1ZGUB

Solution structure of the human mms2-ubiquitin complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Non-Covalent Interaction Between Ubiquitin and the Ubiquitin Conjugating Enzyme Variant Human MMS2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
molecule keywords Ubiquitin-conjugating enzyme E2 variant 2
total genus 23
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1zguB00
3R3MA 3MHSD 3M95A 2KTFA 3PPAA 4JIOU 3ZDTA 2FAZA 3X23A 2ZZPB 2D07B 4ANWA 3ZRFA 2KJ6A 3HM6X 1L7YA 1E8ZA 3AU4A 2HTHA 3BY4B 3RYTA 4MGIE 2K8BA 4F7ZA 2IZVB 4ZYNA 3W1YA 2C5LC 3I3TB 2G3QB 2KQ7A 4BKSA 1LM8B 1M94A 1XT9B 4GDLA 2JZ3B 1Z5SB 3DBSA 4AUQC 2IYDB 1KJTA 2ASQA 1PQSA 4B6WA 1P1AA 1Z2MA 2KXJA 3PLUA 4LJPB 3WAOA 2JF5A 2K6QA 4IM0A 2KDFB 4IW0A 4E71A 1WX9A 2MBQA 4DBGA 2EMSA 2YVCA 4FHKA 5DPSA 3DVNU 1P9DU 3QX1A 4I6NB 3TMPB 4W9CA 4WJQA 2GBMA 1TBEA 4F1SA 2Z59B 4TQ0A 1WGYA 2G45B 2IO2B 2N1WA 2O6VB 3VUWA 2FIDA 3IG3A 3A1QB 3VHTC 2WWZA 4MM3A 1P98A 2WX0A 3H1UA 2KOXA 5CTRC 1L2NA 3U8ZA 1YX6B 4K7SA 4I6LB 4CO7A 2M8SA 2BKFA 2DZIA 3MTNB 3N32A 2KWUB 2ZJDA 3ZNZB 3CSFA 4FN2A 5CHVC 4IWQA 2UYZB 2BYFA 1VCBA 2KDIA 3H7SA 1WXMA 2GBKA 3ML8A 4M8MA 4PS7A 2C7NB 1V49A 4GDLB 4HDOA 4EZLA 3KYDD 4IWOA 2V4LA 2AL6A 3WA0A 3RZFA 4WWPA 1NI2A 3VUYA 1WFYA 3MJWA 3JW0X 4I6PA 4MJSB 2DAJA 2BYEA 2LRWA 3L10B 5D6JB 3SD5A 4WJNA 2KZRA 1ZW7A 1P3QU 2KK8A 2RSUA 3A4SC 2KD0A 4DHZE 5E6NA 3KW5B 2MBOA 1XQQA 4MH0E 3ALBA 3DBHI 2KFKB 2EMTA 3EECA 3R66C 5JHAA 1J8CA 2DZKA 3ZNGC 3ZUNA 1RAXA 2LVOA 1JRUA 2ZPYA 3W1SC 3WANA 1WMHB 2ZVNA 2ZVOA 2DYBA 3TIXA 1YX5B 2KFKA 1LFDA 4J6IA 5D2MB 2BKRB 2DZMA 2K8CA 4ANUA 4BOSC 4K7UA 3SDLC 1E7UA 1XD3B 2A5UA 2L05A 1WIAA 1R4MI 3DOWA 2MBBB 1YD8U 2ZCCA 4MJSA 4W9LA 5LXHA 1UBQA 1UBIA 4HWIB 4NJ6A 3KUZA 3ZO5B 2XEWA 4AP4C 5J2RA 3L08A 4W9KA 3ZW3A 1KM7A 2PJHA 3JSVA 4EZJA 4N9F4 1GJZA 4TQ1A 1RFAA 2K39A 1NDDA 3LJ3A 2CHWA 2ZPNA 1F9JA 2IO0B 3PSEB 3OJ4B 2KMAA 2LGYA 2MX2A 3PTFC 4WWOA 2AWTA 4FADA 2B3AA 4A3OA 4X57B 1ISNA 1WJNA 1H8CA 4A3PA 2M1MA 2J0MA 4F8CB 2L3ZA 3HK0A 4EZKA 3RUIB 2KKCA 3PRZA 3ONSA 4MSQB 3ZNID 1WR1A 4IC7B 4MDKE 1WGGA 2JWZA 3PS6A 3V62A 1SE9A 3IHPC 4K81A 3VTWA 4G11A 4KDIC 5JH5C 2NBUA 3H7PA 5G2NA 1LQBA 2JUOA 2NR2A 1E8YA 3QQ8B 4NQKE 2I1JA 3HIZA 3ZDMC 3A9KA 4ZDVA 1OEYA 3DDCB 2FCNA 3PT2B 3ZKJC 4B95A 3DVGX 5E6OA 1U4AA 3U7DA 1Q0WB 4W9FA 4W9IA 4XC2A 3APCA 2KFJA 2KC1A 1WF9A 3L13A 2LVPA 2D11A 2DZJA 4JL9A 2BGFA 4DK5A 4FA6A 4EFOA 2KDBA 4ZRJA 2ZNVC 3H7PB 4M8NA 3QK0A 2MA9B 3WAPA 5JHBA 1WJ6A 4LCDE 5CHWA 2JZZA 2N9EB 3EHVA 4WQOB 2LJ5A 2MRPA 2C9WB 1UH6A 1OTRB 4GN1A 2BYVE 2GBJA 2D3GA 4GSWA 5TR5A 4HXDA 1Q5WB 3APDA 3UIOB 3U30A 2KDEB 2O2VB 1WRDB 3S2AA 3VDZA 2JPHA 4BKSD 2WDTB 2PE9A 5DCNA 3O65B 3RZWC 4PYZA 5KHOA 3VAWA 1WGDA 4BBNC 1HE8A 2HD5B 1WJUA 2N4FA 4HCNB 4ZRKA 2NPTB 2M17A 2NS5A 3EFUA 3EC8A 4G3XB 4NPNA 4G50A 1EF5A 5DPTA 1WH3A 2CHZA 4DWFA 1GC6A 2GOWA 3VH4B 1WI0A 3OJ3A 2L0TA 2NPTA 4BKTA 3JVZX 3W1SA 1KOTA 1S1QB 2IO3B 2MP2B 3CF6E 3M62B 1WM3A 3ECIA 1UD7A 2JVCA 5E6PA 3UF8A 3RD2A 4YL8A 3IFWB 3TJPA 4NAWB 3A33B 1WMHA 3PV1A 2L0FA 3HM3A 5CX3A 1V80A 3UGBB 3VQIA 2RD0A 3L54A 4RM9A 2KLGA 1UZXB 4OVVA 1WZ0A 2KHWB 3GZNI 3L0WB 1V6EA 4XZ4A 3WALA 2OOBB 2LGXA 3WIMA 1CMXB 3WAMA 4B9KA 3QWZB 2JRIB 2KNBA 3NOBA 4II3B 4MGZE 4FULA 3ZLZA 2LUEA 3PRMB 1GC7A 2UWQA 4EOYA 2V1YA 4LJOB 3ZRCA 2N7DA 3R7QA 3ENEA 3QAQA 3NY5A 3B0AA 3NZUA 2LXAA 3HHMA 3T8MA 5HKHA 3ZVVA 2Z0DB 2K1FA 1E90A 2FNJB 4HLEA 2ZNVB 5D7GA 3OAWA 5AZGA 1MG8A 1Q1OA 2BF8B 3V61A 3VFKA 4XX5A 4ASWC 2R2OA 1T0YA 4HK2A 1NBFC 4IWPA 4WAAA 2G4SA 3K9PB 2CR5A 3KH0A 1I35A 4HJKA 3VUXA 1KLVA 2O6VD 1OEYJ 3AXCA 4WJPA 2MSED 2HJ8A 1WE6A 3TBLD 1WYWB 1WXAA 1WXSA 3QHTA 4W9JA 1Y8RC 1X1MA 2A4ZA 3QIJA 4K1RB 1C1YB 2I1KA 2FCMA 3DVGY 5JZEB 1SGHA 2KJHB 2PEAA 1WR6E 1WY8A 3QC8B 4FJVB 1I42A 2XK5A 2KWVB 5AZHA 1P0RA 3M3JA 2RR9A 4CHKA 1WX8A 4GDKA 4LDTB 2ZCBA 4NJ7A 2WX1A 4RMAA 2FCSA 1EO6A 2AEHA 2GMIC 3NS8A 3RT3B 1FXTB 5GMVA 1V86A 3ML9A 4MGKE 1EF1A 2DENB 4PS8A 2D10A 2L7RA 2MWSB 2CKHB 4BKGA 2WYQA 4M0WB 2CS4A 4MELA 3C0RB 4E74A 4IM3A 3KVFB 3TCAA 2K8HA 4ANXA 4II2B 1OQYA 4MEMA 2PE6B 4NQLB 4KV2A 2OJRA 3X0WA 3ZTDA 4BVUC 5G55A 5J17A 3DBRI 2KWCA 3QARA 1V5TA 3JYUA 5C1ZA 2L00B 4HDQA 4HVBA 1QZEA 5DPRA 5BO4B 3CMMB 2GBNA 1TTNA 3UINB 3AU5A 4IUMB 2MQJA 1ZGUB 2N1VA 3QJZA 4JGHB 1EUVB 2M0XA 1E8WA 4MSMB 5AZFA 2NCNA 3PVLA 2O2VA 1G6JA 4HPMB 3V60A 5EDSA 2BPSA 4NAWA 2N9PC 1YJ1A 5D94A 3A9JA 2LWPA 3NHEB 4GB9A 2BWES 2V3SA 1C3TA 4NY0A 3DVNV 2FUHB 3ZNHB 2C60A 1WX7A 1V2YA 2YLMA 4KIKA 4ICVA 2QHOA 5CHFA 2CU1A 2KX0A 5C23A 2IY1B 3L16A 3ZTCA 3QA8A 4HPLB 2J0KA 1IP9A 3UQBA 4W9GA 4DHJB 1OGWA 1GUAB 4GGQA 4PS3A 4ZRIA 2IY0B 1WM2A 2MP2A 3PZDA 2O6VA 2K6DB 3D32A 2JT4B 3H6NA 3KUDB 2FIFA 3APFA 3AI5A 1UGMA 2L8JA 1S3SG 2DAFA 2NBVB 3A9JB 4KDLB 4EEWA 1H4RA 4DHZB 4IM2A 3KUCB 2KO3A 1IPGA 1GNUA 2LGDA 2PPHA 4K7WA 1YIWA 3DPDA 3PHXB 4FBJB 4GU2A 2KN5A 3IBEA 2DX5B 4DXAB 2LVQA 3PREA 5IAAC 4G0NB 4GDKB 2KC2A 1R4NI 3L17A 4KSKC 1A5RA 4BFRA 3DBLI 3V6CB 4KZCA 4PYUA 4IG7B 3DCGA 3DQVA 3Q3FA 4BBNF 5AEKB 1K8RB 4GIVA 3TL5A 5J18A 4FLHA 2N9XA 3KYCD 2MBEA 2KJRA 2KX3A 3V6EB 2FCQA 2MLBA 4DHJD 4HCPB 4WJOA 2KMCA 2GBRA 4OVUA 2LRUA 2KANA 1E5WA 1AARA 3AULA 4JLCA 3VH3B 2JY6A 2RGFA 2N7EA 2L76A 4P7IA 5LXIB 4GMVA 3UQAA 4W9HA 2IBIB 4GOCA 3RCZA 4URKA 2XBBC 3JSVB 5L83A 4AOFA 1WE7A 2D2QA 1V9JA 4KSLC 3N3KB 1WXVA 1GG3A 2KVRA 4KIKB 4FJZA 5KHQA 2R2QA 2G4DB 2Y5BB 2REXA 2NVUI 1J19A 4EUTA 1J0GA 1IYFA 4EKUA 2LXCA 2MCNB 2NBWB 1RLFA 2MBHA 2RPQA 4KZ0A 2LASA 2CHXA 3VXWA 3B1LX 3A9KB 3Q3JA 2M4NA 5L95C 2XK5B 2KTRA 3GOEA 2K25A 4KVGB 4FHJA 4MGYE 1LXDA 3PLVA 3QCAA 5LLIA 3K9OB 2LI5A 3IVFA 4W9DA 3CSTA 2MW5A 3PRPB 3OLMD 2HE7A 2AYOB 2DYOA 2VRRB 2LZ6A 3T9LA 4FJYA 3ZIMA 4DDGD 2C7MB 4AJWA 2W9NA 2JRHA 4TKNA 2Z0EB 3N30A 4AWJA 3SU8X 2BWFA 3P2BA 2JXXA 1ZKHA 3BINA 4A20A 1V81A 1D3ZA 1RRBA 1TZ1A 3H9DA 1E7VA 5FR6A 4CYEA 2ZEQA 2EKEC 3UIPB 2LD9A 4ANVA 1SIFA 1TGZB 4AJYB 4NNJB 2J0JA 4TV3A 3VVWB 1VD2A 2DYMA 1WGRA 5DPWA 4W9EA 3A4RA 3VTVA 1WZ3A 1UELA 2DHZA 4LDTD 3B08A 3PHWB 4TUUA 2AL3A 3RULA 4DDID 4JQWC 4BOZB 1BT0A 1WGHA 4GXBA 3R7RA 3NZSA 3A1QA 3LDZE 3M63B 1WJ4A 2IO1B 2J7QB 1E8XA 1V5OA 4WWNA 2KLCA 4RM8A 5IA7A 1YQBA 3VTUA 4E3CA 2C7HA 3PGEA 3SHQA 4ICUA 2KQSA 2KTRB
chains in the Genus database with same CATH superfamily
3PPAA 4JIOU 3X23A 2W55A 2KJ6A 3HM6X 1L7YA 3RYTA 4BZAA 1F0ZA 4LNFA 4RF1A 3ZQ4A 3W1YA 3RPFC 3I3TB 1WGKA 2LGSA 4BKSA 2IYDB 1KJTA 3HRDD 3ZGZA 1P1AA 1Z2MA 3DHIC 3I5JC 3WAOA 2K6QA 5HFYA 1WX9A 1OQQA 2MBQA 2EMSA 3BIID 3AEBB 2BTEA 1P9DU 4I6NB 4A6QA 1TBEA 4F1SA 5T8IA 4TQ0A 3E9SA 2O6VB 3A1QB 2WWZA 1P98A 2KOXA 2FE8A 2BKFA 3CSFA 1WXMA 3ML8A 1AN8A 4PS7A 2C7NB 2GI9A 4GDLB 4LNNA 2AL6A 2HJ1A 1I4GA 5D6JB 1FXIA 3L10B 4WJNA 2RSUA 1P3QU 3VR9B 2J53A 2M19A 2MBOA 1OQRA 3ALBA 1VJKA 2EMTA 3EECA 1AYFA 2DZKA 3ZUNA 2IGHA 3DBRB 1IUEA 1RAXA 1JRUA 3W1SC 2ZVNA 2ZVOA 1YX5B 2AQ3B 3NZ3A 5D2MB 2A5UA 4MJSA 2W3SA 4A90A 2XEWA 3L08A 1KM7A 2PJHA 4TQ1A 1RFAA 1ESFA 1FM0D 2KMAA 1MFWA 3PTFC 2B3AA 1WSPA 1WJNA 2J0MA 2L3ZA 3FILB 3RUIB 3NJTA 2KKCA 1D5ZC 4MSQB 2JWZA 1L0XB 3V62A 3IHPC 4G11A 4KDIC 3RNEC 5JH5C 3HIZA 2DBYA 4ZDVA 3DVGX 2UU7A 5E6OA 5IP4D 4W9FA 2WXGA 1V97A 3APCA 2KFJA 2KC1A 4PK1A 5BYRA 3BYTB 1EWCA 5JHBA 1XLNA 2JZZA 2LJ5A 5C3JB 4JE3B 2JU6X 4WQMA 1TZOA 2HDEA 2XN9C 3O65B 4RGNA 1UWMA 4ZRKA 2NS5A 4NPNA 1CQVA 4G50A 5DPTA 4DWFA 1GC6A 3H8HA 3JVZX 4P1CC 2IO3B 1V1OA 3M62B 4ARCA 4ARIA 3UGBB 3VQIA 3HM3A 3BWUD 2RD0A 4B0MA 1WZ0A 3GZNI 3L0WB 1CMXB 3WAMA 1QT9A 1IGDA 3ZLZA 1NENB 3PRMB 3U7ZA 1GC7A 2UWQA 3BVZA 4EOYA 3B0AA 3NZUA 4MACA 5HKHA 2Z0DB 1XLOA 2LGIA 2LHEA 3PZ8A 1UWXA 2ZNVB 3OAWA 1MG8A 3V61A 4RF0A 1T0YA 4HK2A 1HXYD 2CR5A 3TEYA 3VUXA 2O6VD 3AEFB 1OEYJ 4L23A 2MSED 2WHIA 1WYWB 1WXSA 3QHTA 1Y8RC 1X1MA 4S0RA 3AH7A 5BMIA 1L0VB 2XK5A 3SFEB 2VZKD 1P0RA 3M3JA 1XEEA 4GDKA 4M01A 4M00A 5GMVA 2QMTA 3EFCA 1EF1A 2KACA 4PS8A 4XGAB 2WYQA 1F2RC 4MELA 3TCAA 3KVFB 1JCKB 2K8HA 2J52A 1OQYA 2LUMA 4WAFA 4NQLB 3MC0B 5J17A 5C1ZA 4K3CA 2WU5B 4IUMB 2MQJA 3QJZA 1GB1A 2M0XA 1R4NB 1E8WA 4XE0A 4ITKA 4D2KA 4MSMB 2NCNA 5HHDG 1G6JA 1C78A 1F52A 2N9PC 1QQRA 1RFKA 1C3TA 2FUHB 3ZNHB 3Q14C 2YLMA 5CHFA 3N1XC 4HPLB 3UQBA 4W9GA 1SXTA 1GUAB 2Y5PA 4WH4A 3PZDA 2O6VA 2W54A 3AI5A 1UGMA 2L8JA 2DAFA 3A9JB 1H4RA 4DHZB 3AM9A 1IPGA 2LGDA 4S17A 1PFDA 4K7WA 3DPDA 4GU2A 1YJJA 2LVQA 4G0NB 1J7BA 4KSKC 3L17A 1HZ6A 1CZPA 3V6CB 4BAXA 1ZXHA 3T3NA 2WXHA 1T0SC 2INPE 1F1HA 2VH2A 2N9XA 5BYQA 3V6EB 4OVUA 2LRUA 3AULA 1AARA 1TY0A 2IBIB 4URKA 3ZXVA 2BBCA 3T3OA 1YOVB 1T0QC 1XLQA 1V9JA 4KSLC 4MM3B 1WXVA 2KVRA 5KHQA 2R2QA 3OG5A 1IYFA 4DQOC 1NI3A 4EKUA 1XCTL 2MCNB 2NBWB 4JPSA 2K25A 1LXDA 3QCAA 3GE8C 4N58A 1SF0A 2BQQA 5TSSA 2HE7A 1Q10A 1TKEA 2DYOA 2MJEA 2VRRB 3T9LA 3ZIMA 1C77A 1P7EA 4YSZB 3N30A 3IAM1 1OFFA 1RRBA 1E7VA 3Q8BA 2EKEC 3V3XA 4AJYB 5AUKA 4TV3A 5IN7A 1TJEA 2RDHA 1V1PA 4K3BA 4TUUA 3B08A 4BOZB 1FPYA 1WGHA 4GXBA 3NZSA 1PDXA 2IO1B 4WWNA 5IA7A 1K52A 4E3CA 4AS1A 1YNTE 3PGEA 1EU4A 4RGOS 4AQ7A 3MHSD 3MP9A 3ZDTA 3Q8CA 2ZZPB 2D07B 3AU4A 3BY4B 4TSSA 5GXGB 4MGIE 2K8BA 1MJDA 1YN4A 3R2TA 2QIEB 3RFZB 1XF5L 1SSNA 1NYQA 1M94A 5BMHA 3N1ZC 3RI7C 5D3IB 4B6WA 4LJPB 2JF5A 2K3UA 1JWMD 3NVWA 4DBGA 5DPSA 1IBXA 4W9CA 4WJQA 2IO2B 3AEGB 2FIDA 2WX0A 1HA5A 1UUPA 1L2NA 5CTRC 4I6LB 1FNUA 1F77A 3MTNB 2ZJDA 3ZNZB 2UYZB 2BYFA 2KDIA 3H7SA 4HDOA 4EZLA 3KYDD 4IWOA 3WA0A 3RZFA 1GB4A 4WWPA 3JW0X 3SD5A 4HEA1 2KZRA 3A4SC 1JW9D 5E6NA 3KW5B 1WWTA 1PGXA 4MH0E 5G5HA 3DBHI 1LO5D 1K53A 3ZNGC 2LVOA 3GB1A 1GOZA 1WMHB 1LFDA 4YTNB 3AE7B 4ANUA 3AEEB 1R4MI 5LXHA 1YD8U 2ZCCA 1FCLA 4IKGA 4NJ6A 4HWIB 1UBIA 1R7SA 3KUZA 4AP4C 5J2RA 2J42A 3P4SB 4W9KA 4N9F4 2K39A 3P4QB 3ZYYX 2OEDA 2ZPNA 3PSEB 1PGBA 2LGYA 4OZBA 4A3OA 2L83A 1ET6A 1H8CA 4A3PA 3NVZA 1WYGA 2ON8A 4F8CB 4ZRPA 3Q3OC 3PRZA 2QSDA 3ONSA 3ZNID 1WR1A 3MC8A 2KDMA 4MDKE 3PS6A 2SEBD 2M56B 2K9XA 3VTWA 2JZPA 2MH7A 3H7PA 1LQBA 2I1JA 3Q8EA 3A9KA 1OEYA 3ETRA 4B95A 1QLBB 3URYA 3IT6B 1SEBD 2WP9B 4XC2A 1YQ3B 1WF9A 3L13A 4FA6A 3PO0A 3QK0A 2MA9B 5CHWA 2ZW0A 1F2RI 4WQOB 5H92C 3SEBA 4HXDA 1Q5WB 3APDA 2NTTA 2KDEB 2BB5A 3S2AA 2JPHA 2PE9A 2KN4A 2GRIA 2AQ2B 3AN1A 1K50A 1HE8A 4HCNB 2N4FA 1YN5A 2M17A 3KLSX 1N5XA 2L0TA 2LMCA 4BKTA 5HG2A 1S1QB 3KWVA 1QILA 4YL8A 3IFWB 4ZYSA 1WMHA 3PV1A 1D4BA 5CX3A 1JALA 1TS3A 3L54A 3LB8C 2KLGA 1CJEA 1C4PA 2VH1A 1VZ8A 3B9JA 1SE2A 2KHWB 3WALA 4B9KA 1JWAD 2LGXA 1MHXA 3QWZB 2KNBA 4II3B 1UGJA 2RDBC 4LJOB 2BT6A 2N7DA 3ENEA 4C80A 3NUHB 3T8MA 3U2SC 1SJHD 4KX6B 5D7GA 2L52A 2BF8B 1Q1OA 3VFKA 4XX5A 4PT5A 2R2OA 1KF6B 1TYGB 4WJPA 2KVZA 4K1RB 2WDQB 1C1YB 2LHDA 2E3TA 2KJHB 3QC8B 2KT7A 1I42A 4OHJA 2W3RA 1WX8A 1V8CA 4NJ7A 2N0SB 2GMIC 1EO6A 2AEHA 2X38A 4MGKE 2DENB 4YTPB 2D10A 3AE5B 2L7RA 2CKHB 2DLBA 2MWSB 4R3DA 4WWMA 1TT5B 4MEMA 3Q3NC 2OJRA 4J3OD 3ZTDA 2WDVB 2KWCA 3QARA 4HVBA 2X8XX 1QZEA 5DPRA 3AEAB 1TTNA 1ZGUB 1C79A 1EUVB 1FEHA 4LNIA 2RPVA 3J9CA 2BWES 4NY0A 1WX7A 3NG0A 1YMHE 5HI1A 5C23A 2KX0A 3QA8A 2INCC 2J0KA 1IP9A 3SFDB 3VRBB 1DYQA 2IY0B 1WM2A 3W5VB 3D32A 3APFA 5LNK1 1HZ5A 2BVCA 1S3SG 2NBVB 4MT5A 4KDLB 3P63A 4IM2A 2AQ1B 2KO3A 4C00A 2KQ4X 3TEWA 2INNE 3PHXB 3WCQA 2DX5B 4ZHPA 5IAAC 1SE4A 4GDKB 4BFRA 4KZCA 2KYWA 3Q2AC 4RNAA 2HTME 3MJ5A 4BBNF 3BVMA 2XNAC 4GIVA 3KYCD 2G9HD 2MBEA 2FCQA 4HCPB 2KMCA 2GBRA 4JLCA 1E5WA 2V0GA 2NMQA 2N7EA 4P7IA 4LNOA 3UQAA 4GOCA 4JWSC 5L83A 3JSVB 4AOFA 1BMLC 3FC4A 4FJZA 1T6BX 2NVUI 1VR9A 4EUTA 5FK9C 4KZ0A 1L4DB 3VXWA 4HKQA 1AW7A 5L95C 2KTRA 4MGYE 2FBWB 1JMLA 1MI0A 3PLVA 3VR8B 2LI5A 3SR6A 3CSTA 3PRPB 4FJYA 4TKNA 1L4ZB 3W9CB 3SU8X 2BWFA 2V9HA 2JXXA 1ZKHA 2KWDA 1D3ZA 1TZ1A 4CYEA 2ZEQA 1ZP0B 3UIPB 3C19A 5G5GA 4ANVA 2J0JA 1VD2A 4C7ZA 5DPWA 2QC8A 1UELA 1TS5A 2RMMA 4JQWC 3Q69A 4RH6A 3RNAC 3I57A 3R8BA 3M63B 2J7QB 1E8XA 2KLCA 1QOAA 1YQBA 1I4QA 3VTUA 3HVDA 5FR3A 2C7HA 2BYTA 2IPKD 2KTRB 1EF5A 2IJ0A 2WXFA 2BW2A 2KTFA 3Q8AA 3HUIA 2FAZA 3UI3A 3ZRFA 1XLPA 2HTHA 1FIQA 2EELA 1N6ZA 1TS4A 4ZYNA 2C5LC 1DOYA 2G3QB 4QAYA 2OJWA 1LM8B 1XT9B 4AUQC 4GDLA 2JZ3B 1KLGD 2WXKA 2ASQA 3E56A 3PZ7A 2MJDA 3PLUA 3TUOA 4IM0A 1N62A 4E71A 1SJED 3N20C 4FHKA 1I4PA 3KQ4A 4OZCA 3QX1A 3DBLB 2BS3B 2JXTA 3TMPB 2GBMA 2Z59B 4KKIA 2N1WA 3VUWA 3W2DA 3CWIA 3VHTC 4MM3A 4WIPA 4GLSC 3IAS1 3H1UA 2IDYA 3U8ZA 1YX6B 2M8SA 3RN9C 4C56C 4JX1C 2KWUB 3W5UB 4IWQA 1RWSA 2KAJA 3DBHB 1SE3A 2GBKA 4M8MA 1V49A 2WLBA 2LEKA 3VUYA 1WFYA 3MJWA 4MJSB 2BYEA 2LRWA 2KK8A 4LNKA 2V3NA 2KFKB 5JHAA 3R66C 4C7YA 1LGRA 5IKCM 2ZPYA 3WANA 3Q6BA 2KFKA 4P1BC 4J6IA 1ACCA 2L32A 2DZMA 2K8CA 4BOSC 1E7UA 4CQNA 4LTUA 1WIAA 4XWWA 4W9LA 1FMAD 3ZO5B 3ZW3A 3JSVA 2CJNA 1NDDA 3LJ3A 1SIJA 3OJ4B 1D6EC 4WWOA 4FADA 4KGRA 4X57B 1ISNA 1ZPSA 2M1MA 1UF0A 4EZKA 2PVOD 4XWTA 4IC7B 2G1EA 1WGGA 2NBUA 2JUOA 1HTQA 2NR2A 3QQ8B 4YTMB 1E10A 3NVVA 4MH8A 2FCNA 3PT2B 1U4AA 4N59A 2BB6A 4N6EB 3DHHC 4RGMA 4W9IA 2D5GA 1TKGA 3Q8FA 1XXGA 2DZJA 2LVPA 4JL9A 2BGFA 4DK5A 3RNGC 4EFOA 5AUIA 4ZRJA 2ZNVC 1WJ6A 4LCDE 1ZUD2 2I38A 2WXPA 1XO3A 2MRPA 1OTRB 1UH6A 3RNCC 2BYVE 1T0RC 5TR5A 1E6EB 4RCOA 3UIOB 3U30A 2O2VB 4EE2A 3P1MA 3AE2B 1RM6C 2N7JA 2IGGA 3VDZA 2WDTB 3RZWC 3MC9A 4TMAB 4PYZA 3AE1B 1EU3A 4XDDA 3RNBC 4BBNC 3B2FA 1WJUA 1C76A 3EFUA 4A9AA 4G3XB 2I2YA 4XYCA 3BZDB 1WI0A 3EUB2 3OJ3A 1KOTA 1HQRD 3DHGC 2MP2B 1UD7A 5E6PA 4NAWB 2L0FA 4OVVA 2D3CA 1KH0A 1V6EA 4XZ4A 2DNFA 3WIMA 2ACZB 4MGZE 2N9KA 2LUEA 3IXSA 1D5MC 4DXGA 1B9RA 1I4XA 1FO4A 3FKYA 3HHMA 1YQ4B 2K22A 1E90A 1C4CA 2FNJB 2Z8LA 3C8YA 3AMZA 3EGRA 3LYYA 3U4EG 1J7AA 3U52E 5JXVA 4ZOHC 4ASWC 1NBFC 4WAAA 2G4SA 2H89B 1ENFA 1I35A 4HJKA 1NEKB 2HJ8A 1WE6A 3TBLD 3RMKC 1KLUD 1SBBB 4IOIE 4HKZE 4M02A 3BK2A 2I1KA 1FFUA 3N1YC 5JZEB 1SGHA 3P4PB 5BMGA 3GP7A 1WY8A 2PKOA 2JQRB 1BXTA 5AZHA 3Q3MC 4LDTB 2WX1A 4RMAA 3NS8A 3RT3B 1FXTB 3L4PA 1V86A 3ML9A 3N9YC 1R4MB 1KRHA 4M0WB 2CS4A 3C0RB 4E74A 2PE6B 4KV2A 1DOXA 1ZDVA 4M0WA 5G55A 1V5TA 3JYUA 2L00B 4HDQA 2JYTA 2M0AA 3CMMB 5BO4B 2GBNA 2WXNA 3AU5A 4C4VB 2Y3AA 3I9V1 2L1AA 2ZW1A 4JWUC 5BYSA 2PW9A 1FFVA 5EDSA 2BPSA 4NAWA 5D94A 3A9JA 3NHEB 2V3SA 3B2GA 1V2YA 2JYEA 4ICVA 1VRAB 5IOIA 3BYYB 2IY1B 3L16A 5D3DA 1BUIC 4DHJB 1OGWA 4GGQA 1ET9A 4ZRIA 1RYJA 2K6DB 2FIFA 2ICIA 1MHHE 2JWUA 1TS2A 4EEWA 1ZXIA 3KUCB 1L6UA 2PPHA 1NVID 2Q5WD 1YIWA 4ZRQA 4FBJB 2KN5A 3V05A 4DXAB 3PREA 1R4NI 1GAQB 3ZJTA 3AECB 3EA6A 5J18A 1EWYC 2MLBA 3O13A 4WJOA 3KWLA 3AE9B 3AE4B 2JY6A 5LXIB 4GMVA 3RCZA 4HPPA 1GG3A 2G4DB 2Y5BB 1EM7A 1J19A 3DWMA 2E6XA 2LXCA 2WXQA 1RLFA 2LFIA 2RPQA 2YEPB 1FXAA 2CHXA 2LASA 4REZA 3B1LX 3A9KB 3Q3JA 1I4HA 2XK5B 1JQ4A 1QOBA 2WU2B 4DXFA 2PVGC 4A55A 1HTOA 4W9DA 2MW5A 5IO9A 2W82A 2LZ6A 2MHJA 1KTKA 2C7MB 4AJWA 4DDGD 4NAMA 4AWJA 1AWDA 4A20A 3H9DA 2WXOA 5FR6A 4ACFA 2WXJA 1SIFA 2SAKA 1PGAA 1C4AA 1WGRA 3A4RA 5H8YE 3LXFA 3RULA 4DDID 1CK1A 4FXCA 1BT0A 1DOIA 4YT0B 1FD6A 1V5OA 1L5PA 4RM8A 2QJLA 2FUG1 1N60A 2KQSA 2WXRA 3R3MA 3M95A 4ANWA 5EE1A 1Y56A 1E8ZA 1MVKA 1C9FA 4F7ZA 2IZVB 2CJOA 2D3AA 2KQ7A 1I4RA 2QDFA 1Z5SB 3DBSA 1FNWA 2JSVX 1PQSA 2KXJA 1WXQA 2KDFB 4IW0A 4LK0M 2GB1A 2QEJC 2YVCA 1N61A 5EE3A 2DWQA 3DVNU 2PIAA 4KKJA 3FAHA 3VRAB 1J7CA 1WGYA 2G45B 3AV8A 3IG3A 1VDVA 1L0YB 1B1ZA 3GS2A 1V1PB 4K7SA 4CO7A 2DZIA 3N32A 4FN2A 5CHVC 2MJ3A 1VCBA 4YSXB 4YSYB 1TKYA 2YEPF 1FNVA 2V4LA 3NVYA 1NI2A 4I6PA 2DAJA 1ZW7A 2KD0A 4DHZE 3AEDB 4O1NA 1XQQA 5I4DA 3TSSA 1TY2A 1J8CA 3I63C 2K0PA 2INDC 1N5WA 2DYBA 3TIXA 2BKRB 4K7UA 1FRRA 1STEA 1QOFA 3SDLC 1XD3B 1TIFA 2L05A 4NJCA 3DOWA 2MBBB 3MHZA 1UBQA 5EE9A 2KMMA 5E6JA 4EZJA 1GJZA 2Y5CA 2CHWA 1F9JA 1JWUD 2IO0B 4L1BA 2MX2A 3AB5A 2AWTA 2JX5A 3HK0A 2PTLA 5FKAC 4H2AA 1SE9A 4K81A 4P16A 3GE3C 1JRPA 5G2NA 1E8YA 5EE0A 4NQKE 1YN3A 3ZDMC 4ZHOA 3DDCB 3ZKJC 2R61A 2N9LA 4YWGG 3U7DA 3BK1A 1Q0WB 3ZJVA 2D11A 2H88B 4US9A 2KDBA 3H7PB 4M8NA 3WAPA 3OWEB 4XDCA 2QILA 1T3QA 2BS4B 1K51A 2N9EB 3EHVA 2LJIA 2C9WB 1PYWD 4GN1A 2GBJA 1XCQL 2D3GA 4GSWA 4HRSA 1L6VA 1WRDB 4OVZA 4KGSA 4BKSD 5DCNA 3NRZA 5KHOA 3VAWA 1WGDA 3ZJUA 2HD5B 2NPTB 3EC8A 3AE6B 4L2YA 1WH3A 2CHZA 4OZAA 2GOWA 3VH4B 2GLSA 3P4RB 2NPTA 1PUTA 1VZ6A 2OHFA 3W1SA 3CF6E 1I7HA 1WM3A 3ECIA 2JVCA 3UF8A 3RD2A 3TJPA 3A33B 1V80A 1N63A 4RM9A 1UZXB 1QF6A 4HJGE 1UNSA 3P42A 1QKZA 1JWSD 2OOBB 1ZOYB 2JRIB 2NTSA 3NOBA 4FULA 1M4VA 2V1YA 3FILA 3ZRCA 1ROEA 3R7QA 3QAQA 3NY5A 1GPXA 2LXAA 1D5XC 2WQYB 3HVZA 3ZVVA 4LLGM 2K1FA 4HLEA 4IDIA 5AZGA 2PMVA 2QCZA 4IWPA 3BVGA 3IT4B 3K9PB 3KH0A 1KLVA 3AXCA 1VZ7A 4HROA 1WXAA 4W9JA 2A4ZA 3QIJA 1YJIA 1E7PB 2FCMA 3DVGY 1MG4A 2PEAA 1WR6E 4FJVB 4OW0A 1IBXB 3DWGC 3AE3B 2K5PA 2KWVB 3NS1A 1IGCA 4B0EA 2RR9A 4CHKA 3GZNB 2ZCBA 1FCCC 2FCSA 1E9MA 4USAA 3ZXRA 4BKGA 4RGTA 4NZLB 4IM3A 4YXDB 4ANXA 4II2B 2WS3B 2WGSA 1WRIA 1SB3C 1HEZE 3X0WA 4BVUC 3DBRI 2TSSA 4UDUC 2V3PA 5MPOA 1MPEA 3UINB 3R2IA 1A70A 2N1VA 4JGHB 2D3BA 2IGDA 5AZFA 3PVLA 2O2VA 2MEKA 4HPMB 3V60A 1YJ1A 2LWPA 1JROA 3MFGA 4GB9A 3DVNV 1FRDA 1P7FA 2C60A 4KIKA 2QHOA 2CU1A 3ZTCA 4P6VF 2WXIA 4Q2JA 1QOGA 1E0ZA 4PS3A 2WXMA 3AE8B 2MP2A 1DGJA 2JT4B 3H6NA 3KUDB 1GNUA 2PLPA 1ZE3D 2CU3A 3IBEA 2KC2A 1A5RA 3TEXA 2ONQA 3DBLI 4PYUA 4IG7B 2BS2B 3CIRB 3DCGA 3DQVA 3Q3FA 5AEKB 1K8RB 3TL5A 4FLHA 2KJRA 2KX3A 4DHJD 2KANA 3VH3B 2RGFA 2L76A 4A8XC 4W9HA 2RDGA 2XBBC 1KFYB 1WE7A 2D2QA 2WDRB 3N3KB 4KIKB 2REXA 1J0GA 1T5XD 2MBHA 2WNMA 2M4NA 3GOEA 2V4IB 4KVGB 4FHJA 5LLIA 3K9OB 3IVFA 2J4XA 3OLMD 3ABVB 2AYOB 2W9NA 2JRHA 2Z0EB 3P2BA 1JWBD 3BINA 3TEZA 1V81A 4KGTA 2LD9A 5C2TB 1TGZB 2WXLA 1NYRA 4NNJB 3RNFC 4US8A 3VVWB 2DYMA 2B76B 4W9EA 2VZKB 3VTVA 1WZ3A 2EKIA 2DHZA 2AX5A 4LDTD 3PHWB 4WURA 2AL3A 1ZDXA 3R7RA 3A1QA 3LDZE 1WJ4A 4C4VA 3SHQA 4RFBA 4ICUA 1VLBA
chains in the Genus database with same CATH topology
3R3MA 3MHSD 3M95A 2KTFA 3PPAA 4JIOU 3ZDTA 2FAZA 3X23A 2ZZPB 2D07B 4ANWA 3ZRFA 2KJ6A 3HM6X 1L7YA 1E8ZA 3AU4A 2HTHA 3BY4B 3RYTA 4MGIE 2K8BA 4F7ZA 2IZVB 4ZYNA 3W1YA 2C5LC 3I3TB 2G3QB 2KQ7A 4BKSA 1LM8B 1M94A 1XT9B 4GDLA 2JZ3B 1Z5SB 3DBSA 4AUQC 2IYDB 1KJTA 2ASQA 1PQSA 4B6WA 1P1AA 1Z2MA 2KXJA 3PLUA 4LJPB 3WAOA 2JF5A 2K6QA 4IM0A 2KDFB 4IW0A 4E71A 1WX9A 2MBQA 4DBGA 2EMSA 2YVCA 4FHKA 5DPSA 3DVNU 1P9DU 3QX1A 4I6NB 3TMPB 4W9CA 4WJQA 2GBMA 1TBEA 4F1SA 2Z59B 4TQ0A 1WGYA 2G45B 2IO2B 2N1WA 2O6VB 3VUWA 2FIDA 3IG3A 3A1QB 3VHTC 2WWZA 4MM3A 1P98A 2WX0A 3H1UA 2KOXA 5CTRC 1L2NA 3U8ZA 1YX6B 4K7SA 4I6LB 4CO7A 2M8SA 2BKFA 2DZIA 3MTNB 3N32A 2KWUB 2ZJDA 3ZNZB 3CSFA 4FN2A 5CHVC 4IWQA 2UYZB 2BYFA 1VCBA 2KDIA 3H7SA 1WXMA 2GBKA 3ML8A 4M8MA 4PS7A 2C7NB 1V49A 4GDLB 4HDOA 4EZLA 3KYDD 4IWOA 2V4LA 2AL6A 3WA0A 3RZFA 4WWPA 1NI2A 3VUYA 1WFYA 3MJWA 3JW0X 4I6PA 4MJSB 2DAJA 2BYEA 2LRWA 3L10B 5D6JB 3SD5A 4WJNA 2KZRA 1ZW7A 1P3QU 2KK8A 2RSUA 3A4SC 2KD0A 4DHZE 5E6NA 3KW5B 2MBOA 1XQQA 4MH0E 3ALBA 3DBHI 2KFKB 2EMTA 3EECA 3R66C 5JHAA 1J8CA 2DZKA 3ZNGC 3ZUNA 1RAXA 2LVOA 1JRUA 2ZPYA 3W1SC 3WANA 1WMHB 2ZVNA 2ZVOA 2DYBA 3TIXA 1YX5B 2KFKA 1LFDA 4J6IA 5D2MB 2BKRB 2DZMA 2K8CA 4ANUA 4BOSC 4K7UA 3SDLC 1E7UA 1XD3B 2A5UA 2L05A 1WIAA 1R4MI 3DOWA 2MBBB 1YD8U 2ZCCA 4MJSA 4W9LA 5LXHA 1UBQA 1UBIA 4HWIB 4NJ6A 3KUZA 3ZO5B 2XEWA 4AP4C 5J2RA 3L08A 4W9KA 3ZW3A 1KM7A 2PJHA 3JSVA 4EZJA 4N9F4 1GJZA 4TQ1A 1RFAA 2K39A 1NDDA 3LJ3A 2CHWA 2ZPNA 1F9JA 2IO0B 3PSEB 3OJ4B 2KMAA 2LGYA 2MX2A 3PTFC 4WWOA 2AWTA 4FADA 2B3AA 4A3OA 4X57B 1ISNA 1WJNA 1H8CA 4A3PA 2M1MA 2J0MA 4F8CB 2L3ZA 3HK0A 4EZKA 3RUIB 2KKCA 3PRZA 3ONSA 4MSQB 3ZNID 1WR1A 4IC7B 4MDKE 1WGGA 2JWZA 3PS6A 3V62A 1SE9A 3IHPC 4K81A 3VTWA 4G11A 4KDIC 5JH5C 2NBUA 3H7PA 5G2NA 1LQBA 2JUOA 2NR2A 1E8YA 3QQ8B 4NQKE 2I1JA 3HIZA 3ZDMC 3A9KA 4ZDVA 1OEYA 3DDCB 2FCNA 3PT2B 3ZKJC 4B95A 3DVGX 5E6OA 1U4AA 3U7DA 1Q0WB 4W9FA 4W9IA 4XC2A 3APCA 2KFJA 2KC1A 1WF9A 3L13A 2LVPA 2D11A 2DZJA 4JL9A 2BGFA 4DK5A 4FA6A 4EFOA 2KDBA 4ZRJA 2ZNVC 3H7PB 4M8NA 3QK0A 2MA9B 3WAPA 5JHBA 1WJ6A 4LCDE 5CHWA 2JZZA 2N9EB 3EHVA 4WQOB 2LJ5A 2MRPA 2C9WB 1UH6A 1OTRB 4GN1A 2BYVE 2GBJA 2D3GA 4GSWA 5TR5A 4HXDA 1Q5WB 3APDA 3UIOB 3U30A 2KDEB 2O2VB 1WRDB 3S2AA 3VDZA 2JPHA 4BKSD 2WDTB 2PE9A 5DCNA 3O65B 3RZWC 4PYZA 5KHOA 3VAWA 1WGDA 4BBNC 1HE8A 2HD5B 1WJUA 2N4FA 4HCNB 4ZRKA 2NPTB 2M17A 2NS5A 3EFUA 3EC8A 4G3XB 4NPNA 4G50A 1EF5A 5DPTA 1WH3A 2CHZA 4DWFA 1GC6A 2GOWA 3VH4B 1WI0A 3OJ3A 2L0TA 2NPTA 4BKTA 3JVZX 3W1SA 1KOTA 1S1QB 2IO3B 2MP2B 3CF6E 3M62B 1WM3A 3ECIA 1UD7A 2JVCA 5E6PA 3UF8A 3RD2A 4YL8A 3IFWB 3TJPA 4NAWB 3A33B 1WMHA 3PV1A 2L0FA 3HM3A 5CX3A 1V80A 3UGBB 3VQIA 2RD0A 3L54A 4RM9A 2KLGA 1UZXB 4OVVA 1WZ0A 2KHWB 3GZNI 3L0WB 1V6EA 4XZ4A 3WALA 2OOBB 2LGXA 3WIMA 1CMXB 3WAMA 4B9KA 3QWZB 2JRIB 2KNBA 3NOBA 4II3B 4MGZE 4FULA 3ZLZA 2LUEA 3PRMB 1GC7A 2UWQA 4EOYA 2V1YA 4LJOB 3ZRCA 2N7DA 3R7QA 3ENEA 3QAQA 3NY5A 3B0AA 3NZUA 2LXAA 3HHMA 3T8MA 5HKHA 3ZVVA 2Z0DB 2K1FA 1E90A 2FNJB 4HLEA 2ZNVB 5D7GA 3OAWA 5AZGA 1MG8A 1Q1OA 2BF8B 3V61A 3VFKA 4XX5A 4ASWC 2R2OA 1T0YA 4HK2A 1NBFC 4IWPA 4WAAA 2G4SA 3K9PB 2CR5A 3KH0A 1I35A 4HJKA 3VUXA 1KLVA 2O6VD 1OEYJ 3AXCA 4WJPA 2MSED 2HJ8A 1WE6A 3TBLD 1WYWB 1WXAA 1WXSA 3QHTA 4W9JA 1Y8RC 1X1MA 2A4ZA 3QIJA 4K1RB 1C1YB 2I1KA 2FCMA 3DVGY 5JZEB 1SGHA 2KJHB 2PEAA 1WR6E 1WY8A 3QC8B 4FJVB 1I42A 2XK5A 2KWVB 5AZHA 1P0RA 3M3JA 2RR9A 4CHKA 1WX8A 4GDKA 4LDTB 2ZCBA 4NJ7A 2WX1A 4RMAA 2FCSA 1EO6A 2AEHA 2GMIC 3NS8A 3RT3B 1FXTB 5GMVA 1V86A 3ML9A 4MGKE 1EF1A 2DENB 4PS8A 2D10A 2L7RA 2MWSB 2CKHB 4BKGA 2WYQA 4M0WB 2CS4A 4MELA 3C0RB 4E74A 4IM3A 3KVFB 3TCAA 2K8HA 4ANXA 4II2B 1OQYA 4MEMA 2PE6B 4NQLB 4KV2A 2OJRA 3X0WA 3ZTDA 4BVUC 5G55A 5J17A 3DBRI 2KWCA 3QARA 1V5TA 3JYUA 5C1ZA 2L00B 4HDQA 4HVBA 1QZEA 5DPRA 5BO4B 3CMMB 2GBNA 1TTNA 3UINB 3AU5A 4IUMB 2MQJA 1ZGUB 2N1VA 3QJZA 4JGHB 1EUVB 2M0XA 1E8WA 4MSMB 5AZFA 2NCNA 3PVLA 2O2VA 1G6JA 4HPMB 3V60A 5EDSA 2BPSA 4NAWA 2N9PC 1YJ1A 5D94A 3A9JA 2LWPA 3NHEB 4GB9A 2BWES 2V3SA 1C3TA 4NY0A 3DVNV 2FUHB 3ZNHB 2C60A 1WX7A 1V2YA 2YLMA 4KIKA 4ICVA 2QHOA 5CHFA 2CU1A 2KX0A 5C23A 2IY1B 3L16A 3ZTCA 3QA8A 4HPLB 2J0KA 1IP9A 3UQBA 4W9GA 4DHJB 1OGWA 1GUAB 4GGQA 4PS3A 4ZRIA 2IY0B 1WM2A 2MP2A 3PZDA 2O6VA 2K6DB 3D32A 2JT4B 3H6NA 3KUDB 2FIFA 3APFA 3AI5A 1UGMA 2L8JA 1S3SG 2DAFA 2NBVB 3A9JB 4KDLB 4EEWA 1H4RA 4DHZB 4IM2A 3KUCB 2KO3A 1IPGA 1GNUA 2LGDA 2PPHA 4K7WA 1YIWA 3DPDA 3PHXB 4FBJB 4GU2A 2KN5A 3IBEA 2DX5B 4DXAB 2LVQA 3PREA 5IAAC 4G0NB 4GDKB 2KC2A 1R4NI 3L17A 4KSKC 1A5RA 4BFRA 3DBLI 3V6CB 4KZCA 4PYUA 4IG7B 3DCGA 3DQVA 3Q3FA 4BBNF 5AEKB 1K8RB 4GIVA 3TL5A 5J18A 4FLHA 2N9XA 3KYCD 2MBEA 2KJRA 2KX3A 3V6EB 2FCQA 2MLBA 4DHJD 4HCPB 4WJOA 2KMCA 2GBRA 4OVUA 2LRUA 2KANA 1E5WA 1AARA 3AULA 4JLCA 3VH3B 2JY6A 2RGFA 2N7EA 2L76A 4P7IA 5LXIB 4GMVA 3UQAA 4W9HA 2IBIB 4GOCA 3RCZA 4URKA 2XBBC 3JSVB 5L83A 4AOFA 1WE7A 2D2QA 1V9JA 4KSLC 3N3KB 1WXVA 1GG3A 2KVRA 4KIKB 4FJZA 5KHQA 2R2QA 2G4DB 2Y5BB 2REXA 2NVUI 1J19A 4EUTA 1J0GA 1IYFA 4EKUA 2LXCA 2MCNB 2NBWB 1RLFA 2MBHA 2RPQA 4KZ0A 2LASA 2CHXA 3VXWA 3B1LX 3A9KB 3Q3JA 2M4NA 5L95C 2XK5B 2KTRA 3GOEA 2K25A 4KVGB 4FHJA 4MGYE 1LXDA 3PLVA 3QCAA 5LLIA 3K9OB 2LI5A 3IVFA 4W9DA 3CSTA 2MW5A 3PRPB 3OLMD 2HE7A 2AYOB 2DYOA 2VRRB 2LZ6A 3T9LA 4FJYA 3ZIMA 4DDGD 2C7MB 4AJWA 2W9NA 2JRHA 4TKNA 2Z0EB 3N30A 4AWJA 3SU8X 2BWFA 3P2BA 2JXXA 1ZKHA 3BINA 4A20A 1V81A 1D3ZA 1RRBA 1TZ1A 3H9DA 1E7VA 5FR6A 4CYEA 2ZEQA 2EKEC 3UIPB 2LD9A 4ANVA 1SIFA 1TGZB 4AJYB 4NNJB 2J0JA 4TV3A 3VVWB 1VD2A 2DYMA 1WGRA 5DPWA 4W9EA 3A4RA 3VTVA 1WZ3A 1UELA 2DHZA 4LDTD 3B08A 3PHWB 4TUUA 2AL3A 3RULA 4DDID 4JQWC 4BOZB 1BT0A 1WGHA 4GXBA 3R7RA 3NZSA 3A1QA 3LDZE 3M63B 1WJ4A 2IO1B 2J7QB 1E8XA 1V5OA 4WWNA 2KLCA 4RM8A 5IA7A 1YQBA 3VTUA 4E3CA 2C7HA 3PGEA 3SHQA 4ICUA 2KQSA 2KTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3M A;  3MHS D;  3M95 A;  2KTF A;  3PPA A;  4JIO U;  3ZDT A;  2FAZ A;  3X23 A;  2ZZP B;  2D07 B;  4ANW A;  3ZRF A;  2KJ6 A;  3HM6 X;  1L7Y A;  1E8Z A;  3AU4 A;  2HTH A;  3BY4 B;  3RYT A;  4MGI E;  2K8B A;  4F7Z A;  2IZV B;  4ZYN A;  3W1Y A;  2C5L C;  3I3T B;  2G3Q B;  2KQ7 A;  4BKS A;  1LM8 B;  1M94 A;  1XT9 B;  4GDL A;  2JZ3 B;  1Z5S B;  3DBS A;  4AUQ C;  2IYD B;  1KJT A;  2ASQ A;  1PQS A;  4B6W A;  1P1A A;  1Z2M A;  2KXJ A;  3PLU A;  4LJP B;  3WAO A;  2JF5 A;  2K6Q A;  4IM0 A;  2KDF B;  4IW0 A;  4E71 A;  1WX9 A;  2MBQ A;  4DBG A;  2EMS A;  2YVC A;  4FHK A;  5DPS A;  3DVN U;  1P9D U;  3QX1 A;  4I6N B;  3TMP B;  4W9C A;  4WJQ A;  2GBM A;  1TBE A;  4F1S A;  2Z59 B;  4TQ0 A;  1WGY A;  2G45 B;  2IO2 B;  2N1W A;  2O6V B;  3VUW A;  2FID A;  3IG3 A;  3A1Q B;  3VHT C;  2WWZ A;  4MM3 A;  1P98 A;  2WX0 A;  3H1U A;  2KOX A;  5CTR C;  1L2N A;  3U8Z A;  1YX6 B;  4K7S A;  4I6L B;  4CO7 A;  2M8S A;  2BKF A;  2DZI A;  3MTN B;  3N32 A;  2KWU B;  2ZJD A;  3ZNZ B;  3CSF A;  4FN2 A;  5CHV C;  4IWQ A;  2UYZ B;  2BYF A;  1VCB A;  2KDI A;  3H7S A;  1WXM A;  2GBK A;  3ML8 A;  4M8M A;  4PS7 A;  2C7N B;  1V49 A;  4GDL B;  4HDO A;  4EZL A;  3KYD D;  4IWO A;  2V4L A;  2AL6 A;  3WA0 A;  3RZF A;  4WWP A;  1NI2 A;  3VUY A;  1WFY A;  3MJW A;  3JW0 X;  4I6P A;  4MJS B;  2DAJ A;  2BYE A;  2LRW A;  3L10 B;  5D6J B;  3SD5 A;  4WJN A;  2KZR A;  1ZW7 A;  1P3Q U;  2KK8 A;  2RSU A;  3A4S C;  2KD0 A;  4DHZ E;  5E6N A;  3KW5 B;  2MBO A;  1XQQ A;  4MH0 E;  3ALB A;  3DBH I;  2KFK B;  2EMT A;  3EEC A;  3R66 C;  5JHA A;  1J8C A;  2DZK A;  3ZNG C;  3ZUN A;  1RAX A;  2LVO A;  1JRU A;  2ZPY A;  3W1S C;  3WAN A;  1WMH B;  2ZVN A;  2ZVO A;  2DYB A;  3TIX A;  1YX5 B;  2KFK A;  1LFD A;  4J6I A;  5D2M B;  2BKR B;  2DZM A;  2K8C A;  4ANU A;  4BOS C;  4K7U A;  3SDL C;  1E7U A;  1XD3 B;  2A5U A;  2L05 A;  1WIA A;  1R4M I;  3DOW A;  2MBB B;  1YD8 U;  2ZCC A;  4MJS A;  4W9L A;  5LXH A;  1UBQ A;  1UBI A;  4HWI B;  4NJ6 A;  3KUZ A;  3ZO5 B;  2XEW A;  4AP4 C;  5J2R A;  3L08 A;  4W9K A;  3ZW3 A;  1KM7 A;  2PJH A;  3JSV A;  4EZJ A;  4N9F 4;  1GJZ A;  4TQ1 A;  1RFA A;  2K39 A;  1NDD A;  3LJ3 A;  2CHW A;  2ZPN A;  1F9J A;  2IO0 B;  3PSE B;  3OJ4 B;  2KMA A;  2LGY A;  2MX2 A;  3PTF C;  4WWO A;  2AWT A;  4FAD A;  2B3A A;  4A3O A;  4X57 B;  1ISN A;  1WJN A;  1H8C A;  4A3P A;  2M1M A;  2J0M A;  4F8C B;  2L3Z A;  3HK0 A;  4EZK A;  3RUI B;  2KKC A;  3PRZ A;  3ONS A;  4MSQ B;  3ZNI D;  1WR1 A;  4IC7 B;  4MDK E;  1WGG A;  2JWZ A;  3PS6 A;  3V62 A;  1SE9 A;  3IHP C;  4K81 A;  3VTW A;  4G11 A;  4KDI C;  5JH5 C;  2NBU A;  3H7P A;  5G2N A;  1LQB A;  2JUO A;  2NR2 A;  1E8Y A;  3QQ8 B;  4NQK E;  2I1J A;  3HIZ A;  3ZDM C;  3A9K A;  4ZDV A;  1OEY A;  3DDC B;  2FCN A;  3PT2 B;  3ZKJ C;  4B95 A;  3DVG X;  5E6O A;  1U4A A;  3U7D A;  1Q0W B;  4W9F A;  4W9I A;  4XC2 A;  3APC A;  2KFJ A;  2KC1 A;  1WF9 A;  3L13 A;  2LVP A;  2D11 A;  2DZJ A;  4JL9 A;  2BGF A;  4DK5 A;  4FA6 A;  4EFO A;  2KDB A;  4ZRJ A;  2ZNV C;  3H7P B;  4M8N A;  3QK0 A;  2MA9 B;  3WAP A;  5JHB A;  1WJ6 A;  4LCD E;  5CHW A;  2JZZ A;  2N9E B;  3EHV A;  4WQO B;  2LJ5 A;  2MRP A;  2C9W B;  1UH6 A;  1OTR B;  4GN1 A;  2BYV E;  2GBJ A;  2D3G A;  4GSW A;  5TR5 A;  4HXD A;  1Q5W B;  3APD A;  3UIO B;  3U30 A;  2KDE B;  2O2V B;  1WRD B;  3S2A A;  3VDZ A;  2JPH A;  4BKS D;  2WDT B;  2PE9 A;  5DCN A;  3O65 B;  3RZW C;  4PYZ A;  5KHO A;  3VAW A;  1WGD A;  4BBN C;  1HE8 A;  2HD5 B;  1WJU A;  2N4F A;  4HCN B;  4ZRK A;  2NPT B;  2M17 A;  2NS5 A;  3EFU A;  3EC8 A;  4G3X B;  4NPN A;  4G50 A;  1EF5 A;  5DPT A;  1WH3 A;  2CHZ A;  4DWF A;  1GC6 A;  2GOW A;  3VH4 B;  1WI0 A;  3OJ3 A;  2L0T A;  2NPT A;  4BKT A;  3JVZ X;  3W1S A;  1KOT A;  1S1Q B;  2IO3 B;  2MP2 B;  3CF6 E;  3M62 B;  1WM3 A;  3ECI A;  1UD7 A;  2JVC A;  5E6P A;  3UF8 A;  3RD2 A;  4YL8 A;  3IFW B;  3TJP A;  4NAW B;  3A33 B;  1WMH A;  3PV1 A;  2L0F A;  3HM3 A;  5CX3 A;  1V80 A;  3UGB B;  3VQI A;  2RD0 A;  3L54 A;  4RM9 A;  2KLG A;  1UZX B;  4OVV A;  1WZ0 A;  2KHW B;  3GZN I;  3L0W B;  1V6E A;  4XZ4 A;  3WAL A;  2OOB B;  2LGX A;  3WIM A;  1CMX B;  3WAM A;  4B9K A;  3QWZ B;  2JRI B;  2KNB A;  3NOB A;  4II3 B;  4MGZ E;  4FUL A;  3ZLZ A;  2LUE A;  3PRM B;  1GC7 A;  2UWQ A;  4EOY A;  2V1Y A;  4LJO B;  3ZRC A;  2N7D A;  3R7Q A;  3ENE A;  3QAQ A;  3NY5 A;  3B0A A;  3NZU A;  2LXA A;  3HHM A;  3T8M A;  5HKH A;  3ZVV A;  2Z0D B;  2K1F A;  1E90 A;  2FNJ B;  4HLE A;  2ZNV B;  5D7G A;  3OAW A;  5AZG A;  1MG8 A;  1Q1O A;  2BF8 B;  3V61 A;  3VFK A;  4XX5 A;  4ASW C;  2R2O A;  1T0Y A;  4HK2 A;  1NBF C;  4IWP A;  4WAA A;  2G4S A;  3K9P B;  2CR5 A;  3KH0 A;  1I35 A;  4HJK A;  3VUX A;  1KLV A;  2O6V D;  1OEY J;  3AXC A;  4WJP A;  2MSE D;  2HJ8 A;  1WE6 A;  3TBL D;  1WYW B;  1WXA A;  1WXS A;  3QHT A;  4W9J A;  1Y8R C;  1X1M A;  2A4Z A;  3QIJ A;  4K1R B;  1C1Y B;  2I1K A;  2FCM A;  3DVG Y;  5JZE B;  1SGH A;  2KJH B;  2PEA A;  1WR6 E;  1WY8 A;  3QC8 B;  4FJV B;  1I42 A;  2XK5 A;  2KWV B;  5AZH A;  1P0R A;  3M3J A;  2RR9 A;  4CHK A;  1WX8 A;  4GDK A;  4LDT B;  2ZCB A;  4NJ7 A;  2WX1 A;  4RMA A;  2FCS A;  1EO6 A;  2AEH A;  2GMI C;  3NS8 A;  3RT3 B;  1FXT B;  5GMV A;  1V86 A;  3ML9 A;  4MGK E;  1EF1 A;  2DEN B;  4PS8 A;  2D10 A;  2L7R A;  2MWS B;  2CKH B;  4BKG A;  2WYQ A;  4M0W B;  2CS4 A;  4MEL A;  3C0R B;  4E74 A;  4IM3 A;  3KVF B;  3TCA A;  2K8H A;  4ANX A;  4II2 B;  1OQY A;  4MEM A;  2PE6 B;  4NQL B;  4KV2 A;  2OJR A;  3X0W A;  3ZTD A;  4BVU C;  5G55 A;  5J17 A;  3DBR I;  2KWC A;  3QAR A;  1V5T A;  3JYU A;  5C1Z A;  2L00 B;  4HDQ A;  4HVB A;  1QZE A;  5DPR A;  5BO4 B;  3CMM B;  2GBN A;  1TTN A;  3UIN B;  3AU5 A;  4IUM B;  2MQJ A;  1ZGU B;  2N1V A;  3QJZ A;  4JGH B;  1EUV B;  2M0X A;  1E8W A;  4MSM B;  5AZF A;  2NCN A;  3PVL A;  2O2V A;  1G6J A;  4HPM B;  3V60 A;  5EDS A;  2BPS A;  4NAW A;  2N9P C;  1YJ1 A;  5D94 A;  3A9J A;  2LWP A;  3NHE B;  4GB9 A;  2BWE S;  2V3S A;  1C3T A;  4NY0 A;  3DVN V;  2FUH B;  3ZNH B;  2C60 A;  1WX7 A;  1V2Y A;  2YLM A;  4KIK A;  4ICV A;  2QHO A;  5CHF A;  2CU1 A;  2KX0 A;  5C23 A;  2IY1 B;  3L16 A;  3ZTC A;  3QA8 A;  4HPL B;  2J0K A;  1IP9 A;  3UQB A;  4W9G A;  4DHJ B;  1OGW A;  1GUA B;  4GGQ A;  4PS3 A;  4ZRI A;  2IY0 B;  1WM2 A;  2MP2 A;  3PZD A;  2O6V A;  2K6D B;  3D32 A;  2JT4 B;  3H6N A;  3KUD B;  2FIF A;  3APF A;  3AI5 A;  1UGM A;  2L8J A;  1S3S G;  2DAF A;  2NBV B;  3A9J B;  4KDL B;  4EEW A;  1H4R A;  4DHZ B;  4IM2 A;  3KUC B;  2KO3 A;  1IPG A;  1GNU A;  2LGD A;  2PPH A;  4K7W A;  1YIW A;  3DPD A;  3PHX B;  4FBJ B;  4GU2 A;  2KN5 A;  3IBE A;  2DX5 B;  4DXA B;  2LVQ A;  3PRE A;  5IAA C;  4G0N B;  4GDK B;  2KC2 A;  1R4N I;  3L17 A;  4KSK C;  1A5R A;  4BFR A;  3DBL I;  3V6C B;  4KZC A;  4PYU A;  4IG7 B;  3DCG A;  3DQV A;  3Q3F A;  4BBN F;  5AEK B;  1K8R B;  4GIV A;  3TL5 A;  5J18 A;  4FLH A;  2N9X A;  3KYC D;  2MBE A;  2KJR A;  2KX3 A;  3V6E B;  2FCQ A;  2MLB A;  4DHJ D;  4HCP B;  4WJO A;  2KMC A;  2GBR A;  4OVU A;  2LRU A;  2KAN A;  1E5W A;  1AAR A;  3AUL A;  4JLC A;  3VH3 B;  2JY6 A;  2RGF A;  2N7E A;  2L76 A;  4P7I A;  5LXI B;  4GMV A;  3UQA A;  4W9H A;  2IBI B;  4GOC A;  3RCZ A;  4URK A;  2XBB C;  3JSV B;  5L83 A;  4AOF A;  1WE7 A;  2D2Q A;  1V9J A;  4KSL C;  3N3K B;  1WXV A;  1GG3 A;  2KVR A;  4KIK B;  4FJZ A;  5KHQ A;  2R2Q A;  2G4D B;  2Y5B B;  2REX A;  2NVU I;  1J19 A;  4EUT A;  1J0G A;  1IYF A;  4EKU A;  2LXC A;  2MCN B;  2NBW B;  1RLF A;  2MBH A;  2RPQ A;  4KZ0 A;  2LAS A;  2CHX A;  3VXW A;  3B1L X;  3A9K B;  3Q3J A;  2M4N A;  5L95 C;  2XK5 B;  2KTR A;  3GOE A;  2K25 A;  4KVG B;  4FHJ A;  4MGY E;  1LXD A;  3PLV A;  3QCA A;  5LLI A;  3K9O B;  2LI5 A;  3IVF A;  4W9D A;  3CST A;  2MW5 A;  3PRP B;  3OLM D;  2HE7 A;  2AYO B;  2DYO A;  2VRR B;  2LZ6 A;  3T9L A;  4FJY A;  3ZIM A;  4DDG D;  2C7M B;  4AJW A;  2W9N A;  2JRH A;  4TKN A;  2Z0E B;  3N30 A;  4AWJ A;  3SU8 X;  2BWF A;  3P2B A;  2JXX A;  1ZKH A;  3BIN A;  4A20 A;  1V81 A;  1D3Z A;  1RRB A;  1TZ1 A;  3H9D A;  1E7V A;  5FR6 A;  4CYE A;  2ZEQ A;  2EKE C;  3UIP B;  2LD9 A;  4ANV A;  1SIF A;  1TGZ B;  4AJY B;  4NNJ B;  2J0J A;  4TV3 A;  3VVW B;  1VD2 A;  2DYM A;  1WGR A;  5DPW A;  4W9E A;  3A4R A;  3VTV A;  1WZ3 A;  1UEL A;  2DHZ A;  4LDT D;  3B08 A;  3PHW B;  4TUU A;  2AL3 A;  3RUL A;  4DDI D;  4JQW C;  4BOZ B;  1BT0 A;  1WGH A;  4GXB A;  3R7R A;  3NZS A;  3A1Q A;  3LDZ E;  3M63 B;  1WJ4 A;  2IO1 B;  2J7Q B;  1E8X A;  1V5O A;  4WWN A;  2KLC A;  4RM8 A;  5IA7 A;  1YQB A;  3VTU A;  4E3C A;  2C7H A;  3PGE A;  3SHQ A;  4ICU A;  2KQS A;  2KTR B; 
#chains in the Genus database with same CATH topology
 3PPA A;  4JIO U;  3X23 A;  2W55 A;  2KJ6 A;  3HM6 X;  1L7Y A;  3RYT A;  4BZA A;  1F0Z A;  4LNF A;  4RF1 A;  3ZQ4 A;  3W1Y A;  3RPF C;  3I3T B;  1WGK A;  2LGS A;  4BKS A;  2IYD B;  1KJT A;  3HRD D;  3ZGZ A;  1P1A A;  1Z2M A;  3DHI C;  3I5J C;  3WAO A;  2K6Q A;  5HFY A;  1WX9 A;  1OQQ A;  2MBQ A;  2EMS A;  3BII D;  3AEB B;  2BTE A;  1P9D U;  4I6N B;  4A6Q A;  1TBE A;  4F1S A;  5T8I A;  4TQ0 A;  3E9S A;  2O6V B;  3A1Q B;  2WWZ A;  1P98 A;  2KOX A;  2FE8 A;  2BKF A;  3CSF A;  1WXM A;  3ML8 A;  1AN8 A;  4PS7 A;  2C7N B;  2GI9 A;  4GDL B;  4LNN A;  2AL6 A;  2HJ1 A;  1I4G A;  5D6J B;  1FXI A;  3L10 B;  4WJN A;  2RSU A;  1P3Q U;  3VR9 B;  2J53 A;  2M19 A;  2MBO A;  1OQR A;  3ALB A;  1VJK A;  2EMT A;  3EEC A;  1AYF A;  2DZK A;  3ZUN A;  2IGH A;  3DBR B;  1IUE A;  1RAX A;  1JRU A;  3W1S C;  2ZVN A;  2ZVO A;  1YX5 B;  2AQ3 B;  3NZ3 A;  5D2M B;  2A5U A;  4MJS A;  2W3S A;  4A90 A;  2XEW A;  3L08 A;  1KM7 A;  2PJH A;  4TQ1 A;  1RFA A;  1ESF A;  1FM0 D;  2KMA A;  1MFW A;  3PTF C;  2B3A A;  1WSP A;  1WJN A;  2J0M A;  2L3Z A;  3FIL B;  3RUI B;  3NJT A;  2KKC A;  1D5Z C;  4MSQ B;  2JWZ A;  1L0X B;  3V62 A;  3IHP C;  4G11 A;  4KDI C;  3RNE C;  5JH5 C;  3HIZ A;  2DBY A;  4ZDV A;  3DVG X;  2UU7 A;  5E6O A;  5IP4 D;  4W9F A;  2WXG A;  1V97 A;  3APC A;  2KFJ A;  2KC1 A;  4PK1 A;  5BYR A;  3BYT B;  1EWC A;  5JHB A;  1XLN A;  2JZZ A;  2LJ5 A;  5C3J B;  4JE3 B;  2JU6 X;  4WQM A;  1TZO A;  2HDE A;  2XN9 C;  3O65 B;  4RGN A;  1UWM A;  4ZRK A;  2NS5 A;  4NPN A;  1CQV A;  4G50 A;  5DPT A;  4DWF A;  1GC6 A;  3H8H A;  3JVZ X;  4P1C C;  2IO3 B;  1V1O A;  3M62 B;  4ARC A;  4ARI A;  3UGB B;  3VQI A;  3HM3 A;  3BWU D;  2RD0 A;  4B0M A;  1WZ0 A;  3GZN I;  3L0W B;  1CMX B;  3WAM A;  1QT9 A;  1IGD A;  3ZLZ A;  1NEN B;  3PRM B;  3U7Z A;  1GC7 A;  2UWQ A;  3BVZ A;  4EOY A;  3B0A A;  3NZU A;  4MAC A;  5HKH A;  2Z0D B;  1XLO A;  2LGI A;  2LHE A;  3PZ8 A;  1UWX A;  2ZNV B;  3OAW A;  1MG8 A;  3V61 A;  4RF0 A;  1T0Y A;  4HK2 A;  1HXY D;  2CR5 A;  3TEY A;  3VUX A;  2O6V D;  3AEF B;  1OEY J;  4L23 A;  2MSE D;  2WHI A;  1WYW B;  1WXS A;  3QHT A;  1Y8R C;  1X1M A;  4S0R A;  3AH7 A;  5BMI A;  1L0V B;  2XK5 A;  3SFE B;  2VZK D;  1P0R A;  3M3J A;  1XEE A;  4GDK A;  4M01 A;  4M00 A;  5GMV A;  2QMT A;  3EFC A;  1EF1 A;  2KAC A;  4PS8 A;  4XGA B;  2WYQ A;  1F2R C;  4MEL A;  3TCA A;  3KVF B;  1JCK B;  2K8H A;  2J52 A;  1OQY A;  2LUM A;  4WAF A;  4NQL B;  3MC0 B;  5J17 A;  5C1Z A;  4K3C A;  2WU5 B;  4IUM B;  2MQJ A;  3QJZ A;  1GB1 A;  2M0X A;  1R4N B;  1E8W A;  4XE0 A;  4ITK A;  4D2K A;  4MSM B;  2NCN A;  5HHD G;  1G6J A;  1C78 A;  1F52 A;  2N9P C;  1QQR A;  1RFK A;  1C3T A;  2FUH B;  3ZNH B;  3Q14 C;  2YLM A;  5CHF A;  3N1X C;  4HPL B;  3UQB A;  4W9G A;  1SXT A;  1GUA B;  2Y5P A;  4WH4 A;  3PZD A;  2O6V A;  2W54 A;  3AI5 A;  1UGM A;  2L8J A;  2DAF A;  3A9J B;  1H4R A;  4DHZ B;  3AM9 A;  1IPG A;  2LGD A;  4S17 A;  1PFD A;  4K7W A;  3DPD A;  4GU2 A;  1YJJ A;  2LVQ A;  4G0N B;  1J7B A;  4KSK C;  3L17 A;  1HZ6 A;  1CZP A;  3V6C B;  4BAX A;  1ZXH A;  3T3N A;  2WXH A;  1T0S C;  2INP E;  1F1H A;  2VH2 A;  2N9X A;  5BYQ A;  3V6E B;  4OVU A;  2LRU A;  3AUL A;  1AAR A;  1TY0 A;  2IBI B;  4URK A;  3ZXV A;  2BBC A;  3T3O A;  1YOV B;  1T0Q C;  1XLQ A;  1V9J A;  4KSL C;  4MM3 B;  1WXV A;  2KVR A;  5KHQ A;  2R2Q A;  3OG5 A;  1IYF A;  4DQO C;  1NI3 A;  4EKU A;  1XCT L;  2MCN B;  2NBW B;  4JPS A;  2K25 A;  1LXD A;  3QCA A;  3GE8 C;  4N58 A;  1SF0 A;  2BQQ A;  5TSS A;  2HE7 A;  1Q10 A;  1TKE A;  2DYO A;  2MJE A;  2VRR B;  3T9L A;  3ZIM A;  1C77 A;  1P7E A;  4YSZ B;  3N30 A;  3IAM 1;  1OFF A;  1RRB A;  1E7V A;  3Q8B A;  2EKE C;  3V3X A;  4AJY B;  5AUK A;  4TV3 A;  5IN7 A;  1TJE A;  2RDH A;  1V1P A;  4K3B A;  4TUU A;  3B08 A;  4BOZ B;  1FPY A;  1WGH A;  4GXB A;  3NZS A;  1PDX A;  2IO1 B;  4WWN A;  5IA7 A;  1K52 A;  4E3C A;  4AS1 A;  1YNT E;  3PGE A;  1EU4 A;  4RGO S;  4AQ7 A;  3MHS D;  3MP9 A;  3ZDT A;  3Q8C A;  2ZZP B;  2D07 B;  3AU4 A;  3BY4 B;  4TSS A;  5GXG B;  4MGI E;  2K8B A;  1MJD A;  1YN4 A;  3R2T A;  2QIE B;  3RFZ B;  1XF5 L;  1SSN A;  1NYQ A;  1M94 A;  5BMH A;  3N1Z C;  3RI7 C;  5D3I B;  4B6W A;  4LJP B;  2JF5 A;  2K3U A;  1JWM D;  3NVW A;  4DBG A;  5DPS A;  1IBX A;  4W9C A;  4WJQ A;  2IO2 B;  3AEG B;  2FID A;  2WX0 A;  1HA5 A;  1UUP A;  1L2N A;  5CTR C;  4I6L B;  1FNU A;  1F77 A;  3MTN B;  2ZJD A;  3ZNZ B;  2UYZ B;  2BYF A;  2KDI A;  3H7S A;  4HDO A;  4EZL A;  3KYD D;  4IWO A;  3WA0 A;  3RZF A;  1GB4 A;  4WWP A;  3JW0 X;  3SD5 A;  4HEA 1;  2KZR A;  3A4S C;  1JW9 D;  5E6N A;  3KW5 B;  1WWT A;  1PGX A;  4MH0 E;  5G5H A;  3DBH I;  1LO5 D;  1K53 A;  3ZNG C;  2LVO A;  3GB1 A;  1GOZ A;  1WMH B;  1LFD A;  4YTN B;  3AE7 B;  4ANU A;  3AEE B;  1R4M I;  5LXH A;  1YD8 U;  2ZCC A;  1FCL A;  4IKG A;  4NJ6 A;  4HWI B;  1UBI A;  1R7S A;  3KUZ A;  4AP4 C;  5J2R A;  2J42 A;  3P4S B;  4W9K A;  4N9F 4;  2K39 A;  3P4Q B;  3ZYY X;  2OED A;  2ZPN A;  3PSE B;  1PGB A;  2LGY A;  4OZB A;  4A3O A;  2L83 A;  1ET6 A;  1H8C A;  4A3P A;  3NVZ A;  1WYG A;  2ON8 A;  4F8C B;  4ZRP A;  3Q3O C;  3PRZ A;  2QSD A;  3ONS A;  3ZNI D;  1WR1 A;  3MC8 A;  2KDM A;  4MDK E;  3PS6 A;  2SEB D;  2M56 B;  2K9X A;  3VTW A;  2JZP A;  2MH7 A;  3H7P A;  1LQB A;  2I1J A;  3Q8E A;  3A9K A;  1OEY A;  3ETR A;  4B95 A;  1QLB B;  3URY A;  3IT6 B;  1SEB D;  2WP9 B;  4XC2 A;  1YQ3 B;  1WF9 A;  3L13 A;  4FA6 A;  3PO0 A;  3QK0 A;  2MA9 B;  5CHW A;  2ZW0 A;  1F2R I;  4WQO B;  5H92 C;  3SEB A;  4HXD A;  1Q5W B;  3APD A;  2NTT A;  2KDE B;  2BB5 A;  3S2A A;  2JPH A;  2PE9 A;  2KN4 A;  2GRI A;  2AQ2 B;  3AN1 A;  1K50 A;  1HE8 A;  4HCN B;  2N4F A;  1YN5 A;  2M17 A;  3KLS X;  1N5X A;  2L0T A;  2LMC A;  4BKT A;  5HG2 A;  1S1Q B;  3KWV A;  1QIL A;  4YL8 A;  3IFW B;  4ZYS A;  1WMH A;  3PV1 A;  1D4B A;  5CX3 A;  1JAL A;  1TS3 A;  3L54 A;  3LB8 C;  2KLG A;  1CJE A;  1C4P A;  2VH1 A;  1VZ8 A;  3B9J A;  1SE2 A;  2KHW B;  3WAL A;  4B9K A;  1JWA D;  2LGX A;  1MHX A;  3QWZ B;  2KNB A;  4II3 B;  1UGJ A;  2RDB C;  4LJO B;  2BT6 A;  2N7D A;  3ENE A;  4C80 A;  3NUH B;  3T8M A;  3U2S C;  1SJH D;  4KX6 B;  5D7G A;  2L52 A;  2BF8 B;  1Q1O A;  3VFK A;  4XX5 A;  4PT5 A;  2R2O A;  1KF6 B;  1TYG B;  4WJP A;  2KVZ A;  4K1R B;  2WDQ B;  1C1Y B;  2LHD A;  2E3T A;  2KJH B;  3QC8 B;  2KT7 A;  1I42 A;  4OHJ A;  2W3R A;  1WX8 A;  1V8C A;  4NJ7 A;  2N0S B;  2GMI C;  1EO6 A;  2AEH A;  2X38 A;  4MGK E;  2DEN B;  4YTP B;  2D10 A;  3AE5 B;  2L7R A;  2CKH B;  2DLB A;  2MWS B;  4R3D A;  4WWM A;  1TT5 B;  4MEM A;  3Q3N C;  2OJR A;  4J3O D;  3ZTD A;  2WDV B;  2KWC A;  3QAR A;  4HVB A;  2X8X X;  1QZE A;  5DPR A;  3AEA B;  1TTN A;  1ZGU B;  1C79 A;  1EUV B;  1FEH A;  4LNI A;  2RPV A;  3J9C A;  2BWE S;  4NY0 A;  1WX7 A;  3NG0 A;  1YMH E;  5HI1 A;  5C23 A;  2KX0 A;  3QA8 A;  2INC C;  2J0K A;  1IP9 A;  3SFD B;  3VRB B;  1DYQ A;  2IY0 B;  1WM2 A;  3W5V B;  3D32 A;  3APF A;  5LNK 1;  1HZ5 A;  2BVC A;  1S3S G;  2NBV B;  4MT5 A;  4KDL B;  3P63 A;  4IM2 A;  2AQ1 B;  2KO3 A;  4C00 A;  2KQ4 X;  3TEW A;  2INN E;  3PHX B;  3WCQ A;  2DX5 B;  4ZHP A;  5IAA C;  1SE4 A;  4GDK B;  4BFR A;  4KZC A;  2KYW A;  3Q2A C;  4RNA A;  2HTM E;  3MJ5 A;  4BBN F;  3BVM A;  2XNA C;  4GIV A;  3KYC D;  2G9H D;  2MBE A;  2FCQ A;  4HCP B;  2KMC A;  2GBR A;  4JLC A;  1E5W A;  2V0G A;  2NMQ A;  2N7E A;  4P7I A;  4LNO A;  3UQA A;  4GOC A;  4JWS C;  5L83 A;  3JSV B;  4AOF A;  1BML C;  3FC4 A;  4FJZ A;  1T6B X;  2NVU I;  1VR9 A;  4EUT A;  5FK9 C;  4KZ0 A;  1L4D B;  3VXW A;  4HKQ A;  1AW7 A;  5L95 C;  2KTR A;  4MGY E;  2FBW B;  1JML A;  1MI0 A;  3PLV A;  3VR8 B;  2LI5 A;  3SR6 A;  3CST A;  3PRP B;  4FJY A;  4TKN A;  1L4Z B;  3W9C B;  3SU8 X;  2BWF A;  2V9H A;  2JXX A;  1ZKH A;  2KWD A;  1D3Z A;  1TZ1 A;  4CYE A;  2ZEQ A;  1ZP0 B;  3UIP B;  3C19 A;  5G5G A;  4ANV A;  2J0J A;  1VD2 A;  4C7Z A;  5DPW A;  2QC8 A;  1UEL A;  1TS5 A;  2RMM A;  4JQW C;  3Q69 A;  4RH6 A;  3RNA C;  3I57 A;  3R8B A;  3M63 B;  2J7Q B;  1E8X A;  2KLC A;  1QOA A;  1YQB A;  1I4Q A;  3VTU A;  3HVD A;  5FR3 A;  2C7H A;  2BYT A;  2IPK D;  2KTR B;  1EF5 A;  2IJ0 A;  2WXF A;  2BW2 A;  2KTF A;  3Q8A A;  3HUI A;  2FAZ A;  3UI3 A;  3ZRF A;  1XLP A;  2HTH A;  1FIQ A;  2EEL A;  1N6Z A;  1TS4 A;  4ZYN A;  2C5L C;  1DOY A;  2G3Q B;  4QAY A;  2OJW A;  1LM8 B;  1XT9 B;  4AUQ C;  4GDL A;  2JZ3 B;  1KLG D;  2WXK A;  2ASQ A;  3E56 A;  3PZ7 A;  2MJD A;  3PLU A;  3TUO A;  4IM0 A;  1N62 A;  4E71 A;  1SJE D;  3N20 C;  4FHK A;  1I4P A;  3KQ4 A;  4OZC A;  3QX1 A;  3DBL B;  2BS3 B;  2JXT A;  3TMP B;  2GBM A;  2Z59 B;  4KKI A;  2N1W A;  3VUW A;  3W2D A;  3CWI A;  3VHT C;  4MM3 A;  4WIP A;  4GLS C;  3IAS 1;  3H1U A;  2IDY A;  3U8Z A;  1YX6 B;  2M8S A;  3RN9 C;  4C56 C;  4JX1 C;  2KWU B;  3W5U B;  4IWQ A;  1RWS A;  2KAJ A;  3DBH B;  1SE3 A;  2GBK A;  4M8M A;  1V49 A;  2WLB A;  2LEK A;  3VUY A;  1WFY A;  3MJW A;  4MJS B;  2BYE A;  2LRW A;  2KK8 A;  4LNK A;  2V3N A;  2KFK B;  5JHA A;  3R66 C;  4C7Y A;  1LGR A;  5IKC M;  2ZPY A;  3WAN A;  3Q6B A;  2KFK A;  4P1B C;  4J6I A;  1ACC A;  2L32 A;  2DZM A;  2K8C A;  4BOS C;  1E7U A;  4CQN A;  4LTU A;  1WIA A;  4XWW A;  4W9L A;  1FMA D;  3ZO5 B;  3ZW3 A;  3JSV A;  2CJN A;  1NDD A;  3LJ3 A;  1SIJ A;  3OJ4 B;  1D6E C;  4WWO A;  4FAD A;  4KGR A;  4X57 B;  1ISN A;  1ZPS A;  2M1M A;  1UF0 A;  4EZK A;  2PVO D;  4XWT A;  4IC7 B;  2G1E A;  1WGG A;  2NBU A;  2JUO A;  1HTQ A;  2NR2 A;  3QQ8 B;  4YTM B;  1E10 A;  3NVV A;  4MH8 A;  2FCN A;  3PT2 B;  1U4A A;  4N59 A;  2BB6 A;  4N6E B;  3DHH C;  4RGM A;  4W9I A;  2D5G A;  1TKG A;  3Q8F A;  1XXG A;  2DZJ A;  2LVP A;  4JL9 A;  2BGF A;  4DK5 A;  3RNG C;  4EFO A;  5AUI A;  4ZRJ A;  2ZNV C;  1WJ6 A;  4LCD E;  1ZUD 2;  2I38 A;  2WXP A;  1XO3 A;  2MRP A;  1OTR B;  1UH6 A;  3RNC C;  2BYV E;  1T0R C;  5TR5 A;  1E6E B;  4RCO A;  3UIO B;  3U30 A;  2O2V B;  4EE2 A;  3P1M A;  3AE2 B;  1RM6 C;  2N7J A;  2IGG A;  3VDZ A;  2WDT B;  3RZW C;  3MC9 A;  4TMA B;  4PYZ A;  3AE1 B;  1EU3 A;  4XDD A;  3RNB C;  4BBN C;  3B2F A;  1WJU A;  1C76 A;  3EFU A;  4A9A A;  4G3X B;  2I2Y A;  4XYC A;  3BZD B;  1WI0 A;  3EUB 2;  3OJ3 A;  1KOT A;  1HQR D;  3DHG C;  2MP2 B;  1UD7 A;  5E6P A;  4NAW B;  2L0F A;  4OVV A;  2D3C A;  1KH0 A;  1V6E A;  4XZ4 A;  2DNF A;  3WIM A;  2ACZ B;  4MGZ E;  2N9K A;  2LUE A;  3IXS A;  1D5M C;  4DXG A;  1B9R A;  1I4X A;  1FO4 A;  3FKY A;  3HHM A;  1YQ4 B;  2K22 A;  1E90 A;  1C4C A;  2FNJ B;  2Z8L A;  3C8Y A;  3AMZ A;  3EGR A;  3LYY A;  3U4E G;  1J7A A;  3U52 E;  5JXV A;  4ZOH C;  4ASW C;  1NBF C;  4WAA A;  2G4S A;  2H89 B;  1ENF A;  1I35 A;  4HJK A;  1NEK B;  2HJ8 A;  1WE6 A;  3TBL D;  3RMK C;  1KLU D;  1SBB B;  4IOI E;  4HKZ E;  4M02 A;  3BK2 A;  2I1K A;  1FFU A;  3N1Y C;  5JZE B;  1SGH A;  3P4P B;  5BMG A;  3GP7 A;  1WY8 A;  2PKO A;  2JQR B;  1BXT A;  5AZH A;  3Q3M C;  4LDT B;  2WX1 A;  4RMA A;  3NS8 A;  3RT3 B;  1FXT B;  3L4P A;  1V86 A;  3ML9 A;  3N9Y C;  1R4M B;  1KRH A;  4M0W B;  2CS4 A;  3C0R B;  4E74 A;  2PE6 B;  4KV2 A;  1DOX A;  1ZDV A;  4M0W A;  5G55 A;  1V5T A;  3JYU A;  2L00 B;  4HDQ A;  2JYT A;  2M0A A;  3CMM B;  5BO4 B;  2GBN A;  2WXN A;  3AU5 A;  4C4V B;  2Y3A A;  3I9V 1;  2L1A A;  2ZW1 A;  4JWU C;  5BYS A;  2PW9 A;  1FFV A;  5EDS A;  2BPS A;  4NAW A;  5D94 A;  3A9J A;  3NHE B;  2V3S A;  3B2G A;  1V2Y A;  2JYE A;  4ICV A;  1VRA B;  5IOI A;  3BYY B;  2IY1 B;  3L16 A;  5D3D A;  1BUI C;  4DHJ B;  1OGW A;  4GGQ A;  1ET9 A;  4ZRI A;  1RYJ A;  2K6D B;  2FIF A;  2ICI A;  1MHH E;  2JWU A;  1TS2 A;  4EEW A;  1ZXI A;  3KUC B;  1L6U A;  2PPH A;  1NVI D;  2Q5W D;  1YIW A;  4ZRQ A;  4FBJ B;  2KN5 A;  3V05 A;  4DXA B;  3PRE A;  1R4N I;  1GAQ B;  3ZJT A;  3AEC B;  3EA6 A;  5J18 A;  1EWY C;  2MLB A;  3O13 A;  4WJO A;  3KWL A;  3AE9 B;  3AE4 B;  2JY6 A;  5LXI B;  4GMV A;  3RCZ A;  4HPP A;  1GG3 A;  2G4D B;  2Y5B B;  1EM7 A;  1J19 A;  3DWM A;  2E6X A;  2LXC A;  2WXQ A;  1RLF A;  2LFI A;  2RPQ A;  2YEP B;  1FXA A;  2CHX A;  2LAS A;  4REZ A;  3B1L X;  3A9K B;  3Q3J A;  1I4H A;  2XK5 B;  1JQ4 A;  1QOB A;  2WU2 B;  4DXF A;  2PVG C;  4A55 A;  1HTO A;  4W9D A;  2MW5 A;  5IO9 A;  2W82 A;  2LZ6 A;  2MHJ A;  1KTK A;  2C7M B;  4AJW A;  4DDG D;  4NAM A;  4AWJ A;  1AWD A;  4A20 A;  3H9D A;  2WXO A;  5FR6 A;  4ACF A;  2WXJ A;  1SIF A;  2SAK A;  1PGA A;  1C4A A;  1WGR A;  3A4R A;  5H8Y E;  3LXF A;  3RUL A;  4DDI D;  1CK1 A;  4FXC A;  1BT0 A;  1DOI A;  4YT0 B;  1FD6 A;  1V5O A;  1L5P A;  4RM8 A;  2QJL A;  2FUG 1;  1N60 A;  2KQS A;  2WXR A;  3R3M A;  3M95 A;  4ANW A;  5EE1 A;  1Y56 A;  1E8Z A;  1MVK A;  1C9F A;  4F7Z A;  2IZV B;  2CJO A;  2D3A A;  2KQ7 A;  1I4R A;  2QDF A;  1Z5S B;  3DBS A;  1FNW A;  2JSV X;  1PQS A;  2KXJ A;  1WXQ A;  2KDF B;  4IW0 A;  4LK0 M;  2GB1 A;  2QEJ C;  2YVC A;  1N61 A;  5EE3 A;  2DWQ A;  3DVN U;  2PIA A;  4KKJ A;  3FAH A;  3VRA B;  1J7C A;  1WGY A;  2G45 B;  3AV8 A;  3IG3 A;  1VDV A;  1L0Y B;  1B1Z A;  3GS2 A;  1V1P B;  4K7S A;  4CO7 A;  2DZI A;  3N32 A;  4FN2 A;  5CHV C;  2MJ3 A;  1VCB A;  4YSX B;  4YSY B;  1TKY A;  2YEP F;  1FNV A;  2V4L A;  3NVY A;  1NI2 A;  4I6P A;  2DAJ A;  1ZW7 A;  2KD0 A;  4DHZ E;  3AED B;  4O1N A;  1XQQ A;  5I4D A;  3TSS A;  1TY2 A;  1J8C A;  3I63 C;  2K0P A;  2IND C;  1N5W A;  2DYB A;  3TIX A;  2BKR B;  4K7U A;  1FRR A;  1STE A;  1QOF A;  3SDL C;  1XD3 B;  1TIF A;  2L05 A;  4NJC A;  3DOW A;  2MBB B;  3MHZ A;  1UBQ A;  5EE9 A;  2KMM A;  5E6J A;  4EZJ A;  1GJZ A;  2Y5C A;  2CHW A;  1F9J A;  1JWU D;  2IO0 B;  4L1B A;  2MX2 A;  3AB5 A;  2AWT A;  2JX5 A;  3HK0 A;  2PTL A;  5FKA C;  4H2A A;  1SE9 A;  4K81 A;  4P16 A;  3GE3 C;  1JRP A;  5G2N A;  1E8Y A;  5EE0 A;  4NQK E;  1YN3 A;  3ZDM C;  4ZHO A;  3DDC B;  3ZKJ C;  2R61 A;  2N9L A;  4YWG G;  3U7D A;  3BK1 A;  1Q0W B;  3ZJV A;  2D11 A;  2H88 B;  4US9 A;  2KDB A;  3H7P B;  4M8N A;  3WAP A;  3OWE B;  4XDC A;  2QIL A;  1T3Q A;  2BS4 B;  1K51 A;  2N9E B;  3EHV A;  2LJI A;  2C9W B;  1PYW D;  4GN1 A;  2GBJ A;  1XCQ L;  2D3G A;  4GSW A;  4HRS A;  1L6V A;  1WRD B;  4OVZ A;  4KGS A;  4BKS D;  5DCN A;  3NRZ A;  5KHO A;  3VAW A;  1WGD A;  3ZJU A;  2HD5 B;  2NPT B;  3EC8 A;  3AE6 B;  4L2Y A;  1WH3 A;  2CHZ A;  4OZA A;  2GOW A;  3VH4 B;  2GLS A;  3P4R B;  2NPT A;  1PUT A;  1VZ6 A;  2OHF A;  3W1S A;  3CF6 E;  1I7H A;  1WM3 A;  3ECI A;  2JVC A;  3UF8 A;  3RD2 A;  3TJP A;  3A33 B;  1V80 A;  1N63 A;  4RM9 A;  1UZX B;  1QF6 A;  4HJG E;  1UNS A;  3P42 A;  1QKZ A;  1JWS D;  2OOB B;  1ZOY B;  2JRI B;  2NTS A;  3NOB A;  4FUL A;  1M4V A;  2V1Y A;  3FIL A;  3ZRC A;  1ROE A;  3R7Q A;  3QAQ A;  3NY5 A;  1GPX A;  2LXA A;  1D5X C;  2WQY B;  3HVZ A;  3ZVV A;  4LLG M;  2K1F A;  4HLE A;  4IDI A;  5AZG A;  2PMV A;  2QCZ A;  4IWP A;  3BVG A;  3IT4 B;  3K9P B;  3KH0 A;  1KLV A;  3AXC A;  1VZ7 A;  4HRO A;  1WXA A;  4W9J A;  2A4Z A;  3QIJ A;  1YJI A;  1E7P B;  2FCM A;  3DVG Y;  1MG4 A;  2PEA A;  1WR6 E;  4FJV B;  4OW0 A;  1IBX B;  3DWG C;  3AE3 B;  2K5P A;  2KWV B;  3NS1 A;  1IGC A;  4B0E A;  2RR9 A;  4CHK A;  3GZN B;  2ZCB A;  1FCC C;  2FCS A;  1E9M A;  4USA A;  3ZXR A;  4BKG A;  4RGT A;  4NZL B;  4IM3 A;  4YXD B;  4ANX A;  4II2 B;  2WS3 B;  2WGS A;  1WRI A;  1SB3 C;  1HEZ E;  3X0W A;  4BVU C;  3DBR I;  2TSS A;  4UDU C;  2V3P A;  5MPO A;  1MPE A;  3UIN B;  3R2I A;  1A70 A;  2N1V A;  4JGH B;  2D3B A;  2IGD A;  5AZF A;  3PVL A;  2O2V A;  2MEK A;  4HPM B;  3V60 A;  1YJ1 A;  2LWP A;  1JRO A;  3MFG A;  4GB9 A;  3DVN V;  1FRD A;  1P7F A;  2C60 A;  4KIK A;  2QHO A;  2CU1 A;  3ZTC A;  4P6V F;  2WXI A;  4Q2J A;  1QOG A;  1E0Z A;  4PS3 A;  2WXM A;  3AE8 B;  2MP2 A;  1DGJ A;  2JT4 B;  3H6N A;  3KUD B;  1GNU A;  2PLP A;  1ZE3 D;  2CU3 A;  3IBE A;  2KC2 A;  1A5R A;  3TEX A;  2ONQ A;  3DBL I;  4PYU A;  4IG7 B;  2BS2 B;  3CIR B;  3DCG A;  3DQV A;  3Q3F A;  5AEK B;  1K8R B;  3TL5 A;  4FLH A;  2KJR A;  2KX3 A;  4DHJ D;  2KAN A;  3VH3 B;  2RGF A;  2L76 A;  4A8X C;  4W9H A;  2RDG A;  2XBB C;  1KFY B;  1WE7 A;  2D2Q A;  2WDR B;  3N3K B;  4KIK B;  2REX A;  1J0G A;  1T5X D;  2MBH A;  2WNM A;  2M4N A;  3GOE A;  2V4I B;  4KVG B;  4FHJ A;  5LLI A;  3K9O B;  3IVF A;  2J4X A;  3OLM D;  3ABV B;  2AYO B;  2W9N A;  2JRH A;  2Z0E B;  3P2B A;  1JWB D;  3BIN A;  3TEZ A;  1V81 A;  4KGT A;  2LD9 A;  5C2T B;  1TGZ B;  2WXL A;  1NYR A;  4NNJ B;  3RNF C;  4US8 A;  3VVW B;  2DYM A;  2B76 B;  4W9E A;  2VZK B;  3VTV A;  1WZ3 A;  2EKI A;  2DHZ A;  2AX5 A;  4LDT D;  3PHW B;  4WUR A;  2AL3 A;  1ZDX A;  3R7R A;  3A1Q A;  3LDZ E;  1WJ4 A;  4C4V A;  3SHQ A;  4RFB A;  4ICU A;  1VLB A; 
#chains in the Genus database with same CATH homology
 3R3M A;  3MHS D;  3M95 A;  2KTF A;  3PPA A;  4JIO U;  3ZDT A;  2FAZ A;  3X23 A;  2ZZP B;  2D07 B;  4ANW A;  3ZRF A;  2KJ6 A;  3HM6 X;  1L7Y A;  1E8Z A;  3AU4 A;  2HTH A;  3BY4 B;  3RYT A;  4MGI E;  2K8B A;  4F7Z A;  2IZV B;  4ZYN A;  3W1Y A;  2C5L C;  3I3T B;  2G3Q B;  2KQ7 A;  4BKS A;  1LM8 B;  1M94 A;  1XT9 B;  4GDL A;  2JZ3 B;  1Z5S B;  3DBS A;  4AUQ C;  2IYD B;  1KJT A;  2ASQ A;  1PQS A;  4B6W A;  1P1A A;  1Z2M A;  2KXJ A;  3PLU A;  4LJP B;  3WAO A;  2JF5 A;  2K6Q A;  4IM0 A;  2KDF B;  4IW0 A;  4E71 A;  1WX9 A;  2MBQ A;  4DBG A;  2EMS A;  2YVC A;  4FHK A;  5DPS A;  3DVN U;  1P9D U;  3QX1 A;  4I6N B;  3TMP B;  4W9C A;  4WJQ A;  2GBM A;  1TBE A;  4F1S A;  2Z59 B;  4TQ0 A;  1WGY A;  2G45 B;  2IO2 B;  2N1W A;  2O6V B;  3VUW A;  2FID A;  3IG3 A;  3A1Q B;  3VHT C;  2WWZ A;  4MM3 A;  1P98 A;  2WX0 A;  3H1U A;  2KOX A;  5CTR C;  1L2N A;  3U8Z A;  1YX6 B;  4K7S A;  4I6L B;  4CO7 A;  2M8S A;  2BKF A;  2DZI A;  3MTN B;  3N32 A;  2KWU B;  2ZJD A;  3ZNZ B;  3CSF A;  4FN2 A;  5CHV C;  4IWQ A;  2UYZ B;  2BYF A;  1VCB A;  2KDI A;  3H7S A;  1WXM A;  2GBK A;  3ML8 A;  4M8M A;  4PS7 A;  2C7N B;  1V49 A;  4GDL B;  4HDO A;  4EZL A;  3KYD D;  4IWO A;  2V4L A;  2AL6 A;  3WA0 A;  3RZF A;  4WWP A;  1NI2 A;  3VUY A;  1WFY A;  3MJW A;  3JW0 X;  4I6P A;  4MJS B;  2DAJ A;  2BYE A;  2LRW A;  3L10 B;  5D6J B;  3SD5 A;  4WJN A;  2KZR A;  1ZW7 A;  1P3Q U;  2KK8 A;  2RSU A;  3A4S C;  2KD0 A;  4DHZ E;  5E6N A;  3KW5 B;  2MBO A;  1XQQ A;  4MH0 E;  3ALB A;  3DBH I;  2KFK B;  2EMT A;  3EEC A;  3R66 C;  5JHA A;  1J8C A;  2DZK A;  3ZNG C;  3ZUN A;  1RAX A;  2LVO A;  1JRU A;  2ZPY A;  3W1S C;  3WAN A;  1WMH B;  2ZVN A;  2ZVO A;  2DYB A;  3TIX A;  1YX5 B;  2KFK A;  1LFD A;  4J6I A;  5D2M B;  2BKR B;  2DZM A;  2K8C A;  4ANU A;  4BOS C;  4K7U A;  3SDL C;  1E7U A;  1XD3 B;  2A5U A;  2L05 A;  1WIA A;  1R4M I;  3DOW A;  2MBB B;  1YD8 U;  2ZCC A;  4MJS A;  4W9L A;  5LXH A;  1UBQ A;  1UBI A;  4HWI B;  4NJ6 A;  3KUZ A;  3ZO5 B;  2XEW A;  4AP4 C;  5J2R A;  3L08 A;  4W9K A;  3ZW3 A;  1KM7 A;  2PJH A;  3JSV A;  4EZJ A;  4N9F 4;  1GJZ A;  4TQ1 A;  1RFA A;  2K39 A;  1NDD A;  3LJ3 A;  2CHW A;  2ZPN A;  1F9J A;  2IO0 B;  3PSE B;  3OJ4 B;  2KMA A;  2LGY A;  2MX2 A;  3PTF C;  4WWO A;  2AWT A;  4FAD A;  2B3A A;  4A3O A;  4X57 B;  1ISN A;  1WJN A;  1H8C A;  4A3P A;  2M1M A;  2J0M A;  4F8C B;  2L3Z A;  3HK0 A;  4EZK A;  3RUI B;  2KKC A;  3PRZ A;  3ONS A;  4MSQ B;  3ZNI D;  1WR1 A;  4IC7 B;  4MDK E;  1WGG A;  2JWZ A;  3PS6 A;  3V62 A;  1SE9 A;  3IHP C;  4K81 A;  3VTW A;  4G11 A;  4KDI C;  5JH5 C;  2NBU A;  3H7P A;  5G2N A;  1LQB A;  2JUO A;  2NR2 A;  1E8Y A;  3QQ8 B;  4NQK E;  2I1J A;  3HIZ A;  3ZDM C;  3A9K A;  4ZDV A;  1OEY A;  3DDC B;  2FCN A;  3PT2 B;  3ZKJ C;  4B95 A;  3DVG X;  5E6O A;  1U4A A;  3U7D A;  1Q0W B;  4W9F A;  4W9I A;  4XC2 A;  3APC A;  2KFJ A;  2KC1 A;  1WF9 A;  3L13 A;  2LVP A;  2D11 A;  2DZJ A;  4JL9 A;  2BGF A;  4DK5 A;  4FA6 A;  4EFO A;  2KDB A;  4ZRJ A;  2ZNV C;  3H7P B;  4M8N A;  3QK0 A;  2MA9 B;  3WAP A;  5JHB A;  1WJ6 A;  4LCD E;  5CHW A;  2JZZ A;  2N9E B;  3EHV A;  4WQO B;  2LJ5 A;  2MRP A;  2C9W B;  1UH6 A;  1OTR B;  4GN1 A;  2BYV E;  2GBJ A;  2D3G A;  4GSW A;  5TR5 A;  4HXD A;  1Q5W B;  3APD A;  3UIO B;  3U30 A;  2KDE B;  2O2V B;  1WRD B;  3S2A A;  3VDZ A;  2JPH A;  4BKS D;  2WDT B;  2PE9 A;  5DCN A;  3O65 B;  3RZW C;  4PYZ A;  5KHO A;  3VAW A;  1WGD A;  4BBN C;  1HE8 A;  2HD5 B;  1WJU A;  2N4F A;  4HCN B;  4ZRK A;  2NPT B;  2M17 A;  2NS5 A;  3EFU A;  3EC8 A;  4G3X B;  4NPN A;  4G50 A;  1EF5 A;  5DPT A;  1WH3 A;  2CHZ A;  4DWF A;  1GC6 A;  2GOW A;  3VH4 B;  1WI0 A;  3OJ3 A;  2L0T A;  2NPT A;  4BKT A;  3JVZ X;  3W1S A;  1KOT A;  1S1Q B;  2IO3 B;  2MP2 B;  3CF6 E;  3M62 B;  1WM3 A;  3ECI A;  1UD7 A;  2JVC A;  5E6P A;  3UF8 A;  3RD2 A;  4YL8 A;  3IFW B;  3TJP A;  4NAW B;  3A33 B;  1WMH A;  3PV1 A;  2L0F A;  3HM3 A;  5CX3 A;  1V80 A;  3UGB B;  3VQI A;  2RD0 A;  3L54 A;  4RM9 A;  2KLG A;  1UZX B;  4OVV A;  1WZ0 A;  2KHW B;  3GZN I;  3L0W B;  1V6E A;  4XZ4 A;  3WAL A;  2OOB B;  2LGX A;  3WIM A;  1CMX B;  3WAM A;  4B9K A;  3QWZ B;  2JRI B;  2KNB A;  3NOB A;  4II3 B;  4MGZ E;  4FUL A;  3ZLZ A;  2LUE A;  3PRM B;  1GC7 A;  2UWQ A;  4EOY A;  2V1Y A;  4LJO B;  3ZRC A;  2N7D A;  3R7Q A;  3ENE A;  3QAQ A;  3NY5 A;  3B0A A;  3NZU A;  2LXA A;  3HHM A;  3T8M A;  5HKH A;  3ZVV A;  2Z0D B;  2K1F A;  1E90 A;  2FNJ B;  4HLE A;  2ZNV B;  5D7G A;  3OAW A;  5AZG A;  1MG8 A;  1Q1O A;  2BF8 B;  3V61 A;  3VFK A;  4XX5 A;  4ASW C;  2R2O A;  1T0Y A;  4HK2 A;  1NBF C;  4IWP A;  4WAA A;  2G4S A;  3K9P B;  2CR5 A;  3KH0 A;  1I35 A;  4HJK A;  3VUX A;  1KLV A;  2O6V D;  1OEY J;  3AXC A;  4WJP A;  2MSE D;  2HJ8 A;  1WE6 A;  3TBL D;  1WYW B;  1WXA A;  1WXS A;  3QHT A;  4W9J A;  1Y8R C;  1X1M A;  2A4Z A;  3QIJ A;  4K1R B;  1C1Y B;  2I1K A;  2FCM A;  3DVG Y;  5JZE B;  1SGH A;  2KJH B;  2PEA A;  1WR6 E;  1WY8 A;  3QC8 B;  4FJV B;  1I42 A;  2XK5 A;  2KWV B;  5AZH A;  1P0R A;  3M3J A;  2RR9 A;  4CHK A;  1WX8 A;  4GDK A;  4LDT B;  2ZCB A;  4NJ7 A;  2WX1 A;  4RMA A;  2FCS A;  1EO6 A;  2AEH A;  2GMI C;  3NS8 A;  3RT3 B;  1FXT B;  5GMV A;  1V86 A;  3ML9 A;  4MGK E;  1EF1 A;  2DEN B;  4PS8 A;  2D10 A;  2L7R A;  2MWS B;  2CKH B;  4BKG A;  2WYQ A;  4M0W B;  2CS4 A;  4MEL A;  3C0R B;  4E74 A;  4IM3 A;  3KVF B;  3TCA A;  2K8H A;  4ANX A;  4II2 B;  1OQY A;  4MEM A;  2PE6 B;  4NQL B;  4KV2 A;  2OJR A;  3X0W A;  3ZTD A;  4BVU C;  5G55 A;  5J17 A;  3DBR I;  2KWC A;  3QAR A;  1V5T A;  3JYU A;  5C1Z A;  2L00 B;  4HDQ A;  4HVB A;  1QZE A;  5DPR A;  5BO4 B;  3CMM B;  2GBN A;  1TTN A;  3UIN B;  3AU5 A;  4IUM B;  2MQJ A;  1ZGU B;  2N1V A;  3QJZ A;  4JGH B;  1EUV B;  2M0X A;  1E8W A;  4MSM B;  5AZF A;  2NCN A;  3PVL A;  2O2V A;  1G6J A;  4HPM B;  3V60 A;  5EDS A;  2BPS A;  4NAW A;  2N9P C;  1YJ1 A;  5D94 A;  3A9J A;  2LWP A;  3NHE B;  4GB9 A;  2BWE S;  2V3S A;  1C3T A;  4NY0 A;  3DVN V;  2FUH B;  3ZNH B;  2C60 A;  1WX7 A;  1V2Y A;  2YLM A;  4KIK A;  4ICV A;  2QHO A;  5CHF A;  2CU1 A;  2KX0 A;  5C23 A;  2IY1 B;  3L16 A;  3ZTC A;  3QA8 A;  4HPL B;  2J0K A;  1IP9 A;  3UQB A;  4W9G A;  4DHJ B;  1OGW A;  1GUA B;  4GGQ A;  4PS3 A;  4ZRI A;  2IY0 B;  1WM2 A;  2MP2 A;  3PZD A;  2O6V A;  2K6D B;  3D32 A;  2JT4 B;  3H6N A;  3KUD B;  2FIF A;  3APF A;  3AI5 A;  1UGM A;  2L8J A;  1S3S G;  2DAF A;  2NBV B;  3A9J B;  4KDL B;  4EEW A;  1H4R A;  4DHZ B;  4IM2 A;  3KUC B;  2KO3 A;  1IPG A;  1GNU A;  2LGD A;  2PPH A;  4K7W A;  1YIW A;  3DPD A;  3PHX B;  4FBJ B;  4GU2 A;  2KN5 A;  3IBE A;  2DX5 B;  4DXA B;  2LVQ A;  3PRE A;  5IAA C;  4G0N B;  4GDK B;  2KC2 A;  1R4N I;  3L17 A;  4KSK C;  1A5R A;  4BFR A;  3DBL I;  3V6C B;  4KZC A;  4PYU A;  4IG7 B;  3DCG A;  3DQV A;  3Q3F A;  4BBN F;  5AEK B;  1K8R B;  4GIV A;  3TL5 A;  5J18 A;  4FLH A;  2N9X A;  3KYC D;  2MBE A;  2KJR A;  2KX3 A;  3V6E B;  2FCQ A;  2MLB A;  4DHJ D;  4HCP B;  4WJO A;  2KMC A;  2GBR A;  4OVU A;  2LRU A;  2KAN A;  1E5W A;  1AAR A;  3AUL A;  4JLC A;  3VH3 B;  2JY6 A;  2RGF A;  2N7E A;  2L76 A;  4P7I A;  5LXI B;  4GMV A;  3UQA A;  4W9H A;  2IBI B;  4GOC A;  3RCZ A;  4URK A;  2XBB C;  3JSV B;  5L83 A;  4AOF A;  1WE7 A;  2D2Q A;  1V9J A;  4KSL C;  3N3K B;  1WXV A;  1GG3 A;  2KVR A;  4KIK B;  4FJZ A;  5KHQ A;  2R2Q A;  2G4D B;  2Y5B B;  2REX A;  2NVU I;  1J19 A;  4EUT A;  1J0G A;  1IYF A;  4EKU A;  2LXC A;  2MCN B;  2NBW B;  1RLF A;  2MBH A;  2RPQ A;  4KZ0 A;  2LAS A;  2CHX A;  3VXW A;  3B1L X;  3A9K B;  3Q3J A;  2M4N A;  5L95 C;  2XK5 B;  2KTR A;  3GOE A;  2K25 A;  4KVG B;  4FHJ A;  4MGY E;  1LXD A;  3PLV A;  3QCA A;  5LLI A;  3K9O B;  2LI5 A;  3IVF A;  4W9D A;  3CST A;  2MW5 A;  3PRP B;  3OLM D;  2HE7 A;  2AYO B;  2DYO A;  2VRR B;  2LZ6 A;  3T9L A;  4FJY A;  3ZIM A;  4DDG D;  2C7M B;  4AJW A;  2W9N A;  2JRH A;  4TKN A;  2Z0E B;  3N30 A;  4AWJ A;  3SU8 X;  2BWF A;  3P2B A;  2JXX A;  1ZKH A;  3BIN A;  4A20 A;  1V81 A;  1D3Z A;  1RRB A;  1TZ1 A;  3H9D A;  1E7V A;  5FR6 A;  4CYE A;  2ZEQ A;  2EKE C;  3UIP B;  2LD9 A;  4ANV A;  1SIF A;  1TGZ B;  4AJY B;  4NNJ B;  2J0J A;  4TV3 A;  3VVW B;  1VD2 A;  2DYM A;  1WGR A;  5DPW A;  4W9E A;  3A4R A;  3VTV A;  1WZ3 A;  1UEL A;  2DHZ A;  4LDT D;  3B08 A;  3PHW B;  4TUU A;  2AL3 A;  3RUL A;  4DDI D;  4JQW C;  4BOZ B;  1BT0 A;  1WGH A;  4GXB A;  3R7R A;  3NZS A;  3A1Q A;  3LDZ E;  3M63 B;  1WJ4 A;  2IO1 B;  2J7Q B;  1E8X A;  1V5O A;  4WWN A;  2KLC A;  4RM8 A;  5IA7 A;  1YQB A;  3VTU A;  4E3C A;  2C7H A;  3PGE A;  3SHQ A;  4ICU A;  2KQS A;  2KTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...