1ZGDA

Chalcone reductase complexed with nadp+ at 1.7 angstrom resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIELGLVTRDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVRKGASRGPNEVMENDMLKEIADAHGKSVAQISLRWLYEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKIAQIKQNRLIPGPTKPGLNDLYDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural elucidation of chalcone reductase and implications for deoxychalcone biosynthesis
pubmed doi rcsb
molecule keywords chalcone reductase
molecule tags Plant protein
source organism Medicago sativa
total genus 99
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zgdA00
3LD5A 3H4GA 4NKCA 4XZNX 4QX4A 3M0IA 4IGSA 3CMFA 1VBJA 2PFHA 3Q65A 3QKZA 1XJBA 3R58A 1PZ0A 2BGSA 4JQ4A 2CLPA 4GACA 1PWMA 2FZDA 1FRBA 3G5EA 3UWEA 2PDLA 4QBXA 2INEA 1Q5MA 3LZ5A 1XGDA 1ZUAX 2PD9A 1HW6A 1M9HA 3DOPA 1HQTA 2PDMA 2NVDA 4XZIA 4JTAA 1UR3M 3BUVA 3ONBA 2FGBA 3VXGA 2IKHA 4XZMX 3ONCA 3EAUA 3UFYA 2IPJA 4LBSA 5JH2A 2VDGA 4WDWA 3LQLA 2PDXA 1RY8A 4LBRA 4WRHA 3GHSA 4JTQA 2HEJA 2PDKA 4YS1A 4F40A 3EB4A 5HNTA 1XF0A 1ZSXA 4JIRA 3GHUA 4Q3MA 2PDQA 4IJCA 3O0KA 3MB9A 3COTA 2ACQA 3LN3A 2J8TA 4FAMA 3KRBA 4PUUA 3LZ3A 2PDPA 1QRQA 3R43A 3N6QA 1AH4A 4JQ1A 4XO6A 1JEZA 4GQ0A 4YVPA 4JIHA 4GIEA 4XK2A 2F38A 1IHIA 4XVEA 3UGRA 5C7HA 2P5NA 2IS7A 3C3UA 3T42A 1RALA 4PMJA 5LIUX 4YVXA 1MI3A 1EXBA 4WGHA 4JQ3A 2ACRA 3WCZA 4GA8A 2AGTA 2DUZA 2DUXA 4XAPA 1GVEA 2PF8A 1YE6A 4LB4A 1PYFA 2PDGA 3CASA 4JIIX 1Z3NA 3UZXA 4JTRA 2IQ0A 2IPGA 3V0TA 1X98A 1MZRA 3CAQA 1T40A 4MHBA 2IQDA 4EXAA 3LQGA 4GABA 2QXWA 1EL3A 3V0UA 3N2TA 1RY0A 4JTCA 2C91A 3GHRA 2R9RA 4PUWA 1S1RA 2HV5A 2PDNA 1AFSA 2ISFA 1X97A 1R38A 1EF3A 2FVLA 3LBOA 3EB3A 1SM9A 4L1XA 1C9WA 2BGQA 3V36A 1S2AA 5JH1A 3WBXA 2HE8A 1VP5A 4HBKA 2ALRA 3U2CA 3GHTA 2IKIA 3LENA 4XVDA 3GUGA 2PDBA 2IPFA 3CV7A 3G1RA 5LIYX 3RX3A 1A80A 2PDYA 4PRTA 2IPWA 4JQ2A 1LQAA 4GQGA 5DANA 2BP1A 3NTYA 3R7MA 2IKJA 3BV7A 4OTKA 3R8GA 4WDXA 3RX2A 4G5DA 1X96A 2PDWA 3R94A 1YE4A 4DBUA 4WDUA 1ZGDA 5LIKX 1T41A 2A79A 1Z9AA 2FZ9A 3WG6A 2WZMA 3B3DA 4WDTA 2FZ8A 3MC5A 3LNMA 4LAZA 2PDIA 2PZNA 5LIXX 4HMNA 3BURA 3V0SA 3CAVA 2HDJA 1OG6A 1PZ1A 1S2CA 4Q7BA 4FA3A 4PR4A 2I16A 3M4HA 1Q13A 3V35A 4PRRA 5M2FX 4DZ5A 1AZ2A 2HVNA 2PDJA 4XO7A 3DN5A 3WBWA 4JTDA 4I5XA 3BCJA 1US0A 4ZFCA 2ACSA 4L1WA 1J96A 1QWKA 3P2VA 4H7CA 2INZA 2HVOA 1ZQ5A 2PDUA 5HA7A 4YU1A 3UZWA 4H8NA 3D3FA 2PD5A 2F2KA 3ERPA 1LWIA 4RPQA 4EXBA 4XZHA 2PDHA 4R9OA 4FALA 1AH3A 3CV6A 4DBWA 3H7UA 1Z8AA 2DV0A 3UYIA 4LB3A 1EKOA 1YNQA 4GCAA 5AZ1A 4QR6A 3LUTA 2IKGA 3F7JA 4XZLX 3FJNA 2ACUA 3M64A 4QXIA 3R8HA 3LEPA 4ICCX 1PWLA 1MRQA 3UZYA 3H7RA 2WZTA 1AZ1A 4ASTA 5AZ0A 1Z89A 4DBSA 3S3GA 2I17A 3O3RA 1AH0A 3RX4A 2FZBA 4JQAA 3UP8A 1S1PA 2HE5A 1ADSA 5LIWX 3FX4A 2PDCA 5KETA 1YNPA 2PEVA 4LAUA 3UG8A 4IJRA 4FZIA 5HNUA 2R24A 3WBYA 1IEIA 4YVVA 3Q67A 3UZZA 1K8CA 4AUBA 4WEVX 2NVCA 2PDFA 3R6IA
chains in the Genus database with same CATH superfamily
4JTSA 4NKCA 3RF9A 3L2IA 1VEPA 2WNWA 5FIPA 3R1ZA 3U4FA 3T7VA 3BLEA 3MVIA 1CXHA 3HPXA 4GH3A 3QY8A 4RX0A 3WQPA 4JYFA 4ZA0A 4HIBA 2O55A 3QBUA 1MNZA 4DJEC 3H4XA 1QI5A 4OE7A 1ZUAX 4HPJA 1Z32X 3NPUA 1P5BA 4V1YA 3S5ZA 2D1ZA 4AH7A 2UBPC 4QE5A 2WSQA 5C2CA 2VHLA 3CWOX 4Z1BA 3S83A 3L0NA 4BY3A 2GUUA 5C54A 3ISIX 4I6VA 2FGBA 3DYOA 4D8LA 2BTMA 4XZMX 6A3HA 1F05A 2QAFA 2WZEA 3UF9A 3UXAA 3CH9A 4JTLA 1LJYA 2VX4A 9XIMA 1J2BA 3PBYA 5G4HC 1OC5A 4LBSA 3T09A 3MUAA 5AVHA 1UWSA 3ARQA 1X6LA 4IFRA 1J10A 3PK7A 1V7AA 2JGYA 3WY1A 1FH8A 2EPKX 2EPHA 3E2VA 2PDKA 3KP0A 3SN4A 4A8IA 1VBRA 3GHUA 1K02A 1XPYA 7ENLA 2PMQA 3V1HA 5HWMA 3TX9A 1HKVA 3QSTA 2GVEA 3EZ4A 4XZBA 4F9DA 3FAWA 5T9BG 2YYUA 4QNWA 1ZCCA 4CCDA 3AS1A 4A8RA 1C8QA 1FHUA 5HMSA 3WMSA 3AISA 3ZO9A 3BSHA 2A3BA 3PS7A 4JQ3A 4ML4A 1A47A 3I6RA 2XZ9A 4FSAA 4L9XA 3LI1A 1XM3A 1YMYA 2WHJA 1B90A 3VAVA 2OELA 3SUWA 2Z00A 3GZ3A 1Q6DA 4IQLA 4AD3A 3PZVA 3W23A 1UBPC 1HFBA 1SO4A 2H90A 4IH3A 1G69A 1PKNA 1Y8BA 2YBUA 3CJPA 1KXTA 1W9BM 2VCBA 3P7YA 2QJHA 2QCDA 5DCDA 1RY0A 3B06A 4MJZA 3A4JA 3NZPA 2HV5A 3WLSA 5KSWA 4GI9A 1XYBA 3GDRA 1GOIA 4Q22A 2ZZ2A 5GQBA 1EF3A 1RK6A 1W3HA 3VNDA 2Z1BA 3TYUA 4F66A 2A3LA 3W86A 3H4WA 1RQHA 4EWJA 2BVWA 3HU7A 1HO1A 3I65A 3M47A 2J88A 2WW5A 3TAOA 3UJSA 2BY3A 2HE8A 3HTWA 1KA9F 4DI9A 4HPXA 4K1GA 2GVGA 8RUCA 1CDGA 1NF7A 2NWSA 3NNTA 4AD4A 4MG4A 2UY4A 2PWHA 2IXVA 3H55A 4MKNA 2NQJA 2PDBA 3TSMA 1GJPA 4E8GA 2RDWA 1TZ7A 3C52A 2QJGA 3I4EA 4G1NA 1KQYA 1LRTA 4P7NA 1NWUA 3L4TA 2G95A 1QPQA 4PODA 3WQ4A 5IFTA 4GQGA 3FVMA 2VGGA 1DIDA 3VKAA 4C6OA 3LRMA 5D33A 5DANA 1O5RA 3WH6A 2WKGA 1V0NA 3H70A 4PSRA 3F03K 3KWSA 4DBUA 3NL3A 1ZGDA 2VGFA 3BW2A 1S39A 3RITA 1K4HA 1XDJA 2UZ9A 2DT2A 1AVAA 5BWAA 2FZ9A 3IJLA 3AQUA 3N4AA 1IIHA 1YX1A 4R7WA 3TJLA 1OWQA 4JTJA 3K4WA 3L2MA 3UETA 1V6UA 3NQDA 5CPMA 1FBAA 4R3UA 2WB5A 2BMBA 3BANA 3CAVA 3ELFA 3MVTA 2B0MA 3UWUA 3U8GA 1AL7A 3OZYA 1F3XA 1DJIA 4E0CA 4UTWA 4H8UA 3V35A 1G4SA 2P8CA 1HXJA 1FX6A 3STPA 1SJDA 1NAL1 3UWQA 4Q4QA 2QUUA 1F07A 3STEA 1W3LA 2YCLA 1UKSA 2BB0A 1BTCA 2HCVA 3EWWA 3G24A 2QDGA 4HA1A 1J96A 1FWBC 4JTUA 4Z2KA 4UTIA 5A6SA 4MFEA 1OK6A 4F0SA 3S2CA 1O1ZA 4DX3A 2X09A 5E9AA 2EPOA 3CIWA 1WDDA 3AALA 4I9TA 1UUOA 5FSEC 1IQ8A 4BR1A 2X16A 3KTSA 4ATLA 2GWGA 2VCAA 1S38A 3ITYA 1UMLA 2OMAA 3TXZA 1P6WA 1H7PA 4OOZA 5D4YA 1XWYA 3VDHA 1OC6A 1OFDA 2ZIDA 3EXTA 5BOOA 1XKJA 4ZO9A 5EB8A 4HNNA 3WBAA 5CPOA 5FAGA 3C8FA 1TCDA 3ABRA 5BW6A 3QC0A 5T91A 2ZKMX 2MANA 4TTUA 1X38A 3SY5A 4DF1A 3RK8A 5E6ZA 1ADOA 3CAWA 3UWZA 1JPDX 5C2XA 3QLDA 3O3RA 3WUGA 3QV8A 4JTHA 4JBRA 2VFDA 5H8UA 1WPCA 5LIWX 5XIAA 3T05A 2EO7A 3QGKC 1GQJA 5DY3A 2A3HA 2FJKA 4WJXA 4MJ2A 3WBYA 3W1QA 4JEQA 4OFCA 4ZSTA 2DZBA 1S5WA 2ALDA 3HG3A 1V3KA 2J7FA 4QRNA 1Q2RA 3RR4A 1U1UA 1YXYA 4CQ8A 4O1AA 1RBOB 3O06A 1R86A 2CKRA 3E1F1 4DXKA 4EPDC 3GTNA 4EXQA 2XHYA 5F2MA 2EKCA 4I7WA 3LTSA 2OKTA 1E73M 3L23A 1R2RA 4B90A 2HBXA 3ZJ6A 2WVSA 1SQ7A 2C71A 2XTKA 4W93A 5EL1A 3T1GA 3GDMA 2C8NA 1BWKA 1OFPA 3C6CA 4JTAA 1LL4A 4Q7IA 2O7SA 3BW3A 5BMXA 1BRLA 3BOXA 1TV2A 5CG0A 3E38A 1NP2A 2XIQA 3ARPA 3VINA 3ANVA 4QLLA 4U2ZA 3OLDA 1NFPA 1UH3A 2G50A 1OX4B 4TVCA 4AAJA 1I75A 2NQZA 3GTFA 2PDXA 1W5NA 5LKYA 1EHAA 3EOOA 4DXVA 1VFTA 1TMHA 2YW4A 2HTMA 1ME7A 4HZ8A 3QPYA 1IWBA 2ZQ0A 3T2OA 3RPMA 4IJCA 4WLCA 1D8WA 1TVLA 4FAMA 4E2OA 2C1IA 3PWAA 2OWCA 4XKYA 3BOLA 2WPBA 2X2YA 4E4FA 2Y88A 4ZENA 3AYRA 1DHKA 4Z17A 3IJIA 1XFBA 1OADA 4NXSA 2VJXA 1EXBA 3W7GA 4I9AA 4DLMA 3OZMA 3WCZA 3WLRA 2Z2BA 3KBNA 1TWDA 3TQPA 2AGTA 3AMKA 2ZX7A 2G41A 4X2PA 4U33A 1P0KA 4AZ5A 1XIHA 2BVTA 3LLXA 1M1BA 4HPGA 3RGTA 3VIIA 3TA6A 1BQCA 1DHPA 4TV6A 4DI8A 1KGWA 3MSYA 1IYXA 3OVPA 3W7NA 3V16A 2E5BA 4JTRA 1I2OA 2ZRXA 3WK2A 1P0EA 5REQB 1GW1A 2HNEA 3IJQA 3N2TA 4CD6A 2PCQA 4AXKA 4JS3A 1JCXA 3A47A 2JF6A 3IGUA 5E5CA 3WQFA 2V5CA 1C91A 3TWBA 3KL3A 3ZYZA 2C16A 1T8XA 4NRSA 4OUEA 4R27A 4JDYA 2JE8A 1LRQA 3SCOA 2OQHA 1UOKA 5FI8A 5AHFA 4JN6A 3WF0A 2X0SA 5G2WA 2FVKA 4S1FA 3W71A 3OVQA 1I6NA 3CPGA 4IP4A 3IANA 1KBJA 1R2TA 1S2TA 2JK2A 2VMFA 3TTEA 4AZHA 3H24A 1DWIM 3BCDA 1J12A 1UOZA 1FFRA 3NVDA 3SCQA 1TPDA 3AAMA 6REQA 4PTWA 3TV8A 3TYCA 3L66A 3UJ2A 3UCQA 4UZSA 4UFLA 1A80A 2W27A 2CBIA 2IPWA 5CSYA 3DKLA 3LM3A 3T2QA 1CZ1A 3GC4A 5B80A 3S6OA 4ENLA 1XLCA 4ALDA 2W63A 2BP1A 2OSYA 2VC9A 4RZ4A 1EIXA 3NGFA 5CAKA 4IGHA 1TKKA 5JUVA 2PDWA 4L5ZA 2HXUA 3GU1A 1CGWA 1IXPA 4LFYA 3YPIA 1SZRA 3GO2A 3CHFA 3LERA 3LPOA 3VIPA 3KCLA 2A79A 4CQBA 3DGBA 4NI3A 1L6YA 2GQ8A 3NQGA 3SM0A 2HZGA 2R94A 4R7JA 3N29A 1IXQA 3B9AA 5AFDA 1GZGA 1PIIA 3DEQA 1OG6A 3DECA 2EAWA 3QGVA 1Q65A 1IXNA 3VYLA 5TF0A 3TMQA 1Q13A 4XD5A 1EX5A 1TFVA 1LORA 5TIMA 3GQYA 2VZUA 3W1XA 3U0HA 1GW9A 3WK1A 3M0XA 2XM1A 3QZAA 1P1XA 1E9ZB 2PTZA 3T0DA 1XYLA 2PRMA 4IGMA 5BXTA 1W3KA 2OCZA 2OU4A 4H7CA 4PEEA 1XIJA 2HVOA 1O6IA 1TO3A 4YU1A 2VX6A 4EOUA 1ZY9A 1P0BA 1B1YA 1IZKA 1YHTA 3VKDA 4IPLA 2WVUA 5BOFA 4AD0A 4JTKA 2YSWA 2VYOA 3V1PA 4ADTA 1QNQA 2VQTA 3CUXA 5C55A 3MUIA 3W1LA 2YCLB 4MY8A 4GVFA 1XHGA 3BAXA 1Q6OA 1CGYA 2BASA 1VYSX 3CYVA 4GX8A 5AECA 3B0PA 4DJDC 3NQEA 4W8AA 1KRMA 3SIMA 1CBGA 1UYQA 3GG8A 3TOPA 4FX7A 4X0NA 3LV5A 5I06A 3FX4A 2PDCA 5EMJA 4LAUA 1QAPA 3UG8A 4LY8A 1M7JA 4QLKA 5HNUA 1V93A 3SJNA 1NIUA 2AKMA 3UZZA 1K8CA 2PZ0A 3I7RA 2PS2A 2F8QA 4EX4A 2NXHA 3FXGA 3OVRA 4MY1A 3S4TA 2PWGA 3UWVA 1TTIA 3QPZA 3HPFA 5A2AA 4XIMA 4B15A 4UTTC 4AD5A 3E0LA 5HQEA 3U2EA 1TA3A 3WJSA 4INFA 4Q4RA 5HUPA 2QEZA 3OBEA 3GFXA 3NXFA 1F73A 5IDIA 4CUCA 2YDSA 2A85A 5DRCA 2YL6A 4NVTA 1BLIA 1J93A 1NWRA 2D0FA 6ALDA 4ZTXA 4LYKA 3HB9A 3ANYA 3F1QA 3VD7A 2WC7A 3PFMA 1MXSA 3ZJKA 3S47A 3AMCA 3BZJA 1OIMA 4RNIA 1BKSA 3FFSA 2H3BA 5CBIA 3NFUA 1AMYA 2YZ5A 3R4IA 4JCMA 3B9EA 3VDCA 1SFLA 1IT7A 3GHSA 1FHVA 3AIRA 1QNSA 1Q6FA 1YNYA 2WANA 1EJTC 4GZEA 3ZIZA 3RN6A 4C7GA 1TPEA 3NCOA 1ZSXA 4Z2LA 1XBXA 4MUZA 4G7FA 5AYBA 3QQ1A 3DYPA 3WH8A 1WZAA 3GYEA 5J5DA 1ISXA 3KBSA 4DF2A 1TIMA 1DQWA 4DUOA 3GAKA 4H04A 1ITQA 3W28A 1AQ0A 1FWRA 1QNVA 3U7VA 1PVNA 4NILA 1W37A 2AGKA 3RPTA 3CB3A 3WMCA 3SI9A 2Y8VA 5T9CE 3TW6A 3UWYA 3P14A 1GVIA 2R1PA 4GIRA 2ACRA 3WK0A 1CW2A 2XGIA 3SECA 1PO9A 3DHFA 4DJEA 1I0DA 3PY2A 2OEKA 3IV3A 1H11A 3S42A 1TWWA 1FHLA 1CXFA 3DX5A 2BOEX 2ZCGA 4KFPA 1W3IA 2QPSA 2W91A 3CZ8A 4LB4A 3OBAA 2QJIA 4A8NA 1UWAA 1Z3NA 4JOMA 3WLKX 2I57A 3VD5A 1GOQA 3KBVA 3ARTA 4OOUA 2DT1A 3IVUA 3SRKA 1ESWA 1GOXA 1Y5XA 3B9NA 4B2DD 1EL3A 4ZXLA 3NL2A 4KEVA 4KCWA 1NSJA 1XUUA 4H3DA 1OF6A 4MWAB 2YL9A 3ARRA 1E1CA 5EA9A 1ONRA 3VX0A 3ZVHA 1MZHA 1SR9A 3PUOA 3W75A 4AWEA 1IEVA 1X97A 1R38A 3CO4A 4RW3A 1ISZA 1NARA 1RLDA 3E2RA 1HG3A 4MKVA 2XVPA 4YTUA 1H3GA 4WGXA 3CS2A 3AWOA 5XIMA 2NV1A 4CQCA 3VNIA 2ZBTA 3G8EA 1CI1A 4XAZA 3NPVA 5FF3A 4A35A 2B7OA 1B31A 1XLBA 1K4GA 4NZ1A 3EWCA 2ALRA 4NUWA 3I4KA 3SUUA 3T4WA 2A2IA 2CZFA 3GUGA 3VE9A 3KBWA 3WDIA 2AQOA 1OEPA 4C65A 1W91A 3EDJA 3GX9A 1JAKA 1EA9C 3L4VA 1RD6A 4WXYA 1GVFA 1OFAA 5ABFB 4B16A 3ZOAA 3RIKA 2P3EA 2VP8A 4K3ZA 3W87A 1GVOA 1MYRA 4FXJA 1TZ9A 2O0TA 3CT7A 1JYVA 4DZAA 3TFXA 3AC0A 5LGZA 1R0MA 3LGGA 1QI4A 1LZOA 3VD3A 3H2FA 1C8YA 1JF5A 4N02A 4Q8MA 4YTRA 3OBKA 2DFAA 4AZ6A 3IS4A 3PHAA 1M7OA 1RA5A 3WQWA 3W07A 1V8EA 1FWGC 3W1AA 2OO0A 1KM0A 2WJFA 4IL2A 1JCNA 3KZSA 5FD0A 5CKSA 1DKWA 3IJDA 3TK7A 1K8YA 2XWDA 2CZVA 4GIYA 4Q7BA 4D6EA 4MDPA 4PCFA 2GJPA 3FEQA 4LS0A 3OGRA 3BJTA 3OPSA 2NZLA 2Z28A 1JL8A 3CWHA 4A29A 1YTDA 2PDJA 1WZMA 4KRZA 3ZSTA 2NV2A 1D9EA 2F7FA 3EA1A 4M8UA 4XKMA 2V69A 3AIEA 4PE8A 3BGJA 4ZFCA 3CWNA 4XWUA 2C79A 1HL9A 2A0NA 2P8BA 3S9YA 4AISA 4L56A 3B40A 4R9XA 2XFRA 2PD5A 3SCRA 2CXEA 4JD4A 3JU2A 3GNDA 1KO0A 4BFAA 4E8CA 3OGVA 2V2HA 4NJGA 1S5TA 3MBFA 4DBWA 3EOUA 1GTEA 4AIEA 1Z8AA 1F6PA 1MEHA 4LB3A 4RE2A 3GM8A 2OGYA 1YXDA 2YZRA 3VGEA 4GI8A 2BHUA 1WO2A 2DSUA 2PP1A 2ADAA 1XLAA 3BCFA 3EOSA 3GU2A 4PMXA 1Q6LA 3UJRA 2F6UA 3QTPA 1AQFA 3A5FA 2WC3A 2PLCA 1IWAA 4GNVA 3DERA 3APYA 4JYEA 3RFAA 2FZBA 1VBHA 2WJZA 2V8ZA 3TUUA 4W8BA 1G6CA 3PPCA 3U2OA 2DZWA 1JZ2A 3KCJA 2IQTA 4M24A 2VTFA 2XN1A 4AEOA 5I00A 4KRTA 4BQ2A 4D2JA 1I0BA 3MUZ1 1V51A 2D20A 1XGZA 4FNUA 2GL5A 3ZT5A 4I3GA 2DZVA 3Q67A 1R3WA 3TMLA 4GD0A 1XV8A 4J3ZA 2NVCA 5D9PA 1IE7C 4QSFA 4PTXA 5HBFA 3EB2A 2EEXA 2CCRA 1LYXA 3PJWA 4IGSA 4KCUA 4EPEC 5A6LA 2PWEA 3VNJA 4C6EA 2WLZA 2VR5A 4ZBCA 4EVZA 2BGSA 2Y7DA 2CWNA 3FKKA 3NM1A 4BHYA 1US2A 3MCNA 4D72A 1YDYA 1Q5MA 2CLEA 2V5LA 1EOMA 4G8TA 2W62A 4GKTA 4YWIA 2E9BA 1UP2A 3VKCA 1XD1A 3OYXA 2QCLA 3ABZA 3QV9A 2OGJA 1R47A 1FWNA 3OU8A 4YCPA 2HBVA 2OVLA 1J8VA 3SW6A 1DJQA 5TAOA 2PC8A 2IPJA 4K68A 2PTYA 1MRAA 8XIMA 1TV7A 3E12A 2ZADA 3WJXA 2ZDSA 4PMDA 3A4AA 5JU6A 3W2MA 2OXNA 1S3HA 2WOQA 1YKWA 3TA9A 1NM9A 3P80A 3QMSA 1RBAA 1XYAA 3HG5A 4MKSA 3EX6A 1GKRA 4ACYA 3QW4B 4J3XA 1H4PA 1HX0A 1DTUA 1QRQA 4FX8A 1H41A 3LCGA 1UR8A 4N9EA 1DBTA 1AK5A 2CLIA 1CPUA 1QDSA 1G1YA 4FNPA 1SSGA 1E4MM 4AG0A 4S3BA 2I5IA 1UP0A 4O15A 2VFEA 5C7HA 2F6KA 2IS7A 3ARSA 3MUCA 5D9NA 2YA0A 1F3EA 5CQ1A 1QW7A 1F8IA 2VDHA 2DVUA 4OU1A 3BLIA 2DUZA 4A3HA 3L4UA 1QBAA 5E93A 3CV1A 1UR4A 4RZ5A 4RDVA 1C93A 3Q45A 1BVNP 3GNNA 4FO4A 3QPEA 3CV2A 2FVMA 2PDGA 3ZFHA 1RA0A 3NQ2A 1LUCA 1TB3A 2CLFA 6XIMA 4C6NA 1LM1A 5BU9A 4KEUA 4LY4A 1CB7B 2NSOA 3RCYA 5LSMA 4AWSA 2J27A 3CUFA 3H23A 4C6MA 1GT8A 2BV9A 3NXLA 5H1WA 3BO9A 1EC9A 1CGUA 1PX3A 3FGCA 3DKJA 3OO2A 3VIHA 3ITGA 5DFAA 4PCSA 3T9PA 1S5MA 3JRKA 3O6DA 1KR1A 5MKGB 1VRDA 3CUJA 3IK2A 4P7OA 1EIBA 1SM9A 3MA8A 2V68A 4GY7A 2FPVA 3H53A 3GS6A 3A9IA 1UKTA 3APGA 2JF7A 3WF1A 5LGXA 2HROA 1KFKA 2R14A 3CQ0A 4IP5A 2PI6A 4HNVA 4PBFA 3AOFA 3CUHA 3L5LA 5LNWA 4GO8A 1JFHA 4HZ6A 5C9UA 1TVNA 4MGGA 1SJCA 3HN3A 2NQ9A 4E4PA 4ZL1A 2CNCA 4LEFA 4CN4A 3S1WA 1H7XA 4GRSA 3M46A 2QUNA 3WF2A 2Z6JA 2PGEA 3ZJ8A 4POCA 3VMPA 2J13A 2O4MA 2QJNA 2EQDA 3EX4A 3TN4A 2V5JA 4LTSA 4OTKA 5I6SA 1XW8A 3K5XA 2WHKA 3TQ0A 4WDUA 5DEZA 2CFFA 1ZNNA 1X6UA 2BGNE 2EG7A 5EBUA 4LAMA 1DE5A 4PFHA 2VZOA 3NOYA 4JR5A 3RCMA 3MWAA 5H8MA 3SADA 1DJHA 2ABAA 1ME9A 3RHGA 1UQYA 3PZUA 1PX4A 1ZRQA 5FJUA 3PAJA 3WENA 1OFRA 3DI0A 2PURA 3QF0A 3DIPA 1IEXA 3WEMA 4Y8EA 4Z42C 5C9WA 3TVAA 1VD6A 4BI6A 1JYWA 2X7WA 3NWRA 4LBUA 4P61A 3MMWA 4ZZ9A 4XUGA 4O1EA 1V77A 1VFMA 1H7OA 5C0QA 2J74A 3O15A 1EJSC 1B0IA 4JX6A 5A8PA 3FA3A 1E6RA 3F4CA 4F0MA 3MSDA 4C6BA 5FKYA 3JVAA 2J6XA 1XLKA 2J9XA 2OZ8A 4DUXA 5BRBA 4JL1A 2NLIA 2QPUA 3G1XA 1FWIC 4UR9A 3BJFA 5E70A 4OJYA 3R0UA 4QCEA 2V6AA 2W67A 2DSWA 1B3WA 4N42A 4LANA 4XZLX 4KCTA 4KKXA 4QCFA 2YCJA 4LF1A 1OD0A 3STFA 3H7RA 6TIMA 4EWND 2XYLA 1SUXA 3N2OA 3NQ7A 3MHFA 4PULA 3N1AA 3ANUA 3WEOA 1M65A 1WA3A 4H83A 1TYGA 4UQBA 1R7OA 2VC6A 1WZLA 4XX6A 4B4FA 1JYNA 4H9UA 2HE5A 3GVGA 4QJ4B 3F5KA 1V5XA 3MKCA 1SMDA 3DG6A 3REQB 1B5TA 3GZAA 5CJ5A 2X2GA 5FF7A 1GYMA 4IM4A 1GPFA 4X63A 3EKLA 2GGJA 2PDFA 1AD1A 1ZAHA 5IRPA 3W7CA 4O11A 2CIPA 4S23A 1VHCA 2DT0A 3M5ZA 1QW9A 2XN2A 1ITUA 2VX5A 2WBKA 1C90A 5HJXA 1WCGA 4GE8A 1EBGA 3QY6A 4JNYA 1AG1O 4YTSA 4YTTA 2Q3OA 1NDWA 4QSHA 3AZRA 4TQTA 1TRDA 4NU7A 4O8RA 3T0AA 2JBMA 2ZUWA 4TV5A 3W7KA 1DWFM 2YGYA 3B0YA 1W9PA 3L4XA 4HVXA 1OFBA 1B9BA 5C70A 1WDWA 1ZCOA 3AROA 2W79A 3N12A 1MDRA 5IOBA 4DJDA 1RV8A 4FOKA 1VBGA 5G4EA 2Y5EA 3W74A 2GK1B 3W7DA 3GXPA 4F2UA 2D3LA 3R89A 3QJAA 1KTBA 1TWSA 4FNSA 5KITA 2XUCA 3O1NA 3LMYA 4Y9OA 4AX6A 2A21A 3GNPA 3KCOA 3BAKA 1DPMA 1WDRA 1U1HA 4QJ1A 2HVMA 1LL6A 4MJMA 1RQBA 2X7VA 2PDQA 4C1NB 3M6DA 4P7RA 2J8TA 4Z0JA 4HJWA 3M0ZA 4PUUA 4S3EA 2AKZA 3W7MA 3CK5A 2OEMA 3TC6A 1J79A 1H51A 1UKQA 3NQVA 1QO5A 4XK2A 1TX0A 4TX6A 3UGRA 4IPPA 4NZ4A 7A3HA 5CPNA 4PMJA 3TNOA 1B54A 1JD9A 1S2WA 3AXMA 2VWTA 4UTTA 1I8JA 1JPIA 3QOMA 1W5OA 1W17A 5DT5A 1V3MA 2ISWA 4LYQA 1V6XA 4ORIA 1CGVA 5EY5A 2OKOA 7PTDA 4K7VA 4MPQA 3K30A 3FY1A 2PF8A 5IHRA 4X0VA 2HS6A 1GOOA 4DRSA 3LPGA 1UH2A 3PANA 4C6KA 1O12A 1QO2A 2BS9A 1DP0A 2C7FA 3OTRA 3HURA 2P1FA 3BPWA 3CZJA 3LPPA 1S1RA 2V38A 4UIOA 3GNXA 4AB4A 3SCPA 4WR3A 2ISFA 4D6FA 3LBOA 5I03A 1FQ0A 2Y4SA 1H7NA 4HCHA 4GQRA 3S2JA 4JHMA 2POTA 4MM1A 4Q8QA 1ZJIA 4LW7A 3AYSA 4IP7A 2DZAA 1NOUA 1UASA 2J8FA 3G77A 5CZ0A 1SFSA 1IGSA 2VUYA 4QG6A 4XIAA 4PCPA 1T99A 4J28A 3IACA 5TQLA 1AMKA 4CNNA 4JY9A 3VIGA 5DXXA 1QJWA 4YNGA 1VFUA 3GG7A 3GTHA 3PBMA 3VNKA 1OC7A 1WDPA 5LIYX 1IR2A 1FCVA 3NL5A 4UXDA 1XYCA 1D7FA 3RRAA 2HPMA 3E2QA 2C1GA 2DU2A 3WDRA 3FGCB 4B91A 2WSKA 2OLHA 3P62A 1T0OA 2PTDA 1L6SA 4OGZA 2J7EA 3FNDA 3U5YA 2EPNA 1XLEA 4HTYA 1TV5A 2WNNA 2XSBA 4AZ7A 3PJUA 3U6WA 3ZR5A 4RR4A 1UW9A 4PBGA 1JZ8A 3WQ8A 1BYAA 3UW6A 4F2TA 1DXIA 1VFOA 3QFEA 3QY7A 3PJXA 1UQZA 1BQGA 4IJBA 1RBLA 1VBUA 4LVGA 3LNMA 1VLIA 2FPTA 1XLLA 2VZTA 3NO5A 4LAZA 1CIUA 3LG3A 5LIXX 4M80A 1EZ2A 4ZODA 2ZXQA 1PZ1A 1SZEA 4BEUA 4TO8A 5D9OA 1ITCA 3VPLA 1KR0A 3GD6A 4ZVJA 5BXPA 2X1SA 1XCXA 1VYRA 2GOKA 1L8NA 3NYZA 1R46A 2FGZA 7ODCA 3GC5A 1UWTA 4GXMA 3DN5A 4C91A 1VFHA 1RPKA 1BWLA 2QUTA 3LV6A 3USBA 3I10A 2A6LA 3CAKA 2NWRA 4HHLA 4UQEA 4GUGA 3KBJA 4YHEA 1XXXA 4BQ3A 1UKPA 3AU2A 4DVOA 3GNOA 4AWUA 1DJGA 4M5PA 4XQ6A 1UG6A 3PUGA 3RAOA 1UD4A 4J1OA 4UTUA 1POJA 1HJXA 4FALA 1ZJAA 2Y1HA 3B8UA 2XVLA 3UYIA 4HSOA 5AC8A 1YNQA 1XCFA 1FWSA 4DZIA 2PTXA 3N9KA 3IIXA 2ZUUA 2ZXDA 3LUTA 1K7FA 2XH7A 3S5YA 2QW5A 4JZ5A 2GDQA 4WZHA 1YXCA 1Y5WA 3B8DA 1DJYA 4NZ3A 5FJRA 4NZ5A 4WHBA 3BMVA 1EEPA 4JKLA 2DQWA 3WDHA 1P1MA 6XIAA 1FOBA 2ZUMA 3K46A 3WLTA 3EX3A 3ZVIA 4IMAA 5DCBA 3GR8A 1TIWA 1ZAJA 3W7LA 1D2KA 1S1PA 4K8HA 5DMNA 2PLKA 1WX0A 2VGBA 3WK3A 3DFHA 1XGEA 1JUKA 1W32A 3H26A 3P8IA 4JIPA 6CGTA 1XYFA 1K6WA 4IX0A 1YDOA 4YHGA 4DPQA 1UIOA 2R24A 1IEIA 3RR1A 2DH3A 5DX7A 1G4TA 1W6TA 3WQ6A 1SJBA 1KCLA 4Q8VA 5L6UA 3KDNA 2PFHA 4H8VA 4GJ1A 3F4DA 4AF0A 1U22A 1XJBA 3G1SA 4GCXA 2V9DA 3BMWA 4GACA 5EFFA 3AIUA 2WVTA 3M0JA 3GWQA 2PGRA 4O19A 4EF9A 1A5BA 1EZWA 5AHEA 5K4ZA 3LZ5A 3F5JA 7TIMA 2WQPA 1OK4A 3PZNA 4UWMA 3NQCA 2NVDA 4JYDA 2XIIA 5AYIA 4N4QA 4V1XA 2SFPA 4XZWA 5AKQA 1W3JA 4GZ7A 3VGBA 3S9IA 2D73A 2DY3A 1PZ2A 1TZZA 3GAYA 1E5JA 5A6TC 4AZBA 4OBTA 4LNCA 7REQB 2E4TA 3KRZA 3KZPA 4TTGA 4ZMGA 1KKRA 3PNZA 4XAFA 3AJXA 3MP4A 5EPDA 1UA7A 4XD6A 5HNTA 4HA4A 1GYLA 4XD3A 4LOCA 1IGWA 2PC4A 3WFLA 4PUJA 1BSIA 1D3HA 2V5BA 3WIJA 3R5EA 4J3TA 1VR6A 2Y63A 3NGJA 1GQKA 4GIEA 4ML9A 3WQCA 3K1DA 1UMYA 2DDXA 3NVTA 3TCEA 1P48A 4F2BA 4LGXA 1S46A 2G3FA 2XH0A 3NA8A 5HWJA 1E5NA 2W92A 5FAJA 4WGHA 2G37A 3PM6A 4ZOEA 1XYMA 1LOQA 3GR7A 1JUBA 1I1XA 2OX1A 4J9JA 4UQ9A 5KINA 1AW5A 3BG9A 1LTDA 3PPFA 4YN5A 3ITTA 3T8QA 1FWHC 3HZ3A 3SCNA 3DG7A 3NL6A 1UWIA 4ATWA 1BGGA 3B03A 3EWZA 4AC7C 3C2FA 2ZX8A 1RZMA 2IPGA 3QLLA 3UEQA 3LOTA 4NIRA 1XINA 3MS8A 5G2IA 5HR7A 4KW2A 3V0UA 3H12A 5JIWA 2HSAA 2WSRA 3HV8A 3TN3A 4O1DA 3W7RA 3VGDA 4OKDA 1OABA 3BL3A 3CIVA 1F61A 3A4XA 3BTNA 3LSBA 1ODZA 2X41A 1FWTA 3NM3A 4N7QA 4C6LA 4ZO8A 2OX4A 3HBLA 2ZZ7A 3DU0A 4D1JA 4F3HA 1CX9A 5JH1A 3PVFA 1IIGA 5M5DA 2ON3A 4ONVA 3MV01 2Q3RA 2PF0A 1R85A 3TH6A 4JX4A 3FYOA 3PSVA 4XAGA 3NAVA 1E4NA 3TJIA 1VCFA 3URBA 4YIWA 3K8LA 4G56A 4L6OA 2DZXA 2W61A 1E9IA 2BHZA 3TYDA 2TPSA 5D2WA 3N17A 1H61A 3AUOA 3PZQA 3A3WA 3ZT6A 4DELA 3R2GA 3P6LA 1XD0A 2E6FA 1J9YA 1QBBA 4OUIA 5D8WA 1SSDA 2Z6IA 4JFVA 4ZQPA 1HKIA 1A5AA 3WZ0E 3TE9A 4ZO6A 3QM3A 2OYMA 4KT2A 1QK2A 4GUFA 3CZKA 4P7QA 3W27A 2CZ5A 1NQKA 2GGGA 3FCPA 5IBXC 4E2BA 1MNSA 4G7EB 4DYJA 2OT0A 2VEGA 4NG3A 4M1BA 4DWSA 3QV7A 3CPRA 3ES7A 2OLAA 4GUJA 4R85A 1W5MA 2FB3A 1FXQA 3K1GA 2XFYA 2NVAA 5BNKA 1EP3A 5JBEA 3GC2A 3GXNA 3QYQA 3CLWA 4H7ZA 5CZSA 3W81A 1KCZA 2E0PA 3ARXA 4N9DA 4QS6A 3A24A 1RJRA 2VDIA 1N7KA 3RLGA 3PBVA 1DWJM 4NX5A 4TXEA 1BKHA 1FWDC 1US0A 1AL8A 4L1WA 4UNKA 3CUZA 2ATSA 1JQVA 3IWPA 4GKLA 1CENA 4P8VA 4IFKA 1SU5A 2J4GA 3CIXA 3EWYA 2Y7GA 3S1XA 4UR7A 1Z69A 1SFTA 2ZA3A 3OVGA 3S46A 3U48A 4J3WA 1Z44A 1AH3A 1RVGA 5CC7A 4ZEPA 3K4DA 2HISA 4IPIA 4C90A 3VC5A 4RZ6A 3SN1A 3OB8A 4DY1A 5A6MA 4GQBA 4Q4PA 3EPOA 4BK9A 3K8MA 6ENLA 1JVNA 3LLDA 3WJZA 4KMQA 3VUSA 1E9LA 4W4QA 1Z89A 3HGJA 1A3WA 4DAIA 1GZJA 2Q6ZA 3EOLA 4O13A 1KM2A 2EHHA 2WMGA 3MYPA 3OIHA 5K4XA 3SUSA 2QJJA 3RX4A 3URQA 4ZE4A 1KXQA 2ASHA 2JEPA 2J7CA 2HPIA 2PCEA 3FA4A 4ERAA 3MO4A 3W83A 4MB5A 1K77A 1X6NA 1SJAA 1KFCA 4NP7A 4X61A 1Q3NA 1NEYA 5D02A 5IXEA 1C8VA 3S1UA 4JFUA 4UTJA 1HO4A 1XKYA 2CBUA 4ZR8A 4KGJA 4GY0A 5IFPA 4MMWA 3GE7A 4DB7A 3BICA 4MNLA 2ZOXA 5JBFA 3RM9A 2XINA 4R34A 1BF2A 2QUVA 2NX9A 3GVVA 3C0JA 3HQ1A 3LNPA 1O5KA 1V6VA 1FHDA 1PWMA 3C2RA 4QBXA 4LUTB 2ZA1A 1VHNA 3N14A 5I0DA 5GVJA 1OZMA 2F2HA 3E0IA 5DMMA 1SPQA 5KTLA 2O9TA 1HQTA 3V5CA 3TIMA 2D3NA 2PA6A 2GQ3A 4MYAA 2QF7A 3HF3A 1GJUA 1EGZA 1DTNA 3VDGA 3N9SA 3UY7A 3MO7A 3THDA 1JGMA 1O5QA 3KLKA 1KBKA 1QI2A 4F0HA 4HCDA 4PRWA 3UPMA 1M01A 3G6MA 4O12A 3N4FA 2HEJA 1BF6A 3L7RA 4UR8A 4FX6M 1YYAA 4V28A 4ADUA 1GWJA 3P0WA 2FIQA 3O0KA 5D38A 3LGDA 3QKEA 3SQSA 5GJNA 3FJ6A 1ZP4A 4IQDA 1PDZA 1ISYA 3UERA 1AH4A 4JQ1A 4MB1A 4LNYA 1Q8JA 3NDOA 4AVNA 1WXYA 3H2AA 2C0AA 4Y2WA 4E3VA 3CNYA 1GG0A 2PRHA 4O10A 3G18A 1RALA 2J24A 4FLQA 1ZBWA 1E4LA 1F2JA 4W88A 3IEBA 3MQTA 1QOXA 3DHUA 1G0CA 2CLOA 3M7SA 4NZCA 4ZB5A 3WLMA 4EANA 2ZTKA 4Y8FA 3WQOA 4IZGA 3ARVA 4OV9A 4S39A 3T8LA 3W1MA 4EP8C 1TR9A 2O9OA 1E1EA 3B4UA 3I3DA 1C29A 1RAKA 1PXGA 1W1VA 2ZRUA 4RXGA 5DMYA 4X60A 2ZVRA 4MZYA 3PUDA 1PKYA 3TSDA 3E5PA 4CVUA 4QITA 4Z0SA 3HGSA 3L4WA 1HP4A 2OODA 3GTXA 3GHRA 3FIGA 3KOZA 1BXBA 2FZNA 1R3YA 3FXYA 2Y85A 4IIFA 2ZWZA 1A49A 3TWAA 2BVYA 3F2BA 3N9RA 2JKAA 4WJEA 3MUY1 2YL5A 1X7IA 3CMJA 2QCEA 3POCA 2C1HA 4WY0A 3V36A 4UCGA 1T8QA 1Y65A 3VDAA 3ALFA 4HSHA 3Q94A 3IIZA 4RV8A 4I8YA 1QPKA 1CEOA 1WYIA 5GJMA 1TPB1 1FTXA 1Q6CA 3TKFA 5BOEA 2CYGA 3VABA 2OZTA 1DOSA 3TN5A 1I1WA 4QROA 3CT2A 3G1RA 2VFFA 3VKKA 2YCEA 1R3TA 3DFOA 2QCMA 3C56A 5EYWA 4HU3A 2E9LA 5I3FA 3KX6A 4UC5A 4C6JA 4HPHA 3OGSA 2ZXAA 2AL2A 4HJFA 4U3CA 4NNBA 1XLHA 4OBSA 4O14A 1OCBA 3I3EA 1SO3A 2PU0A 2XGZA 4LYPA 3TZFA 3B04A 4GUIA 2VL4A 4CVWA 5C9ZA 4Z2HA 3ORWA 3B3DA 4WDTA 3HG4A 2F9RA 2TRSA 4IXHA 4N6FA 3FW6A 1L0PA 3EWBX 3WBEA 1UUMA 2AL1A 1CECA 3DBNA 4AQLA 1EUNA 4QAIA 4QP0A 3A22A 3DFPA 2YA1A 3OYZA 3QR0A 3Q58A 1V4YA 1XSJA 2W6RA 3BOFA 5HXMA 2UV8G 2OOFA 3CMGA 3ARWA 1EH9A 2QV5A 2ZX5A 1ZZMA 4PMNA 1OQFA 3UCDA 3R13A 3ITXA 3ARYA 3QTGA 1A5SA 1XRTA 3CL7A 2DVXA 4FXRA 4X2RA 1T6MA 3BCJA 5HULA 2ACSA 3KEHA 3DC0A 2DZSA 3UG3A 2TSYA 1WXZA 4C6PA 3M0YA 3WLJA 4DPPA 5A6AA 4HQVA 3CC1A 4DWSB 1E15A 3OLGA 5G1MA 2QDEA 4S2CA 4EXBA 4HK6A 1FKWA 4R9OA 2Z0IA 3L4YA 4W7VA 3M0MA 1UA3A 1AD4A 1VCGA 3U7BA 4KWWA 4D6IA 2WKJA 2V3FA 4GXPA 1QOPA 4L61A 4XAYA 5HANA 3AMGA 4US6A 2V2DA 1CXIA 4MB4A 2C3ZA 4K38A 3KHDA 2J62A 1F7BA 3DXIA 3EX2A 3TYBA 2QGYA 3UZYA 1DIOA 1ODUA 3E0FA 4ASTA 3BLOA 3TC3A 3VOCA 1W3NA 3O6AA 5BWFA 5AB3A 4GX9A 5FEPA 4M19A 4FNTA 1YTEA 5C7VA 4LUSA 2O9PA 1Q45A 3NQ8A 4PTNA 3O63A 2FDSA 2RDTA 1V6YA 4FZIA 4Q8TA 5I09A 3N19B 1HGWA 1XIDA 2VM8A 4JHOA 4FOJA 3NEHA 5CSUA 1OZQA 3L21A 2BXZA 1E6SM 1G4PA 3CHEA 3ABSA 1FWCC 1GONA 2X0HA 5A1AA 1KQZA 3M0IA 5E09A 4AVFA 4XUYA 1VBJA 2CKSA 1CGTA 1JI2A 4H4IA 3B4YA 2HK1A 3M07A 4PL1A 2ZX9A 1V02E 3R58A 3TR2A 2G8ZA 4J7RA 1AUSL 5BXSA 1PV8A 2ZC8A 1XGDA 1M03A 2C13A 3MCMA 1FCBA 1Q85A 4XZIA 3KHJA 3G1FA 4AU0A 1QU4A 4IL0A 4MNKA 4J5NA 3VKBA 1MEIA 4GPNA 1NY1A 4O18A 2NXIA 3UJEA 1H5YA 4J40A 3G1YA 3TYZA 1VEMA 2PLJA 1ALDA 2WK2A 4EPBC 2VZSA 4Q4SA 2ISSA 1WDSA 2ISVA 2D2GA 3W88A 4LBRA 4GJJA 3TN6A 4NZJA 4QEEA 4K37A 1W1IE 4EIVA 3GR4A 2B7NA 2G4FA 1DV7A 4IIDA 3MJYA 5A8MA 4DO4A 4UFHA 1XL9A 4J4KA 3KVJA 2G3NA 3UU0A 1DL3A 2E5DA 2X30A 5SWUA 2PGWA 4BF9A 2VEKA 4DJFA 1SZFA 3CO8A 1EPVA 1XFCA 4C6QA 3SFWA 2XISA 4LCRA 3QC3A 5D03A 2YR1A 1UC4A 5FJOA 2YDQA 1P7TA 2JIWA 2A3AA 2QMJA 4XVEA 4QJ5B 1U83A 3S6DA 4ZOCA 5I2UA 4D6JA 3BDKA 4B9YA 1G5AA 4M7TA 4IIEA 1PUDA 1Y7VA 2V0TA 3LCLA 1ZALA 1BWVA 4AW7A 2ZXBA 1OB0A 4NHVA 1XIFA 4NAFA 2P50A 5CPSA 2VZVA 2XJ7A 4JIEA 1K8ZA 1DORA 5IM51 3IJ8A 1XI3A 3W1PA 3KOYA 4UFMA 3N2XA 1AJZA 3EMCA 3UZXA 1HVXA 1XPGA 4DN1A 5CGQA 4C6FA 4FI4A 3PZMA 1VRXA 3BH4A 4FOUA 5CBJA 1VQTA 3DFNA 1M7XA 4ZO7A 2R9RA 4MZ8A 3HO8A 4RV3A 1OHLA 4ZB2A 3NQFA 4IX2A 1HN1A 4KGLA 4JFWA 4C60A 1AFSA 4IQJA 4PMVA 3BW4A 1OT1A 1ZHAA 2FQIA 1W8GA 2Q02A 4GFSA 4UOQA 4I9JA 2H8XA 3IUIA 1W1YA 2ZE3A 5CGTA 1V3IA 2CLHA 4HKPA 1O66A 3TNBA 2V3GA 4GG9A 1KFBA 4S3AA 1POKA 3U2CA 2XIOA 2GOUA 1D7KA 3JZEA 1AODA 3LENA 3SSJA 2VGIA 4Z2IA 3WMBA 2GUYA 5A69A 1LRNA 4IFOA 4FF5A 3NZRA 2P53A 4AZGA 4DJED 3LRLA 1EPXA 1HL2A 2WWCA 3MDWA 3W6LA 5HMFA 4GLEA 1NF0A 1TVPA 5L9FA 4TMBA 4A21A 3UR7A 2E6AA 1QNOA 4FF7A 2ZUSA 1J0HA 2Y6ZA 3IVSA 1RJPA 4KFNA 4Y9NA 1LQ2A 3BV7A 4NF7A 3RX2A 4KF1A 2OWXA 5GNXA 9RUBA 3MY9A 5LXXA 4B5UA 3ZSSA 4PUKA 4Y7EA 1VIWA 2DEPA 5G1YA 1DQXA 3OW1A 1ONEA 5HPOA 3VNMA 3ZLHA 4K39A 2NQLA 4UTMA 4AXNA 6TAAA 2I14A 1TQJA 3W22A 4Z1CA 3HMJG 3W2JA 3VZYA 2Z1WA 4HMNA 4WJ8A 3V0SA 1TMQA 4WIWA 4FA3A 1X8CA 3MZNA 2VURA 1L6WA 3W53A 4IUGA 1DXEA 1BPLB 4P2VA 1E51A 3NO1A 4NY2A 1XDMA 3CQKA 3EDFA 1UJPA 4U4MA 3DFQA 5CJNA 3WBWA 3VIOA 1TWIA 2FHBA 4JL2A 4IXXA 2CC0A 4DZHA 2NW0A 4JXCA 3F4NA 1R7AA 4IPNB 4ICNA 1MFVA 4ES4A 1NFBA 1REQB 4Z2JA 3LS9A 4PUMA 1JGIA 4BA0A 4MPKA 1E6XM 1I60A 2EPMX 2Q8LA 3S2MA 3ARZA 2DW7A 3MUXA 2Z1VA 3WNNA 1B9ZA 3A23A 2Z24A 4LQ1A 2OSWA 4KRUA 1EKOA 1H2JA 5AZ1A 2YPIA 3IGXA 2XIJA 3OZOA 4UOZA 3WNMA 1GZ1A 3UXLA 1T5AA 3N11A 3GYCA 3GSMA 3PULA 3TLLA 3W1TA 2W3ZA 5IBXA 5CZJA 4ZOBA 2YFNA 5ECUA 4F0RA 3EDEA 2WZTA 3AIWA 3S3GA 1UWRA 4QTGA 3QR1A 3SCTA 3FSTA 3PZIA 1Q6EA 1R5YA 4PBEA 1KFWA 2C15A 1ADSA 1TJRA 3GXIA 3MBDA 3CUGA 2NSXA 1R87A 4ECLA 4LC6A 1H7WA 1A50A 3TZNA 5LZLA 3KL0A 4HGXA 2QV4A 1EJXC 3PNUA 2XPKA 2VX7A 4Q32A 2J77A 2Q01A 2RDXA 3OZPA 1TV4A 3BAWA 4FS9A 4ZQCA 1WUFA 4Y9PA 4L9ZA 3QKZA 3U4AA 1K9TA 3NSXA 1TX2A 3W4RA 1MMFA 3I7QA 4DM1A 4F0KA 5RUBA 3W6YA 1E4IA 2FMOA 2VOTA 4IMDA 4PMYA 1RCXB 1ZJBA 3DOPA 3C0LA 3WQDA 1EGMA 3DGRA 3EDDA 3LHYA 3IJ6A 1ICSA 4GO9A 5FESA 3LBCA 4GJIA 3NIYA 3ONBA 3CXOA 3HG2A 4EF8A 3WJYA 5DELA 3D6NA 2DH2A 4HCLA 4J3VA 1U5HA 3P74A 2WMIA 3UJFA 1W0MA 4O0ZA 4CNSA 3TJ4A 3UZ5A 1OSEA 3VILA 1KRCC 4ADSA 2H3DA 3E2SA 3MYOA 3A4WA 2GVJA 4R7OA 3QMRA 1JPKA 3ZQ9A 4JTQA 5CXPA 4WVXA 3VNLA 2XVGA 3WL0A 2QCDB 2FZMA 1WV2A 3EB4A 2Z29A 5U4NA 4JIRA 2AAMA 2RFGA 3CZGA 3ZR4A 2ZDRA 1TJ0A 3C0SA 1AW2A 3RPDA 2PDPA 4KERA 1QPNA 4YXGA 4AYSA 2VR4A 1OCQA 1VEOA 1RXOB 1LBLA 1RQEA 4JICA 3GW3A 2DP3A 2ZA2A 2Q8ZA 4GHRA 4LUYA 2WWDA 4NT0A 1O95A 3C3UA 1VS1A 3K2GA 1V0MA 2F84A 1PHQA 1OYAA 5CPQA 5FACA 2X42A 1PPIA 4GYKA 1XX1A 1UP3A 3MI2A 2PP3A 5DT7A 3UPWA 3TU9A 4O1FA 3V3WA 5AC7A 1VPQA 2BODX 5HATA 4PMRA 2P3ZA 4Z1AA 1WKDA 2EBNA 3ARUA 2XVNA 2BLEA 1S2UA 1GQNA 5KZDA 4MVAA 2PSNA 1NQ6A 3MP3A 3ECQA 1B30A 4MWAC 1H49A 3LLFA 1NJJA 1W31A 2ZRVA 5HMDA 1K3UA 3HQPA 3V0TA 5CC5A 4J3SA 1R2SA 4CEUC 4CGTA 1X98A 3W3OA 1OCJA 3CHVA 4Q4KA 4NYUA 4HOWA 1B4EA 3LI0A 1N8IA 2C91A 4IG2A 4NI8A 1XSIA 4NZFA 2BFGA 1TPC1 2YKKA 1QI3A 4L64A 2GUBA 4MDOA 3WN6A 4I90A 5CPTA 5I07A 4CD8A 1NTHA 1VPYA 3CB8A 4NAFB 4WY0F 2PBOA 1UR1A 1FH7A 4M82A 1QHZA 3W7HA 1TPH1 4L1GA 1VFLA 1A5MC 3FJLA 4OVXA 4HB7A 4N4PA 4US5A 5HWNA 4WKFA 2VQUA 4DYEA 5A8NA 2GDUA 3LX9A 1JNDA 3FSUA 1MWOA 2IPFA 4F4RA 4N9CA 4GBUA 3VCRA 4UCFA 4IIHA 4U10A 5AOUA 4WKAA 3BARA 3E6EA 4MNMA 4PRTA 4MOZA 3N73A 4D6HA 5HDRA 1CLVA 4Q8PA 2R1KA 3DG3A 3DI1A 3ZR6A 5JVLA 5ABGA 3HMCA 1PS9A 1VJZA 3TTQA 1YADA 1ME8A 2TAAA 2D23A 2XG9A 1LT8A 4AWTA 4EK7A 3MMTA 2G96A 3AS3A 1WKFA 4QS5A 1EF2A 1J6PA 3T40A 4PL2A 4CN1A 1VFFA 1TCMA 2GJXA 4L9YA 5ENLA 1KTNA 2WM0A 4LVDA 4GNJA 3UNDA 1QPOA 3SJ3A 2XIBA 1W1A1 3T2PA 3SCUA 1QI0A 3KTCA 6PTDA 2PZNA 3NPXA 4RCXA 1S2CA 4B3ZA 2WCGA 4CQ9A 1FDZA 1R9XA 4PR4A 4GVIA 2BXVA 3M4HA 2EG6A 2FYMA 2IMRA 1GOWA 3RO6A 4ERGA 5EKYA 3M0LA 4AD2A 1HUVA 2P88A 2JFEX 2YLAA 3O05A 1V02A 1AW1A 1UJQA 5EMUA 4ROPA 4JPGA 4HT3A 3WKZA 4DWDA 1NOFA 3OIXA 3T55A 2RH9A 1XRFA 1XISA 3M9YA 4BF5A 1WOAA 1LLWA 2XH2A 1KM3A 3W2KA 2QMKA 1VJIA 2PODA 2ISDA 3BG5A 2LLEA 1Q8AA 3LCWA 2NUWA 2OEJA 4RPQA 2RGLA 4R33A 2PDHA 3TONA 3BQ5A 4Q8WA 3ZLGA 5A8QA 2Y7FA 3XISA 1RP8A 2WCAA 3SCSA 1JD7A 2VFHA 2DV0A 3M7WA 4DBDA 3LTPA 2R91A 4GCAA 3MPGA 4RZBA 1OT2A 1KM1A 1M6JA 5A8OA 4O52A 4K7YA 1J4EA 4QXIA 1EFZA 1S5NA 3WFAA 3EYPA 1V79A 2XGBA 1VGAA 3U57A 1PWLA 1MRQA 2FPYA 1H5VA 3WLNA 1C92A 3FKRA 5AZ0A 3AYVA 1J11A 4L65A 3B8TA 3CLMA 3D47A 4I8DA 1LT7A 3W02A 3AO0A 3EXRA 4JY8A 1EHNA 1DIEA 1BRLB 2DSVA 1MDLA 3OOQA 1PB0A 3TYEA 4CKQA 5D9MA 2GLKA 3KDOA 2CETA 4HA3A 5FSDC 3GTIA 3RM8A 1J6OA 1Q6RA 3BLDA 3NPWA 3LCHA 3TTOA 5EBAA 4MIMA 4PCTA 5B7ZA 3KOWA 1KTCA 2BZNA 1L6FA 1Z7AA 1WOBA 2YW3A 4Y6GA 4H9VA 2WMFA 4QX4A 1K7XA 3UCCA 3VOGA 2XWEA 2I9EA 3RCNA 3GDBA 1MXGA 4X9YA 3C2VA 1OFEA 3JW7A 3IARA 3WQVA 4XKYB 1VIZA 1XRSA 1PCWA 1KWGA 3RMJA 3FJ4A 3SQLA 2G4JA 3E49A 4FK9A 3HIJA 4TIMA 4QLJA 1E55A 4LX4A 3W29A 5KEZA 2YBVA 3HPZA 4UFKA 3BUVA 1EJWC 1JZ5A 1H1ZA 4OBRA 4EACA 2IKHA 1JI1A 3HOJA 3HA1A 3P60A 4H01A 3FYYA 3CZEA 3KM8A 1EUAA 5I79A 5FJJA 2GJLA 4IIGA 1QATA 1E6QM 2YYTA 1RY8A 1Q4WA 3AI0A 4I5UA 4WRHA 1LBMA 2J6VA 3SGUA 2WNQA 2D0HA 3NZQA 3W85A 4O0KA 2ZRZA 1UD3A 2X40A 3EEGA 1LP6A 3C2EA 4GUHA 4MY9A 4HHMA 1KWKA 3EWXA 2NLYA 1VYPX 3RILA 1FCQA 4X9SA 1PAMA 2XZ7A 3GG1A 3AIQA 3MHUA 4K1WA 1KLZA 4G6CA 2F38A 2OR2A 5A5WA 4UTLA 1TPWA 3QGAC 1ZAIA 3VGGA 4HZMA 1UR2A 2A7PA 3FEMA 2WMIB 1L2UA 4YMZA 4PB5A 3ATZA 4WX2A 4K8GA 3FDKA 1IT8A 4N2YA 3T81A 5FL0A 1H60A 4GXWA 1Q6GA 2Z4GA 6REQB 1OX4A 3TC7A 4KQNA 4Q33A 1GOKA 3B0XA 5FJIA 5DF0A 2XH4A 4IIBA 3NOEA 1OG0A 2QNEA 3G22A 3LHTA 4YYCA 3T6CA 1ZL1A 5H91A 1I4NA 2VEPA 3U5UA 4MHBA 1UH4A 2VT0A 1CLXA 3TW7A 5F2LA 1KD0A 4DJDD 1EXPA 5FEZA 5K9XA 3NDZA 3WQ5A 2PDNA 3PAOA 4OECA 1BHGA 1AA1B 4BF7A 2FVLA 3EB3A 4AY7A 4UFIA 4CEXC 4NQ1A 3FHQA 1RCQA 1DJNA 4RDYA 4P5UA 3ITOA 3LDVA 4AZIA 2PWVA 3GY1A 1FWEC 1X1NA 3A6OA 1MXDA 5D37A 3I68A 4UTKA 1V0LA 4O4VA 1VC4A 3VA8A 5BYWA 5CLTA 2EG8A 5A6JA 4L6DA 3L4ZA 1GORA 4FB7A 4NJJA 3AHZA 4Z1YA 2I5QA 4IG2B 3U3HA 4FLSA 4BJHA 4MAZA 2W66A 4M7SA 3THQA 4HNLA 3KW3A 5D8ZA 5REQA 4GY1A 4GMEA 1BG9A 3LXCA 1LQAA 1W1B1 2GVYA 2YCIX 3LRKA 2BY2A 3WLLA 1VCVA 1IWPA 3KRUA 7TAAA 3PPHA 4UMBA 2VVNA 3R7MA 2XN0A 1UWQA 4ZSUA 3R8GA 3BLFA 4H00A 2DSKA 2YB1A 1MEWA 5FF2A 3CU2A 5DN1A 3FN9A 3L5AA 4H8HA 2A3CA 2TMDA 4IPJA 4A2RA 5FF4A 1JYXA 2D2JA 1FP8A 3DHPA 3M44A 2Y5JA 3R0KA 4FXFA 3AXXA 4H41A 3GXTA 1V7YA 3GB6A 7XIMA 1F4HA 2BX7A 3UXDA 1TUXA 1XS2A 4WSJA 1BVZA 3GDKA 3TR9A 3LSCA 3QV6A 3AICA 5D2XA 5HJYA 5DMLA 3GU9A 4PRRA 4XD4A 1FH9A 1SVDA 1SYTA 3C0QA 3N18A 2O4QA 4BI5A 4AMCA 4KIRA 4CCZA 1EEXA 5DRIA 5HQLA 3BE7A 1L6GA 3MT1A 2C6QA 4FHAA 1JQXA 3W82A 1KM6A 1E56A 3W9ZA 1ZPTA 1RUSA 4O1BA 3TROA 2GJXB 3LHUA 3PB2A 5BRPA 3PP7A 3EDKA 4BQ5A 1ZQ5A 4L7ZA 4O1CA 1OM0A 5MF5A 1LWIA 1GKQA 3CL6A 4MLRA 5CG7A 3VIFA 2QJMA 3PG9A 1U5JA 3GRIA 3LCIA 1US3A 4KEMA 4YYFA 2QKFA 4RNHA 4DHGA 3OHIA 1JFXA 3HPAA 2E67A 2NXGA 2IKGA 4PA8A 4CCCA 1K7EA 3S5NA 3QQWA 1O94A 1IXOA 1TA3B 3C86A 1J5TA 3OLEA 4WOQA 4GZJA 4NL1A 4LS2A 3ABQA 3V4BA 3WMLA 1C7SA 4DBSA 3RJYA 4DAFA 2OOGA 4ATDA 5C71A 1PHWA 1RK5A 1ZBVA 2GGHA 5FL1A 2EKGA 1TELA 2J66A 3AHYA 5ABEA 4IJRA 4TOQA 2E68A 1M04A 2OZ0A 4EAMA 5FJPA 3VX1A 3WDQA 2Z1KA 8XIAA 5DXYA 4C5YA 4YVVA 3RM4A 4KESA 4W9TA 5M17A 3R12A 1KXHA 4W84A 4GH1A 1LLOA 3KUMA 1HJQA 3DDMA 3WNLA 2PP0A 5CEWA 4JEJA 3UYCA 4AHOA 3P81A 2QZRA 4ROQA 5DO8A 4GYJA 1ADDA 1B3ZA 1BFNA 5DLCA 1RH9A 3MMDA 3OA5A 4HTBA 1OBAA 1A3HA 2PD9A 4HYRA 3PTQA 3VIJA 4RKAA 4R5EA 2Q71A 1Y0EA 2VOMA 4RW5A 3UR8A 1CXLA 5PTDA 3RYSA 4E2VA 5EGRA 4CNOA 2AAAA 1Z48A 4LVFA 4UZUA 1KKOA 3OQEA 3VXGA 1YDNA 2ZICA 3ONCA 1KV5A 3POHA 1FFQA 4LALA 4PEKA 3VE7A 2VWSA 3ZXWA 5E1QA 3SRFA 2OYKA 4A3YA 2PRLA 3SY8A 1F6KA 3FHAA 4H1ZA 2VCCA 1WAUA 5AVNA 1KCXA 1JXJA 4EPKA 1C3FA 5FOOA 5I77A 1UWUA 1H1YA 1ICPA 1A0CA 1OX5A 1JNEA 3NZ1A 1QFEA 3H2MA 1XLIA 3WLOA 4ZGYA 1AJ0A 1VFSA 3W73A 3KBMA 4Q3MA 3VGHA 1PZ3A 3CHCA 1YPFA 4B3LA 1E1CB 3ZVHB 1M5WA 4WSHA 3R43A 1OGSA 3B05A 3N6QA 3EWUA 4M6UA 1G67A 4HNUA 1CT5A 2CBVA 4I7UA 3JS3A 3NG3A 2DSZA 4JIHA 3TXVA 1ECEA 4QJ3B 3RU6A 4ICMA 4BKNA 3NYDA 4XV0A 2FMNA 4H6KA 3H22A 4S3GA 1AJ2A 1JCYA 2ZWYA 5HPCA 2RGMA 4CU7A 1WP6A 3SR7A 3PR2A 1RR2A 4PMUA 1MSSA 3S0CA 1XIEA 4LEQA 3OLIA 1W54A 3O9NA 3SBFA 3PZGA 4NASA 1QCWA 1LOLA 1PYFA 3KL5A 2QCCA 5CC3A 3FS2A 3SEPA 3BGGA 4CD5A 4DYKA 9CGTA 3WLPA 1VF8A 3PWIA 5MHBA 2ZRWA 4CNPA 2Q8XA 1MUMA 4S3JA 1W9UA 1UZ4A 5ECVA 3CYJA 4DM2A 2ZX6A 4D71A 3N13A 3MSRA 4NX0A 4AZCA 4JN8A 5FEWA 1ISVA 3W84A 3TW9A 3AYTA 4GYPC 5I78A 3A21A 4H2HA 3MKVA 4FLRA 1P6CA 2YJQA 2Z7GA 1G01A 1MW1A 4IF2A 4PN2A 3WBXA 3AZSA 4Z08A 4MSSA 3QXBA 1TPVA 1XBZA 4MAVA 3GHTA 3GIYA 2IKIA 3KXQA 1GCYA 4M6PA 4ZXOA 5A95A 3ALGA 1XLFA 3CHDA 2RJGA 5T26A 3IIVA 2QVNA 1IT0A 3FA5A 3EEZA 3SGZA 3I7SA 1E43A 2XM2A 2WKLA 2NT0A 4E38A 4CCEA 1BYDA 4MWAA 2DUAA 3S2NA 4HU0A 1Z6KA 4WDXA 4HMCA 4G5DA 3UD6A 5HOSA 2JKPA 3O7UA 1KC7A 1I2NA 2QHAA 1WNOA 1ZS2A 1Q7MA 3IAPA 1T41A 2EGZA 4DO7A 3WD2A 2G5WA 2KAUC 4XB3A 3BG3A 4AFYA 2WMJA 1VJSA 1A4LA 3NSNA 4Q8UA 2HK0A 3DC8A 3TSBA 2CHNA 3AMDA 4OIFA 4JTIA 3MI3A 1O60A 2BHYA 5FCZA 2HDJA 3LTYA 3M0VA 2XVKA 3K4AA 4UUIA 4KWOA 1C7TA 1OY0A 2CHOA 2D69A 3T4CA 5G1TA 1DWGM 2Y5SA 3HFTA 4M81A 4NNCA 3G1DA 4V27A 1OX6A 4Z1DA 4DZ5A 3GKFA 4E5TA 2XFFA 5LHEA 4JAWA 2OG9A 5FJTA 3UXKA 5CGMA 1F76A 2VD9A 1H63A 4H9MA 2OLSA 4H9ZA 1XIGA 4HNTA 3DENA 3EMZA 4JTDA 5ABFA 1EDGA 4I5XA 4LV9A 2OQLA 3N2CA 4H6QA 5CAHA 1MUCA 4URIA 3EGJA 1HJWA 2Y70A 4L4MA 4PUNA 5D2TA 1XIMA 3GVQA 4KIEA 3NJ3A 1EJVC 3WO8A 2I5GA 1JZ7A 4QG8A 1IR1A 4ZFMA 2O56A 2Y89A 3D3FA 2RUSA 5HR6A 3ITLA 3M1ZA 5BZAA 3QZEA 3KWXA 1V6WA 5E0KA 3L0KA 1G94A 1K9DA 4G9PA 3MWCA 1DE6A 3AXHA 4UBPC 3E74A 3U9IA 2EF9A 4AHQA 2QCFA 3R8HA 1RVKA 3AUJA 2MUCA 1QASA 1BXCA 4I7VA 4QDMA 2HXTA 3T0TA 2I7GA 3SN0A 1A0EA 2V82A 4ACZA 1HL8A 2X1RA 4N9BA 1QWGA 5EMKA 4GVHA 1W9XA 3CZLA 2I17A 3PSWA 4DWSD 1KM4A 3N25A 1AQHA 2OB3A 3KVLA 4IMEA 3CGTA 2E77A 3LHVA 4B3KA 5KETA 4A3QA 1QXLA 1JDFA 2AMXA 3PZOA 2CPUA 4PB4A 3B9DA 3ATYA 1XQLA 3S6TA 4KWUA 4P7LA 1JIBA 1OVDA 4WEVX 4NYYA 1K9EA 3R6IA 3VK5A 3W7PA 3UWWA 4XZNX 2WSPA 4IMFA 4LPCA 3BSGA 3TYAA 3Q65A 2TODA 3M41A 3I6EA 1R3RA 2J9ZA 4D1IA 1PZ0A 2ATMA 1JF6A 3K13A 3F2DA 2L5HA 3G5EA 1O68A 2PB1A 1CNVA 1OINA 2HJPA 2YXGA 2A7NA 4A05A 3GUWA 2RJHA 4LUJA 2VRJA 3CQHA 3UT0A 3EX1A 4HOZA 2C14A 4K8EA 1UR3M 2VC5A 1NH6A 4HU4A 3QH2A 4GGBA 5A6KA 2GJRA 3BWWA 3SCVA 3L68A 4PH6A 1GHSA 3W7QA 3UFYA 1X1OA 1BYCA 4XTDA 3WD3A 5CZKA 4ZTYA 4WDWA 4Y90A 1BSLA 3KRSA 5J04A 1KFJA 1LUCB 5G5IA 3QYSA 3WUBA 3IAQA 1KBBA 3C3NA 2J9YA 2YOCA 2CBJA 2FTPA 1I2RA 4H2CA 2XDFA 3KLLA 2WJDA 3DYMA 4WF7A 3M16A 4X22A 4PYSA 1KGXA 4I6KA 3DFYA 3KRBA 1ZFJA 2D2OA 1X39A 3QN3A 2R8WA 3GH7A 4LWWA 3THUA 4B5XA 4C1LA 4IICA 3UVIA 3MHGA 1HTIA 4LU0A 4D8ZA 4LRSA 3S1GA 3PJTA 1EYWA 5LIUX 1VH7A 3SSZA 4YVXA 5E0CA 4UFJA 1HKKA 1XLGA 4JDBA 1TTPA 3R0DA 1TE1A 4UNIA 1J2WA 1A5KC 1ONWA 2GWNA 1LF1A 2WLYA 4QGCA 4CD4A 1GEHA 2R1NA 1TRIA 1SFJA 5CH9A 5HQMA 2C18A 3NQMA 4TMCA 2NQ5A 3VU2A 2G3JA 1P0DA 3KAOA 3RMEA 3A5VA 1E0UA 4KH2A 1DYSA 4Q4OA 3P0XA 4JTTA 3PC0A 5CJMA 1JAEA 4EE9A 5I3DA 3DAQA 4TU1A 2V3EA 4HD5A 3SURA 4WKHA 2A1YA 3PBUA 4DBEA 4Z2GA 3GFYA 2NQHA 1XBYA 5D30A 3G2GA 1BG4A 3H2OA 3QRHA 3Q4DA 2YX0A 3DFTA 2GSHA 1EDQA 3M5VA 1UHVA 4W8LA 2PWDA 1QR7A 2WC4A 3XIMA 4ZOAA 1S2AA 3D46A 5HMEA 2J79A 3N3TA 1WAWA 5F4SA 5E9XA 3IV8A 4C1KA 4Q6JA 1KXVA 3N34A 5IDZA 2WQDA 1E6PA 3AXIA 2G3MA 2BOGX 1TREA 3CV7A 3CQJA 3VTRA 3OODA 4L80A 4AEFA 2VKZG 1HNYA 1I2QA 4L6HA 3AWNA 3AZTA 2J47A 2PDYA 3UG4A 4ZQOA 3WL1A 9XIAA 3TLQA 4D9PA 1N8WA 1YBQA 2WM1A 1C9DA 1KM5A 4AZCB 4GFIA 3UZJA 5ABTA 3PZ9A 4ZQRA 3LXAA 1CXKA 3E0VA 3MMUA 2DJLA 1UROA 2NUXA 4BS0A 4GINA 3U2ZA 5MKGA 4A4AA 4IISA 1IZCA 1NWSA 1I45A 4TX8A 4LJ3A 3WG6A 3WQEA 3RO8A 2GGEA 1V08A 1NDYA 4Y96A 2Q09A 5DY2A 3MC5A 3MZ2A 1ML1A 2B7QA 3VNZA 3VM5A 3AIVA 3LK6A 1EWDA 4KETA 1QK0A 2W4XA 1N2VA 2E40A 1BYBA 4UNLA 2ZTJA 3VI2A 1ZP3A 2QT3A 1U1JA 1E6ZA 1T7LA 3QHMA 1FCUA 4QG9A 2NX1A 2JGQA 3FK4A 1SO5A 1GVRA 2OTDA 1TJPA 3GXMA 2WYSA 1YTKA 1N8FA 4QDWA 2RDUA 4XO7A 3I6TA 1JZ4A 4J2PA 4YTQA 1KRAC 4ZB0A 1PCKA 3WJWA 3M5XA 3MP5A 3SZ8A 3VIKA 3PN8A 4HOXA 1HF6A 5AHLA 3O16A 3STGA 3DZ1A 4W7WA 2PBGA 1XC4A 1HJUA 2F61A 1IZJA 3IJ7A 3LY0A 2AOSA 3MCOA 4U28A 1QPRA 3KVMA 2F2KA 4RXFA 3E02A 1IV8A 4AY8A 4XZHA 3WNPA 4RDWA 2QGHA 2ZUVA 1XG4A 4QHRA 2ONEA 2DPEA 3W72A 2VENA 3TFCA 1IF2A 1THFD 3IJ9A 2GGIA 4BWLC 4DNHA 3LB0A 3HQOA 3BC9A 3GG0A 4O50A 1Q63A 2REQA 2QYGA 5LNSA 2YFOA 3C8NA 2DIKA 3F7JA 2PU1A 2QLYA 1DWHM 1V3HA 4J27A 3UQNA 4IT1A 1E71M 3HQNA 1TTQA 2E6DA 3VVGA 5DBUA 3IPWA 3WDPP 1E70M 4WUIA 3S1VA 2C19A 4GYFA 3H6OA 1UR0A 4M1RA 1AH0A 1OIFA 3ZS4A 1FUYA 2J7HA 1M53A 3H8AA 1JCJA 3H2EA 4PUEA 2OSXA 1KW1A 4HYVA 3NQ6A 5HK4A 3A13A 3GBEA 4FLOA 3TJXA 5LNRA 3ZLFA 4REQA 3G3DA 1JZ3A 1DQUA 1J0JA 2OPJA 1JR1A 1DEDA 2WJEA 4CU6A 1EC7A 5AHIA 1FVPA 2OQYA 2VFIA 5AC4A 1B4KA 4H9XA 1XUZA 4TUFA 3B8WA 3H4GA 3CMFA 1KNWA 2E8ZA 1OYCA 4ACZB 3QMTA 5M3WA 1KRBC 1HJSA 1V3LA 4NNAA 4Q8NA 2CLPA 3VUPA 1A0DA 3TQVA 5FF0A 2FZDA 1FRBA 2OFJA 3P5ZA 4PTDA 2C0HA 4I5RA 3WELA 1M9HA 1HT6A 5J8LA 4J2MA 2VELA 1UUQA 1KGUA 3AHVA 1H09A 2UY3A 4M6VA 3TQKA 1VLWA 1R3SA 4MTVA 3AS0A 1A5OC 2DIJA 4JNMA 1FP9A 4MF4A 3ICJA 2INFA 3DHDA 1P4CA 3NQBA 3EAUA 3EKZA 3MKKA 3WSUA 2WPGA 1AQMA 1TTJA 3PUEA 1XRVA 3VGFA 3D5HA 3REQA 5JH2A 4PB3A 3SFKA 2DZPA 5C9RA 3CUIA 3HV9A 3RLVA 3GXDA 2PTWA 1LCOA 4D6CA 2EPLX 5LA2A 4YS1A 4YCOA 3RU8X 4RNJA 4YPJA 3FYPA 3GKAA 3OHMB 4M51A 3WD0A 3G1VA 3AIBA 4A6GA 3MB9A 2ACQA 4TR9A 4FP1A 3VCNA 1YDVA 5D2YA 2VEFA 1PE1A 1FA2A 2V2CA 1CWYA 1JG9A 1RP9A 2VFGA 1XBVA 4YVPA 5C9XA 4NJHA 2G97A 1IHIA 3TTYA 3KOXA 5K7JA 1M3UA 5JXQA 5BMWA 4NRRA 4AD1A 1UB3A 4V2XA 4FMVA 1HP5A 4GC3A 5I23A 3USZA 3GVWA 1R3VA 1DJXA 4RL3A 1J18A 2FDMA 1HVQA 4V15A 1RSCA 3QFWA 1H62A 3AXKA 3BSMA 2ABBA 1YE6A 2GK1A 4PC8A 1XYZA 3SUVA 1LWHA 2CU0A 2IQ0A 4QM1A 4BCEA 3XINA 1U30A 1YRRA 3DESA 4E3TA 5F1VA 3VO0A 2QXWA 4FR1A 1ZENA 3V7PA 4C1NA 1XG3A 2JKEA 2CZDA 1E1FA 4M0XA 5CLWA 4MJ4A 5AYYA 4IMCA 4H9YA 1M7PA 1NDZA 1UC5A 4EAYA 5E6YA 3CTLA 3W2NA 5U7SA 4CQAA 4IMGA 3WH9A 1UPMB 4F0LA 4DJFD 1P0NA 2EJAA 3VMNA 2ZZ6A 2Z2AA 1OCNA 2VR2A 4HBKA 2RHGA 1W9VA 4GZIA 2YDRA 3BZGA 1HIZA 4XVDA 1X1ZA 3L5MA 1R30A 1FWJC 3FVDA 1A5NC 4HP5A 1QHPA 4GIAA 1UZDA 4LCQA 1ONXA 1U2YA 1RCOB 1A3XA 2RKXA 3RX3A 1M68A 3VOJA 4HU8A 1A5CA 3GH4A 3E9AA 4W7UA 5KZMA 1Z42A 5G4WA 4XBJA 4E4UA 3DH7A 5GJPA 2CERA 3G0SA 3H54A 3AMLA 4Q8OA 1KBIA 2IKJA 4D6DA 2ANUA 3B0UX 3SRDA 5CC6A 2Y8KA 3R94A 2W0UA 4NSBA 4AY1A 4F79A 3IRDA 3WH7A 4RUBA 2Z7KA 4KEZA 4PSPA 5G2HA 1FWFC 2J7GA 1OGBA 1TPFA 4LAKA 4QISA 3F4VA 1PKMA 3WFZA 4YWSA 2VVSA 1PTGA 2XSXA 1JCTA 4ORMA 1EJUC 3TEVA 1LWJA 4K36A 1MFUA 5A6BD 5DBTA 4LV4A 3STCA 1NP0A 3O6YX 3ID7A 3HGOA 4GYPA 4PZVA 3BV4A 1YBQB 3A64A 5C8BB 4LF2A 3ZMRA 2QCHA 4RE0A 1KLYA 5JBDA 3T78A 2WSYA 3ENLA 1T96A 2J7DA 3WF3A 1LDCA 3RG6A 4DWSC 4AVOA 3DUGA 3ZWSA 2FFIA 3APTA 5EFDA 2GQ9A 5AYXA 1GVQA 4GNKB 2QCGA 4BEQA 3QVQA 1EO7A 4PUDA 2E1DA 1K70A 1K9FA 3JZUA 1DJWA 4U3AA 1CLKA 4HA0A 4O4WA 3OG2A 1EX1A 1YIXA 2DZUA 3WNKA 4O0QA 1EGVA 4FNRA 1GKPA 2DORA 1SMAA 2PPGA 3ES8A 2R6OA 1P6BA 1ZBKA 3H7UA 5I3IA 1Q66A 1ECQA 2BWGA 1SW7A 4LSBA 4DNMA 1YLVA 3MJMA 3MSGA 4AF0B 1KFLA 4PTVA 1D3GA 2WZIA 4CQDA 1EWEA 2A5HA 3VD4A 3CEUA 4YLWA 4F9JA 1OGGA 3TDFA 3INPA 1A5LC 2GZXA 2ZUTA 4C7DA 4GWEA 3P84A 2XIMA 4KBXA 4KFOA 5EU9A 2PWUA 1MW2A 2O9RA 4MB3A 4TX9A 1H0GA 4BZYA 4GGHA 1PL9A 2Y8UA 4OQVA 5AC5A 3MW7A 3VOFA 4H7VA 4JQAA 1XCWA 1Y5VA 2E6YA 2DT3A 5K2ZA 1W5PA 5A94A 3P61A 4QIUA 4O28A 4KWSA 2REQB 1BD0A 3ITVA 1W1ZA 4DLFA 3O2LA 3E3HA 3L9CA 4MADA 3NEVA 4AUBA 2E28A 3IUDA 3QW3A 1UKOA 3PZTA 3SO7A 1LBFA 2E7FA 3EPNA 2HRWA 2OZ3A 1BAGA 5F1UA 4GOAA 3WX7A 4S3CA 4JFSA 3WNOA 5XINA 3BLPX 3DCPA 1J0KA 1RJQA 3UWEA 4B5NA 1D3CA 1MVYA 2Z27A 4IOTA 2VO5A 2INEA 1HW6A 1OJXA 3VZXA 4QQ3A 1XIBA 3RLUA 2PDMA 8A3HA 4MUPA 3GW0A 3LXBA 4REQB 3D3AA 1NOWA 1V0KA 1QNRA 1MW0A 2GSEA 1PBGA 3EMQA 3ZM8A 1VPXA 3B8IA 1WKEA 3CM4A 3IUHA 5H8PA 4B2DA 1OFQA 2YA2A 3R10A 1XSKA 1EQCA 4LUIA 2VDGA 1HGYA 2IW0A 3LQLA 1XH2A 1ISWA 3W26A 3II1A 1VZWA 3WD1A 1JULA 4GI4A 3N4EA 4PTMA 1E0TA 1N55A 3C61A 1GGOA 4XZ9A 2BY0A 2CITA 3B9OA 3E96A 3LA4A 2B81A 3LN3A 3Q2DA 1L9WA 1W5QA 3LZ3A 3WDJA 3CL8A 4GISA 3PTMA 5AY7A 1N82A 4B92A 1YQ2A 3H21A 2VNCA 1JEZA 4GQ0A 1CCWB 1J5SA 4K6AA 5BROA 4RK8A 3VIMA 4W5ZA 3IRSA 3IK4A 3EBVA 3UPBA 2P5NA 3CQIA 3WYZA 2X05A 1H7RA 4XG1A 4KS0A 3FLUA 2QIWA 4W87A 3W25A 4OV4A 1OFOA 1XH1A 2PWFA 2OO6A 3E5BA 2ZFAA 3A12A 4XAPA 5CSRA 5IHSA 1OYBA 3GVRA 2CESA 3WLHA 1GQIA 3UR2A 1Q2SA 2A6NA 3DBPA 4UTHA 3P93A 2E25A 4UQAA 1C8XA 2AMGA 2HWGA 4Y9MA 4JIIX 1TMLA 5F4XA 7REQA 4OWGA 1GVYA 3D0CA 4Q6XA 5LYRA 1CGXA 2WMKA 1MZRA 4FPSA 1NU5A 1K6AA 3ABOA 4EXAA 4QAWA 4GABA 5AYZA 5BCAA 1TQXA 5EMMA 3E0WA 3W38A 2NT1A 1TG7A 3HGRA 1UD8A 1GJWA 2UY2A 3O0FA 1PX8A 4JKKA 4L4PA 2R1MA 1HZYA 2H8ZA 2Y24A 2WO5A 3LM7A 3P67A 3B8VA 2QUMA 2A4AA 3QQ0A 5K9CA 4GQQA 4W5UA 3RXZA 3UA3A 2XU2A 1VP5A 1Q6QA 3QOKA 2D22A 4LCSA 3WD4A 3DFSA 2HNHA 2VUNA 3EA3A 3LCXA 5D09A 3OG3A 3AJ7A 2Y62A 5I3JA 2EXOA 1NFGA 4LC8A 2PGFA 4JQ2A 4R88A 4RNFA 3S5OA 1FWWA 1TE6A 4HN8A 3LHZA 3N6HA 1OD8A 3G0UA 3PF3A 5CZTA 4QDPA 4H9TA 4M56A 3W1RA 3NTYA 2Z2UA 1W8SA 3RUBL 2QIIA 4MNJA 4QNEA 2FH6A 2WVVA 4IFKB 4XISA 1NDVA 1F9CA 3CBWA 3MTWA 2FKPA 3KP1A 2YL8A 1Z9AA 3UA4A 2DZTA 4KCVA 4O53A 5KMYA 2WZMA 2BNJA 2AQWA 3O07A 1NWTA 3QHOA 1E0WA 1E40A 2WNZA 4F8XA 3EOEA 3ZJ7A 3F2CA 1LOSA 1UZ1A 3GIQA 2BY1A 1P43A 4QE1A 4B4HA 4FIRA 1ZU8A 4OHQA 3MV11 3T07A 4CN6A 3MU7A 2QAPA 3T0CA 2R1LA 1B3VA 1AZ2A 1BEUA 4AC1X 3T44A 1O4UA 3GH5A 4H6RA 4US5D 3SY1A 3UXIA 4ZCWA 1B3XA 1PKLA 4Y9AA 4N0RA 1ELSA 4OZOA 2WXDM 3OEXA 3HJZA 1EA0A 4MZ1A 4FNQA 2XFWA 2DGAA 4HNOA 3L67A 3G3MA 2ZZ5A 4YJ5A 4OT7A 1A5UA 2Z1XA 2YLLA 3HM7A 5D32A 4G7EA 4J35A 1TUFA 1I9CB 2QVHA 3VFCA 2W5FA 4X3ZA 4B5WA 1EC8A 3S5SA 1XP3A 1PJ9A 4HZ7A 5AN7A 3FJNA 3QR3A 3M64A 4PFMA 5TNVA 4L4OA 2D24A 5BRQA 4W85A 2GPTA 1S5VA 2EJ1A 1PTAA 1D8CA 1MO0A 1EDTA 4Q7NA 3SB0A 1WE5A 1YPIA 2V5DA 4MLJA 3I3BA 4A3UA 3WLIA 4DO5A 3R25A 1QHOA 4HHHA 1PYMA 5GPRA 3O6CA 5HUOA 1SW3A 4O57A 2B31A 4P8UA 3KVKA 2I9UA 3QZ6A 4BI7A 4ZE5A 1JDCA 1GTHA 3NURA 1LL7A 3UGVA 3AHXA 5E0FA 2CLKA 1R9YA 4JTEA 3A3HA 1XQKA 1GYNA 4L4LA 3NR0A 2J75A 1TJ2A 5I24A 2Y2WA 2HQAA 4A3RA 1W56A 3G1AA 2X1UA 2ZVIA 1WKYA 3WH5A 1W2VA 2E8YA 2BVDA 4LVAA 4AMAA 3V5FA 1LQ0A 4JTGA 4HK7A 3T08A 3W37A 3SQMA 4CNTA 2JALA 3FDGA 1JJKA 2AQVA 1FDYA 1XICA 3AS2A 3IGSA 2PDLA 3M43A 1O7AA 4BWLA 1JCLA 4EKJA 2QS8A 5EMYA 3P3BA 5I7GA 3N15A 2D0GA 2ZC1A 5LA1A 1LG1A 2X1TA 3HJEA 3URAA 1RHCA 2JIEA 1SW0A 4JHZA 5A6BA 2ZZ3A 4RPPA 4E8DA 4W86A 4ILSA 3AHTA 2A3EA 1WXJA 1L8PA 5A8GA 1CXEA 1UPPA 4Q4MA 4RE4A 2FHFA 4FEZA 1W3TA 3IIOA 1GNXA