1ZGXA

Crystal structure of ribonuclease mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface mutation Gln to Lys changed the crystal packing
rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1zgxA00
3BIRA 1BRSA 2KF6A 2ZA4A 4J5KA 3WHOA 8RNTA 3GSPA 1GMPA 1I8VA 1BANA 1BGSA 1B2MA 1BNEA 2F5MA 4BU4A 1TRPA 5HOHA 1DETA 2C4BA 3AGOA 1GOUA 2KF3A 1BOXA 1T2IA 1FUTA 1BRHA 1RGFA 4HAAA 2RNTA 1I2GA 7GSPA 1BNSA 1BSEA 1GOVA 1B3SA 1RTUA 1JBSA 5RNTA 1RGAA 2GSPA 1MGRA 1BUJA 7RNTA 1BNJA 1TRQA 3KCHA 2KF4A 1YGWA 1X1YA 4GSPA 3URPA 1PYLA 1I3IA 1T2HA 1X1WA 2SARA 3WR2A 1I0XA 1LNIA 1BRIA 1HZ1A 4HOHA 4BIRA 1RGEA 1RCLA 1DE3A 2F5WA 1IYYA 1B21A 1RGGA 5GSPA 2BU4A 1BRGA 1HYFA 1I70A 1RSNA 1X1UA 1YNVX 3BU4A 4RNTA 2KF5A 1B2UA 1RGKA 1I2FA 1AY7A 3AHWA 1BSBA 3D5IA 1JBTA 3HOHA 1UCKA 2HOHA 1B20A 1TTOA 1LRAA 1GMQA 1C54A 1G02A 1UCJA 1RNTA 1RCKA 1LOVA 1I0VA 1I3FA 1YVSA 2AADA 3A5EA 1FUSA 1BRJA 1UCLA 1FW7A 5BU4A 1FYSA 3RNTA 1BVIA 1BRKA 1PY3A 3AHSA 1Q9EA 1BSAA 1LOYA 1GMRA 2F4YA 3Q3FA 1BAOA 1BNFA 3D4AA 1I2EA 3DH2A 1BU4A 1UCIA 1R4YA 1B2XA 2BIRA 9RNTA 1BNRA 1BSCA 1AQZA 1BRNL 6RNTA 6GSPA 1B27A 1RGHA 1RN1A 2KAAA 4J5GA 1CH0A 1RDSA 5BIRA 3D5GA 1BSDA 1LOWA 1MGWA 1RGLA 2AAEA 2F56A 1X1XA 1RNBA 1RHLA 1SARA 3AGNA 3SYUA 1A2PA 2RBIA 1JBRA 1BIRA 1FZUA 3DGYA 1RGCA 1RMSA 1RLSA 1ZGXA 1B2SA 1RN4A 1BNGA 1B2ZA 4GHOA 1GSPA 1BNIA 1GOYA
chains in the Genus database with same CATH superfamily
3BIRA 5D81A 3TDGA 3CPW2 3QRDA 3LT9A 3BLZA 1OUNA 1SQWA 3WHOA 1MWRA 1AVKA 1IK3A 3B4PA 5CXOA 1LQGC 1BANA 1BGSA 3KN4A 2GEXA 3CNMA 1A2VA 4K90B 3FLJA 4RNYA 4CCVA 3S5CA 1W01A 4O8SA 5HOHA 1DETA 5LC6A 1OHSA 3T0UA 3CCR3 3FGYA 1GOUA 4WYKA 2H0GA 2HMLB 1JN5A 2KF3A 5AIHA 4EXRA 3HI7A 1TIJA 1FUTA 3MPHA 3GZYB 5ELUA 1YJ93 2BMRB 5AI1A 7GSPA 1STFI 4STDA 4IT7A 1GOVA 3ECFA 2CFWA 2RSXA 4FMBA 4FCMA 2ZL8A 3UJMA 3E99A 3EE1A 3PGBA 1JBSA 2XEPA 3ER7A 1UGHI 1FGQA 1KSIA 3LTAA 3LOYA 3X40A 1TRQA 1A90A 1AV4A 1YGWA 2D1WA 1X1YA 3KFQC 5AIGA 1GY7A 4XM4A 3A76A 1TUHA 3DY5A 2SARA 2K54A 3CCM3 1TFKA 1RGEA 4DKIA 4O3VA 1OHPA 2W56B 1IT7A 3I0YA 1OACA 3SXXA 3S67A 1FGRA 3NXJA 1D6UA 4EC6A 4EW5A 1FGOA 4PEJA 1GS3A 1BRGA 1M1K4 3K9MC 2CFDA 3CCS3 2CFLA 1X1UA 1YNVX 2SBLA 3G0KA 3OX9A 4KFDA 3MWZA 4LGQA 2XGLA 1EA2A 2R4IA 3D79A 4N6UA 3IPTA 5AYSC 1RGKA 3NBRA 5CF2A 2CIUA 4U13A 3AHWA 2IMJA 2V1LA 2WO0A 4FMCA 1BSBA 3SLUA 4I4KA 3G713 1ISKA 1FUWA 3HOHA 1UCKA 2HOHA 2CC3A 3DZLA 1LRAA 1GMQA 3OWYA 2Z7AA 2ZDJA 5CF1A 2H0IA 2K3DA 3DMCA 3NHXA 1SJWA 2GU3A 1RNTA 2IY2A 1RCKA 1JNQA 1AR0A 3KZTA 1W2B2 4J9AA 3JUPA 1I3FA 3F7SA 3LZAA 1YVSA 3A5EA 4J8TA 1MNLA 2XRXB 4GL6A 4HVNA 4KT3B 1IV9A 2UUGC 1Z1SA 4R4KA 3FG1A 1T5YA 2E2TA 5IG3A 1BVIA 1UUWB 3MG2A 1Q9EA 3D9RA 3NV0A 5HGRA 1LOYA 3Q3FA 1O7HB 1Q814 4BL3A 1N8QA 3DGNA 3AMOB 1W4NA 3FG4A 3WOEB 1R4YA 2OCTA 2W03A 1UDII 2XH9A 3CCE3 3SOAA 4LMIA 3K7CA 1US1A 5AEWB 6RNTA 1N9JA 1YJN3 5STDA 3X3YA 1RGHA 1VQO3 1N9EA 2BO9B 2KAAA 1CH0A 3GRDA 4OUQA 1RGLA 2LYXA 3M8CA 5DRVA 3S27A 3KSPA 1YIJ3 2XGNA 3AGNA 3X41A 3HK4A 2E2VA 2RBIA 4XDVA 1JZOA 4L8PA 2HMKB 1VQ93 1FZUA 2FNQA 1B2MA 1RMSA 1V74A 3LXUX 3J7Yd 3RGAA 4LZIA 1RN4A 1RRHA 2QGUA 1HU9A 5ELJA 1IVXA 2CG0A 1ZS7A 1A67A 3DGMA 3EN8A 3EX9A 3NM2A 3CME3 3CPOA 1BRSA 3HX8A 1E97A 2FGTA 5I97A 2ZA4A 1KWIA 2STDA 2BMOB 1GMPA 4I5QA 1JB5A 4FMAA 4QWTA 3DXOA 1VQN3 1QVF2 1W00A 2YFJB 3EB8A 4BU4A 1VQP3 3LTCA 3MG3A 2Q07A 2OTL3 2WOFA 1VQ53 3CXC2 2I9WA 1YJW3 4L8OA 3DM8A 2QA43 2ML5A 3NQZA 4LYLB 1BOXA 1LXEA 3IJEB 2KXGA 4FMDA 3I553 3F14A 2UX0A 4N6V0 3PXMA 2KRTA 2YX9A 1I2GA 2IUKA 1BSEA 2XF3A 3FG3A 3BNCA 3FF2A 4WYKB 1DMQA 1JN5B 4H3UA 1VQM3 1SIIA 1JZDA 1UW1A 3GZRA 2F98A 4NPBA 1RGAA 1E3RA 5JPPA 2CKFB 1OH0A 2PNCA 4WWUC 4WP5A 4NHFA 3CCJ3 3G6E3 3JUNA 3PCRA 5IENA 4HM6B 2IUJA 1I0XA 1OCVA 1LNIA 4HOHA 1HZ1A 1OPYA 1WMNA 2QIYA 4G1MB 3BNDA 4XBYA 4BIRA 4MMZB 3VGNA 4CJNA 4HJLB 2F5WA 2W04A 2B1XB 2Y73A 2BNGA 3WA3A 4HM2B 1MWTA 1NWWA 2BT3A 1G96A 2RGQA 1IVVA 2BU4A 1Q824 1BUQA 2W2CA 3S28A 1Q40A 3KE7A 1TP6A 4Q53A 1O7WB 1R4CA 1K9M4 3CD63 1RSNA 2PZVA 2HMMB 3N9HA 4HBRA 4X2HA 3WODG 1YVBI 5IG5A 3G4S3 4N6MA 1SPUA 1I2FA 4AKYA 3CU3A 3UL6A 1V58A 2HMJB 2A15A 1EUIC 1MOLA 3SVAA 4MMXB 1TTOA 4KFEA 5KP1A 1W6CA 2INXA 5BVBA 1UCJA 4HM7B 3GZXB 1UI8A 3RDEA 1VQK3 2OOVC 1LOVA 1UGIA 3MSOA 3NBJA 3LT8A 2KCDA 1T3BA 2AADA 1FUSA 1BRJA 2FXTA 1DVCA 5BU4A 1FYSA 3HIGA 3LTBA 4LEHA 1N5PA 3B4OA 1GMRA 1WQLB 4BTWA 1BAOA 2WGQA 3LMLA 1I2EA 5TGNA 2GEYA 1MWUA 4FCZA 1BU4A 3FZWA 1UCIA 2CFGA 5EEOA 1NNVA 4OK0A 2BIRA 1SIHA 1ASKA 2P09A 4NREA 1AQZA 4JF8A 3U97A 1BRNL 3KSED 2OQEC 3H51A 3NV0B 1B27A 5M19A 4J5GA 1RDSA 1JV2B 1WMOA 5FW5A 1IVUA 1MGWA 3AMOA 5G1LA 5IG4A 2OOVA 5A0OB 1X1XA 5KP4A 3WA2X 3CCU3 1RHLA 1DMNA 1A2PA 3B8LA 3OWSA 1NO3A 2CW9A 3ZG0A 1Q864 1BIRA 2P0XA 3DGYA 1RGCA 3CMA3 3SX1A 1B2SA 1Y4KA 5D82A 1JB2A 1GD3A 1B2ZA 1RN7A 1GSPA 1LVNA 1BNIA 3H3HA 3EN1B 3X42A 4EV5A 4J5KA 8RNTA 2E2UA 2IA7A 3GSPA 3IMAB 3MG1A 1N8R4 4RBNA 1GY5A 3MYTA 1OF5B 2LQVA 1BNEA 2Z6BA 4HM1B 2CWUA 1LNHA 1JB4A 5D83A 3AGOA 1IQ8A 3EHCA 2MC8A 2GU1A 3BNEA 3FH1A 4R9KA 2CWVA 5AIFA 1BRHA 1ULIB 1RGFA 3PZWA 4XBTA 4N6TA 1Q42A 4O02B 3ROBA 3NM7A 2W9PA 3LYGA 3ZG5A 1LQMB 1BNSA 1RTUA 1NJI4 4HM5B 1L5GB 3DGLA 3KIIA 4N6LA 3EQQB 1RRLA 4KFFA 1IU7A 3G8ZA 2GSPA 1VQ73 7RNTA 1K8A4 3X3XA 1CYVA 5LC7A 5AYRB 4XB5A 1FA3A 4GSPA 3GAXA 4OVMA 1GY6A 1X1WA 2L4VA 3DGOA 4ZM8A 1YIT3 3EF8A 3CCQ3 2W9QA 2YFIB 1DE3A 1WNHA 2P38A 3JUOA 1RGGA 5IW9A 3SEDA 3F8HA 1EG9B 3U1WA 3WDGB 2JDIH 3OW22 3FKAA 2H0HA 3OXAA 1O7GB 3JUMA 2O9UX 5EVHA 5G2GA 4RNTA 2Z77A 1B2UA 5FGOA 2F99A 2GBXB 1AY7A 4MEIA 3D5IA 1Q40B 3EJVA 5AIIA 1C7HA 2Z76A 1VQQA 3NBBA 2R41A 1CYUA 3VSYA 4HM8B 4FCJA 1UI7A 1NU3A 1W7CA 3G16A 3NUVA 5JPUA 4HM0B 4IPBA 3T8NA 1M904 4AKZA 1I0VA 3FCSB 4KZ1A 4BTYA 1STDA 2XFSA 4KVHA 1JKGB 3RNTA 3OV4A 1O7PB 3AHSA 4WFOA 4HM3B 1BSAA 3UL5A 1F8NA 2F4YA 1BNFA 3D4AA 2QEX3 2CK3H 4R80A 2OWPA 1CEWI 5BXQA 4RZMA 1B2XA 9RNTA 1QAKA 3Q2PA 1W6YA 4L7KA 3CC23 1A2KA 1BSCA 2WOHA 1U5OA 6GSPA 2J8XB 3K5TA 5BIRA 4EV2A 4HZ9B 3BB9A 1BSDA 1DMMA 3K63A 2OQEA 4EBGA 2HMOB 3F7XA 3CC43 4HKVB 3N54B 5AEUB 1RNBA 1SARA 3HZPA 1Q7Y4 1M1XB 3SYUA 3CC73 2B24B 2CFKA 3OWUA 1ZGXA 1FGTA 1VQ43 2K0MA 5IEOA 1AVLA 1IQXA 2MF7A 1IT8A 5IF6A 1O7NB 2WGOA 4GHOA 3BNBA 1S723 1ROVA 3GWRA 2CHCA 3B7CA 5JBSA 1PU4A 1QAFA 3RGRA 2KF6A 1YGEA 2GBWB 4RNZA 3ALAA 1I8VA 2P0MA 2XR8B 3L0RA 4K1UA 1WTHA 3PS8A 3Q1CA 4H61A 1N5HA 2W0QA 1QMAA 4LSOA 5KP3A 1JRQA 1TRPA 1ZO2A 2CWTA 1U8CB 1ULJB 2GXFA 2ML6A 3LH4A 1VQ83 1OHOA 4TX4A 2C4BA 2C10A 1NB3I 1M9GA 3MHEA 4K61A 1DVDA 1ROAA 3EBTA 1OF5A 1S5AA 1Q7HA 1T2IA 3JUQA 3ZFZA 2ZHXB 4HAAA 2RNTA 3HIIA 2O3OA 1EQKA 3LTDA 1B3SA 1RKYA 1J2BA 1IVWA 5CLKA 4ORLA 3CCL3 4O2HA 4WHAA 5RNTA 1ZX2A 4CDLA 1MGRA 2XSHB 2L1SA 3I563 1DYUA 1QJGA 2D42A 3CNXA 3FSDA 4N6OB 1LOXA 1BUJA 2CH9A 1BNJA 2W56A 3D3LA 2KF4A 3F8XA 3KCHA 3QK9A 3STDA 3N8BA 1YI23 1JJ22 3URPA 1PYLA 2OTJ3 1I3IA 1T2HA 2IYJA 2W6JH 1QALA 3S29A 3F40A 3WR2A 2XFTA 1BRIA 2P05A 3NX0A 5M1AA 3SOYA 1YHQ3 3MKIA 1W6GA 1RCLA 3T8UA 5IG0A 1IYYA 1B21A 1GD4A 1OGZA 2YFLB 1NDOB 5GSPA 3UB1A 1KQS2 4ILFA 1IQYA 1HYFA 4XDWA 1IDPA 1I70A 3V99A 1MWSA 3BU4A 3K0ZA 4FR9A 5IEPA 2KF5A 3V92A 2CG1A 2RCDA 4BL2A 3KKGA 5IERA 1W02A 3JVCA 1JBTA 1CQSA 1D6YA 1TJDA 3O8YA 1UUGB 5DREA 1TFOA 4N6NB 1K734 1B20A 1C54A 4HYZA 5CK6A 1VQL3 1V57A 1G02A 3WOFB 1K41A 4AEQA 5G1KA 3Q90A 2CX0A 4HZBB 1D6ZA 1E3VA 1FGMA 1EKMA 3F9SA 3V98A 1W2ZA 1UCLA 2M7OA 1RJOA 3GZBA 2RFRA 4JRFA 4MJDA 1EEJA 4R9LA 1FW7A 3VF1A 1BRKA 1PY3A 3X3ZA 1TU5A 1NB5I 1WMPA 2BMQB 3NQYA 4X2OA 3DH2A 1K28A 4EYCA 1G0TA 4XBXA 4CPKA 3DUKA 8CHOA 1GYBA 4GB5A 3CCV3 1BNRA 1JKGA 3FF0A 2C11A 4N3VA 1QVG2 1KC84 4BTXA 3EC9A 4R1KA 1HKXA 1RN1A 1W5ZA 1IV7A 3D5GA 1LOWA 3EBYA 1OGXA 1VZZA 2UGIA 5EQLA 5M18A 2AAEA 6STDA 2F56A 2BHMA 2Y74A 7STDA 4IIAA 1JBRA 4HM4B 1VQ63 4K1VA 1RLSA 3WMDA 1PFPA 2JQ5A 1O7MB 3UNLA 2CX1A 1UUVB 4MMYB 1KD14 2XSOB 1BNGA 2HMNB 3PCSA 3PYJA 2F86B 2F5MA 1GOYA
chains in the Genus database with same CATH topology
3BIRA 1BRSA 2KF6A 2ZA4A 4J5KA 3WHOA 8RNTA 3GSPA 1GMPA 1I8VA 1BANA 1BGSA 1B2MA 1BNEA 2F5MA 4BU4A 1TRPA 5HOHA 1DETA 2C4BA 3AGOA 1GOUA 2KF3A 1BOXA 1T2IA 1FUTA 1BRHA 1RGFA 4HAAA 2RNTA 1I2GA 7GSPA 1BNSA 1BSEA 1GOVA 1B3SA 1RTUA 1JBSA 5RNTA 1RGAA 2GSPA 1MGRA 1BUJA 7RNTA 1BNJA 1TRQA 3KCHA 2KF4A 1YGWA 1X1YA 4GSPA 3URPA 1PYLA 1I3IA 1T2HA 1X1WA 2SARA 3WR2A 1I0XA 1LNIA 1BRIA 1HZ1A 4HOHA 4BIRA 1RGEA 1RCLA 1DE3A 2F5WA 1IYYA 1B21A 1RGGA 5GSPA 2BU4A 1BRGA 1HYFA 1I70A 1RSNA 1X1UA 1YNVX 3BU4A 4RNTA 2KF5A 1B2UA 1RGKA 1I2FA 1AY7A 3AHWA 1BSBA 3D5IA 1JBTA 3HOHA 1UCKA 2HOHA 1B20A 1TTOA 1LRAA 1GMQA 1C54A 1G02A 1UCJA 1RNTA 1RCKA 1LOVA 1I0VA 1I3FA 1YVSA 2AADA 3A5EA 1FUSA 1BRJA 1UCLA 1FW7A 5BU4A 1FYSA 3RNTA 1BVIA 1BRKA 1PY3A 3AHSA 1Q9EA 1BSAA 1LOYA 1GMRA 2F4YA 3Q3FA 1BAOA 1BNFA 3D4AA 1I2EA 3DH2A 1BU4A 1UCIA 1R4YA 1B2XA 2BIRA 9RNTA 1BNRA 1BSCA 1AQZA 1BRNL 6RNTA 6GSPA 1B27A 1RGHA 1RN1A 2KAAA 4J5GA 1CH0A 1RDSA 5BIRA 3D5GA 1BSDA 1LOWA 1MGWA 1RGLA 2AAEA 2F56A 1X1XA 1RNBA 1RHLA 1SARA 3AGNA 3SYUA 1A2PA 2RBIA 1JBRA 1BIRA 1FZUA 3DGYA 1RGCA 1RMSA 1RLSA 1ZGXA 1B2SA 1RN4A 1BNGA 1B2ZA 4GHOA 1GSPA 1BNIA 1GOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIR A;  1BRS A;  2KF6 A;  2ZA4 A;  4J5K A;  3WHO A;  8RNT A;  3GSP A;  1GMP A;  1I8V A;  1BAN A;  1BGS A;  1B2M A;  1BNE A;  2F5M A;  4BU4 A;  1TRP A;  5HOH A;  1DET A;  2C4B A;  3AGO A;  1GOU A;  2KF3 A;  1BOX A;  1T2I A;  1FUT A;  1BRH A;  1RGF A;  4HAA A;  2RNT A;  1I2G A;  7GSP A;  1BNS A;  1BSE A;  1GOV A;  1B3S A;  1RTU A;  1JBS A;  5RNT A;  1RGA A;  2GSP A;  1MGR A;  1BUJ A;  7RNT A;  1BNJ A;  1TRQ A;  3KCH A;  2KF4 A;  1YGW A;  1X1Y A;  4GSP A;  3URP A;  1PYL A;  1I3I A;  1T2H A;  1X1W A;  2SAR A;  3WR2 A;  1I0X A;  1LNI A;  1BRI A;  1HZ1 A;  4HOH A;  4BIR A;  1RGE A;  1RCL A;  1DE3 A;  2F5W A;  1IYY A;  1B21 A;  1RGG A;  5GSP A;  2BU4 A;  1BRG A;  1HYF A;  1I70 A;  1RSN A;  1X1U A;  1YNV X;  3BU4 A;  4RNT A;  2KF5 A;  1B2U A;  1RGK A;  1I2F A;  1AY7 A;  3AHW A;  1BSB A;  3D5I A;  1JBT A;  3HOH A;  1UCK A;  2HOH A;  1B20 A;  1TTO A;  1LRA A;  1GMQ A;  1C54 A;  1G02 A;  1UCJ A;  1RNT A;  1RCK A;  1LOV A;  1I0V A;  1I3F A;  1YVS A;  2AAD A;  3A5E A;  1FUS A;  1BRJ A;  1UCL A;  1FW7 A;  5BU4 A;  1FYS A;  3RNT A;  1BVI A;  1BRK A;  1PY3 A;  3AHS A;  1Q9E A;  1BSA A;  1LOY A;  1GMR A;  2F4Y A;  3Q3F A;  1BAO A;  1BNF A;  3D4A A;  1I2E A;  3DH2 A;  1BU4 A;  1UCI A;  1R4Y A;  1B2X A;  2BIR A;  9RNT A;  1BNR A;  1BSC A;  1AQZ A;  1BRN L;  6RNT A;  6GSP A;  1B27 A;  1RGH A;  1RN1 A;  2KAA A;  4J5G A;  1CH0 A;  1RDS A;  5BIR A;  3D5G A;  1BSD A;  1LOW A;  1MGW A;  1RGL A;  2AAE A;  2F56 A;  1X1X A;  1RNB A;  1RHL A;  1SAR A;  3AGN A;  3SYU A;  1A2P A;  2RBI A;  1JBR A;  1BIR A;  1FZU A;  3DGY A;  1RGC A;  1RMS A;  1RLS A;  1ZGX A;  1B2S A;  1RN4 A;  1BNG A;  1B2Z A;  4GHO A;  1GSP A;  1BNI A;  1GOY A; 
#chains in the Genus database with same CATH topology
 3BIR A;  5D81 A;  3TDG A;  3CPW 2;  3QRD A;  3LT9 A;  3BLZ A;  1OUN A;  1SQW A;  3WHO A;  1MWR A;  1AVK A;  1IK3 A;  3B4P A;  5CXO A;  1LQG C;  1BAN A;  1BGS A;  3KN4 A;  2GEX A;  3CNM A;  1A2V A;  4K90 B;  3FLJ A;  4RNY A;  4CCV A;  3S5C A;  1W01 A;  4O8S A;  5HOH A;  1DET A;  5LC6 A;  1OHS A;  3T0U A;  3CCR 3;  3FGY A;  1GOU A;  4WYK A;  2H0G A;  2HML B;  1JN5 A;  2KF3 A;  5AIH A;  4EXR A;  3HI7 A;  1TIJ A;  1FUT A;  3MPH A;  3GZY B;  5ELU A;  1YJ9 3;  2BMR B;  5AI1 A;  7GSP A;  1STF I;  4STD A;  4IT7 A;  1GOV A;  3ECF A;  2CFW A;  2RSX A;  4FMB A;  4FCM A;  2ZL8 A;  3UJM A;  3E99 A;  3EE1 A;  3PGB A;  1JBS A;  2XEP A;  3ER7 A;  1UGH I;  1FGQ A;  1KSI A;  3LTA A;  3LOY A;  3X40 A;  1TRQ A;  1A90 A;  1AV4 A;  1YGW A;  2D1W A;  1X1Y A;  3KFQ C;  5AIG A;  1GY7 A;  4XM4 A;  3A76 A;  1TUH A;  3DY5 A;  2SAR A;  2K54 A;  3CCM 3;  1TFK A;  1RGE A;  4DKI A;  4O3V A;  1OHP A;  2W56 B;  1IT7 A;  3I0Y A;  1OAC A;  3SXX A;  3S67 A;  1FGR A;  3NXJ A;  1D6U A;  4EC6 A;  4EW5 A;  1FGO A;  4PEJ A;  1GS3 A;  1BRG A;  1M1K 4;  3K9M C;  2CFD A;  3CCS 3;  2CFL A;  1X1U A;  1YNV X;  2SBL A;  3G0K A;  3OX9 A;  4KFD A;  3MWZ A;  4LGQ A;  2XGL A;  1EA2 A;  2R4I A;  3D79 A;  4N6U A;  3IPT A;  5AYS C;  1RGK A;  3NBR A;  5CF2 A;  2CIU A;  4U13 A;  3AHW A;  2IMJ A;  2V1L A;  2WO0 A;  4FMC A;  1BSB A;  3SLU A;  4I4K A;  3G71 3;  1ISK A;  1FUW A;  3HOH A;  1UCK A;  2HOH A;  2CC3 A;  3DZL A;  1LRA A;  1GMQ A;  3OWY A;  2Z7A A;  2ZDJ A;  5CF1 A;  2H0I A;  2K3D A;  3DMC A;  3NHX A;  1SJW A;  2GU3 A;  1RNT A;  2IY2 A;  1RCK A;  1JNQ A;  1AR0 A;  3KZT A;  1W2B 2;  4J9A A;  3JUP A;  1I3F A;  3F7S A;  3LZA A;  1YVS A;  3A5E A;  4J8T A;  1MNL A;  2XRX B;  4GL6 A;  4HVN A;  4KT3 B;  1IV9 A;  2UUG C;  1Z1S A;  4R4K A;  3FG1 A;  1T5Y A;  2E2T A;  5IG3 A;  1BVI A;  1UUW B;  3MG2 A;  1Q9E A;  3D9R A;  3NV0 A;  5HGR A;  1LOY A;  3Q3F A;  1O7H B;  1Q81 4;  4BL3 A;  1N8Q A;  3DGN A;  3AMO B;  1W4N A;  3FG4 A;  3WOE B;  1R4Y A;  2OCT A;  2W03 A;  1UDI I;  2XH9 A;  3CCE 3;  3SOA A;  4LMI A;  3K7C A;  1US1 A;  5AEW B;  6RNT A;  1N9J A;  1YJN 3;  5STD A;  3X3Y A;  1RGH A;  1VQO 3;  1N9E A;  2BO9 B;  2KAA A;  1CH0 A;  3GRD A;  4OUQ A;  1RGL A;  2LYX A;  3M8C A;  5DRV A;  3S27 A;  3KSP A;  1YIJ 3;  2XGN A;  3AGN A;  3X41 A;  3HK4 A;  2E2V A;  2RBI A;  4XDV A;  1JZO A;  4L8P A;  2HMK B;  1VQ9 3;  1FZU A;  2FNQ A;  1B2M A;  1RMS A;  1V74 A;  3LXU X;  3J7Y d;  3RGA A;  4LZI A;  1RN4 A;  1RRH A;  2QGU A;  1HU9 A;  5ELJ A;  1IVX A;  2CG0 A;  1ZS7 A;  1A67 A;  3DGM A;  3EN8 A;  3EX9 A;  3NM2 A;  3CME 3;  3CPO A;  1BRS A;  3HX8 A;  1E97 A;  2FGT A;  5I97 A;  2ZA4 A;  1KWI A;  2STD A;  2BMO B;  1GMP A;  4I5Q A;  1JB5 A;  4FMA A;  4QWT A;  3DXO A;  1VQN 3;  1QVF 2;  1W00 A;  2YFJ B;  3EB8 A;  4BU4 A;  1VQP 3;  3LTC A;  3MG3 A;  2Q07 A;  2OTL 3;  2WOF A;  1VQ5 3;  3CXC 2;  2I9W A;  1YJW 3;  4L8O A;  3DM8 A;  2QA4 3;  2ML5 A;  3NQZ A;  4LYL B;  1BOX A;  1LXE A;  3IJE B;  2KXG A;  4FMD A;  3I55 3;  3F14 A;  2UX0 A;  4N6V 0;  3PXM A;  2KRT A;  2YX9 A;  1I2G A;  2IUK A;  1BSE A;  2XF3 A;  3FG3 A;  3BNC A;  3FF2 A;  4WYK B;  1DMQ A;  1JN5 B;  4H3U A;  1VQM 3;  1SII A;  1JZD A;  1UW1 A;  3GZR A;  2F98 A;  4NPB A;  1RGA A;  1E3R A;  5JPP A;  2CKF B;  1OH0 A;  2PNC A;  4WWU C;  4WP5 A;  4NHF A;  3CCJ 3;  3G6E 3;  3JUN A;  3PCR A;  5IEN A;  4HM6 B;  2IUJ A;  1I0X A;  1OCV A;  1LNI A;  4HOH A;  1HZ1 A;  1OPY A;  1WMN A;  2QIY A;  4G1M B;  3BND A;  4XBY A;  4BIR A;  4MMZ B;  3VGN A;  4CJN A;  4HJL B;  2F5W A;  2W04 A;  2B1X B;  2Y73 A;  2BNG A;  3WA3 A;  4HM2 B;  1MWT A;  1NWW A;  2BT3 A;  1G96 A;  2RGQ A;  1IVV A;  2BU4 A;  1Q82 4;  1BUQ A;  2W2C A;  3S28 A;  1Q40 A;  3KE7 A;  1TP6 A;  4Q53 A;  1O7W B;  1R4C A;  1K9M 4;  3CD6 3;  1RSN A;  2PZV A;  2HMM B;  3N9H A;  4HBR A;  4X2H A;  3WOD G;  1YVB I;  5IG5 A;  3G4S 3;  4N6M A;  1SPU A;  1I2F A;  4AKY A;  3CU3 A;  3UL6 A;  1V58 A;  2HMJ B;  2A15 A;  1EUI C;  1MOL A;  3SVA A;  4MMX B;  1TTO A;  4KFE A;  5KP1 A;  1W6C A;  2INX A;  5BVB A;  1UCJ A;  4HM7 B;  3GZX B;  1UI8 A;  3RDE A;  1VQK 3;  2OOV C;  1LOV A;  1UGI A;  3MSO A;  3NBJ A;  3LT8 A;  2KCD A;  1T3B A;  2AAD A;  1FUS A;  1BRJ A;  2FXT A;  1DVC A;  5BU4 A;  1FYS A;  3HIG A;  3LTB A;  4LEH A;  1N5P A;  3B4O A;  1GMR A;  1WQL B;  4BTW A;  1BAO A;  2WGQ A;  3LML A;  1I2E A;  5TGN A;  2GEY A;  1MWU A;  4FCZ A;  1BU4 A;  3FZW A;  1UCI A;  2CFG A;  5EEO A;  1NNV A;  4OK0 A;  2BIR A;  1SIH A;  1ASK A;  2P09 A;  4NRE A;  1AQZ A;  4JF8 A;  3U97 A;  1BRN L;  3KSE D;  2OQE C;  3H51 A;  3NV0 B;  1B27 A;  5M19 A;  4J5G A;  1RDS A;  1JV2 B;  1WMO A;  5FW5 A;  1IVU A;  1MGW A;  3AMO A;  5G1L A;  5IG4 A;  2OOV A;  5A0O B;  1X1X A;  5KP4 A;  3WA2 X;  3CCU 3;  1RHL A;  1DMN A;  1A2P A;  3B8L A;  3OWS A;  1NO3 A;  2CW9 A;  3ZG0 A;  1Q86 4;  1BIR A;  2P0X A;  3DGY A;  1RGC A;  3CMA 3;  3SX1 A;  1B2S A;  1Y4K A;  5D82 A;  1JB2 A;  1GD3 A;  1B2Z A;  1RN7 A;  1GSP A;  1LVN A;  1BNI A;  3H3H A;  3EN1 B;  3X42 A;  4EV5 A;  4J5K A;  8RNT A;  2E2U A;  2IA7 A;  3GSP A;  3IMA B;  3MG1 A;  1N8R 4;  4RBN A;  1GY5 A;  3MYT A;  1OF5 B;  2LQV A;  1BNE A;  2Z6B A;  4HM1 B;  2CWU A;  1LNH A;  1JB4 A;  5D83 A;  3AGO A;  1IQ8 A;  3EHC A;  2MC8 A;  2GU1 A;  3BNE A;  3FH1 A;  4R9K A;  2CWV A;  5AIF A;  1BRH A;  1ULI B;  1RGF A;  3PZW A;  4XBT A;  4N6T A;  1Q42 A;  4O02 B;  3ROB A;  3NM7 A;  2W9P A;  3LYG A;  3ZG5 A;  1LQM B;  1BNS A;  1RTU A;  1NJI 4;  4HM5 B;  1L5G B;  3DGL A;  3KII A;  4N6L A;  3EQQ B;  1RRL A;  4KFF A;  1IU7 A;  3G8Z A;  2GSP A;  1VQ7 3;  7RNT A;  1K8A 4;  3X3X A;  1CYV A;  5LC7 A;  5AYR B;  4XB5 A;  1FA3 A;  4GSP A;  3GAX A;  4OVM A;  1GY6 A;  1X1W A;  2L4V A;  3DGO A;  4ZM8 A;  1YIT 3;  3EF8 A;  3CCQ 3;  2W9Q A;  2YFI B;  1DE3 A;  1WNH A;  2P38 A;  3JUO A;  1RGG A;  5IW9 A;  3SED A;  3F8H A;  1EG9 B;  3U1W A;  3WDG B;  2JDI H;  3OW2 2;  3FKA A;  2H0H A;  3OXA A;  1O7G B;  3JUM A;  2O9U X;  5EVH A;  5G2G A;  4RNT A;  2Z77 A;  1B2U A;  5FGO A;  2F99 A;  2GBX B;  1AY7 A;  4MEI A;  3D5I A;  1Q40 B;  3EJV A;  5AII A;  1C7H A;  2Z76 A;  1VQQ A;  3NBB A;  2R41 A;  1CYU A;  3VSY A;  4HM8 B;  4FCJ A;  1UI7 A;  1NU3 A;  1W7C A;  3G16 A;  3NUV A;  5JPU A;  4HM0 B;  4IPB A;  3T8N A;  1M90 4;  4AKZ A;  1I0V A;  3FCS B;  4KZ1 A;  4BTY A;  1STD A;  2XFS A;  4KVH A;  1JKG B;  3RNT A;  3OV4 A;  1O7P B;  3AHS A;  4WFO A;  4HM3 B;  1BSA A;  3UL5 A;  1F8N A;  2F4Y A;  1BNF A;  3D4A A;  2QEX 3;  2CK3 H;  4R80 A;  2OWP A;  1CEW I;  5BXQ A;  4RZM A;  1B2X A;  9RNT A;  1QAK A;  3Q2P A;  1W6Y A;  4L7K A;  3CC2 3;  1A2K A;  1BSC A;  2WOH A;  1U5O A;  6GSP A;  2J8X B;  3K5T A;  5BIR A;  4EV2 A;  4HZ9 B;  3BB9 A;  1BSD A;  1DMM A;  3K63 A;  2OQE A;  4EBG A;  2HMO B;  3F7X A;  3CC4 3;  4HKV B;  3N54 B;  5AEU B;  1RNB A;  1SAR A;  3HZP A;  1Q7Y 4;  1M1X B;  3SYU A;  3CC7 3;  2B24 B;  2CFK A;  3OWU A;  1ZGX A;  1FGT A;  1VQ4 3;  2K0M A;  5IEO A;  1AVL A;  1IQX A;  2MF7 A;  1IT8 A;  5IF6 A;  1O7N B;  2WGO A;  4GHO A;  3BNB A;  1S72 3;  1ROV A;  3GWR A;  2CHC A;  3B7C A;  5JBS A;  1PU4 A;  1QAF A;  3RGR A;  2KF6 A;  1YGE A;  2GBW B;  4RNZ A;  3ALA A;  1I8V A;  2P0M A;  2XR8 B;  3L0R A;  4K1U A;  1WTH A;  3PS8 A;  3Q1C A;  4H61 A;  1N5H A;  2W0Q A;  1QMA A;  4LSO A;  5KP3 A;  1JRQ A;  1TRP A;  1ZO2 A;  2CWT A;  1U8C B;  1ULJ B;  2GXF A;  2ML6 A;  3LH4 A;  1VQ8 3;  1OHO A;  4TX4 A;  2C4B A;  2C10 A;  1NB3 I;  1M9G A;  3MHE A;  4K61 A;  1DVD A;  1ROA A;  3EBT A;  1OF5 A;  1S5A A;  1Q7H A;  1T2I A;  3JUQ A;  3ZFZ A;  2ZHX B;  4HAA A;  2RNT A;  3HII A;  2O3O A;  1EQK A;  3LTD A;  1B3S A;  1RKY A;  1J2B A;  1IVW A;  5CLK A;  4ORL A;  3CCL 3;  4O2H A;  4WHA A;  5RNT A;  1ZX2 A;  4CDL A;  1MGR A;  2XSH B;  2L1S A;  3I56 3;  1DYU A;  1QJG A;  2D42 A;  3CNX A;  3FSD A;  4N6O B;  1LOX A;  1BUJ A;  2CH9 A;  1BNJ A;  2W56 A;  3D3L A;  2KF4 A;  3F8X A;  3KCH A;  3QK9 A;  3STD A;  3N8B A;  1YI2 3;  1JJ2 2;  3URP A;  1PYL A;  2OTJ 3;  1I3I A;  1T2H A;  2IYJ A;  2W6J H;  1QAL A;  3S29 A;  3F40 A;  3WR2 A;  2XFT A;  1BRI A;  2P05 A;  3NX0 A;  5M1A A;  3SOY A;  1YHQ 3;  3MKI A;  1W6G A;  1RCL A;  3T8U A;  5IG0 A;  1IYY A;  1B21 A;  1GD4 A;  1OGZ A;  2YFL B;  1NDO B;  5GSP A;  3UB1 A;  1KQS 2;  4ILF A;  1IQY A;  1HYF A;  4XDW A;  1IDP A;  1I70 A;  3V99 A;  1MWS A;  3BU4 A;  3K0Z A;  4FR9 A;  5IEP A;  2KF5 A;  3V92 A;  2CG1 A;  2RCD A;  4BL2 A;  3KKG A;  5IER A;  1W02 A;  3JVC A;  1JBT A;  1CQS A;  1D6Y A;  1TJD A;  3O8Y A;  1UUG B;  5DRE A;  1TFO A;  4N6N B;  1K73 4;  1B20 A;  1C54 A;  4HYZ A;  5CK6 A;  1VQL 3;  1V57 A;  1G02 A;  3WOF B;  1K41 A;  4AEQ A;  5G1K A;  3Q90 A;  2CX0 A;  4HZB B;  1D6Z A;  1E3V A;  1FGM A;  1EKM A;  3F9S A;  3V98 A;  1W2Z A;  1UCL A;  2M7O A;  1RJO A;  3GZB A;  2RFR A;  4JRF A;  4MJD A;  1EEJ A;  4R9L A;  1FW7 A;  3VF1 A;  1BRK A;  1PY3 A;  3X3Z A;  1TU5 A;  1NB5 I;  1WMP A;  2BMQ B;  3NQY A;  4X2O A;  3DH2 A;  1K28 A;  4EYC A;  1G0T A;  4XBX A;  4CPK A;  3DUK A;  8CHO A;  1GYB A;  4GB5 A;  3CCV 3;  1BNR A;  1JKG A;  3FF0 A;  2C11 A;  4N3V A;  1QVG 2;  1KC8 4;  4BTX A;  3EC9 A;  4R1K A;  1HKX A;  1RN1 A;  1W5Z A;  1IV7 A;  3D5G A;  1LOW A;  3EBY A;  1OGX A;  1VZZ A;  2UGI A;  5EQL A;  5M18 A;  2AAE A;  6STD A;  2F56 A;  2BHM A;  2Y74 A;  7STD A;  4IIA A;  1JBR A;  4HM4 B;  1VQ6 3;  4K1V A;  1RLS A;  3WMD A;  1PFP A;  2JQ5 A;  1O7M B;  3UNL A;  2CX1 A;  1UUV B;  4MMY B;  1KD1 4;  2XSO B;  1BNG A;  2HMN B;  3PCS A;  3PYJ A;  2F86 B;  2F5M A;  1GOY A; 
#chains in the Genus database with same CATH homology
 3BIR A;  1BRS A;  2KF6 A;  2ZA4 A;  4J5K A;  3WHO A;  8RNT A;  3GSP A;  1GMP A;  1I8V A;  1BAN A;  1BGS A;  1B2M A;  1BNE A;  2F5M A;  4BU4 A;  1TRP A;  5HOH A;  1DET A;  2C4B A;  3AGO A;  1GOU A;  2KF3 A;  1BOX A;  1T2I A;  1FUT A;  1BRH A;  1RGF A;  4HAA A;  2RNT A;  1I2G A;  7GSP A;  1BNS A;  1BSE A;  1GOV A;  1B3S A;  1RTU A;  1JBS A;  5RNT A;  1RGA A;  2GSP A;  1MGR A;  1BUJ A;  7RNT A;  1BNJ A;  1TRQ A;  3KCH A;  2KF4 A;  1YGW A;  1X1Y A;  4GSP A;  3URP A;  1PYL A;  1I3I A;  1T2H A;  1X1W A;  2SAR A;  3WR2 A;  1I0X A;  1LNI A;  1BRI A;  1HZ1 A;  4HOH A;  4BIR A;  1RGE A;  1RCL A;  1DE3 A;  2F5W A;  1IYY A;  1B21 A;  1RGG A;  5GSP A;  2BU4 A;  1BRG A;  1HYF A;  1I70 A;  1RSN A;  1X1U A;  1YNV X;  3BU4 A;  4RNT A;  2KF5 A;  1B2U A;  1RGK A;  1I2F A;  1AY7 A;  3AHW A;  1BSB A;  3D5I A;  1JBT A;  3HOH A;  1UCK A;  2HOH A;  1B20 A;  1TTO A;  1LRA A;  1GMQ A;  1C54 A;  1G02 A;  1UCJ A;  1RNT A;  1RCK A;  1LOV A;  1I0V A;  1I3F A;  1YVS A;  2AAD A;  3A5E A;  1FUS A;  1BRJ A;  1UCL A;  1FW7 A;  5BU4 A;  1FYS A;  3RNT A;  1BVI A;  1BRK A;  1PY3 A;  3AHS A;  1Q9E A;  1BSA A;  1LOY A;  1GMR A;  2F4Y A;  3Q3F A;  1BAO A;  1BNF A;  3D4A A;  1I2E A;  3DH2 A;  1BU4 A;  1UCI A;  1R4Y A;  1B2X A;  2BIR A;  9RNT A;  1BNR A;  1BSC A;  1AQZ A;  1BRN L;  6RNT A;  6GSP A;  1B27 A;  1RGH A;  1RN1 A;  2KAA A;  4J5G A;  1CH0 A;  1RDS A;  5BIR A;  3D5G A;  1BSD A;  1LOW A;  1MGW A;  1RGL A;  2AAE A;  2F56 A;  1X1X A;  1RNB A;  1RHL A;  1SAR A;  3AGN A;  3SYU A;  1A2P A;  2RBI A;  1JBR A;  1BIR A;  1FZU A;  3DGY A;  1RGC A;  1RMS A;  1RLS A;  1ZGX A;  1B2S A;  1RN4 A;  1BNG A;  1B2Z A;  4GHO A;  1GSP A;  1BNI A;  1GOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...