1ZGGA

Solution structure of a low molecular weight protein tyrosine phosphatase from bacillus subtilis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
150
structure length
150
Chain Sequence
MDIIFVCTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a low-molecular-weight protein tyrosine phosphatase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Putative low molecular weight protein-tyrosine-phosphatase y
total genus 59
structure length 150
sequence length 150
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zggA00
2FTKE 1L5YA 5TPZD 1YK1A 4KZKA 2O20A 1Z16A 2PJUA 4HNSA 1JL3A 5D2CA 1NXXA 3N0WA 1ABEA 1E2BA 1NY5A 4IRXA 2MSKA 2MYNA 1DC7A 9ABPA 3MYYA 1ISRA 4RS3A 2HQOA 4P98A 4RZSA 3RVOA 4Z4CA 1JFVA 1OXKB 2E4YA 1JWLA 1DBPA 3I09A 4W5TA 4H3HB 1Z13A 1Z2EA 4LE2A 4ZMRA 1GCAA 4D74A 3LKVA 1FFGA 3BBLA 3MQ4A 5F64A 4EVRA 4F12A 3KHTA 5KWSA 3HS3A 2FQYA 4MAAA 4MQFA 3LUHA 5BQ3A 4RY9A 1NTRA 1ABFA 2CD7A 3D02A 3EGCA 4XXHA 3RVSA 4O1IA 1KRXA 4MLDA 2JRLA 3IPAA 1FQWA 3DLHA 4KV7A 5IX8A 2MYUA 2LIVA 3IPCA 1QQBA 1JH9A 1ZESA 2P9HA 4RY8A 3MIZA 5I4CA 2JB9A 3B2NA 2JVIA 3CKMA 3EULA 4O5AA 1PEAA 1TMYA 2MSWA 4IILA 4F06A 5KC8A 3N8IA 3CZ5A 5EWLA 2LBPA 2JK1A 1YMVA 2M1ZA 3OO1A 3M9XA 1LBHA 5HQJA 3VNAA 4CBVA 4G0ZA 4Q6BA 4MR7A 3ROFA 4MPTA 1LJLA 1MIHA 3BILA 3HCWA 3EDCA 1DP4A 1P6QA 2FEWB 3W9SA 1I3CA 3CRNA 1Z2DA 3RH0A 2E4XA 1A2OA 2VUIB 4D6XA 2GBPA 5DTEA 1PUXA 4EGSA 1QPZA 1NXTA 3QEKA 3I42A 1YMUA 3KSMA 3CZCA 1RPJA 2MYTA 4JAVC 1QKKA 3DGEC 3A0UA 3D8UA 2FQXA 4OATA 4WZZA 3H5IA 2PLNA 3SY8A 5BR1A 3N0RA 3OQNA 5B3JA 3GRCA 1NXSA 1JF8A 3LOPA 2QXYA 4LE0A 4Z9BA 2MYPA 3H1FA 3F6CA 2HPHA 3GBVA 4D6YA 2PAFA 2R4QA 4PICA 1EHCA 3Q7RA 3CLKA 2CHEA 1C0EA 4MGEA 2P4UA 1DJMA 3K9CA 6CHYA 1AB5A 3OMXA 2FSPA 1VLZA 1LJUA 3GYBA 5FWYB 4XLTA 4N41A 5C5EA 1BVHA 1EWTA 3EODA 3O21A 2M98A 4EUKA 4Z4IA 2PE5A 3DLBA 3CG0A 5JNRA 3K4HA 3Q7SA 2GWRA 1SRRA 2OENG 1MAVA 2H3HA 5EWJA 4RXMA 3JTEA 2FW0A 2LUOA 3O1HB 3QX9A 3MM4A 4EYKA 3OQMA 3NHMA 5FWXA 1BAPA 3HUUA 1QO0D 1D2AA 3O1IC 1SD5A 2RDMA 2QW1A 3LUKA 3QEMA 1M2EA 4QICA 4KFCA 3TX6A 4YS6A 1Z18A 4ZMSA 1YS7A 4ZPJA 4MLCA 5JNTA 1EFAA 3A0RB 4MR9A 2QU7A 2AYZA 1GUBA 1QO0A 1B00A 2FMKA 1SXIA 4MS3A 3H5VA 3G85A 4JP1A 3HV2A 3TMYA 3A10A 1FFSA 3QLTA 2N9UA 4YRZA 3CFYA 4WXEA 4TMYA 1DBWA 4KQCA 1ZH2A 2PUCA 1ZH4A 1M5TA 3CHYA 3URMA 3FMVA 1RXIA 4YLEA 1J56A 1KRWA 1XWWA 2QVGA 5TPWA 4RV5A 2QSJA 3M9WA 3RVNA 4MR8B 2ZAYA 3LKBA 3DZDA 4O1HA 3ILYA 2FQWA 3MMNA 4NCBA 5IUJC 2NUBA 2IKSA 4PE5B 3UKJA 2PKXA 1CYEA 2I6FA 1VRVA 3OO0A 3Q41A 2YHBA 3CS3A 4P1ZA 1M5UA 2E4WA 3O2QB 5TQ2A 1ZAYA 3OLWA 4Y9TA 5IUKC 2L18A 3BRQA 4Z4FA 3H6HA 4N03A 2IPAB 1NATA 1TJYA 1ZVVA 3H5OA 3RVJA 3KLOA 4HNRA 5IC5A 4YCSA 1QNLA 1ZN2A 3LUAA 3H1EA 3KYJB 4OBBA 2VK2A 3HSYA 2B4AA 1PNRA 1SXGA 2L17A 1E6MA 4KVFA 1ZHHA 4Z9AA 2FXIA 4RK7A 3F6PA 4Z4HA 4MS1A 4RKRA 3IDOA 3QX8A 2PUEA 2WJWA 1USIA 5BRJA 3UUGA 2E4ZA 4DQDA 5HKOA 2OQRA 2JBAB 1MB0A 1GUDA 5JNSA 2VYCA 5JNUA 1EAYA 3O2JA 4HYEA 4IF4A 4HNQA 2IPMA 2NT3A 3LTEA 5TPWB 3MF4A 3QK7A 3H5LA 4G0XA 3SNKA 3HDGA 3HDVA 2GI4A 4RWEA 4MQEA 1MB3A 1QP7A 3R0JA 1AB6A 1Z25A 1Z15A 5TQ0A 3RVRA 1CEYA 3KKEA 1XHFA 3NHZA 3OMWA 4RK0A 5KQLA 1JBEA 2LPMA 4ZYLA 3HK2A 3FDFA 3FFXA 3OLVA 5HM6A 2ID9A 5IBQA 1SXHA 1TLFA 2E4VA 2IYNA 1U04A 4MR9B 3P9YA 1QMPA 3QLVC 3QELA 2DRIA 4IMJB 3QEMB 1RZRD 3CNBA 4KK4A 3F7NA 4N0QA 1DRJA 3KJXA 3T8YA 2ZWMA 3TB6A 4G0OA 2CHFA 3C3KA 4GNRA 4WXMA 4RXUA 3IP9A 3HEBA 4YV7A 1A0OA 2H0AA 1LBIA 3RVLA 1DZ3A 1NXVA 3JPYA 4DADA 3JVIA 4MS4A 4W5RA 4JASB 1DCFA 4YP9A 2B1JA 1YS6A 3Q7TA 1UDRA 2IPLA 4JB0A 1D5WA 2NZUG 4ETIA 1DG9A 2NT4A 2WJAA 4WWHA 5C5CA 3HZHA 1Z26A 5FWYA 5KI6A 4E7PA 1FSPA 3EQ2A 1KGSA 1WETA 3NNSA 2RGYA 5DLEA 3SQNA 1EWVA 4PZ0A 1ZGGA 3FFWA 3HO1A 3NNDA 1Y1LA 2A9OA 1GLGA 2LP4Y 5EWMB 2HQBA 3H75A 4KNYA 5EWLB 4OLAA 5BRAA 3GA5A 2JVKA 1TM2A 2R47A 4L85A 4XASA 5IEJA 2NZVG 2A9QA 3HUTA 4W5QA 4N47A 1BA2A 1JHZA 4FE7A 5KC9A 4Z4EA 2JCGA 4LDAA 4YWHA 2IOYA 5B3JC 1ZY2A 1EWKA 5TE9A 3TD9A 4F8JA 3QLVA 2FKAA 3LUJA 4OTZA 2X7XA 2A9PA 3FFTA 3GT7A 3NNNA 4JOQA 4RK5A 4GPAA 2VUHB 1JFTA 2PUBA 3CU5A 4DN6A 4MQEB 1GCGA 3C6QA 3EJWA 1W9HA 3KS9A 1LK0A 4LE1A 3SM9A 3Q9SA 3UK0A 3HM9A 1L5ZA 4G97A 2Q5CA 2WB4A 5IEBA 4RU1A 3O74A 2GX6A 2IDMA 3KLNA 3Q15C 1JYEA 3JS5A 5T3YA 4ETNA 5GOTA 3ROTA 2E4UA 1APBA 3O2SB 4KQ9A 5GQSA 3ILHA 1BDJA 3L6UA 1A04A 2HQRA 3H1GA 5E3JA 2PUFA 4G0QA 5TQJA 4WUTA 4MS1B 4KPYA 1P2FA 3IP5A 3RQIA 4Q7EA 2FLKA 2V0NA 5IULC 5KQMA 1U8TA 2FLWA 2QV0A 1YVUA 4L4UA 5KQGA 2QVCA 1E6LA 1ISSA 4RK1A 4EY3A 4F3TA 1BDHA 1PEYA 4ML3A 1S8NA 1VKRA 1R8JA 4PEVA 5CNMA 2FVYA 2FEPA 3OM1A 2FMFA 4MS4B 3OLXA 4UHKA 4NV3A 2W42A 2YHAA 3HJFA 6ABPA 5JS1A 4JB2A 3C3WA 3JY6A 3QLUC 5TQ2B 4ZJPA 2PL9A 3RVPA 3MA0A 1QP0A 3N75A 2QZJA 4G86A 1CHNA 4MQFB 1JFSA 1JDNA 3EAFA 3KCNA 3M6MD 3LUCA 5EWJB 2ID7A 4ETMA 2BGGA 1E6KA 3L49A 3G1WA 3T95A 5T7BA 3T6KA 4RK6A 5TPZA 2HJ9A 4LRQA 3HXMA 4EYOA 1C4WA 2TMYA 4IMIB 5EWMA 4UHJA 7ABPA 4RSMA 1F4VA 4FB4A 1YTUA 3H6GA 5ABPA 4RK4A 4RY0A 1XHEA 2A9RA 3NBMA 5TQ0B 5JNWA 2PUAA 1NXWA 1URPA 3KTOA 1H9CA 2MSLA 2RJOA 5CNIA 3SAJA 4OG2A 2FN9A 3C97A 2WY2D 3IP6A 3JVDA 3OLYA 5CNJA 4G0PA 2R48A 4G0MA 5JS2A 1PNTA 3FGZA 4W5OA 1QQAA 3BREA 3RVMA 1NXPA 4YGXB 2AYXA 3LUGA 4EVSA 1HEYA 3O75A 4KMRA 2PL1A 2QR3A 3A3KA 4RXTA 4XAQA 4QYMA 3KG2A 3DGFC 5DGCA 4S04A 4Z4GA 4MRMA 3GBPA 4E7OA 4EVQA 1T34A 4RDCA 4B09A 2R25B 1RNLA 1OXBB 1RZRA 4W5NA 1FFWA 4TLLB 1MVOA 1USGA 4EYGA 1DCMA 2KYRA 4N76A 3QELB 3H5TA 1DC8A 1ZITA 4H60A 4EYQA 4MYRA 3BRSA 4JA2A 4LDZA 3KYIB 2XDYA 4XFKA 1JX6A 4KK3A 2FN8A 4KRFA 3OQOA 3I5AA 1NXOA 2GKGA 4Q6WA 4G0YA 1VPWA 4NCAA 3LMKA 1W25A 2PUGA 4TN5A 4RKQA 4MR7B 4OLBA 1U2PA 3N6VA 2WWVD 3EQZA 4YR7A 3VNBA 3JPWA 4NICA 5IUNC 2WMYA 2FEKA 1DCKA 5CNKA 4Z0NA 1IIBA 1K66A 3E61A 1P8AA 5KQPA 1P6UA 5HSGA 4FE4A 1U0SY 3S99A 4N0PA 3I45A 1DRKA 2JBAA 1K68A 3GV0A 2PMCA 3N53A 1ZGZA 4LZLA 5DKFA 2WRZA 5DCLA 5FBKA 4PYRA 3CTPA 2FMHA 3HVRA 3RVQA 1Z17A 4Z99A 3LFTA 1ZDMA 3GWGA 3IP7A 4IGAA 4LX8A 4F11A 4QYWA 1JDPA 3CG4A 3DBIA 1Z12A 1TVMA 2FMIA 4TLMB 3E3MA 1USKA 3H5WA 4MS3B 3LUDA 3SG0A 2CWDA 1YK0A 1JLKA 2PUDA 1JYFA 2J48A 4H3KB 3T38A 4YO7A 4KREA 1D4ZA 1D1PA 3N0XA 2F8SA 1YIOA 2L2QA 2F8TA 2RJNA 4WT7A 3GL9A 1DBQA 5CHYA 5FWXB 1KMIY 3O1JC 8ABPA 1U2QA 2HSGA 3OM0A 5FBHA 3TO5A 3C3MA 4MRMB 3F73A 1QP4A 2JVJA 1F51E 4M88A 1PHRA 1BDIA 4XARA 3LUFA 3RVKA 4S05A 4QPJC 4NQRA 5PNTA 4MR8A 3QLUA 3OLZA 1RXEA 2L19A 5JNVA 5ED4A 1D1QA 2IPNA 1M2FA
chains in the Genus database with same CATH superfamily
3NVDA 3WFJA 4BMCA 1FRFS 4XWOA 3T1QA 4IKOA 3WOHA 4IDBA 3FNEA 3GT0A 4GGPA 2PZBA 2Z95A 1NY5A 2ZT8A 5EQTA 2J3LA 2C88A 3ASUA 3C16C 2XNCA 3T7CA 1OPRA 1AN0A 3WG9A 2QSUA 5FDFA 3PI6A 1GJRA 3HKBB 4XYEA 5D3MB 1OH6A 4UUPA 2IUYA 1E96A 1DQZA 3DOJA 5J2UB 4AJ1A 4C4AA 3K1AB 1T5SA 1CQWA 1HRKA 4L1KA 3HS3A 3RK0A 4TYYA 1RBMA 5BQ3A 4P54A 4FGZA 4LYGA 2WHRA 5HG0A 5FUYA 1CFZA 2YWHA 4OAQA 4O1IA 1V45E 2ECOA 2JRLA 4Q7JB 1E98A 3DLHA 4RS4A 4QOFA 2EF0A 4I7EA 1OGJA 3RRFA 2EARA 3UF0A 1T2EA 1E92A 2PPLA 2VP9A 2VXYA 4ND5A 1ZESA 5LOVB 5KYVA 1SU8A 3HXPA 1CX9B 4G5QA 1E0DA 1EUDB 2R8EA 5K8VA 1FUYB 1WU8A 2W22A 2YMLA 5JRJA 4LJAA 1OWOA 4O5AA 5DBEX 2CVQA 1RFGE 3K70C 1JSCA 3U9SA 5G3YA 3CZ5A 2LKCA 1L7EA 2ZBRA 1U3TA 1GQ2A 3EXEA 4N8DA 3TRJA 2UZ4A 1G2IA 1ZS9A 2D1RA 5C5CA 3LLMA 3AV0B 4REMA 3ADBA 3WAJA 2JK1A 3AF0A 2AS0A 4QLOA 4HFMA 8LDHA 5B58C 3AG5A 2GQ0A 5HK8A 5B2ZA 5IYZF 3KV3O 3WLRA 3AEKB 1DHTA 4KBYA 4HYYA 2ODQA 2CJWB 2CUTA 4R31A 1AK2A 4RKEA 2YJNA 2UU9B 3QKRB 3HCWA 3D4BA 3CO5A 1KVTA 3EDCA 4ARAA 1UPAA 4TTTS 4XR9A 3VHXB 4F2WA 3BAFA 3EUAA 2D2EA 3CRNA 5FADA 3RIGA 2FK7A 4BQRA 3BH6A 3JQBA 3T7KA 2GN4A 3LK6A 3IHWA 3O8QB 3ZV5A 3OFND 3QJGA 4JN6B 5FCDA 2Q8PA 3JVVA 1T2AA 1WDMA 1V37A 1MT3A 2QL7A 3LL7A 2CNLA 3ESBA 4H08A 4QUIA 2H2AA 3A9WA 4BVJA 3HY3A 4U2GA 3WQHA 3EEOA 4WZBA 1GXSA 1M7BA 3KUXA 3M3HA 3SIWA 2QJFA 5D5PA 2OHFA 4LSGA 4WNCA 3PGJA 5DGXA 1GZVA 3UJ6A 5SZHB 4MDEA 2NGRA 3U37A 4AX8A 4CCWA 2VXOA 4AMYA 4D5EA 3IV9A 2XE7A 4P38A 4C21A 3GZNA 4Y2VA 4A73A 1D0VA 3PRJA 2FYTA 1D9ZA 3V4ZA 1R6VA 1FL9A 3SR4A 2ZRQA 3FVRA 5K8TA 1YS9A 5JWHA 1HDCA 4FI3C 4MUNA 1XAIA 4GOMD 3H17A 2PMKA 2RHJA 3AHGA 3I01A 3G5UA 3K2BA 4BQOA 1MHTA 2YBDA 3RIXA 5KTMA 4LI3X 1FEZA 2G70A 3TPCA 2BBOA 2QUKA 221PA 4DXDA 2COEA 3ROZA 4GS5A 5CYFA 5C5EA 1BVHA 1MO6A 1JPUA 1QC5B 5HJ5A 4IIBA 3IUBA 4G8BA 5TVKA 2F1RA 3R0ZA 3WWZA 2QLBA 2PDAA 5JZOA 4YXWA 2PE5A 1E2LA 2EDAA 1QH1B 4UFPA 4G1FA 4R1UA 1XGKA 3SEZA 2I7VA 3QPWA 4GRDA 4IDCA 5D5QA 5KVSA 3JTEA 5FI0B 3R5JA 2GCEA 1C3EA 3OCZA 3ZWPA 1RQLA 2ZTUA 1D7OA 1E2MA 1BQEA 2H1RA 3HP4A 2FSHA 1NGSA 3TIVA 1I9CA 3PG5A 1M2EA 1PJZA 3PQEA 1AE1A 4ZMSA 4JXXA 2M32A 1C9KA 1L7VC 1XCLA 3ZGNA 3M34A 4IXMA 4KN9S 3M33A 2ZJYA 3BRWA 3HMQA 4OQQA 5JDCA 2NVUB 3G85A 4LGCA 2PWYA 4KLZA 4WXEA 5I7EA 1SMKA 3GLQA 1PX0A 2VJPA 2ZUCA 4BEBA 1ZH2A 1R0CA 1X8LA 4Q1EA 3V1MA 2GYWA 1NBMD 1JDSA 4NCXA 1CQXA 1N2ZA 5AK6A 4Y2GA 3WL7A 4R5HA 1HT2E 1KAMA 4B35A 4B76A 1Y82A 3ETHA 3ZGYA 1G6Q1 3QUBA 2ORED 4TKVB 4Z4CA 1U65A 2VATA 1M2OB 3BFJA 4N8SA 3BFPA 3T1HB 5HF9A 3BH0A 2ZUFA 4PC3A 3IXQA 3NRJA 4EA7A 3OKPA 3ZDBA 1FTSA 5CM8B 3BXXA 1XXHE 5DF1A 1S8AA 1ORDA 2I6FA 5CW2A 1QIIA 1EX6A 4EDHA 1KKLA 3B9BA 2CVHA 2FFQA 4H7KA 4JBHA 1TJ4A 3K9FC 4QRDA 4XWGA 1TECE 1C3JA 1RACA 1UOOA 2OXRA 4RX1A 4WZBE 5BWCA 1ZVVA 3K6RA 4HKTA 4U6SA 2VK2A 1KBZA 3H97A 2AQKA 4BZPA 5TS2A 2BFDB 5KPDA 5KYWA 1DBSA 2J5RA 2Q9UA 4PIMA 4PHGA 3U4CA 4GEKA 1FNNA 2PLFA 5L4LA 1QUFA 3W2GA 4HGRA 4QDJA 1TQ8A 3IULA 1VSVA 4N3CA 3MNFA 4GM1A 3QXHA 3C4QA 4CJXA 3PA6A 2YS7A 3TL3A 4OFWA 5TF0A 2B1RA 2BEWB 5J9FA 1I14A 3HBNA 3WO0A 3FPGA 1QU2A 2G5CA 1PKXA 1K88A 1UPFA 1P72A 4US0R 1XAHA 2B25A 4FPXA 2KSQA 5KYUB 2D1FA 4D4LA 1CY6A 1JEDA 4YA6A 3BXOA 1O94D 3SYKA 4BPBA 3CZ4A 3DUWA 2WAOA 4YMSA 3V4FA 5ALVA 8OHMA 4H1WA 2JGJA 1IAQA 1ELOA 3FPAA 1J8VA 1XMXA 2O3UA 5FTJA 3NC4A 3FNIA 4UAUA 3AL2A 2Q0HA 2OLEA 4FWBA 3TAHA 3LP6A 4FLFA 4IIFA 1MMFB 4YDSA 4V3BA 2ADMA 1O94A 4YACA 3T7TA 4AS1A 1WU7A 1ZNWA 2CNNA 1XB2A 2E4VA 2HHCA 1I10A 3G9TA 3AZQA 3CX7A 5JSQA 4X7PA 1G21E 3QLVC 1RC0A 2PMWB 1QVWA 4URUR 1ZJWA 4BWVA 2ZR8A 3DDNA 4E3WA 4WGFA 1FFXA 1ZAKA 1U9JA 1W75A 2Y3IA 3DMYA 3G0GA 1OLUB 3IT1A 3S1AA 4MGYR 4B4WA 1KMQA 2MMCA 2TSYB 2HBRA 3GQVA 2ZUUA 3LBYA 1UDCA 3FBWA 3H86A 4WLNA 1PSWA 2H0AA 3GZ4A 3RHFA 4C0LA 5L7TA 1LBIA 1YQEA 1T8TA 4TT3A 1XA4A 4EHLA 1VCMA 4PCAA 4KPEC 1N3IA 1M2GA 1DELA 3C7TA 1R9JA 4MWGA 4ZYTA 2IPLA 2W2OA 2PT9A 2MMGA 4UTNA 3GR6A 4BZZA 3FIJA 2VK4A 3ZBQA 2XCQA 1DTWB 1DIRA 1IQRA 2PCJA 3USCS 4EYSA 5FWYA 3RU2A 1SKMA 1CRWG 2BAGA 1YJXA 3DYIA 3STHA 2QDXA 4LWPA 1RAIA 3K73O 5E3HA 4GZMA 421PA 5JPDA 1ZHOA 4EB6B 1OT5A 2BKEA 3K3PA 4KV9A 2ZIUB 3LK7A 5I3ZA 5LKRA 3DZIA 4GVPA 3A6PC 4DLAA 4KZPA 1BWSA 2WJ4A 3BD6A 4FMBB 4P2GA 2JVKA 4XEHA 4P0PB 3EB9A 3A4VA 3PQFA 3DONA 5A5DA 4B33A 5CB8A 1EA5A 4NPCA 3WGHA 1M2VB 1W0JD 2FVXA 2PUWA 3A3NA 3COVA 4A8HA 1GILA 1C7EA 1NXQA 1VHDA 2CK3D 3MINA 1TUGA 2FUG1 1JSLA 1YNSA 1Z9BA 1Y1TA 1S3GA 3OQ1A 3PC7A 3DBLA 3PNOA 2MHCA 4FNGA 3MFYA 1KR2A 1M8PA 1G5PA 4NBVA 4TT3D 4C04A 4CM4B 4OTZA 4RA6B 5EQJB 5LFAA 5REQB 1WTCA 1OXMA 3N70A 2RE8A 2JARA 2AW5A 3ORHA 5BVGB 1YL5A 1FSZA 1JFTA 4UCFA 4RVFA 3E9CA 4HVTA 4JJZA 3NB0A 1LK0A 4H0NA 3S1SA 3PPYA 1QLJA 1VCNA 1E9CA 1R5OA 2O48X 4KN5A 5AO9A 4OA5A 3WNBA 1GKKA 4WKCA 4LF8B 3GK3A 3UKDA 3AJEA 1EJ6A 1SHZA 2WK1A 2FWBA 2EW8A 2J6IA 3L8GA 4KUGA 5FI3A 5K3DA 3ROTA 3ZI7A 2ODBA 3BF7A 4AQDA 5GQSA 4G4SP 4E94A 4Q1FA 4UEKA 4M0LA 2DKNA 4A9AA 2ZSUA 1U6KA 4KN6A 1KAQA 4IEIA 2ZITA 4YRAA 2B1QA 3JYNA 1Q17A 2Z5LA 4GXNA 4Y2UA 1TTHA 2C4HA 4O08A 5E7QA 5FFNA 2V7GA 4AUEA 4DSUA 1CR0A 1J21A 4PGMA 2B6NA 5DOVA 2RG7A 1UMCA 2JAPA 3FZYA 4MROA 1ZM3A 1EEXB 3WGKA 1VJRA 2J3JA 1EZ1A 2WU3A 1XZEA 4QOIA 4UUNA 1XNHA 1ZUNB 4YO8A 3PCTA 3MHTA 6ABPA 4NCBA 1RJGA 2DHRA 4NG5A 4MPRA 5B37A 3O7MA 3EDMA 5AUQA 2FPPB 3W90A 3B6IA 3S2SA 3RLFA 3OZAA 4LF6B 1I7PA 3DHWC 1JDNA 1YONA 1XX6A 2X0IA 1X7YA 3B1KA 1E2KA 3KQMA 4NENB 4IQ0A 2QTBA 3TRDA 1I4OA 1F8GA 1ETUA 1QHYA 1GITA 3G7UA 3GEEA 4WJKB 3TL2A 3DTTA 5CP8A 3S5JA 1NVEA 2AJ8A 4XTCS 1P33A 4IHJB 4JP2A 4LNUA 1EVQA 4B6GA 5HP4A 2BM1A 2O5EA 2AN3A 3DLTA 3OUUA 2QRNA 1N33B 2FR8A 5KYGA 2VZLA 1KYIA 2QX6A 3T5DA 4M8LA 4OI2A 1FX1A 4AMBA 5IVIA 1UKZA 4NS1A 1D8TA 1A5BB 4X45A 2WMOB 2RI6A 2C9BA 1FDRA 3H2BA 4AWXA 4C2AA 4C3OB 2W58A 4UE6A 3B1ZA 5B30A 1UBFA 3IP6A 2KS6A 3ZV3A 1T35A 1DSSG 4A3SA 5TLSA 3L01A 5JS2A 5D1HA 2O0LA 1NF2A 1MRZA 1GNQA 2G04A 1DO8A 1GYRA 1GO2A 2VT7A 3AUAA 3LWBA 2DTEA 3RUFA 4XDZA 5ADWA 2EATA 2YQ5A 1B6TA 3TJRA 3JR7A 1YJBA 2QY6A 5TT1A 5I47A 1XLWA 2RHCA 5HPYB 3HHPA 3KLPX 1SUCA 1PW7A 1TU3A 1DUIA 3OCJA 1ZOSA 3HXQA 1RNLA 2KB0A 4US2R 3HYTA 2YVUA 3JZDA 4PVCA 2Q3EA 2RGNC 2WM2A 4Y6OA 4WJLA 1EVLA 1QCYA 4BUJA 3FWZA 1BD4A 3EHDA 1DC3A 1A88A 1F8XA 2NUPA 2R6HA 2Z4RA 3P94A 4LJ8A 1BE8A 3ICWA 5DM4A 5H4HA 3USZA 4BRZA 4PO9A 4XFKA 3FNHA 1BROA 1Z7YA 3HLYA 3EPLA 3NATA 3R8XA 2V1UA 3G0HA 4JA0A 1WQ4A 2GUGA 1VG0B 2ZSEA 5B64A 5LMUB 3RDPA 1SXQA 1XVAA 2ZB8A 3PEWA 1HYBA 2Z2KA 3E4DA 2J45A 1NI4B 3WLOA 4DVGA 1PLKA 4G84A 4MHOA 2PX2A 3V48A 4P5PA 1FYXA 3N6VA 3EQZA 1FFCA 2P68A 3JPWA 4M98A 4K81B 3RJ9A 3V5NA 3T5CA 3OQ6A 1U4NA 4A8TA 3DE6X 1VI6A 2P6PA 4XPIB 2Z2YA 5FOXA 4HYTA 1H8EA 3BJEA 3S2YA 3O4IA 4QXAA 3D54D 3QVTA 1FNBA 4RETA 3SC6A 5JQGA 4EFNA 2ID8A 4KQXA 4HRXA 2O6HA 4QU9A 2WRZA 3MJTA 3H1BA 3Q6IA 4PYRA 5BMVF 1XEWY 4TMKA 4EUFA 1RYEA 1PS9A 1TA0A 4B3XA 1ZFNA 4GYWA 5DNVA 2FMIA 2DR0A 1U8AA 2VF2A 3EWAA 1ZGHA 4ZTUB 2AIRA 1J8QA 4RJLA 2W8ZA 1JYFA 3EG5A 4R2IA 4H3KB 2AB0A 4B2LA 1U5BB 4D9NA 4ZYVA 1HY3A 2IEGA 3ZBPA 4KREA 4IJQA 3JTMA 1HMYA 3B9PA 2JKZA 2VJAA 1GLNA 1RAFA 2HBYA 4HN2A 3MJRA 4JR1A 5CVCA 8ADHA 4AY6A 1T0IA 1UOEA 2IX9A 2OCDA 5DT9A 1ZW6A 1JQAA 1QG6A 2ZYSA 4XJVA 4BNNA 1S7CA 1Z6GA 3VPFA 1UXGA 4C5AA 4HEQA 1ULUA 2EOAA 4A5OA 1YDEA 1BDIA 1KHHA 3F47A 3LUFA 4ZDKA 4EY4A 1DRWA 4S05A 4QPJC 1FF9A 4IWNA 1SCUB 4ZQEA 3TLZA 2ZT6A 4CF6A 4ZJUA 4PV7A 2JI9A 4YQZA 4NPAA 3U4AA 3AEQB 1D2HA 2ZPUA 2UUBB 4FFMA 2Q4EA 5ALDA 1BMQA 1DHRA 2FB9A 2HNKA 2XNKA 1JQLB 2J4CA 3G79A 1MC1A 4LZOA 4O2BA 4RYDA 4KQMA 1E63A 3C6XA 4CZ2A 4D3ZA 2ZI5A 3AU9A 3L43A 4YCJA 4QFBA 5BWNA 1FFBA 3EPKA 3I04M 2RD2A 1XQXA 4TRRA 2GJSA 3MGGA 5KCZA 1R00A 5HHTA 3TCXB 3QOWA 2VNKA 3UQYS 2V6IA 4RZSA 4AYWA 3OJWA 3T9BA 3DOEA 3KSZO 3WV5A 3IX7A 2ZU6A 3I09A 4GBED 4ZT5A 3EDYA 1NNEA 3A2LA 2PSFA 5KS2A 4WBNB 1RYBA 4MYDA 1N34B 5A03A 4MDFA 3VV3A 2EZ9A 2FG6C 2Q5FA 5L3RA 2JDID 2MJLA 1WUHS 2H16A 5KBYA 3VZRA 4IJ6A 3JQ7B 1XV5A 2KX7A 3ZQ4A 3PJRA 4GUDA 2CD7A 3QZUA 1JHVA 1K6JA 1WLYA 2YV5A 1UJMA 2J7PD 4F91B 5HGXA 5KSOA 3AI7A 4UHEA 3MW8A 1K9VF 1S2IA 4IOJA 1ENYA 4KDCA 3IPCA 3KSDO 4QX6A 2IE0A 3PL1A 3B5EA 3HLKA 1QYVA 4RY8A 4YYZA 3E8MA 1VE3A 3D8SA 3FWNA 3H84A 3PC8A 1N2CB 1LVUA 2JRCA 4K40A 2VC2B 3D6UA 5KC8A 3WLKX 4Q15A 1AX9A 2WSYB 2FJ0A 3ZQJA 4I8XA 1JJBA 5ALNA 5DWVA 3BE5A 2ECKA 1LDEA 4LJ5A 5DNUA 4MLPA 4DV1B 1ZU5A 3OAAD 2I2FA 4CQLB 4JYMA 3ROFA 3WJAA 4U0KA 2IOHA 1TT5B 3NS7A 1ACJA 5F7XA 1RHJA 3N2LA 1L5VA 4LRSB 4DV7B 1SBHA 1WF3A 5I9BA 1IJFA 3ZJ5A 1ODIA 4G1UC 3G88A 4FNMA 3VDXA 4BNWA 2VPZA 4W8HA 4B40A 1NXTA 3QEKA 1W5TA 3I42A 1G8JA 4Q4HB 2FWPA 3AIOA 3WDMA 1IXYA 4Z54A 1TM5E 2UZ1B 1SU6A 3A4TA 3OPVA 4WZZA 1B42A 4GU5A 1PD0A 1SUPA 1AOXA 1IULA 2OB1A 4XW2A 5T4BA 5JS6A 1QRTA 4DR6B 3L1UA 5LQSA 4IUBS 3MELA 1OI3A 5K0TA 1QIKA 1IH8A 3V55A 4CLDA 1YZQA 1IHPA 5CH5A 1FUUA 1KK1A 1UFVA 2MYPA 5IF3A 1T9ZA 4RF3A 1GGFA 1RC1A 2BF7A 2Q6VA 4B3MB 1XBTA 1YQGA 5EINA 1H5NA 2DULA 5F51A 1LK5A 2JF0A 3RJZA 4OQZA 4DCMA 4L8WB 1SQ6A 1UZMA 3IEMA 2GHRA 2P4UA 4UQOA 4GX0A 2IYUA 1EH5A 3MSCA 1AB5A 2VDNB 2Z3WA 2BTQB 1X8KA 1P1FA 2FSPA 3HJUA 4GMDA 3EIEA 5ARDA 2HEIA 1IXKA 5T67A 1FIUA 4P81A 1K5GA 1FA9A 4I1SA 1JZQA 2PJDA 2C42A 5U1PA 1E1NA 3R7SA 5JG7A 4Q3LA 2NTEA 3LA6A 4OHXA 4PHFA 2C97A 1V1RB 1AO0A 1ULAA 2OCYC 4DLYA 4Z4IA 2J9GA 5JAPA 2ZIWB 1A8QA 3SXUA 1I5OA 4CW7A 1H93A 1J25A 1BXZA 4JUCA 1TI7A 3DEFA 4WNAB 3QX9A 4RPHA 4OHCA 3C6ZA 5ALOA 2FFAA 3ONNA 5BR8B 1RXUA 2K6GA 4NMLA 2QBYA 3A28A 2VJLA 1KI4A 4XCXA 4HRVA 2VRCA 2B8TA 4R2WA 4QICA 2CE2X 5BV2P 4H7JA 1K1EA 1UKBA 5IJ9B 4U2DA 3A0RB 5DP1A 4RZ2A 1Q5PA 4LV5B 2OHGA 2UYCA 1JTEA 5SZKB 1SXIA 2O5CA 1Y9EA 2L69A 4BDSA 1QYRA 3PIIA 4QOSA 2O2EA 5G2OA 3VO9A 3CFYA 3LUPA 1X1BA 2QYSA 5BPFA 3D0RA 2I7CA 5DTQA 4B7ZA 1IXRC 4W4TA 4A7PA 3IMCA 2EZUA 3RWBA 5JCOC 1R0YA 1HO3A 2W98A 4FUQA 3HPRA 4RM3A 4PANA 2H17A 2AR9A 1TE2A 4YCAA 3UAWA 3UHJA 2R00C 2QEQA 2FX3A 3H2GA 1JVNA 5AQEA 1P29A 2IP1A 5IJ9A 5EZ6B 2C0QA 4S1VA 2DFDA 1XK6A 2NYUA 4CEIB 3AESB 3AEUA 4NU5A 2BKXA 1NI3A 3MJEA 5CU7A 5BNFA 4IV8A 4YP1A 2H65A 4Q4LA 4N0EA 3GRRA 3O9ZA 5DFAA 2V45A 1JEEA 2WUWE 3H3JA 3PNLA 4QYIA 3TNDA 3BL5A 3ZU6A 5IUKC 3KQWA 1LPMA 5DCUA 3UNXA 1L6IA 1WP4A 4PSCA 3U80A 3DO6A 1UBUS 2H0QA 3U7QB 4F3YA 3ZWOA 1FFHA 3J7TA 3GUZA 5E4TA 4QJ3A 3VXKA 2G08A 2L17A 1TJ5A 2J6BA 5EJ5A 3A25A 3UW1A 1N0WA 2GEBA 3FPBA 3TBKA 5G53C 5EJ6A 2GSWA 3QX8A 2GK7A 4Y2SA 1DNPA 2BFEB 2O2IA 4K88A 5BRJA 3K96A 2A57A 3QKWA 2QN2A 3DE2X 4LGMA 5ALIA 5IJXA 1KQNA 4E12A 3S8EA 4TL8A 1DX9A 2FFJA 4TV8F 4TQ9A 3L8CA 4FFLA 4E4YA 3ESCA 4YRSA 4JGBA 1IEWA 2E55A 2PKQP 4KODA 1KEEA 1GDTA 4BGIA 5JISA 5CFPA 1E58A 3H5LA 4Y9RA 1BEEA 1YS2X 1JQJC 3A70A 3PQ2A 3LCCA 2R4TA 1UZLA 4ZP1A 4A26A 4GG1A 3R0JA 1U7XA 1EAMA 4LKRA 4UD2A 3UXHA 3T3OA 3VNUA 1FXSA 2JCYA 3GXOA 3P5BA 4X1KB 4W9MC 2Y8EA 1JEQB 1V96A 1MQ8B 1KHTA 2FGKA 3D5QA 5C5DA 1IK4A 1JDTA 4I55A 4H77A 1JNYA 1SXHA 1WW8A 3DZFA 4EJSA 5ALHA 4MAMA 2VOJA 3JD2A 2WJ6A 1IG0A 1ML3A 4IMJB 4JP8A 3CO0S 4BFXA 2CMDA 3L8DA 3ZD8A 1R0WA 1GGMA 1ZM4A 2J7PA 1QRUA 5HBRA 3MGAA 4ZT3A 2Y1KA 3BJMA 1NQOA 1OBFO 5IMSA 1R66A 5JANA 1K6XA 1QVRA 1LPBB 4WLEA 4WNAA 1C3OB 4IINA 5AKEA 4AT1A 4C4OA 4OQDA 5E9AA 5BVHA 4DYDA 5GWXA 4KQ1A 4QBTA 2C95A 3OFSA 1ZJYA 1Y37A 2EBFX 5FT9A 3DD5A 1HDRA 1V3TA 1ICIA 4UOQA 3I61A 3FDXA 3E7WA 3AFIA 5JVDF 3TXAA 4E51A 1QCZA 5T41A 1VI2A 3A1DA 1N9GB 3AU8A 3MUNA 2P6MA 3KT3A 3WIVA 2I91A 1Z6QA 4A8JA 4DJAA 2EFYA 4JLVA 4D9EA 1PVDA 3TTYA 2D62A 1O6FA 3PGA1 4NOKA 5LA6B 3G9UA 1M2WA 2YXNA 3DHEA 4HDAA 4JNCA 4URWR 4X90A 1XZJA 3BFVA 4WY5A 3L8HA 3WMXA 4D25A 1QHEA 4KPUB 3UWPA 3OHSX 4X20B 4YAIA 3FB4A 3EGIA 1ISIA 1NIPA 1W2HA 3GA5A 4KMMA 4EEKA 4FYYA 2GYYA 2YNMC 5EHQA 4E07A 1F2DA 4JYBA 1EVZA 2XEXA 4AKSA 3WAKA 1EBFA 2WWYA 2J30A 2DY0A 3W2IA 1NLZA 1BE6A 3WK9A 2YH2A 4G36A 5EZSA 4ZKDA 1YDHA 4AKHA 3PHBE 4D9IA 1NKVA 4EHAA 3U7HB 2Q4RA 4PTZA 1MQSA 2P6OA 2B61A 4HEA6 3CLSC 1FLDA 4TUYF 1C5KA 5FPHA 2JIOA 5EPEA 3PIRA 1IXZA 5CB4F 4O2BB 4K9SA 3TVTA 2XNDD 4HB3A 1OU0A 3UK0A 2GBCA 4IPTA 1I7LA 5IJWA 2W90A 5C1IA 1SA0B 1S9HA 3ICPA 5T3YA 2AR7A 2J9ZB 2W11A 2RGUA 1GFZA 1Y6JA 1YB1A 3WDSA 3U4MA 1GKLA 3O3NB 2PTHA 1UJ4A 2RH8A 4JEIA 3ZXUB 3KLBA 1YE5A 3M5DA 4S2EA 1APBA 4CLRB 1T6ZA 4YRGA 2W7TA 5CG1A 2A5DA 1P2GA 5B7NA 3VSAA 5CPBA 4N7MA 4NE9A 4B5LA 5HUHA 4FZ5A 1E5XA 3GH1A 1UH5A 3L0IB 3M1AA 1H8ED 3H11A 2O2GA 3E84A 1RFLA 3PITA 4RIIA 1Y4AE 2D54A 4ENSA 2GT1A 3UQZA 4LNHA 1ISSA 2F17A 4EY3A 5JSZB 3ZW9A 4DILA 2JAHA 4KL8S 4MEJA 2B2CA 4E5KA 3LNTA 5MFPA 1NQTA 1S8NA 1SOAA 3P0JA 4DUGD 3PVSA 1O96A 2PYZA 2BGLA 4FVTA 1IIRA 1L4GA 3K31A 4HF7A 1EE2A 4IEFB 4CHGA 3T61A 3B2QA 1C2YA 3LDUA 2E48A 5J47A 1KARA 2QP3A 3GUYA 2NSLA 1AXGA 3PXUA 2WSBA 3W78A 3OEEA 4W7IA 3A4LA 4X7MA 5AOVA 4CGZA 4MQFB 1WUIS 4OHKA 3JAWA 1ZNYA 1LCIA 3IQWA 2F3UA 5CT5A 4JUIA 4NE7A 2DBZA 4KUHA 3SLRA 5DO9A 3KCNA 3O4JA 1N1GA 4J3FA 4CUKA 2XMDA 4UXIA 2H4YA 1HF3A 4WDQA 5AM3A 3L49A 2B1IA 3OWOA 5BSKA 4Z9FA 4EY7A 2R6FA 3TDNA 4WK4B 1IQPA 2R8XA 4WKNA 2FKNA 4QJ4A 4R98A 4YALA 1ENZA 4TYNA 1D0IA 1VMKA 1T8SA 2PT6A 3RT7A 4AAYA 1BGXT 4L51A 1GUAA 3OJEA 3ZZNA 3I04A 1KEPA 4JP3A 3I5YA 3L5OA 4XQ9A 2PUAA 1HTWA 3IR6A 4JVMA 5BUSA 3E9DA 3JWIA 4RH3A 1FU8A 4BB5A 1QH8B 3DPUA 2OFWA 3NASA 4GD3Q 5H5JA 4P9NA 4XVHA 2I4TA 2IX3A 5EL0A 3FYTA 4KIFA 4DDWA 1H2HA 4N49A 3SF0A 1J70A 3PBKA 4G65A 3MBOA 3QWFA 4JJEA 2PMBA 2AYXA 3SDBA 3EUEA 1N3YA 4RJKA 4GOJA 1SK8A 1ZXBA 3C1OA 1X1EA 2VQ3A 2XQJA 1FVXA 5HDBB 2C8VA 1C80A 1CF9A 3QXGA 4RESA 4KQEA 2JEYA 4LJKA 1SZDA 2XVYA 5FUWA 2C7QA 1XCPA 5B7GA 1ND6A 3H2IA 3NXSA 1XWFA 3U3JA 3R9IA 3BRSA 2ZRGA 4EKGA 3NP9A 5G3ZA 3OIWA 3U44A 3UT6A 4BJ3A 4BJ6A 3WLNA 4XVQA 3RWMB 4OSPA 1SC3A 3B5JA 1T1IA 2JIZA 3TZHA 4J1NA 4R8MA 3ZNQA 4CU5A 5ECDA 1G3IA 5BQXA 5GV8A 2EKDA 4XIYA 5J59A 5JHGB 1DKMA 2BMJA 2W2MA 1EM6A 3TX2A 2H1WA 4YR7A 3TE6A 2J6CA 5D8DA 5AXAA 2IRWA 3ZCRA 1E2DA 3G0IA 4I8IA 1UAGA 1K66A 4UATA 4BQFA 1NLMA 1E89A 2XITA 3FVVA 3H2KA 1BXRB 2ZIEA 3U61B 1BYIA 2DFVA 3ZVNA 4HJRA 4MB0A 5JFOA 4YJGB 2YW9A 1SIWA 4NQZA 2IXEA 3N53A 2NZYA 4YP6A 2VEDA 4WLUA 3HWRA 3V46A 2C31A 1Z17A 2JFQA 1OFUA 3M5WA 3F90A 3PX7A 4B8WA 3LC2O 2PANA 3OTIA 4LX8A 2GBLA 5HFNA 3G7SA 1YU9A 1ISPA 1USKA 2LWIA 1L2TA 4IIDA 3VYSB 1BWQA 2RHDA 5GJCA 3ASYA 4R69A 5CFRA 3MB5A 4M1ZA 4GPEA 3HL0A 4IKEA 4EAQA 5U4QA 3AHHA 2PXAA 4HFNA 2GS9A 4J8PA 2XQKA 4MW7A 4HAVA 1U2DA 1V3QE 4HZGA 1SVMA 4JUDX 3WL5A 3ZGVA 3ZKWA 2HA7A 2R6GA 1VIAA 2X2FA 2OECA 2OLJA 3DEKA 4WT7A 3FKSA 3D6VA 1XRJA 2AOTA 3GFQA 4MV7A 1G4UR 2DFPA 4A1OA 2HSGA 1EUZA 1M34A 2I6QA 2ZE5A 1NVTA 3BWBA 2PH3A 2OV2A 1JHOA 1F51E 1HGXA 1TD1A 2O2DA 2XUAA 2ZWIA 5BWMA 4L07A 4LY9A 5ECWA 1Z36A 5AWFC 4ZVKA 4M86A 4ESVA 4NHOA 4MQ6A 4P8RA 1MDFA 5HUJA 3CVUA 1D1QA 1KYQA 3V4OA 1IZ0A 1M2FA 2X9QA 3TOSA 2ET6A 3TTUA 5DBHX 1TK9A 4Z86A 3DYVA 3FUCA 1TDJA 4Q9DA 3C45A 1OI7A 2ATCA 5B53A 4HNGA 3CVXA 1GN9A 4OJMX 1WB6A 3VRHA 2P90A 4KCGA 1ABEA 5FO1A 1H6DA 4NZ9A 3BHJA 3K4QA 3TRIA 2Y0CA 1QJCA 2C4WA 4CLEA 1M1NB 3KU4A 5AKHA 1MRSA 4C6TA 3FFBA 4DMFA 3RVOA 4OI4A 1G8PA 4M1EA 4BLOA 4MP3A 3JD4A 3FZQA 1M6YA 2DXIA 3T5AA 3BMOA 2XMCA 1KEZA 1Z8DA 1H2XA 1M2VA 5TQVA 2CV0A 2JLWA 5A6SA 1UIMA 1JR6A 2CLKB 5ITZB 4D3DA 2JGAA 1KO4A 3LBAA 3WIOA 3AVUA 2A9JA 3UVEA 1ULZA 1PJ3A 2Z0MA 2GEUA 4ER0A 1V41E 2B20A 3NC1C 4Q9AA 1P0QA 5JDIC 3AI1A 3PICA 4FDUA 4M6WB 1N2OA 2ZS8A 3T0GA 1E3IA 3B60A 4L75A 1RQNA 4BP1A 2BKUA 3G3EA 4R1TA 1K7YA 1V1RA 1XNGA 1V9CA 1LFAA 3G5AA 1ZI6A 3GCDA 3EMVA 3ZK8A 1NYRA 2JB9A 3I2KA 1VYUA 2FWMX 5K0ZA 4UUAA 3U5TA 4FSXA 2XUKA 3EFOA 4XD7D 4DC0A 2VDPB 1Z8NA 3INTA 4LF7B 1CZHA 3ANNA 3VC3A 5AHXA 1VE5A 1Z0ZA 3ROPA 4YJHA 1Q3KA 1LBHA 1YVRA 3UUWA 1XMOB 3MTGA 2Y1CA 1GCUA 1FY2A 4QOHA 2H3EA 3N6XA 1AZLA 2WSMA 4GOND 2CL6X 1MIHA 5TY0A 1DP4A 1KEVA 2CNBA 4F71A 1A8IA 1PWEA 3MPOA 1PRYA 2FW8A 1T6BY 1U94A 2HUNA 3DMTA 2ON6A 4FONA 4MWCA 3KJEA 4HDMB 2VUIB 5HILA 4M8IA 2XF2A 5K9ZA 2N47A 2IEZA 1ADBA 1ZK1A 5AMXA 1EESA 5JSHA 1I3MA 2NP7A 2WF5A 1CULC 1SD2A 1XTUA 5HEKA 3C5HA 1Z4LA 2CV1A 3DC7A 2AWOA 3KT6A 2H7VA 3U09A 4BNFA 4EI7A 2NZWA 2JFVA 4ADSG 3O7WA 4QUKA 5JEEA 4ZZ2A 3TSWA 4UHCA 4IH9A 4P4LA 1M34E 2O8DA 3HR7A 1TAHA 4Q9LA 2QVYX 3DAOA 4QU5A 2HIGA 2CLLB 3K4PA 1TU0A 4RAQA 4D6YA 2PAFA 2JBHA 3PC3A 5BYJA 1OLXB 1V4NA 4KAFA 3F5MA 3HA2A 4R01A 2ZJ7A 4RCYA 4ZICA 4RTNA 2UVQA 2ASEA 3FVTA 3K2QA 2FLVA 3FSEA 3QUSA 4AP6A 2VZ8A 4PN3A 1Z07A 5CVUA 1DO0A 4Q03A 2AD1A 3R7NA 1G38A 1YZGA 2JFOA 1RBYA 4LOKA 2NQ8A 2QB5A 2QN1A 3ZWVA 1IJBA 1J42A 1GTL1 1C4OA 2PD3A 4L50A 4BVEA 3AOGA 4CXMA 1WS6A 2PGOA 4WNIA 4Y9SA 4TLAA 3ZH2A 5AVQA 4GXTA 3WP1B 5C51B 1KOGA 3K4HA 1ZK3A 2ACVA 2A1UB 2BEKA 3CZRA 3QE4A 4KLAA 4ZQIA 4J0KA 1QE0A 3MTIA 3CA8A 4Z2AA 4KQWA 1FFXB 1CTQA 1EXMA 1GZHB 3FAZA 4QJBA 3D7RA 3KZVA 5BUQA 5JYDA 5DI3B 3TB4A 2WW8A 1NMSA 1O95A 3DB1A 4EA9A 1JU3A 1RHRA 4ZN6A 1X8JA 3TQHA 1B00A 3I12A 1Y48E 2FETA 4I6GA 2XQFA 1RM3A 1W35A 3SJBA 1V71A 2PM8A 4MS3A 3KWJA 3VJRA 3TMYA 2R6AA 3RU3A 4IIYA 5JAOA 3PUHA 4GM4A 2QRVA 5ALLA 1XKLA 3T5GA 2F1KA 5DEOA 3PF9A 1N3BA 1VKZA 3AKCA 3LC1O 2G4VA 4DQKA 5H80A 4AM8A 5J4YA 3TI9A 2CMHA 5K3SA 4Z9XA 1Z7BA 1FVFA 3FMVA 4ID3A 3JVUA 1KO1A 1YBHA 2G6TA 2YL2A 5ALQA 4BFSA 2EG9A 1KO8A 2ISCA 4U0JA 3KNZA 5H3CA 4IX9A 3EXHA 2FX5A 4I3HA 3ZY4A 7AT1A 4QBIA 3N05A 4P4SB 1O77A 3A4MA 3FM9A 2H2HA 4MVCA 4Z7QB 2PKXA 3C7KA 1ZXXA 1G17A 2BH2A 1CYEA 1DAMA 2XWPA 1M5UA 5JZVA 4L3WA 3WBBA 1WMEA 2A7XA 3OLWA 4Y9TA 4EQ6A 4PG8A 1MT0A 5C31A 1NIJA 2OCIA 4YAWA 1YRWA 3H6HA 1XZHA 1E1CB 2Q3LA 1QO9A 1GUFA 4BEVA 5MN6A 3AO0B 1ATZA 1QC5A 3HYLA 4JC8A 4H9GA 3C14C 4HNRA 4L9AA 3DBRB 3DQQA 4I1PA 1PNRA 4C08A 1WCIB 1JVSA 2JGKA 1IOZA 1NW5A 1VIYA 4IRMA 4Q3CA 5AI8A 2FR0A 4JKIA 1VJ5A 4O4JF 4WESA 1BJRE 4KQJA 5EMLA 2ZJ0A 2ZUBA 4DAOA 2P4EA 1VJ1A 4P82A 4ZJZA 3COWA 1ZIOA 4NAVA 1DIAA 3OLQA 4LJ4A 2KLHA 4NAUA 1NBMA 3TQOA 5KX5A 3T7IA 2PVCA 2ZCUA 3C5EA 1E3DA 1DKOA 1Q57A 1M2OA 1UOPA 3EARA 4K6HA 3RS9A 2GEJA 2W2VA 4YP7A 3TQSA 4LHWA 1UAYA 1RI3A 3LW8A 2V55B 1NJ8A 2BRUC 2GVZC 5DOZA 2B5OA 1M1ZA 1XXHA 1DEXA 4N01A 3OX4A 4MWBA 5K2OA 1IDN1 1GYPA 1F5SA 3UM9A 1D09A 1RHMA 3L92A 1J20A 1XLUA 5LIRA 4Y2HA 3MGBA 4DNXA 2FDXA 3RV3A 3RK1A 3KV1A 4WD3A 4F6RA 4HG2A 3NHZA 2XCSB 1NLYA 3H0EA 4ALJA 1XQYA 3ETNA 4WRRA 5JY1A 4RQUA 1KSFX 1CJCA 2NVUA 2D1SA 3FDFA 3P9ZA 3VVMA 2OZVA 2OK7A 2Z2ZA 3HMKA 3UYKA 1NF8A 2HREA 1V5IA 1G4AE 5HDQA 1Z5NA 3P9YA 5FIUA 2X9GA 3QI2A 4DV6B 1CQJB 2E2WA 2VG8A 4B6OA 1JDVA 3WGJA 2D3WA 3CNBA 1W5FA 1YZFA 2GLTA 4N3AA 4R1LA 4JL5A 1X15A 1AUVA 5F1PA 2C2YA 4GQIA 4BGEA 4I66A 3T0IA 1IN4A 1SVWA 1UFRA 4E33A 3EFEA 1GQFA 4KQHA 5K8UA 1KOFA 1Z08A 4FINA 2CB9A 3EVCA 3JW8A 2Z6QA 1M72A 4I3FA 1BFUA 4QXOA 4W5RA 1COWD 2J6HA 3JVIA 1Y1KE 3VGPA 4LZPA 3PDJA 4TXNA 2QZ9A 1IC6A 3ZUPA 2VYNA 3PQ8A 4CKCA 5KNDA 1PL6A 3QF7A 1AKUA 3EG9B 1A95A 1KFEB 4OMCA 1HYEA 3MTEA 5KI6A 1UXJA 1GCOA 1ETHA 4PLZA 4CKCB 3G2LA 2ZIVB 2O5RA 4J4TA 4L16A 4M1QA 3O8CA 2P0EA 5AHWA 2VK8A 1P1HA 4MA0A 4RANA 3TIFA 5JY6A 2G82A 2SBTA 1Z45A 5LQJA 4AQYB 5CDSA 1ZRNA 3OP4A 5EWMB 2HQBA 2W00A 4ID9A 4QEZA 4AJOA 2Q6IA 4EHFA 4R16A 1H5QA 1CNFA 4BV8A 3VC7A 2D1TA 2R47A 3F9RA 4IWYA 4XASA 2FRDC 1QIDA 2P2SA 1GZUA 3KJQA 5BN5A 4ZK2A 1FJXA 1HYGA 4LI0A 3H9GA 1SBNE 3N2KA 4YWHA 1B23P 1ZGJA 1N77A 4XZ3A 1U3VA 1ZY2A 2I6UA 1ODKA 1XA0A 1TL7C 3F3KA 5DCYA 1P9LA 1COWA 1E6CA 2IU0A 1J9EA 1QG0A 4OYHA 4U2BA 3ZUGA 4DGSA 4G26A 1DXQA 1FOEB 4Q9HA 3ZD9A 2H5EA 3CLRC 4ZDWA 3O8BA 1S01A 3C3XA 3N8DA 3S29A 4EYEA 3QU9A 2H4ZA 1MLDA 2DE0X 1E66A 1FTGA 1ZKMA 5EQFA 4YCMA 2GPWA 4U7PB 1B0AA 3SM9A 4CF7A 1GAXA 3TQCA 1E2QA 2B0JA 2IIVA 1EVIA 3FYDA 3QTLA 3M6XA 2OP1A 1LC3A 3SHQA 3GDFA 2ZZMA 2CJWA 4B1FA 1KEUA 2CFTA 3G9QA 4C2UA 4DW8A 4KQ9A 4G9EA 4HN9A 2PRKA 4XM0A 4Q24A 4CN8A 3MXTA 1CCWA 1G8GA 4J4HA 1MUUA 5CD9A 5H8WA 2PUFA 1VG8A 1XDSA 2YJ4A 1DBVO 2GRAA 2ZRIA 3BMNA 2JATA 4X24A 3Q3IA 4QM7A 3K5IA 3O8DA 4RORA 1U8TA 4C0WA 4EPWA 4FR5A 4OHBA 3NHJA 4DDVA 3A37A 3LTNC 1F38A 1EUDA 4TTRA 3MWGA 3WQBA 3GEGA 2QPOA 1XR3A 1G5FA 1R0SA 1VM6A 4LQCA 3QW4B 2R6R1 1JI3A 3Q0IA 4U1RA 4ZREA 5C4IA 1T29A 2NTNA 1II8B 1VDMA 1YTLA 2R7MA 1B8NA 3DR3A 4YRBA 4H0FA 5AM1A 4AJLA 4A2CA 4KMSA 3KHUA 4CM4A 1XZBA 1O95C 2P6NA 2ATXA 1TEHA 4L7QA 1JYSA 3WWPA 1IOWA 5EZYA 1IEVA 1NC3A 1JFFB 1K97A 1PJCA 3AKEA 3UATA 1SD1A 1XALA 3ZC3A 3PFWO 5H3LA 3GAAA 1BJKA 1G1MA 2QJOA 4RK6A 5AM4A 3LIIA 3UENA 4BO6A 4JI3B 3J80A 4AFNA 2VBCA 1L7OA 2Q28A 3R0IA 4ZYYA 3C8MA 2A9RA 1QQ7A 2B4TO 3NBMA 3FJYA 5JNWA 4KQFA 1H2EA 1NXWA 1A9XA 1L5RA 5DHQA 1NAIA 5EJAA 2R1UA 5C80A 1IHYA 3ZY6A 1NULA 3GDOA 3K9BA 3LBNA 3M82A 4J76A 5FYQA 2C99A 4AO7A 2OFFA 2C4VA 3W1EA 4DB4A 4G0MA 1CJBA 3LC7O 1LDMA 1HK7A 3HYCA 4B3RB 3BYZA 5DHFA 4W5OA 3DG9A 3GVIA 1V16A 1G5TA 1TM1E 4BN5A 4JWTA 3QNMA 3AHJA 4JZKA 2WE7A 2FN4A 1HEYA 3WGNA 5DMXA 2QM0A 3KG2A 3TH5A 2PUJA 3GLGB 3PGVA 1OFHA 4EVQA 1OA0A 2AF3C 4F21A 4HX2A 1W4CA 1Y98A 4ZOBA 4EJSC 3W7VA 2GA8A 1FFWA 4WXRA 2AI1A 3N07A 3ZCQA 2X4DA 2IFTA 4Z8XA 1AUPA 3DBRA 4B6RA 1V16B 1ZITA 3GP8A 3NGLA 1M66A 4FOPA 1FJHA 5JAUA 1MEOA 5E7JA 4KSCA 1PFGA 4AZ3B 2YZMA 1E1CA 3CGWA 1W88B 3GY0A 3QBTA 3EXAA 4B4DA 5KINB 4REQB 3LVBA 1GQOA 4P3YA 3TPFA 3WX0A 1TAQA 1V4VA 3OEHD 4YMVA 4UE3S 5IN4A 2BV3A 5EEGA 4UBJA 5BMOA 2BSQA 1VFNA 5CUQA 5EIAA 3JQ9C 3QMMA 1IY9A 3TLCA 4AS3A 2HWWA 4D4HA 3IB6A 3MQ2A 1H1LA 2A5GA 2VQFB 2BMEA 2Z83A 5E0KB 1DCKA 1JU9A 4M8KA 1QPBA 1JG1A 1ONSA 1P60A 1QVVA 4Y8VA 3M7IA 5DN9A 2BUCA 5C7IO 5HSGA 1ATIA 3NOVA 1KU6A 3A05A 4OL9A 3UJAA 2P9ZA 5FUXA 1P1JA 4EG8A 4UMVA 3ZLVA 3ZTWA 4URYR 4DCTA 2VTEA 2XDQA 2YASA 2ZJ1A 4FD2A 3HVRA 3QX3A 3T7EA 3ES9A 4DV0B 3IP7A 1E5LA 2BR4A 3W77A 4OXRA 4JS0A 1C1YA 5DX0A 2ZWVA 3TNYA 2IHZA 4PSUA 1SCNE 1HE3A 3CLHA 3LP5A 4MS3B 2QXUA 4AZ3A 4QOEA 4Y2XA 3MJFA 2WYWA 3PVCA 4CR6A 3B8EA 1PJ8A 5DEIA 1QAQA 1QRDA 1Y0BA 1YE3A 2W6JA 1ADGA 3FXAA 3I34X 2OCBA 4JJIA 3T38A 5IAOA 5IJ0B 3IL2A 5GY7A 4F97A 2L2QA 2QYTA 1NQWA 3UK6A 1N6IA 2FFHA 3RRZA 1HG0A 4IJUA 2VKQA 4WVFA 3GMSA 4ZI2A 2OBFA 1H4TA 1CK4A 1O4VA 1VIVA 1XTJA 2G0AA 3F73A 3ZHTA 4I5GA 3KAKA 4CKYA 3I9FA 4MR8A 3I0ZA 5IH3A 4ZVTA 4PC7A 4CM3A 3W3ZB 1OPXA 1EGHA 1IUNA 2G36A 2PSJA 3KKPA 1KE1A 4B2IA 4BFCA 3II6X 1S5PA 2DMRA 4I36A 3WQSB 2I34A 3IUEA 1JL3A 1KP3A 5KKCA 1GVHA 2POQX 3DMPA 4F45A 3LAWA 2H52A 4AB1A 1UR5A 2NO0A 3I0NA 1QBGA 5BMVB 1HEUA 1E2PA 1IN1A 1KAEA 4OL0A 1X13A 1N6RA 3PHHA 1CIJA 5F77A 4Y0AA 1RWOA 3FZNA 1AMNA 3O26A 2CXUA 3SR0A 1W1IA 1W93A 2BHTA 3DVQX 3G8DA 1Z13A 5BWBA 4ZMRA 4WGGA 3SZLA 3VPCA 4FZJA 4L02A 3EZ2A 5HFJA 2ISQA 2HT6A 1QWOA 1KERA 4Y6RA 3C4JA 5HJEA 5DNYB 2FN3A 3EX7C 3DTVB 1DUSA 1N0IA 2QK4A 5KVQA 3BGSA 2OEPA 3KEQA 2JGEA 3UWOA 5AJVB 3QUQA 1YI0A 4CV2A 3DFIA 3GLTA 5FOUA 1VMEA 1Y6FA 3IBCA 4FFVA 1OBHA 3EXIB 4YFYA 4CF4A 1U8ZA 1RZ3A 1S3IA 1X94A 4PBRA 2PK3A 1L5KA 9ATCA 3KXLA 2J41A 4MWSA 2PA3A 3T5TA 3HCAA 2C07A 3RUIA 1WSAA 1DMSA 5ES4B 4OFBA 2HDHA 3LQ1A 3VKWA 1RR6A 3PNYA 5E1OA 1KQGA 1KYTA 1SCBA 3VR4H 3JARA 2X3FA 5BT9A 4F5EA 3UTDA 1GM5A 1B93A 3VNAA 3ICEA 5HQJA 1N8NA 1JZSA 1G6KA 3KRTA 5JRZA 1GN8A 2A1TS 3CLSD 1G7RA 3A6JA 4OOFA 5E4YA 1SB9A 3ODPA 1B14A 2IZ1A 1GAJA 4LOAA 4N6GA 1ZCZA 2ZRLA 2QTGA 4O6VA 2CF5A 1QTRA 3FMOB 4D9KA 3WAGA 1P2TA 3EVNA 5BO5A 5YASA 1YR2A 3CRQA 1VLHA 2RBEA 3IGFA 1GOTA 1F0YA 2QTAA 3N8GA 1AS2A 1T1EA 3OKCA 1F14A 1OROA 1F9EA 1P0FA 2H08A 2VA9A 2I54A 2W2PA 4YLGA 3HLTA 1G21A 1KZHA 4M6WA 4HPJB 1RQPA 3DE1X 1MJGA 3MOIA 2QPTA 1IOVA 1QKKA 1F60A 1P74A 1BMFA 3N0RA 1JIKA 1LBEA 5K4AA 1JF8A 3ETLA 4FCCA 2QXYA 5B1SA 2I5PO 4ZQCB 1E59A 1ZH0A 3H1FA 5BQOA 4RDXA 1G8KA 2IYEA 2QLJA 5CDHA 3A1WA 5A5EA 4XA8A 1VJ0A 3KALA 1KJIA 2I76A 4W99A 3ZDXB 3YASA 1OU4A 1JGTA 1M33A 2FPIA 3ECAA 1CV2A 1B43A 1K4MA 4KACA 1PBNA 1FDOA 1RIIA 3K9CA 4WESB 1VKOA 2MR6A 2QF7A 2YXEA 5AK3A 4DBVO 3F5FA 2BDUA 3DQPA 4RHFA 2ZIZA 1SR8A 3G2MA 3JWEA 3OZUA 4X60A 5CXXA 2Q5JA 5J2TF 1XWIA 3GT4A 4FSDA 1UF9A 4OK5A 4ZT7A 3R23A 1A1VA 3GNTA 3EODA 5I9TA 3ID6C 1HDGO 3O8OA 3A3YA 4G8CA 4B3TB 2I1VB 1JR4A 2WI8A 2QRUA 3IQFA 2WM8A 1L7DA 4PWYA 5JD6A 3SQWA 5CFMA 2D2VA 1GT91 2GILA 3L79A 4O1MA 5DHTA 2OT3B 3E9ZA 4EYKA 1W34A 5B6PA 1L5OA 1QO0D 3ONDA 4X3OA 2RGBA 1D2AA 4PGGA 1E1RA 4OVKA 1SD5A 5DX8A 2QW1A 1G4HA 3GJ8A 4BX8A 4CTOA 5KWIA 4YS6A 3EWNA 4EY6A 2Q0SA 4MIKA 1KNQA 3GLRA 4MR9A 3U3MA 1RU3A 2EQBA 3ZQUA 4E5UA 5BNWA 2OMKA 5IABA 3L9XA 3DLPX 3PUXA 4DIKA 2QZZA 1IMJA 1BEZA 2H54A 3W9UA 2CBXA 4AF7A 1FFSA 1ZPDA 5L3QB 1QYCA 4GPTA 1U9IA 2QQGA 2BW0A 3DWFA 3G02A 4JKYA 4TMYA 4N6NA 4QPCA 4E03A 1H22A 3OX2A 3ROQA 2V7UA 2WVAA 4BO8A 2XR1A 1Q7CA 3A1CA 3G7NA 1EI9A 3WRWA 1NV9A 4KQ2A 3ZWXA 4EPTA 2B7CA 4LOLA 4L73A 3KUCA 2A94A 4R8RA 3ZHUA 5BV8A 4QTYA 2HA2A 3D4IA 3UXEA 3Q11A 4CL3A 1ZD3A 4RL6A 5J40A 5HE9A 4LBWA 4OFXA 3KUDA 5E7IA 3RFFA 1CZKA 5ALFA 4NXNB 3IDFA 1ZSNA 1K6IA 3H9EO 3K0BA 3RPEA 5BN4A 2A33A 5HBGA 5KDLA 2WUFA 1KJ9A 2D1QA 3EZNA 2PUVA 4OH7A 2PMDA 4CCYA 3KFXA 1HUQA 2XVMA 1OWLA 1Z68A 5CW1A 5KTKA 2OPBA 2ZI7A 2ZQZA 3F6YA 3KJGA 1N36B 2QMOA 4E1BA 5F7ZA 1Z74A 3DWGA 1G2QA 4Q47A 1WCIA 3RS7A 3BRQA 4ZZ0A 5C1DA 5GONB 3DWIA 4Q02A 2WV7A 3X1ZA 4JBIA 4CL8A 2QQ0A 3BGIA 5L7WA 2LDXA 4BLPA 1SUWA 3LCVB 3MD9A 4QUEA 4C03A 3KLOA 4HUQB 1KMHB 5IC5A 4EO4A 3P0IA 3I8SA 1MX5A 4LC0A 4IS2A 3CINA 5JSZA 1SQFA 5IP5A 1N78A 4HK4A 2EBUA 3F6EX 1BHO1 2YFHA 3U3RA 2FXIA 1N6OA 1W0CA 1Z5WA 3HCRA 1WCV1 2Z8XA 2HCBA 3BB3A 1NLFA 3KUUA 2FP4A 1VBNA 2VSOA 1XTVA 2O2XA 3L4BA 3L1IA 4N0MA 4EM6A 1TFUA 4NYIR 1T5DX 3NEPX 5FRDA 3E9QA 1DIGA 3X1KA 5BV0A 1DCTA 1Z4NA 2AN5A 6PFKA 5MF6A 1WP9A 3Q8LA 3C3AA 1TKCA 4O8CA 4QPZA 3NDIA 3HDVA 1SBZA 1ZBQA 1X7DA 3IMKA 1NVXQ 2I4NA 1NBAA 3ECCA 2WU1A 3WLPA 3B8HA 2GEFA 5HCNA 2Q5OA 2LIPA 1V43A 3SDZA 1OA1A 5AKXA 2BZGA 1XEXB 3KKEA 5LZ8A 2JIMA 3MSXA 4Y7CA 3RKUA 1HMPA 2B21A 1E99A 2GZAA 1Y4ZA 2REQA 1YQWA 1E62A 1NZDA 2DPMA 1ZNXA 1CVIA 8AT1A 1IRIA 3IUNA 2P9YA 3Q87B 1E4EB 1P77A 1N7JA 1Q0QA 5BNIA 1NR7A 3CUSA 2DKOA 4OJYA 5CXSA 3QELA 5HMLA 3OECA 2CB0A 1C4XA 5C1PA 1BEUB 2A84A 3CN9A 1QLHA 2QUIA 4JI7B 1R9MA 1JKXA 3AR5A 1GRNA 4EB8A 2ZM5A 1VMAA 4QUAA 3JALA 4E5YA 3D1JA 2DFNA 4MCJA 4RXUA 4ZCQA 2JIPA 1F0KA 1FNDA 2XUDA 3IRUA 4JK3A 5AI6A 3TCKA 2JC3A 1HQCA 5KHLB 4IDGA 3EJ6A 3S2EA 5EJ7A 2P2YA 1PZFA 1R8QA 5GVRA 2B1JA 2EHJA 4I1YA 4KLNA 2Q0QA 1CUDA 1WMSA 2WJAA 4TM8A 5A5VA 1W4AA 2OFPA 3GN2A 3HZHA 5LYJF 1EB9A 2IYSA 1C0PA 2C2KA 4TZ0A 2I2XB 2YWGA 2AFIA 4OPMA 3GA0A 3EQ2A 3WYNA 3SQNA 2FR8C 1LEHA 2EU8A 3RFTA 5HQTA 3WL8A 4MKFA 4N8EA 4YREA 1FP1D 3B7GA 1EP2B 1EVYA 2FXVA 3C41J 4TM7A 1OC2A 4HAWA 3U31A 4OHYA 3ZPXA 2A9OA 3BIWA 2YRFA 1T4CA 3AP1A 3K2IA 1J1UA 3ABZA 1U9YA 4RNCA 1FBTA 1GZ5A 4I19A 1WZ2A 1HDIA 2OO3A 1JVBA 2QMZA 2Y71A 3PKIA 4TS4A 5ALRA 4ZARA 4R41A 5IEJA 2C3OA 1R3DA 3IALA 4Q16A 2IK8A 1Z34A 3FOWA 1C9NA 1GV1A 4QHSA 1EWRA 5GGYA 1U3DA 3AERB 1GRRA 3KBBA 2BHNA 1JHXA 1M1NA 1X74A 3QLVA 2ZYAA 3K9QO 4RE5A 4WK2B 4FHDA 3TSZA 4YYEA 2X7XA 5JD5A 3VI4B 4K2AA 3WL4A 9GPBA 4LHZA 3FFTA 1YVPA 1TZBA 1Y8RA 4BGVA 1RLTA 4RPKA 1V5EA 1VLVA 2Y9PB 2ZR0A 2WIFA 3A4NA 3K6JA 3AV3A 1B6SA 3PD7A 4WCFB 5LLDA 1XPRA 2RGCA 2Q5CA 1O5OA 3KTDA 3HNPA 4KQGA 1ZVQA 5KTNA 2UYOA 2G1UA 3KLNA 2UYQA 1ABBA 3GRKA 3UJBA 4L0MA 1C8BA 3WYCA 2C78A 2IYYA 4J3JA 1DGQA 1UBNA 4DAEA 3FDJA 2IDKA 4I50B 4R1OA 4L4RA 3H1GA 2YXBA 4PHTA 2BFEA 3VR1A 4L6AA 3NEYA 3G8BA 3ZWMA 5B36A 1ISFA 3P2OA 2NN3C 2VDWB 1QYXA 3IP5A 3L7JA 2QJRA 5BSUA 4M0EA 1R4AA 3GCGA 2OCLA 4JDUA 5EPUA 3ZCTA 5BP7A 3ACBA 4OAOA 4WAUA 2EX0A 5FBLB 3OSUA 4MMZB 1GTZA 4OM8A 4RF4A 1HX7A 1VSUA 5AVOA 3ZZ0A 4FIDA 3C24A 3OHPA 3MWYW 3LS2A 3RAJA 2GN6A 4R1SA 5CNMA 1XE3A 2FEPA 5LWHA 1NWCA 1W44A 2RHRA 4L0DA 2JFYA 1A5ZA 5AKLA 5E7MA 3HN7A 3C3WA 3QMWA 3W8DA 3T41A 1C3OA 2PL9A 3RVPA 1CEQA 4QREA 1Y3HA 4EUEA 4UNSA 1KP9A 4BDTA 2GNOA 2WJZB 4CTMA 5TARA 2XDWA 3LCJA 4ARBA 1T15A 4UTRA 4YX9A 3PC4A 2WTEA 3OM9A 4CEIA 4BFTA 2D7DA 4RACA 3ZIDA 1BXRA 2E87A 4YV2A 4GI7A 1VSTA 1R0ZA 3K15A 4M2LA 4AG6A 1EFVA 1Y6QA 3T95A 3P9NA 1NN5A 4QDXA 5GZ1A 2OKCA 1IU9A 3EOZA 1GPWB 1J6UA 2CYBA 3L0SA 3HXMA 1N32B 1GL9B 1R6BX 4P22A 4LGVA 3KEMA 3JQPA 3BK2A 4UTPA 1ZNZA 2HCTA 3D3QA 4MMYB 4ZEVA 4HVAA 3VU3A 4TZTA 2EFCB 3JASB 3RYIB 3K0KA 4FFWA 1ZR2A 1E0AA 3HADA 3L1HA 3HA5A 1IPEA 4NLLA 4PPFA 4BAGA 2ZAGA 4PS0A 2Y9MB 4RIHA 3HKDB 5J5CA 2B92A 2YYZA 2Y1WA 5J43A 1U7DA 1QGUA 2R9VA 3T7AA 1Q0LA 3LX8A 2LRHA 1BD3A 5SYNA 3ZIAD 1ZUIA 3N3BC 1VP9A 5C32A 3L84A 3O75A 1E1YA 4FFBB 1JXQA 4PYKA 3DKVA 3WGVA 1TIKA 2A78A 3NYQA 1M34B 3GBPA 4AX4A 1OOEA 2HQ1A 3JQRA 1AQNA 4Q7QA 2JGFA 1WXQA 1CUXA 2BT4A 4CR8A 4Z53A 3UCXA 3D4OA 3CNHA 1A96A 2VVTA 4PCUA 2CFOA 3E81A 4D0SA 2KYRA 4FCVA 1RPZA 4DWOA 1EWYA 2V7PA 4OHRA 1JP7A 2ZYGA 2ZPTX 2NU9A 3VZCA 3FOEC 3TLEA 2B69A 3S3TA 1ZXLA 4HGNA 4J03A 5F7JA 5C8YF 4AMGA 3UB3A 4GC9A 1RQRA 2CLHB 4PZYA 2Q5EA 4B0PA 4X84A 5F4ZA 4FHFA 1NYTA 2I71A 4I0WB 3OPNA 3CC8A 4TN5A 1TO1E 1MB2A 4MR7B 3WO1A 5KTSA 5DBFA 5HCIA 5I9MA 2REBA 1P73A 4XQGA 4ISCA 1HNWB 3AEUB 4QXMA 3VNSA 1IZ8A 4I50A 2R1ZA 3JZAA 4MUAA 3G9ZA 4HQNA 1LLUA 3BDIA 5LU9A 2F9MA 2IT1A 3C1AA 3CM0A 4KVAA 1VE6A 4PLCA 4GFDA 2XTNA 3X1MA 5IKPA 4UOZA 5AKJA 2XEDA 3A7EA 2NUAB 1E6UA 2V8BA 1SJ9A 2BR5A 3CXRA 3B5IA 1KBOA 3O3MB 1F4PA 2FMHA 1E9VA 3LECA 3LOQA 1NN3A 2D5IA 2OMEA 2P5TB 2XB4A 2XWQA 3EK2A 4JXJA 1V7PC 1JB9A 1UINA 1Q0PA 4LXYA 1J7KA 1C7IA 3SQDA 1FXUA 2C3UA 3QVSA 4GRIA 2GARA 4INZA 1JE0A 4M1YA 5G41A 4BQIA 4JELA 1RD4A 4N39A 4GP7A 2KMLA 4NOLA 4OU4A 5KSPA 3NVKI 2L42A 1NHWA 1UQTA 2P2NA 1K7FB 5AXBA 5G0WA 1IZZA 1XSEA 4C78A 3R3YA 3O4HA 2BEVA 2Q2WA 3SXPA 2V6BA 3IUPA 3OA2A 4WFJA 5T8KA 3H2JA 4JGIA 4K86A 3V8VA 3ZBUA 4ACBA 4D45A 1U8XX 3KC2A 5TJ9A 3WRYC 5FBVB 5FWXB 4JQCA 2FZVA 1XMIA 5B4VA 2FPOA 5FAXA 2NLOA 4I9FA 4MYUA 4ZGWA 2I3AA 3W5VA 1CF2O 2QUAA 3K2EA 1S8FA 2LDBA 2Y1OA 4HMOA 5CLHA 1ORIA 3S2UA 5L53A 2ZUVA 5GINE 4UMDA 1BN7A 1QKJA 2ZZKA 1H1TA 1T10A 3ZHBA 4D8WA 2IYPA 2YC2C 3NBZC 4IZ6A 5FNZA 3ZCXA 3D6AA 3P9IA 2COUA 4C76A 5K2MA 1NUAA 3V2IA 1MJ5A 2Y92A 3KEGA 1L5YA 2DWUA 4U39A 1RXYA 4WOBA 1MKYA 2GRUA 3OY2A 3G0OA 4G5SA 1QH8A 2ZJ6A 4WXYB 3RM3A 5KTPA 1L3BA 3ZD7A 5FFMA 4BNIA 3AVVA 4Z0PA 1DX6A 3GPLA 3N74A 4X91A 1JJFA 2B36A 1U0RA 1XVTA 1P2VA 4HC4A 4JXKA 2ATEA 4JUFA 2I78A 2XX3A 4DM4A 2H5LA 5BSGA 1GVNB 1KIFA 1Z0FA 3JALB 3W5CA 2WVJA 2ZE6A 3HB4X 3BQ9A 2QJTA 4H6PA 3SHWA 2P0AA 3Q2OA 3B3FA 1UK7A 1Q77A 4HRYA 2MCFA 5B5SA 1XD2A 2C0CA 3FKSD 2VXBA 3QPVA 1K9SA 3K9WA 3RBXA 2R6ZA 1ZOLA 1XZQA 3C87A 3IIIA 5IBPA 1BFKA 3SVTA 3EEQA 1EVKA 1TCBA 3OMLA 3ZVKA 2BKAA 3LG2A 3QENA 4YP0A 1Y3IA 1Z7EA 4MQFA 3LUHA 2VRWA 1F12A 1EHIA 4K1LA 2INGX 4ZEXA 3F5SA 1SY7A 3P0HA 2GYUA 4EFDA 3ZE6A 2J3DA 1GR0A 1XEXA 2HL6A 4P84A 4EG6A 5C35A 3LDHA 3W5DA 4L08A 1RQ2A 2DWPA 2JJ2D 3D7MA 4OBWA 3UB2A 1WPXA 1VI5A 1BGVA 1XVVA 3BB4A 4C7XA 2QLLA 4D4GA 1PGJA 1L4KA 1IAVA 3TNJA 1VQ1A 3MIZA 4BEWA 4YQYA 4N18A 2AKYA 1WOYA 1NVWQ 1ACMA 2XDAA 5AK4A 2ZROA 3FBGA 2DQSA 4Y30A 2VF7A 2MSWA 4IILA 4LVNA 1KETA 3IA2A 3L1KA 2VRCD 1SCUA 4IZOA 5FTKA 4C2BA 5EEHA 4DQLA 4B73A 1X1CA 1DTSA 4GMHA 5BW6B 2XB2A 3F1LA 1NQUA 4B7UA 3K71B 1H2AS 2JGLA 2J1LA 4CLRA 4BGUA 3TGLA 3M4JA 5KNDH 5JD3A 2XYRA 1ZSYA 4BLRA 4MPTA 2REXB 4UZFA 1I4WA 3ZXYA 1P6QA 3IJEB 4R68A 4DJFC 3TEFA 4LS3A 1KTIA 3HXOA 3RADC 4GE0A 1YF3A 5IVHA 1PO7A 1D04A 1YFKA 3RH0A 4AY4A 2ONYA 1JSRA 2HN9A 1WXXA 3VH1A 1HR0B 4J16A 2NIPA 2OHJA 3PA8A 5DZSA 4DGQA 3GLFA 3VI3B 1CY8A 2PQ2A 3FG9A 3I5UA 4F3NA 3E22B 4IGEA 3HBMA 4UVHA 4IG9A 4ZXFA 5EJ4A 1G55A 3ADPA 2AE2A 4ZYUA 3DZCA 4PS1A 1K2WA 2ETXA 5FOVA 5HJ2A 3GFFA 4ANFA 3N2ZB 5LUBA 5B3JA 2HKIA 1DQSA 3QFFA 4BBZA 1EK5A 1H9BA 3CR7A 2PWZA 2JGMA 4X54A 1HDYA 3IQXA 3ANYB 3S8MA 3N5CA 1R8XA 4OUKX 4CKWA 4M76B 4AICA 2GFHA 2Z1DA 1XZAA 2A6PA 1PQPA 3NWBA 2BF4A 4NIMA 1RRMA 3N7AA 1VL2A 2Z9DA 3KQUA 2NX2A 2NPFA 2JEZA 3T94A 4E2ZA 3IHTA 5E9WA 5EHZA 3VO8A 4ZRMA 1E0KA 5D7BA 1O7JA 1Z6AA 2QN7A 4IDPA 2Q7DA 3VSCA 1WSBA 3ZK9A 4HEA1 2OM6A 1VLZA 4HWSA 1LJUA 3IAEA 2R44A 1CUUA 3N8HA 3AHEA 4MZDA 4Z0TA 4C4SA 4N41A 2JLVA 1XMVA 3UB4A 4L3VA 4PF1A 4C88A 3HGQA 3NKFA 2AMJA 2BIFA 4DIFA 3KJHA 4BNTA 3O4GA 3LYHA 4N9WA 1K7SN 5KAPA 3PTZA 2H5IA 3ETJA 3QNWA 1DFGA 1JXMA 1PJAA 1KZ9A 4D3XA 1BA3A 3PSAA 1V4BA 2IYFA 1JTVA 1DWOA 1VHJA 2ESRA 3FB1A 1IJKA 3IAHA 2DHDA 3QXSA 4XSVA 3KCQA 3NHMA 5DRTA 2J7KA 2ZAMA 3DL2A 5FWXA 2A30A 1PDWA 1GTVA 4B9AA 1Z35A 4CI0B 2K7ZA 2JIZD 3GG9A 1KORA 5ERYA 4KFCA 1JN0A 1RKBA 3BCUA 1A2KC 2IP2A 3GVHA 4MUJA 2EP8A 4TXHA 1YDFA 1Z75A 4UKDA 5KREA 4C30A 2AYZA 3PYMA 2OILA 4RH0A 3CBQA 4CMIA 1AKWA 3DSRA 4Q3BA 2GM9A 5A0FA 2N9UA 3W5UA 3ZD6A 2NPIA 1D6SA 3DHYA 3AI2A 2YJ6A 2CVPA 4LFAB 3THOA 3AW8A 1CZNA 3QE3A 4RPCA 4MH0R 2JLBA 1GPBA 1YRAA 2CUZA 4QRIA 3HU3A 3URMA 4ZZIA 4F38A 3DAFA 3F3MA 3L7NA 4CT4B 2QVXX 5LLSA 2OZEA 2DU8A 4YLEA 1F06A 1SVUA 4KTVE 1VG9B 1U1FA 2A5FA 2HRDA 2R4UA 3ITEA 4TL6A 3EZFA 4V24A 5CT4A 4DM7A 3VKUA 4YCCA 1W7AA 4B3SB 3NHWA 1ESZA 2B2NA 1PFKA 3DDWA 3ET4A 3CNLA 2QVZX 2I2BA 4EJ0A 3OJOA 1CJKC 1QIFA 5EVCA 4QGAA 1L4MA 1DOHA 4XJSA 5K0JA 4QT0A 5BQ5A 1A8HA 1Q7RA 1ZUD1 3DFMA 3UK2A 2H4HA 1TC1A 1Y3AA 2HUPA 1CR6A 5KZMB 5BOVA 1K6EA 2HW8A 1HFWA 3SQLA 1OI4A 3GUCA 3ZHRA 3E27A 3AVYA 1V5GA 3VDQA 4LYAA 4JLKA 2WA1A 5DN6A 3U7QA 4TS3A 3MAAC 5HKAA 3KVOA 2OXEA 1RRPA 5G0SA 3BXPA 5LPNA 2BGIA 1H3NA 1XFDA 4HLQB 3A31A 2UAGA 2UZAA 2PS1A 5MN5A 1S6YA 2X8LA 3IDOA 5FPQA 2Q1SA 3SXJA 4PIVA 4ND8A 2FJPA 2UZ3A 1Z47A 5ICCA 1K3UB 2PY6A 4I4TA 1LB1B 1SEVA 2NXEA 4R8LA 5LBIA 3W05A 1CFJA 1UBSB 2XVZA 4DQDA 2JJMA 5LOVF 2B4KA 3AESA 3E05A 3AR3A 1PJQA 3GB9A 2B5VA 1JG6A 3LX4A 1P1KA 3B3JA 1P18A 3E5MA 3LDGA 4OJKA 4IFBA 4Q1CA 4RFSA 3SS8A 3WRVA 1WIWA 1CC1S 4HXYA 3MJSA 2GCOB 4YUWA 3UAGA 3W2EA 4IOKA 5LA6F 1NUHA 1TKRA 2YWRA 4L5YA 2W2LD 4H1UA 5JJLA 3URKA 1H23A 3FDZB 2AI2A 2IYLD 4HS4A 5EP4A 4ZZ3A 2QDKA 2M6LA 5K7SA 2WSSA 5LQUA 1CUGA 1Q22A 1L4BA 4MZXA 4QHYA 3RS4A 4EX6A 5KQLA 1DKUA 2A7QA 4RADA 3GRVA 3W3AA 4UAJA 4MEBA 1M0WA 2XIQA 1A97A 4WUVA 4XQ0A 3DXXA 2WD9A 1L0BA 1WWKA 3IKVA 3STUA 4AJPA 5IN5A 3D7LA 3GAZA 3TD6A 1ECCA 3VZDA 4KXUA 3S5UA 3OC0A 1DRJA 3M4ZA 3T8YA 1EXNA 5J63A 1OLSA 1E0SA 1WXWA 2WWXA 1OXUA 1ZM2A 1DADA 1NBME 3K09A 4PG7A 4BP9A 2XB8A 1WVIA 2FPPA 4O4HF 3FLBA 1NYLA 3GWZA 2BN4A 2WZQA 3FPLA 4P31A 4ZOEA 5IBCA 2ZJ3A 1XTIA 1GTJ1 3JPYA 4YRNA 4RABA 1VA5A 3LQRA 3ICQB 1PFWA 3RIHA 1F7UA 4AURA 1U9CA 3ROEA 4JI6B 3O84A 2W6QA 3F5DA 4Q18A 1RABA 1UMCB 3T1OA 2JI6A 3IE0A 2JLUA 2AG8A 4GBMA 1OZ0A 4AJ2A 5INTA 3BBPA 4HZUA 2NXCA 2ZUEA 5L51A 1QIGA 1ZGGA 2HWXA 1ZD2P 2IU6A 3FFWA 1U7TA 3KDAA 3KDPA 3R9XB 1U4SA 3B9QA 4GR9A 1MTOA 2E49A 2NUTA 5EWLB 1NFFA 3P9CA 5H7XA 3IAM6 4G4GA 4IICA 1J90A 1PWHA 5AIAA 3H13A 5DISB 5FQOA 3RKSA 4HGZA 5BXYA 5C37A 5EKDA 3CRW1 4BE4A 3FOCA 4W5QA 5B2FA 2YVKA 3F4KA 2YNMD 3SD7A 2FEAA 4X8LA 2JCGA 4ENRA 4B3IA 1CJMA 3DL7A 3ZWKA 1JV2B 3NJ8A 5JYCA 3F97A 2JHCA 5AW2A 4TYWA 1M2JA 2Z3ZA 4ZAXA 3HBFA 1FP2A 4ARZA 2QN8A 4OGGA 1NJ1A 1HA3A 2J5BA 2REQB 4PX2A 4JYAB 4HDSA 4K6MA 1RKQA 1WG8A 1CRPA 4GPAA 3AVXA 4I4TF 3D3JA 2O3JA 5D3KA 4A2WA 4BX9A 4LDPA