1ZH4A

Crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
121
Chain Sequence
MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A common dimerization interface in bacterial response regulators KdpE and TorR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords KDP operon transcriptional regulatory protein kdpE
total genus 42
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zh4A00
3Q15C 1KRWA 3NHZA 5CNMA 3G1WA 3JTEA 2QZJA 3NNDA 3A0UA 5DCLA 4QYWA 1M5TA 4EYGA 1EWVA 4P1ZA 2FMKA 4HNRA 3OQMA 2N9UA 4D6XA 1ZY2A 4Z4HA 5IX8A 6CHYA 3OLYA 3CZ5A 2R25B 3IP6A 1DRKA 3DLHA 5ED4A 2IDMA 1F51E 2IPLA 2YHAA 2E4YA 1YMUA 3OQOA 1PEYA 3RVRA 1NTRA 2MYPA 5D2CA 3CU5A 1D1PA 4RK6A 3H5LA 3ROFA 2PUGA 1RXIA 3IPAA 4QYMA 4RY9A 3GBPA 5KWSA 4ZMSA 2A9PA 1ZH2A 1CHNA 4ETNA 3CG0A 1JFVA 4DQDA 4KREA 1DC7A 3LUHA 1A04A 1FQWA 1JL3A 3LUCA 4L85A 1NXTA 3BRQA 1BA2A 1NXWA 2VYCA 4G0QA 4ML3A 3KHTA 4EY3A 2RDMA 2QW1A 1NXSA 3HDVA 4N47A 2JK1A 3M9XA 3CG4A 1TVMA 1QQAA 2MSLA 3CKMA 3HSYA 1APBA 3C3MA 4KZKA 1U04A 4W5TA 2PUBA 1FSPA 5IULC 1XHFA 1USGA 4LZLA 1J56A 4Q6BA 5KC9A 2WWVD 4MR9A 3NNNA 4IMIB 3ILHA 2L19A 3H1EA 2L2QA 1SXHA 3VNBA 5C5EA 3LOPA 1OXBB 4WXMA 3HM9A 4RWEA 4IGAA 3LUDA 3GL9A 3EULA 1B00A 5CHYA 2F8SA 4LE1A 1YK1A 2GX6A 3F7NA 4MR8B 5GOTA 2LP4Y 1W25A 4IRXA 4WZZA 4G0MA 4F3TA 1RZRD 2R47A 1QP7A 2DRIA 3JPWA 4Q6WA 3N0RA 4WUTA 1BDIA 1Y1LA 4YV7A 1Z15A 4MRMB 4KQCA 3MMNA 2IPNA 4XLTA 5DKFA 1NXXA 1T34A 3H5VA 3QLUA 4MR9B 5CNJA 1DJMA 4MLCA 1IIBA 4EVSA 3Q41A 4QPJC 1K66A 4TLMB 3HCWA 1QO0D 3IDOA 2PE5A 3O1JC 3GRCA 4Z9BA 4EVRA 3SG0A 3N53A 1BAPA 4IMJB 4MS1B 2FMIA 2O20A 4XARA 4WWHA 3NHMA 3K4HA 1ZGGA 5I4CA 1P8AA 3RVJA 1QO0A 2MYTA 3RH0A 2JBAA 4MQEA 2QV0A 1XWWA 3G85A 5JNUA 2JVIA 5TE9A 1P6QA 1S8NA 4Z4IA 2GBPA 2JVJA 4FB4A 2R48A 2E4VA 1QQBA 4D74A 3T95A 3K9CA 5EWJA 4RXUA 1Z13A 3M6MD 4RZSA 1SD5A 3CTPA 2QVGA 4TMYA 4B09A 5T7BA 2WMYA 4NQRA 3N75A 2LPMA 3MYYA 4RXMA 2OQRA 4JP1A 2FN8A 4EYOA 2JRLA 1JF8A 4D6YA 4NCBA 3ROTA 2MSKA 5TPWA 3UUGA 5HM6A 1TMYA 5EWMA 2J48A 3Q9SA 3QEMA 3EODA 4YS6A 1H9CA 3CNBA 1GUDA 1KMIY 1RNLA 1EHCA 3DGFC 4MS4A 3SY8A 4YRZA 3GBVA 4RXTA 2AYXA 2PL1A 1HEYA 1YVUA 1L5YA 1XHEA 4G97A 1DP4A 1PEAA 3KLOA 4HNQA 3QK7A 4RK1A 5BRAA 2HQBA 1YMVA 1QPZA 3KYJB 3FDFA 3KG2A 2FLKA 3D02A 1ABFA 2WB4A 3HJFA 4Z4CA 4MQFB 3NNSA 5TQJA 3FFXA 1JYFA 4LDAA 3H5IA 2QVCA 1JX6A 2X7XA 3LTEA 1KRXA 1NXOA 5KQLA 3QEMB 1Z2EA 2PKXA 1KGSA 1AB5A 1MB0A 3BILA 1URPA 3Q7SA 3EDCA 3LUGA 1U2QA 3HDGA 1Z12A 5KQMA 3N6VA 4RKRA 3BBLA 4Z4FA 2QSJA 3O2JA 1JFTA 2PMCA 4YCSA 3MM4A 8ABPA 3EQ2A 5TQ2B 2IPMA 3H5OA 2L17A 2M1ZA 2RJOA 3C3WA 3F73A 4MLDA 4MR8A 1BDJA 5PNTA 3HXMA 1GUBA 2I6FA 5ABPA 3DBIA 4H60A 4O5AA 4F06A 5TQ0B 1JWLA 3BRSA 2LUOA 2ZWMA 2ID7A 3LFTA 5JNTA 1JDPA 3EQZA 2TMYA 2R4QA 4G0YA 3CHYA 1MB3A 3TMYA 2KYRA 1DBWA 1DG9A 2JVKA 3DGEC 3IP7A 3MF4A 1MAVA 3LUFA 4LE2A 5CNIA 5EWLA 5IUNC 2P4UA 5F64A 3RVPA 3H75A 4N0QA 4N03A 1QKKA 4F8JA 1DBPA 4MS1A 2HQOA 3RVNA 3T8YA 4OBBA 5CNKA 4LRQA 3LKVA 1CEYA 1E6LA 5C5CA 4MS3B 4YWHA 3F6PA 4XXHA 2PUDA 3DLBA 4G0XA 3E3MA 1DC8A 1E6KA 3C97A 3LUKA 1L5ZA 4PYRA 4RDCA 3CRNA 4O1IA 1NY5A 1YS7A 5FWYB 2A9RA 1ZESA 1ISSA 1RZRA 3SQNA 2FTKE 1E6MA 4RV5A 3A0RB 3VNAA 2PUFA 2V0NA 1U8TA 2FW0A 3OLZA 4OLAA 1I3CA 2YHBA 1C0EA 1USKA 3HV2A 2B1JA 4P98A 1VLZA 1DCMA 4NCAA 4FE7A 5JS2A 2NT3A 1QP0A 5IC5A 5T3YA 1W9HA 3QELB 1RXEA 4ZMRA 2MYNA 5JNRA 3KJXA 4KNYA 2AYZA 3HEBA 4RK0A 2E4XA 4WXEA 1Z18A 5FWXA 3O74A 3OM0A 3E61A 3IP5A 3F6CA 4HYEA 1JFSA 2GKGA 4DADA 2CWDA 5FBKA 2A9OA 4TLLB 3SM9A 4Z99A 1M5UA 3L6UA 3RQIA 3KS9A 4JASB 2Q5CA 3LMKA 3QLUC 1GCGA 3IP9A 2PL9A 4L4UA 2IKSA 3JY6A 1PNTA 1A2OA 5B3JA 4RSMA 1EWKA 3N8IA 4G0ZA 2M98A 1JYEA 1ZGZA 3LUAA 4E7PA 3RVMA 4G0PA 3Q7RA 4Z4EA 3LKBA 4ZJPA 3H5WA 4W5QA 1ZITA 1ZHHA 1AB6A 2CHFA 4ETMA 5JS1A 5EWJB 4YLEA 4OLBA 2FLWA 5HSGA 2IOYA 3KLNA 9ABPA 3H5TA 3UKJA 4F11A 1LK0A 1GCAA 2PAFA 2W42A 1FFSA 1JHZA 3D8UA 3EAFA 4MAAA 4MPTA 3RVQA 5KC8A 1R8JA 4MGEA 4EUKA 2E4ZA 5TQ0A 2VUHB 5IUJC 4JB0A 4NV3A 1RPJA 3H1FA 2H3HA 2FXIA 4OTZA 2JB9A 4YGXB 3DZDA 4H3KB 4MQEB 4KQ9A 1PHRA 4EYKA 2GI4A 2WJWA 4CBVA 2FQYA 3N0XA 1ZDMA 1EAYA 4MR7B 1DBQA 1TJYA 4XAQA 3O2QB 4XASA 4YR7A 2IYNA 3RVSA 5DLEA 4RU1A 2B4AA 3OLWA 4MYRA 4RK4A 1TM2A 3CZCA 3QLTA 3HS3A 3ILYA 3OLVA 2QXYA 4RK5A 4E7OA 4M88A 3QEKA 4EGSA 3QX8A 1OXKB 3T6KA 1DZ3A 2PJUA 3QLVA 4OG2A 3GV0A 4Z9AA 3I09A 4YP9A 1Z16A 5KQGA 3FFTA 3MQ4A 1NATA 4RKQA 2E4UA 4Z0NA 4JA2A 4EVQA 3BREA 5TPWB 4JOQA 1WETA 1FFWA 3CFYA 2F8TA 5EWLB 2OENG 2FKAA 3HO1A 1LBIA 5BR1A 2VK2A 2XDYA 4PZ0A 3QELA 1YIOA 4LX8A 2FEWB 4Y9TA 4MRMA 1D4ZA 1Z2DA 2FEPA 2QR3A 2CHEA 2GWRA 3I45A 3CLKA 1Z26A 1GLGA 3EGCA 4O1HA 5E3JA 7ABPA 1JDNA 5IEBA 1NXPA 1YK0A 3IPCA 1Z25A 1DCKA 3QLVC 1U2PA 2ZAYA 5TPZD 2VUIB 4RK7A 1USIA 2FMHA 1VKRA 5TQ2A 4RY0A 6ABPA 2HSGA 1M2EA 3HZHA 5KI6A 1F4VA 1FFGA 4FE4A 4ZYLA 1Z17A 3NBMA 4GPAA 3HVRA 2JBAB 3O2SB 4PICA 5GQSA 3O21A 2FSPA 2WY2D 3KYIB 3S99A 1JBEA 2RGYA 5JNVA 1K68A 1SXGA 2A9QA 4LDZA 3HUUA 4RS3A 1VRVA 1ZN2A 1ISRA 4Z4GA 3M9WA 4QICA 5EWMB 3QX9A 1TLFA 2FN9A 5JNSA 4G0OA 5FWXB 3JVIA 2WRZA 1YTUA 1JLKA 5FBHA 4MR7A 2FVYA 4ETIA 2PUEA 1P2FA 2FMFA 4GNRA 3TD9A 5FWYA 1ZVVA 5JNWA 3T38A 4KPYA 4Q7EA 4MS3A 3OMWA 4G86A 3H6GA 4NICA 4KK3A 5B3JC 5KQPA 4DN6A 5DTEA 5IBQA 1LBHA 1LJLA 3RVKA 3FMVA 2HPHA 4KMRA 2PLNA 3KTOA 4F12A 2NT4A 1MIHA 1BVHA 3O1IC 3FFWA 3KKEA 3OO0A 2LIVA 4UHKA 5HKOA 3GWGA 3UK0A 1D2AA 4JAVC 3SNKA 1DRJA 4PE5B 2ID9A 4W5RA 3GA5A 1DCFA 3OO1A 3H1GA 3A10A 4S05A 1M2FA 1D5WA 3C3KA 3KCNA 1NXVA 3TO5A 4S04A 4UHJA 3JS5A 1P6UA 4JB2A 2PUAA 3L49A 3A3KA 1EWTA 1YS6A 1D1QA 3C6QA 1E2BA 3TB6A 2PUCA 4KFCA 2BGGA 4KVFA 3B2NA 1CYEA 1U0SY 2NZVG 3LUJA 3OLXA 3I42A 2FQWA 3R0JA 3W9SA 2LBPA 1LJUA 3SAJA 1SXIA 2FEKA 3EJWA 3JPYA 3GT7A 4N76A 4KRFA 4XFKA 1JH9A 2JCGA 4KK4A 4HNSA 1PUXA 4PEVA 1EFAA 5TPZA 4IF4A 4H3HB 3URMA 3JVDA 1SRRA 2L18A 3OM1A 3P9YA 2MSWA 5BQ3A 1PNRA 4N41A 3HK2A 5IEJA 4RY8A 2QU7A 1QNLA 5DGCA 5HQJA 4OATA 2WJAA 3HUTA 2E4WA 3I5AA 3MA0A 2NUBA 2CD7A 2IPAB 4MS4B 1A0OA 1QP4A 4N0PA 2RJNA 2MYUA 1MVOA 3MIZA 4MQFA 4EYQA 3O1HB 3O75A 3RVOA 3FGZA 3H6HA 1ABEA 3N0WA 4TN5A 1BDHA 2HQRA 1VPWA 1C4WA 4KV7A 4LE0A 4W5NA 2P9HA 4YO7A 3RVLA 5BRJA 2NZUG 4WT7A 1ZAYA 5IUKC 1QMPA 3OMXA 3CS3A 4IILA 3TX6A 2H0AA 3KSMA 4ZPJA 3Q7TA 1ZH4A 3OQNA 2FQXA 3GYBA 2HJ9A 1UDRA 4W5OA
chains in the Genus database with same CATH superfamily
4IVPA 4N6GA 1Z7YA 3T06B 2AH5A 1WZCA 4PCVA 1YRLA 1AURA 1A4IA 3N2ZB 3RABA 1JDTA 1T8UA 3HPRA 4IKOA 1BNCA 3OQMA 4WXRA 2WMNB 3ZYCA 3IKTA 3QSYA 1UWVA 5CD1A 4OVKA 3BKWA 1COZA 1Y9ZA 4CF3A 2WTEA 1XTSA 4FW8A 1GILA 4UC0A 1FFEA 2IDMA 1Q19A 5ECWA 4QDUA 5BUSA 2A86A 3GEBA 1JU9A 4BO6A 3CMCO 1QH8A 3INRA 1R1DA 4OQNA 4XSHA 5EJIA 5IKMA 3PNOA 1DFGA 1ACJA 4JC8A 1XC7A 3PXGA 4DG5A 3HL0A 3IPAA 3SC2B 4EKYA 2YJZA 4ZCTA 5K0GA 4KO8A 4EGAA 3GNTA 4XYMA 1SIWA 1Z0KA 3O73A 5CGQB 5C4GB 1DC7A 1VHDA 3PPIA 4AS3A 4M83A 1JL3A 2I65A 4QGGA 1NXTA 3HSSA 1YR9A 1ZBQA 3CRVA 2WMOB 4DXDA 4PG8A 3VSBA 1SUIA 1SJ9A 2ZRFA 5AJVB 1PD1A 1AF4A 3I6YA 1U5CA 2E82A 2VNSA 5FFFA 5G3YA 3V42A 1DUVG 1SVSA 4CL3A 2FFJA 1QQAA 5ALJA 2CVPA 1W6RA 3EIEA 3CKMA 1O77A 2EATA 1T4GA 1YB2A 1GRVA 2D0DA 2F43B 2ZUUA 3I9KA 1P4HA 2R8BA 1FSPA 1IQRA 3Q7EA 1JWAB 4BLQA 4HOYA 4C6TB 1I13A 3P0HA 4E1VA 2JAUA 4DV4B 3A1EA 1O8BA 2R87A 3HJUA 3R1IA 3RFXA 4F6RB 3PDCA 3RAFC 1FX1A 2DZDA 2VBGA 4IMIB 1WB6A 3NUZA 3VNBA 3VPXA 2AG0A 3A28A 3EVGA 4YT8A 3RK1A 3PF9A 2UZ1B 3M6XA 1E2EA 1WCWA 2WP8J 3E0QA 3LCRA 4G4IA 4B80A 1QG6A 1I4WA 4F9FA 2F17A 3B60A 1FP1D 3QQ5A 4C7VA 4YN3A 1N9KA 4DG8A 2R00A 4JWKA 1DKQA 5ALZA 5EN4A 2PUHA 3UOGA 3D0RA 5IASA 3X1YA 5GOTA 4F9EA 3K0EA 3MSCA 3Q0TA 4I9HA 3X3HA 1UPCA 1CVIA 4C4TA 2D1QA 3C74A 2HMUA 4F1WA 1I1OA 5KX5B 1RWMA 3HR7A 5ESRA 1QP7A 4ACAA 1IIRA 5HFAA 1NG1A 2WPDD 1TF5A 4UCFA 4O3MA 3DOUA 4M0LA 2XMCA 1GY8A 3NGLA 5CXXA 4RTPA 2BSQA 1DJMA 3BDVA 3WB0A 2Y67A 1P74A 3C3BA 2XKKA 3ZDCA 2GZ3A 2JCYA 4MJXA 1IIBA 3V2IA 4IXWA 2G08A 4KXLA 3T0GA 4RVDA 4WN3A 3WIBA 1MBZA 2PS3A 2MTBA 4I50F 3S29A 3GRCA 5DHQA 3W5AA 2YQZA 1JVSA 5COQA 3UMRA 4DNOA 1YE3A 2JASA 3UBTA 3DJFA 3SJUA 2FMIA 5KB3A 4N5MA 4EZEA 3K4HA 2I3ZA 3EVTA 2H4HA 1C7ZA 2VUTA 2AVNA 3NHSA 2IU4A 3BCSA 4FGZA 3BD7A 3AVWA 5IC4A 3BWVA 5U4XA 3ZE6A 1NBMD 3ZI7A 2ZBRA 3DMDA 3CRQA 1W49A 5SZKB 4BJ1A 4M2LA 2P4EA 4WOCA 1OROA 2N42A 4GI3A 2NXWA 3CNLA 3L84A 1KU0A 1FS6A 4D82A 4JBIA 2E4VA 2XNSA 3D6VA 4HWRA 4FHZA 4NTZA 5FRDA 4PGHA 5BUQA 4OUDB 3RRFA 1J21A 1V1JA 3PHCA 5BXYA 4RZSA 3W5SA 4M46A 3V55A 4JIGA 4BBJA 2WUGA 4L8WB 2XPCA 3WWCA 3H9EO 3JASA 5TT1A 1K4YA 2FZCA 1X15A 2WOJA 2GAFA 4DUYB 1CQPA 1G20E 1OWLA 4YI5A 3K9QO 3DLIA 5K3AA 1RBQA 2VDLB 2G5GX 1H9AA 1J39A 1XD9A 4K1XA 5BO5A 3WJAA 4Z7NB 1PL7A 3FYCA 4IGKA 5TPWA 3U1TA 3JWHA 3SZGA 4LOIA 1I01A 5CIQA 1J97A 1MAAA 3ADOA 2PFKA 3EODA 4HVTA 1K6IA 1OU0A 2VSYA 2J31A 2QM8A 3P9SA 1WO8A 3IEKA 1GUDA 3WKDA 2HZ7A 2YFKA 3SY8A 3IO5A 2YXLA 1NLFA 2POQX 2PDAA 1T36B 5MN5A 3GNLA 1HEYA 3OZUA 3RU9A 4CDRA 4G41A 4FOOA 4FDVA 1KPIA 1PEAA 1F0KA 3WWZA 1FA9A 2H6EA 4CMIB 3WIDA 1GIAA 4GKAA 2DSNA 3P2KA 3OQ6A 1YCFA 3K9FC 5JD5A 2J8ZA 3NAZA 3UHOA 3LX6A 4LHVA 5JCJA 1ABFA 2F1JA 2RGGA 2WFMA 5BP7A 8OHMA 4KDFA 2E5LB 1UDCA 2IYSA 3L2OB 3VA7A 5LC1A 2FXVA 3NNSA 4Q7JB 4MYSA 2C7BA 1LPMA 2GEUA 3KZOA 1M67A 4G5FA 4Y2PA 1VC2A 1E1DA 3PQCA 1ZD5A 2WAMA 3H2KA 3K9WA 1LNQA 3MJSA 2WVGA 2VPXA 1AB5A 1A3CA 1W85B 5CDGA 3MFYA 4F45A 4BGEA 2BDUA 4X3CA 2HZBA 1QIHA 5IKPA 3FDZA 2ERYA 2YZKA 3TRHA 2CMKA 1EK6A 2A92A 4NOMA 5JBIA 2QSJA 3QVUA 2FP3A 5AW9A 4C4ZA 4DLVA 1ECCA 1YS2X 2DUWA 5JCXA 1VBFA 2HA0A 1XEFA 2VYVA 2Q5FA 4FT2A 1M1YE 3U3XA 3FIUA 3HBNA 3RLFA 3RYIA 2HRBA 3BXPA 2IIBA 1L5RA 1R50A 1A9ZA 1DQSA 1NQOA 1EFVA 1O95A 1QSGA 2I6FA 3FSJX 3JYQA 3UA4A 3NRJA 4KGVA 4F84A 2H65A 1CIVA 5DJ5A 2JATA 2FOLA 4AN0A 3HB5X 1TJ4A 1MNAA 1WHTB 2QYOA 3A4VA 2IZZA 1VDMA 2J6CA 2ZWMA 3B5IA 4K5QA 2H54A 5EIBC 3BJMA 4EW1A 2R6JA 4Z1MD 5B55A 1P4RA 2GETA 1DMRA 4MKIA 1ULZA 2QJTA 1NVMB 1DBWA 4IUBS 1M8GA 1QC5A 1C8VB 2BRUC 4LZNA 2B83A 3ISVA 3MJ4A 4MVJE 4QC2A 5ELLA 4BUZA 2C42A 4UMEA 5DTJA 3W2GA 4AG3A 5AOVA 5IUNC 4BQNA 1WBDA 3B6IA 3O26A 1TYDE 3KQSA 2Q4BA 2A5LA 2K2WA 1N2CE 2NU6A 4ZAGA 2HQOA 2C57A 3CZPA 4BB9A 5IWAB 2PFSA 5DSTA 3TIFA 1WOYA 3L41A 5AM3A 4XM2A 3KR9A 4JUAA 1P1HA 2A5FA 3BMCA 3U1BA 2IKQA 4LSZA 1MG5A 3PDHA 4OYRA 2GYVA 1J2RA 1RWQA 1P31A 3TRIA 4BEWA 4TXMA 3RC8A 3KC2A 2ZJBA 3TXXA 4ICIA 3QFHA 4L0CA 1Y5RA 3MJVA 2QF7A 2AFHE 1CUBA 3FLMA 1BFUA 2OT3B 2VSXA 4YV0A 3FVQA 5EJ4A 2FTKE 2L69A 1RE0A 1T5HX 4L76A 3EPPA 4RV5A 3OLZA 3KKLA 4ILEA 4J9UE 4EA9A 2WBLC 5A4DA 3NDIA 2YINC 2J32A 3DUFB 5ESXA 2I99A 4URWR 1MXHA 3I23A 4GE3A 3MTEA 1BWQA 1D2GA 2PUJA 4DRXA 4DJEC 1B14A 4IFBA 1I5OA 4TRNA 2CMHA 4DRZA 4KSCA 2ZUWA 4KNYA 2AYZA 1KZGB 2Z9DA 5GONF 3ZNQA 2W8BA 3AESA 3EWIA 3CX8A 4G89A 3I5MA 1SELA 4OMDA 2F2TA 4PX2A 3ZQJA 3UMYA 4R8LA 3A6HA 3ZV4A 1LNSA 3DKIA 4ZODA 3ZXIA 2H31A 4B4KA 2WF8A 4YQZA 2O57A 1CP3A 2I4NA 4BB0A 3SCZA 3N2YA 2N1MA 3AF2A 1E1KA 3LQRA 1CZOA 4PSKA 3VHXB 3IJPA 3TNJA 3UV3A 4AQDA 2HDWA 3G2KA 4KH1A 1T3GA 2EZ9A 1L3IA 1RWXA 5DNYB 4EPXA 4WXPA 1QHYA 2HWKA 3RVMA 1KOJA 3CUTA 4PO3X 2NVUB 2DJ5A 4R0NA 1H4TA 3WIVA 2Q3FA 2R0QC 3JQBC 3N07A 4L57A 2CHFA 4YLEA 2VBFA 4MITA 1IN8A 5HSGA 1I2AA 1MMFB 3NV7A 3G88A 4TOIA 1G8JA 1NM5C 4V02A 9ABPA 1PR6A 3TQSA 3VSEA 3CF6R 4ESOA 1US8B 1FXSA 3IUMA 4HAWA 1K0UA 2J85A 4E5KA 2DKNA 1LZKA 1BCRA 2Z5GA 3PF8A 3JD0A 4TTTS 1FJXA 3D31A 4IIJB 4HDRA 3NFYA 2WVJA 3NRBA 1IK6A 1HLFA 4MYDA 4RADA 1FUEA 3VOTA 2QY6A 3K30A 3KEFA 1C4KA 3IX7A 4LMBA 4M60A 2QR2A 1S1CA 5DRYA 4JUFA 4YRMA 1N5IA 4BC0A 4C0QC 3TLBA 3UWOA 1TW3A 4GL4A 2AR9A 4HAOA 4YGXB 3BSSA 3GUCA 2ZYRA 4C3VA 2ABWA 3UPDA 3WJ2A 5B4UA 1DV2A 3T41A 1O6CA 2GDZA 3FCYA 3U61B 4AI6A 4ZP1A 1QONA 1ZZEA 4U2CA 4CBVA 3RBAA 1F1BA 1N2CB 3E5HA 3JQ7B 4L75A 5AIAA 2IYNA 1JHDA 2BEUA 2XOKA 4C22A 2VCEA 2W93A 2RFLA 3LM8A 4ASUD 2P4QA 4RK4A 2NP7A 1ENZA 1TM2A 3HU1A 4NCJA 3PNQA 5BVHA 2QD3A 1DJPA 4M88A 3QEKA 2WAXA 2DSTA 4MIYA 4CJXA 3SSNA 1B3BA 3FUTA 4XX0B 3VC1A 5KX5A 3GRRA 4IX9A 3SEZA 121PA 4EG8A 1E5TA 2H4FA 2RH9B 3A3YA 3B36A 3SJBA 4J07A 4EG0A 3T4XA 3CKKA 1ORDA 1RS0A 4BNUA 2IU6A 3PHBE 3KQKA 3HVJA 4D7AA 1SXJB 1KKLA 3NGMA 4LHYA 4XD2A 1WP4A 4G1VA 2ETXA 5L3QB 3TCXB 5E0KB 3AHFA 4U0KA 1FPMA 4DBZA 4UVHA 1IM8A 4RHFA 2E87A 1QTQA 2NPIA 3Q6IA 3KVYA 1LBIA 5FLYA 1CQIA 1FTGA 2PGXA 2VK2A 1P1IA 1WVMA 3K1AB 1KSHA 4MGZR 2W43A 4P4UA 4OIFA 4U7JA 3WQRA 5LDDC 2A1IA 3VO9A 4K9NA 2H85A 2F1HA 2WG2A 1JAIA 2I29A 3I45A 1VE9A 1VPEA 1XZGA 1D1SA 3NAMA 3ESRA 2J0UB 4BV3A 4HB4A 3V6LA 4OHWA 1QIIA 3WLHA 5J3JA 4QXPA 5L3RA 4LV6A 5EKSA 4FLEA 3TR5A 1H65A 4PGAA 4V0LA 1JE0A 2H2WA 1M8KA 4FIZA 2X7JA 4F3CA 4TYQA 1Y89A 1USIA 2FMHA 1JKIA 1H1LB 4GLOA 5TQ2A 2HSGA 3LDAA 4AF8A 2P69A 4E32A 2DFKB 1O6GA 2EJCA 1TAUA 1MABA 4D92A 3D6FA 4ZYLA 1TT5A 3L8DA 4GPAA 3UK6A 5CDFA 1FNDA 3W9UA 2GN2A 1E5LA 4ARVA 4GC9A 3CURA 3OIDA 4PC6A 3HUUA 3RC1A 1N5JA 2H17A 4WMLA 2IYRA 1EXNA 1MLDA 3N76A 3LUBA 4RQBA 5BW5A 4G36A 3H3JA 1BX1A 2UYOA 3QYAA 2WB2A 2HU8A 3VNSA 3LRPA 3T7AA 4AYXA 4EKGA 2W5UA 3CE9A 4DCOA 1RKBA 4RLHA 2Q4RA 5AK6A 4ZYVA 2C2OA 2W00A 4E0BA 1P80A 3RROA 1Y1TA 3D5QA 1ZH0A 4QOHA 4Q4HB 1INLA 1XTUA 2GLXA 6YASA 1Z0DA 1PDVA 5BQFA 3CH6A 2XADA 1TTTA 5BR4A 3E35A 2O48X 3RSOA 1G0NA 4PZCA 1ESEA 3L0OA 1SQ0A 4N7JA 4P35A 1GKIA 2KJQA 1LF0A 4YEDA 3WLTA 3HNOA 2WAAA 1EK1A 1UKEA 1SH7A 3D4LA 2IZOA 3CMMA 4ZT4A 3RS9A 2IUFA 3JSXA 4JCOA 4LRSB 3TXAA 2RGWA 1XK7A 4WVLA 3UHPA 5CDFE 4BPBA 1V1RA 2NYAA 2ZBPA 3D8BA 5A06A 1OB2A 1V26A 4IS2A 1N4AA 3WYBA 1D2MA 2ZT5A 3EXHB 3JD1A 1A8IA 2XITA 1Y6GA 1ZMRA 3MS7A 2W6CX 4LOJA 4ZAXA 2NPFA 3A10A 1ZP6A 2QUZA 2ORYA 1ZIOA 2RGUA 3DVRX 3R41A 1WEKA 3DKVA 3TO5A 5C5IA 2FG5A 1ONBA 3OPYI 1Z7BA 4HGNA 1MAUA 4U9HS 3TTXA 4ZOLA 5IT0A 1I0IA 5FLXA 3TAUA 4EMUA 4KFCA 3LP6A 4ZJYA 2W6JD 1P1JA 3B2NA 1TYZA 3V1YA 3FYUB 5JSHA 2C7GA 5BSRA 2YJ5A 2ZYGA 4RNDB 3WJ1A 1KMHB 1NRWA 1NKSA 1Y7TA 4ZVQA 4OX9B 3L01A 2VP5A 4ZALA 1EX9A 2W98A 4NQZA 3OPQA 1U65A 1MABB 4PS0A 1NMQA 2E21A 2H48A 3LE8A 3UT0A 4LHXA 4DARA 1PT6A 4BZQA 4E22A 1U99A 2R62A 3K73O 4P7JA 3QVGA 1SUFA 4HWOA 4LXHA 3RGWS 1T5TA 2XCIA 4QFMA 4AO7A 3GFQA 4E51A 3I5AA 3LBHA 2NUBA 4KQGA 4DJDC 4NY1A 1TUEA 1E2FA 3ZWPA 2HSJA 2FJUA 1DEXA 4DIMA 2C2GA 1VJ5A 1UFQA 2AXEA 4Q16A 2AQHA 3GPDG 4NCAA 3FKSA 5D5PA 4IOMA 2QQEA 4LOKA 5D7BA 3KJNA 4JHXA 4JLMA 4ARUA 2BHLA 4ZOCA 2EZ8A 3DS8A 2QMHA 3MCTA 3KSMA 1GKKA 3N2KA 1KJ8A 2ZCUA 1SMKA 1S4QA 5LMZA 4JSTA 4QFBA 2OCDA 1GFSA 3LVQE 3Q15C 1Q1BA 5TMPA 1XTBA 3WHKA 2R1TB 3AEYA 1LRKA 3IEIA 1GAXA 3C6KA 5BSHA 1TEZA 4J4HA 4NYJR 1LPNA 4IOKA 1XDUA 4QHSA 1HEIA 3NWJA 4RGBA 2AFIE 2FEOA 1CCWA 2E0IA 2GMWA 4HQOA 1E1YA 3BEDA 4LN1A 3DLAA 1AHIA 2JI4A 2GN6A 1U3CA 1FFDA 1C0PA 2R25B 1RAEA 2WJ6A 3F4KA 4JJGA 1V6CA 2IE8A 2C4MA 2OHOA 4IAOA 3UMMA 2CFSA 1V7ZA 1YMUA 3EVBA 1LFDB 3EVAA 1YB5A 1VBMA 3NV9A 1O03A 5AKJA 4F85A 4DB4A 1GPMA 1NTRA 1P5ZB 3CU5A 4UFOA 2IXTA 3AG5A 3H5LA 2D8AA 1L9KA 3T0IA 3W1WA 1E1QD 5F98A 4E5UA 4HX2A 2REXB 4B7CA 1YB6A 5J63A 5LN1A 4M1KA 4KMOA 2JHAA 1PIWA 1GPH1 2W4QA 3EXFA 1RPTA 3VO1A 5KEIA 4BQIA 3DBHA 1P0MA 2PGDA 4YAFA 2BBOA 1YFKA 1AZWA 3MSXA 3H0EA 5K4GA 3BGDA 3L1IA 4L07A 5CW2A 4ZEOA 5GGYA 2M6RA 4C0SA 3RPEA 3W8NA 3AFGA 4FONA 3TR0A 3WOHA 4QJBA 5WRFA 5TSDA 5IJAA 2EOAA 1F7VA 2YHIA 2CCJA 3NEPX 3FUXA 4F9GA 1KE1A 4D4MA 3N1UA 4BV9A 1U04A 3RKSA 2LIPA 2V7PA 3LDHA 2KW5A 4MPDA 5DOVA 1WD7A 1UFRA 3AIIA 3CUKA 5B6JA 2Q1UA 2V5VA 1VCHA 2ZKIA 3PHHA 4GLFA 3HA2A 3CEMA 4HNTA 3A6LA 4L27A 1DV1A 5JS7A 4J3NA 4RWEA 3HM9A 2Z2XA 3TECE 2VDWB 2Z9CA 1IB6A 4BCCA 2CDCA 4JZYA 3CF2A 1TJNA 1P9NA 2QJWA 1H2YA 4W1PA 2WJPA 2WM9B 4HFJA 4XB1A 4JI1B 3F7NA 4O4LA 3RYHB 3DT8A 4YMGA 1FRZA 4GUDA 1W25A 2XHZA 4GZ6A 4WZZA 3TZ6A 3I61A 5ALYA 2VH2A 1P0CA 2GRAA 3N74A 5DF1A 3ZCVA 3DVSX 1YAJA 4WUTA 2FDRA 1Y1LA 3E2IA 3EZFA 5C3UA 3ZGLA 4UAUA 2IRWA 2P9QA 2X9GA 4JJAA 4KXWA 1JEQA 5H5JA 3V1LA 4IGEA 5CNJA 2XUGA 2ZQYA 1PJSA 1RJFA 1XDZA 2VDPB 3KQPA 1HETA 2QMYA 1QKJA 2J4FA 4RHCA 2IHYA 1ML3A 2YS7A 3SG0A 2CXXA 1O0SA 4IMJB 1SKYE 1CDZA 5T4HA 4E5SA 2JJ1A 4BO8A 2FZLA 3BD9A 2OLEA 2V6BA 4L3VA 1XZMA 5DX0A 2NSDA 2TMKA 2JBAA 2RAUA 2BTOA 2W2NA 4MKHA 4O4IA 2VCHA 4KQMA 5G0VA 4MW9A 5LQDA 3FLEA 4UUAA 5I6DA 3E5MA 3BMNB 2J30A 3IHLA 1ZIDA 2WA1A 3N39C 3QVKA 4O4IF 3FPBA 3IIEA 3VPAA 2ZJ7A 1D7AA 2IGTA 1W36B 3KOZA 4HYYA 1Y5NA 3SOZA 4DT1A 4BLSA 1QHIA 3LHSA 4LBWA 4NL4H 1X9GA 3BB4A 3STXA 2A6PA 3OCYA 5HQTA 2BF7A 4KIFA 4MUJA 1CERA 2DP4E 5ECYA 5T7BA 3A6EA 5AK5A 4GXQA 4DDHA 2W9XA 3LNTA 1WDWB 3MYYA 1SY7A 3OEHA 1D2HA 1W0JD 3C48A 3RSLA 4OHOA 2Q4TA 3STHA 4ADSG 1AQYA 2Y27A 3BMQA 3RSCA 4YJDA 3TVDA 2YC4C 5JAIA 1UDXA 2PG3A 4EDHA 5ES4B 1Q12A 5JYDA 4KR3A 3G2PA 1WHTA 4TKVA 5JD6A 1TM7E 1X7DA 3PUZA 2I34A 2QAGB 4TZTA 4FFWA 2H5JA 1RNLA 4EENA 1JH8A 3R4CA 1GV0A 4BKPA 2QPAA 3GBVA 4KI7A 5DM60 3KKQA 1IPEA 2RI1A 5LR6A 4LK2A 1YVUA 4HX9A 2LWIA 1GDHA 1UIRA 2ZWOA 2O05A 4FINA 1J8VA 1XRRA 4RLQA 5DW3A 3MGBA 3GAFA 3L0YA 1A76A 3F7OA 1DFIA 1AK2A 2K7ZA 2VZ9A 4ARSA 2AG6A 3VPSA 1X1RA 2WUDA 2XDWA 1K5PA 4ZK2A 4PWZA 3K0AB 4YI3A 1HKHA 5IDWA 1FFBA 5E8RA 3DR5A 3DHNA 4B34A 3FFXA 1WLYA 5ADVA 4MVJD 2C2KA 4HJRA 4F4JA 4AIIA 5IAOA 1NX9A 2HCTA 2QXTA 3TPCA 2OFXA 4TTJA 3IE0A 3G1TA 4AD8A 3OZEA 4DYVA 2YBEA 3P2EA 1UZUA 1E69A 2K7FA 1W75A 3KLBA 3R0ZA 4Q1EA 3VJMA 1GPJA 4X6UA 2V6GA 4J9VA 3FUCA 3LL4A 2RKWA 5HKKA 4XOIA 1X1TA 1M0TA 2BGKA 3PVCA 4JQOA 2Y71A 1SHZA 2WYWA 3OMLA 3TGPA 1E1CA 1QWOA 2AFIA 2BFWA 2G28A 4OUDA 4PYMA 4G85A 1Q44A 1RBYA 1VG0B 2X77A 3GQVA 3VTKA 1KI4A 3U6KA 1E9DA 5DHUA 1NR7A 4AY4A 2JGFA 1Q1ZA 4OSPA 4XQEA 1Z5PA 5JYBA 4XJXA 2G83A 4D9GA 4A73A 5JNTA 5LQUA 3EQZA 5FUWA 4UBLA 3AHIA 4EJSC 3V7UA 4MARA 1S8AA 1JMKC 3GMDA 4BATA 2GNOA 1F48A 3GEIA 3L1JA 3LG2A 4JQCA 2LW7A 3NHYA 3TMYA 1XPJA 3I2YX 5JYEA 1AMOA 2FE1A 3QLEA 4WJKB 3ZIUA 3KU4A 4UD6A 3KT0A 3FNIA 3AWIA 4K9LA 4RC9A 4WXYB 4FR2A 4EJMA 1N33B 4Y6QA 3EEQA 1AT1A 1NI5A 3IOMA 5DRTA 3JD4A 2IPOA 1T91A 2R2GA 3RHFA 5IZ4A 1Q3KA 2PZAA 4QOIA 4HDKA 4QT0A 1G8FA 3VQTA 5DNUA 4DA0A 1VKOA 3CO5A 4ZI5A 3LO8A 1U1CA 1XL1A 1ZISA 1OIXA 4JLKA 2AN5A 1Q1NA 2XMZA 4FHEA 5CX4A 2UZ0A 1SZCA 3GVPA 3WDMA 1JJAA 1TJPB 4K87A 4AYTA 3RT1A 4IIHA 2IHUA 2Q5QA 3AUAA 2Z5VA 1QTRA 2YVQA 3A0RB 1OPXA 4JLJA 5D3KA 3S6JA 2B1QA 4EA6A 4TWRA 3BGIA 4MJLA 4PLYA 2GR9A 2YHBA 4KE9A 1ZJ6A 2YWEA 1SVUA 4CMEC 3OH8A 4MUFA 2HMWA 1KK3A 2QTVB 2RK6A 5DCWA 2QT0A 4RDHA 4TS4A 3ZBUA 1V5FA 2H1CA 3FJYA 4HGOA 4MGIR 3RJMA 1IOZA 2DBYA 3HEMA 3FGOA 3GVHA 2HR1A 2IDJA 1TJ3A 1K98A 3CPHA 3CO0S 2E4XA 2HN9A 3DXZA 4NU6A 4PIVA 4WXEA 2ZIZA 1R88A 5TV2A 2VJCA 5FWXA 1RCTE 4NU0A 4TVSA 6GPBA 1P6XA 1J9EA 1N0VC 1G66A 2ZRKA 5DWVA 4LX0A 5DTMA 5CFLA 4LJ7A 4EI9A 1OFGA 1CUZA 4DTCA 3W4IA 1YQQA 2XI4A 3AEUA 2OFWA 1WABA 3DOOA 4KXFB 2IYWA 1COWA 3SQMA 2XZOA 3RU2A 3UVEA 3RYFB 3NM4A 2FUEA 2GUWA 2ZXFA 4LUCA 3AK4A 4XVCA 1L7NA 3LBNA 2DHCA 2XVAA 4IXTA 4L8GA 3VPDA 2AD5A 3G2LA 5BNTA 2QT1A 4A0HA 1OKKD 2G0AA 4F4UA 1PJ8A 1UR5A 4JEUA 1QRSA 1U7DA 3SLKA 2IHTA 2ZIVB 5EI5A 3ERCA 2ZS9A 3PX3A 1ZHHA 4DJAA 3AM1A 5REQA 4ZU3A 2WIDA 3JQ9A 2QRJA 4NLLA 2GEBA 3VR5D 1XROA 4M1TA 4F91B 2DLDA 3IYLW 1J24A 2YOFA 4NK4A 3RVQA 1KF0A 4GR5A 1E3DA 1EVLA 3VVBA 4BVKA 1J0CA 4EUKA 5IUJC 3DCNA 2TMDA 1R5JA 1VYUA 1WBJB 3EF1A 3GLGE 2IP4A 3NP7A 1NMEA 2JIRA 1NFQA 5EKTA 5TY0A 4RWZA 3U4MA 3RHTA 3I8SA 4EYKA 1QO7A 1N3IA 1J07A 3VOAA 3I12A 1EMDA 5CYOA 3H1BA 3QXCA 4MI3A 3P0IA 3ZLTA 3EE6A 1P8JA 3I6QA 1Q77A 1YNOA 2EWVA 2B9EA 1M2OB 2AJDA 2EDAA 5F3WB 4BNHA 4AKHA 2QM3A 5TVKA 3FVWA 4ZEWA 1V9LA 2CNKA 4IV5A 4RK5A 4RKWA 4E7OA 4L5CA 3EY9A 3BVPA 4ZEMA 5C7IO 2FG6C 1KYXA 2PD6A 1YI8A 4W8GA 3DZBA 2J5RA 4WW0A 1R3UA 5KINB 3DPSA 4KSBA 5LBIA 4AO8A 3SR3A 2BOVA 1PJ2A 5JRDS 3R5FA 3K70D 3UICA 4RKQA 1FRVA 2QA5A 2WF7A 4LSMA 2DPXA 3TLMA 3IB3A 5B4VA 5TPWB 1VHLA 1VKNA 3AP3A 1XGKA 1BD3A 2QL7A 3CZQA 1VLLA 3HYSA 3FZNA 2AG1A 4FKMA 3A6KA 4IPTA 4QGBA 3NBQA 5ER6A 3V97A 3ZCXA 4EFNA 3Q3GE 1YR6A 3BWXA 1YMQA 3F49S 4EO7A 1V7PC 3O8RA 1MZPA 1YIOA 1H8EA 2DT5A 2FEWB 3PL5A 4EUSA 3U62A 1ZVKA 3ZE1B 3S8MA 3RHZA 2QDKA 2Y0BA 1Z26A 3P9RA 2O9JA 4WASA 1N6NA 2WM3A 4IJWA 1Y6RA 4B6SA 1E20A 4L5JA 4JVMA 4K28A 3E0XA 2AD1A 3I92A 5LL6P 3D6JA 4RY0A 2O1XA 3R8CA 4RFSA 1NF2A 3D7NA 1Y8RB 2FZVA 1XRPA 2ZYDA 1BWRA 3ZQKA 4PICA 2OFPA 1LD3A 1YBFA 3GJQA 4K9QA 2ADMA 1T13A 3OFJA 2DETA 4DR1B 2NTJA 3DV0B 4R2LA 3F9CA 1SBZA 4X24A 4A0RA 1Q15A 4KMMA 4CLOA 1U8EA 4HDSB 1FBTA 1Y8QA 3MD0A 1JAZA 1VA4A 4MH0R 3F6EX 3NI2A 1R64A 1DQYA 1X7ZA 3DVLA 4OJMX 4E3WA 4Z3KA 1EVZA 5FO1A 5AJXA 4GNRA 1PDOA 3TKLA 2G4LA 2GNAA 3PPVA 3GFFA 1JQEA 4N49A 1PFKA 4GOOD 5BN3A 1II8A 3FPAA 3NHJA 3LX5A 3CH5A 1SM4A 2H7VA 4ERNA 2G40A 5K6AC 4K0KB 4QM7A 2ZWVA 4Q1CA 5B6IA 3ROMA 4GPTA 4F12A 2Q45A 3AFMA 2V3CC 2BM9A 5DTQA 3X0DA 1EIWA 2VXOA 2QHXA 4K88A 3I01A 4BECA 2FW9A 4Q1VA 1Z74A 3HYCA 4WRRA 2LIVA 3UMFA 3FNRA 3X1ZA 4L74A 2C4KA 3MWDA 4Y7CA 1RAIA 3E81A 1R6UA 1TA9A 1PWXA 4IXDA 2X2PA 4E09A 1XOIA 2PZLA 1P5JA 2VN8A 2WU0A 2JIBA 1GU1A 3PQDA 4YRDA 5EZSA 4BX2A 4YRTA 1BDMA 4UHJA 1ZMBA 1J1ZA 2PUAA 2IWRA 2I6QA 4KEAA 5JZOA 1SEPA 4NVRA 1QU3A 1AKWA 2C3OA 2G07A 5A3JA 2UVDA 1R0LA 3OM9A 4JBNA 4KQFA 4PZUA 821PA 3I42A 5JU6A 1U0TA 1AK9A 1F4PA 3SAJA 1M1NA 1FSFA 5IG2A 1EWRA 4HF7A 2EFEB 2GJKA 2HRDA 4DJFC 3DQPA 4KRFA 3HKEB 3LY9A 2A3RA 1HOXA 2QOEA 1HL3A 4YPOA 3L8FA 1X7YB 2GO1A 3LECA 4NYMQ 2OD9A 1GGJA 4AVYA 4EHHA 2HMVA 4YJKA 1TM5E 2FR8A 2VXYA 4MPRA 3N9IA 1HDGO 2HF2A 4KXXA 4UOEA 5FWDA 1HTBA 4DUGA 1Q0QA 3ESYA 2VQDA 2JI6A 5EUCA 5U1PA 1FMCA 3WWOA 2EW1A 2ZYAA 4CN8A 4DIFA 3P27A 4J03A 4RMJA 3QA3E 4BQPA 3WQSB 4O4JF 4CT4B 1TZKA 5I9SA 3RVLA 4B6JA 1JJFA 4MOWA 5IUKC 1QMPA 2BGNA 4CQMA 3VU0A 1NN0A 4FS3A 2QN8A 5JXWA 2AN4A 5JTTA 2AN3A 3TKYA 4FWTA 4LEIA 2ZFUA 5DPMA 2IZ0A 1RYBA 2YQ4A 3UCXA 1PVVA 3P9KA 5M04A 3E3NA 1DPFA 4MUAA 3C4VA 5EHGA 1EZZA 3DYVA 2QZJA 4X1OA 1Z4IA 3BIXA 5CIWA 3V2GA 4JFRA 3T9EA 1LVUA 2WYIA 1LW7A 4GDFA 1UBNA 9ATCA 3U9SA 3A58B 1WG8A 4D6XA 4KOAA 1T1IA 5JNLA 4Q9DA 3GZNB 3I4LA 1CE8B 4MB0A 5ED4A 1W19A 1X42A 3R44A 1VSTA 3DV2A 4GNKA 3OTOB 4RF2A 2XMQA 5T6BA 1ZHOA 3JQ7A 3PPYA 4WY5A 2ZG6A 1U5AA 2HM7A 1C0LA 4HDAA 1NY6A 4CM6A 5UKDA 1T6ZA 1XV5A 2XY4A 1PZFA 3ILXA 2PQ6A 2Z4TA 2IU0A 4RIIA 3TIGA 5JSZB 3L6DA 3KK0A 2A9PA 1ZH2A 1E2QA 4X60A 1DWPA 3RD5A 4DQDA 2WJGA 4JDPA 1OYYA 4MVJM 2RBGA 1YQEA 1KIMA 3AM3A 3EIHA 1ZCFA 4KWTA 1JYSA 4M8SA 4Q4HA 1AKYA 2DHQA 2YZNA 3DZJA 4LNUA 3OTGA 3O8QB 4BQFA 1J99A 3WAGA 3U7JA 5A9SB 4X66B 1P4AA 3L0DA 3IQIX 1OYWA 2ZJZA 2OBXA 4HGRA 5KVSA 1CRLA 4KR7A 2Q4DA 3O8LA 4E21A 1QH9A 4EW3A 1V4NA 2P78A 3OC0A 4WNAB 4DIOA 4ND6A 3C3MA 2G71A 3HCRA 2RGDA 1DRVA 2PUBA 3H2SA 1A98A 2X6QA 3AHJA 2HSEA 2ID8A 5AJTA 2W6PA 4JEMA 3EF0A 2Z8ZA 3K70B 3BGOS 4IDAA 3W3AD 1C14A 1MC4A 4QYXA 3PVSA 1RYZA 1H2AS 2IYFA 1MNQA 4ZJZA 2PYZA 5C5EA 1JQAA 1UDBA 3U44A 1NVKA 1Z28A 1N36B 2QPLA 4UJ3A 1KYQA 3PT5A 1HE8B 4JLOA 1ZI6A 5LP6C 3IKVA 1KZ6A 1QMGA 1TQ2A 4I3GA 3AFNA 1WPQA 3SF8A 4B6RA 4G2NA 1H3FA 1ZI9A 1OW3B 3LA8A 3WKBA 4CRWB 5KKCA 2AG8A 1YS9A 1NW9B 2XZDA 3U4IA 4REOA 1ATIA 1G98A 1RYFA 1PG0A 2C58A 1WUKS 4GPBA 2A30A 5A3SA 1W4ZA 4MRMB 4QQFA 4DYDA 5H3LA 1Y3DE 2Z30A 5B4TA 4X45A 4GLJA 1XNJA 1OBFO 3KFXA 2OYRA 3G9UA 4K40A 3UXYA 2WJ4A 1N32B 2ZBEA 4V24A 2BMJA 2ODQA 4FFPA 1PL6A 3OPNA 3QM1A 4R54A 4P4LA 2Q7DA 3WLKX 1KYWA 3B53X 3AJEA 2NXJA 3FTQA 1HDIA 4FSXA 4M8IA 1JALA 4Q66C 2XZLA 4EGFA 3R0VA 4WWHA 3O8QA 3HYRA 3P9PA 2PSDA 5PGMA 3TTSA 1ZGGA 1C9YA 3IMCA 1QO0A 4F2DA 2HT1A 4NAVA 4JELA 1F06A 2R8ZA 4Y6LA 2UYGA 2P2DA 2G7ZA 5CH8A 2ADOA 5JI3E 3W6ZA 1ISMA 1Y48E 2C9DA 2GS9A 1XAHA 1Z0IA 2AOUB 1Z8FA 1LTHR 3VAZA 1R6BX 1TZMA 1B16A 5AW7A 1P7PA 2DTDA 1MO6A 3RVBA 5FL7D 1GEEA 4F97A 3V1MA 5HTOA 3C6BA 2BPOA 3SHFA 4QAJA 2SKDA 2OO5A 5HKAA 2F9FA 4TMYA 4CNQA 4QAQA 1DFHA 2J5BA 4NQRA 2NZ2A 4MXDA 3NIGB 1HEUA 3MRTA 3IHWA 1JT2A 4CM5A 1K7EB 4DB2A 1TEHA 3O92A 3MNFA 3ZD8A 4Y2QA 4J6FA 2VTBA 4PBRA 3UAWA 1X39A 4NJEA 5B57C 2LR0A 2TSYB 5JSQA 5KO2A 2V4MA 5KBYA 1PJ4A 4HNHA 5DIFA 4M0DA 1ZKDA 1AHPA 3ZZUA 1PE0A 1DQPA 3UYLA 2OM2A 1JIXA 2YXEA 3PQ2A 1ILEA 1KO8A 1L7AA 3KPJA 3DFIA 4F38A 3WBKA 2HGSA 3H97A 4ZYZA 3PFKA 3OJWA 4FPXA 1Z6QA 2FZEA 5KWVA 2XDQA 4ALKA 4R8MA 1AKNA 4UNSA 4XD7A 2PN1A 4YAGA 1X8JA 3QK7A 3T3HA 5F23A 5F3DA 1DBSA 2O1WA 1ORWA 1SG6A 2C4NA 3FOAA 4HDNA 4UU1A 2H52A 4ZO8A 5FYDA 4XYLA 4Q9AA 2OSVA 3BQNB 1UM9B 2VYQA 4LI0A 1N6HA 5EIEA 2QYHA 3OT1B 4MKXA 3K0CA 3STWA 3WNQA 1F8GA 5EA2A 1DQZA 2BFBB 3W79A 4MGYR 3SHVA 3MOSA 2VF5X 5B1HA 4ZGBA 4OA8A 2FX3A 2C9ZA 4W8OA 1T4CA 2G8NA 4GGMX 1IUNA 2WJVA 2DQZA 3SQDA 4ZOQI 4ZYXA 3B6KA 1KGSA 3F7TA 3TLYA 4AQ7A 3JARB 3FAKA 3L6CA 1J2YA 3RGGA 5DZSA 4U2EA 1S4MA 1YO6A 3N6VA 4NJMA 4ND3A 4FFBA 4R9SA 3DTVA 3FROA 3F3MA 2RGRA 3QU5A 5GONA 1JFTA 4YCSA 2XQFA 3HCOA 3DDWA 1J0EA 2BGRA 3WI7A 2QL6A 2PWBA 2ALJA 2J45A 5JZVA 3LW8A 5K8CA 1WXEA 5HX7A 2I6SA 3DQQA 3EPLA 4LVCA 2FKNA 4OBWA 1W0KD 3SDSA 4YDQA 5TQ0B 4BNIA 5LMCA 1QX3A 3B3FA 1NQUA 3M70A 1O97C 2KPOA 2ID7A 1YDFA 3X1JA 4WUVA 1FTSA 1Z35A 3FKSD 4A6DA 5KJ1A 5CVEA 2YTZA 4PRLA 2Z6UA 3KXLA 5LCXA 2XNDA 3Q3IA 3E9QA 1JHAA 2RMKA 3AH8A 1BH6A 4KPEC 3KXDA 3CLVA 3PUVA 5F64A 4DBVO 2N47A 3LHIA 4JSYA 4WADA 1BH2A 2AUNA 3COWA 2H2HA 2QRQA 5JAMA 2M9MA 2Q6TA 4E3ZA 2QTBA 1XF1A 3H1PA 2BKVA 1B6TA 4DIEA 1FDTA 2ZB7A 1USWA 5HZHA 5C18A 5I7RA 4M7RA 4A91A 4E5PA 1ZD9A 3OQPA 5FOVA 1X9IA 3VR4D 1RZRA 5CTJA 3RYFA 3FTFA 1UZNA 2JGEA 5TMDA 3NTXA 1ZN9A 1D4FA 2QI9C 4L22A 3VNAA 2CNLA 4U6NA 1VRWA 4DM3A 1I3CA 2O8BB 3I2IA 1USKA 3CW8X 1E6WA 3C43A 4HAUA 4DA6A 5JISA 2QRVB 5LU9A 1FTYA 5JS2A 3B51X 5LKAA 3EC7A 4CHGA 1MN6A 1BOOA 3GCDA 4BX8A 2FQQA 5AI4A 4TXHA 4PNEA 1KS2A 2X15A 1CUUA 1U0JA 3UB3A 3UXMA 4KNVA 4OKSA 1RRFA 2UU9B 1VL0A 4HYEA 3HA5A 4OI0A 5KTNA 1DU4A 1FYDA 1J2TA 3ICCA 1JDVA 1JHXA 1SKAA 2B0CA 2JJYA 2OZLA 3IPLA 1U0HC 3KTDA 3OIGA 4G5RA 1UXHA 3C0KA 4I1YA 5G0UA 1ZWLA 3ZHQA 4ZICA 2VAWA 3KELA 1T0BA 5H16A 1P2VA 1UC9A 4L4ZA 4RIFA 2G1KA 2ZT7A 2GZDA 3SQOA 3B52X 1E6EA 3G7UA 1RJ9A 3DVAA 3E2PA 1F0YA 1RC1A 4CIBA 2VC2B 3CNEA 4Y6SA 4HB3A 5G41A 4O2AA 3E15A 2CUKA 3I5UA 4Q9NA 4IS3A 2YWDA 1CW2B 2H06A 1C3VA 4N5IX 5T8KC 4CCAA 2EFYA 2OGUA 2BONA 5JADA 4Y2XA 3GFBA 1ZM9A 3HVKA 4FBMA 4DPLA 3G13A 2V9PA 4FYIA 4E1AA 4Y0NA 1X0VA 4AKEA 5EHZA 2GLUA 4DS3A 2FPPA 1F12A 3CNHA 1DXHA 5FI1B 5LQKA 2OZLB 3CLHA 1OXVA 1KDPA 3HXTA 4GGPA 4EI7A 2HRRA 3WP1B 4XW2A 1YE8A 1D2CA 3ZDYB 1YRAA 2OXIA 10MHA 3PENA 3WBJA 3Q5DA 3IP1A 4UHCA 2ZSEA 5E7MA 1E0SA 3O38A 5E9JA 5AW5A 2FK7A 4GICA 1NW6A 2OYSA 4I19A 3PYLA 3CC8A 4Q82A 1OAOC 2COEA 3S8EA 3SKVA 5DN6D 3T3MB 4R1NA 2CHGA 1U2ZA 4BMDA 3PDIA 5IH7A 2ZVQX 4NZMA 1RRCA 2NTVA 4LJRA 1NL3A 4WQMA 1GLNA 3WZ2A 1WQ4A 2P7HA 1CUSA 3HWSA 3QKWA 4O2RA 2QRNA 1XL0A 3ZE0B 1AKMA 3FNQA 4DCVA 1FW8A 4A2PA 1BRMA 1SUSA 4CM9A 4MYRA 1G16A 4EKDA 4CW7A 3R3HA 3K72B 1KNQA 1POWA 1ULTA 2NO4A 1UKYA 3IBFA 3GNSA 3HV0A 2JAHA 2Y1LA 5FX2A 1RMYA 2C1XA 1CRQA 2H29A 2YUIA 3BB1A 1OXKB 4JIMA 2BW0A 2PJUA 4ZT3A 5EXTA 3AI2A 3L18A 2AKAB 3FSRA 4AN1A 3HXPA 4B3GA 1M3SA 1NZDA 1SG0A 3DBVO 4LYEA 1J1IA 4X9XA 5CXSA 1SZJG 3DNMA 2ZUBA 4UTZA 3P0FA 5EC8A 2BI7A 1BQ4A 3QOFA 5EYPB 1HYHA 2WU1A 1U3VA 3G5TA 1E4YA 3T7EA 1ISIA 4CDMA 5I9NA 2OCGA 3SHTA 1DS6A 3CVJA 3EDRA 4PHFA 1G5QA 1YFJA 1XNQB 1E4EA 3ZWDA 4PW0A 1TEVA 1KEKA 2DUMA 2OHHA 1T5DX 5D3MA 3UH1A 4CDNA 2FPPB 1GQRA 1Y1QA 2AMYA 2B5WA 1H2FA 2JARA 3E2MA 4G6ZA 2PKYX 4Y9TA 3VH2A 3WIOA 5JRZA 3VNVA 4Y30A 2KHZA 4WY8A 5FNVA 3BMOB 4CTKA 1PWHA 3OHPA 3OE7A 1H1DA 3ZS8A 2HW8A 2VT7A 4YMSA 1OSNA 3AU8A 1Z45A 3ZDFA 1P2SA 3LRXA 3IPCA 2EKZA 1M2WA 3W5CA 1UBOS 1FYWA 3OQ1A 1UDWA 1B26A 1PJBA 2VUIB 1XXHB 4I1PA 3PLNA 1CS4C 1MUUA 4M86A 1RQ2A 2AGVA 4F6RA 4FE4A 4HD8A 5ALSA 2V1XA 4FDLA 3RS2A 1Z5GA 4GOJA 1SUAA 3B1FA 3TZHA 3A4LA 1NDUA 3KV1A 3CVYA 1RVDA 1U3GA 2DKOA 4KQ1A 5J9FA 1JBEA 3T7SA 2XNHA 5F3RA 4LOAA 3WA6A 4CYMA 1DTWA 2V7UA 2XNKA 2ZE5A 3EMDA 3K09C 4LZZA 4PHHA 3TE7A 4Z4GA 2Q2NA 2IEDA 4MQ6A 4MQBA 2P9BA 1RWWA 5E9WA 4E94A 2F3TA 2VP3A 1WCIB 3NIFB 5B58T 4KAXA 1EVYA 4DR7B 2QX8A 3T5MA 1RWVA 3SS9X 3BDIA 2R6GA 5SYAA 3GAAA 1A2BA 4XGNA 2HK7A 5CLHA 3I2KA 1GR1A 1HFWA 1J8QA 3B3GA 3DEIA 4N9QA 4AWXA 3NVMB 2Y6UA 4BCBA 621PA 4RHXA 5EJ9A 5FTLA 4XDZA 3OIWA 2HC9A 4R7ZA 3WBBA 4PYLA 1S8FA 2P5UA 3IQGX 1S7GA 1U2GC 4LRTB 3JQCA 3KO8A 5REQB 3VZSA 4PU0A 3TQFA 4A1OA 5CYFA 2IH4A 3CLTD 3MEQA 4DHWA 3AGQA 3K0FB 4EY7A 3F1KA 1MIHA 4IBOA 3ZHXA 4F4IA 3DZKA 3QXXA 2D5BA 3OO0A 1VIAA 1XMVA 4CDGA 2PBLA 5ALFA 4B71A 2RHJA 4RD4A 5ERGB 1Z2NX 1DRJA 4PE5B 5A9TA 1K1EA 1M75A 3GJ0A 4CKEA 4Y6RA 1JLMA 1U63A 4F5ZA 2N1BA 1SBCA 3H2GA 2YJ4A 3BBPA 1A96A 1P0IA 2X5JO 2VHWA 2VP0A 2XXJA 3IS3A 3R7FA 1BE0A 2E3JA 3AOEC 3U7GA 1Q14A 2PVCA 3SJAA 3Q3EA 4KWHA 4R1UA 3K0HA 2MSEB 1MAWA 3LXMA 4FSDA 3FHLA 3F5DA 1CUVA 3ZGVA 3D7MA 1TGVA 1UFVA 4JJEA 5CHEA 5GINE 4QDJA 4N76A 4NP6A 3U80A 1SBHA 2FWMX 2QTFA 1EVQA 1XEWX 2I2DA 2V8BA 1T9GR 2X9QA 2ZVJA 2OPHA 3ELDA 1MC8A 1EE2A 1GAJA 4Q12A 1W8IA 5GM1A 5JJKA 3GAZA 1HA3A 2IYOA 2PZJA 5LP1A 4DMGA 1NZFA 4IDDA 3V9PA 5K0JA 2QU7A 3FLAA 2CB0A 2JJ2D 2QRVA 4DQ0A 1LWNA 5KTKA 5LOVF 1QP4A 5EMJA 3LCJA 3TBFA 3A3PA 3KJZA 4J4BA 1DEOA 4UMDA 4JUBA 4XGIA 2RHRA 3FGZA 3CF4A 4B5KA 3B9BA 4U2KA 4X3OA 3ZJTA 1ONOA 2HMYB 3NWPA 3KQLA 3KQYA 1YCGA 4P2BA 4U2DA 3F78A 4WT7A 4MCHA 1ZAYA 3OX3A 4QRDA 4BXOA 2XLCA 2AN1A 5ARDA 3K7EA 4UE3S 1HG0A 3KFLA 3D8TA 3G68A 5IYZB 3HMQA 2Q62A 4IP0A 4W5OA 3U4QA 4BQOA 3M1YA 4KUHA 4P3YA 5EE3A 5T4FA 1XEXA 1O9BA 1WNFA 5AK3A 3HFSA 3M3PA 4NDAA 3MMPA 5ESDA 4P58A 4RPHA 2RHCA 1E7RA 1R5OA 5LXTB 3MZ0A 4JYAB 1G63A 1P81A 3KAQA 2ZQ5A 2QL5A 1B41A 1QAOA 2AQIA 5G4KA 3G8DA 3GJ5A 1I1HA 2UXCB 1M10A 2H5EA 4DAOA 5BOSB 1F2TA 5IM4F 3TRDA 4O33A 5BMVA 3FZGA 2M1XA 3NR2A 2PIDA 1QIJA 2FOXA 2PRJA 2A78A 1T5OA 2WSSD 3D6AA 2WTAA 4E31A 4B82A 4I1UA 5HF8A 4W9RA 1FMJA 2IXGA 2ANBA 2MINA 1U2SA 1SVNA 3DDOA 3H3XA 3TQOA 3W4JA 2XAUA 3L6EA 3GA7A 4OB6A 4ZYTA 4FWIB 1Q1AA 2UUOA 3FWPA 3RUAA 4D99A 4GI1A 4DW8A 2IIQA 1MFZA 2VYCA 2ZJ4A 4D5EA 1XMQB 3IQZA 4F6CA 5EIOA 1K2WA 1TC1A 2GRUA 2R96A 1OFIA 3UJ7A 4EP1A 5E1OA 4U4AA 2QL9A 5DCUA 2CLOB 2HFJA 1W88A 3U7FB 2BEWA 3HL4A 4WCFA 3WY9A 3HMKA 4HDNB 5KYNA 1JEAA 2HLHA 4UEJA 4YCJA 3VAYA 2BC9A 2J3DA 1BXRA 1X3LA 3K2BA 1JHQA 1U1FA 3UAXA 3W06A 1N0HA 1YBHA 2YIJA 3OX1A 4ZT6A 1OXBB 5ERXA 5EJ7A 3BCRA 4UDOA 2CW5A 5FB3A 2FCRA 3GL9A 4J1NA 2H2AA 3BFJA 5CA1A 3E22B 1QP8A 2VTKA 2VVTA 3INNA 2GOYA 3DDUA 4GR4A 1JJ7A 3S70A 2GZMA 1IL0A 1P1FA 1XMPA 2I7TA 4OP3A 5FWNA 3C6MA 2IYPA 3CBGA 3EVFA 4EHNA 4GQBA 1SC3A 3C1AA 1V37A 4BO1A 3R7WB 3CW2A 2PUGA 3LK7A 1Z6AA 1BA3A 2IZ6A 3Q3VA 5J2TB 2SKCA 3FMOB 5BSEA 721PA 4X84A 1LVGA 4KE6A 4BQRA 3RWBA 1XEWY 3SZRA 1KETA 1HE4A 3KRTA 4O4HA 5DISB 3KKZA 3Q41A 4JFAA 4D9JA 4B2YA 2VWPA 2GZ2A 3IDOA 4FHFA 1YZYA 3NG1A 3TRFA 3PSAA 1AZTA 2JEZA 1R4NB 3QUCA 3SF8B 1EFPB 1ODJA 2Z5LA 3OETA 4PQGA 2EQAA 2QLBA 2VA9A 4QLBA 5E1DA 2W2QA 5A03A 2NTNA 2IGBA 1H4SA 3HYTA 1ST3A 5JNUA 4O8CA 3L07A 1RXVA 3C4QA 1X19A 1NIPA 2X58A 4M9RA 1AG9A 4RJKA 3REQB 1L5HB 3I1IA 2BTQA 4FDUA 4PPGA 4AC9A 4CLXA 5EQFA 1VI5A 1QK5A 1QVVA 2O23A 2V3WA 4W1QA 3WDKA 4DCSA 4M0MA 1DADA 4Z9XA 1EVEA 3C4JA 4POAA 5LLSA 4TWZA 1HXHA 2DJIA 2PPVA 3T52A 3T95A 5LLTA 3RYCA 5AJUA 1E0AA 2OBLA 3PJFA 1E5XA 1DXQA 2QVGA 3LQ2A 2A1TS 3DCJA 4JEIA 3N75A 5B1YA 3RSQA 2WU3A 4C08A 3V4LA 3JTMA 1J09A 3I04M 3NONA 4FFVA 4U63A 4PC1A 1F38A 3AW9A 3NC1C 1GZHB 1O9GA 3TWOA 4A15A 1Q11A 4XFJA 2IELA 4KRXA 2MSKA 2VJMA 1QVRA 1UINA 4EW6A 3AJRA 3TH5A 5B64A 1L7VC 3DVQX 3H9CA 3AHGA 4QXQA 3EVZA 2WD9A 4NFYA 2AOWA 3SI7A 1IEXA 3WKEA 2XKBA 3GEDA 1LBQA 3L04A 1RM3A 1P17A 3UQZA 4IUCS 1N1MA 5CT9A 2A94A 5TEVA 4MJ3A 1ZNZA 3RSSA 2P8SA 3KZXA 3SYLA 4QNNA 3FCEA 1LLFA 1KJYA 3WNCA 1QHHA 2HQBA 1ND5A 3ENZA 1DIGA 4IQGA 3KYJB 3RAJA 3HB0A 1OFUX 2OHXA 2OXFA 3D02A 1TTPB 3UBMA 4RZ3A 5JPDA 2P6MA 2D74A 5A0TA 4NHOA 3LVBA 4PO1A 1A7AA 1RVV1 3G2MA 2XUFA 2PNJA 1JYFA 1GL9B 2WLTA 3MUNA 1T1JA 1TM1E 4PNZA 1DOZA 2CKMA 5KYXA 1YL5A 1CZUA 3QVXA 3IPXA 4H0NA 2A0YA 1K8YB 3BILA 4IIJF 1EU1A 3H65A 1SC4A 3JQPA 4MW7A 2WWYA 1YL7A 1Z12A 1PJ3A 1EGQA 4TYNA 1GDDA 1PFUA 5FNZA 4RKRA 1IHUA 3BBLA 1YCDA 2VJLA 1RRVA 2PGIA 2H2GA 2QK4A 3ABSB 1FLVA 3O2JA 4M1OA 4Z4FA 3MM4A 4A6EA 5TR9A 5KPDA 1U3DA 1J0AA 1V35A 1RQ7A 1T3SA 2WK1A 3MWLA 5BSKA 1K2VN 3LC1O 2HGZA 3FUUA 3IDFA 3MIIA 4RHYA 1TC2A 2JFUA 2C5LA 4V2UA 4YJFB 1KH3A 1N7HA 2P9GA 2FLVA 2VF8A 1UBUS 3EGDA 1J9ZA 3KALA 5KHLB 3T1TA 4IW3B 5JSZA 3DBIA 2G9UA 4F8YA 1M5RA 1TQDA 3JSAA 5C1BA 3NVKI 3LUPA 4W7IA 2F3SA 3TOXA 1JSCA 1WLSA 4RMIA 1G8SA 1VJ0A 2GWHA 1ZR2A 1NDHA 1EFUA 2ZANA 2QN6A 1W29A 4RTRA 3DZGA 4ZDIA 2XE7A 4ZAFA 1X7ZB 1WXGA 1YRYE 4LE2A 4TMFA 2GO7A 2PJRA 3WNBA 2P4UA 2YCLA 3H75A 2CLLB 4X8MA 4NRDA 2V6FA 2VNHA 2Y0EA 3QY9A 3I76A 3FRJA 1RM0A 5A7FA 4YAJA 4AWBA 1RKQA 4PG4A 3NC0C 4XVHA 2YCBA 4BV8A 3NDBB 2XKJE 2O52A 2FZ4A 1U28C 3PNSA 4NEHB 1U5BA 3GRAA 5HYVA 1YS7A 2C84A 2WHYA 1E1QA 2RGCA 1TIKA 4HQ6A 2ZIWB 3C98A 4LBZA 1M0WA 3WKCA 1EXVA 4X65B 4LWQA 1D0VA 3KEOA 2GYUA 2PMKA 3ND7A 3U81A 3L02A 5JC1A 1C9JA 4QG3A 4GL2A 2B9VA 4LZJA 3AJDA 4EYSA 5EJMA 1BZYA 5CB4A 1Z6PA 1SQ6A 2VJQA 3OIFA 3FSGD 5F1YA 4ZMRA 2HV9A 2MYNA 1YQTA 2IQ5A 3K5IA 1GLVA 1KGDA 4ZK6A 1LDYA 4NPAA 5CCBA 2BCEA 2IK8A 3O74A 4IDBA 4WY2A 4YBRA 3ZE8A 2RHWA 1XLTC 2VFAA 2OGZA 2WICA 1YRQA 2ZRPA 3AR5A 3B7GA 1D04A 3UWPA 3IGFA 4CCYB 4HB0A 4YP6A 4OHXA 1OZ0A 2R8PA 3OEEA 2Z2KA 5EJ5A 1ADGA 5LQAA 1DJOA 2EQ5A 3GBSA 1UK9A 4Y2YA 5HKKD 1QHNA 3U3MA 4DKJA 2ZZNA 4D9IA 5JW6A 1E1RD 1V43A 4WJZA 3EQ8A 5J2UF 4FBLA 3VTFA 1KAEA 1T6XA 4A5SA 4R71A 4YC7A 4W7SA 4Z4EA 1QE0A 2DHDA 2NO1A 3DO6A 3AUJB 5LZ4A 1ZITA 1DWOA 2EKPA 2QVZX 4RMHA 5E3IA 1TQ6A 5LYJB 2BY4A 1CY6A 1XZKA 3FZYA 3KJIA 3HJAA 3G8AA 4FR0A 3ZOKA 3IV7A 4YJ3F 2XSZA 1PT5A 2BSXA 4X44A 2ZDQA 3LQFA 1AQUA 1W4AA 2BEUB 4TL6A 1ZMOA 2PU7A 2JFGA 2QLMA 1GN8A 2QQ5A 3D8UA 2HIHA 3OPMA 4DLRA 4C04A 4D8VA 3IURA 2D1YA 4L9AA 1NFRA 2E4ZA 4IHAA 3RG8A 1IMJA 3MWKA 2VJBA 4JB0A 1KZ1A 2VF4X 2ZUSA 1GHTA 3Q40A 4R3NA 1FNMA 2Z57A 5DYTA 2MR6A 2V7VA 5CLFA 1NU6A 5LYJF 1JJVA 1ENOA 1JHYA 1MO5A 2V59A 2HHAA 2X4GA 3CSUA 4HFRA 2BFPA 4J2HA 4JZKA 4N18A 3TNYA 1RXUA 4ZAZA 1BHJA 1NURA 4GOMD 1DARA 2QJRA 3QE9Y 3S4YA 4FEYA 2AT1A 4PPQA 1G5HA 2GPAA 2B6HA 4CM3A 4LV5B 1E2JA 2NX2A 2WV9A 3BJIC 5DLEA 5KYVA 1SB8A 3VRHA 3ZWAA 2RH5A 4P53A 1R0ZA 5AXAA 4OOEA 2HA5A 2ON6A 2WTMA 4HNAB 2QXYA 4F93B 1MT0A 1RLMA 5GAJA 3RODA 3T5AA 4D42A 2P9EA 1TCBA 4IL5A 2IYYA 4CKXA 5IVKA 4I55F 5CGZA 4BE9A 4YMTA 2UUAB 4W1RA 4DE5A 2XF2A 1TCUA 3TEMA 2FPKA 3IVCA 4KXNA 3I0NA 4URHA 3A70A 3L0PA 3OQBA 5DXFA 5BYJA 3CYFA 4PZZA 3L1HA 4M6WA 4QDTA 4Z86A 2VWHA 3THXB 1JKMA 2P1ZA 2ZB3A 4O4HF 1JPVA 3RAPR 4YASA 1Q83A 5JCJD 4HH0A 1QHSA 2WD7A 2NSJA 4M98A 3SWWA 3PWKA 4NZZA 4BPRA 4U7DA 1OH8A 2R60A 5TIIA 5L3QA 4DC1A 2EU8A 3T61A 2KX7A 3K35A 4OSOA 3TSWA 2CMFA 3NDRA 4IUDS 4FN5A 5CJ2A 2XIJA 5DV9A 1I2ZA 4D0RA 4C01A 2H59A 3ZUPA 3AIKA 4OXKA 2F43A 5IEBA 4X97A 2PSSA 2AJ8A 5LWQA 1WW3A 3WAKA 4B6EA 3M83A 1G55A 1W76A 5FF9A 2QR5A 2PMDA 2QN1A 5FQNA 5KMGA 3DD5A 6ABPA 1M2EA 1QTNA 2WUWE 3D3EA 3INYA 1KU6A 1OAAA 1F4VA 5FH9A 1QLHA 2CUNA 1NYQA 1T3HA 2GZHA 2H2IA 3VU9A 5H70A 2YN4A 1DDIA 5LD2C 1N5OX 1WU7A 4UQPA 5FBZA 2ID4A 4AP6A 5A5EA 1J0XO 4YRPA 2W58A 2H00A 3DO8A 2VOEA 5KOIA 1QGUB 2AE2A 3JX9A 4TTVA 3G0HA 4NV0A 1N25A 2Z1MA 2YICA 1NBIA 3BXFA 5G4KB 2R7AA 1UKAA 5FWXB 2QBYB 2O3JA 2YJTD 4R5HA 5ILQA 2D7CA 1W36D 2GD1O 1EDDA 2OORA 5C35A 1N2IA 5LQMA 1XF9A 2PCJA 3MC1A 4NF2A 2PUEA 2AJBA 2FMFA 3I64A 1YUMA 1RMTA 1MFPA 4YCNA 1HE1C 1H22A 3KPVA 3CB2A 1QOZA 4MYCA 3ZBQA 1R5NA 2F67A 2R6DA 3ZZNA 5FPHA 1GGEA 3D8SA 2B8WA 2B1RA 2R6HA 2P75A 1W5EA 5LUBA 1XZAA 3SHWA 2N46A 3WFIA 5IC6A 3A1WA 1Z36A 3A31A 4OJTA 4CMAA 4MWDA 1W96A 3HGTA 4XYGA 1PGJA 5T4BA 1ZGAA 4FZVA 1Q0TA 1NQXA 2WNSA 1PKXA 1FDWA 3F46A 4MA0A 2P2SA 3ZWOA 2XOXA 4F4DA 1OFHA 3LBYA 2R5NA 4M49A 2D54A 1DTSA 4HDCA 5JVDF 1D6MA 4JAVC 5LIRA 1PJZA 1U2EA 4N82A 1FY2A 2ZU6A 1ZUHA 4AXBA 1JIVA 1MQSA 2D1RA 2LKCA 2JW5A 4FHCA 4RIEA 5KKAA 4ZD6A 4ENWA 4RTNA 1ZNWA 5JO0A 3WQBA 4KR6A 1OBVA 2GYWA 2OTCA 3CN7A 3H2YA 4JVOA 2A0KA 1KFJB 2IV2X 1PLJA 3ZD7A 2F7SA 4G67A 4JB2A 4LGMA 3L49A 1EWTA 3M34A 2PUCA 3QPAA 3NKVA 3S2GA 3INGA 2NZVG 5JMWA 3LUJA 3HADA 2PKQO 1QOQB 3QPWA 3H11A 4BCDA 1YDWA 3WQQA 4I8DA 2OHJA 2XUOA 1LRLA 4X41A 1QZTA 2IV3A 1SNYA 3JPYA 3ZU5A 2CL6X 4JUCA 2Q1SA 1PCXA 4O2AB 1DO2A 1JMVA 2YL2A 4H77A 5JD3A 4YUVA 1PNOA 1O6FA 5LDGA 1C3JA 2Q6VA 2IF0A 3URMA 3LP5A 1MJHA 4OQMA 3SZLA 1SUBA 3E7WA 3I04A 1IU9A 4EB3A 3C5WP 2MSWA 4NMXB 4YJHB 5BV2P 5I9IA 2FEMA 3IQXA 5DASA 3CRW1 4L51A 5BQOA 3EIFA 1HUQA 1ZK4A 4CIAA 1L1RA 1E18A 2QX6A 1I2BA 3R7DA 4YRIA 3AY7A 3RFVA 2FX2A 1VYVA 1C3LA 3S27A 1VPWA 2QMOA 4NBTA 4QOFA 3T5PA 2FR8C 2Y2VA 5CCDA 3UT5B 1GDTA 4C20A 1FC0A 1E7QA 3MGKA 2NZUG 1Z4QA 1EQUA 4MK4A 4OFWA 3A6JA 4Y67A 1XXLA 2GD6A 2GK3A 2H0AA 2OCKA 2Q5EA 3C70A 3JZAA 4NECA 4B6QA 4BWVA 2FQXA 2AMJA 4M9XA 1B8NA 4F2HA 3OQNA 3KSBC 1P1CA 1QIFA 4Q3EA 1WUYA 2JIZD 4EUFA 1QTIA 4UNPA 1KRWA 3E3OA 2YV4A 3JTEA 4XVUA 2JFFA 4RD2A 4Y1RA 3KX2A 4A2CA 4R81A 2FMKA 2FRDC 3GJRA 5AM4A 4FD3A 4F4HA 2R97A 1Z0UA 2C92A 3G2NA 3DJYA 1E3EA 1KH2A 2B5VA 2Y4OA 1IBLB 4Q9HA 4D3FA 3SHQA 2YIMA 2ORED 2ZWAA 2ZTHA 1Q0HA 3Q4GA 4E14A 2ZAMA 5HDQA 4I5DA 5GVRA 2BP7A 4ZI3A 3VM6A 3H8JA 3RVRA 3BTUA 3A2LA 2ZUCA 3JATB 4QJ4A 5DI3A 1JR3E 1DRUA 5BUCA 1N8KA 1XTTA 5AVQA 4A2WA 4GOKA 1J2UA 5JXHA 5IARA 1WDLA 1OLUB 3AL0C 4FGJA 2DHEA 4WAUA 2PMFA 5KYWA 3KSAC 1XZJA 1LSOA 1TCCA 3FRIA 4TMVA 3WKAA 1E5QA 3H18A 3KR1A 4QSMA 5ENZA 3T9FA 4C7MA 4DMRA 5JBNA 2QX9A 3D2BA 4HKTA 5JMOA 3AF5A 6REQB 4LJ9A 2JGJA 3U3DA 4J0DA 5CFNA 4KXYA 4B87A 5AUOB 3B12A 3VR3D 4KZKA 4B8ZA 2AOXA 1VYHA 4U7FA 4JD5A 4JBWA 4WOKA 5D3MB 5ALHA 3CRZA 4ETWA 4H7IA 1G2OA 1K5HA 2OC4A 4M9QA 4ZI7A 1L4EA 1ODIA 2ZITA 3FZEA 4CM9D 1GPLA 1QIKA 1U6KA 2BFDB 3UGJA 1RLJA 3IMGA 3PGMA 3AI3A 1JI0A 1IG0A 4Q7KA 3WE7A 2CL7X 3KYDB 3RVDA 1H8HD 5G1PA 3PHGA 1RDFA 4D3YA 1SZPA 3PQ8A 4CXMA 1XNGA 2WYOA 2ACEA 1X1BA 2JLRA 4MZXA 5G0WA 1Z38A 5ALWA 4G0MA 4F3TA 2CVQA 1FQKA 1QWSA 3E9MA 1XVAA 3PUYA 4H0CA 4EMTA 3SP1A 2NGRA 1CS0B 3N0RA 4QYTA 1MAHA 3A1VA 1L4GA 2PZ8A 1Z2AA 3AJ8A 5AKEA 5JCOC 2E49A 5BOVA 1OH5A 2JG3A 2O8CA 3NZEA 4W6QA 2QNIA 1U3TA 4G5GA 2R8YA 5JZMA 1EGAA 4F4FA 1YOBA 3NHAA 4FMDF 2HTFA 3RRBA 3O1JC 4O2BA 2GRJA 4ERXA 3AUUA 4G0WA 4MS1B 1LTQA 1RW4A 2PV0A 4XARA 3T5CA 3RIYA 5JXGA 3NYRA 1UBFA 4IY1A 4OI2A 5BN4B 2ES4A 3RH0A 1J8MF 3DV9A 1TYCA 1V8FA 4RKEA 1C0IA 1UJBA 3A1TA 2XCTB 3E03A 3FM9A 3B1WA 1K86A 2WKPA 1ABBA 3DE7X 3U4CA 1S8NA 4MRAA 1G5IA 4P81A 5GP1A 1SXPA 1E3SA 2GBPA 4KOEC 2FPLA 3WV4A 5SYNA 1OC4A 1IN4A 2A5JA 2GTPA 3N2EA 4J29A 4TSFD 5CVJA 4FOTA 1TGYA 1WAMA 2CE7A 4L5IA 1BSVA 5C31A 5KUTA 1E7SA 2JFPA 1HOTA 2FPSA 3FCXA 3G5UA 1A71A 3LPLA 5I9MA 3UCEA 1ZOIA 5KNDA 1JEDA 3R3VA 3PICA 4HH4A 2IC5A 3JVUA 3PE4A 1OA1A 4ARIA 4TLAA 4OQQA 5CCXA 2JGNA 3QVVA 3GJTA 4UAJA 4JT9A 4X85A 3AFIA 1S2NA 3EUEA 2Y2UA 3EPJA 2L0XA 2J4CA 1O87A 4LPSA 1RMQA 1HQYE 2FMUA 3P9NA 4HNUA 4BZXA 1CZRA 1W0JA 3HKBA 1M8FA 1C4OA 3PE6A 5EKDA 2EZUA 3SJCA 5JARA 2RD2A 5H8WA 5HZGA 3RBZA 3EQ7A 4FILA 1U6JA 5J5AA 2V7WA 4M7OA 1HKUA 3EWSA 3INTA 4PLVA 1QFSA 3PHLA 4C9BA 2YWGA 3FHOA 1CSEE 4N40A 4NXMB 5M5BA 2CZQA 3EYWA 5JANA 4BQQA 3L4JA 1JAXA 5LYJA 3W34A 4DSAA 5A62A 5EVCA 1QVWA 1UT8A 1F6WA 3BTSA 1UWCA 1XJQA 3AUFA 1Z4MA 2IJGX 2X5XA 1N2JA 3O8OB 4Q4JA 2YWJA 1OI3A 1NF3A 4ED9A 4IYRA 3GT4A 5M3BA 3BH6A 1RT9A 4XGRA 4Y9UA 2XQGA 1EM6A 4TV8F 4HUQB 2GDJA 4QLAA 1U81A 3L0CA 1U28A 5DLPA 1NI4A 3M9LA 1T2EA 3F98A 2O2CA 2J33A 1ODKA 4JQSA 4B2IA 4B3HA 4FZJA 3X1WA 1R9MA 2HWUA 4LZPA 1NT2A 1JR4A 3AG6A 3M4XA 5D6NA 2QBYA 3PNPA 4OD0A 2ZJOA 3FSGA 4LJLA 4CNBA 5KYUB 2RB5A 4YUAA 4TLCA 1Y7PA 3GD7A 2D62A 4KPUA 1ID8A 4TX1A 4X20B 4B6FA 1HX7A 3HJTA 3H4IA 2FH5B 5CYPA 3ANTA 4HN2A 2RJOA 4RCVA 2UUPA 3PXBA 1Y33E 4MR8A 5IDYA 4NCNA 5PNTA 2G6TA 3NIDB 1KFEB 2RGAA 3GK3A 3N2GB 1CF2O 1H2HA 1QORA 2QTRA 2YYAA 2FY8A 4QREA 2JLZA 4TRJA 3TJRA 4JXKA 2FFHA 1EA5A 2YNMA 2ZS7A 1XA3A 4KQXA 4O5OA 1SGWA 4CM8A 5CT5A 3P8ZA 3T4PA 2HHCA 3V7WA 5KNLA 3WO1A 1B1AA 1XHLA 2EF0A 3DXFA 4IEIA 4U9UA 1KEEA 4AJ4A 3CLRD 3OEHD 4XM0A 3H2ZA 1PZXA 1VMKA 1TU0A 2Q6KA 3BX1A 4I1SA 4PIPA 1UFKA 2HMSA 1HI9A 3I3OA 1X80B 5ENVA 3CISA 1XQ6A 2C96A 1O57A 2B3TA 1O5TA 5DHRA 3JVEA 3RVNA 1U6IA 2R1TA 5BSVA 2XEXA 4G8CA 2F1IA 1BROA 2CEKA 3ICPA 4NEQA 3G0CA 4B75A 4ANFA 2HDNB 3K0CC 5BWOA 7GPBA 4PZDA 5LQRA 2ZSIA 1YF3A 1V6SA 2C00A 3HJBA 4DSNA 3PPWA 2P8JA 2YRFA 1F8UA 4GOND 1SKBA 4B4WA 4CL0A 1DC8A 3V8QA 3P96A 1AS2A 1WMAA 3BWMA 4BE7B 2QS9A 4R2IA 3GCGA 5FOQA 3TAHA 3QKUA 4GOLD 4JVLA 5C4IA 3JCZA 1EYZA 2MWMA 2QTNA 4PV7A 3TVYA 3GUVA 1B0UA 4GS5A 3QVGB 5JIBA 1JZSA 5A3VA 4NR0A 1XU7A 1UQTA 4YP0A 5DGDA 3HV2A 2B1JA 5FUBA 5JAHA 3LFHA 1PR2A 3ESDA 5K0TA 4H3VA 5HWSA 2ZSBA 3QBJA 4TQAA 1SXJD 2ZR8A 3FWZA 5F7OA 3GCXA 4DA4A 1E3WA 4G23A 4AZ3A 1BN6A 2XCLA 3H2BA 1RXEA 1FVXA 4IKPA 3AI7A 4OFBA 1O8CA 2W2OA 1VE5A 3PK0A 3I0MA 2CJWB 2X1LA 3SBOA 3L4SO 3K8QA 4OU4A 3TRJA 5IJ9B 1KVSA 2OBNA 4TUYA 4LFCB 1MV5A 3DO5A 4OHMA 5AHXA 2D0OB 5KPJA 3O0TA 4C6RA 1OFUA 3K6SA 3S81A 1N6RA 3WGZA 3NRCA 1T24A 1X6VA 2NYVA 3KS9A 2GT1A 3ORRA 4JASB 3LMKA 2HIAA 4UDYX 2PL9A 4MMZB 4G1CA 1H66A 3VNRA 3WYGA 3EMVA 1Z2PX 4YRSA 3C3CA 3T3NA 4KR2A 4YQFA 2WIGA 1WXHA 4HAYA 2FZWA 4EUHA 1L7OA 4G0ZA 1Y1SA 3L9WA 3DBOB 2V65A 3CUYA 3HKEA 1GO