1ZH2A

Crystal structure of the calcium-bound receiver domain of kdp potassium transport system response regulator kdpe
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
120
structure length
120
Chain Sequence
TNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A common dimerization interface in bacterial response regulators KdpE and TorR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords KDP operon transcriptional regulatory protein kdpE
total genus 46
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zh2A00
3GBPA 1BDJA 1JFTA 3E61A 3CKMA 4HNRA 3N0XA 3TO5A 3C3KA 2WRZA 4MS3B 3EGCA 5B3JC 1W9HA 4QYWA 4RK4A 4D6YA 4JA2A 1RNLA 3H5VA 3DZDA 3O1IC 1I3CA 4YRZA 5KQMA 1Z17A 2HQOA 1U0SY 1M5UA 2E4UA 3G1WA 3HZHA 3LTEA 5T7BA 2PAFA 5ED4A 2VYCA 4Q6WA 2FXIA 1DRKA 2A9PA 3B2NA 3QEKA 2KYRA 3LKVA 3DGEC 1UDRA 3SM9A 4Z4CA 1PNRA 4ZYLA 1ZITA 3RVNA 1ISSA 4MRMB 1IIBA 3EAFA 1F4VA 4RWEA 1VRVA 3OLWA 3GBVA 4Z9AA 5GQSA 5TPWB 2FEWB 3FDFA 4EYOA 1KMIY 1Z2DA 1TM2A 4RV5A 2FKAA 4M88A 3IP9A 2QV0A 4MR9B 2OQRA 4KQCA 3VNAA 3S99A 4OLBA 3HUTA 5IBQA 1D1PA 4TN5A 1YVUA 3ILHA 2FSPA 2BGGA 3QLUC 1PNTA 1PHRA 1FFGA 4KMRA 3N8IA 3TB6A 1KGSA 3NHMA 1XHEA 3Q7SA 4RKRA 1TLFA 4HYEA 4YO7A 4IGAA 1M5TA 2LPMA 2E4ZA 1FFWA 4L4UA 2LBPA 5JS2A 2R48A 4MPTA 3QLUA 3HEBA 3O74A 4MAAA 1NXOA 4JAVC 3OO0A 4EVQA 4G0QA 4DQDA 1DG9A 2GWRA 3TMYA 2PL1A 1FQWA 1JBEA 1EAYA 1ZDMA 2CHEA 4UHJA 2WY2D 2Q5CA 1DBQA 2PUAA 1ZH4A 3OQMA 4IMJB 3HM9A 2WMYA 3GRCA 4O1HA 4Z4EA 4LDZA 1BAPA 2O20A 3OLZA 5JNRA 4W5QA 5KQPA 3A3KA 2FQXA 1U8TA 1DZ3A 1DBPA 2JRLA 3OQOA 2RDMA 1YMUA 5BQ3A 3QELB 3LUCA 3QELA 4GNRA 4D6XA 3C3MA 5EWJB 3H1EA 5DLEA 3H5IA 1ABEA 1NXSA 3MA0A 4EY3A 1SRRA 1J56A 3JPWA 3LUJA 3DLHA 4JP1A 5E3JA 5FWXB 3C6QA 3D8UA 3OLXA 4WT7A 5HM6A 1VLZA 1A2OA 4N03A 1ZVVA 1CHNA 3CU5A 5EWLB 4ETNA 2B4AA 2PUDA 3HCWA 3RH0A 3C97A 3LUAA 4OBBA 4N0QA 3Q41A 1NY5A 3CTPA 3TD9A 1YS6A 2V0NA 1DCMA 1MAVA 2QVGA 4G0YA 2B1JA 3OM0A 4P98A 1ZESA 5EWMB 1EWTA 1EFAA 2FQWA 2MYPA 1JH9A 1AB6A 4Z4IA 4G86A 2E4XA 1Z12A 2FEPA 3SY8A 1H9CA 3LMKA 4JB0A 4RY0A 4F12A 1U04A 2CHFA 1SXIA 1LJLA 3CS3A 3LFTA 4MR7B 2FW0A 4ML3A 1QP7A 3HUUA 1YK1A 3BRSA 1RZRD 3A0RB 2ZAYA 3SG0A 3NNDA 3QX8A 2PLNA 3BILA 3KG2A 4S05A 2R25B 2JVJA 1BDIA 5BR1A 3LUFA 2N9UA 3H1FA 3HDGA 4D74A 3H5OA 3R0JA 3N0RA 5CNJA 5T3YA 2FN8A 5GOTA 4WXEA 1YIOA 1LBHA 4ETIA 3CHYA 4PICA 3BRQA 5TPZA 2HJ9A 4RSMA 3KHTA 4LDAA 1JL3A 2MSWA 3MIZA 1XHFA 3OLYA 3O21A 4RS3A 5FBKA 4N0PA 4MR7A 5IX8A 4TLLB 3I5AA 4OG2A 2L19A 1P2FA 1GUBA 3KKEA 4F11A 5EWMA 3O1JC 2WWVD 4N76A 1A04A 2FQYA 5IUKC 3RVLA 1QNLA 1Z15A 3GT7A 1DJMA 5TQ2B 2LUOA 2MYNA 5JNUA 3CNBA 4EVSA 1QP0A 2MSKA 1CYEA 5HSGA 3H6HA 3QLVC 1PEYA 5CNMA 4LRQA 3IPCA 1TVMA 3NNNA 3VNBA 3Q7RA 5HKOA 5IEJA 5FWYB 1NXTA 1W25A 2JVIA 2WJAA 1M2FA 4YLEA 3H75A 2QXYA 4P1ZA 1EHCA 5KC9A 1U2PA 5DKFA 4XXHA 3RVJA 3IP6A 4KK4A 3IP7A 3OO1A 4QPJC 1MB3A 2A9OA 3KS9A 3MF4A 2NZUG 5TQ0A 4LE2A 1TMYA 4NCAA 4EVRA 1E6MA 2IPLA 1QQAA 3KLOA 4ETMA 1QKKA 4MR8A 4XAQA 2GKGA 1JX6A 1GCAA 4WWHA 1DC8A 1C0EA 3Q7TA 2WB4A 1RXIA 3EJWA 3JVDA 3M9XA 4GPAA 4MQEB 1GCGA 2RGYA 3KSMA 4NICA 4QYMA 5JNVA 1Z18A 1NATA 4RXUA 2PE5A 3QLTA 1YMVA 3OQNA 2L2QA 5CNKA 3G85A 3JTEA 3CZ5A 3M9WA 3ROFA 1K66A 4NQRA 3URMA 4KVFA 4XFKA 4OATA 1RZRA 2HPHA 3HS3A 3JS5A 4MS1B 4MQFB 3JPYA 1RXEA 1QPZA 3HXMA 3T38A 1RPJA 3I45A 1Z2EA 2A9QA 1ZHHA 3GYBA 5C5CA 1LBIA 3EDCA 1DBWA 3NNSA 4S04A 4H60A 1S8NA 4QICA 1ABFA 2YHAA 3SQNA 4MRMA 2IYNA 3HDVA 5IC5A 3QEMB 3BREA 4NV3A 2F8SA 1TJYA 1NXWA 2IOYA 2PUEA 4LX8A 5DGCA 3T6KA 1DCFA 4ZMRA 1BA2A 3HV2A 1JLKA 2R4QA 4RDCA 1GUDA 2QW1A 5CHYA 1F51E 4W5TA 4Z4GA 2PJUA 4CBVA 1YTUA 3KCNA 4RK0A 4O1IA 2ID7A 2WJWA 5TQJA 3BBLA 2H0AA 1JFVA 3TX6A 1QQBA 2ID9A 1DP4A 4F06A 3SAJA 1DCKA 4RK7A 1VKRA 4PEVA 3FFWA 5JS1A 3IPAA 2FTKE 1URPA 3O75A 1EWKA 2VUHB 3LUGA 4KK3A 4O5AA 3W9SA 1PEAA 1NXXA 2RJNA 2QZJA 3F6CA 3L49A 5TPWA 2CD7A 2IKSA 2FVYA 3O1HB 4FE4A 4MR8B 4N47A 3UUGA 3T95A 4FE7A 2JB9A 1USIA 4H3KB 2R47A 4OLAA 3L6UA 3CFYA 1NTRA 3CLKA 3RVOA 5ABPA 3HJFA 3MYYA 3QX9A 3LUHA 5IULC 3HVRA 5C5EA 4F8JA 1QP4A 4EYGA 4JOQA 3E3MA 3CRNA 1SD5A 2PKXA 1B00A 3HSYA 5KC8A 1P6UA 1PUXA 2W42A 3IDOA 3O2SB 1ZGGA 4RK6A 4KPYA 4N41A 2GX6A 2JK1A 5FWYA 3MM4A 1KRXA 4G0OA 1YS7A 1EWVA 3T8YA 3OMWA 1ZY2A 3N75A 4YV7A 3N0WA 4EGSA 4ZMSA 1LK0A 4RKQA 2GBPA 3F73A 2NUBA 4RK5A 1OXBB 1ZH2A 4YR7A 1NXVA 3NHZA 2QVCA 3RVKA 3RVQA 9ABPA 4IF4A 3RVRA 3UK0A 5IUNC 3FMVA 1JF8A 4YWHA 3OM1A 4JB2A 1JDPA 2JBAB 4ZJPA 1BDHA 4RK1A 1U2QA 4KQ9A 1DRJA 1LJUA 2XDYA 4LE1A 1MIHA 4ZPJA 3KYIB 1MB0A 3LOPA 4Z9BA 3HO1A 4YS6A 2MYUA 5TQ2A 4KNYA 1M2EA 3GA5A 2MSLA 4YP9A 1Z26A 3A0UA 1JHZA 4MS4B 2QU7A 2NT4A 1AB5A 4EYQA 5JNTA 4RY9A 1APBA 1DC7A 4MLCA 2PUCA 4MS3A 1YK0A 3D02A 3H5TA 1P8AA 3H5LA 3MMNA 5CNIA 3SNKA 4MS1A 4F3TA 1USKA 1JYFA 1ZN2A 2JCGA 4RXTA 3IP5A 4G97A 4KZKA 1E2BA 5KQGA 4UHKA 4OTZA 3H5WA 2FLWA 3CZCA 3DBIA 4XLTA 4KRFA 3O2JA 5FBHA 5I4CA 2JBAA 4G0ZA 2AYXA 4HNQA 4Z4HA 3H6GA 1MVOA 5BRAA 2FMIA 2IPAB 4XASA 4RY8A 1KRWA 5FWXA 1OXKB 2I6FA 2FN9A 1XWWA 2FMFA 4IMIB 2IDMA 3QLVA 1E6LA 2IPNA 4KV7A 5EWJA 2PUGA 2PUFA 4NCBA 2J48A 4G0XA 3K9CA 3GV0A 3QK7A 1NXPA 3EQZA 3F6PA 1FFSA 2H3HA 3C3WA 3LUDA 5JNWA 8ABPA 2E4YA 2FMKA 5HQJA 1Y1LA 2P4UA 1ISRA 3K4HA 3FFXA 4RU1A 4MLDA 3ROTA 4PE5B 4Z0NA 4W5RA 3DLBA 1BVHA 4LZLA 3RVSA 5TQ0B 4Q7EA 2NZVG 3OLVA 4EUKA 5KWSA 2QSJA 3NBMA 4KFCA 3CG0A 3O2QB 4HNSA 2P9HA 1JWLA 5DCLA 5EWLA 2LIVA 2IPMA 4RXMA 3H1GA 4MYRA 3Q15C 3A10A 2F8TA 4FB4A 2PMCA 3KJXA 4MGEA 5B3JA 2E4WA 4Z4FA 3KLNA 2PL9A 1D1QA 5PNTA 1L5ZA 1ZGZA 4JASB 2VUIB 1CEYA 1WETA 5KQLA 1JDNA 3RVPA 4KREA 1C4WA 4W5NA 3MQ4A 3EODA 4MR9A 1L5YA 3N6VA 2MYTA 4YGXB 1ZAYA 3I42A 3KYJB 4PYRA 2CWDA 3Q9SA 4IRXA 4PZ0A 2HQRA 4Q6BA 5DTEA 2AYZA 2LP4Y 1T34A 2M1ZA 3KTOA 3GWGA 4TMYA 4MQFA 2E4VA 2OENG 1Z16A 1D2AA 3N53A 2YHBA 3P9YA 2VK2A 2L17A 7ABPA 3F7NA 6CHYA 1QMPA 1VPWA 4TLMB 3GL9A 3CG4A 3I09A 3JVIA 4L85A 5D2CA 1K68A 1R8JA 4B09A 3DGFC 1D5WA 3ILYA 1Z13A 2GI4A 2FMHA 3JY6A 1E6KA 1GLGA 4G0PA 4IILA 4WZZA 2A9RA 4Y9TA 2HQBA 1QO0A 4RZSA 4DADA 4DN6A 4MQEA 2M98A 4XARA 3QEMA 1P6QA 1HEYA 3LUKA 4E7PA 1JYEA 4G0MA 3LKBA 4MS4A 1FSPA 3RQIA 4YCSA 3HK2A 5IEBA 5IUJC 1Z25A 3EULA 4E7OA 2HSGA 1SXHA 5TPZD 6ABPA 1QO0D 5KI6A 2NT3A 2ZWMA 2L18A 2JVKA 3FFTA 1JFSA 3OMXA 5TE9A 1D4ZA 3M6MD 4LE0A 4WXMA 2FLKA 5BRJA 2X7XA 4WUTA 2TMYA 3UKJA 2RJOA 4Z99A 4H3HB 5F64A 3EQ2A 4EYKA 3FGZA 2DRIA 2FEKA 4W5OA 1SXGA 1USGA 2QR3A 5JNSA 1A0OA 3RVMA 2PUBA
chains in the Genus database with same CATH superfamily
3ND7A 2EL7A 1X7HA 2DR0A 1R64A 3MT7A 1V37A 3VBEA 3QFFA 3SS8A 2B25A 5C81A 5GZ3A 3SC6A 4MS3B 4BNYA 3CE6A 1TD1A 4BTVA 4GP9A 2JGMA 1YB5A 3KKMA 2IDJA 1PT8A 2XHEA 2BMFA 2YS6A 3G5AA 5TX7A 4PGAA 5K01A 3VKHA 1RNLA 5JSZA 4H0FA 4DUGA 1GTRA 3W2GA 4EHNA 1VG0B 3KQNA 3H19A 1ORIA 3PRYA 4GYWA 3F8TA 2X2PA 3HI4A 3UWMA 5KOYA 1FNDA 1NNEA 2CEAA 2ID8A 1SCJA 1Y5MA 3T5PA 2WAAA 4QVGA 1N0IA 1NIJA 1DRKA 2PRJA 3ENZA 5IBPA 2HMVA 4TTVA 4FN4A 1XZIA 3QEKA 4WFKA 5K51A 3ITNA 4KKXB 1XQXA 4AU1A 2AE1A 4HN4B 4LWZA 2R3SA 1X9GA 2XZOA 5LXTF 1OA1A 3PA8A 4LZPA 4YH1A 5TJ9A 4KR3A 3UV3A 4AJ2A 2FHPA 1QHIA 5GQSA 5IJXA 5LQAA 1AQUA 1MX9A 1WUJS 5E1BA 3ICWA 1T6ZA 1FB5A 4UXIA 5B3LA 4LBZA 2ZJZA 4OMCA 4EA6A 8ATCA 5EJ5A 4M98A 5HFAA 4M1OA 4D4MA 1JGTA 3KFXA 3NASA 5AO9A 4KW7A 1UWVA 5DT9A 2GD1O 4GS5A 1JU4A 1NQXA 3IFSA 3QKUA 2JLVA 4FKZA 2ODNA 2Q1XA 4KYIB 4ZYTA 3TB6A 4RKRA 4Y2YA 5CH3A 1L0BA 4P38A 4UNIA 4MIOA 2BEKA 5EEHA 4HC4A 2NP7A 3N2KB 3P71T 4XCXA 3GIWA 2QS9A 3CRMA 1RT9A 3GLKA 5HFNA 3VR1A 2C3PA 2C4NA 2Y1KA 3S8MA 4AK9A 5I7FA 5IRCD 1UKYA 3QLEA 1TM7E 1Y7TA 4D9IA 2XVMA 3UUFA 3TPCA 4XWKA 2KM1A 4H3VA 3PUYA 1XZKA 3HCDA 2E18A 2VJMA 3GLIA 2TMGA 1EAYA 1NASA 1WE2A 3HFGA 3LKDA 3LQ4A 3QW4B 3JQ7B 2AZMA 2ZT5A 3OIGA 3PU6A 2KW5A 4K1LA 4NC9A 2GTHA 4KE7A 2CDCA 4XWAA 1GZDA 1E59A 1I14A 1KSFX 2FQXA 2PZLA 1YZQA 2AFIE 2E5FA 1X7DA 2Z4SA 1EBBA 2Z58A 4CM8B 4DMFA 4HXGA 2ZR9A 1TQHA 3PX7A 3P5BA 4JBIA 3SJBA 2G0NA 1OYYA 2YFQA 2WHEA 1D2EA 4V39A 3ABQB 3SZRA 1U8XX 4YASA 2D7CA 4GNKA 1VG9B 3KBBA 1ZGJA 1KOFA 4MWEA 3TQQA 5D8DA 1GVHA 3ZW8A 5EIHA 1I9GA 1OXXK 4KIFA 4RYDA 5E9JA 4A2CA 5CB6A 3ILXA 5ARBA 2H1CA 2HXYA 1NVUQ 1T8UA 1V9SA 2PJDA 3PKZA 4RNCA 3TW6A 3C97A 3ZWQA 1WXFA 2F43B 2WIGA 1EXWA 4FFNA 3NC0C 4JX8A 2HCFA 4H1UA 1T1SA 3LL7A 2X9QA 4LXYA 1UC9A 3P32A 4E09A 1C9YA 4JQCA 3BYZA 5ALEA 4NU0A 4I9HA 4DUZB 1P61B 2VHZA 5ITZA 1ATZA 2QJFA 2GERA 1SOVA 3N8DA 3LMKA 3IT1A 4F12A 5BSWA 4DBLC 1C81A 1U04A 4YP7A 5I4KA 2A7XA 3LLSA 4FCWA 4BMOB 1Z68A 2W11A 3E9YA 4Q7QA 3CF0A 3DZKA 1Q0QA 2H2GA 4BGEA 1DRUA 2BBSA 2YR0A 3ELWA 4QBGB 3TCXB 3D6HA 4EG8A 4RQAA 4F4JA 3PQEA 5JJIA 1U9YA 4IGIA 3UFXA 4CKXA 5EA2A 3N39C 3ZOZA 1DJLA 1JECA 2JKVA 3ESXA 2WYHA 3HKDB 1SHLA 1Q21A 3B1WA 4WCDA 2VP9A 1VKNA 3AEQB 4MV1A 4AWBA 1PJ3A 3ADPA 4DXDA 1FP7A 1HFWA 3CX6A 1QAMA 4N6OA 4CMKA 1AK9A 4R8SA 4UUMA 3GW8A 3U7RA 4JLBA 1V5WA 1U3TA 3U62A 1VGQA 4IH9A 1M34E 4OGKA 2WHYA 4GT1A 4I46A 5ESRA 4KPFC 2X3YA 3RFXA 4D2IA 5IAAA 3OZEA 1LVGA 4F11A 1GGMA 4JI1B 3L8DA 1H65A 2AJLI 2HEGA 2ZSAA 4N76A 4L78A 3EEOA 3KR2A 2WSBA 2ZKIA 3D1LA 3ET5A 1NI4A 3C3EA 3HU1A 1TCCA 1C9KA 5HOQA 4RKFA 1M0TA 3CISA 2JI9A 3SHQA 4YDRA 2Q07A 2WTAA 1E7QA 4F46A 1I6WA 2CVHA 4LRQA 5H16A 2EW2A 2YH2A 1NW5A 1JKJB 4TVKA 1H2EA 2QE6A 3TLAA 3OM8A 3FOZA 5DBEX 2DU8A 3TS1A 3NAZA 1WXHA 3M49A 1GKYA 4KBFA 3T9BA 3CPEA 1NRJB 3BXPA 4UTPA 5LLTA 3G89A 3H3FA 3IQIX 4QUHA 3UN1A 5FCDA 5JSZB 1E9CA 1NF2A 4R2LA 1M8GA 4JUAA 1WBDA 3OX4A 4L8LA 1O2DA 3AU8A 3MF4A 5FOVA 1GAWA 2IITA 4LS3A 4C0QC 1IPEA 2IZ1A 2R7MA 4DAOA 2C5BA 3UPDA 3I2FA 3K9HA 3PJGA 5FKJA 2IYEA 3OSZA 1HTWA 1OAOA 3OEHA 1N2GA 5J2TF 4UPEA 1JV2B 1CUIA 3AESA 4KO2S 5EHNA 3TRDA 2CVQA 1KO5A 1UH5A 3AEKA 3Q7TA 4FXPA 3K92A 3TKYA 4YY3B 2ON6A 3CLVA 3LYHA 4EFMA 4AQYB 3KDSE 4KN9S 2QRNA 3ZY6A 4Y6OA 3UXMA 1GL6A 4M22A 2CKDA 1P1HA 4BAGA 1YMVA 2DPGA 5D5HA 2L2QA 2WOJA 5KJFA 5KTNA 4M0UA 3ETNA 5CNKA 4LYAA 5HE9A 4PO9A 4OI4A 1T0JB 4U5XA 2QTLA 1DUIA 4KVFA 5H83A 2JFZA 3OHMA 2HPHA 4DIFA 1QX4A 2ATEA 2W2VA 4TKLA 3UT6A 3T9CA 3RHSA 4KOAA 2H4HA 1CFZA 1TC2A 2J5QA 4HQKA 5D85A 1QYDA 1RPJA 1LU9A 1W1WA 1NAIA 2O5VA 1BXGB 5FA5A 4O4JB 1EXDA 1DOZA 4Q4JA 1DBWA 3G6WA 5DYWA 3MJSA 1NLZA 4JHXA 3MBOA 2OYRA 1HOTA 4IL5A 4J7UA 4L08A 4LXXA 4YAUA 1I7QB 2IOYA 2ZTVA 3N28A 3TTYA 1WA5A 3FCUB 2Q6OA 1I2AA 3PNYA 3S44A 2HO4A 3DW1X 4OU4A 1PQWA 1K5GA 4TTJA 4KI0A 1MB2A 4KXNA 2XECA 1F51E 4ZAGA 2RCNA 5KTYA 4UTZA 3LHDA 2AXPA 1YB6A 4M0KA 2KX7A 4D9NA 2ZCVA 1T9ZA 2BFPA 1Q1NA 3FBWA 5I9BA 5F2NA 1W4ZA 2B20A 1R0WA 1MABB 5D3ZA 4FDVA 4L5CA 3JR3A 3KPJA 4OKSA 4OBEA 1ACLA 2OKGA 4WCFA 4U7PB 1BYIA 3K20A 4LRXA 4BKOA 4B46A 7REQA 2W9XA 4KE6A 1UBUS 2K2WA 1EWKA 4E21A 4YROA 2PAAA 2DWCA 1JJFA 3N8NA 2F1RA 1ZYUA 4R84A 1V96A 5EXDA 2HIMA 2AJDA 1BO6A 3TQIA 3HJRA 5JI2E 1MJHA 4H7EA 2ZROA 2Q46A 4RO0A 3KB6A 2XNHA 3JVEA 2H59A 3MW8A 4H3KB 3L6UA 3ZY2A 2E1RA 2G9RA 3BKWA 1CYDA 2IZ6A 3A1NA 5KNCH 1KVTA 2QRMA 3QWFA 4G8BA 4MP8A 9LDBA 1BA3A 3AL0C 2VI5A 4NS1A 4PY2A 4YNBA 4C88A 3HVRA 3PJDA 4FKMA 2VDJA 4FD3A 1DIAA 2GZSA 3RB8A 4BGUA 1T2VA 5FX2A 3FPHA 3E3MA 5JD3A 1X2BA 5LZ9A 3O93A 2BH2A 5MF6A 3C43A 3HSYA 3TJMA 4C4TA 5JIBA 1ZZGA 2AL7A 3ZOKA 4MI6A 3IOBA 3ZI4A 1FU7A 4C5AA 4N41A 2QRPA 2Q1TA 1IAQA 3K0AB 4JVOA 1U94A 3UJPA 5AVVA 5BN1A 1C7RA 1I2ZA 2B35A 4LF9B 1MJNA 4PX2A 1NW7A 4K5QA 4XQ9A 1MGPA 4DM4A 2Q9UA 4A8HA 5CH8A 1MORA 5C4IA 3ICQB 1KIFA 2RGUA 1TTHA 2CLKB 5K20A 1EP2B 4EPXA 4RKQA 1FW8A 4RLQA 3O1LA 5WRFA 5CA1B 3F73A 1XGKA 2O7NA 1NVAA 2Q6VA 4GAEA 1BXRA 2CKMA 2O9JA 3NS7A 3RVKA 1PBTA 4JI3B 1FP1D 4NARA 3N6RA 4E07A 1THGA 4HV4A 3ECSA 3C8HA 4YMGA 4BECA 3OWHA 4KI7A 1SQGA 4YPVA 3EF0A 3IBTA 2FG6C 4CWAA 3U7FB 2CHGA 5BQOA 1RRFA 2D00A 5T6MA 4ZODA 2I6UA 3HB0A 1SMKA 2C42A 3C5CA 1J33A 3UK7A 3KYIB 3WKDA 1WCV1 3EGDB 4X1IB 5FQNA 1CK4A 2KMLA 2OBYA 1N34B 1J2TA 1R0LA 1XKQA 3S0JA 4AWXA 1K1EA 4HY3A 4XWYA 5IKPA 2MYUA 2Q2QA 3PHHA 3ESZA 4U9HS 5EP3A 1IDOA 5D3KA 4H59A 5TQ2A 3KAPA 4DYVA 2PVPA 2Z9CA 3CJQA 3OKAA 3ONNA 2NPOA 2CMGA 3PUWA 4LEIA 2OKCA 4ACAA 5EJEA 1V8DA 2FAXA 3DVSX 5I5GA 3GPIA 1TW3A 3T35A 3WYBA 5LN1A 4UULA 5THQA 2IH5A 4CTNA 1YCDA 4H6XA 1N5MA 2BRUC 1JILA 3EBOA 2D7DA 4D82A 3PHLA 3WYDA 2ZAIA 1P17A 4R0MA 5EQFA 1HDXA 2JCGA 4FFOA 1MP0A 2P2GA 4L22A 4HNGA 1V47A 5A03A 4B40A 5I51A 4ESHA 2B99A 3S2YA 1GFSA 4DMUB 2OHHA 5C3MA 3D3NA 4ZO8A 3A7EA 4Q1BA 4RJKA 3DQQA 1KBOA 3FSEA 3ZXSA 2NU7B 1JXMA 3KAKA 2PQ6A 4H6PA 3IBSA 4B6QA 3QOWA 5DYYA 2AYXA 3L7YA 4DVGA 1P7CA 3HCPA 3PQFA 4PTZA 5GONA 1Y8RB 4TV9A 4C04A 4CKCA 4LF7B 2EHJA 3PGXA 4LC0A 6REQB 2UVPA 1BXKA 1KRWA 1NSYA 4JGGA 1ODKA 2II6A 4RIEA 5IMSA 1WABA 5HUJA 1KDPA 2HCBA 1MHPA 1UJ4A 3SJCA 3UTCA 5G1OA 1YI0A 4NPCA 3O0DA 1H1LA 3QMMA 1Q0HA 1NUAA 1QM5A 2ZPAA 2V65A 3GJ8A 4LZOA 5F73A 4AJOA 1D3AA 5KYWA 2J1LA 1VBKA 2V45A 2QZZA 5CCEA 1BTOA 2GZHA 4TTRA 3ZZNA 2LTAA 5I7VA 2W2KA 1TM5E 2W0MA 3A6EA 2G7ZA 3OIWA 3OLVA 4TSFD 2IW1A 4MRPA 3ULKA 2I3BA 2C8VA 3VI4B 5JSFA 1YR8A 2C97A 1JG3A 2ES4A 1O9HA 1GYPA 4IDDA 5F1OA 3L01A 1UQRA 3IEUA 2IPMA 3R8CA 2HHCA 3VPAA 3HJCA 2AG8A 2AOWA 4IMPA 3OSUA 3UY4A 1L8OA 4D4IA 1O95D 1AN0A 3QYPA 4MNTA 1VE9A 5ES3A 5C18A 2XMDA 5T4HA 2WA2A 2BHLA 3WIBA 3EZLA 1IZZA 1SVWA 2ZSUA 1X1CA 2DTEA 1ZGZA 2GCIA 2FGKA 1Y8QA 3GCDA 4G01B 3ZQ6A 4DYDA 2Q3FA 5JATA 3T1QA 2C3YA 3GGDA 3EXHC 2Z8XA 4MR9A 1GJRA 1ZIDA 4PFQA 1EDBA 2XOKD 3IHKA 4MKIA 2CWDA 4ZOAA 3I58A 2E82A 3BN3A 4TL9A 3T3EA 3TLCA 4QBKA 4D9EA 3LZDA 3LO8A 2ZQZA 5KHLB 2IYWA 3NIGB 2F00A 5DOVA 2Z5VA 2KJQA 2PFGA 1L9KA 2G1JA 3WZ2A 1L8XA 4BBZA 1RJDA 1DRVA 4CM6A 3T3NA 2HU5A 3UMYA 4U5QA 1Q22A 3WMGA 2RHDA 4C0SA 4DRXA 3AOGA 3C98A 4KXUA 3V7NA 5ALOA 1FXUA 4BIMA 4CTOA 1YOBA 1I13A 1VHJA 3GNLA 4MUFA 2EFHB 3ZDEA 2ZE5A 2A1IA 2VUTA 1QGUB 1X1EA 1DMRA 3WYEA 4A6PA 1EWQA 1USUA 1UBFA 1U28A 4XJXA 4KX5A 1EK6A 3H65A 3TNDA 3ZE9A 1A96A 3DEKA 4NBNA 4R0NA 2AEMA 5TMDA 2BFOA 3U0VA 3BMCA 5JVDB 4B6OA 2DFLA 1MKYA 4KO8A 3QKRB 2VQEB 3FUVA 2XUDA 3BHNA 1II9A 3MD0A 4ABTA 4XEUA 2JGEA 3UMVA 3HUEA 2UAGA 3BWEA 4LHZA 4QEZA 4BNLA 5FJJA 2JIQA 3HB7A 4E5KA 1W75A 3KQTA 3CN9A 3WLQA 4IAOA 5BY2A 2XRMA 1SXHA 2O3RA 2ZTLA 4LJRA 1LY1A 1ZNQO 4H6WA 4L4SA 4NTZA 4EI7A 1Q1GA 2D2FA 2Z8YA 5CT6A 2RGXA 4B6EA 4BOYA 4HYTA 1XRPA 2BJVA 2FW8A 3ONEA 4RJTA 3MLAA 1C0IA 1H4TA 3PENA 5TS2A 3RF7A 4HG2A 5CVCA 4ZIRA 4R16A 3GLHE 3GEBA 3NIBA 4BKPA 4G6ZA 1TMOA 3SEAA 2YQZA 2CUNA 3LRXA 3ZDRA 4OHUA 1YAHA 5GINE 4IIJA 3F3KA 2OSVA 3DWIA 3O31A 5KNCD 3SEQA 2RG1A 4L76A 2I1WA 3CWQA 1B26A 2WHPA 3CMMA 3JU3A 1YB7A 2HXGA 1DO0A 1RXVA 1A4UA 2AI3A 1UXKA 3BMNA 4H9GA 2Q6TA 3IAM1 3U3MA 1MQSA 3NETA 3SYTA 1IM2A 3P0EA 4CFSA 1CQZA 4Y1GA 3TL6A 3WYGA 4C4SA 3EDMA 3F97A 1H6AA 1VZ3A 2IZ0A 5E6UB 4EG7A 1RC1A 4ZI3A 1FQKA 1Z5NA 1ENZA 2QT9A 3O1IC 3A1TA 1D7OA 3UWKA 3MGAA 3OE1A 4UEJA 3RYFA 3MUFA 4P83A 2JLAA 2PRIA 3V3TA 1VMDA 1KEKA 1C8VB 2HRQA 2J3EA 3QWIA 5LNK6 1EFRA 1THTA 1XK6A 2JJQA 4ALLA 4YHHB 1FNSA 5AVQA 3DNFA 2RGDA 4PG7A 3FKSD 3RSCA 4ARUA 1EA5A 4ZHSA 5ED4A 4LISA 2XNCA 4LDNA 4PONA 1YRBA 3Q3HA 1J0CA 2R8EA 3PGMA 3TW4A 3KQUA 2PFSA 1LQ2A 3G23A 3ELUA 3FHLA 1LLQA 3DFMA 5JCJA 4MRMB 3M6VA 4JGBA 2IY8A 1VRVA 5CW1A 3OLWA 2WD7B 4BJ6A 2ZUWA 3BBPA 3ZV7A 2YMPA 1F9EA 1COWD 3P1JA 1TW2A 3FG9A 5SZHB 1RRPA 1FTWA 5KSWB 2VJLA 3LBNA 1V7ZA 3CUYA 4PYOA 1ZSVA 3DAHA 3QVXA 1OIVA 3HBJA 2R6ZA 4J07A 4OJNA 1PJRA 3MAJA 1PEKE 3LDHA 3HC7A 2BGIA 1JG1A 1WPRA 2JCVA 4GE0A 3PTLA 4KPGA 3T7TA 3FYCA 1D2GA 3HH8A 2ZULA 2O1XA 3GLIE 1OFGA 2DJIA 3TLXA 3AVXA 3ZKWB 1UBOS 1G7RA 1ZNZA 3QSYA 5H1YA 4ALIA 4BVEA 4J75A 3BZWA 2NQ2C 4EVQA 4LDJA 1G9TA 2C2GA 1E4EA 2XODA 4DQDA 2GWRA 2XUHA 5JH7F 1EXVA 3SI7A 3HNOA 2Q5CA 2I3ZA 1WM1A 3KP1A 3ZE2B 1YDEA 4PN3A 3DT6A 3RS0A 1YI1A 2OV1A 3EF3A 3QNUA 3T3IA 4B85A 5ALNA 2YWBA 3WADA 1ZO8A 2NU6B 2W48A 2ZRJA 4NAUA 4AUKA 1CDOA 2G76A 1KR5A 3GFGA 2JAUA 1ADJA 2Q5HA 3FDIA 3EVDA 3UGJA 3OJ0A 4JP1A 1H0KA 3L4SO 1SCIA 4QBIA 4QZVA 1R4NA 2UXCB 1YE3A 3AO0B 1A2OA 1PZNA 5BR4A 5JANA 3C3XA 3CU5A 1ZVVA 3T0GA 4JOBA 1JSCA 1SXPA 1I80A 3I0ZA 1CUEA 4NPHA 2AN4A 3VH3A 1ESEA 1HYBA 1QFXA 3GCWA 2JA2A 1WW2A 1O3YA 3G17A 3I5MA 3RH0A 3UAVA 2I3DA 2YZ7A 5H3LA 4AROA 2ORYA 1ZXXA 1Y9JA 3X1JA 3GFTA 4GVPA 3RRJA 4DL9A 2X1MA 4I1RA 1BZYA 1C2YA 2B3DA 2P3OA 3FR7A 4J7XA 4TS1A 4F5DA 5JMTA 4H31A 4F5EA 1TAUA 3HCCA 4BMCA 2VDPB 5FPQA 2VZLA 4H15A 1ZFNA 2R86A 3D0QA 3ZE6A 2XMQA 5KUTA 4NZMA 5U1PA 2G3YA 3BZBA 4EO9A 3WK6A 1A4XA 1N0UA 2Q5QA 3D5TA 4QWMA 3HUUA 1M2KA 1L5HA 4IY1A 3SG0A 4IRUB 4CU5A 2FPMA 2LCIA 2G71A 4PX9A 3IV7A 4ZARA 1GTZA 1MCZA 2NO9A 2B1QA 2COUA 3KLMX 3M6AA 4ZC8A 3A27A 4EPTA 3U7GA 3MS2A 4I1OA 3ZE7A 1KO4A 4ODIA 3AHEA 3DWFA 4ZCQA 3VPCA 1NF3A 2FW6A 1VL0A 5C32A 2E6KA 3GQVA 3OESA 2X6QA 5BN3A 1TJ3A 3TQSA 2J3DA 3PQ4A 3PQ5A 2Q4TA 3E1KA 3ESCA 3TOVA 5LDHA 2ZE7A 1EVYA 1U11A 2DBRA 2YYYA 1VQ1A 2H1SA 4Q5IA 3U5ZB 4BXOB 1C4XA 1ECBA 4P7GA 3OTHA 3IE1A 3N8KA 4FYVA 3INYA 3HP7A 3VNSA 3AFMA 3QUCA 3VOBA 3N3BC 4UDXX 5SY6A 3PT5A 1RPNA 2MDTA 3THWA 1XB2A 5C34B 2ZPTX 4EUHA 2QBYB 5IUKC 3KTAB 3KQOA 1IEWA 2A57A 4P7FA 1AZWA 3AERA 4M89A 3CJTA 3M6XA 1QIEA 2EKZA 3GPBA 3FWZA 4R6WA 1RCTE 2VJQA 4MHOA 3SHTA 3M4NA 1SG0A 1E0JA 4X62B 1Z0IA 2QYOA 1GYRA 2G4LA 5FTMA 1NJ8A 1Z39A 4J7AA 2C4TA 1L1FA 5DX0A 3KTDA 3NATA 4PLHA 4NPAA 1MO6A 2V59A 4JLNA 4CN8A 2JVIA 4NXMB 4YLEA 3WIDA 1C9EA 3JQQA 4LPSA 3C6ZA 3NGMA 4ZQIA 5FPKA 4HLCA 3E0QA 3IQFA 4EP1A 2QJOA 3RQSA 1R66A 3FHOA 4LXTA 1NYRA 2HQSA 3DCYA 5ELMA 4CEIA 3G0GA 4QPJC 5EESA 1MB3A 1Z4QA 1AHIA 4ZT3A 2NSLA 4TRRA 3OY7A 3HLKA 4UDYX 2BMEA 4PCUA 4TTPA 4X3OA 5ISMA 1AMUA 1HDEA 2R8YA 5ITZB 3BSYA 4WGFA 4INZA 3IKLA 5AHXA 2VNJA 5K3DA 4ETMA 2ZI7A 3G7UA 2YHIB 3G88A 1EK2A 4JEMA 4QWWA 1KMNA 2O8CB 3K09C 5DDIP 1KEZA 4J1TC 5B7GA 3KQLA 3MGKA 1FW6A 1YZTA 1VG1A 2ZEJA 1KR2A 4U2BA 2C4VA 4G36A 2P41A 2Y77A 4CT4B 3UC5A 1E1CA 4PGFA 2JZCA 2OCLA 3Q8WA 1OPRA 3OQNA 5CXQA 4MXDA 4R01A 5AK4A 2JGJA 3JQ8B 3GFPA 4X92A 2FWMX 3FD8A 2QTFA 3JSXA 4TQUS 1NKTA 1O5TA 4ZU1X 4JI7B 2GN9A 4LY6A 1YZFA 4OATA 3BE8A 5K0SA 5KNBH 4HRVA 3K94A 1M76A 4OQNA 1I2BA 1S3SA 2XXAB 1DV1A 1QR6A 1RXEA 3C39A 3UANA 3GN1A 2RAFA 1QIMA 4KKVA 2P9EA 4CETA 3PK0A 1LBIA 5CT8A 2GVDC 4YTEA 4S04A 3ZTWA 1XTZA 2QN1A 9LDTA 2BMDA 2HK7A 4CL2A 1FU4A 4Q9HA 2VDVE 4ENVA 3SBEA 5EXSA 2JLWA 1N2BA 2ZI3A 1XAHA 1KEVA 5EI5A 3VGJA 1EM8B 4G2NA 1ESDA 3C2QA 2QW1A 1ZUNA 1Y4DE 3EFHA 1U8CB 3HR4A 2O0HA 2F67A 1MGOA 1OASA 2OCIA 4QREA 5D51S 4G07A 1EGMB 4YJGA 3F7MA 2C96A 2WJWA 5HF6A 4CG2A 4LKOA 5E4FA 4OLHA 2H0AA 2QD1A 1IUNA 2GAAA 2TS1A 2OK8A 4DLKA 2HHLA 3I2KA 4W5HA 4PEVA 4R1TA 2QBYA 1L3CA 3EUWA 5FO1A 1AZLA 3K32A 2GD6A 4A8PA 1XPJA 4R1PA 1NKVA 3TEMA 4MV5A 4I8IA 1RYYA 1AOXA 3GA0A 2RKOA 3MWDA 4EG6A 4ESVA 3UCXA 1G18A 1EI9A 4NATA 1CIVA 4B0OA 2GZDA 2C4MA 1FTGA 1O5IA 5AW4A 1VL5A 5JJBA 5FAKA 2Z8YM 3QPVA 1QGED 2ZIUB 4JLWA 1DRWA 3AETA 4FEEA 5K0ZA 1FX1A 2ODEA 3WL5A 2R60A 2AFVA 3OWOA 3EN0A 4Q9DA 4KIUA 1M6HA 3AR2A 4W8GA 4EYGA 3CRNA 1KVQA 2PKXA 4LRTB 3OQIB 5BSEA 1O0CA 4WK4B 1P6UA 1T5OA 3OTGA 1USVA 4CCSA 2G36A 3CR7A 4KZPA 1SK9A 4KIGA 4UE6A 3BMQA 1S3IA 1TMGE 2XMPA 2Z2IA 3R3WA 4QODA 3DJYA 5DZSA 4BU1A 5KQRA 5JFGA 4Q18A 3QWBA 2BDEA 2UVDA 1PE0A 1DNPA 3GRYA 3KJGA 1MC8A 3L4KA 3MJDA 2D1FA 2YHIA 4Y0NA 3FE2A 1P5JA 4TKZA 2GT1A 2ECOA 5G0UA 1FS4A 4U00A 5F1YA 4BFTA 3MOGA 5CX4A 3PEVA 3CLUD 5UKDA 4EZBA 4C14A 1CJVC 3W3ZB 3CIOA 1MC5A 1LDBA 1JA1A 4OB7A 3LT2A 3L41A 2FUG6 1I7PA 4UU7A 4DWVA 2CLDX 3OM1A 1JDPA 1OAOC 3CE9A 3ZV6A 1TQ6A 3ZN2A 4ILEA 1SKAA 4Z1OA 1DEHA 3T5BA 4QGSA 2D7JA 3LBFA 3HP4A 3WE7A 1VI5A 1W48A 5IHXA 1KORA 1SULA 2H7YA 3HBAA 1DUVG 2NVBA 4W1RA 1X77A 4CLOB 4QJ3A 2DXIA 3GEDA 1RWOA 1JSZA 2FY8A 2IYAA 3K35A 1C7QA 4K03A 4MW7A 5TS3A 2OCGA 4F5WA 3WFZA 3ETJA 1PR2A 3NBAA 3VX4A 1BE8A 2W00A 2XMRA 4XTRA 3KZMA 1U99A 4YP9A 4DNFA 1QCYA 3SK0A 4AY3A 4C7VA 1VP3A 3GD5A 3UVEA 1NRIA 3VR3A 1G5FA 2IYFA 2BGWA 2AOVA 4FDMA 1GQFA 3QOYA 5LDGA 1E2PA 4BX9A 3SYNA 2VPZA 1A5ZA 3KV3O 1HE4A 1FRFS 3R20A 3K5WA 1TZBA 4N1AA 4KGVA 3T06B 3BJRA 2A35A 4NP6A 1BDBA 1O03A 3BWCA 4O2BB 4X8MA 3UC9A 3WGOA 1G1AA 1RWPA 5CVDA 3MINB 1P4JA 4B73A 5TQVA 3W6ZA 3WDSA 1Y8QB 3QWAA 2CWWA 4FMCF 3GQBA 3JYHA 1DCTA 1ZEMA 4H7IA 4AJEA 5CJPA 1CUCA 3K70B 2LGJA 4IJWA 2WY2D 3OQ6A 1MVOA 3KKOA 1FP4A 1S89A 3MHPA 3KZNA 2WJHA 2J4FA 2EP7A 3P19A 3SKVA 3ZQKA 4IQGA 3UH0A 3PEWA 3FVRA 1OXKB 2C4HA 2CXQA 3PPIA 5FJIA 5SY9A 3W5CA 1XWWA 3O7WA 1EVJA 3OP4A 4QFCA 1JQDA 5KTPA 4S1PA 2PGIA 3R9WA 3BF8A 2QN6A 1TAQA 2ADOA 1YQ9A 1M6VB 1SAYA 1BWQA 1UBHS 2O0LA 1D1SA 1VSTA 4M8LA 1NNUA 4KFSA 2YJ3A 3PV0A 2WA1A 5K8UA 3ABOB 1MBZA 4M0FA 2DT5A 3FFXA 4CKBB 1IHXA 1ZN9A 3G7SA 4EUKA 3BB4A 4RQUA 3PR3A 3RKSA 1N92A 4HNSA 1V6CA 4BCBA 1NMSA 2AEEA 3HEMA 4A6EA 2P2YA 3DW3X 4ND8B 3QZUA 3WGGA 2IYZA 4H77A 1HPLA 2PSHA 5AQ1A 1TQ8A 3TQRA 2GZRA 3E9RA 1RMTA 3NG1A 1Q1ZA 3MINA 4ROSA 5E1MA 4DM7A 5IASA 3LT0A 1D09A 1PGOA 4PNPA 4AC9A 2V7QD 4KREA 1V8PA 2NTNA 2VBCA 2C83A 4BDTA 4YAWA 4D44A 3EODA 3OX3A 3GJRA 2WNIA 5ARCA 4YP6A 3OQ1A 2AIRA 1UPCA 4IVPA 1PL7A 5KWEA 3OOJA 4KE9A 4RIFA 2IV2X 1DAKA 1H22A 2HQRA 3NYIA 5K6AA 4IJKA 1K4YA 2GCGA 4PO3X 3PEUA 2PH3A 1NR5A 3GWGA 3MJHA 2VP6A 4NG5A 3KHSA 1X7WA 2JFQA 3QHQA 3RV3A 4PRYA 1WF6A 2L17A 3MNFA 4PHCA 3B9BA 4IDAA 5IJZA 1PKEA 4D26A 1KPHA 1NE7A 3R5KA 2P65A 5KTSA 3WQRA 3O84A 1BW9A 1SELA 1Z5WA 3U9TA 5KNLA 2B36A 1D2RA 2BFNA 4G1CA 2XUKA 3FPKA 1D5WA 3O4HA 3OBIA 4FHFA 3JWEA 3ZHYA 3AJAA 3FDZB 5U4XA 4CXMA 4E6EA 4OAPA 2G70A 2W8BA 3HP1A 3NHLA 1TK2A 2CLSA 1OBHA 4HCJA 2A9RA 3K9GA 3P27A 4TROA 4XD2A 5KPDA 1L5WA 2ZCUA 2F7SA 3CGWA 2E5LB 5C52B 4B33A 4ID3A 1Y1PA 4N82A 2ZSJA 3VZDA 4I1SA 1QF7A 1MXHA 4KXYA 3WYFA 1GTMA 1DPGA 3WRXA 2JCBA 1W30A 4FEAA 3TOXA 4G37A 4CM4B 4UMDA 2VNAA 5JAHA 4JUIA 5NULA 1EK0A 2QN9A 3D7LA 1CUYA 1KL7A 2NSHA 2JIRA 3EPPA 3X1WA 2NZYA 1XO1A 1QO0D 4KFTA 1ZQ1A 1I2DA 4BS9A 3RARA 1MW9X 2V8OA 2WJ3A 3REQA 3S6JA 1FP4B 4PRKA 4S12A 2V58A 4B4UA 3OQVA 3VZCA 3JQDA 4XFJA 2GN1A 3U37A 5IT5A 3T1YB 4GKKB 2A4MA 2GBLA 1E9EA 4J4TA 4Z99A 5FLXA 1ULHA 3SSAA 4UUBA 4W5OA 2YCBA 3FFBA 2Y1DA 4PYNA 2C29D 3P0RA 2QR3A 3UF0A 1NLMA 1BDIA 4C06A 3NIDB 3VVLA 3EX7C 4C3ZA 2WSIA 1WXDA 4OJMX 1MJ5A 4FR2A 1I3MA 3KOWA 4QXRA 2H08A 1U8YA 3TO5A 4HDSA 4IIGA 3L0ZA 1DAPA 4FMPA 4QHSA 3NONA 1EFCA 1B0UA 2X1LA 4LI0A 5LP6B 4MVYA 4QYWA 3FWPA 2ZIXB 4B4KA 2P4EA 3NTVA 5AKGA 1H8ED 3KT3A 4TLEA 3ZNOA 3FPGA 3G6KA 1CD5A 3GRVA 3NTUA 5T3UA 3CLUC 4OGWA 4UFNA 1I3CA 1XD8A 4RLFA 4F7DA 4P3OA 1H3NA 1EJ2A 2W6CX 1EJBA 3IVRA 1AGXA 1NOIA 1R7RA 1Y6QA 2AFRA 2Q1UA 4HZGA 3UWPA 4X64B 1JFRA 2EDCA 4RMJA 4CYMA 4R0VA 4FHGA 3FCYA 1DAFA 2I62A 3L6CA 1PNRA 3LKVA 1BX0A 1U9JA 3EZ6A 1DFIA 3HN2A 1CPYA 4BFXA 3RVNA 1ZJJA 4N7JA 5E8JA 1NJGA 2XE4A 5KB3A 3SZ3A 4B9AA 1PFQA 3OOWA 4GM0A 4Y6PA 4GOXA 4MA4A 2IF0A 4Z9AA 3NEAA 5TPWB 2G5CA 4DC9A 5F7OA 2FX3A 2ZB2A 5EIFA 4L75A 5CCDA 3VV2A 4F7WA 4E1AA 3K73O 1TUBB 2WAMA 4O5OA 5BO5A 3TIFA 3AF6A 5REQA 1C1YA 1YVUA 2PT7A 5F78A 2BM8A 1NE2A 1LBQA 1QH9A 4QOSA 3L7DA 1DXQA 4QUIA 4TKUB 3RF6A 3U60B 1U4OA 4YT4A 5LJLA 4P4UA 3D59A 2EYQA 2FJ0A 3LDAA 4B71A 4BV3A 1U2EA 1RADA 2KBEA 4EX7A 4X24A 1H93A 4G1VA 1EX9A 4X44A 1IMJA 1JA0A 3CO5A 2VHWA 2BLNA 3M3PA 5F7JA 4R3UC 3KU4A 4YBZA 1KDYA 1DIBA 4UOQA 2C1EA 4KQEA 1X0XA 4DG5A 4MX8A 2JFYA 4BQPA 2VG8A 2CHEA 4XSHA 4L4XA 2OOSA 2RHTA 4U0KA 1WXEA 4DSTA 5C80A 3FKJA 4MARA 2XT6A 2GD0A 5AVTA 5AK6A 2PVSA 4BJ1A 4F9EA 5JROA 1QMGA 1WSAA 2H9AA 3BDAA 2OPHA 3RV4A 1P74A 4GQBA 1RKXA 3DH0A 1C41A 1SIUA 2GBGA 2NSJA 4WTOA 2A14A 4D9BA 4PN7A 4K6KA 2J32A 1KWGA 3FPCA 3I6YA 1T9HA 2I66A 3EC2A 4CUZA 2OP1A 3SFTA 3MEQA 1Z5ZA 3F9RA 2R1VA 4O4HF 5EWLB 1CJKC 1JDJA 3D7KA 3DQPA 4ZQGA 3QKTA 4Q4AA 4TMWA 1B0AA 2VYQA 2X4LA 3EPHA 5D87A 3ER9A 1QBGA 3Q5DA 4X8OA 1JI0A 2CJYA 2VWGA 3CTPA 5T8KC 1UBJS 4LXGA 2QUHA 4OSOA 5BW5A 2FQWA 4AM8A 5JXHA 3Q8XB 4TWAA 1M6VA 2YFKA 3TVTA 3BICA 1GNLA 1W5TA 3VSEA 1U2DA 1RM3A 3SY8A 3WGQA 5KU7A 3R76A 5HXAA 3ZZ0A 2FE4A 4BXOA 3GH1A 1X7YA 2DSTA 2Q5JA 4E51A 1JAIA 2FW0A 1N8NA 4RPCA 2ZYIA 3I9MA 1UMDB 4HH1A 4RFLA 1C7FA 3SQMA 4C0KA 5A5GA 3G0HA 3I37X 1GZSA 4I55F 3WLOA 3S2ZA 3OJXA 3PNKA 2EZTA 4IDNA 3C14C 2E9SA 4OXQA 5AOVA 4ZTZB 1G64A 5HUQA 3M70A 1Z5GA 2D8MA 1PSDA 1TE2A 2QAJA 1HE1C 2WT4A 3VOAA 4AB1A 4FPXA 3T5TA 5LA6A 1RJ9B 2GN8A 1SHKA 5IMBA 4D8VA 4WNAA 2Q9AA 5IKOA 4REMA 1FTYA 1BFKA 1MAHA 1QQ7A 3DP9A 5J4HA 1PJQA 4FC7A 3KHTA 2P78A 3JSAA 3OLYA 4PANA 2DPXA 2CLFB 1UKCA 1QRSA 2EFDB 3BQMB 1D2MA 3HDYA 3LZ6A 3VISA 4JJ8A 1C9JA 2YXLA 4BKMA 2X8BA 4E5MA 3W2TA 2R7NA 4IJ6A 3G9UA 4AJJA 1ZNYA 4GOND 5L4SA 4LF5B 2IXEA 2KE5A 1P7YA 3DA8A 4JYAB 2HJGA 3GUUA 1ZKMA 2OT3B 3CO0S 2BKEA 2Z6QA 2D1SA 3FVVA 1HE8B 2VYFA 2X22A 5TGDA 2GXUA 3I2YX 5EC8A 1H3EA 4OBXA 1ZMTA 4XXHA 2O54A 3LPLA 3UMJA 4HH0A 3L7BA 3IP6A 2IVFA 1W36D 1WBBA 1R18A 1P9NA 1R16A 4I8XA 4HDNA 3OO1A 1ZJZA 4QPCA 5DEIA 3RJTA 1ONBA 5K6TA 1CUJA 1ONOA 1OZHA 3P2KA 3KTAA 5TQ0A 1TF5A 1KFEB 1U81A 4AKGA 3TE7A 1M1ZA 2A33A 3IILA 1Z4JA 4EVRA 3PNVA 2W70A 4JL5A 4FFWA 1YZYA 3IIEA 3RSLA 3PQCA 3E9QA 1ORHA 3FNEA 1NUTA 1X8KA 4D0SA 1DC8A 3WO0A 1OT5A 2FVXA 1WXWA 1NVEA 3PE4A 4UJ3A 4KJZA 4V1CA 4JC5A 3LFHA 5DBGA 1PO7A 4HGNA 2WFAA 3BIOA 2BGMA 3AOEC 2ZYDA 4YBRA 3TXAA 1HWYA 5I3ZA 3FIUA 4M0EA 4LXIA 2GXQA 3W2FA 3HA7A 2F3TA 4J8PA 2D8AA 4ZHQA 3IRVA 2YYSA 1T8YA 1YJXA 3M9WA 3TD2A 4KAAA 3B6KA 1XPRA 1TT5A 3CINA 4DF3A 1FEZA 2JEOA 4FYKA 1R9GA 4MB6A 1UKVY 2A1UB 3AKCA 4FFLA 5LZ8A 2G5PA 4K05A 2YV5A 4HNHA 2OHVA 1Z33A 3TAUA 3OT1A 1GPLA 1TT7A 5HJ7A 2BLLA 2X0NA 3K8QA 4NJMA 2A9QA 4KCGA 2AMYA 1E3IA 1YBMA 2QYSA 3G9ZA 4HQLA 5E9QA 1T6BY 5KNDA 4H60A 3NJRA 3TR6A 2B3TA 4MRMA 1CQWA 1FRNA 2FB9A 1JS1X 3M4YA 3UG6A 4RZUA 1NXWA 2IUYA 2IKQA 3DSRA 3VVCA 4R2WA 1GN8A 1T15A 3AHGA 5JBIA 5IAKA 3R6GA 2VQ6A 3EIQA 3STXA 1M6EX 1Z8HA 3KELA 2X6TA 3PD0A 3E7DA 4YPFA 1ZUNB 4Z4GA 4KN6A 1XN4A 2PBFA 4KQMA 3TJZA 2CB9A 3KCNA 3SLRA 2C9BA 4REOA 4AIRA 3A4NA 1W29A 3BCSA 3MJCA 4R3WA 4MZXA 4ZAWA 1DINA 4C2AA 1C1DB 2J41A 2IPOA 1CRPA 1VKRA 5EYPB 2QKYA 1N6IA 4D8UA 1NYTA 3ZXXA 4P81A 1OI4A 3PXXA 1ADFA 4XUDA 2JHAA 1R6XA 5JS7A 1QKIA 2O2CA 4MR8B 4CMIA 1AUVA 3TLBA 1XEWY 1I3KA 3H83A 2R0QC 2JJ1D 4OYYA 2PWAA 1T10A 1Q7RA 2R47A 2ISSD 2ZB3A 4RGYA 4B47A 4OK3A 3PC8C 3OFSA 4WPGA 2HU8A 2WTMA 3AY0A 2QT0A 3BXXA 2FX2A 1W581 3N2ZB 4LJAA 2EFEB 3NDPA 5J2UF 2E89A 1NVGA 1GSHA 2YV4A 5TSDA 3FTEA 4O59O 3RNOA 1IXZA 5FL3A 5KC8A 3EUFA 1U2DC 2DC1A 3AF0A 4XVUA 4RK6A 4QUEA 4MUJA 3O90A 2C9DA 5I4BA 2QL5A 3L9WA 3PYMA 3M9LA 4K2HA 2WM2A 3I64A 3T8YA 2ZZNA 1DVRA 4A6DA 3TSAA 1U5CA 4CF6A 2FFBA 3U4QA 3VSAA 5DM1A 4KB5A 3F8WA 4GBGA 4RK5A 2HRBA 1ZVKA 4QAQA 1SUFA 2QVCA 1OX6A 3ELDA 1RWWA 2E49A 5JCZA 1V6AA 2QG6A 2P1RA 4WNYA 4XM0A 4KQ6A 4CQLA 2H11A 1PG5A 2ZG6A 1YB2A 5EGSA 3W4KA 3QP9A 4JJFA 4N3BA 4S1OA 2J0VA 1E94E 3VYTB 5F76A 4XD7D 2E21A 1AU9A 1S3GA 4N01A 2WBLC 2DEUA 4K6CA 4B2YA 3ZK9A 3FMPB 3ND5A 5ALFA 1WNFA 1U90A 2JANA 3D6FA 2VQSA 3SIRA 3N2IA 1U9IC 4LCBA 4LF8B 5HRAA 1REQB 3ER6A 3CJRA 4L6IA 4UOEA 4XIGS 1U2TA 4G0NA 5JNTA 4MLCA 1AURA 3A36A 3LD9A 1EVIA 4QJ5A 1DLJA 2FSUA 1ECPA 2KHZA 1Y3CE 3GLSA 4QQKA 3E9ZA 3COJA 4MS1A 3L7OA 1USKA 2AX4A 4UM7A 4FNAA 4YLGA 1VPVA 1HXHA 4FP9A 1QHGA 2ECPA 2NZ8A 4R9NA 3ZS9A 2ODPA 4D9MA 5KQGA 3SZLA 1JEAA 4RACA 4UHKA 5HTKA 1U8ZA 3QMPA 4OKIA 3H99A 3GVIA 3R0XA 1ECGA 4KQJA 3RR2A 2HKIA 4YV0A 1DBIA 1NVMB 1SBNE 4K26A 4UARA 1D7AA 1JLLA 4NAVA 5T67A 4CCWA 2VNSA 2GARA 1M1XB 1OX4B 3FPLA 5JH7A 2ZWIA 2Q1SA 3B20A 4LUCA 4RVNA 4ZI7B 4Y1RA 4BMNA 3VR6D 4G23A 3TZEA 1A2QA 2GKSA 2C31A 3PB3A 1EX6A 4AF7A 1ZN7A 4I66A 4M86A 4DV2B 4YA6A 1RBMA 3DDWA 4GHWA 1R8SA 3K9CA 1DZIA 1NUPA 2ECKA 3RUHA 3ZW9A 1NVKA 1KSGA 1F7VA 1DFGA 2ZT8A 3H11B 3JQEA 3MCUA 4NBUA 3TZCA 1GPJA 2ZYWX 2FMKA 3B3JA 2Q3HA 2SICE 1BJRE 1HBJA 3EAQA 4MGKR 5DHAA 3RSFA 3ICPA 4ZYVA 4BZZA 3ZX4A 3NVKI 3A1VA 4AUEA 2VR1A 3ONFA 4OF4A 1E0DA 2P9HA 1JIKA 4LHWA 4I4TF 3RU3A 1SIWA 3H1PA 1DWQA 1QZ3A 3E35A 5D7NA 4MYRA 5JR3A 4UM5A 3ED5A 1D6MA 2ZYUX 2O8FB 2OO3A 2PMCA 3PIRA 3FXAA 2ZRFA 1P4HA 1N9ZA 2YINC 3EISA 1A1SA 1E58A 2QSZA 1W1IA 3CKLA 4YCJA 5DHUA 5PNTA 5CEJA 1S02A 1WX1A 4UNNA 3TKAA 1W36B 1W59A 4GZLA 3D4LA 4R9RA 3RJMA 4J0QA 3NAQA 4TN1A 5CDFA 3M7IA 1GCOA 5J47A 1C4WA 4YXWD 1CFJA 2IV7A 1E1RD 1L7NA 5JJCA 2XYHA 3V9AA 4G5FA 4J6FA 1DHRA 5HMLA 3FTFA 1LNZA 1HFJA 2HQ1A 4BO6A 4WXHA 4IHJB 4B83A 4DA8A 1NTOA 2VYVD 3UW3A 3W6NA 2Q50A 3P4UA 3MFYA 4Q6BA 1G0NA 1KMMA 1NJ5A 2NPIA 2VYVA 3U4AA 1QOQB 4TV8B 1T2EA 3EXAA 4F84A 5FPHA 3GROA 3KTOA 1HURA 1E64A 4QLBA 2QVYX 2E4VA 4X1YA 5FTKA 2VBIA 2VK2A 2WG0A 2OA0A 2VP0A 4UEQA 4URHA 1VPWA 3KL2A 1GCUA 4KN5A 5IKEA 1YHNA 3H5RA 5BR8B 3LY8A 3CG4A 3ZWWA 1ID8A 1VHLA 3NFYA 4MZDA 3H0KA 1W2HA 1KMHB 1RI2A 2FPIA 1Z4LA 3PX3A 1BKDR 1Q95A 1I4TD 5LSAA 3A6GA 4JVMA 1VIMA 3U3KA 1KSJA 2GFHA 4D25A 2RGRA 3KZOA 2WWFA 1CUXA 4OIMA 3TL2A 2FRDC 5EQDA 4JI8B 1YCGA 1Z6XA 4Y9TA 1GPWB 5JG7A 2O05A 2NO4A 2Z1MA 2Q0HA 1BXRB 3P4YA 4FOLA 2NLOA 4X20A 1RACA 4HDCA 1P3JA 4X0EA 4HWKA 3G0IA 3LXMA 4YRRA 4ME6A 4J0IA 5AJTA 4E7PA 2HYDA 2XCUA 3AG5A 4Q9KA 2R97A 3LKBA 3QF4A 4AG5A 4UBIA 2HDOA 1Z2PX 2RONA 4YCSA 1F3OA 4Q4HB 1D0VA 1GZ7A 2PA0A 3EULA 2IS6A 2BEWA 1AGPA 1DUSA 1TJPB 1E2GA 5TPZD 6ABPA 2JA1A 4GMFA 4JBWA 4LMRA 4IXDA 1IONA 3L82B 4QYIB 4S35A 4CT0A 4FT4A 2R5NA 1QP8A 2WSSA 4WXMA 4II7A 1C30A 3O2NA 3JZMA 1GAEO 4MCAA 2IUSA 2OB1A 4CV3A 2GAFA 1AKQA 4XTCS 3WXBA 3EVEA 4MROA 2V03A 5EERA 1F0KA 3EQ2A 3O4FA 4JA0A 4DUPA 3AM1A 3C8MA 2ZUEA 1BX1A 1YQUA 3KWMA 5BV1A 1IZ9A 1WCYA 3WA7A 3OZWA 1YR9A 1H4VB 1M1NB 1N8SA 4A91A 3DMDA 4FLFA 3ZJVA 1SCKA 2PUBA 1EG2A 1TF2A 1Q15A 2CDAA 2XE6A 1Y7HA 2IOFK 4JKOA 4PC6A 3UQYS 1U7WA 4JJ6A 4DQKA 5BN4A 5KOJA 3A2KA 1EESA 3FUXA 1V1JA 3I76A 1AUXA 1GHTA 1BVYF 2WQZA 4X97A 4FC6A 3IE0A 4PTYA 4WCFB 3TG2A 4CGZA 4E94A 1N6OA 2YNMC 5SZKB 2JIDA 1Z17A 3M33A 4EI8A 1Q3TA 3V33A 2G09A 1L5QA 1ISPA 3PD7A 2I7DA 4HI0E 1XPOA 4O2RA 1J4AA 3L6OO 4Z9XA 1YD7A 3KD2A 1J23A 4XOIA 1FDUA 3ZUGA 1QRUA 3NTQA 3OOHA 3F49S 3PGLA 3R3YA 4H4DA 4P3KA 4C2BA 2ZDHA 2GEJA 1X9HA 3B2NA 4QOHA 1US8B 3THOA 3JZAA 3WJ1A 4AZ3B 2AQ8A 4NE2A 3VA7A 1SOWA 2HR1A 3LY5A 3IUJA 3X1ZA 5K2OA 3EAFA 1EKXA 3L7CA 4W7HA 3IMGA 1Q19A 1Q6YA 1P4AA 2AT1A 1W5EA 3ZTTA 2EFCB 1P7VA 4DR3B 3ED1A 1YJQA 2UYYA 5E38A 4DSZA 2GM4A 3U09A 1I3LA 5CLQA 2J45A 1UPBA 2F3QA 4ZVQA 4ED9A 4BYMA 3D0OA 4RNDB 5FFFA 2CXPA 3BRCA 3Q72A 2N1BA 4PG6A 1P60A 3VMMA 4UOZA 2QP4A 2Z1NA 1LBSA 3ILHA 2R8OA 4HAXA 4RD4A 4CRWB 1PHRA 1U0HC 1LDGA 3UV7A 1UXHA 4BN5A 1NNI1 4OXNA 1I3NA 3U2QA 3QXJA 2EU8A 1KY4A 5KAMA 1ML3A 1LUAA 1WWKA 4QLOA 4U7TB 2QRUA 3LPDA 2BCJQ 3TZKA 4MPTA 4IIXA 1ULBA 1W76A 3LLVA 1FX0A 1K6EA 3VKFA 2C58A 5U4QA 3UICA 3PBKA 3KEMA 2I9PA 4GZMA 4LTDA 2HPVA 4TQ9A 4AJ9A 4DILA 4C5CA 2QX6A 3GEHA 1IOWA 2PL1A 3EEYA 3UAXA 4YT2A 4YN3A 3OQMA 2EF1A 3HM9A 2Y71A 3K1JA 3OBBA 2JRLA 2VYND 2L42A 3IIJA 3QTTA 5K3EA 4HDSB 2DPMA 5B53A 3AF1A 3LUCA 1XJQA 1Q3KA 2HJSA 1BCSB 3DDZX 1U63A 3RJ5A 4PNZA 5M04A 1UC8A 4M9CA 4I1PA 2HO5A 1JEDA 4BJ3A 3COYA 3OIVA 4ON9A 5JAIA 3CBQA 5K4GA 2JAWA 4K3VA 1ZPDA 3VU1A 3EXG1 121PA 5JY6A 1QIKA 4UZFA 1M7HA 2XH8A 1TB4A 2D0OB 1L4EA 3QMVA 1WVMA 1NVWQ 2FPGB 2G1KA 2WJZB 5CXXA 4BVFA 4C7BA 4DIDA 3HFRA 1RPAA 2J5BA 2ZYTX 1T0IA 1VPLA 4ND8A 2IYPA 1S4MA 5G40A 2FPKA 3H4VA 3VHXA 1C3LA 4O2BA 1M73E 2QTGA 4V24A 5EQTA 3J81k 2DH6A 3NYRA 1DCMA 2V0NA 2XB4A 3GAMA 1YVEI 1EFHA 3OM0A 1JZQA 1KFKB 1XYVA 3U16A 1XC7A 1XG5A 1VL2A 1KE2A 1Q7TA 3KR9A 2H4YA 1QS0B 3HDQA 4RVDA 3BL6A 3WJ2A 4D98A 4DMMA 4YCNA 1RTTA 2FEPA 2W71A 4UNPA 3QE2A 2PLFA 1FYVA 2ZUBA 3I6MA 4R83A 1OV6A 1W5AA 4CR8A 3BH0A 4RD0A 5KDLA 1MAWA 2C0PA 5JMOA 1ZI6A 3K1ZA 3H1AA 2HNBA 3L8EA 3GCZA 4LK2A 3TBFA 2CHVA 2EJWA 3DO6A 4ZZ1A 5A2GA 1JQ3A 1J0AA 3OF5A 4ER7A 1H66A 2CVPA 2XY4A 1MABA 2YVUA 2C54A 2AN1A 3PDJA 2J0UB 3DM9B 2R7LA 4DGSA 2O8BA 3WWYA 4ZV4A 1U7TA 3C3BA 5B64A 1NW4A 2O2GA 2OGTA 3BRWA 4OGGA 3K6SA 2CLMB 3KLBA 1E0AA 1A88A 2ZM6B 3ZVLA 1VIDA 1M2WA 1UKEA 4U9IS 3AKZA 1FVXA 1THMA 2H1IA 4KYTA 2HJ9A 2WUGA 3VPFA 2DKNA 4F6LA 1A8IA 4NZNA 1YL7A 2GTIA 2O07A 3SJ7A 5FBKA 1XHFA 1UXOA 4LCJA 1LEHA 3TRHA 2BSQA 5JE8A 5K0NA 2ZI5A 3ERCA 1GUBA 4DCSA 4MEJA 5BRNA 2Q5OA 1KPIA 4OJTA 5D5QA 4DE5A 2X8AA 3R7WA 1W88A 3R3XA 2D5AA 3ON5A 3W9UA 2RCYA 3HR8A 4UAVA 3FOWA 4QSHA 2V96A 2ZUVA 4E11A 2P9BA 4BV2A 1CSEE 2H06A 4M76B 2V5AA 4MPRA 4QDKA 4BZQA 1RAGA 5B6JA 1LQTA 1RLJA 1PWHA 4TTIA 4IJ5A 4S1TA 3FSGD 1QF6A 2VA8A 4L0DA 4EAAA 2V55B 2BKVA 3H9BA 5EMHA 1NW3A 4BFZA 2X0FA 1V5IA 5KHAA 1FSGA 4QM6A 4LQDA 1FMJA 1JAHA 5AOBA 2CFSA 5KTTA 1LI7A 1XAJA 2QTVA 1TM3E 2UZ1B 2H0RA 4R1NA 5ALLA 3X44A 4BBJA 1ZIYA 1TYZA 4XUEA 1NL3A 4MR8A 4AJLA 1WVIA 2VF4X 4G67A 2JD1A 3QIVA 2XXJA 2Y76A 2R79A 2E6UX 2NSDA 3OEHD 1CQJA 5BOVA 4J6EA 2WB4A 3TNJA 1WXQA 5C7IO 2CL7X 4MMXB 1QH8A 4GPAA 3RT7A 1M1UA 3QGMA 5HK8A 2RGYA 1YTLA 1EP9A 4QJBA 4IWYA 3L0IB 4RXUA 4O3FA 1OFHA 4K87A 1YKGA 3A1WA 2YZNA 4DRYA 1YASA 4HJRA 3CA8A 1QGAA 1ODJA 3VTFA 4PAGA 3QVUA 1GTG1 2EZ9A 2I7XA 3I9V6 4EVIA 4BQEA 2EQBA 4C0BA 5A4DA 3P97A 4F3RA 5CB4A 2GNAA 3EZYA 3JS5A 1OLXB 1O94D 1YNSA 1MC1A 1K3UB 1CVIA 4MO2A 1ZHHA 3UTDA 3LC7O 4V0MA 3TDMA 5BPFA 3QX7A 3AFGA 1GG9A 2YHAA 1HI9A 4B35A 1KMQA 2F9MA 2IYNA 3O47A 4M1QA 4DC0A 5IN4A 3DMHA 3R2JA 3TFQA 4C0WA 1AKWA 3DCJA 2OE2A 3PCRB 5JXIA 3NBZC 4DCGA 1JPNA 2YVQA 4PU0A 4Q4LA 3W3AA 4WH0A 2DQ4A 5IKMA 1NVFA 1R8QA 1UF9A 1EE2A 1YTUA 3OMLA 1XNJA 1HNZB 2O8EA 4MUIA 3AUTA 4PR0A 1ZHFA 3AFIA 2OHIA 4NMXB 5A7FA 3WGVA 2NU9B 4EEXA 5EY5B 1N2XA 3HN6A 2ZS8A 4YIHA 4QNNA 4ZQFA 4FB5A 2O14A 4F1JA 3SF0A 1PV1A 1SY7A 3RIXA 1SQSA 4OSEA 1G4AE 3QX3A 2AFHA 2RJNA 3AIOA 1F2TA 1IUPA 5I48A 2AJCA 4FE4A 2DFDA 5LVAA 4TYNA 2CDNA 3HU5A 2GS9A 2X77A 3EZ9A 4OLAA 5KMGB 1AKUA 5HIAA 2DWQA 2WM3A 2DBZA 3LT1A 4LQLA 3F5DA 3VZSA 5FDFA 3GRRA 1WMFA 3L7IA 2PY6A 5TNXA 4LBWA 4CI0B 1CUWA 4GBED 2J9RA 3R5FA 1YCHA 2R7KA 1N1EA 2E87A 3H9CA 5DIZA 1BS9A 3OQIA 1UR5A 3LL4A 1GITA 3DEAA 3QU5A 2PT6A 4GUDA 4TYMA 4E2WA 1EU1A 2W42A 3GCXA 1RIIA 1JKJA 1LLDA 1GR1A 1OGIA 1VFPA 1XZLA 2XQKA 3OFVA 3ORFA 4HX2A 4P3PA 1EHIA 5IJAA 1CUBA 3VR4D 2JCYA 3T5AA 1ID1A 1A7JA 2PZEA 2WTXA 3HVKA 2ZFUA 2JAQA 1VPEA 3G3EA 5HTOA 2QTZA 4Y98A 3E6AA 1KYXA 2XB8A 4IHJF 4X90A 5K99A 1ULSA 3FM9A 3K0FB 3OUZA 1ZY2A 3KKLA 3AIIA 4XR9A 2BFAA 4F85A 1UL1X 4AWAA 4CMHA 1Y63A 1U1IA 3T3PB 4TYWA 4WK0B 1ZRNA 2HADA 1JLHA 4U63A 2QTHA 2VH2A 3EXFA 1F9AA 4JEIA 4RE5A 3WBFA 5K8CA 4Z3DA 2Q3MA 4UTVA 3BIJA 1IOLA 3NUZA 1B8UA 3IIMA 3U61B 2QMUA 2D1QA 3D7SA 1KY2A 2NGRA 3KJHA 1DRJA 3MJEA 2XDYA 5CFMA 2BD0A 1A8UA 2Z56A 5H3CA 4NBWA 1D03A 2HUPA 4EMUA 2YWCA 3H04A 5G3ZA 4DB2A 4EY4A 1B2LA 2PD4A 2QEQA 3INTA 1P5RA 3QPCA 4O2BF 4PS0A 5D5PA 3KIPA 1V41E 4KX3A 4UD2A 4FILA 3ZS8A 1ZW1A 2NQTA 2ZYRA 3MK31 1PQPA 1QHHA 1XF9A 3DTVD 1LF0A 1KEWA 4RY9A 5AKJA 1KC1A 1FMCA 4O4LF 4DR6B 3C15C 1FFEA 3R8XA 1UT6A 2HDHA 4IMRA 2B4TO 3VYWA 4A0SA 2Z6AA 1NU6A 1BNCA 4FINA 4JWTA 2GYVA 2AF3C 3EFBA 3JQRA 2GWHA 3ODPA 3DAOA 2PX4A 1YBFA 3EBPA 6ADHA 2EARA 1ILWA 4MMYB 1H2XA 1WY7A 4JXKA 2IYSA 3WGYA 2IXBA 4MQ4A 2VAPA 3ZCRA 3EA5A 4Z4HA 3UFXB 5ANRB 3C7DB 3G7NA 2VTDA 4XLTA 3U26A 4BP3A 2IC5A 1G4UR 5CVVA 5F3RA 1TKRA 4CQLB 1KSHA 2C9OA 4XGIA 4L0MA 5KYVA 2X41A 2L0XA 1Y6JA 3OCYA 1C0PA 2PZKA 2YNMA 3PHIA 2IDMA 2P62A 3ROMA 2QVBA 3H97A 3DUWA 1CF2O 4K0RA 3X1XA 2R65A 1V4VA 1NXPA 3EQZA 3H8VA 2H3HA 1CS0B 1R1DA 3KM0A 4OQPA 3BMNB 4P31A 3KNZA 4IOMA 2F1KA 3EJ6A 4M1SA 2X5OA 1PT5A 4P4TA 2F48A 3IJPA 4Z0NA 2VT2A 4URZR 5CA0A 3SYKA 4RPGA 3SE0A 5BYBA 4M38A 4KFCA 1NOJA 1XZHA 4ND4A 3WP1B 4B82A 5CFRA 1IZYA 1PZFA 2JGIA 2AOUB 5D84A 4GZ6A 2QZ9A 3E05A 5F1PA 4BLQA 4FYJA 2I6SA 1SBCA 4R1LA 2H2AA 3EVNA 1IXKA 2VDWA 3HACA 2IXAA 2FSVA 3KZCA 5DGHA 5DFAA 5HKLA 5M3BA 4L4YA 4MUYA 1Z08A 2W58A 1N5LA 5C4GB 3WAJA 3AUYA 3Q2OA 1EDEA 5BSFA 4JR1A 3RVPA 3BHIA 4D8YA 2J7PA 4OMUA 1VDZA 1P9LA 1L8AA 1TZKA 5AM1A 1PX0A 4DOMA 5JLAA 1JR6A 2G04A 5A05A 5J5CA 2YDYA 1ZAYA 4RF3A 4BO3A 2VHVA 5BW8A 2OY0A 3AEYA 1YQDA 2GR9A 3AI2A 5DYIA 4YB8A 3V8MA 3PNMA 1Q12A 1PYGA 4LX0A 1RMQA 2YXNA 2AYZA 3MB8A 5CA1F 5SYAA 1S9HA 2XLBA 3H4IA 2YHBA 1Y9AA 2IUTA 2ZS9A 1K7SN 1X15A 1QMPA 2B94A 2VDOB 3K1TA 5HILA 3D5QA 3NDBB 1VCNA 2Q3BA 2UYHA 4Q15A 3E22B 4MOWA 5HP4A 2IIBA 1C3XA 5HHTA 3SE7A 4BB5A 1M1YA 3R74A 2C61A 3NWOA 3GUZA 3FPJA 5F5LA 1BFDA 3T4XA 1RQ2A 5FAXA 2O5EA 1T8WA 5KVVA 3BL5A 1HV8A 4M7OA 2BZSA 3NHAA 4RLSA 4C1BA 3MS4A 3ZIAA 4JITA 1BMTA 3OZ7A 2Q8NA 3CVOA 1LC3A 1BS2A 1N5IA 3ASZA 4H7FA 3A6LA 4OI2A 3S5UA 2QSYA 1QHHB 1M2VB 4QUBA 2HA0A 4EZIA 1T29A 1AMNA 1GA6A 4G24A 1JNXX 3FBTA 2QTVB 4B74A 1THZA 5K0EA 2ALJA 2JI7A 3L06A 3QLJA 3QU2A 4MRVA 4TVBA 1NZFA 2JVKA 3KXLA 3LXXA 4WK6A 3ZZTA 5FUQA 3U40A 1HLGA 3GPDG 1XTUA 4W5WA 2YVKA 3EHDA 5C51B 2Y9PB 4CL8A 2D1RA 4EA9A 3HO8A 5JY1A 1HLPA 3L7KA 2VF8A 4FBMA 4MI1A 4HEQA 5I7WA 5JJLA 3NHFA 1O97D 1KYIA 2DCUA 1Y37A 2J4CA 2ZR0A 3PCXA 3VNVA 3TPZA 5CTJA 1XTVA 1BGWA 1JWAB 2Z3WA 1EINA 5BT8A 5B1YA 4HB3A 2K7ZA 1CNFA 1GKUB 2VRNA 3P26A 1SHUX 1DJPA 3AHFA 1YXMA 2COKA 4KSBA 3K4QA 4MUXA 2WG1A 3VR4H 3C45A 3H5VA 4O63O 4LY3A 1N0VC 2BTQA 1JMVA 2P75A 1UZAA 2DQKA 1HZZA 3NHRA 1MB9A 1SXJD 3DZJA 3G0DA 1E1LA 3CEHA 2DHEA 2WVHA 4OD0A 2OO5A 2FPIB 4NMLA 4NRDA 5JC8A 4BNKA 1NMZA 5IDWA 1AN9A 4Q48A 2X1VA 5JHGB 1G59A 3T1OA 2MSNA 5BMVA 1P1FA 5KNBA 1QYXA 3I0MA 5D3QA 5EN4A 3IVAA 2A67A 2DCMA 3DVQX 4I2NA 1KE1A 2JCSA 2Y1XA 2H8GA 1OX5A 2R6HA 3EIEA 1IZ0A 3D2CA 3GLRA 1TKAA 1NJSA 3H2JA 1UXJA 3THSA 4YMHA 4A8JC 1V3UA 4YJHB 3L4JA 3WISA 1H2BA 1GFIA 4XRGA 2CT8A 1KTVA 3FDFA 4R2MA 1JRLA 3EG5A 1QFJA 3BSFA 1UINA 2A5LA 4HF7A 3EWAA 1A7KA 1II8A 5A4FS 1JB1A 2JFWA 2PRZA 3SLKA 4AJHA 1I0LA 2ZBUA 5KWVA 1AMOA 3K0EA 4OLBA 1ODFA 2YOFA 3N1UA 1D8AA 4TN5A 1C2TA 1L6RA 2V7BA 2FSPA 3LF1A 4L8WB 4URFA 3ZH9B 3ZK7A 4D56A 2BGGA 5HKKD 1R5JA 4OBWA 4R5HA 1E8DA 3DZGA 3EOBI 3I3OA 2D0DA 1AA6A 2PEYA 4YRPA 1M5TA 5EHIA 2I6TA 1L5VA 3R4VA 4P34A 4KRXA 4YACA 5CMLA 1GGVA 3CPHA 3RYCA 5LIPA 1G8KA 3DMRA 2C8KA 3IT0A 4YO8A 2WD8A 2KB0A 3B3GA 4Q3AA 1FQOA 4UMEA 4WBNA 1UKZA 2UZ0A 1OI7A 3HLTA 5G4KB 4O1HA 3D6AA 3AH8A 3H9UA 3MWEB 3USES 3K9BA 4RF4A 1CR4A 1XVIA 3EVGA 3NKLA 1HQCA 3TAHA 5KNDH 4OXXA 1D9ZA 3F5SA 2O8DA 4KXFB 1N2EA 1WHTA 4M7RA 1PJBA 1UBTS 2HWUA 3DAYA 3ISVA 1ZP6A 4QNMA 2GK3A 1T3ZA 3Q0IA 3FGNA 5KREA 2JLYA 1WCIB 3TRKA 2JFOA 2YWEA 3GNSA 3TOSA 1U8EA 1H9AA 1Z6YA 3GFVA 1EFPA 1JKMA 5BSRA 3GDHA 2PS0A 2YQ4A 2P9YA 1WIWA 4XJVA 3V7WA 2C20A 3LCJA 4YUZA 3DFFA 4Z7OB 3OX1A 3V5NA 5C7LO 3I6BA 4OQMA 1XD2A 2EAUA 3EEQA 4BCDA 3HYCA 1OZGA 3NALA 3JAMA 1RJGA 2B4AA 4AECA 1Q0ZA 1JHQA 4PCVA 3HCWA 2GO7A 3SOPA 5L3SA 3LUAA 3AB8A 5CPBA 2YJ6A 1CRLA 1FCJA 1Q44A 3LRTA 2IOHA 2GCOB 4HAVA 5AVOA 4G0YA 2CL6X 1ZESA 5EWMB 4R05A 4DV0B 3CBGA 5EZYB 3L8GA 2V7VA 4OIFA 1NBWB 4OB8A 3CX3A 2Q9CA 3W4IA 2GM3A 1AKEA 1YKSA 2VDMB 5JVDF 1ZLYA 1E4OA 4AUMA 4L9RA 4MR7B 1YR7A 2QI9F 2IELA 1UWLA 3A9UA 3I4CA 2GPSA 4R6XA 1SXJC 3A32A 1SVLA 4HAYA 4L73A 5CLGA 5F9MA 2PXCA 3PC7A 1X7XA 2AW5A 2WWWA 3KG2A 4CQMB 4Y1FA 5BR1A 2N3ZA 4RA9B 3UZUA 4Z4IA 4KMOA 2QM0A 3IUEA 2DB3A 5L7YA 2M6LA 3P0IA 4DPKA 2DLCX 3GPCA 1EM6A 2H4FA 4BO0A 3RAJA 3WNBA 5DXJA 3Q9NA 4DJDC 3AJ8A 5JEDA 2J09A 1KYYA 1LBHA 3U13A 3QKSA 4BMPB 1VPDA 5G3YA 5TB5A 1AO3A 2HBQA 4BNTA 1FLNA 4DEXA 1GU7A 4AS3A 621PA 2ZRQA 1G8AA 3MIZA 1J1UA 3O21A 3V8QA 1CUFA 4N0PA 1OXTA 1RU3A 3TUIC 1S8OA 2IFTA 4P3NA 4R7ZA 4QOGA 1ZD3A 3O1JC 3T1NA 3W1VA 3ZJ4A 5C8YB 3LVQE 3HE3A 4KNVA 1B74A 1GU1A 2LDBA 1TYCA 3Q0EA 2EW1A 3F67A 4NZ9A 1MO2A 2XD4A 1IG3A 2FPRA 3L0OA 3HRIA 4RMGA 1T4CB 5MN6A 4Z1MD 2IEBA 4QPZA 5LP6F 3N7TA 1TVMA 3BMQB 2PZ8A 2J3QA 3ZW7A 3FX2A 3AKDA 1QHXA 1PG0A 3TE6A 2OZVA 3PS9A 3KZXA 3H42B 1NHWA 2I22A 3N2YA 1DHTA 1FRVA 3S2FA 1PIWA 4ARVA 2JFNA 3FMOB 3R44A 1Y6ZA 2Q7XA 3DWEX 1RRGA 3IEMA 2PYZA 5ELLA 4M0MA 2E48A 1H8HA 2O2IA 4ENQA 4TWIA 3RC7A 2FPUA 2B83A 1JVSA 1XRMA 3WL7A 1H05A 3MMPA 4AMUA 1E9AA 2MWMA 5FTWA 4JX9A 5JECA 4P6VF 2DBQA 2ECFA 1G9SA 3G2PA 4W7SA 4LJKA 4V2IA 3WWPA 1QK3A 4G5QA 4OK6A 3VR5D 5GJWC 3BGOS 1ZIPA 4LYDA 2QLLA 1F2VA 1PAUA 3PC6A 4AMGA 4AI6A 1JDBB 3T94A 1RXIA 3IDSA 1D2NA 4QT4A 5IT0A 2Z9BA 4QYMA 4ZO4A 4E31A 3I1FA 2J08A 3D0KA 5JAMA 1XZCA 3F5MA 4JBXA 4ARZB 1IOVA 3VDXA 2J3MA 2BEWB 2X0RA 4NQRA 1J8YF 1L5KA 3TLZA 3URMA 1JH9A 4NEGA 5KBYA 3OCJA 1R8YA 4IFIA 3DMYA 5JOQA 2J6BA 3QYJA 3TSOA 1E1YA 4MDFA 3EPKA 2Y0DA 3DHEA 3DONA 4WUVA 2P1DA 4G56A 3Q11A 4K9MA 1FUYB 3E48A 4C3UA 2GNPA 2ZWOA 3GYBA 2G80A 3MWFA 2R11A 3N9IA 2R8BA 4AF6A 1X7ZA 3BZUA 1E2NA 1F6DA 3KO8A 4LZNA 3TZ6A 2ENUA 1OIWA 3ZHVA 1E3SA 2I3AA 3QVSA 2J9YB 4K6MA 4OPMA 1QFZA 1NSFA 2V7TA 5K8JB 3EDQA 1C7IA 2YW9A 3MWYW 2MT9A 2QTNA 1Z6GA 2R4QA 3P2IA 4N3NA 3QFSA 4HB0A 2WJPA 3F98A 4N49A 4IH4A 2R1TA 2BMWA 4YRTA 3QBEA 1HORA 4E2ZA 4E4YA 2AHOA 2GOYA 4FMDB 3H9GA 2OV6A 4UHDA 3PVSA 1MC4A 4NH0A 3PGVA 2OGUA 4GKBA 3VSBA 1GDHA 1OFTA 4JP2A 4EJSB 1GQYA 2ID9A 4FFRA 1RSZA 4HS4A 2YXBA 2O8FA 1G1MA 1DCKA 3SAJA 3WX0A 4LDRA 4FCCA 1I1OA 1DDIA 1T3HA 1XTIA 4JC4A 4L0CA 3Q5GA 4GOJA 4TPKA 3HM2A 3I01M 3IAUA 4TXLA 3RNLA 4PLPA 3LRPA 3W9SA 5A5FA 1NXXA 3IDQA 1IAVA 4G4JA 3AVYA 2FA9A 4DEYA 5EP2A 4E2FA 4POAA 2WU8A 1NQWA 4FE7A 4ID9A 2CBGA 2JB9A 4B32A 2ZJAA 3VJLA 4PC7A 2QNRA 2F43A 3CLKA 3RVOA 2WPNA 4F4FA 1X1AA 2JHCA 3A70A 3GGPA 3QX9A 1VGRA 3ANLA 3OZIA 4Q02A 1AUPA 2EZ4A 5C5EA 5ED0A 3VDNB 4F8JA 1S3FA 1HKUA 3WGLA 1BRTA 4OFBA 5L6LB 3WYNA 3DEHA 5H9WA 2H00A 2DTXA 1OBVA 4TKVA 3CVYA 1W9MA 1DXHA 3FPEA 4LWOA 1B6RA 4R2HA 4WSOA 3ZR4B 3MILA 5E2IA 4OYLA 2PQ0A 4A8TA 1SQ6A 3N2GA 1AE1A 2X5JO 3DTNA 1X8XA 3KV1A 3TGPA 2Z3VA 1N6PA 2P4HX 3DYIA 1ZWKA 4S0ZA 1FXWF 3FKQA 4C89A 4CTJA 3OMWA 3R6D