1ZGDA

Chalcone reductase complexed with nadp+ at 1.7 angstrom resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
b'EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIELGLVTRDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVRKGASRGPNEVMENDMLKEIADAHGKSVAQISLRWLYEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKIAQIKQNRLIPGPTKPGLNDLYDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chalcone reductase
publication title Structural elucidation of chalcone reductase and implications for deoxychalcone biosynthesis
pubmed doi rcsb
source organism Medicago sativa
molecule tags Plant protein
total genus 99
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zgdA00
3DOPA 4DBWA 4JIHA 4JTRA 4AUBA 3BV7A 3U2CA 4MHBA 4Q3MA 3LENA 2A79A 3R7MA 2IS7A 3CASA 4PUUA 3H7UA 2PDFA 3C3UA 3LZ3A 2HE8A 4PR4A 5DANA 3O0KA 3UFYA 3V0UA 5HNUA 1HQTA 2IPGA 1YE6A 4QR6A 4XZLX 1AZ2A 3GHRA 4GABA 3ONCA 2ACRA 4WRHA 3NTYA 5M2FX 1Q13A 3R8HA 1GVEA 4I5XA 4XO6A 3BUVA 2INEA 1QRQA 2PDJA 3WG6A 4JQAA 1Z9AA 3LD5A 2DV0A 4JQ2A 1X96A 2IPJA 3GHUA 2BGSA 4LB3A 4XZNX 1ZGDA 2IPWA 2F38A 2FZ9A 1EL3A 2IKGA 3V0TA 1Q5MA 2PD9A 2PDGA 4LAZA 4JQ1A 3LEPA 3N2TA 2PDLA 4YVXA 2VDGA 5JH2A 5AZ0A 1S1PA 3V35A 3V0SA 2ALRA 3CMFA 4XZIA 1ADSA 5JH1A 1PZ1A 1MZRA 4G5DA 3R94A 3H4GA 3RX3A 4GA8A 3VXGA 3FX4A 2C91A 3UG8A 3M0IA 3BCJA 2ACQA 1M9HA 1IEIA 2BGQA 2FGBA 4PRRA 4PRTA 3LZ5A 4NKCA 3CV7A 2HV5A 1AH0A 2PEVA 2BP1A 4IJCA 1AH4A 2PDWA 4LB4A 1XJBA 1RY8A 1EF3A 4WDXA 2HVOA 3UZWA 3LN3A 1MRQA 4IJRA 4FALA 1IHIA 5LIUX 3V36A 3Q65A 3BURA 1S2CA 3N6QA 2NVDA 4FAMA 2PDMA 2IQ0A 1FRBA 1Z89A 1AFSA 2IKHA 4QBXA 2INZA 5LIWX 4EXAA 3UWEA 1US0A 4L1XA 3UZYA 2IKJA 2WZMA 1T40A 1A80A 4ICCX 4WDWA 2QXWA 1OG6A 4QX4A 2PDPA 1AH3A 1Z3NA 3LUTA 2FZ8A 4JIRA 4EXBA 2FZDA 1T41A 1X98A 2R24A 2WZTA 3GHTA 4HMNA 2IPFA 4GCAA 4F40A 4WEVX 3QKZA 4Q7BA 2P5NA 3MC5A 1PWLA 2R9RA 3GUGA 5AZ1A 4JTQA 3UGRA 2CLPA 4H7CA 3RX2A 4JTAA 1S1RA 3P2VA 4ASTA 3KRBA 2ACUA 3RX4A 3UYIA 3F7JA 4FA3A 1LWIA 4PUWA 2I17A 4IGSA 3Q67A 3EB3A 3R58A 1PYFA 1ZUAX 4ZFCA 2PDKA 3LNMA 4GIEA 1C9WA 1Z8AA 3DN5A 3EAUA 1AZ1A 5LIKX 1RY0A 1XGDA 4YVVA 1S2AA 4OTKA 1PWMA 2ISFA 2PDXA 1K8CA 2PDBA 4JQ3A 2IKIA 3CAQA 3R6IA 5HNTA 2IQDA 2HEJA 1JEZA 4LBRA 1YE4A 1J96A 3WBWA 2PF8A 4WGHA 3R8GA 4FZIA 4PMJA 1SM9A 3UZZA 4H8NA 1EKOA 2HE5A 4RPQA 3ERPA 4GQGA 4HBKA 4XZMX 3M64A 4JTCA 4LAUA 2FVLA 4R9OA 2DUXA 2PDUA 2PDHA 3GHSA 1UR3M 3R43A 4GQ0A 4WDUA 2NVCA 1X97A 1VBJA 4JTDA 2PDCA 3LQGA 2I16A 2PZNA 3FJNA 4YS1A 3H7RA 5KETA 4XO7A 2HVNA 3UZXA 4DZ5A 1QWKA 3WCZA 5HA7A 3T42A 3LBOA 5LIYX 4LBSA 2F2KA 3EB4A 4XVEA 2HDJA 4XAPA 2DUZA 2PDYA 5C7HA 3WBYA 5LIXX 1VP5A 4QXIA 1EXBA 1RALA 3O3RA 4XK2A 4XZHA 4DBUA 4YU1A 4GACA 3B3DA 3LQLA 3UP8A 1XF0A 1LQAA 4YVPA 3CV6A 1ZQ5A 1R38A 2AGTA 1MI3A 3D3FA 4L1WA 2FZBA 3COTA 1ZSXA 2PD5A 4DBSA 3MB9A 3G5EA 3CAVA 1YNPA 3S3GA 3G1RA 4XVDA 2ACSA 3M4HA 2PDIA 3WBXA 2PDQA 4WDTA 3ONBA 4JQ4A 1PZ0A 2J8TA 1YNQA 4JIIX 2PFHA 2PDNA 1HW6A
chains in the Genus database with same CATH superfamily
5D05A 3EWZA 4JIHA 1RBAA 4IT1A 4MZYA 4JY8A 1HN1A 3I7SA 2NUXA 1I2RA 2P53A 3IGSA 1DWGM 3S46A 3O9NA 3N17A 3ARPA 4M6QA 2HPMA 1EUAA 1HGYA 1AMYA 2QCMA 2ZWZA 3M0KA 2D23A 2JALA 4PUUA 4LS2A 1P48A 5A6SA 1KRBC 1W3IA 1SYTA 4JR5A 5SWUA 2YX0A 1AJZA 2WNWA 3QMSA 2GQ9A 3GLCA 3M41A 4O1CA 3ZFHA 3VIIA 2XHYA 1UKTA 4UCFA 3OZPA 1DJWA 4QE1A 2PU1A 1FHLA 3MSRA 1C7TA 4IIGA 1CNVA 4AMCA 3W75A 2YFOA 4DELA 2OQYA 3PG9A 4JX6A 5C7VA 1EP2A 2PRHA 3THUA 4ZB5A 4HP5A 2QUUA 3U8GA 2PRMA 1V3LA 3LD5A 4KMQA 1V6WA 1DIOA 3IV3A 4O8RA 5FJOA 2PF0A 3K1DA 1L6WA 2WVUA 4HTBA 4W88A 4Y9OA 3AYRA 1K02A 5EMLA 3N2CA 3OBKA 3T40A 1FDYA 3VD7A 5CQ1A 3NQGA 2PGEA 3L0GA 3ITLA 3KAOA 3VZYA 1IQ8A 1AMKA 1Q7ZA 5F7UA 1BAGA 5LNRA 2WM0A 1F8IA 3KVMA 3ES8A 1VF8A 3LBMA 3L4YA 3GKFA 5M1TA 3PZTA 1KBJA 4BS0A 4I8YA 4QEEA 5F2MA 3P3BA 3EKLA 3L2MA 3XISA 4IIEA 2F6KA 3W1AA 3CL6A 1OIFA 3M7SA 3M0IA 3S5SA 1SJDA 4X2RA 1QDSA 1I75A 3BXWA 4TOQA 3NYDA 1QPKA 4L80A 2XYLA 1ZCCA 7TIMA 4C1KA 3CV7A 2Z1WA 5AC7A 5H91A 5C8BB 3LGGA 5CZJA 1XYFA 4AIEA 3ZT5A 4AISA 1AJ2A 1UD2A 3GYEA 3I6RA 3OVPA 1FCUA 4RCXA 4V28A 5JUVA 3DFNA 1LG1A 3ICJA 5CCZA 6CGTA 2C3ZA 1G0CA 3PBYA 3SUWA 1ZJIA 4RX0A 4PMQA 1LOQA 3LTSA 4CQ9A 1UB3A 2SFPA 2O9TA 4Z1DA 3GBDA 1E6NA 4G7FA 3N1AA 4YHEA 4E3TA 1JUKA 4OT7A 1CXFA 4JAWA 4AFYA 3KOYA 3CQHA 4KEVA 3DYPA 3R2GA 2J78A 3GNPA 1XYBA 3KOWA 1RCOB 1JD9A 3K4DA 3C0JA 1XIDA 5CZKA 2F2HA 3O16A 1JD7A 1R3YA 2D1ZA 3E2VA 1RPXA 4A8RA 5E70A 8A3HA 5AYBA 2TMDA 5T26A 2CETA 2PC8A 4QG9A 4ZQCA 4L9XA 1OG6A 1IT0A 2J4GA 4NY2A 5TQLA 4Y8EA 4HPGA 2EAWA 2FZ8A 4ZQOA 4JIRA 1K8YA 2B7PA 4EE9A 5A8PA 1M1BA 3UXDA 4GQQA 2EJ1A 2GGGA 4KQNA 4S38A 4WEVX 4HU8A 2PWDA 4HHMA 3QV7A 3ABSA 3M44A 1CECA 4M80A 1TPFA 4IJBA 3GG0A 2VEKA 2GFTA 3PPCA 4XAFA 4Z0JA 4DO6A 4R27A 3W85A 3O07A 3WBAA 2VKZG 1PYMA 1WBHA 2GJRA 1TVPA 1LROA 1A4MA 1H1ZA 1SW7A 2XJ7A 1XBYA 2B31A 1XV8A 1PXGA 4ERGA 3A12A 3EB3A 2VGFA 1PB0A 1JVNA 1D8WA 4OHQA 3PULA 2Y24A 3W86A 2F9RA 3BCFA 5HMEA 1WXYA 5G1YA 2G37A 1KFJA 2NXIA 5RUBA 2ISFA 5HXMA 3NL5A 2FYMA 3MO7A 2BOFX 1CGWA 3FOKA 2PWGA 4ML4A 4QDPA 5FF0A 4PTNA 4WGHA 3R8GA 1E72M 3PBMA 1S5MA 1ONWA 3UWVA 1W5PA 3P0XA 4E3VA 4A2SA 1Q3NA 5H8PA 3BVJA 3NL2A 3O06A 1VRXA 2YCIX 4PUKA 2FGZA 1JGIA 3HN3A 3LMZA 4O4VA 4OKDA 3ERPA 3G77A 2DDXA 4B16A 1QNVA 3SRFA 4LAUA 3B40A 3BPWA 2DUXA 3QJAA 5TF0A 3ZSTA 3R43A 4Z1CA 3SCUA 2YSWA 4AVNA 3QOKA 1TV3A 5HMSA 3FS2A 4MAZA 1NDZA 1OFOA 1QR7A 4M82A 1Q6LA 4Z2JA 1U5VA 4DNMA 2XVLA 1F74A 3DGBA 4MPKA 1EIXA 4M7TA 3W01A 3BOLA 3UXLA 3GAYA 4AC1X 3OYXA 1FCBA 1ICQA 2X16A 1JCYA 3UCDA 3B0PA 1VP5A 3UG5A 2QJMA 1H1NA 4W85A 4ERIA 1A5BA 4JTUA 2ZZ2A 1EJSC 1E73M 4XKYB 3S2JA 1NIUA 3VUSA 4BI6A 2XIQA 5DBUA 3PBVA 2E77A 1T8XA 1VGAA 3SGUA 1UZ4A 4PUJA 1C8XA 1YNPA 4IFKA 4DPQA 3PC0A 3NQMA 1TPUA 4EAMA 3E2QA 3IGUA 3TFXA 2C6QA 3HF3A 1J79A 2OZTA 4H3DA 3VKCA 1LL6A 2CBJA 2L5HA 4D8LA 1FWBC 3L67A 2ZZ6A 4GKTA 4GJ1A 3GK0A 4DBWA 4M51A 3H2EA 4CKQA 1VRDA 2A0NA 1OC6A 1EP3A 4W4QA 4ONVA 1TX2A 2J24A 3UG4A 1N7KA 4MKNA 2DIJA 1IXNA 2CLFA 4IPJA 4HZ7A 4LNCA 3SIZA 4TMCA 2ISDA 2DJXA 1XFBA 3NQDA 1A5AA 1TRIA 2VRJA 5GJNA 3CK5A 2WZEA 3FA4A 1ML1A 2O7SA 4ACZA 4DX3A 4NSBA 5IRPA 4MWAE 4DHGA 3AS2A 3N9KA 4ZZ9A 4PN2A 4XD3A 3GC5A 4RZ5A 3ZJ8A 4WIWA 3RMEA 4AIBA 3HQPA 1VQTA 1YW1A 4AWEA 1GVRA 3K2GA 3M6YA 4M1RA 1EJXC 2DORA 1MEIA 1O60A 1I2QA 1ISYA 2XINA 2QCFA 4QTGA 2EPMX 1GYNA 3BGGA 4S2BA 1JXKA 3PHAA 3VIHA 3QMRA 1O5XA 3ARRA 5I6SA 4LB3A 1G4TA 4BHYA 3OLDA 5C2XA 4IUOA 3TJ4A 5D9OA 3PY2A 1U1UA 3HGOA 3QKEA 3VM5A 2A2IA 3UG3A 3LHZA 3NPWA 2FLIA 2H8XA 2BHZA 4LAZA 3FJ4A 4A3YA 3VDBA 4JL1A 4E8GA 4BQ2A 4F0KA 3ITVA 3G0SA 3FLUA 4UIOA 3FEQA 4UR7A 3L5MA 2E6YA 1L9WA 4PCPA 3LM3A 4ZSUA 3LK6A 3TA6A 3MMTA 3WNOA 3RMJA 1UWTA 5G1TA 4P8VA 1F9CA 3ES7A 5F1UA 1J9YA 2CHRA 3VKKA 4J3TA 1FWNA 2ACQA 2YXOA 2CLKA 3PUEA 3CPUA 4M1BA 1XIIA 3HG4A 5IBXA 4LVGA 2E7FA 2W27A 2OQLA 4C6EA 1E43A 4O16A 4CD5A 1A0DA 3E9AA 4MFDA 2O9PA 4HU0A 4O54A 2JF6A 2ZRWA 4MLRA 1XYAA 4F9JA 2JEPA 1ZBCA 1JI2A 1E56A 3VZZA 1TPDA 3V36A 3EA2A 3L12A 4L5ZA 4QISA 4CCEA 1TIMA 2OB3A 3OOQA 1UWRA 1L0PA 5GQBA 3DFSA 1KKRA 1GKRA 4TXEA 3T44A 3EWWA 2VTFA 1Y5VA 4E8CA 4UR8A 1PJ9A 3EOOA 2VT0A 4OUEA 2OYMA 4KETA 5A2AA 4ZO8A 3BK0A 3TWAA 2Q01A 3M5VA 5GPRA 1O1ZA 1VIZA 4D6CA 1XM3A 4C1NB 3MU7A 3EX3A 3ABXA 5HR7A 3U5YA 3BW4A 2DT2A 4AAJA 1W9XA 4O4WA 1CIUA 4HMNA 3PG8A 1H7RA 1K9DA 2DW6A 4F40A 3KOXA 2J47A 5G5IA 4CNSA 5I0DA 1FCQA 2PCQA 4KBXA 4ILSA 3GD6A 3MC5A 4NG3A 4BR1A 5K4ZA 1GOKA 1EC8A 4CU8A 1MNZA 1VJSA 1ENUA 5IHRA 3SR7A 3RX2A 1BG4A 3VABA 4IPPA 1UIPA 3S6DA 2BVDA 2REQB 4QS6A 3TLLA 1KQYA 1XLEA 5EMMA 1WXJA 4PSPA 1FBAA 3FVMA 3WJZA 3ZQ9A 2QV5A 2FQIA 1PYFA 1ZUAX 1WZKA 4OU1A 2BXZA 1LLZA 3DHUA 3DERA 2PTWA 5I03A 4YVVA 3UNTA 3L5AA 1JF5A 5DXYA 5JBEA 3FEMA 3DC0A 1OFAA 1PX3A 2OO6A 4HSHA 4NZ5A 4CD8A 2ZTKA 1VB9A 1MW0A 4JQ3A 2IXVA 3V3WA 3G1AA 5KSWA 3XIMA 2BY2A 1TVLA 2HEJA 4LBRA 1YE4A 1FWTA 3A23A 3URNA 1R9XA 1C9DA 7REQA 1Q6OA 3S9ZA 5E6YA 3UZJA 1TVNA 4L4PA 3MPGA 4X0NA 1S2VA 5BXTA 4GZIA 4C6JA 1YXYA 5A6KA 3G6LA 1GT8A 1JQXA 4H83A 4LUSB 3SY1A 1R46A 1BD0A 1W1ZA 4UC5A 2D69A 3GIPA 3AOFA 5G2HA 2FMNA 2ZC8A 2GJXB 2I16A 2QV4A 1EC9A 3CPRA 4MF4A 1TV8A 3TZFA 4LVDA 5A8NA 3PUGA 3HPFA 3GVGA 4IFOA 2WC4A 3E02A 4QQ3A 4O8AA 4AXKA 4S3FA 1ISWA 1TV5A 1D3GA 3FYOA 1R7AA 4RL3A 1XRVA 2JIEA 2WVTA 3RR1A 2NX1A 3QY6A 2J88A 3C4UA 1GONA 4KGJA 3B3DA 3EGJA 2XN2A 3JR2A 2CKRA 4YVPA 3CV6A 4GQRA 4OUIA 2XVGA 1KM1A 3D3FA 3IAPA 1OX5A 2H3DA 2CZVA 2RAGA 2E9LA 2FJKA 4UTLA 1VFOA 1W2VA 1M41A 3O15A 1CXLA 4D1JA 4IZGA 4KIRA 5CSUA 5D03A 1JCMP 3W27A 1NTHA 1O4UA 4Q7IA 3VNLA 3M0VA 2XU2A 4H9ZA 2YR1A 1UH3A 1GKPA 2G5WA 4N2YA 3HZ3A 2ZQ0A 3KUMA 4EP8C 2P8BA 1JPIA 3WL0A 1Q63A 1S3HA 3EOLA 3CUHA 5DCDA 3BQ5A 1UMYA 5MKGA 1Q7QA 3SRKA 4DB7A 2DQXA 4LCSA 4GNKB 5AYXA 2WMGA 2EGZA 2E1DA 1NQ6A 4H01A 3JZUA 4QS5A 3M9YA 2D22A 2XFWA 3G1HA 4JEJA 4L6DA 1BGAA 4G56A 4JTLA 4YIWA 1DVJA 3UWUA 8TIMA 3W02A 3PZIA 2POTA 4LF1A 3CQIA 4C6IA 3IPWA 4Y96A 5GNXA 2DZWA 2CKSA 4PRWA 3W29A 1UC5A 2J75A 1JRBA 4HCHA 2J7DA 1R9ZA 3K30A 4XO6A 1HL2A 4O19A 3JVAA 4UOJA 1BKHA 3PZUA 1UCWA 3UW6A 1XC6A 3SIMA 3R4IA 4JTFA 1TJ2A 2B7OA 3MW7A 3CM4A 3NXLA 1I2NA 3AO0A 2F38A 6ENLA 4RXFA 4U10A 3NOEA 3A24A 4PTDA 2Q02A 1AQ0A 1QUMA 4KW2A 3VGDA 3SUTA 4NXKA 3VUPA 3NZPA 1UD4A 1YDOA 3AUOA 5JH1A 4WSHA 3EDKA 4G5DA 3FSTA 2CZDA 2TAAA 3VXGA 3FJ6A 3W0KA 5DY3A 1AL8A 1L8PA 3PVFA 1E6RA 1UR1A 3ZLHA 4WCJA 4KGLA 4RXGA 3N4EA 3AIBA 1W56A 4HIBA 4LYKA 4UTTA 1P7TA 2Y85A 4HPJA 3GTIA 1WAUA 1F5ZA 4HJFA 1RLDA 1UMLA 1OSEA 3MUY1 3CHEA 2D24A 5ABEA 1OCNA 1XSJA 2QJGA 1Z48A 4NP7A 3P8JA 3GTXA 3TMQA 4JCLA 4KEUA 2ZCGA 4AIOA 3VGFA 3E0WA 3KFTA 1AFSA 1UYQA 3OW1A 1BYCA 5LNWA 4JTIA 1R3WA 2J7CA 2WANA 3QV6A 4IICA 1YLVA 4M29A 4EK7A 5CPOA 1JDFA 3H22A 1XISA 2I14A 3GDKA 3TE9A 3MQTA 3L2IA 1A80A 3RILA 3W2LA 4Z2KA 1EZWA 5FF2A 1WDPA 2A4AA 3A13A 3W82A 4MWAC 2FKPA 1K70A 1FWDC 1NP2A 3NPUA 2P76A 1SZFA 4JIEA 4YNGA 2VRKA 5BU6A 1AH3A 1QI5A 2Q6ZA 2Z2AA 3NFUA 2I1OA 4UTUA 2BY3A 1VEMA 1T41A 1W1IE 1AODA 1Y7VA 4NAFA 1WOAA 1IEWA 1PE1A 3RM8A 2YCEA 5H6HA 2RDXA 3NNTA 3L21A 2V5BA 1X7IA 2EO7A 3O05A 4UMAA 3WJYA 3MZNA 4AF0A 4NVTA 4RZBA 4MB3A 3RGTA 4D1IA 5DFAA 2V6AA 1UBPC 5E9AA 2PWUA 1TIWA 3VKJA 4OQVA 5EBAA 1B5TA 2FTWA 4W8BA 4JKKA 4DUOA 1X6UA 1G7VA 3W7RA 3N6JA 1GW9A 3LV6A 4X3ZA 3HTWA 1OB0A 1OFDA 2I17A 3Q67A 3WLIA 4AX7A 4EX4A 2NLIA 3N11A 1PIGA 2PSNA 1M6JA 4PCNA 3LS9A 5MF5A 1YDNA 2RFGA 4ZE4A 1HJQA 2QCNA 4Q4PA 4LAKA 4Y6GA 3O2LA 5CG7A 2VURA 2DIEA 2E5CA 1HL8A 3B0VC 3NZQA 3OQEA 1XUUA 1E5JA 2H6RA 2YXXA 4AHOA 2ZRZA 1CYGA 1E0WA 2J9XA 3EEGA 1CX9A 2UBPC 3G3DA 3CLWA 4ML9A 4HGXA 2X7VA 1T7LA 3OLIA 3W7EA 3HJEA 3AYSA 4FIRA 2H3BA 7XIMA 3HPZA 3UVIA 1R30A 1KFEA 4Z1BA 4AYGA 2V38A 3LI0A 3VX0A 3T6CA 2FFCA 4L9YA 1R3VA 1JPDX 2ZA1A 2Y7EA 3CV2A 2C16A 4Q4SA 3GDMA 4GG9A 5IDZA 2PZNA 2Q8LA 4DZAA 2J25A 3T07A 1VKFA 4H41A 3NWRA 3UZXA 4LYRA 3T42A 3IGXA 3VDAA 1R5YA 3S6TA 1BGGA 3R79A 1ZJAA 4FS9A 5I3IA 4ZL1A 4FOUA 2IXUA 1V7AA 2X41A 4X61A 5LXEA 5D4YA 2PDYA 1MVYA 2PGFA 3S1XA 2DPEA 2X7WA 1KFKA 3MMUA 3P67A 4NF7A 3BLKA 4IPLA 3BLLA 4URIA 4BF5A 3TX9A 2WKLA 1G4PA 2FB3A 5CPQA 3COTA 1G4EA 2BB0A 1ZSXA 1UD8A 4DJEC 4OECA 3R89A 1K9TA 2CBIA 2QIIA 4GJJA 1MW1A 3E1F1 4NYYA 3QY7A 4EWJA 3G5EA 3W38A 1J0JA 2H8ZA 4LAMA 4M24A 2ACSA 1GVYA 3WD0A 2PDIA 3AHZA 3S5YA 3UR8A 1VJZA 1ITUA 4MAVA 3CGTA 1SO3A 1UR0A 4TUFA 2JE8A 2CZ5A 1BWVA 5U4NA 2PDNA 4DYJA 3DOPA 2BBFA 1XYCA 3RNDA 4UFIA 1JPMA 3N14A 3K8KA 3TCSA 3WFZA 4AIUA 4M5PA 1CLKA 1PEZA 3TYAA 1ZCOA 3CS2A 5LSMA 2FHFA 4G7EA 5TIMA 2NT1A 1W5NA 2O4QA 3DX5A 5DANA 1GOQA 3P93A 1AL7A 4QAWA 1J8VA 2ANUA 3TYDA 3CWNA 1F73A 1LF1A 1VFMA 2IPGA 2YB4A 1WXZA 3B4YA 1SSGA 3AIQA 5ECUA 3QHNA 4AD3A 5C70A 1DIEA 2VC9A 4MLJA 3CNYA 1EXPA 3TCEA 1D8CA 1D7FA 1TWSA 2EXOA 1AW2A 4ATDA 1O94A 4QROA 1CGTA 3B8TA 3GE7A 4AWTA 1B2YA 3N4FA 4IQJA 2OEKA 1BG9A 4I7WA 3E5PA 1N8FA 4RDYA 1H51A 1KBIA 3T0CA 4LUJA 4D2JA 4PFMA 3TA9A 5HAOA 1E40A 2GWNA 1EP1A 1X1OA 1KLYA 2NV1A 3SQLA 5GJPA 3MKVA 3NQEA 2C0AA 3SCRA 3I6TA 4X22A 3R1ZA 4AZ5A 3HMCA 3RCNA 3AJ7A 3G18A 1E0XA 3MSGA 2G41A 1SPQA 1QFEA 3QM3A 4NX0A 1VAHA 2VYOA 4ROQA 4CN4A 2GGJA 4A3HA 3AU6A 1BLIA 1MUMA 5D02A 4C91A 2W5FA 3TJLA 3TJIA 3KL5A 3UT0A 3ITOA 4NJKA 1FWFC 3ITCA 3UU0A 2C8NA 2WJDA 3H4WA 4KWVA 1SGJA 2XIJA 5FOOA 3BCJA 2A3LA 3TKFA 3E0LA 2HISA 1MEHA 3RR4A 3O6DA 2FGBA 1S3TC 1E1CB 3TYZA 3GFXA 3AUJA 3WNNA 3V18A 3EKZA 2XFYA 4DXVA 2QJIA 4LY4A 2VEIA 3G24A 1AH0A 2DVTA 2BP1A 3UPWA 4EOUA 5JBFA 3QW4B 5AHFA 1KCXA 1JFXA 1UH2A 3CZJA 2QLYA 3MVTA 5T9BG 2E09A 5A5WA 4D72A 4XD4A 3N6QA 4O28A 2X30A 3TYBA 5TD4A 1EJUC 2YCKX 4PTVA 1DWAM 4YPJA 5EFDA 3UWZA 3DENA 3GO2A 2OT0A 3H8AA 2C1GA 1EBGA 2V67A 4YL2A 2P0OA 2F8QA 3WMBA 3MSYA 2PPGA 3IUHA 3HPXA 4N0RA 2I9UA 4O10A 2QDDA 3UGVA 1XINA 1TMLA 3WK0A 3TN3A 2VC7A 3A4XA 1AW5A 4HT3A 3U6WA 3KRZA 1UPMB 3RK8A 3EXSA 3QYQA 4JFVA 1NU5A 4IX2A 1W91A 4XKYA 1EQCA 1EJWC 4MKVA 1B3XA 2NWSA 2ABBA 3B8WA 3CUGA 1LQ2A 4B3LA 3OLGA 2Z7KA 3GNNA 3H2FA 3WDPP 3B9OA 1H7PA 3DC8A 2XVPA 2FZMA 1KGWA 1NF0A 3UVAA 4AD4A 1RCQA 4IL0A 3WDQA 3A9BA 1Q6GA 3CC1A 1S1RA 3N25A 3N13A 3L4UA 2ACUA 1C8VA 4QDMA 3TTQA 4F2TA 4D6EA 2WPGA 2BXYA 4U3AA 3A9IA 5M3WA 3VDCA 1XIHA 2VI0A 5HWNA 3NQCA 3EXTA 3KLKA 4HD5A 4JHZA 3ISIX 5AHIA 3ANVA 3M5ZA 1WDDA 3KOFA 5D9MA 1EYEA 3T4CA 4ENLA 5HQMA 1BEUA 1QNOA 4J1OA 3OODA 2ICSA 4L4OA 3K1GA 4K8HA 1KGUA 1JCLA 1RVKA 3VKBA 4XBKA 1S5VA 2IMRA 1RP9A 2VCCA 4C6LA 4FZIA 1TUXA 2ZWYA 6REQA 3UA4A 4Q8TA 3U2ZA 4NZJA 5IXEA 4FP1A 2GJNA 1EKOA 1XLAA 3QC0A 3VYLA 4XD6A 4HOWA 1POJA 4O1FA 5CAKA 4I9MA 4QGCA 4AYSA 4E2VA 2FVLA 1OGGA 2G3MA 2ZUMA 1JZ5A 1K4GA 4QLLA 2NVCA 4WDUA 4CD4A 1J2BA 3F2BA 1XDLA 1P1MA 1W8GA 2TYSA 4PODA 3W4RA 4ZXOA 1RJRA 4MOZA 4ICNA 1DORA 3GUWA 1MSSA 2VR2A 2RDUA 2ODOA 5K2ZA 4EF8A 2YCLA 4XWUA 2W9MA 3R25A 4J2MA 1WCGA 3SQMA 1CB2A 5HA7A 1MDRA 3T4WA 2VXNA 3AHXA 3ZIZA 1QWGA 1WUFA 4CD7A 1K7XA 1MO0A 1EX1A 3MV01 4MMWA 2NSXA 4XVEA 2HDJA 3FK4A 3THQA 3W7LA 4QCEA 1S46A 1VEOA 3PZMA 2VEGA 4O17A 3WBYA 3LPOA 3ZWSA 4Z1AA 3LQLA 3NM1A 3ABZA 3V5OA 4HMEA 4GI6A 1FWJC 5D8ZA 3SCNA 3AWNA 3W22A 2HBXA 4H7VA 4AXNA 2ISVA 3E6EA 1DHPA 2YDAA 3NDOA 3EWCA 3V5FA 3K8LA 4XVDA 4PA8A 3A64A 3SCWA 1PCKA 3KRUA 5C71A 5FJUA 1DWJM 3F4DA 4GNJA 2PZ0A 1M04A 3WMSA 1I2OA 4H9XA 1DE6A 5DT5A 1M65A 1E6SM 3AZTA 3NZGA 1VJIA 4UB9A 3H2OA 3LG3A 2Y8KA 4PSRA 3AJXA 3PFMA 4EIVA 1V6UA 2XFRA 1VCFA 2H9AB 1E6QM 1W5OA 2UWFA 3CASA 2IW0A 3R0KA 3K5XA 4WQ6A 1DWIM 1KM4A 1NY1A 2FHBA 4GGHA 2NX3A 2QCLA 4TX9A 1LUCA 1CI1A 3V0UA 1ZJBA 3I10A 3VKAA 1XWYA 3NEHA 4IPNB 3F5LA 4POCA 2XWDA 4F2UA 3FV9A 2BHYA 1BPLB 1JZ4A 8RUCA 3THAA 4JTGA 2HNEA 5K7JA 1BF2A 4Q22A 4DBDA 4BWLA 2Z24A 1SW0A 4LUTA 4H6QA 3ZR5A 4IP5A 1ZHAA 3VU2A 4M3PA 4JNYA 4C6DA 2GUBA 3EXRA 1O5KA 3UY7A 3WSUA 1X96A 1L6GA 4BKNA 3WK1A 3EPMA 2QPSA 2VFHA 1PIFA 1ZGDA 3W9ZA 3ABRA 3WNMA 1X1NA 2YW4A 3N34A 2REQA 1UWIA 4JTJA 1K9EA 4M8UA 1O68A 5A6JA 1JCTA 4B5VA 1E0TA 4UFKA 3AMGA 2RH9A 1OY0A 2KX9A 3RUBL 4YVXA 5AZ0A 1I60A 2DZBA 3VIJA 4PUNA 5EMKA 1ZBVA 1R0MA 1PX4A 1IZKA 3VD3A 2B7QA 1S39A 4QLKA 4NX5A 2R82A 5CG0A 5DMMA 1ONEA 2F61A 3AU2A 5CPSA 3U48A 3UG8A 4LS1A 4MVAA 2OCZA 5I09A 2EHHA 1YX1A 5CSSA 2WC7A 4CN1A 3C56A 3AXMA 2QZRA 1UKQA 3ATYA 1Q65A 3W7GA 2HV5A 1BYAA 1PBGA 3PPHA 3SCPA 3GNRA 1KCLA 4DWSC 4H9VA 1IGSA 4WD0A 4P8WA 3BAYA 5K4XA 3T0BA 4JOMA 1XIMA 2W67A 1FFRA 1W1TA 1O6IA 4AZ6A 3OZYA 1KXVA 2PDMA 1KC7A 1CXIA 4FX6M 3OVGA 4CD6A 4MJ2A 2ATMA 5LIWX 4HHHA 5A8GA 4U2ZA 2GGEA 1OYCA 2C1IA 5ECVA 3RJYA 1A5SA 4MFEA 1VPXA 3NGJA 1XGZA 1K8XA 4W7VA 2Y8UA 2QXWA 3TW9A 3OG2A 1RAKA 1I8JA 4KRZA 2HZGA 1LOLA 3P74A 1SVDA 2EG7A 4H9YA 2FMOA 1ECEA 1QBAA 5C9XA 4GO9A 4J5NA 4DY1A 3TK7A 1HFBA 3GHTA 2G3IA 3QY8A 4UTIA 1TWZA 5BZAA 5IHSA 2VDHA 2Y8VA 3C2YA 2PTZA 3FHAA 5K9CA 4FK9A 1XGEA 5DO8A 4JTQA 5T9CE 2PB1A 2D20A 3GNOA 3P2VA 3VK5A 2V5CA 5GVJA 1AW1A 3KRBA 3F7JA 3LCFA 2WPBA 3WF2A 1XRFA 1LWIA 1IE7C 3QTPA 4LY8A 3ARVA 2GDVA 2YIHA 3I6EA 4RK8A 4HYVA 2WAGA 4WF7A 3S2NA 1QI2A 1F3WA 1K9FA 3EAUA 3PZGA 1C8QA 2VR4A 1S5NA 4JNMA 1OABA 2Y5SA 1F6YA 3M16A 5KTLA 5DXXA 4KRUA 1K8CA 1W1YA 3TROA 2OJPA 3NA8A 3NIYA 4GKLA 2W66A 1B4KA 2IQTA 4ZOCA 3F03K 2BVWA 1XRTA 4UTJA 4JS3A 1F3EA 1GEQA 2DZXA 3KP1A 3NSNA 3GRIA 4B90A 1QU4A 3LX9A 5T8GA 1F8MA 1HO1A 5B80A 1SM9A 4OVXA 3NL6A 2BOGX 2CBUA 1CBGA 4BF9A 2XSAA 3SO7A 4RW3A 3CH9A 2NLYA 3W74A 4B5UA 4NI3A 4IIHA 1CGVA 2PDUA 1POKA 3GIQA 4V27A 1W3TA 4OOZA 3KHDA 3TN4A 4JTDA 1J6PA 2DVUA 4HZ8A 1WDSA 3TR2A 4O52A 5EKYA 4DXKA 3CEUA 1F6PA 3EMCA 3UR2A 1V3KA 3ZO9A 5HUOA 1C90A 1RBLA 4DZ5A 1EA0A 1QT1A 1VYSX 1HKWA 4ATLA 3CTTA 1XQLA 4I6VA 4JFUA 2BS9A 4B5NA 2WQPA 2DUZA 2YOCA 3CLMA 3WFAA 5KZEA 4M6PA 4YLWA 4DWDA 1GQKA 4B91A 2A7RA 2VWSA 3OIHA 2WVVB 3PANA 2ZC1A 1ADDA 2Y7DA 2DZSA 3I7QA 2VOTA 5D9PA 1NFGA 3MJMA 1QI0A 4W8AA 1E9IA 3MTWA 3U9IA 3IAQA 4U28A 5J04A 3EPNA 2WYSA 5HULA 2VOMA 3ANUA 2Z1SA 1UJPA 4B9ZA 1PVNA 4P8UA 3S5OA 3WJXA 3M4HA 3H2MA 1QXLA 4KWUA 3QPEA 3CXOA 3PWGA 2WMKA 3SY5A 1E5NA 5HQEA 2FJUB 4UFHA 2YBUA 2GVEA 2QF7A 3WEMA 4M6VA 3VTRA 1L2QA 5AHMA 3WQDA 3UCCA 3RM4A 1XIFA 4PEKA 2QIWA 3S1VA 4IP4A 5BOEA 2PP1A 3UERA 4U5KA 3IJDA 3H7UA 2PDFA 3D3AA 3MKKA 5I23A 1VBRA 3RF9A 4DJDC 3L2LA 4NZ4A 3O0KA 1EIBA 2A3EA 4QJ1A 4AVOA 4QSFA 4AY7A 4AW7A 5EL1A 3U7BA 4F0HA 2WW5A 4RZ4A 4KH2A 3KCOA 3B8IA 4AZBA 3Q45A 1CDGA 1WDWA 1AZ2A 5BOOA 3MS8A 4X9SA 3GNDA 2BLEA 4GZJA 1OEPA 3N2XA 5I79A 4WOQA 5I77A 1VHNA 3KS5A 2ZRXA 4HVXA 1V0MA 3E96A 3W6MA 3M0LA 3DFQA 8XIAA 1Z9AA 2GGHA 5G4HC 4F0MA 4ACZB 3F4WA 4H4IA 1UWAA 2IPJA 4WOZA 3W26A 1Y5XA 5BXPA 3M6DA 1KR1A 1OGBA 1X8FA 3MI3A 2YKKA 2IPWA 4XKMA 1MNSA 2A5HA 4PBEA 1DE5A 2IKGA 3V0TA 4D6DA 1LWHA 1YTKA 4AQLA 3W2UA 1EDTA 2UY5A 1Q8JA 1CZ1A 1TR1A 1NSJA 3PNZA 1OWQA 4IXXA 4GX9A 1ECQA 2DSVA 5E0CA 2DSZA 1WA3A 4AD1A 2GJPA 2GSHA 4G1NA 1RUSA 7CGTA 4J4KA 1RD6A 3CTLA 1PAMA 4PUEA 1IEIA 2BGQA 2FGLA 2BV9A 3A4AA 1A53A 4DUWA 4KKXA 3O6CA 5CXPA 4GQBA 4ZMGA 3FFSA 4UZSA 1K7FA 1K1DA 3PTQA 2WKGA 1KW1A 3T1GA 3RFAA 2VNCA 3UZWA 1RH9A 4TIMA 5BXRA 4HNNA 4A4AA 5LIUX 1RD5A 4BK9A 3DXIA 4BF7A 5CPTA 5LNUA 3LPFA 4HU3A 3SUSA 1R87A 3RRAA 3FKKA 2XH7A 3TOPA 1MUWA 1US3A 4A8IA 4C7FA 1XLJA 1KM0A 4NRSA 2VZSA 3GVVA 3AI0A 1B9ZA 2AMXA 2Y5EA 1M3UA 3SUUA 1G01A 3EX6A 1BSIA 2OT1A 4AEEA 3WL1A 4NZ1A 4I8DA 3QSTA 5F2IA 3MYPA 1CWYA 3LXCA 4CNNA 5IDIA 1ZALA 1J12A 2WSYA 4J9JA 4EVZA 3G22A 3LMYA 1EH9A 1XCXA 3N2BA 3H6OA 4KS0A 3R11A 5MHBA 1U83A 1B57A 3C3NA 3HQ1A 1JZ2A 3FCPA 1UP3A 1US2A 1DJZA 2V2CA 1PV8A 1L6SA 3INPA 1G6CA 2YL6A 1H41A 2BNJA 5FAGA 4BI7A 1U1JA 4ECLA 1ZL1A 2BG5A 3C2FA 4JN7A 2WSQA 4K6AA 3WJSA 3PSVA 1IYXA 3W7CA 4TVDA 2DT0A 4I9AA 2YA1A 4JTAA 2GVYA 1PPIA 3WK3A 4XISA 4ASTA 3T81A 2YZRA 1QHPA 2BODX 1RLCL 1VFLA 4KFOA 5I7GA 4YYCA 2ASHA 1BVZA 3UQNA 4CVUA 4HB7A 1L6YA 1E9ZB 1B4EA 3BGAA 1ONXA 1SFLA 1OCJA 2FVKA 1FKWA 4EAYA 5E0KA 1AA1B 2NQJA 2DY3A 1EBHA 4XZBA 3BC9A 1MDLA 2DSKA 3P60A 3WYZA 4NNBA 1GK8A 2RJGA 5E1QA 4XAGA 2PWFA 3SDOA 4M56A 2P3EA 1IR1A 3AIVA 3BMXA 4XUYA 1XD0A 4LYPA 3B8UA 3VNZA 3I3DA 2PWVA 4IOTA 1RVGA 4IMAA 1WP6A 5C5YA 2NQHA 3B8SA 4R9OA 3T09A 1NF7A 1GQJA 3WH5A 1LJYA 1XIJA 4NL1A 1K77A 3LYEA 3MDWA 3S83A 4TX6A 3HG2A 2OOGA 5FJJA 5CPMA 3SI9A 2YFNA 2TODA 3GZ3A 4XO7A 3OA5A 1JDAA 3PN8A 2O4MA 1X39A 4YWIA 3LCWA 2DZVA 3RG6A 1Y0EA 1PDYA 1M7XA 4GJIA 3NXFA 1J0ZA 1BHGA 5C7HA 2ZZ4A 5C2GA 5CBIA 1OHLA 1NAL1 1ZAIA 4XK2A 4CCZA 2PP3A 4PTMA 3H26A 4RJEA 4AEFA 1Q6EA 4P7QA 1QHOA 1U33A 3M5XA 4ZCWA 3O0FA 4IM4A 2ZXQA 4EF9A 1MI3A 4NI8A 3URAA 4DI9A 1S2TA 4V33A 2Q09A 1GVQA 4NZCA 2OQHA 1ODZA 3ZM8A 2HK0A 3QSRA 1OX6A 1UC4A 4WUIA 4NQ1A 2FPTA 1YPXA 5LA1A 5DT7A 1DHKA 3OEXA 3ZVIA 3ONBA 1EWDA 3AS0A 3KHJA 1EJVC 1QMLA 3FYYA 3BANA 3C0QA 4WJEA 2PLMA 4AZHA 4XG1A 1LDCA 3U2CA 5LHFA 5FF4A 4ADSA 1RQHA 3R7MA 4CQDA 2E0PA 2VX7A 1HVQA 3UJRA 2BOEX 1O66A 2AGKA 2HE8A 3EA3A 1BRLA 3POHA 3QV9A 1E70M 5HNUA 4C6MA 4Z42C 2VD8A 3MKCA 5MKGB 1F6KA 2WJZA 1RQBA 2AL2A 1TJ0A 3BMWA 3B04A 4O1DA 3TAOA 5T91A 1HKIA 2D3NA 1U5HA 3GDTA 3SN4A 2CNCA 4F66A 3GB6A 1A4LA 3SCOA 2RHGA 1QRQA 1TSIA 2GGIA 4FXFA 3WG6A 2ZRYA 4RZ6A 2VZTA 1YNYA 4L9ZA 3UBPC 2I57A 1MW2A 4UNIA 4PBFA 4O14A 4H00A 4PGLA 1GYMA 4CUCA 1ZPTA 1QASA 3OG3A 2KAUC 3CUFA 2GSEA 1DQWA 3TW7A 5DMYA 3GR4A 5FSDC 1QOPA 1O1HA 2X1TA 2QEZA 2C1HA 3FY1A 4F8XA 5HWJA 2VDGA 4JIPA 4LUIA 2E25A 4XBJA 5AC4A 3TTYA 4HA0A 3VE7A 1KD0A 4LRSA 3WEOA 1TMQA 1RQEA 3RX3A 2ZA3A 3FX4A 4JIQA 3ARUA 1E71M 4TU1A 2OPJA 2J7GA 2Y5JA 4GFIA 1ICSA 3DHPA 1VEPA 1QK2A 3DECA 3AISA 1Q4NX 1B9BA 4G8TA 4J3UA 4UQCA 1PTDA 1CLVA 2DZTA 4MGGA 1JULA 3TC3A 3WD3A 1AH4A 4Y8FA 1OK6A 3LCHA 3IACA 5K9XA 5HATA 1OC5A 3BJTA 3CHVA 3I7RA 5JBDA 2QMKA 4W8LA 3MBFA 5A95A 2JIWA 4UFJA 4AH7A 1HTIA 1S2CA 4GYKA 4M7SA 5C0QA 4FOJA 3G3MA 3L4ZA 1P7TB 2P88A 2GPTA 3KX6A 2VDIA 3VNMA 1H2JA 1VS1A 3WD1A 5I2UA 3IVTA 2YB1A 4EXAA 1JUBA 4NJGA 3MP3A 3UWYA 1GZ1A 4R33A 4S3BA 1Y65A 3VI2A 4HZ6A 4IL2A 3WF1A 2DUAA 1MW3A 4MY9A 2PWHA 2EPNA 3W71A 4PMZA 4Y9AA 1MRAA 3LUTA 3EDEA 1KLZA 4HQVA 3TQKA 3SECA 3NO3A 5ABHA 1X38A 1H3GA 3UA3A 4O0KA 4C6QA 2V2HA 4N4QA 1WKFA 3OQ8A 2VHLA 4R7JA 3C52A 3WLTA 1E6PA 4J35A 2OO0A 1JZ7A 4LX4A 3BSMA 3C8NA 4GZEA 3P5YA 4Q33A 5BMWA 3DG7A 5FACA 2PLKA 2R9RA 1A5OC 3LGDA 2WSKA 2X42A 3PTDA 2G95A 4H7CA 4CQCA 1HP4A 1VFFA 1ZY9A 3BZGA 3V5CA 3UF9A 4IGSA 1XYMA 4AF0B 3YPIA 6ALDA 2OX1A 4GUIA 3VGEA 1P0KA 5LIKX 3U4FA 4KRTA 3OPSA 3VOFA 5LA2A 1OVDA 4Y9MA 4ALDA 2BDQA 3S1UA 3TXVA 3PAJA 6XIMA 4W5UA 5AB3A 4PCTA 4PMOA 2IKIA 4MB5A 3WQPA 1ITCA 1XPGA 3UETA 5H8MA 3WF3A 4YTSA 1WX0A 2WWCA 4WLCA 1V6TA 1S2UA 1SSDA 4Q8WA 2B0MA 1VCVA 2HSAA 3OHMB 1ZP4A 2MANA 5CPNA 2WCGA 1FXPA 2R94A 1TKKA 4GNVA 4MJMA 1HZYA 1IEVA 3GW3A 1OJXA 4S3JA 3QTGA 3ITXA 4ZTXA 4A8NA 1KM3A 4GIAA 1KGXA 1SQ7A 5KZMA 4MWAD 3DAQA 2PDCA 1DBTA 3XINA 2OSYA 5CLWA 2DH3A 3WFLA 1YKWA 5M5DA 1W6TA 1J5SA 4U4MA 2TPSA 2V3FA 2FPYA 4DF0A 2W3ZA 1E51A 1KWGA 2OSWA 3VOHA 6A3HA 1OADA 5A69A 3WH6A 4TQTA 4HYRA 4JKMA 3GDBA 2J79A 4DIAA 1MYRA 2Z1VA 3N19B 2NUWA 3ARQA 3AYVA 4IF2A 3G0XA 1IXOA 3PFRA 2QUNA 4JZ5A 4MNMA 3APTA 3E38A 1YDVA 3AC0A 1IZCA 2DZUA 2WKJA 3P6LA 1XKYA 2J9YA 2VD9A 2RKXA 4AZGA 3VIPA 2OWCA 1FTXA 2EJAA 2PDQA 1LT8A 4GYPC 4FNQA 3DU0A 4HHPA 3AHVA 1TZ9A 2G4FA 4WXYA 5E93A 1V02A 1VC4A 2GOUA 3OA3A 4A05A 2X1IA 4EXQA 1UROA 1QPOA 2P8CA 3BAIA 3ARSA 3GNXA 3AMDA 1FWWA 4PR4A 3M0MA 1ME7A 1SFTA 4JN8A 5M03A 4BEUA 3NDYA 1BYBA 5IFPA 3OVQA 4A2RA 1P0EA 4CU6A 4FB7A 4GRSA 2O55A 1SO5A 3VFLA 4IQEA 1DQUA 3UEQA 1GOOA 2HXTA 5D2VA 3C5QA 3LLXA 4DAIA 3WDJA 1Q8AA 3QR1A 2AQOA 2WJFA 4G7EB 1IV8A 3TYEA 4N9CA 4ZB2A 3PJXA 3N73A 4W93A 3GC2A 4U3CA 4I5XA 1ZAHA 3KCJA 5E0FA 1T5AA 1DJGA 2CESA 1T0OA 1BVNP 4H2CA 4FMVA 4KERA 1BF6A 1TCMA 2OZ0A 4E2DA 2PCEA 3FIGA 3IUDA 2P50A 4W5ZA 1UR2A 3QGVA 4HHLA 4WSKA 4JICA 5ABGA 4BQ5A 1IIGA 3CHFA 3AICA 1Q45A 1JCJA 3N3MA 2PGWA 4FNTA 5A8QA 1KV5A 3IWPA 4HCLA 1RA0A 3KZSA 4LC8A 3TSDA 1IR2A 2ZDSA 4KPLA 2OWXA 4K1WA 4FNPA 1ZP3A 1H49A 1XLDA 1ZBWA 4JX4A 3CMFA 4DJED 2C79A 3R94A 4L56A 4TO8A 1FWSA 2W6RA 4GA8A 4ZGYA 4H9UA 2W0UA 2D3LA 1RCXB 1TTJA 1XP3A 2J7FA 4L6OA 3TDFA 3T8LA 3IIXA 3PP7A 3N9RA 5FESA 4CNOA 1NM9A 5I5RA 2PLCA 1JCXA 4MG4A 3KBVA 5PTDA 1Q2RA 3H70A 3IIZA 1GGOA 3W37A 3ZXWA 4AC7C 4HNUA 5I00A 3W7OA 4Z08A 3GTNA 2Y2WA 2YYTA 3CB3A 3IGHX 1R3SA 2Z00A 3L0NA 1RY8A 4WY0B 4MWAA 2OLHA 4H6EA 2Z1BA 3S9IA 1XH1A 3LN3A 1MRQA 3TVAA 4IJRA 2ISWA 3EX2A 1TPC1 4S3EA 1IGWA 4Y9NA 1IEQA 1JYVA 4RR4A 1ELSA 1V02E 4IHCA 1P0BA 5A6AA 3LCXA 1SO6A 2HVMA 4H6KA 5FIPA 4YCPA 1Z89A 2XH4A 1KQZA 1XHGA 3UJEA 3UYCA 2X1SA 5C2CA 2RDTA 2RGLA 5G2IA 1WQ5A 1XIGA 2V30A 5EB8A 2CLIA 1MZHA 1DJHA 3WLRA 2ZYFA 2ISSA 3VNJA 3W24A 3KWXA 4DF2A 4QQUA 1M7JA 2YBTA 1TQJA 2BY0A 2FH8A 2PGRA 3MCMA 1TTQA 2WVVA 2Z27A 1V3HA 3EWDA 2W62A 1VIWA 4TVCA 3GXTA 1VH7A 4C7GA 3H24A 4K2SA 1DYSA 2DW7A 2XUCA 4AMAA 1IF2A 2GWGA 4MNKA 2VJXA 1VFUA 3CQKA 1TCDA 3EX4A 4K37A 4GYFA 4H1ZA 3PUOA 4YJ5A 2EPOA 1FWIC 4GE8A 5F2GA 4PYSA 5FD0A 3NOYA 2VCBA 1W3KA 2DVXA 1SO4A 4GVGA 1A3WA 3LPGA 1EUNA 4Q4KA 1XCFA 1BQCA 4FF7A 2X2YA 5CJNA 1N82A 4FSAA 3CBWA 4R9XA 4DN1A 1E6ZA 1KTNA 4K7VA 2PWEA 3B9NA 2CERA 4P7OA 3K8MA 1VPYA 1XGDA 4I90A 1BFNA 3F1QA 4FNSA 4Q4OA 1VD6A 2CCRA 4HK6A 1MEWA 1TPWA 3ABQA 2NXHA 3WDIA 3W7NA 1D2KA 1TPH1 4P61A 3GM8A 4MIMA 1J2WA 5HNTA 1UOZA 1K6WA 1B31A 3QMTA 3G1DA 1GQNA 6PTDA 4KT2A 3GY1A 4E2BA 3FJLA 3STFA 4RE3A 4D9PA 1H7OA 1VFHA 2W92A 3T0TA 1UA7A 3GH7A 7ENLA 2VGIA 3ORWA 2JEQA 3N15A 1FP9A 4C6PA 3W70A 1C91A 3G1YA 6REQB 1I1WA 2FB2A 3W72A 3KBSA 4HOXA 4FXRA 2JKEA 4DJEA 3REQA 1FA2A 1GJPA 1QWKA 3WCZA 3WLPA 2GL5A 4AG0A 3NVDA 4UQEA 1JJKA 2XM1A 1VLIA 1QPQA 3ZWTA 3TNOA 4QHRA 3A22A 5LIXX 1Z69A 3P81A 4QJ4B 4U33A 1V6XA 3RPMA 5A6LA 3IK2A 3DUGA 1T6MA 1UASA 1XF0A 4NJJA 1LQAA 1ODUA 3O63A 2YCLB 4H19A 1KM5A 5J5RA 4IWWA 4MYXA 4CCCA 3R5EA 3KRSA 3VE9A 3P61A 4L64A 4GI9A 1OD0A 1OF8A 1RBOB 3DGRA 1P0NA 2EQDA 3QF0A 2ZE0A 4HCDA 1UUOA 4W7WA 3A4WA 1ICPA 1UD6A 4UMBA 4AX6A 3C0LA 1NEYA 2E28A 2ZX6A 3RDKA 4YTRA 3M0JA 4J3SA 3OO2A 4NJHA 4JL2A 3NQ8A 3JS3A 4I6KA 1V79A 2E6AA 3IJ9A 3SADA 1KXHA 3ZR6A 1BXBA 1R2SA 3LLDA 4IQLA 2WNZA 1HUVA 2DP3A 3FGCA 1PKYA 2ZKMX 3NURA 2P1FA 5I3GA 4AZ7A 4J3WA 1IWAA 5AC5A 2EPLX 4D6JA 2CW6A 2J7BA 5F4WA 2ZE3A 4A22A 2QCHA 1OINA 4GXPA 1OZMA 3RRXA 2VUYA 3WDHA 5DN1A 3ITYA 1KFBA 1V51A 1BTCA 3MA8A 1TX0A 3UXKA 3W28A 5LNVA 1LUCB 3CEPA 3BO9A 1EJ7L 2R1MA 2DV0A 5C9WA 1FH9A 1GQIA 1YDYA 5I3KA 2DIKA 2I5IA 3K13A 3KVKA 3WLQA 4UCGA 5A8MA 3KW3A 2VL4A 1JR1A 2F6XA 3H12A 3TAKA 1A3HA 4R88A 4LUTB 8XIMA 4UTWC 4PL1A 1IZJA 1OCBA 4N4PA 1A50A 4HPNA 3MYOA 4Q32A 3ZR4A 4YXGA 2R8WA 4D6GA 3CIWA 3WKZA 2I5GA 2O56A 1W3NA 4KFNA 1EB3A 3N2TA 4KCTA 1H61A 2WMIA 1JL8A 1R9YA 1EWEA 1YBQA 3E2SA 1S2WA 3B0YA 3R13A 3CU2A 4G1KA 3G1FA 4CNPA 1G1YA 4YTQA 1R3QA 2QHAA 5JVLA 1W9DM 3AXXA 5H1WA 1UJQA 3NG3A 4OFCA 3P62A 5A8OA 3UJFA 5I3JA 3BAJA 4YYFA 3QZEA 3O6AA 1J4EA 1EDQA 4P7LA 2WHKA 3LZ5A 4J28A 3VD5A 2B4GA 1PKNA 4OBSA 2J6VA 4B3KA 1V93A 3U7VA 4GVIA 4RE2A 4A35A 4ZBCA 1LM1A 4F2BA 3W7IA 5A3HA 2I9EA 5CZSA 2WMFA 2YLAA 3HV9A 3SBFA 4XAYA 4K3ZA 5FKYA 1VBHA 3GIYA 3BURA 2EBNA 3GSMA 3ZS4A 1XLIA 1WKDA 2RDWA 1ISZA 5FJPA 3QH2A 2X2GA 3T9PA 4QBXA 1LRTA 3QXBA 4O1AA 4HA1A 4LSBA 2ZICA 4JTEA 1OFPA 3OIXA 1KR0A 4JTTA 4F3HA 5A1AA 3S42A 4L7ZA 4DO4A 3WZ0E 3S2CA 4GH1A 1V3IA 2HTMA 3W1PA 1Q6CA 3M47A 1M53A 3QBUA 4LEFA 3TYCA 2QJJA 3LBCA 1KFWA 3I4EA 4MUPA 1TG7A 4GX8A 1EF2A 4ROPA 4IIBA 3TTSA 4P5UA 3T2OA 1TE1A 4DO5A 2XVKA 3R8RA 4NT0A 2Q8XA 2JFEX 1H5YA 4UZUA 3WLJA 4G6CA 1VZWA 3TOYA 3HQNA 4U31A 2VELA 1GG0A 4PMNA 2CHNA 1C92A 1X8CA 2PA6A 3MMDA 2V5LA 1OYAA 4FR1A 1GVSA 3H21A 1W5MA 3ZLFA 1UR8A 4MUZA 5E09A 4Z0SA 3ZJKA 1W8SA 1FVPA 3DBNA 2VRQA 4PMRA 1AUSL 4FA3A 4H8UA 2R1KA 1E3ZA 1J5TA 1RK6A 1LBLA 5FJRA 4B5WA 1FWCC 4ZFCA 1GUVA 3GXFA 4L4LA 2JBMA 1K4HA 3OGSA 3W23A 1VLWA 4JNZA 3MP4A 1EZ2A 3BJSA 2ZFAA 2WO5A 5DCBA 5TAOA 1LWJA 4FLRA 1KV8A 1CGXA 1W54A 3UPBA 3CUIA 4DWSD 2LLEA 1NDYA 3MZ2A 3QQ0A 3W53A 4NIRA 3EKGA 3AIRA 3CAQA 3R6IA 1H0IA 2GVLA 1XLCA 1BTMA 3WBWA 4DAFA 4Y7EA 1F76A 2XG9A 2WLZA 3HMJG 4HNOA 4RDVA 1F61A 3NPVA 2NQZA 3LHUA 4BCEA 1O12A 2XIMA 4KEMA 4JHOA 1F2JA 3W7MA 3FSUA 3B06A 3BL3A 4Q8NA 1F4AA 1ISXA 2ZX8A 3RPDA 1W1PA 5AHLA 1A5KC 1V0NA 1UWUA 3FN9A 3W1RA 5EA9A 1K8ZA 3ZJ6A 1V0KA 3SJ3A 3ZSSA 1J0YA 5CSRA 4DM2A 3RO8A 2Q71A 2VFIA 3VGGA 1OX4A 1J93A 4DZIA 1WB0A 1NWUA 2YZ5A 4QLJA 2F2KA 1H1YA 1JG9A 1FP8A 2VZOA 3CUZA 3QVQA 4XAPA 4O11A 1QPRA 2Q8ZA 5L9FA 3A3XA 1EXBA 1P6BA 1RZMA 4OWGA 1WAWA 1YADA 2RUSA 2O9RA 4GACA 1ISVA 1XXXA 5G4WA 4MKSA 1GORA 3CQ0A 3ENLA 1FFQA 1RK5A 1PS9A 4ZOBA 3WQGA 4MDPA 1QVBA 1O95A 1IEXA 1QI4A 2X05A 1TJ1A 3AFBA 1XL9A 4XD5A 4O53A 2F7FA 2PD5A 3MB9A 3AQUA 1PTGA 2PU0A 3JU2A 1B54A 1NWRA 1QBBA 2DU2A 4X60A 1ALDA 1GQLA 3E0FA 3APGA 3B9AA 4ZQPA 1IWPA 1BXCA 2Z1KA 3TP4A 3NQVA 1S5TA 1ZFJA 2ZX7A 4MHBA 3LCLA 4ZQMA 1T99A 3W1TA 2DZPA 1W31A 3LENA 3LI1A 3Q2DA 5HMDA 5EY5A 2QUTA 2IS7A 1V4YA 3DFOA 4PZVA 5AECA 1R47A 3M7WA 3BJFA 1QW7A 3BAKA 1SJBA 4C5ZA 1PHWA 4QR6A 3W88A 4XZLX 5CJ5A 3M0HA 2ZZ7A 5FEPA 2G96A 3CHDA 5FL1A 5D2TA 3LA4A 3WDRA 4O15A 3CWOX 3RCYA 3D5HA 4NJIA 1Q13A 1GVEA 3W1NA 3EOUA 3PWAA 3FKRA 4J7RA 3W2KA 2VFDA 2YDRA 3EEZA 4WKAA 1HXJA 1R8LA 4F79A 2QAFA 5FEWA 3EDDA 3QR0A 4WX2A 4CU7A 4O50A 2QQ6A 2WZHA 4MB1A 2QGHA 3SFKA 2XSXA 1F4HA 3F5KA 3OU8A 3TQVA 4RV8A 4M0XA 3SB0A 3KBJA 2ZRUA 4BY3A 4ICMA 3EOEA 3KTXA 3MY9A 2UY2A 3U5UA 1OFEA 4DWSA 4IMDA 3ZVHA 2CHOA 1HJWA 2A3AA 2X40A 4QG6A 3GWQA 3W73A 4UNLA 4QDWA 3B0UX 1X6NA 5DEZA 5ENLA 3L65A 1HL9A 2ZUUA 4NAEA 4BQ3A 3AHYA 3GQYA 3F4NA 3O7UA 1Q2SA 1UKPA 1GG1A 3S1GA 3HURA 1E15A 3S4TA 4Q8UA 2QUVA 3WMLA 9XIMA 3APYA 5KITA 2VZUA 5I3FA 1XC4A 1U30A 2PDWA 3BAXA 3VOCA 3BLOA 1PIIA 2V68A 1EF3A 2GSJA 3HG3A 2HVOA 1EC7A 1D3CA 1XYLA 3SGGA 3I65A 3ZT6A 4DJDD 3FXYA 2YCJA 5A94A 1XLHA 2NVDA 3PTKA 2OTDA 3TSMA 2QW5A 4HJWA 1F3XA 2YGYA 4EANA 3H55A 1FRBA 5KINA 1NARA 5REQA 5CC5A 1LL7A 1H63A 3BOFA 4RNFA 4I5RA 2HBVA 3B4UA 3SN1A 3UWEA 3ITGA 2E67A 2Z28A 3GAKA 2WOQA 1ME9A 3CJPA 4L1XA 3UZYA 2WZMA 2G4JA 4WHBA 4LRTA 3N12A 4MNLA 4B5TA 4Q6JA 5IFTA 2VWTA 5BRBA 4MTVA 3VCCA 5D2XA 3N3TA 2JGQA 1W1B1 3BLIA 3CMJA 2HK1A 2DGAA 3HOJA 3I4KA 1M7PA 1K6AA 1MUCA 4W9TA 3LSBA 2V3EA 2ZADA 5AOUA 3BG3A 4ERAA 4DXXA 5JXQA 1KA9F 2OR2A 4R3UA 5CAHA 1TWIA 2ZUWA 5AVNA 4HNVA 3GUGA 3ME3A 2AMGA 3FAXA 3WQVA 3I3EA 5DQPA 3AMKA 3UGRA 1Q85A 3USZA 2WBKA 4E4UA 2GYIA 3PAOA 1GJWA 3SCQA 2A7NA 3OBAA 4S3AA 2E40A 3NL3A 3VIFA 4UBPC 3CZLA 3V1PA 1BQGA 5JQ9A 2YA0A 4TX8A 2DJLA 3W07A 3HM7A 2QT3A 2XN1A 4PUMA 1G5AA 4M81A 4FX7A 3CYJA 2PDKA 5A6TC 5G4EA 2YA2A 2VFGA 1KRCC 4PCSA 6TIMA 4I7UA 5ABTA 1VBUA 3WBEA 4PULA 4O12A 2WJEA 4IGNA 1LZOA 2BZNA 4AD2A 4OTKA 1PWMA 2OEJA 5TBOA 5J5DA 4XX6A 1KBLA 4FNUA 4TV5A 4OBRA 2PDBA 3CUXA 4H8VA 1RA5A 1HF6A 2V5JA 3F5JA 1EEPA 2IQDA 3VAVA 2NW0A 4G2DA 3BDKA 4XSMA 3U2OA 2OWWA 4QITA 3S2MA 3QOMA 1V7YA 4PMJA 3MV11 3SAZA 3UZZA 1LLOA 3K4AA 3W1MA 5BWAA 3C6CA 4O18A 3STEA 4XZMX 1X7FA 2QYGA 4DEFA 2QNEA 2PLJA 1WDRA 3AZRA 1R3TA 4OOUA 2CZFA 2EF9A 3TV8A 4HA3A 1CXEA 3LQGA 1B3VA 3CO4A 1ONRA 4MB4A 2HWGA 3UD6A 3IV8A 3RO6A 2ZRVA 3H7RA 5D30A 4GWEA 4TTGA 5LNSA 2WNQA 4AZCB 4NNAA 4DNHA 5DBTA 4B4HA 3GFYA 3V75A 1KBBA 1LP6A 4LBSA 5LIYX 1Y8BA 1G67A 1UP0A 1FQ0A 1H60A 4JPGA 2XPKA 4XZHA 3T0AA 3DG6A 1LYXA 2ZBTA 4FF5A 3SN0A 4W86A 3FAWA 4O0ZA 3DHFA 1W2PA 4J2PA 4QEHA 2AOSA 1H4PA 3WEZA 1XQKA 1TYGA 3KVLA 5EMUA 5AVHA 1GZGA 2VP8A 4AY8A 4REQA 5BCAA 3S0CA 3MCOA 3MDUA 4DJDA 1M68A 4HTYA 1GCYA 4GUJA 3C86A 3MWCA 1H5VA 1KNWA 2EEXA 4WY0A 4AWUA 5XIAA 3PPGA 4JN6A 2WMHA 4JTRA 2DT1A 1OYBA 1GKQA 1OT1A 1P0DA 4HMCA 3DKLA 1W37A 4R34A 3ARWA 4GO8A 3KTSA 4LAOA 2CBVA 3S8HA 2Y88A 4H6RA 4K68A 4F4RA 2KZHA 4ZSTA 4WK9A 3LRMA 1N8WA 3PZVA 3UY8A 3KP0A 5EFFA 4AU0A 1NFPA 4KESA 4B4FA 4N6FA 4GFSA 5CSYA 3DG3A 4BJHA 3GHRA 3R12A 1JXJA 4WGXA 5EYWA 3VOIA 2XIBA 1UQYA 3NTYA 2ZZ1A 3HIJA 1EDGA 4I5UA 3KVJA 1BRLB 3WD2A 1WUEA 3CHCA 1GTEA 3JUGA 4E38A 1FHVA 3CAKA 1SMDA 1R6WA 3WUFA 2OXNA 5C9UA 2W79A 3HQOA 1TUFA 1UH4A 2BGSA 4B15A 2AL2B 3F4CA 4UTKA 4XZNX 4DVOA 1WZLA 3FYPA 3AMLA 1TB3A 3MBDA 4LYQA 2Y0FA 1EL3A 1E0VA 2AQVA 4R7WA 2AKZA 3DDMA 4UQ9A 3VNIA 5C9RA 3IIOA 5A2CA 3ID7A 3LEPA 1HIZA 2QMJA 1HVXA 3HG5A 3STCA 4HSOA 4B5XA 1XLGA 1XPYA 4XZIA 4PMUA 1NDVA 1PZ1A 3GTFA 3OZOA 2NSOA 1QOQA 2D0GA 3F2CA 3CIXA 5D8WA 3W7DA 4CGTA 2AQWA 5HPCA 4JTHA 5D2WA 3WQ5A 4S23A 4CCDA 4QSHA 3GXMA 3WLSA 1GEHA 4PRTA 4PUDA 3IJ6A 3ARTA 3M0YA 3NQ7A 2F84A 3BLFA 3MUZ1 2GVJA 4PEEA 3L7RA 4GPNA 1B3WA 3B9DA 4A29A 3VGBA 4IG2A 1TRDA 4FEZA 2J74A 1ZJHA 1KO0A 3I3BA 4NILA 3H23A 1JZ6A 1V77A 4FALA 2OOFA 4I9TA 4GBDA 1CTNA 3H53A 4O0QA 5DY2A 2Y63A 4NASA 1YRRA 3NAVA 1EGZA 1E3XA 2Z6IA 1ADOA 1A0CA 3ALGA 2AL1A 2A3HA 1B90A 3RYSA 2DZAA 3OYZA 1H11A 4IP7A 4F9DA 4K39A 2RJHA 5F2LA 1W9PA 1EX5A 2ZUTA 4MY1A 3HPAA 3VD4A 2QKFA 3MUAA 3MP5A 4N9BA 4WJ8A 3KM8A 3VDGA 2WSRA 3W25A 4DJFC 2WHLA 3TUUA 2NWRA 3IANA 3NO5A 4UUIA 1CCWB 4EXBA 1X98A 4DRSA 3QGKC 3HGSA 3KE0A 1U2YA 4LVBA 3G8EA 4PH6A 4C65A 4KCWA 4JGDA 1NVMA 4HOZA 1DQXA 1TPVA 3TONA 3TH6A 3TC6A 1DIKA 2NVAA 1XFCA 4HZMA 1A5UA 1XBZA 1TREA 2J66A 3A21A 3EWYA 3RX4A 4KWOA 2E9MA 4V2XA 1TA3A 2XGIA 2HJPA 5AHEA 5G1MA 1XD1A 3T2QA 4HKPA 4DQWA 3ANYA 3QPYA 5BMXA 1PUDA 1FWRA 2YBVA 1SFSA 4QCFA 5GNZA 3H7VA 3SRHA 2HNHA 4GOAA 2OKTA 1W9UA 3WELA 2YXGA 3ELFA 2EPKX 1NH6A 2E1WA 3VD9A 4KFPA 3BV4A 2E9BA 3NQ6A 3KEHA 1AQFA 2GDQA 1LOSA 3URBA 3CUJA 4Q7NA 4E8DA 3NQ2A 4TR9A 5HJYA 4A6GA 2QCCA 4A3QA 4H8NA 4GY1A 2EG8A 4ZENA 1H7NA 4AHQA 2A1YA 4Z2HA 4JCMA 2J7HA 3D0CA 3R10A 4PFHA 4GQ0A 3VFCA 2PUZA 1KRMA 3HBLA 3BG9A 1DJXA 1ZTVA 2GK1B 3W7KA 1V08A 4GUFA 1EPXA 1G4SA 1IIHA 1C93A 4JFSA 4TMBA 4FXSA 2Z7GA 3EOSA 4JTKA 1I9CB 5C54A 4DLFA 3RITA 1YIXA 2PTDA 1LORA 1PL9A 4H8HA 3K4WA 4NZ3A 4DZHA 3O3RA 4H9TA 2E6FA 3HO8A 3PZNA 5BYWA 3AROA 2E3ZA 1D7KA 1R38A 3IJ8A 5CC6A 2FZBA 1UZHA 4JY9A 3B03A 5I02A 4YMZA 1Z7AA 1ZENA 4R5EA 3T0DA 2VFEA 3SJNA 4C6BA 2CLMA 3W1UA 2OLSA 3WQ8A 1UBSA 1IXPA 1OFBA 4Q4QA 3QW3A 3OHIA 1BSLA 5E9XA 2XSBA 3PZ9A 2ZZ3A 3IJQA 3NQBA 2Y4SA 2ZA2A 2R1LA 4GINA 1JNEA 4N9EA 5BU9A 1HKMA 1XI3A 4Q3MA 1PKLA 4DO7A 4WY0F 5TNVA 5D09A 2AAMA 3WNLA 1UOKA 3G6MA 3GG7A 4X63A 1I2PA 2ATSA 2HCVA 5HJXA 2ZUSA 3UFYA 1NP0A 2VR5A 3AWOA 4D6IA 2C19A 3C61A 4H9MA 1PTAA 3IIVA 1ZS2A 4FLOA 3EBVA 2BSLA 2VUNA 2WC3A 2D2GA 3UR5A 4XV0A 4EKJA 4MJ4A 3RAOA 4NU7A 1NQKA 3FHQA 4GI8A 4WSJA 1QATA 4NXSA 1A49A 1G7UA 2NV2A 1W0MA 2WXDM 1KRAC 2INEA 2FHCA 1CB7B 1UQZA 3WLLA 4JQAA 4DF1A 3TR9A 2VX6A 3K46A 5AN7A 3NPXA 1F3TA 3MANA 3GHUA 3TIMA 1G9HA 5LHEA 1IWBA 5K9DA 3OJGA 1VHCA 1XCWA 3F4VA 1FY6A 4GC4A 1E1EA 1F05A 3STGA 3QQWA 4FO4A 2D0FA 3LY0A 2GOKA 1NDWA 2BTMA 4YWSA 2PDGA 3DH7A 2JQXA 4IIFA 4PMVA 4JQ1A 3W2NA 3TTEA 3GVQA 3A4JA 4W7UA 4GK8A 1W3LA 3H2AA 1HKVA 3IRSA 3MUCA 4DM1A 2ALRA 4G9PA 3V7PA 3L23A 2FPVA 1ADSA 1QNPA 3RLGA 2XZ9A 1PZ3A 2JKPA 1XX1A 4ORMA 1ZLPA 3A6OA 1UR4A 3AXHA 1RR2A 4HMDA 4QNEA 3HFTA 4US5D 3H2CA 5FL0A 3N04A 1XLFA 3F2DA 1KXTA 1QNRA 4ZTYA 2X0SA 4QE4A 3PBGA 3UCQA 3ARXA 3WLMA 1LCOA 2POZA 5JMUA 5AY7A 1MMFA 2PBOA 4LBUA 1EO5A 1GPFA 1BVWA 4FIQA 1C29A 1IXQA 1JGMA 2Z25A 4IJCA 3G1SA 3GFZA 4GXWA 2XISA 4LB4A 2QPUA 3SRDA 3URQA 3PJUA 1XJBA 4QRNA 5A6BD 4J40A 3HB9A 1KB3A 4IMGA 3KBNA 1IHIA 4RW5A 4WKFA 2ZDRA 4KEZA 3WQFA 1OZQA 2ZUNA 2VVSA 4GZ7A 3N18A 4FAMA 2Y7FA 5CC3A 2XN0A 2ADAA 5DLCA 5HJLA 3TWBA 2V5DA 3LPPA 2HQAA 3TJXA 3WMCA 1QW9A 3N9SA 2INZA 2CC0A 2BXVA 1US0A 5A2BA 4MWAB 4E4PA 1N55A 3BARA 9CGTA 2VMFA 2CLHA 3RLVA 3N2OA 3OP2A 3J7HA 1WNOA 1CW2A 4C90A 4ICCX 4GISA 3OB8A 4UFMA 1E55A 3G8RA 4IPIA 4XB3A 3VDHA 2A6NA 1KBKA 4WKHA 4GBUA 3LM7A 2FZDA 1MFUA 1AG1O 3W3OA 3AYTA 4OV4A 3DFPA 1V03A 1J11A 2YL9A 2X1RA 3N29A 3UESA 5HANA 2VQTA 1WE5A 1JCNA 3GS6A 1A5CA 4S2CA 4U5IA 1E9YB 3SSZA 3QZ6A 5F4SA 3BAWA 3E2RA 4WJXA 4XIAA 3UYIA 2NQ5A 2WNNA 1EO7A 2G3JA 3GR8A 3GVWA 3DHDA 4AD0A 2A6LA 2XH2A 1DIDA 2CITA 4K1GA 1Q4WA 4JFWA 1NOWA 3VX1A 4E4FA 4XUGA 1TV7A 3M5YA 3L9CA 3QLLA 3LNMA 2BVYA 3RPTA 3LNPA 3QRHA 3A47A 2J62A 1RY0A 4ZO7A 1KCZA 5FAJA 2CYGA 1MWOA 1JFHA 1YQ2A 5EPDA 3MHUA 2NUYA 4XTIA 3S2LA 2PDXA 5AC8A 4DUVA 4IX0A 3NM3A 4ACYA 3BLPX 4IXHA 2XTKA 4LS0A 2C14A 3DI0A 3RN6A 4JD4A 1E4NA 2XFFA 3GW0A 4XAZA 4NRRA 2PF8A 4O1BA 3NQFA 3P14A 3NSMA 1NFBA 3I68A 1AD1A 2EKCA 3RXZA 2BWGA 3UR7A 2HE5A 2VX4A 1K3UA 1HG3A 3V1HA 1HJSA 2VFFA 4AWSA 4HBKA 2FTPA 4BI5A 2E6DA 3VMOA 3SCVA 4JTCA 2VEPA 2PDHA 1OCQA 1FWHC 3DBPA 1P5BA 2Z4GA 4GC3A 5U7SA 2J7EA 1N2VA 4N9DA 3WO8A 2TRSA 4NUWA 3MT1A 2FVMA 2WHMA 4BEQA 1UIOA 1SMAA 3AS3A 3QPZA 4KCUA 4LVAA 2YJQA 1DTUA 2HVNA 1RPKA 4YHGA 3LBOA 4MNJA 1UA3A 3USBA 4JTSA 1MXDA 3P80A 4RNHA 3EB4A 2ZVRA 4K8GA 4US5A 1XICA 2J8GA 4GYPA 2OVLA 1Q6RA 1FDJA 2PS2A 2PMQA 3L4VA 1R86A 3GU1A 4HU4A 3EMQA 3TN6A 3H2NA 1BWKA 3REQB 7ODCA 4YN5A 3FDKA 4LJ3A 5HR6A 3P8IA 1CT5A 5BRPA 3CT2A 1FXQA 1QJWA 2ZX9A 3CO8A 3THDA 3FA3A 3B05A 4WZHA 5A6BA 4ZODA 2PODA 3TQPA 2CLLA 1QHZA 1QAPA 2BVTA 3KL0A 3VOGA 1PZ0A 3FNDA 3AIEA 5LKYA 1TR9A 3LHVA 4I9JA 7TAAA 4AEOA 3EWBX 1XLKA 4F0LA 1Z41A 3ALFA 3PS7A 3ITTA 2WMJA 2YDQA 2P10A 4IMCA 1NOFA 2OSXA 3B8DA 2BHUA 3BLDA 4QJ5B 2VEFA 1IT8A 1SZRA 5AC6A 3VGHA 4LW7A 3GXPA 1JYXA 3BICA 1WZAA 4LALA 5I06A 1BXNA 3OZMA 3D47A 1FKXA 1H7WA 2ON3A 1GWJA 2PBGA 4CEUC 1P6CA 3IJ7A 3WQEA 1OQFA 1LG2A 3W1XA 3GC4A 2Z2UA 2X8RA 1DJNA 1QTWA 1WKEA 3B9EA 3LSCA 4WRHA 1MQPA 4PB3A 1UZ1A 3FGCB 5LYRA 3R8HA 1EYWA 4EPDC 3UXIA 2NZLA 1W1A1 5DF0A 3PZOA 1GVFA 4K38A 4JQ2A 3RJXA 1E4MM 3CQJA 2JKAA 2GQ8A 1GOIA 2OGYA 4IFRA 3T08A 2UY4A 3AZSA 3UJSA 1LRNA 4LV9A 2FZ9A 4GMEA 1XH0A 2YLLA 1EFZA 5HNNA 3LLFA 3SCSA 1Q5MA 2G8ZA 1QOXA 4K8EA 3L5LA 4W87A 3V16A 3OBEA 1B30A 3AIUA 3AXIA 3VO0A 4OIFA 3ABOA 2B7NA 3V35A 2A3CA 3QFEA 2OX4A 2DT3A 3BQ6A 3MMWA 1TTIA 4PB4A 4LH8A 1GOWA 2J9ZA 4Q6XA 3S47A 2CFFA 2PRLA 2XIOA 2B81A 3BMVA 1GPWA 1VCGA 1L6FA 1UR9A 3L4TA 3G0UA 1GNXA 1M9HA 3JW7A 1XKJA 4H7ZA 3EDJA 4V15A 2E8ZA 2WMIB 3Q94A 1YBQB 2QUMA 3NQAA 3KTCA 1VYRA 3HFYA 4KIEA 2NT0A 1KKOA 3VA8A 2PEVA 2RGMA 2CPUA 3H4XA 1YEYA 3O1NA 4XZ9A 2WCAA 2V0TA 2R1NA 2Q3OA 3GH5A 2HS8A 3WLOA 2V63A 2GLKA 2W4XA 3LHWA 4DYEA 1CEOA 2O7QA 1NWTA 1HJUA 4ZVJA 5CGMA 1KM2A 5CJMA 4W84A 3LTPA 2VENA 4LVFA 2CWXA 1XRSA 3C2VA 2VQUA 5IBXC 1RXOB 1GVOA 4ZQRA 5CBBA 2UY3A 4C60A 1DJIA 4AZCA 1O7AA 4UTFA 1LQ0A 4ADTA 4FHAA 2G50A 4HNCA 2J77A 4FNRA 3TYUA 1TWWA 4JKLA 3L4WA 2IUZA 2W91A 1V8EA 4QX4A 2PDPA 1XR2A 4A3UA 5FJIA 4ZFMA 3QFWA 5D37A 2HMCA 1TV2A 1Z44A 2ZUVA 3LRLA 4RUBA 2VX5A 4KWSA 3SCTA 1PZ2A 1S5WA 2R24A 3TN5A 3VCRA 4AB4A 4KF1A 1V0LA 1KFLA 3PF3A 3SW6A 1SFJA 1V5XA 1EGVA 1QPNA 1JZ3A 3HU7A 3PM6A 1J18A 4LFYA 1JDEA 3HA1A 2VCAA 3QGAC 5AZ1A 2VGBA 4PL2A 4IQDA 2HS6A 1LRQA 3AIWA 1OFRA 4MADA 2C0HA 3W87A 4RE0A 4UOQA 4XTDA 3VIMA 5JIWA 2YW3A 4JYFA 4X9YA 4PUWA 4O13A 3BSHA 3M1ZA 1KWKA 3ARYA 4MY8A 1QCWA 2V5KA 3R58A 5HINA 4RV3A 4ZOAA 4LQ1A 2NQ9A 1I1XA 5CBJA 3DI1A 3MI6A 1C9WA 3KBMA 4QIUA 2W63A 4B5SA 2YYUA 4IISA 2OMAA 2JF7A 3SQSA 1M01A 3BW3A 3GBEA 3HJZA 3IJLA 4ADUA 3KDOA 2WM1A 1KXQA 2UV8G 3PK7A 1UP2A 5BRQA 2MNRA 3DFYA 3TEVA 2FH6A 3TC7A 1DWHM 4GY7A 4S1FA 3CAWA 3E3HA 3LCIA 1EHAA 2OZ8A 3VC6A 2R6OA 1KTCA 3Q58A 5BOFA 3S5ZA 3KXQA 4C6CA 4RPQA 1LBFA 2C15A 2ZXBA 3E12A 5B7YA 3G1VA 3CZKA 2X09A 1UUQA 5CZTA 3EDFA 1W17A 2V3GA 4O57A 1X97A 1FDZA 1XBXA 4TV6A 4E2OA 4FOKA 2BX7A 1T8QA 5CKSA 2QF8A 1OT2A 1OBAA 1W1VA 3OGRA 3UXAA 3VCNA 4ZOEA 4D71A 1MFVA 5CGTA 1OK4A 2OELA 4UXDA 5KETA 2E4TA 3NYZA 2C71A 1JQVA 4PE8A 5FA5A 2HRWA 3MUIA 2OU4A 3HPSA 5D9NA 1FOBA 4GUHA 2QCDB 1AQMA 1RP8A 2XH0A 1Q7MA 4DBUA 3EMZA 4FPSA 2I56A 1WDQA 1UG6A 3D46A 3W81A 1IT7A 1OX4B 2Y62A 3WH7A 2Z0IA 3O8AA 4LUYA 4IGMA 1DKWA 4A3RA 3BLEA 4DBSA 2QJHA 3JZEA 3WQCA 2XVNA 1Z42A 4Y90A 3PBUA 2XGBA 3WBXA 3FW6A 4HN8A 2INFA 2G3NA 4CVWA 4GD0A 3GTHA 4V1YA 2J8TA 4JIIX 5LXXA 1DXFA 3GU2A 3FDGA 4OGZA 4R85A 3WUEA 5FJTA 1J6OA 3RU8X 4LCRA 3DFHA 4WVXA 3PR2A 3U0HA 1DJYA 3LRKA 3TQ0A 1D9EA 2QCGA 1WV2A 3SY8A 1DXIA 1UD3A 1XH2A 4S3DA 2Z6JA 1ITQA 5LZLA 1EA9C 3LZ3A 4RLIA 1KM6A 4QAIA 4NZFA 3NVTA 4J3VA 1J01A 1HQTA 1G69A 4UWMA 5ABFB 5I3HA 2J27A 1EPVA 5CGQA 1A5LC 4UTWA 4UR9A 2OEMA 4Y9PA 4WXZA 3WN6A 1REQB 5BWFA 4P7RA 3QC3A 4NHVA 3CWHA 3QYSA 1X1ZA 4GABA 1TZZA 3ONCA 2ACRA 3GH4A 5DCEA 3V4BA 3L66A 4CLMA 4WR3A 3VNYA 2Q3RA 4NNCA 1AJ0A 3BUVA 3EPOA 3W1LA 2VZVA 1V3JA 3DESA 2VVNA 3DZ1A 5A6MA 5EMJA 2PURA 1WPCA 2QDEA 3MSDA 5DMLA 4JDBA 5DRCA 2Y6ZA 3O6YX 2V69A 2D2OA 2V81A 4LU0A 5FI8A 4HN4A 3CIVA 4F0RA 3HV8A 2J13A 4LCQA 4Q8PA 2OYLA 2GZXA 4AHPA 2D0HA 4FXJA 1XDJA 3M07A 2PDLA 3S6OA 3MJYA 3ZT7A 3WF4A 2ZTJA 4GI4A 3V0SA 1P4CA 1RV8A 3T55A 4LV4A 1DWFM 1OGSA 3MUXA 3W7HA 3H4GA 4HNLA 4Q4MA 4QFUA 2C13A 1SW3A 3PB0A 3DYMA 1YTEA 4ZXLA 3RIKA 3GDLA 5I07A 4LGXA 2DFAA 2BFGA 1F7BA 3ARZA 4DWSB 3ZVHB 5I78A 4FI4A 5C55A 1SZNA 3C2EA 3GXIA 1XLLA 2PTXA 4RE4A 4UQBA 2OFJA 1LT7A 1XIEA 3LDVA 2VM8A 2QAPA 1VFSA 4GIRA 1YMYA 4UOZA 4NAEB 3P82A 4QJ3B 1VBGA 2I7GA 5HDRA 3CL8A 2PE4A 4BZYA 3Q65A 1E6XM 1ZNNA 3TNBA 4B92A 1ESWA 5AKQA 2ZXDA 1DPMA 2GK1A 3BTNA 2ABAA 4UMCA 1JDCA 2IKHA 4C1NA 3IEBA 3WQ4A 1A0EA 1H7XA 3VIGA 4AZIA 1ME8A 4UTTC 2CWNA 1UKSA 2BGNE 1OD8A 2E5DA 1TPEA 3GYCA 3CPGA 3LXAA 2YL5A 3BW2A 1B3YA 2WLYA 1JAEA 4WDWA 3A5VA 1HJXA 2J8FA 4OV9A 4RDZA 1DOSA 4A21A 1Z3NA 1N8IA 3WIJA 3W7PA 3LV5A 5REQB 1I0DA 1NELA 1I0BA 3LHYA 2WVSA 4PTXA 2ONEA 3W1QA 2V2DA 4I3GA 3SEPA 2HPIA 1SU5A 5FF7A 1QO5A 4J3XA 3ZZ1A 1G94A 3CZ8A 2OYKA 1HP5A 4CN6A 1QNSA 5KZ6A 2P5NA 3MO4A 3SURA 3E49A 1PWLA 3STPA 3KDNA 3IUIA 2GDUA 2VC6A 3GX9A 3VINA 4ZA0A 1YHTA 1EHNA 3KOZA 1I6NA 4LWWA 1OC7A 4EPKA 3W2MA 1PCWA 4DLMA 4EACA 3GXDA 2D73A 1P6WA 2NV9A 4LPCA 1SJAA 2D2JA 4US6A 3GDRA 3NJ3A 4N6EA 3A3HA 4IGHA 3SGZA 3E74A 3LCGA 3JRKA 1C3FA 1B1YA 3IARA 4GHRA 1JNDA 4L4MA 3T05A 4GIEA 2OODA 2ZXAA 4M19A 5HMFA 3E0VA 4MM1A 1GYLA 4HSNA 1Q6DA 4RKAA 2OG9A 3AS1A 3NUKA 9XIAA 2R91A 4GGBA 3AMCA 2ZZ5A 1TTPA 5DMNA 3Q37A 1O5QA 4H04A 3BGJA 1TE6A 1WZMA 3KLLA 4TVUA 4R53A 4H2HA 5HUPA 3L0KA 1JYNA 1E1FA 4EPBC 3U57A 2Z29A 3WUGA 2X1UA 4XQ6A 4LUSA 5I24A 3MI2A 4Z17A 1J10A 3G2GA 1L8NA 4K36A 2GJXA 2G0WA 1TELA 5FEXA 4ZR8A 3SM0A 2DH2A 3LB0A 1R2TA 4KWWA 4GQGA 1AVAA 4AVFA 1M03A 2BY1A 4RNJA 3WQOA 2O0TA 2Z2BA 3ECQA 1MQQA 5HBFA 3CV1A 3CYVA 1FHUA 4B3ZA 5IM51 3SSJA 5CLTA 4C6NA 4RNIA 5HWMA 4YS1A 4XSLA 1SJCA 1HT6A 3B0XA 1J0HA 5EBUA 1XBVA 4JDYA 3P7YA 3QN3A 1W3HA 2W61A 4ORIA 4IH3A 1A5NC 1FH8A 5HOSA 1W32A 4DYKA 3WQ6A 3BOXA 4IMFA 1RALA 1B3OA 3U3HA 4K7YA 4Y2WA 3ZMRA 3UP8A 1FH7A 4YTUA 5E6ZA 1I4NA 1FCVA 2ZVIA 4L1WA 2QDHA 1QK0A 1UZDA 1ZAJA 1LLWA 2A21A 3VIOA 4QM1A 1D3HA 5IOBA 3S3GA 1TZ7A 4D8ZA 4L6HA