;  5FQM A;  1K54 C;  1WYB A;  2VGJ A;  3NDE A;  3V50 A;  4OVD A;  4JF5 A;  4N9K A;  3SS4 A;  1YT4 A;  1IKG A;  1EWZ A;  4JXG A;  5HAQ A;  4HEF A;  4KZ8 A;  1Z6F A;  1LHY A;  5HX9 A;  2ZC5 B;  3Q7V A;  5TR7 A;  2ZQC A;  1YLY A;  3HUM A;  4Q8I A;  1WYC A;  2WYX A;  3DWZ A;  3WS0 A;  2WZZ A;  4JF6 A;  4OPQ A;  3VP1 A;  2P9V A;  1HTZ A;  2XD1 A;  2Q9N A;  2V1Z A;  4KZB A;  4B88 A;  2ZC4 B;  4E6W A;  5G18 A;  2ZQA A;  3HLB A;  4LV1 A;  1DJA A;  2GDN A;  4FH4 A;  5GHZ A;  2Y2K A;  4GD8 A;  4OLD A;  3MZD A;  3C7U A;  3S22 A;  4IBX A;  3HUO A;  1K57 A;  1ONH A;  3GVB A;  4E6X A;  4DDY A;  1KGG A;  2WAE A;  4OH0 A;  5I94 A;  2WZX A;  3LO7 A;  2ZC6 B;  4CJN A;  2G2W A;  5F83 A;  2WK0 A;  1N9B A;  2OSU A;  3NDG A;  4KZ9 A;  4KQO A;  5KSH A;  3MXR A;  2Y91 A;  3DW0 A;  3BLM A;  3WWX A;  2Q9M A;  3SH8 A;  1E3U A;  3HLC A;  3HLD A;  4E3O A;  1JTD A;  1YLZ A;  1K54 A;  1XXM A;  4KG2 A;  4BJP A;  3GRJ A;  1BUE A;  2WGW A;  4EBN A;  4PPR A;  1MXO A;  3S4X A;  4ZDX A;  1CI9 A;  1FSY A;  3Q7Z A;  3PBN A;  5TFQ A;  5U47 A;  1ALQ A;  3IHA A;  3TOI A;  1NZO A;  4UA6 A;  2OV5 A;  3IXD A;  4L0L A;  2EFX A;  4OOM A;  3MKF A;  3GTC A;  3SH7 A;  2Y2J A;  3NY4 A;  3OC2 A;  1ZKJ A;  4QD4 A;  3RXW A;  1TDG A;  4U0X A;  3UDI A;  2V2F F;  4K0W A;  3ZG8 B;  3ZNY A;  3UPN A;  1Y54 A;  3N7W A;  1U60 A;  4MBF A;  1G6A A;  4OKP A;  2HDR A;  1IEL A;  2EX9 A;  4E3I A;  4FSF A;  1SDN A;  5F1F A;  1ERO A;  3PBT A;  5DF8 A;  4R0Q A;  5DF7 A;  2Y2I A;  3UDF A;  3BM6 A;  3VFH A;  3M6H A;  2P74 A;  3IXG A;  5CGX A;  4OQ0 A;  3G34 A;  3ITB A;  4GOG A;  4K91 A;  1PZO A;  2FFF B;  3CG5 A;  3BFC A;  4R4R A;  5EVI B;  5FI7 A;  4DXB A;  5HL1 A;  3A3D A;  4DRT A;  3ZG7 B;  2ZLY A;  3AGD A;  2HP6 A;  4S2L A;  1TVF A;  2ZC3 B;  4WEK A;  1CK3 A;  2R9W A;  3I7J A;  4N9L A;  5FQJ A;  1SKF A;  1FOF A;  3NIA A;  4U3T A;  5L2F A;  1GHM A;  1FCN A;  1KE0 A;  1IKI A;  4CPK A;  3GR2 A;  1ZC2 A;  5GL9 A;  1H8Y A;  3IT9 A;  5FAP A;  4KZ7 A;  1GA9 A;  3A3F A;  1KGF A;  3BYD A;  5CRF A;  1XX2 A;  3FV7 A;  4IED A;  3BRM A;  1MWT A;  2VGK A;  1XA1 A;  1H8Z A;  2ZQ8 A;  2H10 A;  2BLS A;  4MNR A;  5EE8 A;  2HP9 A;  3UDX A;  1SDE A;  2G2U A;  5HFO A;  4GB7 A;  2XK1 A;  3S1Y A;  4XXR A;  5JYO A;  4DE1 A;  3PTE A;  4S2N C;  1HZO A;  1SCW A;  3GV9 A;  4S2O A;  5E43 A;  4GDN A;  4PMA A;  1S6R A;  3HRE A;  1GCE A;  1SHV A;  5FI2 A;  3SS5 A;  1I2W A;  1W8Q A;  2QZ6 A;  3NCK A;  3QNC A;  3UE3 A;  3V39 A;  1W5D A;  4OQH A;  4WBG A;  3A3E A;  4WYY A;  3Q7V B;  2Y55 A;  3AGE A;  2X02 A;  1YLP A;  4JPM A;  4K0X A;  5AQ9 A;  3WRZ A;  4FCF A;  3OPL A;  4WZ4 A;  2EFU A;  4X55 A;  3RXX A;  3B3X A;  1K6R A;  2QPN A;  1XGI A;  5E2E A;  2UWX A;  1RP5 A;  2J8Y A;  4GNU A;  2A3U A;  3P98 A;  4WEL A;  3C4P A;  4YIN A;  2RCX A;  5HAI A;  3WS4 A;  3OCL A;  1FSW A;  4PM5 A;  3D4F A;  5AQB A;  1FR6 A;  3MXS A;  4MBH A;  3IF6 B;  1MPL A;  1JVJ A;  1ZG4 A;  4PM7 A;  4BL2 A;  2WGI A;  1HVB A;  1PZP A;  2EX6 A;  4MEZ A;  3W4Q A;  4KZ6 A;  3CMZ A;  3EQU A;  1YLJ A;  3TG9 A;  3VOY A;  3FYZ A;  2A49 A;  5F82 A;  3W4P A;  1J9M A;  2HP5 A;  4P6B A;  4PM8 A;  2I72 A;  4LCM A;  5EEC A;  2JCH A;  3ZCZ A;  5KZH A;  1GHI A;  1XKZ A;  2Y2M A;  4KQQ A;  2IWC A;  4NK3 A;  4WEJ A;  5FDH A;  2C5W B;  2ZMA A;  2OLU A;  2QMI A;  1PW8 A;  3ZNT A;  3WRT A;  3BFD A;  1KE3 A;  3SH9 A;  3HLW A;  2XFS A;  4WMC A;  4S2N A;  1PI4 A;  4Y0T A;  5A91 A;  1NRF A;  3BFF A;  4DKI A;  1FR1 A;  4C75 A;  5DTT A;  2H0T A;  4DXC A;  3IXH A;  3UN7 A;  4KG6 A;  2X71 A;  5DF9 A;  3QHY A;  5CGS A;  5DTK A;  3OPR A;  4C3Q A;  1BUL A;  5HW3 A;  4GZB A;  4NET A;  1IYS A;  1KVM A;  1QMF A;  1MWS A;  4UA7 A;  3RJU A;  1YM1 A;  3ISG A;  5FAS A;  1XPB A;  1K56 D;  1ESU A;  4JXV A;  1O07 A;  1FQG A;  4RX2 A;  1BT5 A;  1IYO A;  1QME A;  4ID4 A;  4LV3 A;  3LEZ A;  5A92 A;  3G2Z A;  4B4Z A;  3OCN A;  1DJB A;  2DCF A;  1XGJ A;  4LCL A;  4BL3 A;  5DVA A;  4F94 A;  2HPB A;  3FWL A;  1IYQ A;  2WKE A;  3O88 A;  3IQA A;  4JBF A;  3O86 A;  3VP2 A;  1L0D A;  4ZJ3 A;  1PIO A;  5D3O A;  1O7E A;  1NYM A;  3N8S A;  1OME A;  1CEF A;  5E2H A;  3LY3 A;  1HD8 A;  3JYI A;  3LCE A;  3MBZ A;  4KZA A;  5A93 A;  3C4O A;  4BQM A;  3SS3 A;  4OPY A;  4WM9 A;  3QNB A;  5FQQ A;  4IVI A;  4QHC A;  1ES4 A;  4OQI A;  5EVI D;  3ZHH A;  2DNS A;  3PAE A;  3SOI A;  5A90 A;  4BEN A;  4X53 A;  3IWO A;  1TDL A;  4S2K A;  2XF3 A;  3N8R A;  5GLC A;  4ZAM A;  3VOZ A;  5CTM A;  1BZA A;  2BG1 A;  4OP5 A;  2PU4 A;  5EVI C;  5J8X A;  1LL9 A;  1MKI A;  2J9O A;  4P85 A;  4OON A;  4N1X A;  2J7V A;  2R9X A;  3HVF A;  3Q81 A;  4M3K A;  1NZU A;  3ZG0 A;  4R23 A;  4E3L A;  4E3K A;  2HDS A;  5FQK A;  4GN2 A;  4OP8 A;  4OOL A;  5CED A;  1BSG A;  1JWZ A;  4FH2 A;  1ESI A;  1MY8 A;  3BLS A;  4QY6 A;  5HAP A;  1YLT A;  5EVL A;  2EX2 A;  4R3B A;  2Y2P A;  1BLC A;  3G30 A;  3E2L A;  4R4S A;  4DF6 A;  1K4F A;  5AQ7 A;  4Y7P A;  3BEC A;  1K6S A;  4EWF A;  1CEG A;  3DWK A;  3HL9 A;  3PBR A;  3V5M A;  3MZE A;  4Z9Q A;  1PWC A;  1K56 A;  3IXB A;  4WMC D;  4PM9 A;  4KZ3 A;  3N6I A;  4JKT A;  4X6T A;  5EPH A;  4GD6 A;  1ERQ A;  1M40 A;  2RL3 A;  4R3J A;  4UHU A;  4ZBE A;  1K55 C;  1EI5 A;  1PWG A;  3PBO A;  5JYP A;  2Y2O A;  5FAQ A;  2V20 A;  5M1A A;  3ZFZ A;  3G4P A;  2Y2H A;  3OZH A;  3IWQ A;  3G2Y A;  4X68 A;  4IBR A;  3VP3 A;  1RGY A;  3M2K A;  1BLP A;  1AXB A;  1W7F A;  1YMS A;  3G31 A;  5F1G A;  4Y0U A;  4OLG A;  1LL5 A;  2E8I A;  3Q1F A;  5EVI A;  3Q82 A;  4A5R A;  3G32 A;  2PBY A;  2P9V B;  4R1G A;  1PI5 A;  1DJC A;  3O3V A;  4KQR A;  4UA9 A;  4EV4 A;  4FD8 A;  5TGF A;  1W8Y A;  3UY6 A;  3V3S A;  3IF6 C;  1L2S A;  3ZGA B;  1MWR A;  1PYY A;  3G35 A;  2FFY A;  2WAD A;  3MFD A;  4S2P A;  3C5A A;  3GQZ A;  1IEM A;  1CI8 A;  3FKV A;  3HLF A;  3HLG A;  5FI6 A;  3UNW A;  4D2O A;  4EBP A;  4EUZ A;  2XFT A;  5FA7 A;  5EOO A;  4HBT A;  3OPH A;  1GHP A;  4LV0 A;  1DY6 A;  3TSG A;  3ZG9 B;  4BLM A;  1LI9 A;  4DE3 A;  1JWP A;  5GLD A;  5FAT A;  1PWD A;  1LI0 A;  2XGN A;  2X01 A;  4HES A;  2XD5 A;  4WZ5 C;  5CER A;  1K55 A;  1W79 A;  1K4E A;  3AGF A;  3VFF A;  5GLB A;  1JWV A;  5IHV A;  2ZQD A;  4RX3 A;  2WGW B;  1I5Q A;  3P09 A;  1VQQ A;  4E3J A;  4S2M A;  4QY5 A;  2WAF A;  4ZJ1 A;  5EOE A;  4QB8 A;  3ZVT A;  4DE2 A;  1Q2P A;  1L0E A;  1ZG6 A;  4ZTK A;  1NYY A;  4H8R A;  5KSC A;  1XP4 A;  5GLA A;  3IH8 A;  4E3N A;  2WGV A;  4EBL A;  4XUX A;  2EXB A;  5DTS A;  3W4O A;  5E2F A;  2ZD8 A;  4UAA A;  2ZC7 A;  2C6W B;  3HBR A;  3PBQ A;  2JBF A;  3CJM A;  2Y4A A;  2Y59 A;  3MKE A;  3EQV A;  3NBL A;  1KDW A;  3IF5 A;  1WE4 A;  3FZC A;  5CTN A;  3ZDJ A;  3IF6 A;  3VSL A;  5CHM A;  1ONG A;  1XA7 A;  1C3B A;  4JF4 A;  2ZM2 A;  3C7V A;  4PM6 A;  5CGW A;  3E2K A;  2XQZ A;  2XDM A;  3A3J A;  1LLB A;  4JXS A;  3BFE A;  4KG5 A;  3DTM A;  4XUZ A;  4E3M A;  2JE5 A;  4EQI A;  1E25 A;  4LV2 A;  2WUQ A;  5CXW A;  3IH9 A;  5CEB A;  2WKI A;  2HDU A;  5M18 A;  1ES2 A;  3OPP A;  4BD1 A;  3UE1 A;  1H5X A;  1KE4 A;  1RCJ A;  4HBU A;  3NI9 A;  3M6B A;  4WZ5 A;  1YLW A;  1FCM A;  3PAG A;  1ERM A;  4X56 A;  2CC1 A;  4LEN A;  3V3R A;  1YMX A;  3VMA A;  2ZM0 A;  2XLN A;  1PW1 A;  2JC7 A;  5FQ9 A;  1YQS A;  3UPO A;  4KZ5 A;  2Y2L A;  4YFM A;  5GHY A;  1KDS A;  4O7D A;  1BLS A;  3UE0 A;  4QJG A;  2WKH A;  3PBS A;  1JTG A;  2EXA A;  3Q07 A;  1IYP A;  4BD0 A;  3WS5 A;  4N92 A;  5M19 A;  1NY0 A;  3VP4 A;  4OPZ A;  3BEB A;  2EX8 A;  3O87 A;  2H5S A;  4P87 A;  3GMW A;  1K38 A;  1N4O A;  4ZJ2 A;  4U0T A;  3BFG A;  3M2J A;  2XEP A;  4OPR A;  2Y2G A;  5E2G A;  1MWU A;  4GKU A;  1TEM A;  5BOH A;  1S0W A;  2Y2Q A;  5KMW A;  2ZQ9 A;  2XH9 A;  1L0F A;  1M6K A;  2Z2L B;  4IVK A;  3LY4 A;  1NJ4 A;  4RA7 A;  3UPP A;  1KGE A;  3N8L A;  4S2I A;  3VSK A;  4X69 A;  3ZVW A;  5GHX A;  1E4D A;  3MZF A;  3UO9 A;  4RVA A;  4DE0 A;  1NXY A;  5FQI A;  2HDQ A;  2ZJ9 A;  4QU3 A;  4JXW A;  4RYE A;  2IWD A;  3W8K A;  3GSG A;  4MLL A;  2IWB A;  2DRW A;  3N4I A;  3IWI A;  3ITA A;  5EUA A;  5FSR A;  3ZG5 A;  5HAR A;  2ZQ7 A;  3WS1 A;  5FAO A;  5CEC A;  1ES3 A;  1K25 A;  4S2J A;  1FCO A;  2Z2M B;  2XR0 A;  3A3I A;  4OQG A;  1L0G A;  3WS2 A;  5CHJ A;  2Y2N A;  3VP0 A;  2H0Y A;  2B5R A;  4Y0O A;  1ES5 A; 
#chains in the Genus database with same CATH topology
 4JLF A;  4KEN B;  4DDS A;  1K57 C;  1GA0 A;  1VM1 A;  1E3U D;  1XJ3 A;  3FKW A;  3FPV A;  2PU2 A;  1I2S A;  4LFU A;  1XFN A;  4GLQ A;  4X1L A;  2VGJ A;  3TE8 A;  3VE4 A;  4GS9 B;  1EWZ A;  2HJ9 C;  1Z6F A;  2IA2 A;  5L10 A;  3MF0 A;  5HX9 A;  3JVV A;  3HUM A;  1V9Z A;  3MR0 A;  3DWZ A;  3L9K A;  2P9V A;  2XD1 A;  2LB5 A;  3PHY A;  2ZQA A;  2GDN A;  4IBX A;  1ONH A;  2QHK A;  3GVB A;  4E6X A;  1NLY A;  3LI8 A;  4WLA A;  3CIT A;  2WZX A;  2ZC6 B;  4CJN A;  2WK0 A;  3NDG A;  4KZ9 A;  4KQO A;  1XJ4 A;  3NJA A;  2Y91 A;  3BLM A;  3LIE A;  1JTD A;  4BJP A;  3G6O A;  4PPR A;  3S4X A;  4HJ4 A;  3R7W A;  5U47 A;  4IJG A;  3IXD A;  2O9A A;  4OOM A;  2Y2J A;  4QD4 A;  1ZKJ A;  4U0X A;  3UDI A;  3ZG8 B;  1Y54 A;  4MBF A;  4LRZ E;  4H6J A;  2HDR A;  4E3I A;  5F1F A;  1ERO A;  2KDK A;  5J3W A;  3U4L P;  3T1R A;  3G34 A;  3ITB A;  4K91 A;  1PZO A;  2W1R A;  4CLC A;  3BFC A;  2QJ7 A;  4S2L A;  4WEK A;  1WA9 A;  4KUK A;  2PBD P;  4ME4 A;  2EA9 A;  4KQD A;  1FOF A;  1KE0 A;  3DAV A;  3A3F A;  3FV7 A;  4WF0 A;  3UDX A;  1SDE A;  1XFQ A;  2G7U A;  2Z6C A;  3PTE A;  1GCE A;  3SS5 A;  1W8Q A;  2QZ6 A;  3NCK A;  4NXE A;  3UE3 A;  4OQH A;  4WBG A;  4LPZ A;  3AGE A;  4JPM A;  1W63 Q;  3WRZ A;  4FCF A;  2EFU A;  3P7N A;  4MN5 A;  2QPN A;  2J3W A;  1VET A;  2A3U A;  4GW9 A;  3C4P A;  1FIK A;  4BMW A;  4PM5 A;  5AQB A;  1FR6 A;  4MBH A;  3KYQ A;  4BL2 A;  2EX6 A;  3ZQ5 A;  3CMZ A;  1YLJ A;  3VOY A;  3FYZ A;  1J3W A;  4PM8 A;  4JGP A;  3H82 B;  2YKH A;  3QP2 A;  2JCH A;  3H9W A;  2IWC A;  2C5W B;  2ZMA A;  1CJF A;  1KE3 A;  3EGX C;  3LGO A;  4M4X A;  3LR4 A;  2H0T A;  4NG2 A;  3SZT A;  5FEF A;  3T4Q A;  4UA7 A;  1O07 A;  1FQG A;  4IUK A;  4GS9 A;  4YNR A;  4ID4 A;  3G2Z A;  1P97 A;  5F68 A;  3FWL A;  5DFY A;  1IYQ A;  3O88 A;  4JBF A;  5D3O A;  2A2L A;  3O5Y A;  2B02 A;  3QNB A;  3DBA A;  2VV7 A;  3PAE A;  3CUE C;  5TJJ A;  4S2K A;  4G3W A;  3N8R A;  4UEY A;  2BG1 A;  4OP5 A;  2PU4 A;  1MKI A;  4HNB A;  3H7W B;  2J7V A;  2BAS A;  2OWJ A;  5I5L A;  2P04 A;  3ZG0 A;  4R23 A;  4GN2 A;  1BSG A;  3BLS A;  1YLT A;  4R3B A;  1TS0 A;  3HCY A;  1BLC A;  3G30 A;  4LGW A;  5AQ7 A;  4HI4 A;  1CEG A;  3DWK A;  3HL9 A;  4PAU A;  1OPX A;  3LEQ A;  4L9F A;  5IT5 A;  3UB8 A;  4UHU A;  3EOI A;  4HJ3 A;  1K55 C;  3OLO A;  1NWZ A;  5JYP A;  2GJ3 A;  3OBF A;  3LR0 A;  2B18 A;  3G2Y A;  2CMN A;  3JVU A;  3VP3 A;  1W7F A;  3G31 A;  4Y0U A;  1T18 A;  4OLG A;  1LL5 A;  3Q1F A;  2W3H A;  1KOU A;  3Q82 A;  3G32 A;  3K3D A;  2PBY A;  4R1G A;  1GSX A;  4KQR A;  4EV4 A;  4FD8 A;  1DP6 A;  3IF6 C;  5FDS A;  1PYY A;  2FFY A;  2WAD A;  4ARZ B;  1TS6 A;  4EUZ A;  5EOO A;  2HF6 A;  4Y13 A;  3ZG9 B;  1ZHH B;  4I3A A;  1LI9 A;  5GLD A;  5FAT A;  1PWD A;  4WUJ A;  2X01 A;  4HES A;  4YWZ A;  4EEP A;  2WGW B;  3C8C A;  3P09 A;  5AVF A;  5HD5 A;  1VQQ A;  4S2M A;  2OOL A;  4QB8 A;  4DE2 A;  1YSQ A;  5DJT A;  4YOF A;  5GLA A;  4EBL A;  2JKT M;  2EXB A;  3W4O A;  4UAA A;  2ZC7 A;  5F5Y A;  4EET B;  1YKD A;  2Y4A A;  4QWO A;  3FZC A;  4AFI A;  3VOL A;  1XA7 A;  1C3B A;  3C7V A;  2VA0 A;  2ZMV A;  4E3M A;  5A8B A;  4EQI A;  3BY8 A;  4HP4 A;  1LSX A;  5CXW A;  5G4Z A;  5EV0 A;  1ES2 A;  3OPP A;  4B93 A;  4BD1 A;  1H5X A;  3NI9 A;  2VJW A;  1ERM A;  3GDI A;  3C38 A;  2CC1 A;  1XJ6 A;  3UB6 A;  3UB7 A;  2YKF A;  2UV0 E;  2W0N A;  2Y2L A;  1KDS A;  3ZYT A;  2XA7 M;  4KUO A;  2V8F A;  1IYP A;  3WS5 A;  2Q0O A;  4N92 A;  5K5B A;  3BEB A;  2WKQ A;  2H5S A;  4P87 A;  4B9O A;  3GMW A;  3A0V A;  1N4O A;  3M2J A;  3NEC A;  5E2G A;  1MWU A;  1S0W A;  3IBJ A;  4P6Z S;  2W1T B;  2XH9 A;  1JNU A;  4EES A;  1M6K A;  4IVK A;  1KGE A;  1MZU A;  4X69 A;  4FUW A;  3F1N B;  2VGL S;  3MZF A;  4F3L B;  1NXY A;  2IWD A;  4I3I A;  3GSG A;  3IWI A;  3FC7 A;  3EGD C;  4K08 A;  5HAR A;  4ZRR A;  4S2J A;  3VP0 A;  2H0Y A;  2B5R A;  2V0W A;  5F83 A;  5CX7 A;  3HUN A;  3CPT B;  2ZM8 A;  4KZ4 A;  2OLV A;  1MBL A;  5FEG A;  4C6Y A;  5AQA A;  4OOY A;  2W3F A;  1BLH A;  2KX6 A;  5DJU A;  1KVL A;  5CHU A;  2LB9 A;  5FQM A;  1WYB A;  2JKR I;  2A24 A;  2D02 A;  1YT4 A;  4HEF A;  3KX0 X;  3Q7V A;  4Q8I A;  2J80 A;  1WYC A;  2JKF A;  2WYX A;  4OPQ A;  4R38 A;  1HTZ A;  3E98 A;  5HPI A;  5L09 A;  2ZC4 B;  4R70 A;  3HLB A;  4LV1 A;  1DJA A;  4FH4 A;  4HIA A;  4OLD A;  3MZD A;  3S22 A;  3HUO A;  2PYP A;  4HJ6 A;  2VV6 A;  4DDY A;  4OH0 A;  3LO7 A;  1YAX A;  2GNX A;  5KSH A;  5HSQ A;  2PD7 A;  2W3D A;  3QP8 A;  3DW0 A;  5EFW A;  3HLC A;  1YLZ A;  1K54 A;  2WGW A;  1CI9 A;  3PBN A;  2O99 A;  3IHA A;  4UA6 A;  1G5U A;  3MKF A;  3SH7 A;  2HV1 A;  2QKP A;  3TRC A;  2V2F F;  5IU1 A;  3N7W A;  1U60 A;  1LL8 A;  5EM0 A;  4FSF A;  4R0Q A;  1CF0 A;  3V67 A;  3M6H A;  4EW7 A;  1S4R A;  3IXG A;  3CI6 A;  2OAP 1;  3C2W A;  5CGX A;  5KIZ A;  5HDD A;  5FI7 A;  2JN7 A;  2ZLY A;  2HGV A;  3I7J A;  1SKF A;  4O0P A;  3MS6 A;  3UMD A;  2GX5 A;  5L2F A;  3GR2 A;  4KZ7 A;  3BYD A;  5CRF A;  2ZQ8 A;  3C30 A;  2HP9 A;  3D9Y A;  2EWV A;  5JYO A;  2XK1 A;  3S1Y A;  4XXR A;  4S2N C;  4S2O A;  2NUP C;  3V5M A;  4WYY A;  4K0X A;  3KYZ A;  3OPL A;  3T1Q B;  4WZ4 A;  2I9V A;  4X55 A;  3RXX A;  3B3X A;  1K6R A;  1XGI A;  2UWX A;  3D72 A;  4YIN A;  3F1N A;  4F3L A;  1FSW A;  3D4F A;  4MEZ A;  3TG9 A;  3EQU A;  3FG8 A;  1PRQ A;  3KO6 A;  5EEC A;  3T4L A;  3ZCZ A;  3F1P A;  1GHI A;  4NK3 A;  4KQQ A;  4WEJ A;  2OLU A;  3ZNT A;  3BFD A;  2VX8 A;  3BWL A;  1PI4 A;  4Y0T A;  5A91 A;  2PR6 A;  3RH8 B;  3BFF A;  3NUL A;  5DTT A;  4DXC A;  3UN7 A;  4KG6 A;  2X71 A;  4C3Q A;  5HW3 A;  1MWS A;  2L0W A;  1YM1 A;  3ISG A;  1ESU A;  4RX2 A;  3RTY A;  4LV3 A;  1DJB A;  4XT2 B;  4LCL A;  4BL3 A;  3LID A;  1IFQ A;  2WKE A;  3IQA A;  2HZ5 A;  3O86 A;  3QP1 A;  5EM1 A;  1CEF A;  3MBZ A;  3SS3 A;  4WM9 A;  4QHC A;  5EVI D;  4OQI A;  2DNS A;  3SOI A;  4X53 A;  4D60 A;  1N9L A;  1TDL A;  4LLO B;  3T50 A;  3VOZ A;  3UE6 A;  1BZA A;  5EVI C;  4N1X A;  2R9X A;  2E8J A;  4E3L A;  2HDS A;  4OP8 A;  4FH2 A;  5HDS A;  4QY6 A;  5EVL A;  2EX2 A;  4R4S A;  3E2L A;  3BEC A;  4Z9Q A;  1K56 A;  1OJG A;  3QP4 A;  4KZ3 A;  5EPH A;  4JGQ A;  4GD6 A;  1ERQ A;  2RL3 A;  2PHY A;  4ZBE A;  3PBO A;  2V20 A;  1PFL A;  3G4P A;  2Y2H A;  5DFX A;  3IWQ A;  4X68 A;  3IS2 A;  2E8I A;  4A5R A;  1SZV A;  3CLO A;  1DJC A;  5J4E A;  1OT6 A;  1W8Y A;  3G35 A;  3MFD A;  4GHI B;  2Z6D A;  4D2O A;  2XFT A;  1GHP A;  3TSG A;  2FZ0 A;  4MN7 A;  3MMH A;  2XD5 A;  4WZ5 C;  5CER A;  2INW A;  3AGF A;  4Z1W A;  5MC7 A;  2WAF A;  1Q2P A;  1L0E A;  4ZTK A;  4H8R A;  1SKO B;  3IH8 A;  3BJN A;  2C6W B;  3HBR A;  3CJM A;  2Y59 A;  4PKY G;  3EQV A;  1T1C A;  3IF5 A;  1ONG A;  4JF4 A;  1ODV A;  3E2K A;  2XDM A;  3BFE A;  3DTM A;  2NUT C;  1K0K A;  4I38 A;  1E25 A;  2WUQ A;  2L1M A;  2VEA A;  1XJ2 A;  3UE1 A;  1KE4 A;  1RCJ A;  4UQI S;  4HBU A;  2Y79 A;  2R78 A;  1OTE A;  4X56 A;  2O0Y A;  1F98 A;  4LEN A;  4MN6 A;  2JC7 A;  2BTF P;  1YQS A;  3QP6 A;  5HZH A;  4QJG A;  1FIL A;  3MXQ A;  3Q07 A;  3PYP A;  3TW8 A;  4BD0 A;  2L4R A;  5M19 A;  1NY0 A;  1T19 A;  4OPZ A;  2VZW A;  3K2N A;  3O87 A;  4ZJ2 A;  4U0T A;  3BFG A;  3OOV A;  4NKP A;  5KMW A;  1S1Z A;  5EVE A;  1H8M A;  4R3A A;  4JGR A;  2JKG A;  3UPP A;  1NJ4 A;  4S2I A;  3ZVW A;  5GHX A;  2JHE A;  4DE0 A;  5FQI A;  2HDQ A;  2ZJ9 A;  3LIF A;  3KSG A;  1Z09 A;  5FAO A;  1ES3 A;  1K25 A;  1FCO A;  5CHJ A;  2Y2N A;  4X25 A;  4BWI A;  3T4S A;  1RGZ A;  4NXG A;  4RQ9 A;  2H28 A;  3NC8 A;  3IHB A;  1BTL A;  4NEE D;  5J7E A;  3CZD A;  3HLE A;  1Q2Q A;  1NLZ A;  3SS4 A;  5HWV A;  3VE3 A;  1TS8 A;  4JXG A;  5HAQ A;  1LHY A;  4EU0 A;  1W63 M;  1YLY A;  1DP9 A;  2WZZ A;  4KZB A;  4E6W A;  5G18 A;  3T12 B;  4CLC D;  2Y2K A;  1DP8 A;  4GD8 A;  4GHI A;  3C7U A;  1K57 A;  4CLC C;  1KGG A;  5I94 A;  2G2W A;  1N9B A;  3H82 A;  3UME A;  2Q9M A;  3SH8 A;  1E3U A;  3HLD A;  2PDR A;  1BUE A;  4EBN A;  1MKM A;  1MXO A;  4ZDX A;  1FSY A;  1ALQ A;  4P6Z M;  1NZO A;  2OV5 A;  3DTI A;  2EFX A;  1SKO A;  1D7E A;  4HH2 A;  3GTC A;  3LYX A;  3OC2 A;  3RXW A;  1TDG A;  2VGL M;  4K0W A;  3UPN A;  1IEL A;  3IX8 A;  1SDN A;  5DF7 A;  3UDF A;  1N9N A;  4OQ0 A;  4GOG A;  2FFF B;  4Y17 A;  2XRO A;  4R4R A;  4DXB A;  1VHM A;  3MQQ A;  2HP6 A;  1CK3 A;  2R9W A;  3HJK A;  1GHM A;  1FCN A;  4CPK A;  1ZC2 A;  5GL9 A;  3IT9 A;  5FAP A;  3H7W A;  1KGF A;  1XX2 A;  4IED A;  1XA1 A;  2BLS A;  4MNR A;  5EE8 A;  1OTD A;  3MQ0 A;  4GB7 A;  2B95 A;  3MQO A;  4DE1 A;  4GCZ A;  1HZO A;  1SCW A;  5E43 A;  5HPF A;  4GDN A;  2PYR A;  1SHV A;  5FI2 A;  3V39 A;  1W5D A;  3A3E A;  2Y55 A;  1YLP A;  5AQ9 A;  1LSV A;  2VK3 A;  4GNU A;  3P98 A;  5L8M A;  5AJG A;  3WS4 A;  1D06 A;  3OCL A;  1ACF A;  2J3T D;  3MXS A;  1OT9 A;  3IF6 B;  1MPL A;  1JVJ A;  4PM7 A;  2WGI A;  1HVB A;  2PD8 A;  2A49 A;  5F82 A;  2J3T C;  3EEA A;  4P6B A;  2I72 A;  4LCM A;  2PT7 A;  1XKZ A;  1UGU A;  1PW8 A;  3WRT A;  3SH9 A;  3HLW A;  2XFS A;  4ARZ A;  1FR1 A;  3IXH A;  5DF9 A;  5DTK A;  3B47 A;  3HJI A;  3BQA A;  1KVM A;  1QMF A;  3RJU A;  5FAS A;  4JXV A;  2O9C A;  3T4T A;  1QME A;  4EER A;  4H6J B;  1OTI A;  4B4Z A;  1XGJ A;  3VV4 A;  4F94 A;  2ZMF A;  2HPB A;  3NOP C;  1L0D A;  1PIO A;  4Q0H A;  4MDZ A;  1NYM A;  3N8S A;  1OME A;  4HP9 A;  3LY3 A;  1HD8 A;  3LCE A;  3C4O A;  3E4O A;  4BQM A;  1GSV A;  4OPY A;  5FQQ A;  4IVI A;  3ZHH A;  1S4S A;  4Y3I A;  5FL3 A;  3EEH A;  4BEN A;  1VB6 A;  4MCW A;  2XF3 A;  5J8X A;  4P85 A;  4OON A;  4EEU A;  3HVF A;  3Q81 A;  1NZU A;  5FQK A;  2WKP A;  2OWH A;  4HOI A;  1JWZ A;  5L07 A;  2V0U A;  1MY8 A;  5DKL A;  2Y2P A;  1K4F A;  1AWI A;  4I5S A;  1PWC A;  1X0O A;  3GEC A;  4WMC D;  1YPR A;  2P7J A;  4JKT A;  4X6T A;  1F2K A;  1M40 A;  4R3J A;  4WN5 A;  1PWG A;  1VET B;  1V9Y A;  5M1A A;  3ZFZ A;  3U2A A;  4IBR A;  3BQ8 A;  3M2K A;  1AXB A;  3P01 A;  4BBU A;  3CUE A;  1YMS A;  4L9G A;  5F6A A;  2V8C A;  2W1T A;  2EWW A;  3S7N A;  4UA9 A;  2WKR A;  5TGF A;  2W3E A;  3UY6 A;  3V3S A;  1L2S A;  3L7H A;  1H3Q A;  4S2P A;  1Y4O A;  5HD3 A;  3C5A A;  3GQZ A;  4HHD A;  1CI8 A;  3FKV A;  4EBP A;  5FA7 A;  4HBT A;  3OPH A;  4LV0 A;  1DY6 A;  4QPR A;  4BLM A;  2XGN A;  4FTX A;  1K55 A;  3CPT A;  1W79 A;  1K4E A;  5IHV A;  2ZQD A;  2DMW A;  4FOF A;  4IUH A;  4X1M A;  4QY5 A;  4ZJ1 A;  2KOI A;  2JKT I;  1ZG6 A;  1NYY A;  5KSC A;  1XP4 A;  1T1B A;  4II7 A;  5E2F A;  2ZD8 A;  1EW0 A;  5HWT A;  1KDW A;  3ZDJ A;  3IF6 A;  3VSL A;  5CHM A;  2ZOH A;  1T1A A;  1CQA A;  4NXB A;  4PM6 A;  2XQZ A;  2HJE A;  3A3J A;  4JXS A;  1LLB A;  2V9A A;  4KG5 A;  2JE5 A;  4LV2 A;  1DRM A;  3IH9 A;  5CEB A;  2HDU A;  5M18 A;  3M6B A;  1FCM A;  3PAG A;  3T1X A;  2MJ6 A;  3V3R A;  1F9I A;  5FQ9 A;  3RFB A;  4I39 A;  5GHY A;  4O7D A;  1BLS A;  5DKK A;  2WKH A;  1JTG A;  2QJ5 A;  4Y15 A;  1OJ5 A;  1UWN X;  4OPR A;  2Y2G A;  4GKU A;  2ZL1 B;  4Y2F A;  2Y2Q A;  4BBT A;  2KLI A;  2ZQ9 A;  3LY4 A;  4RA7 A;  1E4D A;  2XRN A;  2M7V A;  4CQH A;  4O8G A;  2DRW A;  3N4I A;  3MFX A;  3S7P A;  5FSR A;  1GSW A;  5CEC A;  1TF1 A;  3A3I A;  3WS2 A;  4Y0O A;  1ES5 A;  3E4Q A;  3CWF A;  4GDB A;  1NRJ A;  3LUQ A;  3W2Z A;  4B4X A;  3LFV A;  3LR5 A;  3MJQ A;  3LR3 A;  1IOU A;  1G68 A;  4MBK A;  4P0M A;  4N1H A;  2J9P A;  1K54 C;  3NDE A;  3V50 A;  4OVD A;  4JF5 A;  4N9K A;  1OTB A;  3F1O B;  1IKG A;  1H0M A;  2JKR M;  4KZ8 A;  2ZC5 B;  5TR7 A;  2ZQC A;  4UQI M;  3WS0 A;  4JF6 A;  3VP1 A;  2AVX A;  3T4K A;  2Q9N A;  2V1Z A;  4B88 A;  4EQ1 A;  4HY8 A;  2PRF A;  5GHZ A;  1MC0 A;  3LI9 A;  5TBM B;  2WAE A;  3JPU A;  2OSU A;  3MXR A;  3UB9 A;  3WWX A;  4MMN A;  4E3O A;  1XXM A;  4KG2 A;  3GRJ A;  2QWS A;  1G28 A;  5TFQ A;  3Q7Z A;  3NOU C;  3B33 A;  3TOI A;  4G3K A;  3IBR A;  4HH3 A;  4L0L A;  3IX4 A;  1P0Z A;  3NY4 A;  3ICY A;  3UB5 P;  5HL6 A;  3ZNY A;  1G6A A;  4OKP A;  4XT2 A;  2EX9 A;  3FPW A;  3PXP A;  3IX3 A;  3PBT A;  5DF8 A;  2Y2I A;  3PR6 A;  3BM6 A;  3VFH A;  2P74 A;  3LIC A;  3CG5 A;  5HL1 A;  5EVI B;  3A3D A;  4DRT A;  3ZG7 B;  3AGD A;  1TVF A;  2ZC3 B;  3A0R A;  4N9L A;  5FQJ A;  3KSF A;  3NIA A;  4U3T A;  1HLU P;  4ETZ A;  4LRX C;  3LIA A;  1IKI A;  1P9W A;  1H8Y A;  4O01 A;  1GA9 A;  3BRM A;  1MWT A;  1L3L A;  2VGK A;  4LRY C;  5HDC A;  1H8Z A;  2H10 A;  3B42 A;  2G2U A;  5HFO A;  3D3O A;  4IHQ A;  2A24 B;  3GV9 A;  3SW1 A;  4PMA A;  1S6R A;  3HRE A;  1D1J A;  4G3V A;  1I2W A;  3QNC A;  3Q7V B;  2X02 A;  5HWW A;  2ZL1 A;  3BY9 A;  4E04 A;  3R4K A;  1TD5 A;  5E2E A;  1RP5 A;  2J8Y A;  3MSH A;  2O9B A;  4WEL A;  2RCX A;  2VLG A;  5HAI A;  4WL9 A;  4L9E A;  1ZG4 A;  1PZP A;  3W4Q A;  4C75 A;  4KZ6 A;  2FH5 A;  3W4P A;  1J9M A;  2HP5 A;  4ETX A;  5KZH A;  2V1A A;  2Y2M A;  5FDH A;  2QMI A;  4WMC A;  3CAX A;  4S2N A;  3LIB A;  3KSH A;  1NRF A;  4DKI A;  2VKS A;  2P08 A;  3QHY A;  4Q0J A;  5CGS A;  3OPR A;  4CLC E;  1BUL A;  4GZB A;  4NET A;  1IYS A;  4DJ3 A;  1XPB A;  1K56 D;  3KSI A;  5IS1 A;  1ZTU A;  3F1O A;  1BT5 A;  1IYO A;  4DMZ A;  3LEZ A;  5A92 A;  2QYB A;  3OCN A;  2DCF A;  5DVA A;  1BYW A;  3VP2 A;  4ZJ3 A;  4I3J A;  1O7E A;  5E2H A;  5A93 A;  4KZA A;  3JYI A;  3NOT C;  1S67 L;  3S7O A;  1ES4 A;  4PKY A;  3T4O A;  4DJ2 A;  5A90 A;  3IWO A;  5TBM A;  5GLC A;  4ZAM A;  5CTM A;  1LL9 A;  1VEU B;  2J9O A;  4HQA A;  4M3K A;  4E3K A;  2K2N A;  4OOL A;  5CED A;  2OAQ 1;  1ESI A;  5HAP A;  4DF6 A;  1STZ A;  4Y7P A;  1K6S A;  4EWF A;  4ESP A;  3PBR A;  3MZE A;  4Y5F A;  3IXB A;  4PM9 A;  3N6I A;  5C5K A;  2V1B A;  3T4J A;  1EI5 A;  2Y2O A;  5FAQ A;  1LSW A;  2XA7 S;  3OZH A;  1RGY A;  1BLP A;  1N9O A;  5F1G A;  2K7S A;  5EVI A;  1P9R A;  2K31 A;  2P9V B;  1PI5 A;  1TS7 A;  2ZBB A;  3O3V A;  2PAV P;  3T1S A;  3F1P B;  4NXF A;  1MWR A;  3ZGA B;  1IEM A;  3HLG A;  3HLF A;  5FI6 A;  3UNW A;  4GJ4 A;  4DE3 A;  1JWP A;  1LI0 A;  1LT0 A;  2D01 A;  3VFF A;  3BW6 A;  1JWV A;  5GLB A;  4RX3 A;  1I5Q A;  1PNE A;  3S7Q A;  3R7W B;  4E3J A;  2PR5 A;  3E4P A;  5EOE A;  1G6O A;  4EXO A;  3ZVT A;  2ACG A;  3NHQ A;  4E3N A;  1S66 L;  2WGV A;  5AVE A;  4XUX A;  4BBV A;  3A0S A;  5DTS A;  3PBQ A;  2JBF A;  1YSP A;  3MKE A;  3EWK A;  3NBL A;  3TJZ C;  1WE4 A;  5CTN A;  4PHT A;  3QP5 A;  2W3G A;  2ZM2 A;  4Q0I A;  5CGW A;  5LBR A;  4XUZ A;  2Y8H A;  4CLC B;  2WKI A;  3E0Y A;  3K3C A;  4WZ5 A;  1YLW A;  2M1C A;  1YMX A;  3DTK A;  3VMA A;  2ZM0 A;  2XLN A;  1PW1 A;  4DN0 A;  3ULF A;  1UWP X;  4KZ5 A;  3UPO A;  4YFM A;  3UE0 A;  3CHW P;  2W27 A;  5F69 A;  3PBS A;  2VV8 A;  2ZOI A;  2EXA A;  3VP4 A;  2EX8 A;  3KYE A;  1K38 A;  3IS2 B;  2XEP A;  1TEM A;  3DTE A;  5BOH A;  4JGO A;  4R6L A;  2GZA A;  1F5M A;  1L0F A;  2M7U A;  2Z2L B;  5G4Y A;  3N8L A;  3VSK A;  1A0K A;  3UO9 A;  4RVA A;  1S1Y A;  4QU3 A;  1Y28 A;  2XSS A;  4JXW A;  4RYE A;  3W8K A;  4MLL A;  2IWB A;  3ITA A;  5EUA A;  1VEU A;  3ZG5 A;  2ZQ7 A;  3WS1 A;  2Z2M B;  2XR0 A;  4OQG A;  1L0G A;  1OTA A;  4EUV A; 
#chains in the Genus database with same CATH homology
 4JLF A;  4GDB A;  3HUN A;  4KEN B;  4B4X A;  2ZM8 A;  4KZ4 A;  1RGZ A;  4DDS A;  2OLV A;  1K57 C;  1GA0 A;  1MBL A;  1VM1 A;  1E3U D;  3NC8 A;  1G68 A;  5AQA A;  4C6Y A;  4MBK A;  4OOY A;  1BLH A;  4P0M A;  3IHB A;  1BTL A;  4N1H A;  3FKW A;  2PU2 A;  1I2S A;  3CZD A;  1KVL A;  5CHU A;  2J9P A;  3HLE A;  1Q2Q A;  5FQM A;  1K54 C;  1WYB A;  2VGJ A;  3NDE A;  3V50 A;  4OVD A;  4JF5 A;  4N9K A;  3SS4 A;  1YT4 A;  1IKG A;  1EWZ A;  4JXG A;  5HAQ A;  4HEF A;  4KZ8 A;  1Z6F A;  1LHY A;  5HX9 A;  2ZC5 B;  3Q7V A;  5TR7 A;  2ZQC A;  1YLY A;  3HUM A;  4Q8I A;  1WYC A;  2WYX A;  3DWZ A;  3WS0 A;  2WZZ A;  4JF6 A;  4OPQ A;  3VP1 A;  2P9V A;  1HTZ A;  2XD1 A;  2Q9N A;  2V1Z A;  4KZB A;  4B88 A;  2ZC4 B;  4E6W A;  5G18 A;  2ZQA A;  3HLB A;  4LV1 A;  1DJA A;  2GDN A;  4FH4 A;  5GHZ A;  2Y2K A;  4GD8 A;  4OLD A;  3MZD A;  3C7U A;  3S22 A;  4IBX A;  3HUO A;  1K57 A;  1ONH A;  3GVB A;  4E6X A;  4DDY A;  1KGG A;  2WAE A;  4OH0 A;  5I94 A;  2WZX A;  3LO7 A;  2ZC6 B;  4CJN A;  2G2W A;  5F83 A;  2WK0 A;  1N9B A;  2OSU A;  3NDG A;  4KZ9 A;  4KQO A;  5KSH A;  3MXR A;  2Y91 A;  3DW0 A;  3BLM A;  3WWX A;  2Q9M A;  3SH8 A;  1E3U A;  3HLC A;  3HLD A;  4E3O A;  1JTD A;  1YLZ A;  1K54 A;  1XXM A;  4KG2 A;  4BJP A;  3GRJ A;  1BUE A;  2WGW A;  4EBN A;  4PPR A;  1MXO A;  3S4X A;  4ZDX A;  1CI9 A;  1FSY A;  3Q7Z A;  3PBN A;  5TFQ A;  5U47 A;  1ALQ A;  3IHA A;  3TOI A;  1NZO A;  4UA6 A;  2OV5 A;  3IXD A;  4L0L A;  2EFX A;  4OOM A;  3MKF A;  3GTC A;  3SH7 A;  2Y2J A;  3NY4 A;  3OC2 A;  1ZKJ A;  4QD4 A;  3RXW A;  1TDG A;  4U0X A;  3UDI A;  2V2F F;  4K0W A;  3ZG8 B;  3ZNY A;  3UPN A;  1Y54 A;  3N7W A;  1U60 A;  4MBF A;  1G6A A;  4OKP A;  2HDR A;  1IEL A;  2EX9 A;  4E3I A;  4FSF A;  1SDN A;  5F1F A;  1ERO A;  3PBT A;  5DF8 A;  4R0Q A;  5DF7 A;  2Y2I A;  3UDF A;  3BM6 A;  3VFH A;  3M6H A;  2P74 A;  3IXG A;  5CGX A;  4OQ0 A;  3G34 A;  3ITB A;  4GOG A;  4K91 A;  1PZO A;  2FFF B;  3CG5 A;  3BFC A;  4R4R A;  5EVI B;  5FI7 A;  4DXB A;  5HL1 A;  3A3D A;  4DRT A;  3ZG7 B;  2ZLY A;  3AGD A;  2HP6 A;  4S2L A;  1TVF A;  2ZC3 B;  4WEK A;  1CK3 A;  2R9W A;  3I7J A;  4N9L A;  5FQJ A;  1SKF A;  1FOF A;  3NIA A;  4U3T A;  5L2F A;  1GHM A;  1FCN A;  1KE0 A;  1IKI A;  4CPK A;  3GR2 A;  1ZC2 A;  5GL9 A;  1H8Y A;  3IT9 A;  5FAP A;  4KZ7 A;  1GA9 A;  3A3F A;  1KGF A;  3BYD A;  5CRF A;  1XX2 A;  3FV7 A;  4IED A;  3BRM A;  1MWT A;  2VGK A;  1XA1 A;  1H8Z A;  2ZQ8 A;  2H10 A;  2BLS A;  4MNR A;  5EE8 A;  2HP9 A;  3UDX A;  1SDE A;  2G2U A;  5HFO A;  4GB7 A;  2XK1 A;  3S1Y A;  4XXR A;  5JYO A;  4DE1 A;  3PTE A;  4S2N C;  1HZO A;  1SCW A;  3GV9 A;  4S2O A;  5E43 A;  4GDN A;  4PMA A;  1S6R A;  3HRE A;  1GCE A;  1SHV A;  5FI2 A;  3SS5 A;  1I2W A;  1W8Q A;  2QZ6 A;  3NCK A;  3QNC A;  3UE3 A;  3V39 A;  1W5D A;  4OQH A;  4WBG A;  3A3E A;  4WYY A;  3Q7V B;  2Y55 A;  3AGE A;  2X02 A;  1YLP A;  4JPM A;  4K0X A;  5AQ9 A;  3WRZ A;  4FCF A;  3OPL A;  4WZ4 A;  2EFU A;  4X55 A;  3RXX A;  3B3X A;  1K6R A;  2QPN A;  1XGI A;  5E2E A;  2UWX A;  1RP5 A;  2J8Y A;  4GNU A;  2A3U A;  3P98 A;  4WEL A;  3C4P A;  4YIN A;  2RCX A;  5HAI A;  3WS4 A;  3OCL A;  1FSW A;  4PM5 A;  3D4F A;  5AQB A;  1FR6 A;  3MXS A;  4MBH A;  3IF6 B;  1MPL A;  1JVJ A;  1ZG4 A;  4PM7 A;  4BL2 A;  2WGI A;  1HVB A;  1PZP A;  2EX6 A;  4MEZ A;  3W4Q A;  4KZ6 A;  3CMZ A;  3EQU A;  1YLJ A;  3TG9 A;  3VOY A;  3FYZ A;  2A49 A;  5F82 A;  3W4P A;  1J9M A;  2HP5 A;  4P6B A;  4PM8 A;  2I72 A;  4LCM A;  5EEC A;  2JCH A;  3ZCZ A;  5KZH A;  1GHI A;  1XKZ A;  2Y2M A;  4KQQ A;  2IWC A;  4NK3 A;  4WEJ A;  5FDH A;  2C5W B;  2ZMA A;  2OLU A;  2QMI A;  1PW8 A;  3ZNT A;  3WRT A;  3BFD A;  1KE3 A;  3SH9 A;  3HLW A;  2XFS A;  4WMC A;  4S2N A;  1PI4 A;  4Y0T A;  5A91 A;  1NRF A;  3BFF A;  4DKI A;  1FR1 A;  4C75 A;  5DTT A;  2H0T A;  4DXC A;  3IXH A;  3UN7 A;  4KG6 A;  2X71 A;  5DF9 A;  3QHY A;  5CGS A;  5DTK A;  3OPR A;  4C3Q A;  1BUL A;  5HW3 A;  4GZB A;  4NET A;  1IYS A;  1KVM A;  1QMF A;  1MWS A;  4UA7 A;  3RJU A;  1YM1 A;  3ISG A;  5FAS A;  1XPB A;  1K56 D;  1ESU A;  4JXV A;  1O07 A;  1FQG A;  4RX2 A;  1BT5 A;  1IYO A;  1QME A;  4ID4 A;  4LV3 A;  3LEZ A;  5A92 A;  3G2Z A;  4B4Z A;  3OCN A;  1DJB A;  2DCF A;  1XGJ A;  4LCL A;  4BL3 A;  5DVA A;  4F94 A;  2HPB A;  3FWL A;  1IYQ A;  2WKE A;  3O88 A;  3IQA A;  4JBF A;  3O86 A;  3VP2 A;  1L0D A;  4ZJ3 A;  1PIO A;  5D3O A;  1O7E A;  1NYM A;  3N8S A;  1OME A;  1CEF A;  5E2H A;  3LY3 A;  1HD8 A;  3JYI A;  3LCE A;  3MBZ A;  4KZA A;  5A93 A;  3C4O A;  4BQM A;  3SS3 A;  4OPY A;  4WM9 A;  3QNB A;  5FQQ A;  4IVI A;  4QHC A;  1ES4 A;  4OQI A;  5EVI D;  3ZHH A;  2DNS A;  3PAE A;  3SOI A;  5A90 A;  4BEN A;  4X53 A;  3IWO A;  1TDL A;  4S2K A;  2XF3 A;  3N8R A;  5GLC A;  4ZAM A;  3VOZ A;  5CTM A;  1BZA A;  2BG1 A;  4OP5 A;  2PU4 A;  5EVI C;  5J8X A;  1LL9 A;  1MKI A;  2J9O A;  4P85 A;  4OON A;  4N1X A;  2J7V A;  2R9X A;  3HVF A;  3Q81 A;  4M3K A;  1NZU A;  3ZG0 A;  4R23 A;  4E3L A;  4E3K A;  2HDS A;  5FQK A;  4GN2 A;  4OP8 A;  4OOL A;  5CED A;  1BSG A;  1JWZ A;  4FH2 A;  1ESI A;  1MY8 A;  3BLS A;  4QY6 A;  5HAP A;  1YLT A;  5EVL A;  2EX2 A;  4R3B A;  2Y2P A;  1BLC A;  3G30 A;  3E2L A;  4R4S A;  4DF6 A;  1K4F A;  5AQ7 A;  4Y7P A;  3BEC A;  1K6S A;  4EWF A;  1CEG A;  3DWK A;  3HL9 A;  3PBR A;  3V5M A;  3MZE A;  4Z9Q A;  1PWC A;  1K56 A;  3IXB A;  4WMC D;  4PM9 A;  4KZ3 A;  3N6I A;  4JKT A;  4X6T A;  5EPH A;  4GD6 A;  1ERQ A;  1M40 A;  2RL3 A;  4R3J A;  4UHU A;  4ZBE A;  1K55 C;  1EI5 A;  1PWG A;  3PBO A;  5JYP A;  2Y2O A;  5FAQ A;  2V20 A;  5M1A A;  3ZFZ A;  3G4P A;  2Y2H A;  3OZH A;  3IWQ A;  3G2Y A;  4X68 A;  4IBR A;  3VP3 A;  1RGY A;  3M2K A;  1BLP A;  1AXB A;  1W7F A;  1YMS A;  3G31 A;  5F1G A;  4Y0U A;  4OLG A;  1LL5 A;  2E8I A;  3Q1F A;  5EVI A;  3Q82 A;  4A5R A;  3G32 A;  2PBY A;  2P9V B;  4R1G A;  1PI5 A;  1DJC A;  3O3V A;  4KQR A;  4UA9 A;  4EV4 A;  4FD8 A;  5TGF A;  1W8Y A;  3UY6 A;  3V3S A;  3IF6 C;  1L2S A;  3ZGA B;  1MWR A;  1PYY A;  3G35 A;  2FFY A;  2WAD A;  3MFD A;  4S2P A;  3C5A A;  3GQZ A;  1IEM A;  1CI8 A;  3FKV A;  3HLF A;  3HLG A;  5FI6 A;  3UNW A;  4D2O A;  4EBP A;  4EUZ A;  2XFT A;  5FA7 A;  5EOO A;  4HBT A;  3OPH A;  1GHP A;  4LV0 A;  1DY6 A;  3TSG A;  3ZG9 B;  4BLM A;  1LI9 A;  4DE3 A;  1JWP A;  5GLD A;  5FAT A;  1PWD A;  1LI0 A;  2XGN A;  2X01 A;  4HES A;  2XD5 A;  4WZ5 C;  5CER A;  1K55 A;  1W79 A;  1K4E A;  3AGF A;  3VFF A;  5GLB A;  1JWV A;  5IHV A;  2ZQD A;  4RX3 A;  2WGW B;  1I5Q A;  3P09 A;  1VQQ A;  4E3J A;  4S2M A;  4QY5 A;  2WAF A;  4ZJ1 A;  5EOE A;  4QB8 A;  3ZVT A;  4DE2 A;  1Q2P A;  1L0E A;  1ZG6 A;  4ZTK A;  1NYY A;  4H8R A;  5KSC A;  1XP4 A;  5GLA A;  3IH8 A;  4E3N A;  2WGV A;  4EBL A;  4XUX A;  2EXB A;  5DTS A;  3W4O A;  5E2F A;  2ZD8 A;  4UAA A;  2ZC7 A;  2C6W B;  3HBR A;  3PBQ A;  2JBF A;  3CJM A;  2Y4A A;  2Y59 A;  3MKE A;  3EQV A;  3NBL A;  1KDW A;  3IF5 A;  1WE4 A;  3FZC A;  5CTN A;  3ZDJ A;  3IF6 A;  3VSL A;  5CHM A;  1ONG A;  1XA7 A;  1C3B A;  4JF4 A;  2ZM2 A;  3C7V A;  4PM6 A;  5CGW A;  3E2K A;  2XQZ A;  2XDM A;  3A3J A;  1LLB A;  4JXS A;  3BFE A;  4KG5 A;  3DTM A;  4XUZ A;  4E3M A;  2JE5 A;  4EQI A;  1E25 A;  4LV2 A;  2WUQ A;  5CXW A;  3IH9 A;  5CEB A;  2WKI A;  2HDU A;  5M18 A;  1ES2 A;  3OPP A;  4BD1 A;  3UE1 A;  1H5X A;  1KE4 A;  1RCJ A;  4HBU A;  3NI9 A;  3M6B A;  4WZ5 A;  1YLW A;  1FCM A;  3PAG A;  1ERM A;  4X56 A;  2CC1 A;  4LEN A;  3V3R A;  1YMX A;  3VMA A;  2ZM0 A;  2XLN A;  1PW1 A;  2JC7 A;  5FQ9 A;  1YQS A;  3UPO A;  4KZ5 A;  2Y2L A;  4YFM A;  5GHY A;  1KDS A;  4O7D A;  1BLS A;  3UE0 A;  4QJG A;  2WKH A;  3PBS A;  1JTG A;  2EXA A;  3Q07 A;  1IYP A;  4BD0 A;  3WS5 A;  4N92 A;  5M19 A;  1NY0 A;  3VP4 A;  4OPZ A;  3BEB A;  2EX8 A;  3O87 A;  2H5S A;  4P87 A;  3GMW A;  1K38 A;  1N4O A;  4ZJ2 A;  4U0T A;  3BFG A;  3M2J A;  2XEP A;  4OPR A;  2Y2G A;  5E2G A;  1MWU A;  4GKU A;  1TEM A;  5BOH A;  1S0W A;  2Y2Q A;  5KMW A;  2ZQ9 A;  2XH9 A;  1L0F A;  1M6K A;  2Z2L B;  4IVK A;  3LY4 A;  1NJ4 A;  4RA7 A;  3UPP A;  1KGE A;  3N8L A;  4S2I A;  3VSK A;  4X69 A;  3ZVW A;  5GHX A;  1E4D A;  3MZF A;  3UO9 A;  4RVA A;  4DE0 A;  1NXY A;  5FQI A;  2HDQ A;  2ZJ9 A;  4QU3 A;  4JXW A;  4RYE A;  2IWD A;  3W8K A;  3GSG A;  4MLL A;  2IWB A;  2DRW A;  3N4I A;  3IWI A;  3ITA A;  5EUA A;  5FSR A;  3ZG5 A;  5HAR A;  2ZQ7 A;  3WS1 A;  5FAO A;  5CEC A;  1ES3 A;  1K25 A;  4S2J A;  1FCO A;  2Z2M B;  2XR0 A;  3A3I A;  4OQG A;  1L0G A;  3WS2 A;  5CHJ A;  2Y2N A;  3VP0 A;  2H0Y A;  2B5R A;  4Y0O A;  1ES5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...