1ZH4A

Crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
121
Chain Sequence
MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KDP operon transcriptional regulatory protein kdpE
publication title A common dimerization interface in bacterial response regulators KdpE and TorR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 42
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zh4A00
2IDMA 5JS1A 3KCNA 4YV7A 1PNTA 1DBPA 4ETMA 5F64A 3T6KA 2LPMA 4RY0A 3JVIA 3HK2A 1NXPA 1QMPA 4NV3A 1BDJA 4EVQA 3L6UA 3QLVA 3EGCA 1JYEA 4TN5A 3JS5A 3JPYA 3LMKA 1B00A 1DBWA 3SG0A 1YVUA 4GNRA 1PHRA 4MGEA 1Z2DA 2FN9A 5EWLB 1QQAA 4DADA 2E4XA 3OQOA 4MS1A 3MF4A 4MR7B 1JFVA 1KMIY 2QW1A 3H1GA 3LTEA 4TMYA 2PJUA 2GWRA 3N8IA 3UK0A 2A9PA 3G85A 4RK4A 1DCKA 3T38A 3EODA 3RQIA 4E7OA 1BDIA 4KNYA 4IMIB 4MR8B 3R0JA 3C6QA 1ISSA 2P9HA 5IULC 5JNVA 4MS1B 4N03A 3G1WA 1JWLA 1U8TA 3Q9SA 5TQ2A 2L18A 1EWVA 1APBA 3ILYA 2HQOA 3O1IC 5HKOA 4N41A 1EAYA 1M2FA 1ZESA 4G86A 4MAAA 1JX6A 2OQRA 3OQMA 3RVPA 3H1FA 1ABFA 1DC7A 4IRXA 3CRNA 1YMUA 5BRAA 5FBKA 2AYXA 4RZSA 4YGXB 5FWXB 8ABPA 3UUGA 4JB0A 3CU5A 1ZY2A 1VKRA 3KS9A 4Z99A 1TVMA 3H5LA 5IUJC 5JNRA 3LUGA 2FMFA 1QO0D 5TQ2B 3C3KA 3HO1A 3MM4A 3ROTA 1D4ZA 3GYBA 1NXWA 2LUOA 3SM9A 2M1ZA 1W25A 2WJWA 1DCFA 2VUIB 3I5AA 1ZHHA 4KRFA 3M6MD 5BQ3A 3DZDA 3JTEA 2FLWA 1QQBA 1MIHA 1P6QA 2QXYA 5GQSA 3VNBA 4FE7A 4JP1A 1RNLA 2NT3A 2VK2A 3FFWA 1P8AA 2QV0A 2LP4Y 4S04A 1F4VA 3LKVA 3EQ2A 3KLOA 2MYUA 5KI6A 1KRXA 4PE5B 2NZVG 1YK1A 4RY9A 1YIOA 4XARA 7ABPA 1M2EA 4RU1A 4DN6A 4LE2A 3MMNA 2FLKA 2QU7A 4KV7A 4O1HA 3H6HA 1TLFA 2GBPA 2QR3A 3O2QB 3KJXA 1T34A 1TMYA 3HDVA 3ROFA 3TD9A 1Z16A 4EYGA 1D1PA 3HXMA 5JNWA 1PEAA 3GWGA 4O5AA 1USKA 2ID7A 4PEVA 3UKJA 1Y1LA 1Z25A 3GBVA 3HZHA 3OM1A 5B3JC 4NQRA 4EVRA 3HJFA 2PUGA 3D8UA 4L4UA 5KQGA 4WUTA 3BRSA 2QZJA 2R48A 3SQNA 2GKGA 4F12A 3KLNA 2IYNA 4G0YA 2PUAA 2FTKE 3RVJA 1DBQA 2FEKA 3JY6A 4YP9A 3OO1A 4YLEA 4WWHA 4WXMA 3N75A 2MYNA 1QP0A 4F3TA 5CHYA 3OLXA 1Z15A 1GLGA 1ZDMA 1FFGA 2FSPA 3DGFC 4H3HB 1DRJA 1EHCA 1JHZA 2GI4A 3F7NA 2PUDA 3A0RB 2PKXA 1Z12A 3DLHA 1ZITA 3GBPA 2WJAA 4JA2A 4KK4A 2PUBA 4XAQA 2TMYA 4RK7A 1AB5A 4ZMSA 4OG2A 3CZCA 1OXBB 1JDPA 1MAVA 3E3MA 3MQ4A 4RKQA 4EYOA 3HSYA 4RXUA 4ZYLA 3BILA 1JF8A 1D5WA 4PYRA 4TLLB 3T95A 5HSGA 4QYWA 2PAFA 2L17A 1TM2A 1BDHA 2FEWB 4G97A 1FFSA 5TQ0A 4WXEA 5I4CA 4G0PA 4DQDA 4ZJPA 2PUEA 1KRWA 3LUHA 4Z0NA 2YHBA 1RXIA 4QPJC 6ABPA 5EWJA 5TPWB 2ID9A 4UHJA 2GX6A 4LDAA 1GCGA 1E6LA 2PUCA 1U0SY 3O1HB 3TX6A 2Q5CA 3RVQA 3URMA 3CS3A 4JASB 5FWYA 2FMKA 1QKKA 1YK0A 1LK0A 3LUDA 4G0OA 1PEYA 2H3HA 4YCSA 4JB2A 4W5NA 3CFYA 2J48A 5KQPA 3BRQA 3N0RA 4N76A 5EWJB 1U2PA 1QNLA 4OATA 1W9HA 1JFSA 2MSKA 3RVLA 2QSJA 1R8JA 2PL9A 3IP5A 1JFTA 4PICA 4ETNA 1S8NA 3NNDA 4FB4A 1Z26A 4HNQA 4PZ0A 5B3JA 3RH0A 4RK1A 3RVKA 1NY5A 3DGEC 1SXGA 4ETIA 3N6VA 3NHMA 4G0QA 4IMJB 1ISRA 4KK3A 3GRCA 5TPZA 1DG9A 3C3MA 2E4YA 3I42A 3LUKA 1C4WA 1YS6A 1MB3A 2FMHA 4JAVC 4L85A 4MQFA 3VNAA 3Q41A 2WWVD 4HYEA 1Z13A 4Q6WA 3H5OA 3EAFA 3QX8A 4MQEA 1GUBA 3KHTA 4MS4A 2YHAA 3OMWA 1XHFA 4KQCA 5CNIA 2JRLA 4HNRA 4E7PA 3I45A 4EY3A 5DLEA 4YRZA 3KSMA 5T7BA 2FEPA 1YTUA 4YWHA 1Z2EA 2PMCA 3FDFA 3QEMA 4MQFB 1NATA 3HVRA 2E4VA 3OLZA 3NNSA 1Z17A 2QVCA 4Q6BA 2A9QA 4MS4B 1LBIA 2NZUG 5JNUA 3QEKA 4G0ZA 2N9UA 1L5YA 4LDZA 2DRIA 4MPTA 1ZH2A 1IIBA 2E4ZA 4RS3A 3H75A 3QEMB 2L2QA 2F8TA 4MLCA 1SXIA 3LFTA 5HM6A 3FGZA 4NCAA 1NXXA 2JBAA 4RWEA 3ILHA 4MYRA 5C5CA 1GUDA 2IPNA 3H6GA 3OLVA 4RXMA 2JVIA 5CNMA 1LBHA 3GL9A 5KC9A 3FFXA 3T8YA 3QELA 1DP4A 4MS3A 5CNJA 3LKBA 2AYZA 1DC8A 2IKSA 3EULA 5BRJA 1ZH4A 1EWKA 3CHYA 1VRVA 3SY8A 2PE5A 4WZZA 1E6KA 2QVGA 3N53A 2CWDA 5IUKC 2ZWMA 1C0EA 1NXVA 1ZGZA 3QLUC 3LUFA 4FE4A 4N0QA 3OQNA 3KYIB 2CHFA 2IPAB 1A04A 3A0UA 3O21A 1EWTA 4MS3B 2BGGA 4NCBA 2P4UA 3O75A 1QP7A 3S99A 1YMVA 3QK7A 1JBEA 3KYJB 2A9OA 1UDRA 5TPZD 1JH9A 2F8SA 4H60A 3FMVA 1BVHA 2MYTA 3D02A 1OXKB 5T3YA 1YS7A 2NUBA 3CZ5A 3LUJA 3W9SA 3M9XA 3A3KA 1NXSA 3CLKA 4RXTA 1I3CA 3N0WA 3H5VA 2VYCA 1JDNA 3KKEA 3MYYA 4MR9A 4YO7A 4QICA 4WT7A 5JNSA 2MSLA 4D6YA 4MRMA 5BR1A 1DRKA 3F6CA 4Z4IA 1XHEA 4XASA 5KQLA 3NHZA 4Q7EA 5CNKA 5IX8A 3HUUA 2LIVA 4LZLA 1ZGGA 2CHEA 2FQYA 4IGAA 1LJUA 2FXIA 3KG2A 4W5QA 4LRQA 2ZAYA 5ABPA 2M98A 4M88A 4Z4HA 3EJWA 1K68A 1QO0A 3P9YA 4RV5A 4XFKA 4EYQA 2RDMA 4MR9B 2RGYA 2R4QA 2R25B 4KQ9A 4KZKA 1ZAYA 5PNTA 1SXHA 1HEYA 2X7XA 6CHYA 2FKAA 2R47A 3JPWA 2L19A 4KMRA 5TQ0B 3O2JA 2HQRA 2FMIA 1MB0A 1VPWA 4OTZA 2PLNA 1RXEA 5GOTA 4MR7A 4XLTA 5C5EA 1USIA 1P2FA 2WB4A 1F51E 1QPZA 4EYKA 1NXOA 1D2AA 2W42A 3GV0A 4Y9TA 4EGSA 2MYPA 4KFCA 4LE1A 4N47A 4YS6A 5FWYB 2LBPA 3IP7A 3QLUA 1VLZA 2WY2D 1Z18A 5TQJA 4MR8A 3K4HA 3IDOA 2MSWA 3SNKA 4ZPJA 3MA0A 2HSGA 3Q7RA 1FSPA 4F8JA 2OENG 5IEJA 3H5WA 3LUAA 2IOYA 4RSMA 4HNSA 4KREA 1A0OA 2O20A 2NT4A 2FW0A 2FQXA 4Z4EA 2RJNA 1NXTA 3MIZA 5JS2A 3TO5A 5IEBA 1LJLA 3BBLA 3DBIA 2FQWA 3RVNA 4YR7A 3Q15C 4D6XA 3M9WA 5EWMA 3O1JC 5FWXA 3IPCA 5E3JA 3A10A 4W5RA 3IP6A 3F73A 3L49A 4OLBA 3O74A 3GA5A 2I6FA 3HV2A 4P98A 1SRRA 3IP9A 3LUCA 1RZRA 3IPAA 5DKFA 3Q7SA 4H3KB 2PL1A 5KC8A 5FBHA 3SAJA 4B09A 5IUNC 4W5TA 2HPHA 4RDCA 3JVDA 4CBVA 4KVFA 4TLMB 2IPMA 1ZVVA 4KPYA 1H9CA 4MQEB 3NBMA 3B2NA 4G0XA 4OLAA 3OM0A 4LX8A 5EWMB 1QP4A 2JVJA 4Z4CA 3H5IA 1PNRA 2H0AA 1FQWA 2E4WA 1ZN2A 3I09A 3HS3A 1BAPA 3TB6A 3EQZA 4OBBA 3RVOA 1XWWA 1TJYA 2CD7A 3OMXA 1M5TA 2RJOA 4RK5A 2VUHB 3HUTA 2E4UA 4Z9AA 3NNNA 1PUXA 4N0PA 3QLTA 5JNTA 3RVRA 2B1JA 3CNBA 1DCMA 3LOPA 1DZ3A 2JCGA 5DTEA 1JL3A 3RVSA 3CTPA 4GPAA 3E61A 3QX9A 5D2CA 3C97A 1CEYA 3QLVC 4W5OA 1E6MA 2FVYA 2JBAB 2WRZA 1BA2A 4RKRA 5TE9A 4UHKA 1SD5A 1USGA 3C3WA 5KWSA 1JYFA 3QELB 4O1IA 2JK1A 3FFTA 3K9CA 4RK0A 1M5UA 4ZMRA 4MLDA 3HM9A 4F06A 3CG0A 3HEBA 3RVMA 1DJMA 3F6PA 3H5TA 4IF4A 1L5ZA 1CYEA 1E2BA 2PUFA 2JVKA 3TMYA 1K66A 4EVSA 9ABPA 1A2OA 4RY8A 4F11A 4G0MA 1J56A 2IPLA 2HJ9A 1URPA 3OLWA 2FN8A 2HQBA 2JB9A 1P6UA 1CHNA 5ED4A 1GCAA 2A9RA 3O2SB 4LE0A 4Z4GA 5DCLA 3H1EA 2WMYA 1ABEA 4S05A 1NTRA 4P1ZA 1U2QA 4QYMA 1EFAA 4NICA 4RK6A 3OO0A 1RZRD 1JLKA 4XXHA 3Q7TA 5IC5A 3CKMA 4ML3A 5IBQA 4D74A 1FFWA 5HQJA 3DLBA 1KGSA 5KQMA 1AB6A 3HDGA 3HCWA 4Z9BA 1U04A 5TPWA 2XDYA 5DGCA 1RPJA 4EUKA 4MRMB 1WETA 3OLYA 3EDCA 3CG4A 4IILA 4Z4FA 3GT7A 2B4AA 3N0XA 4JOQA 1MVOA 2KYRA 2V0NA 3KTOA 1D1QA 3BREA 5EWLA
chains in the Genus database with same CATH superfamily
3UJPA 1BJTA 4MWGA 4QM7A 3GEDA 5LQCA 1G59A 2DKOA 3TNLA 2BAGA 2BZ1A 1IDN1 2ZPUA 4KH1A 4PAWA 5T67A 1X6VA 3SS8A 3TLCA 3S8YA 3MJRA 4ZOAA 1E2JA 3K9QO 1VHQA 3IIMA 4CM9D 4FB5A 2ZRLA 3AI1A 3EWIA 1DEKA 3Q5DA 4TMKA 1N6IA 3WKDA 2H2HA 3JPYA 1B00A 1C5KA 2P9GA 5LMNB 1KMNA 2EL9A 3WXBA 5E4JA 4F2DA 4YACA 5DCWA 2IYAA 3H1PA 1DDIA 1R64A 3PDHA 2D5AA 2D1RA 1X3LA 4WLUA 3X2FA 5GZ3A 4AJ2A 1W8DA 2IY7A 3K35A 3WMFA 5TIIA 4B7XA 4TUYA 4XJTA 3UOWA 4F5WA 5AKJA 4OA5A 3ST7A 4ZOCA 2WQ6A 2NTEA 2XBUA 1L6RA 2BUBA 1L0BA 1R0YA 5TARA 4NK4A 3BSWA 3V4VB 2VHQA 2X9VA 4X7BA 1ZOOA 4JYAB 3R0JA 1QRAA 1JG2A 2JAQA 2O06A 3GNTA 3PC8C 3D1LA 3CUWA 4O2LA 4URUR 1W36C 3G1WA 1ZL2A 3I01M 3II6X 2QRGA 4BVLA 4ZYWA 3JXEA 3GDOA 2F6RA 2C3UA 5YASA 2B8EA 2PT9A 5TQ2A 3V1KA 1WDWB 4BGUA 2ZIFA 2C78A 3L7OA 1Z6QA 1XIVA 1GTL1 3H1FA 3HUDA 4YNBA 4CJXA 4ZTUB 1DC7A 4JLUA 5FA8A 3TW8A 1M6NA 3CO5A 2OUIA 1Z75A 2PR2A 3NTLA 3AFHA 4N1AA 4EMTA 3X1YA 2AOUB 5BSTA 3U2QA 3A9VA 1CQJB 3V2GA 2IIVA 1DDOA 3GFTA 3K6SA 1YTLA 4G4SP 5GVSA 3JQDA 3UN1A 1GQSA 2ORWA 2OT3B 4BE7B 3GGJA 4PZDA 2NPFA 2VYVD 2PO5A 1LDYA 1UK9A 3C3KA 3LO5A 2ACVA 1L4MA 2O7RA 4K1LA 5GAJA 1W7AA 2WT8A 3L5KA 3B5JA 4BKPA 4RFVA 1LC0A 3A9CA 1XYVA 4RESA 2DFLA 4LSGA 3WK7A 3LIPA 1MORA 4ZALA 3TCKA 5DT9A 2WUGA 2FLWA 3E7FA 3L6CA 4WTOA 4PC7A 4UQOA 3TXYA 4AUKA 5IJ9B 4YJGA 3W2TA 2V03A 3AU8A 5DJ5A 4C7BA 5IPFA 1FMFA 3WHPA 1Q0LA 3UF0A 3RAFC 4EZIA 3DVAB 3VDXA 2P1ZA 2VHEA 1HDOA 4TMWA 1TVEA 4ENSA 3BGWA 3SR3A 4IDHA 3W1EA 1A1SA 1BKYA 3MJTA 4MI1A 1ZN9A 4PWZA 4E88A 3W78A 3RO7A 4OJQA 1W96A 4YALA 3B1ZA 5EZ6B 5I9MA 3BWBA 3G2QA 5HTKA 4IUDS 3AY0A 1CZLA 1MBZA 2A88A 2R8ZA 4HXFB 4LHXA 1JHYA 1Q57A 4H08A 4LJLA 4NCIA 3GAZA 4W7IA 1ZU4A 5B3JC 5HIJA 2FE1A 4C4ZA 3HJFA 2VVTA 3JAWA 1JHXA 3IQGX 3K9NA 3L79A 4UNQA 2X1HA 1JKJA 3SQNA 2P79A 1UH5A 3LQ1A 2PJZA 2B8NA 4JI5B 1OAKA 3IILA 3P2YA 1ORDA 4MUAA 3FVVA 1F9AA 1I33A 1R4ZA 2MYNA 2NU7B 2OKCA 2UVDA 3H42B 3IBSA 3KJIA 2DQSA 1UMKA 1VPLA 2O7VA 2ODPA 3HM2A 3IKJA 4RJLA 1Z15A 3A4VA 5BSVA 1KI4A 2ERYA 4FS3A 1JJIA 3K1TA 1DRJA 1GPBA 3F7NA 2QAGA 2PNJA 1E3JA 5CM9C 4I8DA 1NRXA 1Y7PA 3E48A 5CFLA 3L6DA 4KO4S 2Z5VA 1SVKA 1GY8A 4XAQA 5FNVA 3SVZA 3NC0C 2AK2A 2GVDC 3BK1A 1Z0IA 2VQFB 1M1YE 3K4QA 3OZBA 1XQ1A 4M60A 4UJ3A 5A9TA 1E6UA 1J0EA 3D43A 1HYGA 4RIFA 3W79A 4S3MA 1J5XA 3CLHA 3RC1A 1TM2A 1UCFA 3RT9A 5B1EA 4A16A 4G81A 5IHXA 1HDIA 4NS1A 1QVAA 4WUVA 1AK2A 1XFAA 1SVNA 4M1YA 4B3HA 1MG5A 1AKTA 3UJDA 1LU9A 3H7AA 1KARA 1EM6A 5WRFA 2ID9A 3ML1A 3B70A 3N59A 2V4MA 4XM2A 2WM2A 1AGPA 1KKUA 2I3DA 3ZH2A 2RGWA 2Q6VA 1F12A 5CX1A 3S3TA 1GGNA 1ZCBA 4TWBA 4BZZA 3ZZ1A 1G8PA 3HZRA 2MR5A 4JASB 3UWMA 2A6PA 1JECA 2ZANA 3JD4A 1D9ZA 3ZDEA 1WMBA 2EIXA 3E9ZA 3COPA 1E9BA 1Z45A 2PGNA 4EJSB 1FS4A 3BMCA 3AHGA 2I8LA 5LA6B 3C3BA 4U2EA 3U13A 5CD9A 1PT8A 2QAIA 5JEEA 2RAPA 5EWJB 2GO7A 1PWZA 2GBLC 2X58A 3LI2A 3ER9A 2FRXA 1QYDA 4YGYA 2ZE5A 5EE9A 1W5AA 2FW9A 1CQWA 3VR3D 1QO9A 1YU9A 1ZIOA 1UDBA 2V9CA 4N6GA 4PYNA 1SUDA 2FFJA 4MDFA 3I01A 2RGRA 3AIKA 3M2PA 3DBOB 1CUZA 4W4TA 3NRBA 4D4MA 1RYMA 3VQTA 3KFVA 1TW2A 2CXPA 2OQ2A 2VXOA 3NHMA 3O8NA 1NGSA 2QTCA 4G65A 5CPBA 5HCIA 5J40A 3MS4A 3VR0A 3OFND 1MNQA 5HX7A 1HNNA 3IAS1 1BVUA 2ZBDA 1VA4A 1WTCA 1DKNA 2CLCX 4LUCA 1EGHA 5AI6A 1Q6YA 3VJMA 1WM1A 5GJWC 3ANLA 4LSWA 4B9AA 3L4BA 4OX9Y 1K5DA 4DDMA 1V7ZA 4FIDA 4S0ZA 1I14A 2VJBA 1E5LA 4Q39A 3K2EA 2PRJA 2XKBA 4MQEA 3KHTA 4B0PA 2F9LA 2HI0A 4YCCA 3EZGA 5MFPA 1G5RA 1PJRA 4CM8B 4J0FA 3CVXA 1U90A 3TNDA 1IXRC 1EDBA 4D9GA 3TPCA 4NZNA 2YWJA 1NYTA 3WXMA 4G23A 1XJ5A 1ZJ5A 2PV7A 3OKFA 4NZ9A 4YRBA 3BRWD 4YRQA 1U31A 4DEVA 1FA9A 2QVCA 1DT5A 5CD1A 4C05A 3I61A 4M38A 1UJ2A 5DN9A 4CLEA 1BA3A 1KSHA 2QZ4A 4MV6A 3E9NA 2QQ0A 2B61A 1N33B 2PGLA 5LA6F 5E0KB 3QEBZ 4GLBA 2HF2A 4BLSA 2YV5A 4I4CA 3TGLA 3LFTA 4ZO4A 4LZPA 3JQFC 1A4IA 2XUPA 2JZCA 3BKXA 3LNCA 1Z74A 3CJRA 3QPAA 5CNMA 4DC0A 2FH5B 3A3NA 2JVIA 3EXG2 4OHCA 1HT3A 4S12A 121PA 1FDIA 5JXWA 5KC9A 3D2BA 3HVUA 1C3EA 1UKAA 2P35A 4MS3A 1L5GB 3NTUA 4AJKA 4B7CA 2R11A 3THRA 4F6CA 1E92A 1G6KA 2WVAA 3LRTA 1HYBA 5T4HA 2BCGY 1OZHA 4QXOA 1LBQA 2XE6A 1D2MA 1TE2A 4DKJA 2QVGA 2O8CB 2X3YA 3HR8A 2QZZA 1M7HA 4KC0A 3V4ZA 5C1DA 1EUDB 1QLHA 3GNSA 1TK2A 3ESAA 4JGIA 1DB3A 2IPAB 2XD9A 4LNAA 4QX6A 3QVGA 5GY7A 4F9EA 4RDXA 5CDGA 4HDAA 5AM1A 4J03A 3RRBA 4OH7A 2QY9A 2FFRA 1ZQ9A 4HDQB 1RADA 2A9OA 2DULA 2UYQA 2DVMA 1DU4A 4GIBA 1OT3A 4I6GA 4MQ6A 3VH3A 4CEHB 2GAAA 3O8DA 4PR3A 2B4TO 1U8EA 1Q7BA 3BERA 5T3YA 1V8ZA 1Q0RA 2FPUA 1OU4A 4EEZA 3RK4A 1XPUA 3CA8A 1I3CA 4URYR 3GRFA 4V2UA 3T4XA 2PQ0A 3BKWA 1P1IA 2ZJ7A 3HKDA 3UCXA 2EGUA 1JNXX 2ZSKA 2WNSA 3NHLA 4U02A 1U9JA 1BC5A 2HK8A 3SJCA 1SHJA 1NQOA 2WTNA 1D1TA 4B35A 5CIQA 1ULAA 4OHVA 4PZLA 2HA0A 4QBHA 1SUEA 3ZDAA 4J0QA 5HKLA 3HCOA 3G5MA 2ZYIA 2CHEA 2PCLA 4V24A 4QLOA 3LYHA 3HMKA 4JDUA 4AJOA 2V7XA 1S9DA 2WIKA 3AHIA 5E6RB 5IK2A 1CJTC 1ZIPA 1K68A 2R62A 5IP5A 4Q4HB 4A8JA 4UEQA 2RDMA 3IOCA 1U8YA 1LX6A 2AI2A 3ZYCA 1NDQA 1NSTA 3I1YA 1U1CA 4W9NC 3SVLA 3JQ7B 1O95D 1DIAA 4QSMA 3DAGA 1FDSA 5GZ6A 1A9XB 1E1YA 1W85A 5T3UA 4AZ3B 4DA7A 4RMHA 3RFXA 1E2IA 1EA7A 4LN1A 4JEMA 2ONKA 2HSJA 3OX1A 3WNQA 3A6PC 1GITA 2CWWA 1UC8A 2HRQA 4A0GA 3I32A 1V4VA 4KYVA 1XX6A 2D3TA 1GZ3A 1D2AA 2FWRA 3QWIA 3RRXA 3H2HA 4N49A 1GJRA 2A92A 3ENNA 4JLJA 4DMFA 3R24A 5AVQA 2VSFA 1NW5A 2JIRA 2RAFA 2HCFA 3AY3A 4O0MA 3MA0A 1PJLA 1P72A 5EE5B 1L4HA 2GB4A 3FBTA 2EEPA 1QLJA 4F8JA 1GPH1 1IBMB 3H5WA 1E6CA 1JZQA 2GEJA 3IUEA 5UKDA 3C16C 1I94B 4KN5A 3K9WA 1GAXA 4TRNA 1XDWA 3MOIA 2KQUA 1CETA 2VCEA 3BBLA 1AKRA 1DLIA 1JKMA 3DWGA 4DCUA 3RB8A 3IA7A 3QVTA 3UQZA 3D8SA 4ZC1A 4I9UA 2C99A 1ZJYA 3HUEA 5ALHA 5B3KA 2AOUA 2G06A 3WV5A 2X0NA 2PX5A 3NI2A 1CQJA 5EMHA 4B8YA 2D00A 3H65A 2XZOA 1I9GA 4I14A 4Q12A 5G1OA 4EG7A 3T7CA 5KHLB 3VPSA 3MERA 3NWOA 4C7JA 4A4DA 4B3MB 3BGDA 2H8GA 1X80B 3UAGA 2QE7A 2Y1CA 3EIHA 3GYGA 4GYYA 4R1LA 4B6PA 1E1LA 5IANA 4CIDA 1HEUA 1X38A 3JTMA 4TLMB 2VHTA 1PK7A 4QC2A 2CLSA 2D0DA 5HE8A 5LQUA 3KAKA 2WOOA 3G9QA 4L02A 2Q46A 1E3MA 4Z4CA 3ZK7A 1YD7A 2IIPA 4F60A 2B1RA 3MLBA 1YUMA 2BFOA 4JIMA 5IZCC 2H0AA 4CG1A 3K09C 4BLPA 1HPLA 5JWRA 2WSBA 3CGWA 4ARZB 1JHRA 4Q3LA 3OTOB 5FOVA 4FBLA 5BV7A 4E22A 3OZCA 1WXIA 5DDIP 4BVBA 3QRWA 1Z5PA 1KJNA 5CEJA 4YRGA 1QJ4A 4CQMD 2D5CA 1UPBA 3PL5A 5AI5A 4DMGA 5B7QA 4BRSA 1WD5A 1XI2A 1AUXA 4M98A 3RU9A 4EECA 1U0NA 4QUGA 5C8DA 2ASEA 1DCMA 3QPVA 3OKAA 2AOVA 2EJWA 4IUCS 4I81A 1JL3A 2YNMD 5ERXA 3A9WA 4XWTA 1QWSA 5IYZF 2C97A 2YJNA 4UVGA 1LJ8A 5ARDA 2G83A 4GRAA 4DNOA 2Y6UA 5DHQA 1H94A 3NEPX 1ZZGA 3WISA 5IS2A 4AS3A 4QOGA 1X7XB 2JGNA 4ILKA 4ZQGA 4AURA 4HWOA 2F00A 4DAEA 5I4KA 4Q9KA 1NVVQ 4OQQA 3THOA 3X1KA 3GGSA 1LFAA 1JIXA 3OOJA 4PR0A 3WFZA 3DV9A 4AVYA 5EE3A 1IK6A 4NBRA 3UAZA 4TVKA 4IF4A 4UBLA 3OZXA 2SNIE 5KTKA 2C2KA 1CYEA 4KWTA 3DOUA 3AL0C 2QUJA 1O5IA 1X9HA 2XMBA 2NU7A 3COWA 4Q03A 3KL2A 3JVEA 3H0KA 1XLUA 1XRMA 5JAQA 4G1BA 4D4LA 1S9HA 5K3BA 4F0JA 3K8OE 2QTVB 3RF6A 2X15A 3AF0A 3VBEA 1AY0A 5CIYA 3TLGB 4JVMA 5B7GA 3NM5A 1IEQA 2V4ZA 2C04A 1XGKA 2VDKB 3VXKA 3ZGNA 3ESBA 4F8YA 3SKYA 3BH0A 4TL6A 4R9UC 1GQYA 4RULA 1EFAA 4NICA 4BEBA 3GRVA 1KERA 4BO1A 2HC9A 3ADKA 3AJ8A 3EAGA 1M6WA 3L8HA 1JKXA 3DWIA 3DVRX 1VP3A 3NUZA 3OAAD 1WMFA 2PKQP 1JTFA 4BWVA 1CUEA 2BLNA 3B6ZA 4MYUA 1MVNA 4V03A 2VFAA 3WLPA 1DBVO 2Z6QA 4GE3A 1KJ8A 2D13A 1JAZA 2ZJ1A 3TZLA 1D2GA 2VYNA 2P3QA 3M6UA 3NBQA 4QOHA 3TKAA 1DMSA 4JGBA 1A27A 5BYJA 1JSRA 3IP1A 1G63A 3PWSA 2PL3A 3D7RA 3TZQA 2AG1A 1XEXA 4G5XA 1CUYA 1SD1A 7REQB 5AW2A 3T8YA 1EIZA 3MAJA 2XB4A 1XTTA 4L15A 1C0IA 1Q74A 3RYCA 4LY0A 3BDIA 4NZOA 3ED1A 1KZGB 4IFTA 5DNYB 2G4VA 1XJQA 5GINE 3T3OA 1COWA 2XMPA 3MWGA 3EW9A 4M36A 4URXR 3JARA 3BL6A 3BXZA 4HK4A 5HILA 1QFYA 5KU7A 1XZAA 4E5MA 1XQXA 2FJUA 2PKEA 1JYEA 3CXRA 1P62B 4KFSA 3U81A 1DBWA 3PQDA 4WX2B 4Y3UA 2GYVA 1PHRA 2AG5A 5FXMA 3BXPA 1HO3A 3BAFA 3QITA 3J81k 1NVGA 1YA8A 2R65A 3LPNA 5B2ZA 5KNCA 3DNPA 4MR7B 3IBTA 3B6EA 3CN7A 3TTTA 2C5AA 3CLSD 4J3NA 4DZRA 1OE0A 4R8LA 3OC0A 2QA5A 4V02A 3DDCA 2C9YA 4GVLA 1OYYA 3UAVA 2G4CA 1TO2E 4LDQA 1KWGA 2W71A 4TZ6A 5BV8A 4KLRA 3VHRA 3VUFA 3T1NA 2C7VA 3QXGA 1FTWA 4E1AA 3OCZA 5HKKA 3DQPA 3D3KA 5BQXA 5IAOA 3VO8A 1UBGA 2UZ1B 3GFGA 3MJDA 4MS1B 4N03A 4RLSA 4WACA 5KYKA 1O3YA 3DMPA 1JR6A 4HRAA 4QQNA 1U8TA 4UUQA 2HRRA 2NN3C 1B6TA 4TLAA 4A03A 1O8BA 4CM8A 5JS8A 4HEQA 3TX2A 2HNAA 3FKSD 5CEFA 2GYYA 1NX9A 3L7NA 1MRZA 4ZV7A 4DQXA 4NMXB 2D5IA 4PIPA 4M21A 3ZGOA 2KJQA 2QNIA 3OM8A 2PUJA 3FIJA 2QAGC 3HKBA 4JB0A 5BN5A 4J9VA 3CU5A 1UANA 3BVPA 1VKRA 4BNKA 4MPPA 5EPUA 2VTBB 4FYVA 1KJIA 2XQVA 2AEJA 3LHIA 5I8ZA 3V1UA 5FPKA 1YACA 2A9JA 4RZXA 3CF6R 4JQYA 3FMPB 3L02A 2GTHA 2PS9A 5HK8A 4IRMA 1Z4OA 2OC9A 2VDJA 2COKA 1NDUA 3FOBA 1V6SA 4CTNA 5IDXA 4J2OA 1I30A 1WU7A 4P4GA 1ZHHA 2FK8A 1ETUA 2R4TA 5CNIA 2P2CA 4UPDA 1G8GA 1IOWA 1DPGA 3UT0A 1VA5A 2GM9A 3D1JA 4KIJA 5JAOA 4K6KA 1YJQA 2JI9A 3SF8B 3ZW7A 1F1JA 1FB5A 1VPEA 2JLQA 2K87A 3Q8WA 1R9NA 1P31A 2VDUE 1KRXA 1A2QA 4WJKB 4ZVNA 1WOMA 3AERB 3G8BA 3TZ6A 1HFWA 3S8MA 1M2VB 4KQFA 5HDQA 2PYZA 5K0BA 3L4JA 2WPDA 3K92A 3R6WA 3ND9A 2BEWB 2WZCA 1W0JD 1TJ5A 3O26A 5EA2A 2Q4OA 3WYGA 3S2IA 4DCJA 2AIRA 1IN4A 5ADVA 4H6WA 1U5BB 3S5UA 4OJMX 5TLSA 5BPHA 1N6NA 4GKAA 4Q24A 2C7QA 3M3DA 1T5DX 16PKA 3AVYA 3USES 1BXRA 2IEDA 4IV5A 1KO8A 5DNWA 5DSZA 4YX9A 4AO7A 2B3DA 3DBLA 1KAGA 5JSZB 2W70A 4G67A 4BMSA 2PUGA 4Q1VA 3VR6A 5FTLA 4OB7A 3BUSA 4G0YA 3ZE2B 4EG5A 2FTKE 4LOHA 3MILA 1KXZA 3JY6A 5FUMA 3DR3A 3VI3B 1G1MA 1LPMA 3IKLA 1JI0A 2YWDA 3IEPA 3LC0A 4MXDA 4U6SA 1P0CA 4D45A 2N75A 1FTSA 3AW8A 2GF0A 4NJMB 4D9KA 3L4BC 4GXQA 3G0GA 4KBFA 1GDDA 4FZJA 5DTJA 4N0MA 1Q2XA 3G2PA 5F5XA 4BV8A 5D86A 5E6RA 2ONJA 3NJRA 2V8OA 3A4YA 3CSDA 3E3MA 4YCJA 2C5BA 4QJIA 3RD5A 4L8YA 3BILA 1K7CA 1Z4MA 2EEZA 3JQ7A 3ACCA 2L17A 3RIGA 1BMDA 1K8XB 4BIIA 4AZ3A 1A9XA 2G1JA 2WFLB 3O95A 4AO6A 2JFXA 4LMAA 4P4LA 4O02B 4NYMQ 1RW4A 4BXOB 1FVOA 5AHKA 1QHSA 4OQEA 3V1MA 5JWOA 1UR5A 4N5LA 3UHJA 4GPD1 4WEOA 2XUKA 4K8RB 5U4QA 2J0QA 1TDJA 5NLLA 4TQUS 3C7KA 1M75A 5FUVA 4EOGA 1NVXQ 1Q1NA 1UKCA 3M5PA 3V4SA 2Q5CA 2XITA 1PRYA 2R2GA 3EXIB 3IURA 3OCJA 3PPWA 2ZIZA 4G4IA 3WGJA 1T3GA 4RANA 1LK0A 1H69A 1WF3A 4TPKA 4RETA 4N5HX 5DHPA 3S0JA 2DEUA 2YN4A 2P9YA 2DFVA 2Q3BA 4AY6A 2H7VA 2DWUA 2WP8J 1OI3A 3UIEA 2B78A 3VUEA 2IGTA 2CEKA 2C31A 3HB4X 3GPCA 2Z83A 2XWPA 3B7PA 4JROA 4MUIA 3PNPA 1PNVA 3OQ1A 1V11B 2SKEA 3O94A 1AXEA 1FNBA 1FRZA 2KX7A 4HNQA 4F5EA 5CCEA 3RUIA 1GUAA 1J0CA 1AQ6A 5KVCA 5LOVF 2WWIA 1W4ZA 1HY3A 1OFTA 3NDBB 1SXPA 2RAVA 1DLJA 2E6UX 4DUPA 1EDDA 1K7FB 1PTJA 5KX5F 4OSPA 1SR8A 2O3QA 3ITDA 4G36A 3WAKA 5HR5A 3HYLA 1X80A 1UMCB 4BATA 1ZI9A 1BOOA 3BMOB 2AI3A 2FGKA 3RYTC 1THTA 4IQGA 1YR6A 3T9AA 1PEDA 4DIDA 5EGSA 2YMQA 1CIJA 4PQRA 4IQFA 2H1HA 2MCFA 2I4NA 4DQKA 2QXTA 2RC6A 1QCDA 1XKLA 2W6OA 4RYDA 3W7AA 1CRQA 1E2UA 4ZO9A 3LT1A 4GNKA 3GIWA 5C52B 3RS3A 2YV1A 4ARZA 3P52A 5JJLA 4FOOA 2CB9A 1U0LA 3SX2A 1DKPA 2AN1A 1N2OA 2VSXA 1CT9A 3VPHA 4AO8A 4EIWA 3PGXA 2VQDA 5DGXA 1FFEA 1EQAA 5ALTA 4K6OA 1RWNA 2Q4BA 4N8DA 5DTMA 3GGDA 1IK4A 3LHFA 3KT3A 5THKA 1PT6A 3MCUA 5MGBA 4HB0A 3WBBA 3W5BA 4UHBA 2XZPA 1P77A 2H1VA 3E9MA 4A8JC 3JD3A 1GNRA 4R0NA 4H7FA 3QEMB 1TRKA 2ZQZA 4MUJA 4R1MA 1ZK3A 4MV8A 3U3RA 4XB1A 5C5CA 5AW0A 4CFZA 4HSEA 2C9BA 4IRUB 3URKA 4UZEA 3CX6A 2R4UA 4NBSA 3SZ3A 4RTMA 3GLFA 4NDNE 1Y8RB 4UOEA 3K94A 5F2KA 3DT9A 3PIRA 5GONF 3STHA 1G1AA 4ESHA 2IZ0A 4EX6A 1RXCA 2QEQA 4MA0A 4B3JA 5C8YB 1O96A 2O52A 3RODA 4AMBA 2RK3A 3Q1LA 3DFMA 1SVLA 3DTYA 4MMZB 4L78A 1EG2A 4UNRA 2IHZA 5KTRA 2LWIA 4C87A 2DSTA 1SUPA 1T36A 1ZGZA 1SA0A 3CEPB 3HO8A 3OD1A 3VPBA 4EGFA 2W2LD 3KYIB 3TLGA 5KYVA 5I7UA 3QPWA 4PZAA 3O21A 2BGGA 3RTDA 3VYWA 4IUBS 2Z3ZA 3WBKA 3I8OA 4S35A 3RTGA 4CM6A 2Z09A 2Y0EA 1LPSA 1YZVA 2ZATA 2BBSA 2Q3FA 1R9GA 2KS6A 4TWIA 3QKUA 1JH9A 1KZ6A 1QU2A 3FMVA 5A5FA 2JLCA 1BE6A 4AK9A 1XF9A 3AETA 3HV0A 2FSUA 1IOLA 3B9RA 5A3RA 3CW2A 2HXYA 1TLLA 2F3SA 4R6WA 4UM7A 3M9XA 4Y9RA 1TT7A 1HR0B 2C5SA 3PUWA 4QU0A 4Y6PA 5BQFA 1ZOIA 2J5KA 1VSVA 3ZZNA 3RUHA 3Q8KA 3MYYA 2DLDA 3GH3A 3HNPA 3QFHA 3TDNA 3EGWA 5J2UB 3WYAA 1HETA 1NN0A 1RPAA 2D1QA 2ZRGA 1KAHA 2REQB 3MW8A 5BQPA 4Z4IA 4QJBA 1L5OA 3RWBA 3DDOA 4TZKA 5IT0A 1C9MA 2WSYB 3M0EA 4DXAA 1T3LA 4PC2A 2DX7A 7REQA 1ZGGA 3QEAZ 1BXZA 1X74A 3QVUA 1Z08A 3ZOKA 4CKXA 4NBNA 2YZ2A 2VPZA 3AWIA 3PHLA 4IHKA 4L0CA 4BAZA 4FQ7A 4S1TA 4EYQA 4CDRA 2B7BA 1OV6A 1SK9A 3LS2A 1DMRA 1R8QA 2R4QA 2TMGA 4S0XA 3IIJA 4U7TB 2W48A 3ZU2A 5FOQA 4AKIA 1SXHA 3L46A 4ZQBA 3LAWA 3AJAA 3JPWA 4RZQA 2OHOA 5CK4A 4MKRA 4BTVA 1ZNXA 4BX3A 4TXNA 4AAYA 4WNIA 1OJLA 1YT5A 2ZJ4A 3ZI4A 1MTOA 1S6YA 2NAFA 1IDOA 1QS0B 1F0KA 2W6JD 1RXWA 1MO4A 1Y5NA 4Q5IA 4ZT7A 1GUFA 2DE0X 2W43A 4I50B 4MR7A 3DPIA 3G8AA 4LXTA 4JBNA 5A6VA 4XDYA 1EJ0A 1EINA 1FE8A 2ZU6A 2IIQA 5KAMA 4F93B 3ZCTA 1VYHA 2GFQA 1I4EB 4PQGA 5DLYA 1KC1A 4XOIA 2EF0A 4WLFA 3V8NA 2ZBVA 3A4NA 4ZHQB 1Z7YA 4UM9D 4G9GA 2UZ1A 4U7HA 1UINA 2B34A 2WVHA 2PDAA 1EFPB 1U11A 1K6EA 1NU8A 2WTUA 1U8XX 2W6QA 4X84A 4BVJA 3KTFA 3VHLB 4A1FA 1WUYA 2YJ4A 4M76B 5AVZA 2QF7A 2WTEA 5E7QA 3UJ7A 3ZIAA 3CGGA 1UK7A 2XEXA 2Z3WA 1QANA 2R6CA 1DAOA 4IKEA 1P5HA 3GCWA 2BIFA 4RPGA 4Y0AA 4ZREA 4F5DA 9LDTA 1ND6A 3A31A 5JS6A 2XB2A 2VTBA 2XIQA 3I2FA 3ILSA 2QMUA 1U0JA 4HO1X 4RE6A 3IPAA 5C81A 4YJ2A 1O9GA 1Y5MA 1XEFA 2OFOA 4UHEA 5FBHA 1LTKA 2D5LA 2YASA 4G89A 3KR0A 3SAJA 1VJ1A 1K89A 2AD5A 3DMGA 2C8VA 3TSCA 5BSWA 2AMJA 2B35A 3WLOA 3W4IA 1QAQA 1V26A 2GZRA 1I13A 3CKKA 4FDVA 4WIAA 3ZDBA 1K0UA 1UPAA 3LRPA 4IAOA 4R8RA 4A92A 2PMKA 2H5EA 3SKXA 1M6EX 3ZY6A 2B0CA 3EXFB 3TJRA 4WESB 1YI1A 3PNQA 3GVXA 1KOJA 2FA9A 3PNMA 4KXYA 3SR0A 3GVIA 4YMWA 4ALIA 3QXCA 4K9RA 1CW2B 1LVGA 1W4CA 1W47A 2E9SA 3OBIA 2YDYA 3AERA 5A62A 3BOSA 2N1MA 2GEUA 1S3IA 2XE7A 1LX7A 2VPTA 2EFJA 1M2VA 3G1UA 1SVMA 4KE9A 5CGZA 5DN6A 3FUVA 4D8XA 4LOIA 2JIMA 1R0KA 1LLQA 3OT4A 3LHSA 3E3AA 1NG1A 5JBQA 2RB4A 3G2JA 4HDCA 2EG9A 4HQRA 4JGGA 3E4CA 4DM4A 1N0VC 4ZJZA 3N0TA 2HIGA 1G5QA 1UOEA 3GDWA 2FVYA 3L7AA 1PV1A 3PXEA 5EZYB 1IHXA 4JUCA 4H7KA 2AHOA 5F3RA 4ER5A 4M99A 1B26A 5JSZA 3JQ8B 1G3UA 3QELB 1M2OA 3UJ9A 1QRRA 3SCZA 1N34B 1PFVA 4EY4A 4BDSA 1RWWA 1XZQA 4PTLA 3PT9A 4ZMRA 4DLUA 4ZRMA 3CG0A 2AEMA 2FWBA 1CFZA 2W6NA 4RD1A 3CPSA 5TMBA 1RWXA 4EI7A 3BAZA 2VDWB 1RPTA 4K6HA 2GVZC 2X0IA 1DJQA 2IEAA 3W5AA 1MDFA 1S3GA 2IGBA 2QMOA 2VAPA 1XF1A 2PS0A 3EZ7A 1KK0A 3WX0A 4FCCA 1RFLA 2BM0A 1O08A 1TQ2A 1TD1A 1XG5A 1SU7A 2AEEA 3FCUB 4NJMA 3T9DA 2C5GA 1J49A 2YYYA 5IT5A 1EDZA 3ZBQA 3DEAA 4D0RA 2K6GA 2LKDA 3LBIA 5I51A 1E79D 4CCAA 1GL6A 1U3UA 2IDJA 3R2JA 1WF6A 1XCMA 1KZ7B 1WX1A 3FSEA 4XGIA 2GF2A 2H1LA 3M7IA 3NUQA 1QFXA 4CIYA 2PVCA 2ZJ3A 3KALA 3TB4A 3BGSA 5AVUA 1TVKA 2A59A 3M3PA 3ZZUA 1UF9A 4ZI7F 1N3IA 3V3TA 2HW8A 1IUPA 2WFLA 4JITA 1E4VA 5KHAA 4ARBA 4D9MA 1KOFA 3WWDA 2Z58A 9ATCA 2EP8A 3JD1A 1DJOA 1CRLA 1AB6A 1ZGAA 4ZVTA 4L8GA 5LVAA 3HWSA 1TMOA 4HVAA 1RJWA 3E18A 1IEXA 3MMZA 4UW9A 1E1CB 4DLPA 5JTTA 1WETA 4MVWA 3H2ZA 1CUIA 3OETA 1RZVA 4Z4FA 4FM9A 3N0XA 3LLMA 4PS0A 4JYZA 3EXIA 5AIBA 1Z4PX 5JXJA 4ISBA 1XVUA 3DQZA 1Y4UA 2BMDA 2QIPA 4YV7A 3DONA 4UTPA 5JH7B 2ZJ6A 5L6MB 3AHEA 4IX9A 1E8NA 3OIDA 2WDPA 3Q10A 3QJGA 4BN5A 3VMMA 4BFSA 2LPMA 3B1WA 4JZYA 2FFQA 4QFCA 1RZUA 4R31A 3LKDA 2ZYHA 1V6AA 3ZDFA 1GPYA 2VEOA 5EP1A 4YPVA 2HEGA 2X0KA 1PQPA 1RFGE 3BIJA 4N0EA 3ZE1B 3RAEC 1VIYA 3RF7A 2GTPA 2JFVA 4WN9A 3HQ4O 3L7YA 3SLRA 2EX1A 4WLNA 3H1GA 1SK8A 1C9DB 2ZYTX 2HK6A 3GFQA 4MUBA 2PJUA 5B58T 5BSUA 1KTVA 2ZRPA 3CEMA 4BGIA 1DAPA 5HGXA 3T38A 3TJMA 4CI9A 1QG6A 4GX2A 1FU8A 1UMCA 3IO5A 2C2BA 3KNZA 4Q9HA 3KVOA 1M1ZA 1Z2CA 5DASA 5JALA 1CY6A 3I0NA 3FE2A 1FPQA 2WF7A 1WB9A 1A9RA 3Q3EA 4MYTA 5HQTA 3W5HA 2XVZA 2P78A 3R3HA 3FNIA 4DLLA 1WRBA 1CLEA 3Q9SA 5LR6A 1FZQA 1JHOA 3AUYA 2PBFA 2OXFA 3AUKA 3H1BA 3I72A 3R0XA 3U40A 4DM3A 5KTNA 1L6IA 1OFVA 3T34A 4MAAA 2Q45A 2ZI9A 2FEXA 3MPUA 3WZ2A 2Z04A 3RS2A 5LJLA 2XCTB 1IHDA 3TM4A 1Y37A 1KYWA 3IAHA 3PUVA 1WW2A 1ZR2A 2WR8A 5FBKA 1QGUB 2OHJA 1FYXA 4Q05A 4YIHA 4BFTA 8MHTA 5BV2P 3D8NA 1SHZA 2H51A 3GPDG 2O5EA 5JADA 4MVXA 1PDVA 1N3LA 5JH7F 2NTVA 2RHGB 5DSXA 5GV8A 5JNRA 1P44A 1SEVA 1BD3A 2FXVA 2GO1A 3CBGA 1GKLA 4J0GA 5BNIA 3DCJA 4XEHA 1L1QA 5DX1A 2A9VA 1Y6FA 3D2LA 2C1EA 2YZNA 4MDHA 1DUSA 4FWBA 2V7WA 3I5AA 4KRFA 4TV8F 3PXGA 1MH9A 4M22A 2QENA 2V6BA 4MZDA 4EF5A 3IR7A 4XWKA 1P6QA 2IOHA 3VNBA 2RGDA 4JP1A 3D81A 3FDJA 2AKAB 4C7OB 1KK1A 4PF1A 2OZLB 3ZEAA 2HSEA 4I9HA 1GL9B 3MHPA 1J97A 2OR3A 4KQ1A 4E3WA 2VOEA 3FLMA 1YRLA 2ZRFA 4YJDA 2RH5A 5FIUA 1E1RA 5KI6A 3ZC3A 1T0HB 2NZVG 3DWEX 4K6GA 1XNQB 2PGXA 1K1EA 4QFDA 7ABPA 4R2KA 1YS9A 1E60A 1MENA 1RHMA 3UENA 4GKBA 4X6LA 4DSZA 2QN8A 1T4BA 3L7IA 1I1HA 3SSNA 1UAGA 2UDPA 1AKQA 3R7DA 4TZTA 2VP2A 2YWFA 1JA1A 2HHJA 5EYPA 1KJYA 3NOQA 2A30A 4JLBA 1USKA 5ALFA 4D79A 1NP7A 1LF0A 2VWQA 4MQ4A 1C30B 1KMMA 3IAEA 4MVJA 3LBNA 4MKZA 4NQRA 1T6YA 5TC4A 5CFOA 4DR6B 5KQGA 2WV7A 4WUTA 2CSUA 1WXHA 1E6WA 1AKYA 1YJXA 4L57A 1XQWA 3GFRA 5BSKA 1E6EA 1VJRA 4GGPA 1ZJJA 2XUOA 3EOBI 4M9SA 1K2WA 4A9AA 1PTJC 3Q4GA 4YLEA 3PT5A 4REQB 3WK5A 4NEHB 1XK6A 1J20A 2D1YA 5IAJA 5J2UA 2REQA 1G5PA 4PBTA 4GO1A 3LH5A 3OFKA 1OILA 2VYFA 1E89A 5DYIA 2ZSBA 5DVZA 3F9RA 3JQBA 1VYTA 4H0NA 3LT0A 4KQMA 4P35A 5K1ZA 3U62A 1C9JA 1U28A 2ZWIA 1XTQA 4IIXA 1FUIA 1Y3IA 2WTBA 1EVYA 3DC2A 4RFLA 3VX3A 4YRAA 1SC9A 1VHJA 2C8LA 1RSZA 2A5FA 2GN6A 3GC6A 2BH2A 3BIOA 1MAAA 2Z1MA 1GAEO 1LSOA 2J7KA 5LP6F 2RE8A 1KI6B 5HSGA 1LQUA 2DLCX 4O4LF 1DQRA 1MX9A 2AB0A 1GGHA 4P3OA 2Q41A 4NBVA 4AP5A 4WZBA 2EJUA 4DWOA 1BN6A 3IBGA 4I2NA 4ZJPA 2PUEA 1V5EA 3G1TA 3JAMA 4G1EB 4Y2XA 5DT2A 5HRCA 4KR7A 1CZRA 2F4VB 3G0CA 1F2DA 4GQAA 2X6TA 1ACJA 1LLDA 3PHHA 2V3WA 3D9QX 3I1IA 4LDAA 4H0CA 1JEQB 1GVNB 2N0SA 4LJ9A 4TLCA 2Q6TA 3I5UA 5CB4F 1N5MA 2HDWA 4YDQA 1GDHA 2IFTA 3G7NA 5FQOA 4Z2YA 3RVQA 1YE3A 1I0IA 5T6BA 2RHTA 1RMTA 1XYYA 2QN3A 3L4EA 5K9ZA 4JUIA 1NM5A 4LRUA 1C81A 3AF1A 1WBDA 2QYHA 5KU1A 1YVDA 2XV1A 3ELYA 3L04A 4YJ3A 4D96A 4PNPA 3FHLA 2J48A 4Z9YA 3SM3A 4ALNA 3SQXA 1IWOA 4DR2B 2NSJA 2VQSA 3CEAA 3WIVA 4LC9A 3M6VA 4FKZA 1NUSA 4DLVA 1Q0ZA 1Z56C 3TL3A 3SZUA 3D1VA 1CDEA 3IKTA 3B60A 3ZY5A 1YV9A 3B85A 3L01A 3DE0X 4EH1A 4YLGA 4F97A 4ZEXA 5GTDA 2XYVA 3U19A 4KG7A 5F9MA 1F6WA 4ZT6A 3I73A 5BR8B 2AWNA 4J7AA 2HPVA 4QJ4A 3HG7A 5H8WA 1ISRA 2D0IA 4GM4A 4EZBA 5I7WA 1CNFA 5A02A 4YXFA 3LUKA 1C4WA 5E1MA 2F17A 1LI4A 1PWEA 3IVRA 4FMBB 4OBEA 1QYIA 3OFSA 1JEDA 2W6PA 8ADHA 1NIPA 3PR1A 1G5TA 2QN1A 1DKOA 4Y1RA 4YI3A 2WZQA 4BS9A 4L5IA 1V71A 3C6BA 1SRQA 3HYRA 4QNMA 1FMJA 2MINB 4BCCA 2EARA 1UUFA 3BCRA 3EF1A 1LY1A 2NZXA 1V5WA 1XHFA 3VTAA 1ZMOA 4MV5A 1OR8A 2O5VA 1CR0A 1WVIA 2FJPA 2G40A 3Q72A 2CDAA 3T3EA 3UHPA 2H5LA 4DUGD 1QB7A 2GXAA 5K0SA 2JANA 3EXFA 3IAXA 1NUTA 5BR4A 1XCPA 1A7KA 2Q8QA 2XTMA 4WESA 4JLSA 4LYHA 1M54A 5HA5A 1V3TA 1H6BA 5GJCA 1P1HA 3E8XA 4JUDX 1NQ5A 1GPUA 2UZIR 3GT4A 4HXEB 4ND8B 1Z17A 4AROA 1KFEB 2A1UB 3AH8A 4MVJP 2WHRA 5DBFA 1RBZA 1B2LA 1YZQA 3MT8A 2QX4A 1E9CA 3E27A 1Y9DA 2AXQA 3HSSA 1GRQA 5EZQA 5AM0A 5ITSA 2F9FA 2PNFA 4NZPA 1P75A 4Q7MB 3W6NA 2P3SA 3QVVA 1XVIA 4A6XA 3WGUA 3DF9A 5B1YA 3AESB 3NHFA 1SPBS 4I9FA 3JQ9A 1NJFA 3HP1A 4JWKA 5HM6A 3FTFA 5EZYA 4KYIB 2WIJA 4MVYA 3UWDA 1RC8A 2DERA 3PKJA 4D02A 1GUDA 1IRIA 1CF9A 1O94A 2K5UA 1UPCA 2XWQA 3JQ8A 1KBOA 1LV8A 3QELA 2YC2C 3DDNA 4HRYA 3TF5A 2AYZA 2HWUA 4PS1A 1N5OX 3BJRA 5DBEX 2O8VA 2IS6A 1I4OA 2OFXA 4QUEA 4GX5A 1IVSA 1EFLA 1MTZA 3EXHB 5F23A 5FOWA 3G82C 1PZGA 4JOBA 1TFUA 1DC5A 3FG9A 3VAAA 1ZO8A 2D62A 2FZ4A 4WBNA 2VDWA 1P5RA 3M3HA 1Q7RA 1VCMA 3NEJA 3CX7A 4BYGA 2F1RA 5DHAA 4DIUA 3ON5A 2CWDA 5EP2A 1RS0A 4FT2A 1Y5IA 3ZNNA 3LQRA 1W1IA 3OQNA 3DT6A 3EA0A 3FVQA 2DBYA 4JLWA 3OIUA 4I1UA 2F3TA 3THYA 2DU8A 4HUTA 3G2IA 3T5AA 1O9HA 2XA9A 4DLBA 2AZMA 2VWHA 4ZT2A 1YQXA 4GH5A 2M2IA 3VOSA 3FRHA 3BEDA 4KXLA 1A9SA 3VR5H 2CNKA 3R7AA 1J5EB 1T5IA 3IT0A 4MB0A 4WBXC 1IBRA 2NUBA 2FFHA 2OBYA 5KYUB 1MAWA 5KJ1A 4Q48A 1YE5A 3GH1A 3N0WA 1MFZA 1H2RS 1I7DA 2EJCA 4YCBA 4HRVA 1RAHA 1U0EA 3IAUA 3D3NA 4PGGA 3MGAA 1E7WA 4LJSA 3L1UA 1CNMA 1GAJA 1I10A 2ZYGA 1NDHA 1B76A 4DG5A 5KQLA 3A7DA 2XB9A 5IX8A 1M2HA 3UC5A 1P2SA 2IEYA 2L82A 4OL0A 5ABPA 4FKMA 1P33A 2ACWA 3TTXA 3P9YA 4J7CA 5DBHX 1GTZA 2RGYA 3DE4X 3RR2A 5CYGA 2I54A 3GELA 5AVXA 1E96A 3AFOA 2X22A 4JA0A 1V2GA 2G1PA 2H4WA 1B93A 1V7CA 2WVJA 4HN9A 4HNAB 2NNWB 4ECAA 5LDGA 5A7FA 1FS5A 4GF5A 5TX7A 4IDDA 3R9WA 2H31A 4DBVO 1RXVA 5F21A 4CM5A 4RJTA 4HDRA 1EI9A 3H84A 3DDWA 1E3EA 1FQOA 2BGMA 2CVZA 1M7BA 2ODBA 2GN0A 2SECE 1SUBA 4TSKA 2ZUTA 4CQMB 4K9PA 4AKGA 4Y9TA 2IPOA 1NC1A 3A05A 3R0ZA 2VF7A 3RM3A 3QLUA 2VQ6A 3CRMA 3F6SA 4XUDA 5ALYA 3WMEA 2E55A 2JFGA 2UUOA 1OX4B 3RLIA 4BPRA 4NZYA 3KIPA 1P60A 2YY6A 3OESA 4GL4A 3VI4B 1KFCB 1QV7A 1T3ZA 5TB5A 5M7EA 1S5PA 3V48A 3U4MA 1NBHA 5EY5B 3RTBA 1X86B 4RSMA 4YRRA 2FEAA 1FYVA 3CRRA 3N2IA 4XLZA 4QDTA 1T9DA 2VDMB 2W8ZA 1CEEA 2IYZA 1OX6A 3RU7A 3ZCVA 1IH8A 5KYYA 3WFIA 2W6ID 2W0SA 3C8MA 5A9SA 4FGZA 3W2FA 4E94A 5KOJB 2AG8A 3MT0A 5GM1A 2FAXA 2ZP1A 3TINA 1QGUA 7ADHA 1O1YA 1N1DA 5EWMA 3ID6C 3RJZA 4YMGA 4NXMB 4BKOA 2OLJA 5IRCD 4EW6A 3F73A 3WLHA 1XR3A 4Q37A 4TSFD 2NMVA 3H4TA 3DT8A 3JYNA 3KBBA 5J4YA 5JVDA 1RZRA 1MIOB 2I2AA 2JGDA 4P33A 1NNI1 4FDUA 5C7YA 2IZOA 1RBYA 4K0RA 3GF4A 3DXXA 4KMSA 4B7AA 3FKQA 4B45A 1MJGM 4XSGA 2O8BB 1PS8A 3WQSB 4CLDA 1WPRA 2ZPAA 1U8AA 3E0QA 4D0LB 3UXYA 3EIWA 1FTYA 1RC1A 1JU3A 5AUQA 1FQWA 4XOUA 3QUSA 1BAPA 1FDOA 3ZVKA 2ORIA 1YR8A 4KN9S 2AZ4A 4RK5A 1CJCA 4KIGA 3GLIE 3LSTA 4CLRA 2E4UA 4EMBA 4B6FA 2OMKA 1NSYA 2B1JA 3CNBA 4KSYA 4AJPA 2O59A 1O54A 1NX6A 1U8CB 3RVSA 2I29A 2I66A 3CTPA 4R8MA 2R1TB 3F97A 3ZCRA 1NASA 2GK4A 3PHIA 5ALZA 3A70A 3C97A 2OGTA 3R41A 1OLXB 1YZTA 3DWFA 3TGPA 3NG1A 5M2QA 1VI6A 1YRAA 2GD0A 2XYQA 1F2UB 1M6VB 1NLFA 1OPXA 3DOEA 3V3KA 1GSOA 3D4LA 1DEOA 3L6RA 5KWSA 5J5AA 3L92A 4O1IA 4IOJA 4UDYX 4C4TA 4GWLA 1QF6A 3NTXA 3UV6A 4RK0A 3WK9A 3HM9A 1SCIA 2ZIGA 3D7LA 1T6XA 3B12A 4F4FA 3OZAA 1JDVA 1PJ4A 1P9WA 2CMGA 1S8FA 2HF9A 1FUEA 1YB1A 4OCZA 4R1NA 4X8HA 1L5SA 5B37A 5ECWA 4YMHA 1JJAA 2PCJA 5ICEA 3U4QA 3ZQ4A 1Z0ZA 3IFSA 2PZKA 3DFFA 3HVJA 2ISQA 4UJ5A 4DIEA 4EPVA 3GEPA 2WJ6A 2J4FA 1C0LA 4EENA 2HQBA 2JB9A 3PFKA 4B79A 1T24A 3OTWA 4FBMA 1GRCA 1MQ8B 2JGJA 3GCGA 1GKYA 3O2SB 1T35A 1WMAA 3SLGA 4YV0A 4IG9A 2WMYA 3RHTA 1L7PA 1IN1A 2PL5A 4NY1A 5A5VA 1KI6A 3T7TA 4GWGA 5L3ZA 1ZH8A 2PQMA 1TZMA 3K7EA 4WKCA 3UCEA 3ZN2A 3OC6A 4B75A 4WKNA 1V4BA 3F3YA 3MAGA 4PLFA 1HQDA 3DUFB 2E1RA 1UBUS 4ZZ1A 2Y2VA 5KQMA 4G4GA 4J07A 1GFWA 3E0XA 3H9UA 3H2YA 4B47A 3GQBB 1G20A 2V6JA 2O2EA 4OBXA 3TBFA 3GLFE 1R0XA 1UBJS 4RMGA 4YJFB 2H0RA 2ATVA 1JEQA 2OB2A 2XA2A 3PLRA 4JJ8A 2G17A 3FIUA 3OQ6A 3WRVA 3UB3A 5KTYA 1E1QD 3OP1A 4HPXB 5DYGA 5G53C 3S81A 1O97C 4DLWA 3JWIA 1Z28A 3HJBA 3K05A 5IVPA 1KZ4A 4KO1S 4F3YA 4QBIA 2DECA 4Y7DA 1PNTA 2GKOA 3CT4A 3IR6A 3TQTA 1E61A 4UUAA 3I3OA 2IH5A 4OMUA 2J3QA 2WVGA 1QWOA 1NXPA 4JLVA 4ZCQA 3DF7A 2CLFB 3DBHA 4B4OA 3HCDA 3W8EA 4C22A 4YT5A 3SG0A 4EAQA 3PUYA 5FPQA 4MGEA 2EFGA 4P34A 3AILA 5FL3A 2WWTA 3IUBA 1N1MA 3PA6A 3ANXA 2IHBA 2FZ5A 2YIDA 3JWGA 3RKSA 4BBJA 2JD0A 4K3UA 3TLMA 4PFSA 4R8SA 4UBNA 3BHNA 2GCOB 4PLWA 1EVZA 5ARCA 1LRLA 5L3SB 1T3SA 4ILEA 3AR2A 1XRQA 3P5BA 4HNTA 4RYLA 4H7JA 2ESRA 3WICA 4LDPA 1GPAA 3E9DA 3LGAA 4HGQA 4KNYA 2H2IA 3NAQA 1C2TA 1WXEA 4GR4A 3W4KA 4QVIA 2XH8A 3DOOA 3I2IA 1UODA 1SOMA 4ZT3A 3WNBA 2VT7A 1RHUA 3CRVA 4KDEA 2F90A 1KZ9A 2IK8A 4MEBA 4KGVA 3KJFA 4R3UC 2GESA 1CUSA 3K0BA 2P5SA 2ZTUA 1MJGA 4GVPA 1KE1A 5BVHB 1TAHA 4XYBA 1J2JA 1ZESA 2CY0A 2VHJA 2ZIVB 3OQMA 4LK2A 4UAJA 1GTSA 1I4DD 1JEOA 3WYEA 4M49A 1JAXA 4L7QA 3A1CA 3LLCA 4XTRA 3ZDRA 1C8KA 3JQBC 4CV3A 2A1UA 2CK3A 2WYUA 3AV0B 4RF3A 8ABPA 1U28C 3B1FA 3WDKA 1Z0KA 3F4BA 1JVSA 2OEPA 4ZCLA 2QTTA 3FSGA 1I4LD 3VKHA 2NZJA 4P3XA 2P6OA 4DGSA 1WE2A 1PK8A 2R1VB 3HCEA 3K8QA 2CV2A 3F5FA 4FR5A 1NURA 2AMVA 4R54A 3AESA 4DIBA 1COZA 4HN4B 4CIWA 2RGNA 3USCS 1XAHA 4CCSA 2X5JO 2I2FA 3KB8A 5L8VA 4WFQA 3OSUA 4UC0A 4ZRNA 4ASUD 4DWWA 4D8WA 3QMWA 1RWMA 1SQ6A 3NP7A 1PW7A 3QPCA 3EJ6A 3JTEA 2FPIA 3HI6A 4GMGA 4N5DA 3BH6A 1Y7TA 3TSWA 5EQTA 2QL5A 3VNUA 1PR0A 3FTPA 3PPXA 5FBQB 2LP4Y 3ROQA 3EXHA 3JZAA 1P18A 1TL7C 3IHTA 4RJJA 4FFNA 4WY2A 5ESRA 3V1LA 1NG9A 4LF9B 3H18A 4FI3F 1BSVA 1Q7CA 1YK1A 4KQJA 1CDDA 4KQ2A 1SU4A 4TYMA 5FR1A 3R7FA 4Z3DA 3ZV6A 2EX0A 4C4RA 4KR0A 5EJ9A 2GEBA 4RM2A 4NYIQ 1J21A 2FLKA 1NM5C 2QU7A 1FFXB 3F74A 1H5UA 4TWZA 2DJIA 3CW8X 4YK7A 1G3RA 5EHIA 3ZDZB 1L3BA 1D6MA 2R8XA 2GARA 1R6VA 4KIWA 1A9TA 4GXTA 4LJ6A 4KKXB 3W6OA 4C4YA 4NDAA 1FNNA 4DZZA 4O5AA 2ID7A 2QQFA 1ZNYA 4KYUA 2G9NA 3ZE7A 3S28A 2VSQA 3P1JA 4HDSA 4B0OA 2IXFA 2CHGA 3D8RA 4KRXA 5ED0A 5KYXB 1DS6A 1BW9B 2XEDA 2YQ5A 3FMGA 3OKCA 2WJZB 3BRSA 5KYUA 4GKKB 1SBTA 3MMXA 2IYVA 3P0HA 4BNWA 3GFVA 4V1CB 2RHOA 3KX2A 4WA8A 2B94A 1IN5A 3GPIA 2YBDA 5EQJB 4CQNA 3KCQA 3TR0A 1C1XB 1XCLA 1KP3A 2W2KB 3GARA 4FW8A 3ZBPA 3UPTA 4IDEA 3GUUA 2H06A 2EX4A 3NU1A 3T35A 3V6MA 2FSPA 4XR4A 3SZMA 1HRKA 4XGNA 4LG1A 4IHJF 3SHVA 3P9CA 4WLEA 5A03A 2C1ZA 1I2ZA 3HFJA 3JWPA 1BWQA 3IQDB 4TTJA 1ITZA 2J87A 3ZE0B 4NIMA 3G2MA 1R18A 1KKLA 1OXBB 4C5BA 3RAPR 4YJ2B 4MYDA 2XNDD 3N70A 2YFYA 2FMTA 2FSIA 4QYWA 1ESDA 2EKDA 3EDOA 4XCQA 2DY0A 1SUFA 2XTAA 1N0HA 4GOND 4L5CA 5IMSA 1P9OA 1WHTB 2GAFA 1NONA 3OE4A 2QI9F 3EVDA 3GVCA 4IYJA 4BZPA 2V7QD 1VQ1A 5K4HA 4HNAA 1K4YA 1VPTA 2IUFA 4ABTA 1MJNA 2VPWA 1LXCA 1E2HA 4H6PA 4OEHA 5REQA 1PR6A 4CMKA 1AM4D 4KQGA 1Z5NA 4UHJA 2NUTA 3FMFA 4LVNA 1E6LA 2X9LA 1II9A 3UCFA 1CY2A 2WHPA 3IESA 4TVSA 2QJWA 3L8ZA 3JQ9C 1SY7A 1A8SA 3G3EA 4DY4A 4F4HA 3T5DA 4YMIA 3M6LA 4KWCA 1J1UA 3U1BA 2W4QA 4XDZA 1YFKA 1J0AA 4FE3A 1X7WB 1NYQA 1O94C 2OV2A 3IXMA 4L5YA 1OX4A 3NALA 1QBGA 4PNHA 3G79A 3ANYB 1C1DA 2KM1A 3F78A 4ZAFA 1Q11A 2AG0A 3RJ9A 4OATA 1JFSA 5IABA 1IRXA 1K75A 2H1SA 4QDZA 3TR5A 4E03A 2PSFA 3WL7A 3R4CA 5CT8A 1Q0PA 3BJZA 2ZIXA 2BTEA 2HA6A 3NNDA 1GRNA 4NK5A 3UB2A 5JXGA 4PZ0A 1Y6JA 1Z8HA 2FDRA 3GLRA 3WDLA 1JDBC 3EUWA 1BJKA 2G88A 3O3OB 4M0FA 5I8PA 5KOJA 4BPBA 1AN9A 4BWYA 3DXYA 3PJGA 2P5YA 4FFBB 2P30A 1MT3A 2AXEA 2NG1A 2PXAA 1EJ6A 2ZZKA 3PQFA 2FMHA 4L85A 2EVWX 5K8UA 1PT5A 5G1NA 1XK7A 1YZGA 2GJ8A 4DCOA 4KDFA 1RKUA 4CU2A 4RADA 5C7LO 1NW4A 4X41A 3GN1A 3U7RA 2VHVA 3EAFA 2IUYA 2A0XA 3C43A 3OMWA 2IKQA 5F7OA 3ZJUA 1NI3A 5CFQA 4IEFB 3V1TC 2I4IA 1L4KA 3DYVA 4IJKA 1IM8A 2JFPA 2NADA 3DMRA 3D8BA 5DHUA 2PMCA 1NR5A 1K3TA 2VJMA 1V2HE 2WD7B 1MW9X 2WFZA 3OE5A 2DUWA 3QLJA 3GLTA 4HY3A 3AEUB 3QE2A 4P54A 4C7KA 2I4LA 4UHCA 3OJXA 2WJPA 4FSHA 3DPSA 2DBQA 4XKJA 4L95C 2C2XA 1G8AA 3TR6A 2C57A 1H6AA 4GMKA 2B4YA 2NVOA 1RYFA 2ZDHA 2NP7A 2N9UA 2UZ4A 4LDZA 4MPDA 3GLVA 1NW9B 3FPAA 4N7BA 1X1SA 5B1SA 1F8UA 3FDZB 1RQNA 1YFLA 3LA8A 4MLCA 5DW3A 5EVCA 3E84A 1PNQA 2OWDA 4JQSA 5KNCH 1PV2A 2CFCA 4FYYA 1F2UA 1KH3A 1O77A 1M6VA 2G09A 4MV7A 5BQ5A 1GGKA 2JEYA 4HWKA 4AYTA 1XZNA 4NVRA 3ZJTA 4KOEC 3HTXA 1Y6RA 3Q98A 5PGMA 3THXB 2CLEB 1B3RA 1I2AA 2H63A 3KD2A 1YDMA 3L4SO 3ULKA 5COBA 1PJTA 1V39A 1TAQA 3PJDA 1YRQA 3R5FA 3ZLJA 1MC8A 7AT1A 3DTVD 4AYWA 4ARIA 4XPIB 2CNNA 3FHTA 3CJTA 2GEFA 3JQPA 4KX3A 5JCJD 1SUWA 1HE5A 1FDVA 3QLUC 3HCFA 3HA5A 1N5LA 1XELA 4FNMA 2HIHA 2KHZA 2ZSEA 3N8DA 1AJEA 3U4AA 3GBSA 3RPEA 4TRMA 3DO8A 1VLLA 1R6AA 1TQDA 1BMQA 2CUZA 1UDRA 4LMPA 1TMGE 3I9V1 5LLDA 3ZHVA 4RLQA 1EUZA 5DB4A 2IL1A 4BX9A 2EKLA 2OBFA 1R1DA 1SZCA 1PFUA 3W06A 1V16B 3PD7A 4Q3AA 4BFYA 1NF8A 4ZOEA 4UM9B 2QXUA 3H8SA 2OESA 1AUVA 3O8QB 3DUFA 3M33A 4OFXA 4P2GA 3UMRA 3JD2A 4G1UC 3ZTYA 4D99A 3TOZA 3QU2A 3T1VA 4JT8A 4G84A 3THSA 3QKTA 3AEZA 1MZVA 2P2YA 3GQBA 5JNSA 3K2IA 2ZROA 3JZFA 4B4DA 1Z2OX 4YJFA 4L8LA 5G2OA 4CTJA 3NDRA 2QY6A 1DJPA 5FUWA 2HZ7A 1CIPA 3W0LB 1DQNA 1R15A 5GZ1A 5F9FA 1TUEA 1IUOA 2NZ8A 3PICA 2ZJAA 4YUWA 1R4MB 2J7PD 3WGLA 1SURA 1GZUA 2JKVA 2VHXA 4G24A 4MQ5A 2PN1A 3HRIA 5K45A 3A6FA 4LJ5A 3OCVA 1MHTA 3CX3A 1JDSA 5THXA 2P9JA 4MR9B 5DV9A 1RPNA 2PANA 5DM4A 1FSZA 2EDAA 3E3OA 3KOOA 5THQA 2P3LA 2ZVDA 4Y6SA 4EUHA 1W1UA 3GAAA 1RYDA 4KMRA 4ZU6X 1KQNA 1LSJA 1YCHA 5TQ0B 2QLMA 4ZI3A 3O2JA 1YC2A 2C20A 2P9ZA 4OTZA 3E1SA 5H1YA 3RSLA 1LDGA 5I4IA 4R98A 1EHIA 4D8VA 2F3RA 2YWEA 5L3SA 4O08A 1QMGA 3H11B 421PA 2J0SA 5LYJB 1J8YF 3HE3A 3VR6H 5KJCA 4DR1B 4LE1A 3T5TA 2Q2OA 4YDSA 5AW7A 1ISHA 3NHKA 1HNXB 1Z18A 1D0VA 2XMSA 1Z0DA 2D59A 1G9SA 2LTAA 1X9GA 3FYHA 3HB9A 5LZ5A 3SNKA 2DCUA 3UV7A 5IWCA 3DL2A 2ZWPA 4ENRA 1BDMA 2JIBA 1JTEA 1LKZA 3EVCA 4HQLA 3ZU4A 5FP0A 1DBSA 4Y0VA 1ONSA 1SG9A 1AVTA 5BVHA 1BU5A 4OUDB 3PDIA 1NXTA 1JIKA 1PR4A 3FBWA 4MO2A 3DBIA 5HOEA 4A6DA 1VMEA 4LV6A 2REXB 1G98A 1QGOA 4XJXA 4TL9A 2JATA 4L8FA 3TMKA 2PO7A 4FZRA 2I7DA 1TYBE 2Q2VA 2ZQYA 3D6NB 3HU1A 2WD9A 3EFHA 4R69A 4WZBE 2XT9A 5K03A 3S6JA 1A88A 3LLVA 2UYGA 4JK3A 4OHWA 4YP5A 3Q1KA 5IKOA 4MKIA 1T9AA 2UUBB 1LH0A 5KTSA 3A25A 1K06A 3IVMA 4HEA6 4AZSA 5JDIA 3W8DA 1OYWA 2XNCA 2B37A 2ZBUA 1O9BA 3F98A 3DDHA 5CLHA 2OXRA 4M0LA 2MTBA 4Z0PA 2OMEA 2QVYX 4E30A 2XVYA 3PWTA 4ZDIA 1NP3A 4ND6A 4ZI2A 3ER8A 1A5BB 1SHKA 4E4RA 1XDUA 4OBBA 1JWAB 4DV7B 2YL2A 1YR9A 2PMEA 3IUNA 3LRXA 4DV5B 2H54A 1KU6A 1MT0A 3IHLA 1UQRA 3QLTA 5B1IA 3LVBA 1BH6A 2B1IA 5AHWA 4LGYA 3ABRB 2Q5QA 3LOPA 521PA 1H65A 3QIAA 2V3VA 2O0MA 4LHVA 3V4FA 2IEZA 4MI6A 4OYLA 3QG5A 4MHOA 1QHYA 4BCDA 4DANA 4E11A 1T8YA 2PRSA 5LKRA 1GA1A 3WWYA 1L7MA 2BT4A 2BKXA 4QU9A 1F5NA 1HLDA 2O05A 5EIBC 1UT6A 4US0R 4IKOA 5AWFC 5JS7A 1P4HA 3O4FA 3T0FA 1I0LA 1BE0A 4FGUA 3C3WA 4FHEA 2JJ1D 4RJKA 1BW9A 3AG6A 1XALA 1VKJA 1EVJA 3E5MA 1XA3A 3K32A 3NX4A 3ZHBA 4L4RA 4L72A 5J2TF 2RGBA 6YASA 1XMQB 4KNWA 3RVMA 5HZKA 4V1CA 1PFKA 3TSZA 4CT0A 2PYIA 4Z2AA 1C1XA 4TS3A 4DILA 4Y1GA 3WLQA 2W2KA 3JVVA 4XJVA 2ZE6A 3AF4A 4FD2A 4I55B 3QUAA 1F4PA 3A6GA 4MARA 1K86A 3EWNA 2UXBB 5K2OA 1K8ZB 2PQ2A 1ZZEA 4OX9B 4N7RA 2PSEA 4X3OA 1Y8AA 2FN3A 3FTNA 3QYAA 1TYCA 4F5YA 5K0FA 1JHAA 1W93A 4YEDA 2AJBA 2P4SA 4OMCA 621PA 1UKVY 2YV4A 1RI1A 1NTRA 2FUKA 2KBEA 4UVIA 4XCVA 3K30A 3WGKA 4BDTA 3UG6A 1VBNA 5CPFA 4UD2A 2ONYA 2WD8A 4J0CA 5TS2A 3U6KA 1RLJA 3REFA 1WHTA 1P7ZA 4IP0A 4X97A 3IXQA 5JAHA 3ZGZA 5F4ZA 4LBZA 1TU3A 2HLNA 2BMWA 2N3ZA 2NQTA 3ES9A 2YXBA 1CX9B 3PTZA 4MLPA 1OBCA 1MC1A 3S44A 5B7NA 4J75A 3NV9A 1RKQA 4XYEA 4QULA 3L1IA 1XD2A 4NCXA 4EUKA 4G0UA 2YXNA 1Y8QB 3SIRA 3DEHA 4CE6A 5A04A 2JLUA 1V7QA 2FWIA 3LT2A 2RGNC 4JOQA 1MVOA 1N7JA 4B7ZA 2OBMA 4CLRB 4I3FA 5B4TA 4PRLA 2MDTA 1GSAA 2CL0X 4PO8A 3X44A 1UQUA 2VA8A 1X7WA 4LECA 4MWDA 2H7YA 1T4GA 4TS1A 3HB0A 4F86A 1DBPA 2BFWA 3I2JA 4JELA 4TM7A 1VYUA 3WOVA 4DBZA 3AKYA 3OWXA 2AFVA 3TQCA 3T6KA 2G1AA 3CW9A 4RY0A 1EG7A 2Q5JA 4DV3B 4FJ2A 4HFMA 2NWQA 4JQOA 2JI7A 5D5HA 3EXHC 5EE0A 4H1VA 3JYOA 3JS5A 1DDGA 3QNMA 5KYTA 1P80A 1YVUA 3KQQA 3OZIA 1VZ3A 1HL7A 3P2JA 3ER6A 4FGJA 2VJCA 4I55F 3OIVA 4KGDA 1NHGA 1SVIA 3TDKA 1E4EB 3EVZA 3OQOA 5EZ5A 4AP9A 3D6AA 3FOAA 1K5PA 3U39A 4FFBA 3A9RA 1KSGA 3W5IA 1V5GA 3BSSA 3Q12A 1N5KA 4DWJA 3O83A 4BX0A 3D8HA 4I5IA 4DDTA 2ZTSA 3G85A 3DE7X 1I8TA 4Y6OA 4HQFA 4JMLA 3NVDA 4Y6RA 3WWPA 1RYHA 5H9WA 4C89A 1L8QA 2XUGA 5A06A 2EAUA 5A7GA 1TA9A 4D56A 3IDAA 4JIGA 1A82A 4MUKA 1X2EA 3D64A 3DZBA 1AGXA 3PU6A 1O57A 2CDRA 4OYRA 4HT3B 1O7JA 1FP1D 1XOIA 3HDTA 4LDNA 2BTOA 3D6FA 4RH0A 4XX0B 1HG0A 3C3EA 2HWKA 4P4SB 1MV8A 1TD9A 1VLQA 4P5PA 1T8TA 3KWFA 2OGUA 2RHHA 4FR2A 3FVWA 4FW9A 2ATIA 1RTKA 2V1XA 4GP6A 5ENVA 1JILA 3OPQA 1G64A 1Y3FE 4UFPA 4C1BA 3ELBA 2RI0A 1K3UB 2AZDA 3KSAC 2H9YA 2YZGA 4U2KA 1CR6A 2QP3A 3KZMA 4EUEA 2JBWA 1TT5A 2ENUA 1N2ZA 1SUSA 2AT1A 2GHQA 3IQFA 4CLXA 1VBFA 3N6RA 4ZZIA 4QBTA 1NW6A 3F2IA 1EBBA 4GMHA 4MUHA 4PG6A 2NVWA 1N8SA 3IX7A 4H6VA 4UHFA 1AGRA 4D0SA 5CA1F 2I4TA 1FK8A 1DI0A 3FPLA 5BQ3A 2GD1O 3KQLA 2DQZA 5MGNA 2XRMA 1MIHA 4E14A 3MUEA 4U6QA 2EFEB 2CE2X 3FFWA 5CXXA 1VGRA 4NATA 3M4ZA 3ZGXA 3THXA 5JFOA 1A5TA 1W0KA 1MFPA 1NVEA 1MKYA 3HN7A 1NWHA 1OLOA 4Q7JB 3AXTA 2YHSA 1RZ3A 4M0KA 3ZE9A 2Y0DA 1YIOA 3MSXA 4HGYA 3GJXC 4XARA 4BV3A 4NP6A 5HQ3B 3I1JA 3G23A 3KC2A 1ZYUA 2R1ZA 2QX9A 4BN4A 3KZXA 4KV7A 2EXXA 2ILTA 3DHNA 4NF2A 5COAA 2H1IA 3BD8A 1U1EA 1Z07A 4IG4A 4NBLA 1T34A 4WEQA 3HDVA 3SHOA 1DAMA 1JHQA 1Z16A 2BWJA 4R6XA 2IBSA 4DWVA 2ZSFA 3FJ1A 5E1DA 5EIAA 4B6EA 4LY9A 1IZ0A 2Z30A 2JH9A 2CJWA 1TEZA 4PEVA 5E3HA 1NZFA 5I6DA 4LKOA 1YS1X 3PE4A 4OHUA 1V16A 2HYIC 1MNAA 3NATA 5AH0A 3TWOA 2G67A 2I8AA 4WNAB 1N9KA 2IEGA 4GPEA 1SELA 2JK0A 3O8QA 3KLNA 2O1SA 3IE0A 3EPRA 3KWJA 3MGBA 4NAVA 4CGYA 2FEKA 1P91A 2GHIA 5HJEA 2WE7A 3TRFA 4HAOA 3SMQA 1Z7EA 5AKXA 4LSMA 4ONEA 4YRTA 4ZOLF 3U4IA 2IYYA 2POCA 4RTJA 1FFGA 3MS2A 4WINA 3EGEA 1LWOA 1JHZA 3QVKA 5AJXA 4JI6B 1R4MA 1QGZA 1S2OA 2AOWA 2I6TA 1Z12A 2D2IA 2P0EA 2ZR0A 3KWLA 3NVMB 1RCUA 3CZMA 4L0QA 1VL6A 2G0AA 2J3MA 2ONCA 4RK7A 5JAIA 5FF9A 2D2XA 2IY8A 4PANA 1NNUA 1QAOA 4RKQA 5TMDA 4HVCA 3V97A 3GNQA 1JS1X 2WLTA 3IAM1 3IQHX 4N01A 3S4YA 3D6UA 1PGQA 2WJJA 1Z7WA 1BDHA 1SO8A 3MUFA 4LV5B 2PG3A 1THZA 5E4FA 1WULS 5TQ0A 2ZIEA 3H2IA 1AKWA 1Q17A 5HF5A 3T9EA 5I9IA 4AECA 2GNOA 2X9QA 3B51X 1GYRA 3PFFA 4JL8A 4PWYA 1RXIA 4XVQA 5EKTA 5KSYA 2IHVA 2KE5A 2UYOA 4HQKA 4LDJA 4LZOA 4TKZA 1WHSB 2QL7A 3WLKX 2VPXA 3P5SA 1IYZA 1EZ4A 2J9RA 1I7NA 3H11A 2QGFA 3NBAA 2J9FA 1LI5A 2I80A 4L28A 5LYJA 1HKUA 5ANRB 1KQFA 1JVBA 1M2WA 3CS3A 5L9AA 1YK0A 2W4MA 3PSHA 4CM4B 4DV0B 4QDUA 4W5NA 2VDRB 4GOXA 2HSDA 3V8QA 2BJHA 3GJTA 1BFUA 2YJTD 4PZUA 3P9RA 3UV3A 4ZYYA 4N76A 2I3GA 1O2DA 1YI8A 3E35A 3P7MA 4E4YA 4PX2A 5AJUA 4X45A 2HMUA 3ZXXA 4COKA 3B1KA 3UK1A 1JJBA 1IE3A 4FFOA 3I39X 4OSEA 4OUDA 5FJIA 5IHPA 3C6KA 2DKNA 5IF3A 3VJRA 5JO9A 2RHLA 1XZLA 4URZR 5BMVF 1T2CA 1YZHA 2VJDA 4KMMA 1ST2A 3U37A 821PA 3WA7A 3DGEC 4KUGA 5JE8A 3PEWA 3TZKA 3MFYA 4MYCA 5KHOC 1X2BA 2PX0A 4IOKA 3DD5A 5JUWA 1Z4JA 1Q21A 5A0TA 4F91B 4KUHA 1RKVA 2XNKA 4PFQA 4AZWA 4ZAYA 1TECE 1SXJA 1IVYA 2L42A 1G20E 4IQ8A 2XNHA 5G1PA 4EHBA 2OZEA 3QFRA 4C78A 1ECJA 3R40A 1DAHA 1KEPA 4PGFA 4ALLA 4BRWA 2YFHA 1ZA2A 4D3XA 5IBCA 2OCKA 4KQCA 1WCIA 4M8NE 4ZQHA 3SD7A 1VMAA 3P19A 4HPJB 4O63O 5IJZA 1Z38A 5IMBA 4I1RA 5HNKA 5IC4A 1Z6ZA 2H57A 3K6RA 3IDZA 2PMDA 4GBGA 5EERA 1XRSB 1NQTA 1N7HA 4RHUA 2ZT6A 4H0FA 2E4VA 3GWZA 3O9MA 1Y7IA 1VPVA 2DHEA 2Q21A 1OWLA 3JALB 4ZJUA 4OAPA 4X7RA 1LW7A 3LV8A 1MU0A 5TGTA 4KI7A 2ZUDA 2X8JB 3SE0A 4MNTA 3B82A 5H81A 4XQEA 1QIIA 3O4RA 4Q16A 3CB2A 4L50A 4ME6A 3GEBA 3AEQA 2X1LA 2FY8A 5A9RA 2DHQA 4EG8A 2WAOA 1R4NA 1J24A 4MV1A 2UKDA 3BF8A 3M8KA 4MGYR 5AFSA 1XL0A 2O4CA 1NNSA 1UBNA 4OHZA 4NCHA 1TUIA 4CR8A 4QU8A 1LDNA 2X9NA 3ILHA 5IDVA 2WWYA 4W8OA 2OCAA 1R74A 5CNJA 3LKBA 3PXAA 3N7UA 5EJAA 4H3VA 3IOMA 3GDFA 4MRVA 1HYQA 5EHQA 1EEHA 3QIVA 1CV2A 1YIDA 2P8SA 4A8HA 5LQJA 1EWKA 3SY8A 1DIHA 1NV9A 4X3CA 2GJKA 1WZCA 4NV0A 1BE1A 3UJBA 3VVCA 4BFXA 2DUNA 3VNRA 5LOVA 1TM4E 3T1TA 5KREA 1AQYA 4RVFA 2XZLA 4DT1A 4U7FA 1P0MA 3M1AA 4CETA 4M87A 2PH1A 1EE2A 4G3XA 2J08A 2VJYA 3PQEA 2O6HA 4N8SA 1NRIA 1V25A 4UXJA 3PFIA 4MCJA 5JMWA 2PV0A 1ZI6A 3OF5A 2WF6A 3HB7A 1PZHA 1Q1ZA