1ZGXA

Crystal structure of ribonuclease mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Surface mutation Gln to Lys changed the crystal packing
rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1zgxA00
4BIRA 1I70A 1LOWA 1RGAA 2C4BA 1TRQA 1BRGA 1I0VA 1X1WA 1RGCA 1B21A 7GSPA 3A5EA 1BNIA 1SARA 3SYUA 1IYYA 1GOUA 1BSAA 1A2PA 1G02A 1RLSA 2GSPA 5RNTA 1GOVA 1LOYA 3AHSA 1TRPA 4HOHA 1LOVA 3BU4A 1MGWA 3D5IA 7RNTA 1B2MA 1Q9EA 1BUJA 2KAAA 1BAOA 1FUSA 2HOHA 3DGYA 3D5GA 1AY7A 1YVSA 1RDSA 3D4AA 3AHWA 1BANA 1BSDA 1UCLA 6GSPA 1I3IA 1I0XA 3HOHA 1B27A 1BIRA 1BRKA 3WR2A 1BU4A 3Q3FA 1RGHA 1FZUA 1B20A 1UCKA 3WHOA 1X1YA 1RN4A 9RNTA 3GSPA 1BRJA 2KF6A 1RGLA 1YNVX 3BIRA 1PY3A 1TTOA 2F56A 1B2XA 2F4YA 1GMPA 1BSCA 2F5WA 1RGKA 5GSPA 1I8VA 1RGEA 1RGFA 1BRHA 2BU4A 1RNTA 1LRAA 1T2HA 1FW7A 1RGGA 4GHOA 1RCLA 1X1UA 1CH0A 1HZ1A 1X1XA 1BSBA 1RN1A 4RNTA 1BOXA 1I2EA 1RMSA 2KF3A 6RNTA 1FUTA 1ZGXA 1GMRA 8RNTA 1MGRA 1B2UA 1C54A 1R4YA 4BU4A 1HYFA 3DH2A 1JBTA 1RNBA 1RSNA 1B2SA 1BNGA 3RNTA 1JBRA 1GSPA 1I2FA 1BRIA 1RCKA 1BNRA 1BVIA 1RTUA 1UCIA 2AAEA 4HAAA 2RBIA 1BRSA 1BNSA 5HOHA 1B2ZA 2ZA4A 1BGSA 1FYSA 2KF5A 2RNTA 2SARA 4GSPA 2KF4A 1RHLA 1DETA 4J5GA 1I2GA 4J5KA 1BNFA 2BIRA 1JBSA 1BRNL 1GOYA 1PYLA 1GMQA 2F5MA 1BNEA 1LNIA 1T2IA 5BIRA 1I3FA 1UCJA 1AQZA 1BNJA 3KCHA 1B3SA 1BSEA 2AADA 1YGWA 5BU4A 1DE3A 3URPA 3AGOA 3AGNA
chains in the Genus database with same CATH superfamily
1CQSA 1S5AA 2FNQA 2HMJB 1GY6A 4HYZA 1LNHA 4HM0B 4FCJA 1QVF2 2C4BA 1TRQA 1SQWA 1HKXA 1JJ22 1WQLB 1I0VA 5JBSA 5AI1A 1W4NA 3D79A 5IG3A 3IPTA 5IEOA 3WODG 3GWRA 3SYUA 4GB5A 1HU9A 3NUVA 3X42A 3CC43 1A2PA 1G02A 1Q814 2HMKB 2XFSA 4GL6A 2XH9A 3QRDA 3BU4A 1MGWA 3D5IA 4DKIA 4HM4B 1B2MA 2KAAA 3DGMA 4R1KA 1BAOA 1JKGB 1K9M4 3DGYA 3TDGA 3NBJA 1E3RA 1RDSA 2BO9B 3RDEA 2V1LA 2I9WA 2BHMA 1OF5A 1UCLA 1YHQ3 2P05A 3FGYA 2O9UX 4HM2B 1SIIA 1YJN3 2GEYA 4G1MB 2CH9A 4L8OA 3WR2A 4HM7B 1RGHA 1FZUA 4HBRA 4FMBA 1IVVA 1QMAA 3WHOA 2INXA 3EX9A 1VQM3 2GU3A 3GAXA 1RN4A 3CCR3 1GD4A 4CJNA 2D1WA 3FH1A 3UJMA 1J2BA 3SX1A 8CHOA 1OGXA 1RJOA 1U5OA 2Y74A 1PY3A 2Z77A 3H51A 3HX8A 1TTOA 3NQZA 5AYRB 3G6E3 3D9RA 3CPOA 5DREA 2F4YA 1YJW3 2W56B 1ZO2A 1QAFA 2F5WA 3PGBA 2XEPA 1KSIA 1ZS7A 1IVUA 1RGFA 1RKYA 1BRHA 3JUNA 1RNTA 3GZYB 3CU3A 3PZWA 1T2HA 3CCE3 1FW7A 1UGHI 1STFI 4GHOA 5TGNA 1K8A4 5IG5A 1D6ZA 3WMDA 1X1XA 4EV2A 4IIAA 2CW9A 3DUKA 4RNTA 3RGRA 3UB1A 1DMQA 3UL5A 5AEUB 1FUTA 5LC6A 2CX0A 4CCVA 3MHEA 4XDWA 3K0ZA 1STDA 3VSYA 2RCDA 2IUJA 1JBTA 5IEPA 4CDLA 2BT3A 3G16A 4LYLB 1OH0A 1NB5I 1RNBA 5CLKA 1GSPA 4N6MA 4WYKA 1Q864 3U1WA 3WDGB 1V74A 2CWVA 3OV4A 3CCM3 1BVIA 1IU7A 2CG0A 3EE1A 4MMYB 1UCIA 2AAEA 2HMMB 3EHCA 4HM6B 3HI7A 3WOFB 1R4CA 2XFTA 1BNSA 3KZTA 4XBXA 1B2ZA 3DXOA 3T0UA 1VQO3 1A90A 4HJLB 1BGSA 2CX1A 2SARA 4J5GA 3CCJ3 1Q7HA 1DETA 1RHLA 2Z76A 2XR8B 2BIRA 1RRHA 3CCU3 1EA2A 1VQ73 3JUQA 1BRNL 1PYLA 3FLJA 3DZLA 2E2UA 3LTCA 1O7PB 1N8QA 1JV2B 3N9HA 1UI8A 1LXEA 4N3VA 2ZDJA 1I3FA 1UCJA 3O8YA 1BNJA 4HM3B 1EQKA 2WOFA 3PCSA 3Q2PA 4IT7A 5AIFA 2AADA 4FMAA 3SOAA 2OQEA 1YIJ3 1WNHA 4KFDA 3H3HA 1AR0A 1PFPA 3AGOA 5AIGA 4WWUC 3L0RA 3GZBA 4BIRA 1M1K4 1I70A 3SOYA 1L5GB 4N6V0 3MG2A 1FA3A 4AKYA 1S723 2OTL3 3CCQ3 3UNLA 3LMLA 1BRGA 3MYTA 1YI23 1X1WA 4PEJA 1CEWI 2IMJA 2WO0A 2J8XB 6STDA 4AKZA 4CPKA 1UW1A 4MMZB 1GY5A 3A5EA 4BTYA 1FGTA 5IF6A 1VQQA 2GBXB 2M7OA 3SXXA 1YJ93 3DMCA 4LGQA 1NO3A 1LOYA 1TRPA 4HOHA 2IA7A 5D82A 2QGUA 1VQ93 3U97A 2WGOA 1Q9EA 1V57A 2FGTA 3KIIA 3ZG0A 3D3LA 2P0XA 5AEWB 1OHPA 1Q824 3NXJA 3S5CA 1OPYA 4K1VA 1JN5B 2L4VA 2W56A 3EN1B 7STDA 1VQ83 3G713 1GD3A 1I3IA 1ROAA 1D6YA 2QEX3 1BIRA 1DYUA 1EUIC 1BRKA 1FGRA 1VQK3 1IVXA 3Q3FA 3NX0A 2BMQB 2L1SA 2JQ5A 4AEQA 3G4S3 3GZXB 3V92A 3X40A 4JRFA 2OQEC 4I4KA 3F40A 5IG0A 3BIRA 1RGLA 1YNVX 2CFGA 4N6TA 3BLZA 3OWUA 2RGQA 1B2XA 1E97A 2ML6A 1OHOA 3F7SA 1Q40B 1KQS2 3CCL3 3KE7A 5M18A 1GYBA 1YVBI 1RGKA 2YX9A 3OX9A 5GSPA 1RGEA 2W9QA 4MMXB 1VQN3 5IW9A 2XSOB 1LRAA 2F98A 1VZZA 3K7CA 1VQ63 1OACA 1X1UA 2H0IA 2P0MA 4FR9A 3CC23 1OGZA 1RN1A 5DRVA 3DGOA 1I2EA 4HM8B 1ASKA 1W2ZA 2KF3A 2RFRA 2CFWA 1FGMA 3HZPA 8RNTA 1N5PA 1IQYA 1B2UA 1MWTA 4I5QA 3AMOB 4BL2A 1QJGA 2MF7A 2CC3A 1O7HB 2K0MA 1EG9B 1A2VA 1HYFA 3N8BA 4BU4A 1IVWA 1JRQA 3WA3A 1C7HA 1IDPA 1W01A 3EBYA 1JBRA 1E3VA 1UGIA 2CWUA 4N6NB 2XF3A 1BRIA 3MKIA 1Q42A 4R9KA 1RTUA 2F99A 3LT8A 4N6LA 4HAAA 2RBIA 2BMOB 2B24B 3F7XA 4K90B 5HOHA 1ULIB 3CD63 2W03A 1O7GB 3GZRA 4FMCA 4LEHA 2UUGC 4X2OA 1IQ8A 1NDOB 2KF4A 1W6GA 4JF8A 5BVBA 3B4OA 1BNFA 1VQP3 1MWSA 3NM2A 3SEDA 1MNLA 1OUNA 2BNGA 3EC9A 4ZM8A 1N9EA 1FGOA 3FCSB 2H0HA 5EQLA 3IJEB 2F5MA 1BNEA 1LNIA 1T2IA 3LOYA 4K61A 1ULJB 1AQZA 3F8HA 2YFLB 1EEJA 1TUHA 1U8CB 2YFJB 3KCHA 5D81A 1KD14 1K28A 3KSED 5BU4A 1M904 1DE3A 4WFOA 1WMPA 1VQL3 3OWSA 3URPA 1OHSA 1NU3A 3JUMA 4BTXA 2B1XB 3MPHA 3LYGA 4LMIA 3PCRA 1LOWA 3E99A 4LSOA 4XDVA 5STDA 1RGAA 3CXC2 1AVLA 1M9GA 3B4PA 3BNCA 4EW5A 2H0GA 3DM8A 2Z7AA 2W04A 1RGCA 3CNXA 1B21A 2CG1A 2PZVA 5G2GA 1W00A 1JN5A 7GSPA 3S29A 2CFDA 1SARA 4EBGA 2Q07A 1IT7A 4KZ1A 5CK6A 1NNVA 2Y73A 1BSAA 2UX0A 1RLSA 2IY2A 2ML5A 3CME3 3G0KA 1GOVA 5ELJA 2E2VA 2C11A 1UI7A 2OOVA 1JB5A 1Z1SA 1IV7A 1LOXA 1BUJA 2CHCA 5FW5A 3KFQC 3F8XA 1PU4A 3T8UA 3LTDA 3S28A 3IMAB 3D4AA 1ZX2A 5BXQA 2IUKA 2GEXA 3A76A 1Q40A 2ZL8A 3BNBA 4KT3B 2STDA 1BSDA 3I563 3S27A 1A2KA 2D42A 1I0XA 5CF1A 1B27A 2K54A 3ER7A 1MWRA 1BU4A 3NBRA 5FGOA 3CPW2 2FXTA 5KP4A 1B20A 3MWZA 1UCKA 1QALA 1UUVB 2CK3H 3EBTA 5AIIA 4NREA 1JZOA 1TJDA 9RNTA 1IQXA 3FG3A 1BRJA 1SJWA 3LXUX 2KF6A 3UL6A 5JPUA 3NBBA 4EXRA 4KVHA 1TU5A 1US1A 1DVCA 1JZDA 1NB3I 3QK9A 2KCDA 3EQQB 3ZG5A 4N6OB 3K63A 1T5YA 3AMOA 3FG1A 2GBWB 2W6JH 3NV0B 1I8VA 5G1KA 1G96A 3EN8A 4STDA 2XGLA 3FKAA 1K734 4HM5B 2BU4A 3LTAA 2RSXA 4RZMA 3I553 2IYJA 2Z6BA 3DY5A 3MSOA 4L7KA 4U13A 5CXOA 1RCLA 5KP3A 2QIYA 3T8NA 1G0TA 3X3XA 1NWWA 1BSBA 1W6CA 3JVCA 5AIHA 3F9SA 2OWPA 2PNCA 3SVAA 1IK3A 1RMSA 2OOVC 1CYVA 3LTBA 5CF2A 1C54A 4XBTA 3CC73 1R4YA 1QAKA 5EEOA 3ALAA 4NPBA 4J9AA 3K9MC 3HIIA 3ZFZA 4EC6A 1BNGA 3KSPA 3RNTA 3ROBA 1N5HA 4EYCA 1BNRA 1RRLA 3G8ZA 4LZIA 1UUGB 5M1AA 4FCZA 4N6UA 1KWIA 2C10A 2HMLB 1SPUA 1Y4KA 4FMDA 3DGLA 2P38A 2ZA4A 1EKMA 1O7NB 2O3OA 3NQYA 4R4KA 1YGEA 4O2HA 1YIT3 1I2GA 4O02B 1JBSA 1WTHA 1VQ53 4H61A 1GOYA 3BB9A 3S67A 1JB4A 1UUWB 2WOHA 4XB5A 5ELUA 5G1LA 4ORLA 1BUQA 1GMQA 4R80A 3CNMA 1V58A 2ZHXB 1D6UA 4HKVB 4HZBB 1CYUA 5M19A 1BSEA 1YGWA 1NJI4 4HVNA 5HGRA 3X41A 1SIHA 3GRDA 2CFLA 3J7Yd 3JUOA 1WMOA 3N54B 2MC8A 2A15A 1GS3A 3ECFA 3CMA3 1W6YA 2GXFA 3PXMA 1TFOA 4OK0A 5JPPA 1O7WB 5AYSC 4WHAA 3BNDA 3VF1A 3SLUA 4KFEA 2W9PA 4XM4A 3FSDA 3NHXA 3V98A 2BMRB 1O7MB 1DMMA 1LQGC 4RBNA 3V99A 1IT8A 3PS8A 1BNIA 2HMOB 3CCV3 4H3UA 4TX4A 1GOUA 2UGIA 4K1UA 2CKFB 4OVMA 2GSPA 4BTWA 1IYYA 3Q90A 5RNTA 3AHSA 3K5TA 5D83A 1LOVA 2W0QA 3HIGA 2K3DA 5EVHA 7RNTA 3BNEA 2OCTA 1DVDA 1FUSA 2HOHA 4EV5A 3KKGA 1AV4A 3D5GA 1AY7A 1F8NA 1M1XB 1YVSA 4OUQA 3EJVA 1N9JA 3AHWA 1BANA 3NV0A 4XBYA 3Q1CA 2E2TA 1MWUA 6GSPA 5A0OB 3HOHA 2HMNB 1A67A 5I97A 5IG4A 1W02A 1ISKA 3KN4A 4QWTA 1FGQA 1MOLA 2W2CA 1X1YA 2JDIH 2XRXB 4O3VA 3VGNA 4IPBA 3GSPA 4X2HA 1OCVA 3HK4A 1GY7A 3RGAA 1UDII 3X3YA 2F56A 4MEIA 3OWYA 3MG1A 1W2B2 1GMPA 3NM7A 1BSCA 1OF5B 1LVNA 1TFKA 2KXGA 2R41A 1FUWA 2R4IA 3FF2A 4ILFA 3WA2X 1RN7A 2LYXA 1JB2A 1RGGA 3LZAA 3WOEB 1CH0A 3JUPA 1HZ1A 4Q53A 2XGNA 1BOXA 3FZWA 6RNTA 3EF8A 1ZGXA 1GMRA 1MGRA 2YFIB 5IENA 3X3ZA 2QA43 3EB8A 3DH2A 3CCS3 3MG3A 1JNQA 2WGQA 1IV9A 1RSNA 1B2SA 5LC7A 4KFFA 1N8R4 1VQ43 1I2FA 4FCMA 1RCKA 1W5ZA 4RNYA 3M8CA 3LH4A 4J8TA 2OTJ3 3PYJA 3B8LA 1AVKA 1BRSA 1WMNA 2F86B 2CFKA 3F14A 1FYSA 1JKGA 2KF5A 1TP6A 2RNTA 4GSPA 4HM1B 3STDA 4R9LA 1DMNA 4BL3A 4L8PA 4J5KA 1T3BA 1QVG2 1LQMB 5IERA 4RNZA 3B7CA 2XSHB 4NHFA 2SBLA 3FF0A 4WP5A 4WYKB 3FG4A 2GU1A 2KRTA 5BIRA 4HZ9B 2P09A 1Q7Y4 4MJDA 4O8SA 3DGNA 2CIUA 1ROVA 1B3SA 2CWTA 1KC84 3OXAA 1TIJA 3LT9A 3OW22 1W7CA 2LQVA 3I0YA 5KP1A 1K41A 3AGNA
chains in the Genus database with same CATH topology
4BIRA 1I70A 1LOWA 1RGAA 2C4BA 1TRQA 1BRGA 1I0VA 1X1WA 1RGCA 1B21A 7GSPA 3A5EA 1BNIA 1SARA 3SYUA 1IYYA 1GOUA 1BSAA 1A2PA 1G02A 1RLSA 2GSPA 5RNTA 1GOVA 1LOYA 3AHSA 1TRPA 4HOHA 1LOVA 3BU4A 1MGWA 3D5IA 7RNTA 1B2MA 1Q9EA 1BUJA 2KAAA 1BAOA 1FUSA 2HOHA 3DGYA 3D5GA 1AY7A 1YVSA 1RDSA 3D4AA 3AHWA 1BANA 1BSDA 1UCLA 6GSPA 1I3IA 1I0XA 3HOHA 1B27A 1BIRA 1BRKA 3WR2A 1BU4A 3Q3FA 1RGHA 1FZUA 1B20A 1UCKA 3WHOA 1X1YA 1RN4A 9RNTA 3GSPA 1BRJA 2KF6A 1RGLA 1YNVX 3BIRA 1PY3A 1TTOA 2F56A 1B2XA 2F4YA 1GMPA 1BSCA 2F5WA 1RGKA 5GSPA 1I8VA 1RGEA 1RGFA 1BRHA 2BU4A 1RNTA 1LRAA 1T2HA 1FW7A 1RGGA 4GHOA 1RCLA 1X1UA 1CH0A 1HZ1A 1X1XA 1BSBA 1RN1A 4RNTA 1BOXA 1I2EA 1RMSA 2KF3A 6RNTA 1FUTA 1ZGXA 1GMRA 8RNTA 1MGRA 1B2UA 1C54A 1R4YA 4BU4A 1HYFA 3DH2A 1JBTA 1RNBA 1RSNA 1B2SA 1BNGA 3RNTA 1JBRA 1GSPA 1I2FA 1BRIA 1RCKA 1BNRA 1BVIA 1RTUA 1UCIA 2AAEA 4HAAA 2RBIA 1BRSA 1BNSA 5HOHA 1B2ZA 2ZA4A 1BGSA 1FYSA 2KF5A 2RNTA 2SARA 4GSPA 2KF4A 1RHLA 1DETA 4J5GA 1I2GA 4J5KA 1BNFA 2BIRA 1JBSA 1BRNL 1GOYA 1PYLA 1GMQA 2F5MA 1BNEA 1LNIA 1T2IA 5BIRA 1I3FA 1UCJA 1AQZA 1BNJA 3KCHA 1B3SA 1BSEA 2AADA 1YGWA 5BU4A 1DE3A 3URPA 3AGOA 3AGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIR A;  1I70 A;  1LOW A;  1RGA A;  2C4B A;  1TRQ A;  1BRG A;  1I0V A;  1X1W A;  1RGC A;  1B21 A;  7GSP A;  3A5E A;  1BNI A;  1SAR A;  3SYU A;  1IYY A;  1GOU A;  1BSA A;  1A2P A;  1G02 A;  1RLS A;  2GSP A;  5RNT A;  1GOV A;  1LOY A;  3AHS A;  1TRP A;  4HOH A;  1LOV A;  3BU4 A;  1MGW A;  3D5I A;  7RNT A;  1B2M A;  1Q9E A;  1BUJ A;  2KAA A;  1BAO A;  1FUS A;  2HOH A;  3DGY A;  3D5G A;  1AY7 A;  1YVS A;  1RDS A;  3D4A A;  3AHW A;  1BAN A;  1BSD A;  1UCL A;  6GSP A;  1I3I A;  1I0X A;  3HOH A;  1B27 A;  1BIR A;  1BRK A;  3WR2 A;  1BU4 A;  3Q3F A;  1RGH A;  1FZU A;  1B20 A;  1UCK A;  3WHO A;  1X1Y A;  1RN4 A;  9RNT A;  3GSP A;  1BRJ A;  2KF6 A;  1RGL A;  1YNV X;  3BIR A;  1PY3 A;  1TTO A;  2F56 A;  1B2X A;  2F4Y A;  1GMP A;  1BSC A;  2F5W A;  1RGK A;  5GSP A;  1I8V A;  1RGE A;  1RGF A;  1BRH A;  2BU4 A;  1RNT A;  1LRA A;  1T2H A;  1FW7 A;  1RGG A;  4GHO A;  1RCL A;  1X1U A;  1CH0 A;  1HZ1 A;  1X1X A;  1BSB A;  1RN1 A;  4RNT A;  1BOX A;  1I2E A;  1RMS A;  2KF3 A;  6RNT A;  1FUT A;  1ZGX A;  1GMR A;  8RNT A;  1MGR A;  1B2U A;  1C54 A;  1R4Y A;  4BU4 A;  1HYF A;  3DH2 A;  1JBT A;  1RNB A;  1RSN A;  1B2S A;  1BNG A;  3RNT A;  1JBR A;  1GSP A;  1I2F A;  1BRI A;  1RCK A;  1BNR A;  1BVI A;  1RTU A;  1UCI A;  2AAE A;  4HAA A;  2RBI A;  1BRS A;  1BNS A;  5HOH A;  1B2Z A;  2ZA4 A;  1BGS A;  1FYS A;  2KF5 A;  2RNT A;  2SAR A;  4GSP A;  2KF4 A;  1RHL A;  1DET A;  4J5G A;  1I2G A;  4J5K A;  1BNF A;  2BIR A;  1JBS A;  1BRN L;  1GOY A;  1PYL A;  1GMQ A;  2F5M A;  1BNE A;  1LNI A;  1T2I A;  5BIR A;  1I3F A;  1UCJ A;  1AQZ A;  1BNJ A;  3KCH A;  1B3S A;  1BSE A;  2AAD A;  1YGW A;  5BU4 A;  1DE3 A;  3URP A;  3AGO A;  3AGN A; 
#chains in the Genus database with same CATH topology
 1CQS A;  1S5A A;  2FNQ A;  2HMJ B;  1GY6 A;  4HYZ A;  1LNH A;  4HM0 B;  4FCJ A;  1QVF 2;  2C4B A;  1TRQ A;  1SQW A;  1HKX A;  1JJ2 2;  1WQL B;  1I0V A;  5JBS A;  5AI1 A;  1W4N A;  3D79 A;  5IG3 A;  3IPT A;  5IEO A;  3WOD G;  3GWR A;  3SYU A;  4GB5 A;  1HU9 A;  3NUV A;  3X42 A;  3CC4 3;  1A2P A;  1G02 A;  1Q81 4;  2HMK B;  2XFS A;  4GL6 A;  2XH9 A;  3QRD A;  3BU4 A;  1MGW A;  3D5I A;  4DKI A;  4HM4 B;  1B2M A;  2KAA A;  3DGM A;  4R1K A;  1BAO A;  1JKG B;  1K9M 4;  3DGY A;  3TDG A;  3NBJ A;  1E3R A;  1RDS A;  2BO9 B;  3RDE A;  2V1L A;  2I9W A;  2BHM A;  1OF5 A;  1UCL A;  1YHQ 3;  2P05 A;  3FGY A;  2O9U X;  4HM2 B;  1SII A;  1YJN 3;  2GEY A;  4G1M B;  2CH9 A;  4L8O A;  3WR2 A;  4HM7 B;  1RGH A;  1FZU A;  4HBR A;  4FMB A;  1IVV A;  1QMA A;  3WHO A;  2INX A;  3EX9 A;  1VQM 3;  2GU3 A;  3GAX A;  1RN4 A;  3CCR 3;  1GD4 A;  4CJN A;  2D1W A;  3FH1 A;  3UJM A;  1J2B A;  3SX1 A;  8CHO A;  1OGX A;  1RJO A;  1U5O A;  2Y74 A;  1PY3 A;  2Z77 A;  3H51 A;  3HX8 A;  1TTO A;  3NQZ A;  5AYR B;  3G6E 3;  3D9R A;  3CPO A;  5DRE A;  2F4Y A;  1YJW 3;  2W56 B;  1ZO2 A;  1QAF A;  2F5W A;  3PGB A;  2XEP A;  1KSI A;  1ZS7 A;  1IVU A;  1RGF A;  1RKY A;  1BRH A;  3JUN A;  1RNT A;  3GZY B;  3CU3 A;  3PZW A;  1T2H A;  3CCE 3;  1FW7 A;  1UGH I;  1STF I;  4GHO A;  5TGN A;  1K8A 4;  5IG5 A;  1D6Z A;  3WMD A;  1X1X A;  4EV2 A;  4IIA A;  2CW9 A;  3DUK A;  4RNT A;  3RGR A;  3UB1 A;  1DMQ A;  3UL5 A;  5AEU B;  1FUT A;  5LC6 A;  2CX0 A;  4CCV A;  3MHE A;  4XDW A;  3K0Z A;  1STD A;  3VSY A;  2RCD A;  2IUJ A;  1JBT A;  5IEP A;  4CDL A;  2BT3 A;  3G16 A;  4LYL B;  1OH0 A;  1NB5 I;  1RNB A;  5CLK A;  1GSP A;  4N6M A;  4WYK A;  1Q86 4;  3U1W A;  3WDG B;  1V74 A;  2CWV A;  3OV4 A;  3CCM 3;  1BVI A;  1IU7 A;  2CG0 A;  3EE1 A;  4MMY B;  1UCI A;  2AAE A;  2HMM B;  3EHC A;  4HM6 B;  3HI7 A;  3WOF B;  1R4C A;  2XFT A;  1BNS A;  3KZT A;  4XBX A;  1B2Z A;  3DXO A;  3T0U A;  1VQO 3;  1A90 A;  4HJL B;  1BGS A;  2CX1 A;  2SAR A;  4J5G A;  3CCJ 3;  1Q7H A;  1DET A;  1RHL A;  2Z76 A;  2XR8 B;  2BIR A;  1RRH A;  3CCU 3;  1EA2 A;  1VQ7 3;  3JUQ A;  1BRN L;  1PYL A;  3FLJ A;  3DZL A;  2E2U A;  3LTC A;  1O7P B;  1N8Q A;  1JV2 B;  3N9H A;  1UI8 A;  1LXE A;  4N3V A;  2ZDJ A;  1I3F A;  1UCJ A;  3O8Y A;  1BNJ A;  4HM3 B;  1EQK A;  2WOF A;  3PCS A;  3Q2P A;  4IT7 A;  5AIF A;  2AAD A;  4FMA A;  3SOA A;  2OQE A;  1YIJ 3;  1WNH A;  4KFD A;  3H3H A;  1AR0 A;  1PFP A;  3AGO A;  5AIG A;  4WWU C;  3L0R A;  3GZB A;  4BIR A;  1M1K 4;  1I70 A;  3SOY A;  1L5G B;  4N6V 0;  3MG2 A;  1FA3 A;  4AKY A;  1S72 3;  2OTL 3;  3CCQ 3;  3UNL A;  3LML A;  1BRG A;  3MYT A;  1YI2 3;  1X1W A;  4PEJ A;  1CEW I;  2IMJ A;  2WO0 A;  2J8X B;  6STD A;  4AKZ A;  4CPK A;  1UW1 A;  4MMZ B;  1GY5 A;  3A5E A;  4BTY A;  1FGT A;  5IF6 A;  1VQQ A;  2GBX B;  2M7O A;  3SXX A;  1YJ9 3;  3DMC A;  4LGQ A;  1NO3 A;  1LOY A;  1TRP A;  4HOH A;  2IA7 A;  5D82 A;  2QGU A;  1VQ9 3;  3U97 A;  2WGO A;  1Q9E A;  1V57 A;  2FGT A;  3KII A;  3ZG0 A;  3D3L A;  2P0X A;  5AEW B;  1OHP A;  1Q82 4;  3NXJ A;  3S5C A;  1OPY A;  4K1V A;  1JN5 B;  2L4V A;  2W56 A;  3EN1 B;  7STD A;  1VQ8 3;  3G71 3;  1GD3 A;  1I3I A;  1ROA A;  1D6Y A;  2QEX 3;  1BIR A;  1DYU A;  1EUI C;  1BRK A;  1FGR A;  1VQK 3;  1IVX A;  3Q3F A;  3NX0 A;  2BMQ B;  2L1S A;  2JQ5 A;  4AEQ A;  3G4S 3;  3GZX B;  3V92 A;  3X40 A;  4JRF A;  2OQE C;  4I4K A;  3F40 A;  5IG0 A;  3BIR A;  1RGL A;  1YNV X;  2CFG A;  4N6T A;  3BLZ A;  3OWU A;  2RGQ A;  1B2X A;  1E97 A;  2ML6 A;  1OHO A;  3F7S A;  1Q40 B;  1KQS 2;  3CCL 3;  3KE7 A;  5M18 A;  1GYB A;  1YVB I;  1RGK A;  2YX9 A;  3OX9 A;  5GSP A;  1RGE A;  2W9Q A;  4MMX B;  1VQN 3;  5IW9 A;  2XSO B;  1LRA A;  2F98 A;  1VZZ A;  3K7C A;  1VQ6 3;  1OAC A;  1X1U A;  2H0I A;  2P0M A;  4FR9 A;  3CC2 3;  1OGZ A;  1RN1 A;  5DRV A;  3DGO A;  1I2E A;  4HM8 B;  1ASK A;  1W2Z A;  2KF3 A;  2RFR A;  2CFW A;  1FGM A;  3HZP A;  8RNT A;  1N5P A;  1IQY A;  1B2U A;  1MWT A;  4I5Q A;  3AMO B;  4BL2 A;  1QJG A;  2MF7 A;  2CC3 A;  1O7H B;  2K0M A;  1EG9 B;  1A2V A;  1HYF A;  3N8B A;  4BU4 A;  1IVW A;  1JRQ A;  3WA3 A;  1C7H A;  1IDP A;  1W01 A;  3EBY A;  1JBR A;  1E3V A;  1UGI A;  2CWU A;  4N6N B;  2XF3 A;  1BRI A;  3MKI A;  1Q42 A;  4R9K A;  1RTU A;  2F99 A;  3LT8 A;  4N6L A;  4HAA A;  2RBI A;  2BMO B;  2B24 B;  3F7X A;  4K90 B;  5HOH A;  1ULI B;  3CD6 3;  2W03 A;  1O7G B;  3GZR A;  4FMC A;  4LEH A;  2UUG C;  4X2O A;  1IQ8 A;  1NDO B;  2KF4 A;  1W6G A;  4JF8 A;  5BVB A;  3B4O A;  1BNF A;  1VQP 3;  1MWS A;  3NM2 A;  3SED A;  1MNL A;  1OUN A;  2BNG A;  3EC9 A;  4ZM8 A;  1N9E A;  1FGO A;  3FCS B;  2H0H A;  5EQL A;  3IJE B;  2F5M A;  1BNE A;  1LNI A;  1T2I A;  3LOY A;  4K61 A;  1ULJ B;  1AQZ A;  3F8H A;  2YFL B;  1EEJ A;  1TUH A;  1U8C B;  2YFJ B;  3KCH A;  5D81 A;  1KD1 4;  1K28 A;  3KSE D;  5BU4 A;  1M90 4;  1DE3 A;  4WFO A;  1WMP A;  1VQL 3;  3OWS A;  3URP A;  1OHS A;  1NU3 A;  3JUM A;  4BTX A;  2B1X B;  3MPH A;  3LYG A;  4LMI A;  3PCR A;  1LOW A;  3E99 A;  4LSO A;  4XDV A;  5STD A;  1RGA A;  3CXC 2;  1AVL A;  1M9G A;  3B4P A;  3BNC A;  4EW5 A;  2H0G A;  3DM8 A;  2Z7A A;  2W04 A;  1RGC A;  3CNX A;  1B21 A;  2CG1 A;  2PZV A;  5G2G A;  1W00 A;  1JN5 A;  7GSP A;  3S29 A;  2CFD A;  1SAR A;  4EBG A;  2Q07 A;  1IT7 A;  4KZ1 A;  5CK6 A;  1NNV A;  2Y73 A;  1BSA A;  2UX0 A;  1RLS A;  2IY2 A;  2ML5 A;  3CME 3;  3G0K A;  1GOV A;  5ELJ A;  2E2V A;  2C11 A;  1UI7 A;  2OOV A;  1JB5 A;  1Z1S A;  1IV7 A;  1LOX A;  1BUJ A;  2CHC A;  5FW5 A;  3KFQ C;  3F8X A;  1PU4 A;  3T8U A;  3LTD A;  3S28 A;  3IMA B;  3D4A A;  1ZX2 A;  5BXQ A;  2IUK A;  2GEX A;  3A76 A;  1Q40 A;  2ZL8 A;  3BNB A;  4KT3 B;  2STD A;  1BSD A;  3I56 3;  3S27 A;  1A2K A;  2D42 A;  1I0X A;  5CF1 A;  1B27 A;  2K54 A;  3ER7 A;  1MWR A;  1BU4 A;  3NBR A;  5FGO A;  3CPW 2;  2FXT A;  5KP4 A;  1B20 A;  3MWZ A;  1UCK A;  1QAL A;  1UUV B;  2CK3 H;  3EBT A;  5AII A;  4NRE A;  1JZO A;  1TJD A;  9RNT A;  1IQX A;  3FG3 A;  1BRJ A;  1SJW A;  3LXU X;  2KF6 A;  3UL6 A;  5JPU A;  3NBB A;  4EXR A;  4KVH A;  1TU5 A;  1US1 A;  1DVC A;  1JZD A;  1NB3 I;  3QK9 A;  2KCD A;  3EQQ B;  3ZG5 A;  4N6O B;  3K63 A;  1T5Y A;  3AMO A;  3FG1 A;  2GBW B;  2W6J H;  3NV0 B;  1I8V A;  5G1K A;  1G96 A;  3EN8 A;  4STD A;  2XGL A;  3FKA A;  1K73 4;  4HM5 B;  2BU4 A;  3LTA A;  2RSX A;  4RZM A;  3I55 3;  2IYJ A;  2Z6B A;  3DY5 A;  3MSO A;  4L7K A;  4U13 A;  5CXO A;  1RCL A;  5KP3 A;  2QIY A;  3T8N A;  1G0T A;  3X3X A;  1NWW A;  1BSB A;  1W6C A;  3JVC A;  5AIH A;  3F9S A;  2OWP A;  2PNC A;  3SVA A;  1IK3 A;  1RMS A;  2OOV C;  1CYV A;  3LTB A;  5CF2 A;  1C54 A;  4XBT A;  3CC7 3;  1R4Y A;  1QAK A;  5EEO A;  3ALA A;  4NPB A;  4J9A A;  3K9M C;  3HII A;  3ZFZ A;  4EC6 A;  1BNG A;  3KSP A;  3RNT A;  3ROB A;  1N5H A;  4EYC A;  1BNR A;  1RRL A;  3G8Z A;  4LZI A;  1UUG B;  5M1A A;  4FCZ A;  4N6U A;  1KWI A;  2C10 A;  2HML B;  1SPU A;  1Y4K A;  4FMD A;  3DGL A;  2P38 A;  2ZA4 A;  1EKM A;  1O7N B;  2O3O A;  3NQY A;  4R4K A;  1YGE A;  4O2H A;  1YIT 3;  1I2G A;  4O02 B;  1JBS A;  1WTH A;  1VQ5 3;  4H61 A;  1GOY A;  3BB9 A;  3S67 A;  1JB4 A;  1UUW B;  2WOH A;  4XB5 A;  5ELU A;  5G1L A;  4ORL A;  1BUQ A;  1GMQ A;  4R80 A;  3CNM A;  1V58 A;  2ZHX B;  1D6U A;  4HKV B;  4HZB B;  1CYU A;  5M19 A;  1BSE A;  1YGW A;  1NJI 4;  4HVN A;  5HGR A;  3X41 A;  1SIH A;  3GRD A;  2CFL A;  3J7Y d;  3JUO A;  1WMO A;  3N54 B;  2MC8 A;  2A15 A;  1GS3 A;  3ECF A;  3CMA 3;  1W6Y A;  2GXF A;  3PXM A;  1TFO A;  4OK0 A;  5JPP A;  1O7W B;  5AYS C;  4WHA A;  3BND A;  3VF1 A;  3SLU A;  4KFE A;  2W9P A;  4XM4 A;  3FSD A;  3NHX A;  3V98 A;  2BMR B;  1O7M B;  1DMM A;  1LQG C;  4RBN A;  3V99 A;  1IT8 A;  3PS8 A;  1BNI A;  2HMO B;  3CCV 3;  4H3U A;  4TX4 A;  1GOU A;  2UGI A;  4K1U A;  2CKF B;  4OVM A;  2GSP A;  4BTW A;  1IYY A;  3Q90 A;  5RNT A;  3AHS A;  3K5T A;  5D83 A;  1LOV A;  2W0Q A;  3HIG A;  2K3D A;  5EVH A;  7RNT A;  3BNE A;  2OCT A;  1DVD A;  1FUS A;  2HOH A;  4EV5 A;  3KKG A;  1AV4 A;  3D5G A;  1AY7 A;  1F8N A;  1M1X B;  1YVS A;  4OUQ A;  3EJV A;  1N9J A;  3AHW A;  1BAN A;  3NV0 A;  4XBY A;  3Q1C A;  2E2T A;  1MWU A;  6GSP A;  5A0O B;  3HOH A;  2HMN B;  1A67 A;  5I97 A;  5IG4 A;  1W02 A;  1ISK A;  3KN4 A;  4QWT A;  1FGQ A;  1MOL A;  2W2C A;  1X1Y A;  2JDI H;  2XRX B;  4O3V A;  3VGN A;  4IPB A;  3GSP A;  4X2H A;  1OCV A;  3HK4 A;  1GY7 A;  3RGA A;  1UDI I;  3X3Y A;  2F56 A;  4MEI A;  3OWY A;  3MG1 A;  1W2B 2;  1GMP A;  3NM7 A;  1BSC A;  1OF5 B;  1LVN A;  1TFK A;  2KXG A;  2R41 A;  1FUW A;  2R4I A;  3FF2 A;  4ILF A;  3WA2 X;  1RN7 A;  2LYX A;  1JB2 A;  1RGG A;  3LZA A;  3WOE B;  1CH0 A;  3JUP A;  1HZ1 A;  4Q53 A;  2XGN A;  1BOX A;  3FZW A;  6RNT A;  3EF8 A;  1ZGX A;  1GMR A;  1MGR A;  2YFI B;  5IEN A;  3X3Z A;  2QA4 3;  3EB8 A;  3DH2 A;  3CCS 3;  3MG3 A;  1JNQ A;  2WGQ A;  1IV9 A;  1RSN A;  1B2S A;  5LC7 A;  4KFF A;  1N8R 4;  1VQ4 3;  1I2F A;  4FCM A;  1RCK A;  1W5Z A;  4RNY A;  3M8C A;  3LH4 A;  4J8T A;  2OTJ 3;  3PYJ A;  3B8L A;  1AVK A;  1BRS A;  1WMN A;  2F86 B;  2CFK A;  3F14 A;  1FYS A;  1JKG A;  2KF5 A;  1TP6 A;  2RNT A;  4GSP A;  4HM1 B;  3STD A;  4R9L A;  1DMN A;  4BL3 A;  4L8P A;  4J5K A;  1T3B A;  1QVG 2;  1LQM B;  5IER A;  4RNZ A;  3B7C A;  2XSH B;  4NHF A;  2SBL A;  3FF0 A;  4WP5 A;  4WYK B;  3FG4 A;  2GU1 A;  2KRT A;  5BIR A;  4HZ9 B;  2P09 A;  1Q7Y 4;  4MJD A;  4O8S A;  3DGN A;  2CIU A;  1ROV A;  1B3S A;  2CWT A;  1KC8 4;  3OXA A;  1TIJ A;  3LT9 A;  3OW2 2;  1W7C A;  2LQV A;  3I0Y A;  5KP1 A;  1K41 A;  3AGN A; 
#chains in the Genus database with same CATH homology
 4BIR A;  1I70 A;  1LOW A;  1RGA A;  2C4B A;  1TRQ A;  1BRG A;  1I0V A;  1X1W A;  1RGC A;  1B21 A;  7GSP A;  3A5E A;  1BNI A;  1SAR A;  3SYU A;  1IYY A;  1GOU A;  1BSA A;  1A2P A;  1G02 A;  1RLS A;  2GSP A;  5RNT A;  1GOV A;  1LOY A;  3AHS A;  1TRP A;  4HOH A;  1LOV A;  3BU4 A;  1MGW A;  3D5I A;  7RNT A;  1B2M A;  1Q9E A;  1BUJ A;  2KAA A;  1BAO A;  1FUS A;  2HOH A;  3DGY A;  3D5G A;  1AY7 A;  1YVS A;  1RDS A;  3D4A A;  3AHW A;  1BAN A;  1BSD A;  1UCL A;  6GSP A;  1I3I A;  1I0X A;  3HOH A;  1B27 A;  1BIR A;  1BRK A;  3WR2 A;  1BU4 A;  3Q3F A;  1RGH A;  1FZU A;  1B20 A;  1UCK A;  3WHO A;  1X1Y A;  1RN4 A;  9RNT A;  3GSP A;  1BRJ A;  2KF6 A;  1RGL A;  1YNV X;  3BIR A;  1PY3 A;  1TTO A;  2F56 A;  1B2X A;  2F4Y A;  1GMP A;  1BSC A;  2F5W A;  1RGK A;  5GSP A;  1I8V A;  1RGE A;  1RGF A;  1BRH A;  2BU4 A;  1RNT A;  1LRA A;  1T2H A;  1FW7 A;  1RGG A;  4GHO A;  1RCL A;  1X1U A;  1CH0 A;  1HZ1 A;  1X1X A;  1BSB A;  1RN1 A;  4RNT A;  1BOX A;  1I2E A;  1RMS A;  2KF3 A;  6RNT A;  1FUT A;  1ZGX A;  1GMR A;  8RNT A;  1MGR A;  1B2U A;  1C54 A;  1R4Y A;  4BU4 A;  1HYF A;  3DH2 A;  1JBT A;  1RNB A;  1RSN A;  1B2S A;  1BNG A;  3RNT A;  1JBR A;  1GSP A;  1I2F A;  1BRI A;  1RCK A;  1BNR A;  1BVI A;  1RTU A;  1UCI A;  2AAE A;  4HAA A;  2RBI A;  1BRS A;  1BNS A;  5HOH A;  1B2Z A;  2ZA4 A;  1BGS A;  1FYS A;  2KF5 A;  2RNT A;  2SAR A;  4GSP A;  2KF4 A;  1RHL A;  1DET A;  4J5G A;  1I2G A;  4J5K A;  1BNF A;  2BIR A;  1JBS A;  1BRN L;  1GOY A;  1PYL A;  1GMQ A;  2F5M A;  1BNE A;  1LNI A;  1T2I A;  5BIR A;  1I3F A;  1UCJ A;  1AQZ A;  1BNJ A;  3KCH A;  1B3S A;  1BSE A;  2AAD A;  1YGW A;  5BU4 A;  1DE3 A;  3URP A;  3AGO A;  3AGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...