1ZGDA

Chalcone reductase complexed with nadp+ at 1.7 angstrom resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIELGLVTRDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVRKGASRGPNEVMENDMLKEIADAHGKSVAQISLRWLYEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKIAQIKQNRLIPGPTKPGLNDLYDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chalcone reductase
publication title Structural elucidation of chalcone reductase and implications for deoxychalcone biosynthesis
pubmed doi rcsb
source organism Medicago sativa
molecule tags Plant protein
total genus 99
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zgdA00
1PWLA 1ZUAX 4WEVX 3BURA 2AGTA 2PDXA 1X98A 4I5XA 4XVEA 2ACRA 3B3DA 1Q13A 2IKHA 3CAQA 1M9HA 1Z9AA 2IPJA 2J8TA 5JH2A 3M4HA 1EKOA 4Q3MA 2PDMA 4R9OA 2HE5A 4FALA 4WDUA 4JTAA 3VXGA 3ONBA 2IQDA 3RX2A 2PDUA 2FZBA 1AH4A 2HDJA 2I16A 5HNTA 5LIUX 2IKJA 4QXIA 1EL3A 3CMFA 4GACA 2PDBA 3V36A 3D3FA 1MRQA 4H8NA 4DBUA 4JTRA 4PRRA 3MB9A 3O3RA 2I17A 4PUUA 3M64A 3EB4A 3MC5A 3BCJA 1LQAA 1YNPA 3FJNA 1SM9A 4NKCA 1K8CA 1UR3M 3M0IA 1RALA 3H4GA 1T41A 1MZRA 3V0SA 5C7HA 1J96A 2FZDA 4GABA 2ISFA 3CV6A 3UGRA 3BUVA 4JQAA 4JIIX 3KRBA 3WCZA 1LWIA 2PDFA 4YVXA 2CLPA 1XF0A 3O0KA 4XZHA 4ICCX 5KETA 3LZ5A 1QWKA 1ADSA 4YVPA 4FAMA 2IKGA 4WDWA 1AZ2A 3BV7A 1IHIA 1EF3A 3UFYA 3LQLA 4XO7A 1R38A 4LAUA 1OG6A 1A80A 3V0UA 1PYFA 3LQGA 2PDYA 4DBSA 2BGQA 3UZZA 2HVNA 1YE6A 3H7UA 4JQ4A 3R58A 3V0TA 3Q67A 2INEA 3UZXA 3LN3A 4FA3A 4JQ2A 2PF8A 5HNUA 1PWMA 5AZ1A 1S1RA 3COTA 3UYIA 2C91A 1XGDA 4PMJA 2DUXA 2PEVA 4XZMX 5LIXX 4QBXA 3R8HA 1X97A 4JQ1A 3LENA 4HBKA 3EAUA 1AH0A 4GCAA 2VDGA 3CAVA 2A79A 4GQ0A 1Z3NA 2DUZA 1XJBA 2WZTA 3GHSA 4XAPA 3UZYA 4JTCA 3QKZA 4PR4A 2PD5A 3P2VA 2PDHA 2PDCA 2PDLA 1PZ0A 3ONCA 4H7CA 3WBYA 5M2FX 4LBRA 4LB3A 5LIYX 2PDNA 4WDXA 2FZ9A 2HVOA 4YS1A 1ZGDA 3GHUA 2WZMA 2P5NA 1S2AA 2HE8A 3R8GA 1Z8AA 3FX4A 2HV5A 2R24A 2FVLA 3ERPA 1C9WA 4PUWA 3R6IA 2F38A 2PZNA 3LEPA 4WRHA 3R43A 3WG6A 4JIHA 5LIKX 2INZA 2IKIA 4GA8A 4XZNX 4LAZA 4GIEA 5DANA 1AZ1A 3DOPA 4LBSA 2ACSA 2ACQA 4OTKA 3R7MA 4IJCA 3UP8A 4WDTA 5HA7A 3DN5A 3LNMA 1RY8A 1S2CA 4ZFCA 4WGHA 2NVCA 4FZIA 3V35A 4LB4A 4XK2A 2HEJA 4QX4A 4XO6A 1MI3A 1JEZA 2QXWA 2PD9A 1S1PA 3RX3A 3CV7A 2PDJA 3WBWA 2IS7A 1X96A 2FGBA 4EXBA 2R9RA 2BGSA 3G1RA 1T40A 3U2CA 4ASTA 1EXBA 2IQ0A 1ZSXA 4JTDA 3UWEA 3UG8A 4JTQA 2FZ8A 2DV0A 1FRBA 3UZWA 4XZIA 2ALRA 2BP1A 1GVEA 3N6QA 4IGSA 4DBWA 4MHBA 1AH3A 4QR6A 1VP5A 4L1XA 3Q65A 3N2TA 3C3UA 4GQGA 3G5EA 1QRQA 4HMNA 2PDIA 4IJRA 4AUBA 3EB3A 3H7RA 3LUTA 1AFSA 4DZ5A 4EXAA 1VBJA 2IPFA 2PDGA 4L1WA 4YVVA 1IEIA 5LIWX 2PDPA 4JQ3A 3T42A 3LZ3A 5AZ0A 1US0A 4PRTA 1YNQA 4G5DA 1Q5MA 4Q7BA 2PFHA 5JH1A 3RX4A 3R94A 4YU1A 1HW6A 4F40A 2IPWA 1YE4A 4RPQA 2PDWA 3LD5A 2NVDA 2PDKA 1PZ1A 3LBOA 1RY0A 2F2KA 2ACUA 1Z89A 3GHRA 2IPGA 2PDQA 3S3GA 4JIRA 4XZLX 3GUGA 3WBXA 3NTYA 3F7JA 3CASA 1ZQ5A 4XVDA 3GHTA 1HQTA
chains in the Genus database with same CATH superfamily
3SCVA 1UWTA 3ALGA 3INPA 3CO8A 1DJQA 4ATDA 2L5HA 4P8WA 1UROA 5GVJA 4E4FA 4FNQA 5IHSA 3GYCA 4CNSA 2XN1A 4JS3A 1A3WA 3CUZA 5CC5A 4N6EA 4RDZA 4I9AA 1KKOA 1UD3A 4LS1A 1L0PA 3E6EA 3MSDA 3T78A 3EA2A 1TE6A 1M5WA 2PWEA 4R9OA 2HE5A 1R46A 3N17A 3GQYA 3OZYA 3VNZA 1J0KA 3VOIA 1BVZA 3CHCA 1TTIA 2PDUA 2V6AA 3WX7A 2XZ7A 1TPUA 5M5DA 3FJ4A 3AS0A 4N9DA 2E0PA 3NEVA 3R8RA 4DB7A 1GYMA 3FIGA 4JTRA 4A3YA 2A3EA 4WSKA 3TXVA 1W1B1 4GUJA 3ITTA 3UBPC 2R1MA 1F61A 4M7SA 1UWIA 1OGGA 3GR7A 2ZX8A 2NX1A 3S1VA 2O55A 2GJXA 1XYAA 4KCUA 6ALDA 2OWCA 4D6FA 3ALFA 1PXGA 2PZ0A 4G1KA 1MXSA 1DJIA 4IUOA 2HS6A 5I07A 4O0ZA 2FZDA 4PE8A 1US2A 2D23A 3UGRA 3SN1A 1PHQA 1JFXA 2PI6A 1QPQA 2EEXA 4PB3A 5D33A 1AMKA 3C86A 1EA9C 3S6DA 1QU4A 1Y5VA 4HHHA 1C8QA 2F9RA 5BRBA 4HSNA 3PK7A 4X9YA 1NQ6A 3KDNA 3LHVA 4DWSD 3FSTA 3K8MA 3O6AA 3FXYA 4UNIA 1NIUA 1KFKA 1SJBA 1AZ2A 3XISA 3KBSA 4UCFA 4F66A 1MXDA 1CXEA 4C6DA 5GJNA 5I00A 5I77A 4DZAA 3MJMA 1BF6A 1JZ3A 2TMDA 3LQGA 3S9ZA 3TYDA 3T2OA 4G7FA 3EWWA 5CPNA 1UR2A 3HZ3A 3IGUA 2INEA 3L4WA 4E38A 3UNDA 4RE3A 3UR8A 4YHEA 1PWMA 1NWSA 5T91A 3VDHA 4NSBA 4QTGA 4TX8A 3HN3A 3L12A 3VDAA 3AU6A 1LBFA 1TUFA 2ZRZA 1JF5A 2OLAA 4AVOA 1EJ7L 4Q4MA 3KRZA 3MKVA 2QHAA 1BD0A 1OSEA 3UWVA 4EAYA 2QPXA 2E6DA 3C61A 1XYFA 3N18A 3GH4A 1WQ5A 4Z17A 1S2TA 3LRMA 4YTQA 4NX5A 4JHMA 3N14A 4MNKA 3WMLA 3W2NA 3NA8A 4Q8QA 3TMQA 3C5QA 2A3LA 3GXDA 1B57A 2XIQA 5EPDA 1ME8A 4ZQNA 4X2PA 3G2GA 3TFXA 3WBYA 2YW4A 1TZ9A 4OIFA 3POHA 3PWGA 3UETA 2FDSA 4AC7C 3T0CA 4DAIA 2P5NA 3AUJA 3KCLA 3MHUA 4WF7A 2XINA 5F4SA 2B7NA 3TR9A 4DZHA 1E6PA 2HV5A 2JKAA 1EB3A 4WKHA 2R24A 3VD7A 3REQA 1BPLB 4D6HA 4DF2A 3GLCA 1ML1A 5D9NA 5EGRA 2XDFA 5BMXA 3N9RA 4I9MA 3G22A 5C9ZA 1HKIA 2WM0A 1BGAA 1FHUA 2E6AA 3K1DA 2HVMA 4UTHA 4UWMA 3ZVIA 4ROPA 1TWZA 3LM7A 3P5ZA 4LANA 3LRLA 3NL6A 1F9CA 1W17A 1JDCA 1ECQA 1Z6KA 2XH0A 4F9DA 4W5ZA 3GYEA 3OVPA 1M7PA 2HEJA 1W56A 4Y9PA 4IG2B 2QJJA 4B5VA 3PVFA 3H53A 3KUMA 1L6GA 2IS7A 3LHYA 1HN1A 1XQLA 3SUVA 1V6YA 3QYSA 1AW1A 2WZIA 2Q01A 1PIFA 3NEHA 4ZTXA 1SFSA 3G77A 2JIWA 2GVYA 4KFPA 1Z44A 3VZXA 3DZ1A 2WNQA 1WCGA 3N15A 3VOHA 5HULA 3BH4A 3VC5A 2VEKA 1GVEA 4BJHA 3KVLA 4CN6A 3S9YA 2OGJA 3AMDA 4QLJA 1K7EA 3W7JA 1GG1A 2A3AA 3IJ9A 5I23A 1Q3NA 4UR8A 4GQQA 3G5EA 2D3NA 4OWGA 1XINA 5D02A 1TPEA 1KRCC 1E56A 4QNEA 4LRSA 3FCPA 2OCZA 1X1ZA 2EO7A 1OG0A 2CHRA 2VVNA 3BQ5A 4QEEA 2QVHA 4W4QA 3M0MA 1LORA 3I68A 3MA8A 1SMAA 4DEFA 2Z2BA 4S3AA 1US0A 2GGJA 1K8YA 2GOKA 1UA7A 2OTDA 3FEQA 2AQWA 4UOZA 1JUBA 1UUOA 1FH9A 1VPYA 4N42A 5CG7A 3CMGA 5CJ5A 2HBXA 1LUCB 3GDLA 1OHLA 1JZ8A 4YCOA 1ECEA 1J79A 3G24A 5AYZA 3CGTA 4DWSC 3WDJA 1XLJA 3GM8A 4PRWA 1C8XA 4DVOA 1QMLA 4GIRA 4UTFA 2PRMA 1UJQA 2AGKA 1ESWA 3B40A 3W2JA 1EBGA 1G1YA 2X1IA 2F2HA 4OKDA 4JICA 1T6MA 5A8NA 1BYDA 3MMUA 3UYCA 1EPVA 3LCXA 2FYMA 1Q13A 2Z1WA 3CAQA 3R79A 2J8TA 3M4HA 1V02E 2Y7EA 2RDWA 2OWXA 2WKLA 3JS3A 1YXYA 4F0MA 1UR4A 4WJXA 5CLTA 4F48A 2Z28A 1I6NA 3ZLHA 1K7FA 3W1UA 1YX1A 1AH4A 3TN6A 3TQPA 1FHVA 5C8BB 2VCBA 1XRTA 5AHNA 2XWDA 2ZTJA 3CZGA 3JRKA 3MYPA 2DT1A 3AIQA 1QT1A 3IJ6A 1TA3A 2R82A 1R8LA 4ZR8A 1RBOB 4JTJA 4JGDA 4NNAA 1R30A 3FV9A 1RHCA 1VYRA 4DJED 8CGTA 4PUDA 1S38A 3FJNA 1TTQA 2DJLA 1GVOA 5F4XA 4C5YA 1KC7A 3CK5A 3CUHA 4PMVA 5ECVA 4GY1A 1V77A 3P84A 4H8VA 4Z2IA 4LS0A 2YZ5A 1RR2A 2DSUA 4IIGA 2O9TA 5IFPA 4O52A 5AC4A 1AJ0A 1ZRQA 3F2DA 1H0IA 3IK4A 4CNTA 4P8VA 2JEPA 4WJ8A 3PTMA 3SCQA 4QG6A 4K8HA 2A6LA 4PMQA 2CWNA 2NQJA 1MNZA 1ADSA 3OG2A 2I5QA 3GVWA 3M07A 1MQRA 2YCJA 1IIGA 1NH6A 4O13A 3LCHA 3VNDA 3WLPA 3CPGA 1H50A 1OCNA 9RUBA 5JXQA 3L66A 3MO4A 3B8IA 4X63A 1MFUA 2OJPA 2TODA 1F3TA 1XUZA 1K8XA 2YDSA 3EX4A 1BVNP 2DORA 2BV9A 3Q67A 4XWUA 3BG5A 1UG6A 5CPOA 3PZMA 3W2KA 2P76A 3MWAA 4GH3A 1B9BA 3WQFA 4WHBA 3ZLGA 1L9WA 2AKMA 4WOZA 4ZQOA 3QQ1A 3U0HA 4FXRA 3PZQA 4QBXA 4AX7A 1S3HA 4FNUA 4JIPA 3EOOA 3PPHA 3EKLA 4EAMA 3D47A 2WSYA 1GW1A 2Z1XA 3PB2A 2EBNA 1W9PA 1JDAA 4ZQCA 3UG3A 2OEKA 1SO3A 2WNNA 3NO5A 1O12A 2ESCA 4S23A 3A3XA 3GXFA 4OZOA 3VGGA 3C3NA 2WHJA 4JTCA 3CQIA 1MW2A 3DGBA 2R14A 3W76A 3UXKA 7PTDA 3QW3A 2XFRA 4IPIA 4S3FA 2EHHA 4W7VA 5EMYA 4L9ZA 2Q02A 2FZ9A 2HVOA 3RILA 1XKJA 2WMJA 1T5AA 3M9YA 3N3TA 2H9AB 1SU5A 3B0UX 3SCWA 1CGVA 3HIJA 1HTIA 3EX2A 1ITCA 2EXOA 4LQ1A 4NXKA 1KR0A 1QO5A 5FJJA 4MLJA 4EP8C 4FO4A 3GVVA 2ZZ7A 1K9EA 1GORA 3R6IA 1A3HA 1BG9A 1H11A 2WSQA 2CBUA 2XGZA 4UR9A 3L0KA 1C92A 1K03A 1Q7ZA 3IK2A 1OF8A 4LYRA 2ZX6A 4WRHA 3QGVA 1QATA 2NW0A 4GRSA 3QKEA 2ATSA 2WC3A 1RJPA 1LDCA 4D6EA 1ZCOA 3DOPA 3CUJA 1MEWA 1MMFA 2VO5A 3PHAA 1EJXC 1VF8A 2ABAA 4WDTA 3K8LA 3BJTA 2ZA1A 3BG9A 4AHOA 2OZ3A 5LGZA 3G1FA 3V5CA 3AHXA 4W9TA 1R2TA 2QUUA 2GSJA 2J7DA 3STEA 4BA0A 2FVMA 2C7FA 3CB3A 3G8RA 4D71A 4Q8NA 2P3EA 3IJDA 1MI3A 2X42A 3IAQA 5EKYA 4LUYA 4QCEA 3W22A 4DNHA 1D7KA 4HU3A 7TAAA 4I6VA 4HHLA 2PU1A 4U2YA 4EF8A 1LOSA 1R5YA 3G1RA 4UQAA 5GJMA 3ECQA 4HVXA 5ABTA 3TSBA 2RUSA 3UWUA 3E02A 4QHRA 1D3GA 1U83A 3WL1A 3IANA 4ZFMA 3MMDA 4C7FA 3H4WA 4IL2A 1CB7B 1GPFA 1T0OA 2WKJA 4NZ4A 1TPWA 3VKJA 3GVQA 1V6UA 3ZSSA 3M0JA 2F6KA 3TYAA 2V81A 5L6UA 1KV5A 3ZJ6A 6A3HA 1XIGA 1G9HA 1I4NA 1TTJA 3NAVA 4HU8A 5K7JA 3FA4A 4DZ5A 5I5RA 1VFTA 4V33A 3HPZA 2XHYA 4FOJA 1IEIA 2GPTA 3BAYA 3P8IA 4DJEC 3A24A 3DHDA 4JL2A 5B7ZA 1YNQA 2Z0IA 3PPCA 1Z32X 2GVGA 9CGTA 6CGTA 1Q8AA 1PS9A 3RX4A 4ML4A 3HGRA 4WSHA 1AA1B 3IAPA 3STPA 4J2PA 4QCFA 3W29A 5D32A 1R86A 5EMMA 4ZQRA 4AZ7A 2IPGA 1KGXA 1I2PA 2VTFA 3NTYA 1H7RA 1JF6A 4JTGA 2XM2A 3BZJA 5BRPA 1TMHA 1RP9A 3AYTA 1KCKA 1PTAA 1RCXB 1DWGM 1KGWA 3NQVA 1VCFA 2BOFX 3PY2A 1EJTC 1ME9A 5A6SA 3WUEA 1X98A 3NQGA 4KIRA 1UPMB 4PUEA 3IUHA 4RNFA 4U10A 5G2WA 1XW8A 2HPIA 1VFMA 2HK0A 3FEMA 2WMFA 2E9BA 1W9BM 1PB0A 4L4OA 1V3IA 3QR3A 2JEQA 4YN5A 2A7PA 1MDLA 3I10A 2OGYA 4US5D 5HUOA 2JF6A 3TSMA 1J2BA 2OEJA 1SO5A 3AAMA 1EYEA 2X1SA 5EU9A 3SUTA 1OIFA 2IKJA 3W86A 5FEWA 3FJ6A 4XAGA 4GVGA 2WXDM 2B31A 3UCDA 4HNUA 4KF1A 3GTHA 1QFEA 1XKYA 3UVIA 3E1F1 2A5HA 3M64A 1ZAIA 4Q8MA 1NELA 3QFWA 3OW1A 5K4XA 1LLZA 1F5ZA 2PGEA 1ICSA 1TCDA 2PWGA 1E0UA 4EOUA 3MP3A 3M0IA 1VFLA 2X05A 2D0FA 2E9LA 4B9YA 3WLIA 5AC6A 2ISFA 5AFDA 1N8IA 2Q8LA 5H8UA 1W9VA 2BXYA 4PMNA 4ZMGA 5U7SA 3OOQA 3WMBA 2DZPA 3NQEA 1CLKA 1KR1A 3HV8A 3OODA 2QJGA 4NYUA 5GPRA 1QWKA 3AS3A 4CLMA 3MUAA 3QV8A 1E70M 3FLUA 3L4TA 4HOWA 3LB0A 1XRVA 3W6LA 1TELA 2V68A 2DDXA 1CWYA 1UBPC 4Q4SA 4JTSA 1B3ZA 3VD9A 4XB3A 1D7FA 2YLLA 3TQ0A 3UGVA 2EAWA 3SJ3A 4ZSUA 1NWUA 1H7XA 3P14A 3H2AA 1OX5A 3CWOX 3F1QA 4JQ2A 5HJLA 4EX4A 3EMCA 4G56A 4R7JA 1EZWA 1RBAA 3SCRA 4DPPA 3KZSA 2UWFA 1TX0A 1GOWA 1J8VA 2Y7FA 3H70A 4ERAA 2BDQA 4NZ5A 1AL8A 3QR0A 3G1VA 1KA9F 2JIEA 3EAUA 3GB6A 1JRBA 4TXEA 3IRDA 1NFBA 3CAVA 2A79A 3BC9A 3B8TA 3HQOA 4Z0JA 4E2BA 3W0KA 3V7PA 2WHMA 3M0VA 4JHZA 2ON3A 2P1FA 1MO0A 2OU4A 4ECLA 1Q6OA 4QLKA 2HSAA 4YS1A 6TIMA 5B7YA 4IIBA 2BTMA 3OBEA 3T07A 4AD5A 1R0MA 2WVVB 3DHFA 4A21A 4HK7A 5I79A 1HL8A 2I7GA 1P1MA 1H62A 2RH9A 4AY7A 1P6WA 4TIMA 2J25A 2J24A 2BZNA 3L0GA 5D03A 3FNDA 3W27A 3MP4A 1LYXA 1RSCA 4ZA0A 3PBVA 2QV4A 4AF0A 3TJXA 5FL1A 3B8UA 1OZMA 4UQBA 4G2DA 2GWGA 1ZB5A 3EBVA 3WIJA 1GK8A 4IJCA 4WXZA 3UP8A 3LCIA 4I6KA 2ZOXA 1XLIA 3VM7A 4V28A 1UA3A 2V5KA 3C56A 4CD8A 2CFFA 2Z7GA 2IXUA 3EYPA 3BTNA 3S1UA 1TJ2A 1R3SA 4MIMA 4QX4A 3BLLA 5KTLA 1UC4A 5MF5A 2GGHA 2Y70A 3RU6A 3LY0A 3B0XA 3O06A 4QDWA 4GYJA 1UD8A 1TV4A 4JTEA 4PTWA 3ZVHB 4IH3A 1K3UA 2J8FA 2TAAA 1CGWA 5RUBA 3PUGA 3UA4A 1ZBCA 2FIQA 1ODUA 1XWYA 3A64A 5F2IA 5BWFA 1BRLA 1XYLA 2CLFA 1EXBA 2IQ0A 3NQ6A 5AC8A 4HA0A 1O60A 1K9FA 4MB3A 1VBGA 4HNOA 2A4AA 2C14A 3VCRA 1X8FA 1R9ZA 3AS2A 5BYWA 2ZUWA 3H55A 6PTDA 4ZE5A 4IQEA 5EBUA 1AUSL 4CQBA 2ZX7A 3L4XA 2WWCA 3FAWA 1CDGA 2QPUA 2GUBA 2C0AA 2A6NA 3Q45A 4MSSA 1T7LA 3DFQA 2NQHA 3CS2A 3AMCA 2A3BA 1TJPA 1EBHA 4CQCA 2JKPA 4UFHA 3L4YA 4RE2A 5XIMA 4RJEA 3DC0A 4L1WA 1UWQA 5LIWX 2PDPA 4KEMA 1GPWA 1NOUA 1AODA 3DH7A 4AZHA 1J93A 2Z00A 1G0CA 5EFDA 5BXPA 3R1ZA 1X7IA 1ELSA 2JALA 2ZZ4A 1HW6A 4EK7A 1SQ7A 4WQ6A 1WXJA 5A3HA 4B4HA 5LA0A 1UB3A 4G8TA 1TX2A 2PDKA 5FJOA 3U2EA 3QPYA 3D0CA 2F2KA 4BS0A 4WR3A 1GOMA 2VC6A 2B0MA 2PDQA 4X2RA 4DJDD 3UJ2A 1UKTA 3WBXA 4MG4A 1EWDA 4L6DA 3DX5A 3U7VA 1P48A 4NNCA 2E9MA 4XVDA 3H26A 3AI0A 4Z1BA 2Z2AA 5C9XA 2HJPA 1MEIA 3I7SA 3KW3A 3QYQA 1OC6A 1B3OA 2C8NA 2PS2A 3W7OA 4BQ2A 2RAGA 3GSMA 5D38A 2GK1A 4XVEA 1BYBA 5LHEA 4H7ZA 2ZRYA 2J7FA 3FS2A 4LC6A 5D09A 4GIAA 4CN4A 4CD7A 1NWRA 1EP1A 2D20A 5KSWA 4LNYA 7A3HA 3OZOA 2J4GA 4GNKB 3A4JA 2IQTA 3SR7A 4IFRA 3W85A 4BEUA 3SUSA 2VEIA 2ZRUA 1UUQA 1LOQA 4XIAA 5IXEA 2CYGA 1UZ1A 3N2CA 3RX2A 3BDKA 2NX9A 3TTOA 3TAOA 3GD6A 3LV6A 1TR9A 3KTXA 4GGHA 4XIMA 2O92A 3S1XA 2E8ZA 3K4AA 1M53A 1ADOA 4XZWA 3NQFA 1VLWA 4H04A 1THFD 1ZS2A 3O3RA 2VT0A 3SZ8A 3SGGA 1VR6A 2B7OA 3KOZA 3BCJA 1VCGA 2PLJA 1YNPA 2OX1A 5MKGB 1SM9A 2FVKA 1QI4A 4L4LA 3CJPA 4H9YA 1AJ2A 1XBZA 5AB3A 4LSBA 3MHGA 2YGYA 2YDAA 1W9DM 2XFFA 3PJTA 4DHGA 3M6YA 1A0CA 3DFOA 1RBLA 3V0SA 1E1CA 4GABA 4RNJA 3CV6A 5G4EA 1AL7A 3TZNA 4D6IA 2PWUA 4AMCA 3EDFA 4W93A 1E40A 3GIQA 3S5YA 1WUEA 5GQBA 1DJGA 1XUUA 4ICCX 3V18A 2G4JA 4Q4QA 4IIHA 4TTGA 2O9RA 4LTSA 1EQPA 1HP4A 4AZBA 3P93A 4L64A 3WF0A 3WEZA 4LWWA 3LQLA 1K4GA 1QK2A 3K4WA 3F03K 4FLSA 1T99A 2FQIA 3WF4A 3TROA 5M1TA 2VXNA 3OIXA 1JZ6A 1I2NA 2YXXA 3W24A 1XR2A 2VCAA 1UQZA 3BLFA 3TC3A 4JFSA 4B5UA 2Y88A 1E9ZB 3HPAA 1GZ1A 2Y5SA 4KETA 4M6UA 5E5CA 1BLIA 5C9RA 4C6QA 4C7DA 3NPXA 7REQB 2G3MA 3RR1A 2QIWA 1W32A 1YPIA 5CPTA 2NSOA 4WOQA 1XH2A 4LH8A 3W53A 3KBWA 3UWZA 2VQTA 1W3JA 1FKWA 4P61A 1J2WA 3GAYA 4CCCA 2VDGA 3A22A 4UFLA 1UD2A 1YRRA 2X2YA 1E3XA 2H8XA 1FWSA 4PR4A 4IP7A 5C54A 3WFAA 3EWUA 1DTUA 3BOFA 2D3LA 3W1TA 3RG6A 3ANVA 1OINA 2OSXA 5HXMA 1KM4A 1FH8A 3RM9A 3MKCA 3GHUA 2P0IA 1G7UA 1A3XA 4UIOA 4GYFA 4P7NA 3LCFA 5E1QA 4D1JA 2YFOA 4F2TA 1EOMA 5CZ0A 2HWGA 3ARYA 4O1EA 3PC0A 3BICA 4LY4A 4OJYA 3A9BA 3RHGA 4IMAA 1VCVA 3CO4A 1ZY9A 3H12A 3SECA 1ZJHA 4KWUA 1AW5A 2YDQA 4M24A 5K4ZA 4GI4A 4C6JA 2Y24A 5HOSA 2GL5A 4KEUA 1KBBA 1YPXA 1F05A 3LYEA 4F2BA 2XTKA 2QJNA 1U5JA 3CMJA 2GQ3A 3PN8A 3S1WA 1EC9A 2OZTA 3OP2A 2D2JA 3IV8A 1S2CA 4ZOCA 3T7VA 4DJDC 4GG9A 2V9DA 1NFGA 4FZIA 3H23A 3APYA 2ZA2A 2XFYA 3VE9A 4ZBCA 1J4EA 2R1PA 4MNMA 5DT7A 3FGCB 2YX0A 2YBUA 2PBGA 2P0OA 3G0UA 3LM3A 4J4KA 4Z1YA 4PMXA 1X39A 2NT0A 2R9RA 4Z1CA 3W26A 4XD6A 3GBEA 2C1IA 1VBHA 3LHZA 1B3YA 1TV3A 4WGXA 2OPJA 2VC5A 3GIYA 3UWEA 4JTQA 4CN1A 3N4AA 1EGVA 1OFDA 2JGQA 1IZJA 3GH5A 3F2CA 4JTFA 1ZJAA 4NZ3A 3SCTA 4GOAA 2EF9A 2WMKA 4LVBA 1KM3A 1JULA 4HK6A 3WQCA 1G4PA 3TOPA 3WELA 2IMRA 3T05A 2IPFA 1EDQA 4YVVA 4HK5A 4HZ6A 1QBAA 4B9ZA 3BAKA 2PPGA 4MZYA 1FWJC 3ANYA 3MTWA 3W00A 3VD4A 2I57A 3CLMA 2VD9A 5HWNA 2XIIA 5BU9A 4NJJA 3VDBA 4GJ1A 4B16A 3LPOA 3KP1A 2VRKA 1HG3A 1OT2A 4DX3A 3LD5A 4LAMA 4HZMA 4MM1A 3VGBA 5TD4A 4KGJA 1VFSA 3GHRA 2WMIB 4O4WA 1LWJA 3L2IA 1J0YA 1OK6A 3EMQA 2VUNA 3V1HA 1FP9A 1T8XA 3W6YA 1FFRA 4U2ZA 5ECUA 4RK8A 3IV3A 2ZZ6A 4QITA 5A8MA 4D1IA 3APGA 2PF0A 3L21A 3E49A 1JCYA 4ONVA 4WCJA 4I5XA 4KGLA 2WC7A 1IXQA 2V3DA 2HROA 3S2NA 1XX1A 3P5YA 2UY4A 4W7WA 5ABHA 4M8UA 2CESA 4A8LA 1KCZA 2VX7A 1UW9A 1QOPA 2G5WA 3IJ8A 2R94A 3CZLA 2XGBA 3GX9A 3OTRA 2J75A 4HGXA 4IXXA 3TYUA 3PBGA 3WKZA 3DG3A 3TDFA 1QTWA 5AN7A 3VMOA 3C2FA 4H2CA 4RNHA 1J6PA 3SUWA 2NT1A 1JXKA 3GWQA 5AHIA 3UXAA 3HG3A 4EPBC 3J7HA 3V4BA 2E1DA 1DVJA 4N0RA 2WK2A 3W4RA 2D0HA 3P60A 2HCVA 5E6ZA 3PZTA 2OODA 3VKAA 3FXGA 1REQB 3ISIX 1OGSA 2QGHA 4NJGA 3TAKA 1FBAA 1YBQB 4A4AA 3W7HA 5AHEA 1WOBA 2QCEA 4KCVA 1HVQA 1KM5A 1KV8A 5T8GA 2VM8A 4HNLA 1UOZA 3TC7A 4IT1A 3UERA 3MCMA 3RRXA 4L4PA 2GYIA 1MZRA 3R0DA 5DCDA 5CBBA 3MI6A 4XSLA 4JQAA 1A5KC 3UR7A 3LLXA 4C1KA 1V0MA 3KX6A 3LZ5A 2EPHA 4YVPA 2WZHA 2DY3A 1FUYA 3C0JA 1XYBA 2PCQA 3K2GA 5DT5A 5H8PA 3KWXA 3MVIA 2FGLA 1PCWA 3TJLA 4XO7A 2RKXA 1S2VA 1FY6A 1L8NA 1EJRC 5D2WA 5KINA 1E1FA 3AWNA 4LOCA 1KNWA 2PUZA 4PFMA 4JQ4A 5K9XA 1A5NC 3QR1A 3VDGA 2PODA 3EWXA 3FKRA 1TMQA 1W8SA 4URIA 4HMCA 4PYSA 4RPPA 1WX0A 1D8CA 4ZENA 1NEYA 2Z1VA 4GYPC 4BR1A 4AD3A 5HQMA 1DHPA 1DWHM 3DFSA 3TTQA 1OVDA 3L0NA 5CXPA 4HPGA 2DIEA 3DECA 1VJZA 4PTMA 1E9LA 1CPUA 3TC6A 4RXGA 1OCJA 1PSCA 1W1IE 4A3UA 1KBKA 1OBAA 1O94A 2B7PA 1DKWA 3KZPA 3GC2A 2W6RA 4BY3A 1K77A 3GHSA 5AHMA 1H60A 3QKZA 1MUMA 5T9BG 4PB5A 4LVFA 2F84A 1UUMA 2E6FA 3JZEA 4JX6A 1U1UA 2GWNA 2ONEA 4JFTA 2YCIX 1IEXA 5AC5A 1V6TA 2VNCA 3ITGA 4PTXA 3T6CA 2CC0A 3ZMRA 3VZYA 1XSKA 1QXLA 2DIJA 5D4YA 1G6CA 3L4VA 1E72M 4OUEA 2XVLA 5JMUA 1JCXA 2ATMA 1KFEA 3W87A 3W7IA 2QJMA 1W91A 1C9WA 4BQ4A 2FPYA 1ONRA 3LHUA 4DUWA 4UTIA 4O16A 2QULA 3T0AA 1IXPA 3BVJA 1DHKA 1GNXA 3MQTA 4IIFA 1C90A 1X6LA 1SZGA 1KRBC 3H4XA 4LUTA 2GQAA 1EEPA 3LCGA 5DANA 4GZ7A 3WZ0E 3U5YA 3RLGA 2CLHA 2DH2A 1M7XA 5HQLA 5KZDA 4C6PA 3RK8A 3LBMA 4CQ9A 4QEHA 4ZFCA 3G1SA 2Q3OA 3AIVA 2A7RA 4LF1A 4K36A 3MWCA 1WKYA 4TTUA 3W7LA 1KKRA 2GDUA 1L6SA 5HWMA 4IPNB 1D2KA 1WV2A 2O0TA 1W31A 4XD3A 1G4TA 3TTSA 5CC3A 1CBGA 3JZUA 3KWSA 3LPPA 3GS6A 4R33A 3GFXA 3W02A 1LCOA 2KAUC 3A21A 4IF2A 1HVXA 4C6KA 4JYEA 3O7UA 3EDDA 4GE8A 4AC1X 4JNYA 4EVZA 4DXXA 4FR6A 1E4IA 4U3AA 3GKFA 2G96A 5D2VA 4RDYA 3ZM8A 3W7EA 1VP5A 3R5EA 2OSYA 2VEGA 4ADSA 3MBFA 3LU2A 1XLEA 1GKQA 1ZJIA 3W7CA 2GJRA 5TQLA 3M1ZA 3L2MA 4F9JA 2GUUA 3CT2A 3BAJA 5DELA 3GU2A 4Z2HA 3O63A 4GPNA 3MBDA 1XLFA 3T42A 1KBJA 4DZIA 2QAFA 5PTDA 2VDIA 2DVUA 4Z1DA 3EOEA 4HA1A 3OA5A 3CYJA 3WBEA 1RP8A 3QY7A 4CD5A 4MTVA 3SN0A 4QG8A 3BAWA 1S2UA 3CT7A 2YB4A 4H6KA 3R11A 4I9JA 4O11A 2W66A 4XQ6A 2OKOA 4JIRA 4W5UA 4TV6A 3WO8A 2OT0A 4ZODA 3HG5A 3TZFA 1JFHA 3VIFA 4D8AA 1OFPA 4GC4A 4K2SA 3HGSA 1E55A 1H1NA 3KRSA 4WEVX 5IDIA 1MXGA 1IR1A 2J7GA 2PDXA 4B5NA 4UQDA 4FOKA 4UMAA 5BROA 1PKLA 4XBSA 5AC7A 1RD5A 3PG8A 3RCNA 2I9UA 4S2BA 4KFNA 3H6OA 3TSDA 1E0TA 2A1YA 5CGTA 4R34A 3N2XA 4OUIA 4WDUA 1VPXA 3URBA 3N73A 1G69A 5DQPA 3UPWA 1H1ZA 2XIOA 1XQKA 3NOYA 3EWCA 4PSPA 4FB7A 4RLIA 4ZOBA 1XCXA 2BHYA 2Y5JA 3GDMA 2PTDA 2G95A 3GTXA 3QXBA 4QLLA 3IJQA 4M6QA 2PDBA 2XH7A 4OE7A 4TOQA 3D3FA 3DI0A 5GNZA 3BW4A 2X0SA 4AIEA 4BF7A 1V03A 2EJAA 4AZCB 3GW3A 3S0CA 3MC5A 4KMQA 3QRHA 2EG6A 1J10A 3CL8A 2XGIA 4RXFA 1UHVA 5HAOA 1ADDA 3VKDA 1OC7A 2DZWA 3ZWTA 2QV5A 4MYXA 3BCFA 4CD6A 2GDVA 2YCEA 4O19A 3WQEA 3SADA 5K9CA 4AFYA 2BASA 1QPOA 1EZ2A 3BK0A 4QE5A 5XIAA 2PRLA 3HOJA 1W2PA 4MUZA 3PR2A 1H63A 4L61A 2UY5A 4XG1A 1FTXA 1Q6CA 3LGDA 4M6VA 4MPKA 3UW6A 1J0ZA 3VOFA 2J62A 3O0KA 1EP3A 2PLMA 1N8FA 1TYGA 1FWCC 4Y7EA 2BHUA 4FAMA 4NF7A 2PGWA 4F0KA 4KEZA 1B5TA 4WDWA 4K1GA 3TN3A 3BMWA 3T9PA 4UZUA 2NV1A 4JY9A 4XAZA 2E09A 1CXIA 4LAUA 5H1WA 3VFLA 3EKZA 3W25A 1M01A 4J7RA 4DBSA 1M7OA 4ICNA 3KM8A 1YE6A 3S2CA 5LNVA 2FFIA 3WNKA 4MZ1A 1AVAA 1P6CA 3USBA 1NAL1 4IWWA 2YYTA 3UZXA 3SBFA 1UYQA 3EA3A 2Z6IA 3W70A 4AX6A 3QY6A 1XIEA 4C65A 1DWAM 4C6CA 1W8GA 1QOXA 3LERA 1B90A 2PEVA 1WP6A 3WH6A 4OBSA 4Y8EA 1HZYA 3WEOA 1FWBC 4HHPA 1UR8A 4D8LA 2H90A 4UTWC 2QCGA 4PUKA 1XIIA 4PN2A 5DMMA 1AQMA 1KRAC 2QW5A 1UKPA 1V51A 4BKNA 1WDPA 3NQ8A 5C7VA 5FD0A 3CXOA 3ITYA 4ACZA 3BANA 5I24A 2GJXB 1FKXA 3KOWA 2PDHA 3CUXA 3DC8A 3ATYA 3B0PA 1PCKA 4JKLA 3WQVA 3DESA 3CPUA 3GIPA 2VX5A 2CPUA 3DUGA 4WDXA 4J3WA 4TMCA 1K9DA 1BWLA 2RGMA 3M0KA 4QIUA 5DMLA 5C2CA 4TX9A 1QI5A 2ZQ0A 3HV9A 2GOUA 5BCAA 4HZ8A 4E5TA 2PSNA 3O1NA 3WJZA 1M04A 3MT1A 3MKKA 4GXPA 2H9AA 3VK5A 1KFLA 1HO4A 3NYZA 1WNOA 1GUVA 3MMTA 2PZNA 1OJXA 5FAJA 4NAEA 3CL6A 5EB8A 3WQ6A 1EGMA 5EMKA 3CUGA 5A6AA 5FEPA 5AVNA 2WPGA 3WN6A 2CNCA 2DFAA 1JPDX 2V5JA 1HFBA 3R7MA 1P0NA 3WLJA 2PBOA 2GGIA 4UTUA 1MUWA 5MHBA 1B4EA 1ZZMA 3FOKA 4JIEA 1E6SM 4KERA 3LCLA 3F4CA 1FCBA 4HYWA 3FK4A 4IMCA 4HN4A 4LB4A 3OHIA 4AIOA 3SO7A 4WUIA 2PD9A 5LHFA 1R3VA 5LNWA 4K8EA 2VC7A 4NILA 3WUGA 4CCEA 4CQAA 2OWWA 2WO5A 3QZ6A 1TVNA 2VFDA 3VIMA 4NZFA 3WEMA 3N34A 3RJYA 4AHPA 4N4QA 1IYXA 1TWIA 1XIMA 2E3ZA 3TONA 5CJNA 3IS4A 3PBWA 4QROA 4UTTA 1QO2A 3WNOA 4ZSTA 1E9IA 2VD8A 4OVXA 4UTKA 1E71M 4UBPC 4MHBA 5M3WA 2AOSA 4IFKA 2QQ6A 2VR4A 3NSMA 2CZDA 2J66A 3E96A 3RYSA 2HZGA 5D2XA 3IVUA 1E6ZA 4GQRA 4HNNA 4ZQMA 3REQB 4O18A 3AIBA 4WVXA 4P2VA 1KCXA 1VGAA 1K70A 1I60A 1UH3A 1Y0EA 3CH9A 1TG7A 3RLHA 3H2FA 5JQ9A 4GO8A 4Q7BA 1X6NA 1JNEA 4F40A 1NP2A 1SZNA 4R85A 1OFAA 2YB1A 4Q4KA 3KS6A 1ZBKA 3WH8A 1AQ0A 3WK3A 1R3WA 1SZEA 3R13A 2WHLA 2VR5A 4CU8A 3P6LA 1W1TA 1O4UA 3F7JA 3TNOA 1EJSC 1HQTA 3T0DA 2PC8A 3DHPA 3DU0A 4OOUA 1LG1A 1XPGA 1CXLA 4CQ8A 4Q33A 2VWSA 5DBUA 4ZE4A 2CKRA 5K3VA 4IHCA 1KGUA 4C1NA 2QVNA 1DJHA 3UJEA 1MW3A 1K9TA 2VMFA 3DFNA 5F2LA 2E5DA 5D2YA 4LC8A 3GFZA 2J78A 1K4HA 4AVNA 3AMGA 4WX2A 1DORA 5I7GA 5A8QA 3ONBA 1YMYA 4NXSA 1E15A 3NO1A 5DF0A 2O9PA 3GXIA 3ENLA 4A8NA 4DF1A 3D6NA 2RHGA 1G7VA 5HNTA 1OADA 1ICPA 3PUEA 5FJUA 4GACA 4S1FA 1XCFA 2HISA 3W1QA 4AIUA 2YSWA 3ABOA 1SVDA 3B9AA 1FOBA 1U5HA 3IARA 3HQPA 4JN8A 3G18A 1Q6GA 4HPXA 3PPFA 5G2HA 2EPKX 4HTYA 4Q4OA 1A0DA 4W85A 3V1PA 1CNVA 4WY0A 5K9DA 4HJWA 2DZSA 4YPJA 3ZSTA 4GXWA 2J7HA 1OCQA 1OEPA 4U31A 4M56A 1J12A 4FP1A 1DWJM 3WFZA 3IIOA 3AIRA 4LFYA 1H7NA 1YIXA 1XS2A 3RPMA 3RPTA 1XBXA 4A2SA 1F8MA 1TRDA 5F1VA 3M44A 3SN4A 2FFCA 4I8DA 3TLQA 1E4NA 4FOUA 1VQTA 4MOZA 4PH6A 1VC4A 4TR9A 5D04C 3N25A 2OX4A 3GDBA 3WD4A 3SCPA 1I45A 3NJ3A 1X6UA 2ZUVA 1UC5A 1NDZA 5KMYA 3NVTA 4N6FA 4H9UA 1RAKA 3ZOAA 4F4RA 4LY8A 3LPGA 1AD4A 2J74A 4MAZA 2PDYA 1C91A 3MDUA 3NQCA 3R58A 3MV11 1IQ8A 2DH3A 3WJXA 4QP0A 3CIVA 4FA3A 2WJFA 3GZ3A 2OZ8A 5GNXA 3UYIA 4HJFA 1JL8A 4O28A 5HUPA 2QDDA 2VEFA 3FN9A 2B81A 3ITXA 3R8HA 1VIZA 3B9NA 1TVLA 3RNDA 3TQVA 3GRIA 1TA3B 3KVKA 4AZIA 1NF7A 3ARVA 3AZTA 2VDHA 1LBMA 1XC6A 4DQWA 3MUZ1 3BSHA 4GUIA 4GI9A 2R91A 4LW7A 3VILA 4IMDA 4JAWA 1O5XA 5XINA 9XIMA 3WDRA 3WLSA 3ZQ9A 4MB1A 4FLRA 1RXOB 2PTZA 4KW2A 4UMCA 1VENA 3MMWA 3DYPA 3QW4B 5G5IA 1JDDA 4BF9A 1P6BA 2BHZA 3UT0A 3VIGA 1PBGA 2WZMA 1JUKA 1QHPA 1EHAA 4C5ZA 2XN0A 4A3HA 4QJ5B 5FEZA 3GFYA 2FVLA 3BLDA 3EX6A 4PUWA 2WVVA 3TTEA 4EWND 3AYSA 3E0VA 2CLKA 5CPQA 1JPIA 4ALDA 3OJGA 3KVJA 2GUYA 4HNVA 1OYAA 1XLMA 2VL4A 1EA0A 5E0CA 2D73A 1HX0A 4NX0A 1UR1A 1OIMA 3LBCA 2ACSA 1BYAA 3U4AA 1EUNA 4OTKA 1AK5A 1QR7A 1OT1A 4HN8A 1W9XA 3L5LA 4RNIA 1C29A 2PWVA 3EOSA 3BSMA 2NVCA 3QLDA 1RK6A 2C19A 3THUA 4E8DA 1A5CA 4DWDA 5EY5A 3W6MA 5D8WA 4M6PA 1J5SA 3UJRA 1ISZA 4RW5A 3W7KA 3CV7A 4GUFA 4RZBA 4BI6A 2CERA 4EXBA 3PULA 5IOBA 2BGSA 3A4WA 3VX1A 1DJWA 5M17A 1ZSXA 1GEQA 2Q6ZA 3EDEA 1TFVA 5IBXC 3MUCA 2DV0A 3ZXWA 4MWAA 3LDVA 3NQDA 8RUCA 1G94A 1ITQA 2R8WA 4GH1A 1LJYA 1SFJA 2I5IA 2P8CA 2BODX 1RJQA 2F7FA 3WQ5A 4POCA 1T8QA 3FA5A 3N12A 3GNNA 4Z2JA 4AXKA 1X7FA 1M3UA 2Y8UA 1WZAA 4RV8A 2OQYA 3H7RA 1IWPA 3A5FA 2CHNA 4HT3A 4IQDA 5HJXA 3TA6A 8XIAA 3N9SA 1W5PA 3NYDA 1JCMP 3LZ3A 3PBUA 1WO2A 3PG9A 2EJ1A 1Q6FA 3SCOA 2VCCA 4IM4A 3MUY1 4BWLA 4M29A 3FDKA 3II1A 1EF2A 3NVDA 3VGEA 4LUJA 3WUFA 3GNOA 1KWKA 5DO8A 2XSBA 4M80A 1PZ1A 1OY0A 1IEQA 4DJFA 3GUGA 3AMKA 3C0LA 9XIAA 3DERA 4AZ6A 3DFPA 3E9AA 3EXSA 3SW6A 2H3DA 1Y65A 1HL2A 3AU2A 4NT0A 3MI2A 1RUSA 2Z26A 5LNSA 3AXKA 1D3HA 2ISDA 2EGZA 4PMRA 3AWOA 1RLDA 2JKEA 1GZJA 5E6YA 4AEOA 3KOFA 3G6LA 5I3GA 4OFCA 1DWIM 5FSDC 1CCWB 4JTLA 4DI9A 4KIEA 4JXCA 1N7KA 3RIKA 4R7OA 3PTKA 4ZCWA 3TLLA 1JAEA 5EMLA 1O6IA 4R3UA 2CXGA 4ZB2A 4LVDA 3EMZA 3B8VA 2IQDA 1J01A 1EX1A 1CI1A 1XRSA 3TK7A 4IQLA 4WZHA 4IFOA 4LV9A 1A5LC 2PCEA 3G1HA 3C0QA 1H0GA 1AJZA 5HMEA 3W74A 3HURA 4UFJA 1MRQA 1UWAA 5TF0A 3QY8A 1OABA 1GVSA 1CXKA 4GZIA 4XTIA 3T4CA 4L65A 2X41A 7CGTA 1LQAA 3NL5A 2OO0A 4E8CA 3VYLA 4F0RA 5FSEC 3FHQA 3STFA 4NIRA 3DFTA 4A6GA 2ZADA 1E5NA 4XAYA 4E4UA 5I6SA 3GU9A 3C2YA 3SGUA 2FTPA 1UR3M 3H2NA 2NUWA 2BWGA 1MSSA 3SY8A 1W0MA 3E0IA 1SSGA 3PTDA 2QJIA 2ZKMX 3GTFA 4HHMA 5BXSA 1IT8A 1UBSA 3IIVA 4S3GA 4JIIX 1NOFA 3WCZA 5DEZA 1F76A 1XLCA 5LXEA 2W67A 4BFAA 1QNSA 1WXZA 3UCQA 3LX9A 1VH7A 3P8JA 5EMJA 2WJDA 2Y2WA 3BV7A 1YHTA 4JOMA 3L2LA 1EF3A 5FCZA 4K39A 4C90A 4UC5A 1Q6RA 4HU4A 5A6MA 3U2ZA 4JTIA 1GYLA 3S2MA 3LCWA 3HPXA 2Z2UA 5G1YA 1A4MA 3CNYA 1BVWA 2AMXA 4Q4PA 5FOOA 3DAQA 3MDWA 5H2ZA 4JR5A 1F7BA 4L1GA 2CLIA 3UPMA 1JPMA 3W82A 4K6AA 2QDEA 2H8ZA 3WQPA 1AMYA 4MLRA 3L23A 3FHAA 1WZMA 1M6JA 4AU0A 4YIWA 4S3CA 4HBKA 1QW7A 1XLDA 3NXLA 3K8KA 1E6RA 4C91A 1VIWA 7REQA 3UG5A 3RM8A 3THCA 3PZIA 2OLHA 1CB2A 1Z3NA 2NXGA 1JUEA 1CT5A 2ZRXA 3GG8A 4LU0A 4IGNA 2PE4A 3U2OA 1A5SA 1XC4A 1ISXA 1XI3A 1GOKA 4FHAA 1UP2A 3C2VA 1Q6EA 1MDRA 3ONCA 4IUGA 1DJXA 3WJSA 5ABFA 2FB3A 1EDGA 2I56A 1GKPA 1KQZA 1YTDA 3OGVA 2OB3A 4C6BA 3UWQA 3A4AA 4OV4A 4QDPA 5BZAA 3B0VC 3ABXA 3W07A 1B54A 1OX6A 2Z4GA 3WMCA 1XYMA 3VC6A 3AHYA 1V3HA 3HA1A 2DZAA 4U4MA 3QZEA 3FJLA 1B9ZA 3IGSA 7ENLA 3VFCA 5C0QA 1KCLA 1Y8BA 3HGJA 1OF6A 4AG0A 1QASA 4DLFA 1L6YA 3GG7A 1HIZA 1O1ZA 3QMSA 4F0LA 1DQWA 5E70A 1C7SA 1AZ1A 4U5KA 2WVSA 1WDSA 1JZ7A 1XLGA 2PTYA 3SSZA 4FI4A 2WOQA 3N2BA 4W8BA 1TV7A 1GQIA 3LGGA 3ZFHA 2YYUA 5HMFA 3V35A 3TV8A 5C2XA 4JX4A 4Y2WA 5LKYA 1E9YB 4MVAA 1Z41A 5HNRA 1A47A 4XO6A 1U2YA 1DL3A 1O95A 1TVPA 3TW7A 4LYPA 3DCPA 4FIQA 4J3UA 4HMEA 3EWYA 3BLOA 3DG6A 3L9CA 2A3HA 3RF9A 3EKGA 1TJ0A 3C6CA 3SRFA 3IACA 4DLMA 2QNEA 3MUIA 3U8GA 2EPOA 1MRAA 1XH1A 1T40A 3QZAA 3PBMA 1E6QM 1SFTA 2P3ZA 1QI0A 5D9PA 5E93A 1GVYA 1MW0A 2XH4A 1F74A 3U48A 4O10A 3UG8A 4QDMA 2INFA 2I5GA 3MU7A 4L5ZA 1EIXA 1IR2A 3QMRA 5TBOA 2HXUA 2NWSA 4DUOA 3RR4A 4O1BA 3I3BA 3T4WA 3W28A 3MV01 3K4DA 2C3ZA 4GLEA 4REQA 2D2HA 4CNPA 1YDNA 2X8RA 4FXFA 4PMOA 1FWDC 3TMLA 4JTHA 2XIJA 5D9OA 2C18A 3RRAA 3CPRA 4EXAA 2DZTA 3QN3A 5FEXA 3IGHX 4KS0A 5CZKA 4N9EA 1BSLA 2RJGA 4O8RA 1T96A 4AF0B 4LAKA 4J35A 4PRTA 4F8XA 2G4FA 3VCNA 1UIPA 3GUWA 3GXMA 4Q4RA 2PFHA 1OWQA 4OQVA 1RQBA 2PGFA 3PFMA 4JBRA 3W9ZA 5G1TA 4ATLA 4DO4A 3QOMA 3OIHA 4QQ3A 1KXQA 2NVDA 4FS9A 4GBUA 3NOEA 1LT8A 1S5NA 1OFEA 1WE5A 1BEUA 1W6TA 1UD5A 1QHOA 3KL3A 4CU7A 3K5XA 2QDHA 3OBAA 2BY3A 4IPPA 3A6OA 4DO5A 4L56A 2VEMA 4XD4A 1IEWA 1KW1A 2E1WA 2FHFA 1HP5A 4QQUA 3TUUA 4AIBA 3AXHA 4GY7A 5AKQA 2XSAA 1NQKA 4HNTA 3QTPA 2NWRA 1W5MA 1UZHA 2ZA3A 5KZ6A 3GDTA 4AZ5A 3VDCA 4J28A 3B9OA 4HMDA 2GVLA 1TQXA 3CAWA 5C70A 1GOIA 5D30A 3GK0A 2YIHA 3C2RA 5KITA 3ABZA 1RVKA 1B4KA 1TR1A 2ZXDA 2FLIA 1GW9A 1C3FA 4B2DA 1EL3A 4NG3A 1CXHA 4ZEPA 2G0WA 3ME3A 1S39A 1Q2SA 1TV2A 1Q6DA 4TUFA 3P3BA 1EQCA 1LRTA 1ZALA 5DCEA 4E0CA 5A6BA 3TKFA 2FJUB 5LNRA 3UXIA 3T2PA 3CHFA 4TV5A 3W83A 2ZFAA 4KQNA 3U9IA 4NKCA 4FNTA 4HOXA 4KWOA 1RALA 1Q7MA 6ENLA 2OG9A 3E2RA 3NPVA 1VHNA 1DBTA 4M0XA 3B8WA 3NZRA 4C6IA 3DBPA 1WDRA 3GR8A 3MZ2A 1EX5A 5LNUA 2EG7A 2CLPA 3QSRA 2R6OA 1Q8JA 1SR9A 1XICA 1XIDA 1R9XA 4QAWA 3B9EA 2ZUUA 4QSFA 1KFBA 4HPJA 1JYVA 4H83A 2ZZ2A 4WK9A 4X3ZA 2J27A 1US3A 1JJKA 3W1RA 1FWWA 4IOTA 2GK1B 2GQ8A 2VUYA 1GVIA 2CIPA 5C9UA 3U5UA 1TPFA 2CITA 3AICA 4Q32A 4HZ7A 3WQGA 5EBAA 5EYWA 1DIDA 3LXAA 4EWJA 1OX4A 2W63A 4NJIA 4J3VA 2XISA 3F4WA 2G3JA 3WQWA 2QR6A 3TU9A 3UJSA 4AEFA 1LL6A 5KEZA 1K02A 2DZXA 1CENA 2EPLX 4JN6A 4PBFA 5FF2A 2VJXA 1G5AA 3WF2A 6TAAA 3NQBA 2A7NA 1ONWA 2YL5A 3ZZ1A 2VFHA 3SJNA 3KBMA 3GXNA 3SIZA 3KBJA 3P81A 3VCCA 1IIHA 1HJWA 4YCPA 3QC3A 4D8ZA 3IWPA 5IFTA 4AWUA 3EPNA 2BNJA 2DUZA 2ICSA 4C6LA 1XD0A 5FI8A 4J9JA 2VI0A 4JEQA 2PLCA 1BF2A 3VNJA 1MQQA 3GNDA 3HMJG 2FH6A 1UD6A 4HTBA 4DI8A 3UCCA 3EWDA 3ITLA 5CPSA 1E1CB 5G4WA 4H7CA 1Q4NX 4LBRA 2E68A 1TV8A 2Z6JA 3QEZA 1SO4A 2X7VA 2OOGA 4GI8A 4LBUA 5DY2A 3FVMA 5CBIA 2ZUMA 3CHDA 1H7WA 2FHBA 1YDOA 2YXGA 4BK9A 1S2WA 1OYBA 1EO5A 3S1GA 4EE9A 3CIWA 1PZ3A 4X22A 3PAJA 2QMKA 4B5SA 5FESA 3VOGA 4AISA 3GVRA 2F38A 1H4PA 1JCLA 4B90A 5C6MA 5TIMA 3WK1A 2C1HA 2Y4SA 1LL4A 2Z29A 3GKAA 4KWVA 3WD0A 1YXCA 3H22A 1PZ2A 1IT7A 4O1FA 3OGSA 2W91A 4O12A 3KRUA 4FIRA 2V5CA 4D2JA 1W3TA 4D6CA 5BRQA 4BI5A 3NGJA 1ZLPA 3EX1A 3ZJ7A 1SJCA 4IJBA 3NXFA 2QS8A 5M03A 1ZBVA 5L9FA 3OO2A 4H00A 4O0KA 2FPTA 2HPMA 1Z7AA 1LP6A 3WD2A 1GGOA 2VFEA 2ALDA 3UXLA 2I9EA 3NDZA 1FFQA 4NL1A 4H3DA 1O68A 2Q71A 5AYYA 2J6VA 2VHLA 4IGMA 1DXFA 2V69A 4A05A 3MZNA 2FZ8A 1O66A 4JDYA 4MJMA 3RMEA 5IHRA 1YEYA 4FX6M 3KLKA 3T0TA 4UB9A 1HXJA 3ZT5A 4XZIA 4W88A 2BVYA 4GUGA 3SGZA 3N1AA 1O1HA 4Y6GA 4IGSA 3VIKA 2BY0A 2AAAA 2V8ZA 3H21A 4B3LA 3ARSA 3LK6A 4UZSA 4B3KA 3SRDA 4OGZA 3NSXA 2QUNA 1CECA 3BWWA 2V82A 1ZBWA 3UR2A 2OEMA 5I0DA 1HGYA 1E5JA 5CKSA 4LUIA 2REQA 1R7AA 1AFSA 1NVMA 1FWRA 4LJ3A 3OG3A 1Z42A 1LLWA 3FFSA 5C2GA 3W7RA 2XVKA 4B3ZA 1MVYA 5JUVA 1V6VA 5H8MA 1W1YA 4ORIA 1R3TA 2GVEA 4FNSA 1TQJA 3RAOA 4I7VA 2IPWA 2QT3A 1LL7A 2UY2A 2CETA 4RKAA 4RPQA 2PDWA 1LRNA 3SAZA 2AL2B 3QC0A 4G7EB 2TPSA 2VGFA 1B0IA 3A5VA 3LBOA 4D72A 3URNA 3KHJA 4XAFA 3TFCA 5LSMA 3SI9A 3N19B 3TYBA 1R6WA 2BOEX 2DT3A 3N2MA 3QJAA 1F6PA 2VZVA 1VZWA 1EUAA 1PDZA 1ZUAX 2Z7KA 2VGGA 5E9AA 3URQA 1WAUA 2VKZG 1M7JA 1OD8A 1TUXA 3SDOA 1H1YA 1DJYA 1KQYA 1DQXA 1M65A 2W3ZA 1Q66A 3WH5A 3MSGA 2VOMA 3QHOA 2PDMA 3SEPA 3OHMB 1FWAC 3MW7A 2BOGX 1UOKA 3SUUA 4F79A 2YA1A 2D69A 4LEFA 3W84A 1MUCA 4C7GA 3LSCA 4TX6A 5AYIA 3BAXA 5EA9A 1OFRA 5CPMA 3HQNA 3VKKA 4JDBA 1JCJA 2X0YA 3VUSA 1WXYA 4ZO8A 3S83A 3AHVA 3TNBA 2QUVA 4DBUA 2ZZ1A 2WB5A 4UMBA 2I17A 4IX2A 1VD6A 3BL3A 4O1CA 3A12A 1YLVA 4RE4A 6XIAA 1OCBA 3OGRA 3BXWA 4O17A 3V5OA 1P7TA 5HQEA 3QTGA 1X1OA 2QIIA 5I3KA 1BKHA 4WD0A 1OC5A 1E1EA 4KESA 2YW3A 4M5PA 3O15A 4EPEC 1DPMA 2RGLA 2DUAA 1T41A 2C13A 2J47A 2P88A 4H8HA 1ZFJA 1WKFA 2QAPA 2NZLA 1Q6LA 4A2RA 3UY7A 3BOXA 3H2OA 3ZLFA 2GGEA 2F8QA 5LYRA 1PTDA 1H2JA 1F07A 3QHNA 4NZ1A 2IKGA 3NL3A 3PTQA 1IHIA 3RO6A 3GG0A 3PSWA 4QSHA 4FPSA 1W1PA 4PTVA 4DAFA 2HRWA 4I5RA 3TCSA 1M68A 4KBXA 3T44A 3N6HA 5JU6A 1EYWA 2VR2A 2W9MA 5I02A 3PB0A 1EFZA 2D2GA 2PF8A 5T9CE 1S1RA 3I4KA 4XISA 2PP3A 4ZQPA 1R7OA 2WSPA 5CZJA 1GVFA 3A9IA 1XGDA 1H7OA 1BAGA 2RDTA 1K8ZA 1WKEA 1XSJA 1EC7A 1JYXA 1LTDA 4GINA 1ZJBA 2MUCA 3QGKC 1QNOA 6REQA 5EFFA 5AYBA 1Q2RA 3CEPA 3B8DA 4JQ1A 3I7QA 4LCRA 8XIMA 1DE5A 4K1WA 4CVUA 3OVGA 3WF1A 1GVRA 3W38A 5DRIA 1OFQA 2QYGA 4GQ0A 2QLYA 1CLVA 3GDKA 4QG9A 4V27A 3S2LA 4PMDA 3IUIA 5FACA 1S5WA 3SSJA 3TCEA 1GJUA 3EOLA 1UP3A 1I8JA 1M03A 2V0TA 3DFHA 2YL9A 3TH6A 4HNCA 2A3CA 1YDVA 3M7SA 3PUDA 1GQKA 3W73A 2CZFA 3BQ6A 3MPGA 5E0FA 1WKDA 4S3JA 3RCMA 1LROA 5BXRA 4NAFA 4NHVA 4YL2A 5I03A 1V0LA 4Q8VA 1ISWA 5CAHA 4ZO6A 3DDMA 1EO7A 4PCPA 3MVTA 3ERPA 1H09A 2MANA 2R1NA 4GFIA 3M41A 3TJ4A 3S2JA 2NLYA 4MJ4A 3HQ1A 1CEOA 2IKIA 5D37A 2DEPA 1POKA 4L9XA 3UD6A 3BGAA 3NQAA 2XN2A 3NM1A 4H9VA 1NARA 3DN5A 4H6QA 3USZA 4OHQA 7ODCA 2FMNA 2VYOA 1HKKA 1WBHA 3NFUA 1HNYA 1V93A 3AXXA 4JPGA 2XM1A 1O5QA 1S1PA 3O16A 5IRPA 3VGHA 4JYFA 1TWDA 1W3NA 1KTBA 4R27A 1X1NA 4IMGA 2J9YA 2NQLA 1FWHC 4O4VA 1UKOA 4P7LA 3HFYA 4ILSA 4U28A 3TX9A 2W5FA 4UQCA 1F6KA 1SUXA 3A13A 3C2OA 1F4HA 1W3IA 4FEZA 2CW6A 3W7MA 1H41A 1ZU8A 3W1XA 1NOWA 2O7SA 2W4XA 1V6XA 1EHNA 1V02A 1AG1O 3STGA 1XIFA 4Q6XA 4Q6JA 2D0GA 3RPDA 4JTUA 3ABSA 3N2TA 4W84A 3WYZA 4J27A 3FW6A 3THDA 4K7VA 2OLSA 3GNPA 4YMZA 2VGBA 5JIWA 3BW3A 3TW9A 3CQKA 3VMNA 1DOSA 1OFOA 1WZLA 4L6OA 4XZBA 3HBLA 1VBJA 2DSZA 2PDGA 4ZVJA 1GJWA 1V4YA 3VM5A 4DWSA 1DE6A 4MFEA 1H5VA 3TR2A 3T0BA 1EDTA 4LUTB 3MS8A 1TREA 1DIEA 5HPOA 2WSRA 4S38A 3R94A 3MCOA 3NM3A 1S5TA 3F4NA 3VZZA 3PPGA 3PJXA 5FA5A 4B92A 1KXHA 3DYOA 3ICJA 4XZLX 5LZLA 4HPHA 1YTKA 2FH8A 2SFPA 1PWLA 4CKQA 1YXDA 1A53A 2ZXBA 2BFGA 2FGZA 3W7NA 4E3VA 2BVTA 2V38A 1XRFA 3M0YA 1TZ7A 2HXTA 3N6JA 2XH2A 1U22A 1W54A 5FJIA 4DF0A 2GJPA 4WJEA 3VNIA 1U33A 1FXQA 4KWSA 3P82A 2D22A 3VVGA 4W86A 3WL0A 1FDJA 1KM2A 1RPXA 3NDOA 3O8AA 4TVUA 3S46A 2X1TA 4YLWA 2J7BA 3DXIA 4OV9A 2E28A 2WCAA 4GZEA 4BQ3A 3T08A 3BSGA 3HPFA 2DJXA 4J40A 7XIMA 3V36A 1QW9A 2Y62A 2BXVA 5CEWA 3TVAA 2E5CA 2VQUA 3E0LA 4Q8TA 2VZSA 1GONA 4MPQA 1J0JA 3V75A 3AMLA 4MY9A 4H9TA 4P7OA 3W2UA 2GVJA 1DJNA 1MW1A 5REQA 4PCTA 1XXXA 1W3LA 4PUMA 4ZTYA 1H51A 1GQLA 4N02A 2R1LA 3SCSA 4XTDA 1FCUA 3BG3A 3G1YA 2VENA 1R85A 4NY2A 4TO8A 2DQWA 1UIOA 3HGOA 2V67A 3B03A 5CC7A 4OBRA 2JQXA 1E6NA 1LWIA 3EWZA 1XDMA 4UQ9A 1LT7A 3S5OA 5FJRA 1XF0A 2A21A 2ZDSA 4XZHA 1S5VA 3CHEA 4QE4A 3NO3A 4N2YA 1LQ2A 2H3BA 3GVGA 4JL1A 4HYVA 4EKJA 3WJYA 1IWAA 1EJWC 5FKYA 2OQHA 1NY1A 2J13A 4B5XA 3CV2A 4NU7A 2EG8A 3F5JA 2OYLA 3TN4A 3ITOA 1LWHA 4C60A 2YCLA 3UZZA 4ENLA 3E74A 1VFOA 2J9ZA 1BWKA 4QAIA 2VGIA 4JX5A 1GOQA 2Z25A 2WAGA 4GVHA 1V3MA 1N2VA 3CAKA 3VKBA 3E5BA 3LG3A 4HQVA 3NUKA 5I3FA 3IRSA 1J0HA 1W3KA 3WLMA 3CUIA 3JU2A 1IGWA 1GEHA 5HBFA 5GNYA 4AH7A 4DELA 1L2UA 2PTWA 3GG1A 2ZUTA 4IGHA 4GJIA 4XZMX 1W2VA 3CM4A 3GXTA 3EDKA 1QPRA 1X97A 2V2CA 3BZGA 3TYZA 3LENA 1R2RA 3KFTA 1ISYA 3KBVA 3VA8A 3D46A 3K46A 1AH0A 1OGBA 2VWTA 4CU6A 1FP8A 4AD2A 3IGXA 2V5DA 4XKMA 2PA6A 4N7QA 1B3WA 1CX9A 3PZOA 3QHMA 4US6A 1PO9A 4PEEA 1DQUA 1QPKA 5CSYA 3VGFA 3P2VA 2J79A 2VZOA 5CZSA 3W7QA 4QM1A 3MCNA 4FK9A 1PZ0A 3CZ8A 4TU1A 1O5KA 2NQ5A 5I3HA 5F2MA 4XKYA 4LV4A 1JI2A 2ASHA 4BI7A 1EP2A 1FA2A 1KRMA 4CVWA 3SY1A 4IXHA 2BB0A 1Q45A 5A8PA 1QVBA 2PB1A 1I9CB 3APTA 4FMVA 4RV3A 1XGZA 3C4UA 3P0XA 1RQHA 3Q2DA 4RZ5A 2WBKA 3F4VA 1K6AA 2V2HA 4XUGA 1C93A 1JCTA 4H01A 3W23A 1E3ZA 2ACQA 3DYMA 3IJLA 3CC1A 3VGDA 2X0HA 3KOXA 4S3BA 2I1OA 1SW0A 2AAMA 2YZRA 5A94A 3LA4A 2UZ9A 4ZZ9A 4C6EA 1NF0A 5G2IA 3N2OA 1RQEA 1POJA 5JBDA 4LUSA 3F5KA 1XIHA 1F8IA 1WZKA 4E2DA 3KDOA 1V7YA 5CG0A 4HIBA 4O0QA 2POZA 1YYAA 2QUMA 1U30A 3PZVA 4AW7A 4HSOA 4JYDA 2NLIA 1IE7C 2F6XA 3MHFA 2OELA 2QDGA 2PRHA 2J88A 3H8AA 3DEQA 2XU2A 1JPKA 3WMSA 2R1KA 5A1AA 4J2MA 4GVIA 4ASTA 4ACZB 5CSSA 2ADAA 3U3HA 4G1NA 2P8BA 3BMXA 1RH9A 1XFCA 4Y90A 3BLKA 5FAGA 2BVDA 1XLBA 3UWYA 2Z1SA 2WCGA 3PJUA 4S3EA 1TPB1 1R9YA 4DJEA 2WSKA 2ALRA 4C6NA 1LZOA 2BP1A 4PSRA 1JIBA 4RCXA 1ALDA 1IXNA 4L1XA 1Q65A 4OBTA 4AVFA 3GDRA 2JGYA 4ZO9A 4X61A 1JI1A 1KFCA 2FPVA 1A5MC 4PEKA 3KLLA 3VNMA 5J5RA 3PZGA 5CGMA 3R25A 1W1VA 4Q8PA 4NAEB 4PTNA 1W3HA 2OYKA 1JGIA 3OVQA 3R12A 3PSVA 2ISSA 1E43A 4MJ2A 4Y8FA 4ADTA 5AZ0A 3KP0A 2X1RA 4ORMA 1UMYA 2PMQA 1V8EA 2FMOA 4GNJA 5JH1A 1CGXA 4LCQA 4Y9OA 1NDVA 4YU1A 3W88A 2YDRA 1A5UA 3GW0A 4Q8WA 2YA0A 4RZ4A 3WLOA 1EJUC 2E4TA 2WM1A 1YPFA 4L4MA 1RY0A 3V16A 2CEQA 4A29A 4V15A 5H6HA 3ABRA 2P53A 3Q4DA 4Z0SA 4NYYA 3H2MA 4IZGA 3ZWSA 2G8ZA 3UEQA 4H19A 4AWSA 3GHTA 3LXBA 1FXPA 3NR0A 2AL1A 4NRSA 1EGZA 1V7AA 3VD3A 3BURA 3LMZA 1JD9A 2XIBA 2ZC8A 3WNNA 3U6WA 4JNZA 3H2EA 4P5UA 2VFIA 3NCOA 2IPJA 3ABQA 3ZT7A 2YL6A 4CNUA 1VEOA 2J7EA 4Q3MA 3E38A 4IISA 5FJPA 3RMJA 4EXQA 5FF0A 2BX7A 2QCDB 4WIWA 4A8IA 4UNKA 1FWGC 1QNRA 2V3FA 3VXGA 1YQ2A 1PX3A 3O9NA 1TKKA 3UU0A 4IFKB 2ANUA 1SYTA 4I3GA 4QRNA 3AXMA 1MNSA 4AWTA 1ZP3A 5LIUX 2E6YA 4QXIA 4XX6A 1XYCA 2VRQA 3N13A 1F4AA 2ZWZA 5BOFA 5F7UA 4PCFA 1UQYA 2ISWA 5AHLA 4GVFA 2E67A 3VMPA 1TCMA 1YNYA 6XIMA 4W89A 3WK2A 4AXNA 3GZAA 2ZXAA 2QMJA 3OLIA 3BJFA 4GUHA 4KEVA 3WH7A 1CXFA 5JIPA 2B4GA 3E12A 2WQDA 1J96A 1FWTA 5HANA 2Y63A 1H5YA 3QOKA 3C2EA 3KRBA 3FAXA 5A6TC 3PZ9A 1CGUA 3BOLA 4NZJA 1F3WA 2Z1BA 1VFFA 2CLLA 1WOAA 3VABA 1E4LA 4AB4A 4HCDA 4N4PA 2EKCA 4FLQA 3ZYZA 3C0SA 5KETA 4AYSA 4TVDA 1C9DA 2DZBA 4DY1A 5A69A 1YADA 2CXEA 2PGRA 3BW2A 3LPFA 2YXOA 1PAMA 1NP0A 3FDGA 1AD1A 4MKVA 4C1NB 1KM0A 4JTKA 1FWNA 3ATZA 3THAA 3MSRA 1A80A 2XVNA 5J8LA 1YW1A 2OFJA 2WMGA 1V08A 5FIPA 4AYGA 3SFKA 3CQJA 1C7TA 3V0TA 3CEUA 2EQDA 1KLYA 4Q7NA 4GKLA 3T09A 1U5VA 5HNUA 2ZRVA 1I1XA 4B15A 3OLDA 5A95A 4H6EA 3E0FA 4YWIA 3W1LA 3ZR6A 2QEZA 3OPSA 2DUXA 3SRKA 1QNPA 4NZCA 4YJ5A 4IG2A 3YPIA 3LNPA 4Z2LA 3WSUA 5E0KA 1UKQA 4K8GA 4XBKA 1G67A 5A2CA 4WY0B 1UKSA 3KL5A 4MKSA 3ARTA 3WLHA 1XJBA 2V5LA 4V1XA 1UCWA 3CQHA 3EA1A 5FF4A 1GYNA 3W1NA 3JW7A 3H54A 2PDLA 2V3GA 4R7WA 2FHCA 4JKMA 4BZYA 2PDNA 1NSJA 1BWVA 1FX6A 3LTSA 1ZGDA 4DNMA 2HE8A 3QH2A 2UBPC 4W8LA 5HINA 1U1JA 3R4IA 1S3TC 4J5NA 2ZVRA 4W7UA 1UR9A 3GAKA 4DO6A 4GXMA 5CC6A 4O15A 4LEQA 3TEVA 1O7AA 4ZXOA 4B5WA 5DMNA 4GGBA 2YBVA 2G97A 5DRCA 1J6OA 2EPMX 3MANA 4JIHA 4KPLA 4GD0A 1CW2A 2H6RA 1QI2A 1PKYA 1KFWA 4O54A 4C6OA 4RW3A 2PP1A 4PULA 3RLUA 1SJDA 3NZGA 1TPVA 1BGGA 1TV5A 1GHRA 3MJYA 5AVHA 3Q37A 1TIWA 4PL2A 4MGGA 2WLYA 4A22A 4BHYA 3UQNA 2NV9A 1LUCA 3PS7A 1TE1A 3I7RA 4GISA 1DXIA 4IMEA 2QXWA 3AHZA 3ORWA 1BFNA 3I6TA 4US5A 4LS2A 2KX9A 3WNLA 3QQWA 4JCLA 3P62A 1PEZA 1MYRA 2CZEA 2VC9A 2DZUA 1XL9A 2ZDRA 1JPHA 5AECA 3GBDA 1TWSA 2DPEA 1FQ0A 3B04A 3GXPA 3SQMA 4I7WA 1ME7A 4LRTA 4M51A 3OEXA 5G1MA 3M47A 5HNNA 2OQLA 3O2LA 1PX4A 3QMTA 2CLOA 4MDOA 3RUBL 2QPSA 4F2UA 3RCYA 1XDJA 3C8FA 2AQVA 1BSIA 4GQGA 3NZQA 3N3MA 3HG4A 4GIYA 5H91A 1BXNA 2OVLA 4LVGA 1QNQA 3JVAA 2W0UA 4RZ6A 5BOOA 3AROA 4GX9A 5DX7A 5EL1A 1TB3A 4UQEA 3VAVA 3W81A 4ERGA 3CV1A 3EXRA 1VJSA 1J9YA 1LQ0A 1Y5XA 2CBVA 2CCRA 3S6OA 3P80A 3LHWA 4G5DA 5BW6A 4Z08A 1AW2A 4WKAA 4MKNA 4H9MA 3B8SA 1TSIA 1ENUA 1ODZA 3QV7A 4RDVA 3RN6A 1FVPA 2A85A 4QJ4B 3HTWA 4GO9A 2Y85A 3ARRA 3NPWA 1DYSA 1KXVA 4IIDA 3SCUA 3ELFA 1PKMA 3ANUA 4JFUA 3B05A 4QNWA 3ZT6A 1OZQA 2FTYA 3NZ1A 4J3ZA 1VHCA 3NZPA 4PBEA 2WBGA 4ACYA 4CNNA 4DRSA 2DZVA 4Y9NA 4GMEA 2BXZA 3S5ZA 4V2XA 1VEMA 5C5YA 2AGTA 1JQVA 2X30A 2A2IA 3D5HA 2JK2A 1K7XA 4KRUA 1ITXA 1Q7QA 3IUDA 2Y7GA 2PP0A 3B3DA 2IKHA 1I2RA 3KL0A 1VBRA 4DBEA 1Z9AA 3IJ7A 4PC8A 2W92A 3WLTA 1OQFA 1EKOA 3NQMA 1IWBA 4MWAB 1QHZA 1DEDA 1VKFA 3R10A 4FALA 3QV9A 3R0KA 4CNOA 4ZGYA 1KFJA 2BVWA 4JIQA 1KM1A 4HA3A 1VPQA 4PCNA 3CH0A 1R3RA 2FZBA 4I90A 5KZMA 3CIXA 2HDJA 3SM0A 4YTRA 4YYCA 4O57A 4LX4A 3SQLA 3FYPA 2W79A 5D9MA 1SR0A 4CCZA 2YBTA 1SZRA 3MO7A 4IICA 3CZJA 3T55A 3MB9A 5G4HC 4XUYA 2ZZ3A 4I7UA 1CGYA 2FDMA 4Z2GA 3XIMA 1UWRA 4QS6A 4D6GA 1TJ1A 2BBFA 4PL1A 2C6QA 1KM6A 1HJUA 4KWWA 1I1WA 3MSYA 4MMWA 5AY7A 4C1LA 4L80A 3CWNA 1HKVA 4W8AA 2YOCA 4U33A 4JCMA 1JVNA 3VD5A 5AHFA 4X60A 1UJPA 2VVSA 2YA2A 3Q94A 3JR2A 4PODA 2VFGA 1HL9A 5J5DA 1GT8A 4LVAA 2HQAA 2QUTA 3ZR4A 4GJJA 1BKSA 2WNWA 3N4FA 3QBUA 3VIPA 5ENLA 4DUXA 2CLEA 4GHRA 3WK0A 2QCFA 3WDPP 2ZBTA 3WQ8A 3EGJA 1WDWA 1SJAA 4F0HA 4D6DA 3ZS4A 1OG6A 3TXZA 1XG3A 4HD5A 2PC4A 3E3HA 2RJHA 1GZGA 3NDYA 4IMFA 2DSWA 3DENA 2FKPA 4Z2KA 4N9CA 1HJSA 4GQBA 3OLGA 4MY8A 2OXNA 5HATA 5HMSA 4A35A 1OD0A 1XLKA 2XFWA 3COTA 5C55A 1GTHA 1BYCA 3NQ7A 1XHGA 3TW6A 2HNEA 4O1AA 3RO8A 2ZUSA 4LGXA 1VLIA 3SIMA 3AUOA 2VZTA 3KCJA 1GJPA 1XFBA 2V5BA 3W3OA 5CAKA 4Y9MA 1DIKA 4H2HA 1PKNA 5HMDA 1NDYA 3B4YA 2QGYA 1XSIA 4KRZA 4GCAA 3BLEA 3AIUA 4K68A 4GX8A 1EJVC 2FZMA 4BQ5A 1R3YA 3W7DA 5I3JA 3AXIA 3SY5A 1H3GA 5DN1A 2PD5A 3BARA 1XBYA 3PNZA 3L65A 3AOFA 3HO8A 3PWAA 3RJXA 1F6YA 2PDCA 1KB3A 4WXYA 3STCA 5JVLA 3KHDA 2G41A 4E4PA 4FF7A 4EPDC 3TIMA 2X40A 4V1YA 3BMVA 4GBDA 2C79A 2BSLA 5D8ZA 1TPC1 2DGAA 1XLHA 3IPWA 5I3IA 1VYSX 2QJHA 1KWGA 1ZTVA 4X0NA 3VIIA 3DKJA 3DG7A 4DJDA 3T8QA 3OYZA 4MAVA 4RUBA 4QFUA 2ZICA 3OA3A 3RDKA 1XD1A 1ZAJA 1JYWA 5HR6A 3HF3A 4TMBA 3V3WA 4FR1A 4GK8A 3TP4A 1S5MA 1F3EA 5CCZA 3WLKX 3MUXA 2X2GA 1CGTA 1Z69A 4E6MA 3LNMA 3WDHA 3SFWA 3A23A 3WH9A 1JZ5A 2ISVA 4D6JA 1QPNA 4LT9A 4NVTA 4PFHA 4IL0A 4HOZA 1DV7A 1VYPX 2G50A 3S42A 4FX8A 4UNLA 4H7VA 1XLLA 1XYZA 1NM9A 2Y0FA 4DM1A 3AC0A 3GE7A 2WWDA 4Q22A 3THQA 3WENA 3BPWA 5GJPA 3T2QA 3PBYA 2XIMA 4XD5A 5A2AA 5LA1A 2NXIA 2X1UA 3EEGA 3BGJA 3VNLA 4KT2A 2VP8A 1WB0A 1V0NA 5BXTA 1W5QA 1VJIA 2MNRA 1V5XA 5HPCA 1I2OA 3WD1A 2NUYA 2A0NA 4FSAA 4M1RA 1FRBA 4P8XA 2HTMA 4K7YA 1J11A 3R2GA 1VFUA 5ABFB 5BNKA 1JRCA 3EWBX 4S3DA 1DIOA 3N6QA 2P10A 1AH3A 3B06A 4QR6A 4NP7A 3OZMA 4J1OA 3L68A 1UASA 2BLEA 1QRQA 1UZ4A 2BY1A 4FX7A 2NV2A 2CZVA 2ZCGA 3HMCA 1HO1A 1JQXA 3LS9A 4AUBA 3CU2A 4CUCA 1P1XA 3IEBA 3PJWA 3WDQA 3LUTA 1OB0A 4NUWA 1RCOB 3KCOA 1EOKA 4NQ1A 3UZ5A 3LLFA 2HMCA 4UTTC 4H6RA 4JQ3A 4OU1A 3GU1A 4WKFA 5SWUA 5LXXA 4L7ZA 4EPKA 2XG9A 3PF3A 1XP3A 2OO6A 1FHLA 4MUPA 3UR5A 4R9XA 1MZHA 4YWSA 1UR0A 3ARPA 3IIZA 3HFTA 5BOEA 3TOYA 3VX0A 3GTIA 2C15A 4E8GA 4ICMA 3A3WA 3W37A 4H41A 4C6MA 1JGMA 2XJ7A 3B97A 4IPJA 3RFAA 1D3CA 1RV8A 3CLWA 2AL2A 4G7EA 1ZQ5A 5B80A 3B0YA 4LPCA 3CUFA 4AHQA 3KXQA 3CL7A 5ABEA 2YR1A 2ZRWA 4DXVA 5F4WA 3EXTA 3PWIA 2G37A 5AOUA 3M7WA 2E8YA 1SSDA 2GSEA 3FA3A 3I6RA 3TE9A 5A8GA 1M9HA 1IV8A 1JG9A 1P0EA 1UPPA 3B4UA 4QGCA 3BE7A 3T81A 2Y6ZA 3OQ8A 4AWEA 5F2GA 3ITCA 4UOQA 3M5ZA 3QGAC 2DQXA 4OT7A 4HU0A 4REQB 1A5BA 1HKMA 3WQ4A 2O56A 2TRSA 3ZR5A 1GOOA 3W7GA 1IXOA 2WJEA 4M1BA 3CMFA 5I06A 4H8NA 3HB9A 4PRRA 3BLPX 4QJ1A 3EB4A 2VFFA 4YYFA 3G0SA 4MWAD 2TYSA 4QJ3B 3VOCA 3RM4A 1EH9A 3FYYA 1GTEA 3UG4A 3VE7A 3BCDA 1ZPTA 2WVTA 1K8CA 4X9SA 2XPKA 5FJTA 4J3TA 5C7HA 4J3XA 2ZC1A 4LF2A 3BUVA 1Q63A 1DXEA 1RPKA 2BS9A 4JNMA 3OVRA 4O53A 4ZB0A 4HPNA 4DXKA 2VEPA 1I0DA 2QZRA 3BJSA 1NDWA 3O6DA 1SGJA 4GYPA 1WDDA 3W1AA 5DXYA 2GFTA 1XH0A 4D9PA 4XBJA 3CQ0A 3OU8A 3AZSA 4JTTA 3LSBA 4FXSA 1XPYA 3ARQA 3W72A 1B31A 1A4LA 4DJFD 1UMLA 1N55A 1V0KA 3VUPA 2NQZA 2BGNE 2OMAA 4BCEA 3ITVA 1FWEC 1TRIA 2C91A 2XVPA 4MF4A 1B2YA 2AMGA 1K6WA 3KTSA 2OSWA 4PMJA 1P4CA 2WVUA 2C16A 5F1UA 2GSHA 1V3KA 2PLKA 2D1ZA 1LG2A 3QPEA 3ID7A 3KEHA 1WUFA 3ZVHA 3VTRA 4H1ZA 2V30A 4TQTA 4I9TA 4U5IA 2X7WA 2WZTA 3W2MA 2JE8A 4S3KA 3UA3A 4MNLA 2WC4A 3QV6A 1EIBA 3SQSA 3L4UA 2Q8XA 2Y7DA 2PWDA 8A3HA 4QE1A 4J3SA 2WYSA 1XV8A 3PNUA 4ZB5A 3EZ4A 1A50A 1GKRA 3EDJA 3BAIA 2VX6A 2YFNA 4IP5A 3CHVA 1AQFA 2ZUNA 3R8GA 1K1DA 1Z8AA 2VRJA 4S2CA 3FY1A 3TYEA 3LHTA 2ZXQA 1NWTA 1RCQA 1TMLA 4B5TA 2WANA 2CBIA 1L6WA 3CYVA 1NJJA 8TIMA 2ZTKA 3S47A 2P50A 4ML9A 3R43A 3NIYA 3GNRA 3NG3A 1KD0A 1A49A 1SMDA 4LAZA 1EWEA 3ES8A 1Z48A 1OX4B 1UP0A 3PFRA 4ES4A 5CQ1A 1O5RA 1XDLA 5CJMA 2IW0A 2O7QA 3AFBA 4MNJA 3GR4A 1J18A 3O07A 3DHUA 3KTCA 3WDIA 3WD3A 1KBIA 1PYMA 4XV0A 2YPIA 4NRRA 2HNHA 3B9DA 4GFSA 1BG4A 1L2QA 5CH9A 4M19A 3E2QA 4CEUC 4XK2A 1TPH1 4RE0A 3RX3A 1E6XM 1GVQA 3FKKA 2W62A 4BF5A 5AYXA 4Z42C 1YKWA 3UNTA 1V3JA 5BU6A 5JBFA 4CD4A 4FNRA 3QQ0A 3T40A 4LYKA 3URAA 3ZIZA 4JTDA 1IF2A 1B1YA 2BY2A 3M0XA 1X8CA 3H24A 4F3HA 1JD7A 3LV5A 4KFOA 4FNPA 3UZWA 3DI1A 2OZ0A 2V2DA 4H4IA 2PU0A 3M5XA 4HSHA 3HPSA 4X0VA 3SURA 3S6TA 4DM2A 4ERIA 1I75A 1HGWA 2WV8A 1PUDA 2XZ9A 1ZNNA 3ARWA 4JHOA 4UUIA 2EKGA 4AD1A 3R89A 4PMUA 1SO6A 3DBNA 3A3HA 4HMNA 2PDIA 5CGQA 4IJRA 3NSNA 4JZ5A 4IIEA 3VKCA 1W9UA 4DYJA 4DPQA 3E2VA 2BG5A 1WDQA 2ABBA 3RITA 4P8UA 3GTNA 4EF9A 3WLQA 5CBJA 4MWAC 1U1HA 4HCLA 1J0IA 4CQDA 1HJVA 3VNKA 3W1MA 1PJ9A 3FVDA 2RDUA 5MKGA 3LRKA 1QNVA 1E4MM 2Y61A 5CSUA 3HJZA 1YE4A 4H9XA 1WYIA 4E2OA 1BXCA 4YTSA 3O6CA 5DLCA 3N29A 3NURA 3AALA 1Z89A 4RDWA 2NX3A 1B30A 1G4SA 5I3DA 3S3GA 3TQKA 3LGEA 3EX3A 3S9IA 2CWXA 3LI0A 2J8GA 3HM7A 3CASA 3ES7A 3KBNA 2UV8G 2J6XA 4GCXA 2E25A 5HWJA 1PPIA 4BWLC 1KLZA 5A6LA 2DVTA 2C1GA 4I5UA 4WY0F 1PIIA 3I6EA 3N04A 5A6KA 2IUZA 3HG2A 1XG4A 4FLOA 2ACRA 4NJKA 4UFIA 5ABGA 1QCWA 1L8PA 4DJFC 3IVTA 3NWRA 2I14A 3LTYA 1RLCL 3M5VA 4MWAE 1OFBA 1RA0A 3L5AA 5HR7A 1QDSA 1YTEA 1BTCA 2ODOA 4A3RA 4F0SA 1PTGA 3KS5A 2HK1A 4JTAA 3WUBA 4Q7IA 1HF6A 1I2QA 4A8RA 1LOLA 5HJYA 1ZL1A 4UOJA 1X38A 2KZHA 3Q58A 2D24A 2I16A 4PMZ