1ZHBB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for CD8+ T cell-dependent recognition of non-homologous peptide ligands: implications for molecular mimicry in autoreactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zhbB00
3BPOC 4DOHE 1SY6H 3OF6A 4HWEL 4LBEB 1H0DA 1KTLB 1JV5A 2CUIA 1NJ9B 4Z7VF 1T7VA 1VACA 3ARFC 3QISA 4JPIA 5D1ZD 4CU7A 3LN4A 3AS1A 1T66C 3V4VL 4EDXA 3QHZH 3CSYB 3WYRA 3EJJX 1X5JA 4UOJA 4PJ5B 5F7EL 3S96A 3MV8D 4YHOL 2QTEA 3PGFH 5MENE 1MLCA 1H3PH 3OB0H 2V9RA 1AGBA 3BKJL 5EO0B 1AC6A 1IKNC 2XA8L 2VLLB 4F7MB 1BQHG 1L4IA 2DWEB 3BPCA 4TPRH 2V5YA 3RQ3A 1UT9A 5L6YL 1J9CT 3MREA 5HYSB 2VXTH 5C07E 2WAHA 1AO7A 5EO9A 1KTDB 5F7KC 4YE4H 3SGKA 5D1QC 4MNHB 1MCDA 5HGBA 1YNTA 2IADB 1NBZB 4NHUB 4JO3L 1RHHA 2EEBA 1NC2D 5IMKA 4XWOC 3MRMB 2G9HA 3CMGA 4OLZL 1NDGB 3MV8E 4JJ5A 4NT6A 4W4OA 5D96B 4JRXA 4LPCA 4XCFH 1I9RL 1PD6A 1VFMA 2QQLL 4CVXB 4KC3B 1GGUA 4PUBL 3IJYB 4Q9QH 3CPLB 2GQHA 4M3JA 2WUBH 4OZFB 1CQYA 4DKDC 3FAWA 1DTUA 3G6AB 3KPPA 3DXAD 2A9NL 1ZHBB 2FEEI 1LWRA 3BP4A 3UC0H 4WJ5A 3GO1H 4O9HH 2W65B 1MFNA 3K81A 3NGBC 2AAVA 4JDZA 3O9WA 2DM4A 4L1DA 5C0DA 2M26A 5C0AA 4IRJB 4Y1AA 1GAFH 3RDTA 2X4OB 3CH1B 2K9UA 6FABL 5SWZB 5HHXL 2HFGH 2PO6C 3D3VA 2PW1A 4OD1H 4UT9H 1IM9A 3UPAA 3G6AA 2AK4E 4N0FB 1UWXK 3AVEA 3T0XA 1JPSH 3FOMB 1J11A 4PJAA 5GGTL 1JGDA 4H0HB 4PB0L 4OF0A 3QXWA 2VAAA 2VDNL 3WNPA 4N0RA 3T8XB 1P7HL 5EOQL 1SJXA 1YNLH 3RWHB 5FK9B 1NCDH 3TJEH 1KLUB 4M5ZH 2DLGA 3MV9D 1P4IL 5F7DB 5ESQB 4YDLB 4G8GD 3MLTB 3BVNA 3GSRB 3VRLF 2FSEB 3KPLB 4WW2C 1FYHB 3JZ7A 1PKQB 3QUXC 2EH8L 1LO3H 3SKNB 2YPKB 1FGVL 1BJ8A 2LU4A 5HHPA 1IGJA 4EN3A 2G75B 3OL2A 4YHLL 2AKRA 1F2XK 4NZRH 5DJCA 2AERT 4L8BA 4K2UL 1UYWH 5HDOA 1KJVB 5F7HA 1ZT1A 4MCZB 2CKBH 3QSKB 5B22A 1MEXH 3QCVH 5C0EA 5J1AB 3NIDF 2XQBH 2DI7A 3AXLB 2GAZA 1DBBL 1N64H 2AVGA 3QQ3A 4YFLI 1HWGB 3HUJB 1D6VL 3AB0B 2HN7A 4WY7H 3CX2A 3MZTA 3OKNB 4RMUA 2HTKC 3EFFA 5TF0A 3W82A 5CBAB 1QFPA 3EBAA 3LHPH 2XACC 3O6LL 3PGCB 4DGVH 4TQEH 3I6KA 3AU1B 3CZFA 3F7RA 1NCWL 3HNVH 1GGCH 5GISL 4Y16D 3CVIH 1TJIH 3RFZC 3ULUC 3WFEL 3E0GA 2WQRA 2BHYA 2VABB 4PRIE 3TH2T 2VZSA 1P7KA 2GYSA 3QFJB 1AHWB 5D93C 2G2RB 1YUHA 1I8MA 2XPGA 2VXSH 3GBNL 4J3WA 4JHZA 2CKBL 3D39B 1GCFA 1EO8H 3DV4B 3W0WB 3ZDYF 1AGDB 1PJ9A 5CILH 5K9OA 5JQ6L 3O45B 1OSZA 4GKNB 4HIIA 5FFLA 1WAAF 4M6OL 5SWSB 2ZPKL 3IXAA 1H0DB 5JXEA 1RJYB 3FONB 3P30H 4FNLH 2HRPL 5FGRA 1GRWA 5JLZB 4GG6F 5BQ7B 1C16B 4KJWC 2XTJD 3IFLL 5C0BB 4ESKA 12E8H 4FRWA 4N1HB 4J3UA 2E27H 4JZJB 1L7IL 1MFBL 2N56A 2R1XA 3LS4L 4MDJA 1G9MC 1IARB 4QRTB 4W4OC 4D0CB 2GY5A 5IEHB 4OZHA 3QFDB 1EJOL 1PDKA 1HCVA 1OTTD 4FFWD 1H5BB 5IMMA 2ILLA 1KC5H 1T5WB 1MI5A 5LJYH 1NCTA 5CJXC 4P0DA 4NRYA 1J05B 4Y4FB 4Z0BH 5DHVB 3HUJA 2XKUA 3JV4A 5GGRB 3QNZA 2PXYA 3T0EB 5FDWB 3O2DH 3QA3A 5I1IL 2W0LA 1F97A 1BJMA 1Z5LB 2AJXH 4LKXB 1YMHB 4JO2L 4GMTL 4EQ3A 3CDFA 2YPLE 1BQUA 3JWOL 2V2WB 2VXQL 2VR5A 5F21B 1EAPB 3LKPB 3LSOA 4BSWB 4QY8B 2VR4A 3JWNC 3EZ8A 4K94C 1CGUA 1ES0A 2NY4D 3W39B 2CGRL 1DVFB 2WUBL 3O3EB 2G60L 3IDXH 4PJEB 5IVXE 3SKNA 1XF3A 3LZFH 4HIXH 5GS0H 1UH4A 3RVXD 2QSTA 4JDZB 15C8L 1DEEA 4AEIL 3U36B 5IW6A 1G0DA 1KXQE 3NPZB 1X4YA 2CLRB 2ZUQC 3D85A 1AO7E 3TA3A 4U2YA 1RMFH 1IAIM 2W9LA 1ETZA 3C8HA 5DVKA 1IVLA 2EDDA 5EA0H 4Z8FL 4Y16B 1QQDA 4MVBD 1PQZB 4OIBA 3BKYL 3P11H 3QEQB 4F15B 1JGVH 3F58L 7FABL 2R0KH 1IGMH 3UTZB 4YXLL 4KI5E 1P5UA 4JREB 3U4BL 4JFOA 2D4FA 4I3SH 4F9PC 1D5IH 2J12B 3DI3B 3TYGL 5IR1A 4E41A 4I18A 3D39D 3CUPB 3BIKA 4P5MB 2YD8A 1R0AL 1CGVA 4CN1A 4OV5A 4X6DF 5DHXB 5DQJB 3FQRB 4KKBD 4U6VH 4KK6C 2HYMA 3DYOA 1JGUL 4XP4H 1SBBA 4PLKD 4LVOB 4EI5C 5C0BD 3HZMA 3NH7L 1V8HA 2X9WA 1Y18A 1YMHA 1AXIB 3IAPA 4EJ1C 3CX5K 2FEDD 1JWUB 1XH3A 4XAKD 3PJSA 5F96L 5BQ7A 1OGTB 1T7ZA 5EZLB 2BSSA 3TNMB 2E7LC 1N4XH 4PTUA 3TO2A 2AQ2A 1YC8A 2A2QT 3C09C 2X4SB 1FP5A 4GMSL 5DURD 3E6HB 3I50H 4ZSOB 4A2LA 3IVKB 3P77A 4WWKA 3WFBL 5IBLD 2D9QB 1UXWA 4NFCA 1PBYA 4PJIE 3OKOB 1CD1A 3BH9B 3UBXI 4NO2A 3LMJL 5DD3H 5I1EH 5GZND 5IHLB 3GI9L 5DMJB 3T0ED 4XP6L 3QWRD 1CLOL 2X7LA 5HYJD 4HF5H 2X4QB 2F19L 1NGXA 4MNGE 1J5OL 4BQ9A 2OM5A 3E6HA 3KLHD 5TDPB 1WTGT 1K4CB 1N59A 3BZFA 1KJMB 5INDA 3ULUH 2YWYA 1D6VH 1SJVA 4DKEL 4XVJH 3T65A 5KG9A 3P4LA 1JZ6A 1RUQH 5GSRB 5CD5C 4QRQB 1T0PB 2ZSVB 2C1PA 1DVFD 1U91B 2EYRB 2IGFH 1F6FB 1T1XA 4H25A 2FYYA 4WNQB 4XCCL 4LPVA 4X6DB 3QIUA 4WHDA 1NC4A 4F33A 3MNZA 1S7SB 1A6TA 3L9RB 1J8HE 2GSGB 5JHLH 4QRRA 1VA9A 1YQVH 3GJEA 3CZFB 1LD9B 3RY6C 1CL7H 3MUZ1 3K2MC 4I5BA 5D7LA 2C9AA 1RFDL 2EYRA 1TPXC 5HHME 2M1KA 2VLKD 1VEPA 3BE1L 4BZ1H 2B20A 2R4RL 3HKFA 3I9GL 1XZ0A 2YUWA 3F5WB 2E7HA 4MNQD 3VD3A 4OQTL 5HHQA 3CSPA 4MA7H 1F4XL 4POZD 1E28A 3QXAA 5BMFL 2VZ3A 3IGAB 1KIRB 2HLFC 4X98B 4NM8L 5EU6A 1WZ1L 5IW3A 3VFTA 3NCCB 3FQRA 4LGRB 5TE7L 4G6ML 5LCVL 5I6XC 3O3EA 4YO0A 1BLNA 5A16A 2ED7A 5ERWB 1KCVH 1FZMB 1AD9B 3LEVH 2DTSA 4X7CC 2VZUA 5GSRA 1HDMA 4OZHE 1RIUH 2XZCL 3VFMB 2W60A 3MACL 4WI2A 4C4KT 3OJDB 3U2SB 4JFPB 2DQCL 5E8OB 1CDCA 5B38A 1FSKC 2DQIL 3DROA 5MP6L 5GS0C 4NNXA 1YEKH 5DC4B 1I85A 1MFCH 4ZUVA 4Q2ZA 4LLQB 4L4VD 3RL2B 4WTXA 1INDL 2H8PA 2X70A 4GH7B 4WW2A 3T0EA 4UB0L 3MR9B 4NQDB 4PUBH 1FCGA 2R0KL 1E4JA 4OD2B 3CDGA 3LIZH 5FKAA 2VRAA 3CFEA 4QXTA 3SKMA 3MRDB 4Q6IC 1X6LA 4ZYKB 2CRZA 1ZHLB 3PWNA 1RIVH 3QEHB 4HWBA 4KY1H 4LCCB 3BIKB 4P5MA 1EIBA 2UWEB 4P9HC 4XNUH 5I1LA 2MSPA 4ZO9A 4F37F 2WW8A 4M8QB 1YY9D 1SJEA 3HRZA 4GAFB 1Z9OA 3LQZB 4NNYB 1ZA6B 5I9QB 1ZLUH 3D18B 1CIUA 1HIMH 1EPFA 3ETBF 3H9HA 1MCWM 2X70B 5E7BA 3RX8A 4CRPA 1U42A 3QEGL 5EBGA 3WNNA 2OMNA 3FQTB 4XNQA 5TE6L 3IDXL 5DF0A 3MODL 4PJCA 4M1CD 1HXMA 4N0UE 1OW0C 2KQMA 2L0DA 3FB7A 5DTFB 1GZPA 1D9KB 3R06B 4OZIF 1DBML 4NNYA 5IQ9B 3CGTA 1BOGB 4HWZA 4GMTH 2I25N 3D5OF 5L8KB 2FX7L 3BDYH 3HS0A 4NO3A 1AXTL 2IANE 5DVNA 5HGAA 4FQXA 3QCUH 1FNLA 3JV6B 5TH2B 4JLRB 3BEVA 4ZG1A 1EO7A 1AY1H 4HKZA 3BAEL 1T1YB 1T03L 1ZT7B 5J3HC 1E6JH 1FAKT 5F1IA 2VISB 2IAMB 3LKRB 4YNYB 2DDQL 5I2IB 3VG9B 4WV1C 3VFPA 4Z7QE 4ZPVA 4ZAKB 4Y2OA 3UX9B 3T65B 4PJGA 4KUCD 4PLJD 2I5YH 1AGEB 3EO0A 2EXYD 3G5YB 4IRJC 5H37H 4Z78A 5C0IB 4WTWA 5F88A 3KDMB 5CAYB 1YQVL 3EDDA 4P2OC 2LTQB 3RP1A 4BZ1L 3DUSA 4MA3A 1A0QH 1I1FA 2X9XA 1JPST 2IH3A 3KYNB 4JY5H 3D3VD 1WC7A 5F1OB 4U1LB 1KULA 1RZKC 5CHNB 1QSEE 2OR8A 4E5XA 3PF2A 4HUXB 4HUKB 4JPVH 4FQJH 2JELH 1J7VR 5F9JA 3VD9A 4WU7A 2NY6C 3RGVB 2Y7QA 3MGOA 4HJ0D 5BS0E 2NTFA 2F5AH 5FGCE 1K5NA 3DROB 5JORA 2A83B 4LFHD 4X9FA 1YZZA 5M7QA 1IGTB 1FPTL 1TENA 2BNUB 3CAFA 3KPMA 3DXAB 3TIEA 4M00A 4N1CA 2PTUA 4K3EL 2OLDA 1A6AA 2WMPA 2MKLC 3NCMA 2GK0B 4F7PB 4P3DB 1WIUA 2LQRA 5KBNC 1TJGL 2D7TL 2BP3A 2JJVA 3F7YA 4E41D 3QCVL 1HHHB 4UT7L 2DWDA 32C2B 3MLXH 5GJSH 4RISL 1AGCB 4L8DA 4EIZC 4H26B 1Q9WA 4LSQH 1DJSA 4JZNB 1CICC 3QULB 1O5DT 1LO5B 3LPFA 1A6VH 3TYFA 1JNJA 3PP3H 3FO0H 5C0FB 1I9IH 4NN6C 5E5RB 2I24N 5AZ2H 1VEOA 4JANA 3U2SA 3O6FC 1N6UA 2YZ8A 5CZVH 1LO4L 4F57H 3TWCH 5F7NC 2VQ1B 3BWAB 4WHTB 3TCXA 3QO1A 2FX7H 3DARA 4Q9CA 4UNVA 3RWDA 1FAIL 1KNOB 1T1ZB 3KR3H 1MVFA 2VDPH 2XYCA 4X0KA 3QIBA 5CHNA 4ZSOE 2ICCA 1IEBA 4OCYL 3TN0B 4OZ4A 3L3JA 1RIHL 3ECBA 3I6LE 3MRCA 3MA9L 4XAWH 2ADIA 1ZLWH 1B0WA 4APQA 1KEGH 3DJ9A 3PHOB 1AGBB 2OZ4A 1LE5A 4CNIB 3V6FB 1LDPH 1BVKB 3I3EA 4UTAL 1MI5E 4GW4B 4ZAKD 5FHBL 5I1AB 3G6DL 5BJTA 1RUPH 4GOSA 3BZEA 3I02A 4XBGB 2IBBA 1OTUC 5IGXH 2HFFA 4ZTPL 1I7ZB 1BZ9B 3BRDA 5JHDD 4OLXL 1Q0YH 4ORGA 3RKDC 4ZAKA 1IAOB 1FL6A 3MOBH 1I3GH 3FOMA 2DQGL 2VXTL 3KPSE 4YFDB 4O2EB 4V1DE 4JJ5B 2WK2A 4NT6B 3QHTC 5CWSB 4XB8A 1ZSDA 3MODH 4Z5RA 5I1AA 5JXEC 1S9XB 1WC7B 3W9EB 3KJ6L 5T1KD 2VXVL 5TGBB 1J8HB 3HS0B 4O51B 4KJPC 4XMLL 3OWEA 4Z76B 1FNEB 5DK0A 4H20H 3O3UN 5HDBE 2VH5H 4PRPD 2X4RA 3SGDH 3FZUD 4NZDA 3OAYH 5ISZB 1W72B 1ZK9A 3VD5A 3P0GB 4MLIA 4WVRA 1WIOA 3NCJH 5DZNA 5EO1B 2PTVA 4RGNE 1A6PA 4DUWA 1W0WB 2XWTA 4ELMF 5H35A 3I85A 4YEEA 2R0ZH 1PG7L 3DVFA 4AIZA 2XTJB 1ADQA 2IAMA 1U58A 1V05A 3G5XB 5CD5D 4FQQA 4JVWA 1X5YA 3QFJE 1QPPA 5B3JE 4OCLC 2CDEB 1RAMA 1AJ7H 4P4KB 3SE9L 4ZDHA 3PP4H 1T7WA 3KWWA 1JWSB 4ZFOL 3IDJB 4KKCC 5IFHL 5BRZE 3HZYA 4X7TA 5JPNB 3GSNB 3LCYA 1RPQA 3RPKA 3WO4B 3E8UL 4PJFA 1OAYH 1UJ3A 1WJ3A 3VH8A 4ZUUB 3SDAC 4PJDA 3SN6N 3UJJH 2VDMH 3LD8C 32C2A 4JQIH 3V6BR 1D5XA 5HY9A 3QNYB 4DZBB 4J4PD 3W5MA 1RURL 4ODTH 2EC8A 4APQD 4LHUD 2P49B 4Y4FD 3QWQB 4LLMB 4KVNH 4KK9C 2CDEA 5ESQA 4PLJC 2Y4SA 1NGYA 2PO6D 4EDWL 3RWCB 1JWSA 4HUVB 1ZGLA 1BHGA 4JRYD 4FABH 3RBGA 1OT1A 4J3VA 1KJ2L 5I73C 4D0DA 4RFOH 5H2BB 3K7UA 2EIEA 2FX8L 3SBWC 4JFYB 3KXFA 4LQFL 2KDGA 1RZGB 1MCHA 5GQBA 2V2XB 1P84J 3HZKB 1ZXQA 2FIKB 4JCLA 1ONQA 1HQ4B 2NY4B 4DGYH 1FNEA 5DK0B 3MRFA 5EU3A 1R5IA 5EBLA 3VG0L 1ZHKA 3GHEL 1YYMH 4AEHL 2L4OA 3SO3B 4XNZC 4BH8B 1F8TL 1WBYA 3GIVA 1HINH 4UAOC 3BPNC 3RVTD 1JNNH 4AQOA 3TBYB 4WY7L 4Q0XL 3ZTNL 5EN2B 3QWOB 3V4PH 2EH7L 1A6WL 2KH2B 5FF6B 1GZQB 3NN8A 1ORQB 2OR7A 3BT2L 4LVNC 5I71C 1HI6A 1TVDA 5F3HB 4JGUA 4UMGA 2YC1A 5FA3B 4PRAA 5GHWL 3MCKA 2GJJA 1ZLSH 4MA8H 5EUOF 3KPNB 3DV4A 3W0WA 2YK1H 3P0VL 4FOMA 4M6NL 5HHPB 3K0WA 1FN4A 3T3PE 3WIHL 3MRJA 4Y1AB 4R8WH 1QRKA 1MFEL 3OKLB 4L9LA 4WENB 1YQ2A 1UZ8A 5GGSA 3O3BA 5F6IC 2HFEB 3FQUB 1J8HA 5J4MA 1N4XL 4LLMA 1G7HB 1QBAA 4MJ5A 5HDQL 4OZ4B 2IC2A 5JOPE 1N5YH 1JGLL 4P9HL 4HC1L 5DI8A 3I2CH 1YY9C 5ITBH 2B7DT 2CLZB 3MV11 2Y25A 4ZOBA 4J4PA 2ITDA 3S3JA 4QRSA 4PJ9C 5L8JB 1BAFH 3WHXA 1VB9A 5B39G 1YEEH 3DRTB 3BWUC 4GKSB 5TDOA 4G7YH 4JFYA 4G8GA 1EHNA 1UKSA 1FRGH 3VW3H 2ZCHH 4ALAL 4CADB 1XF5A 4AG4H 3D25A 2GW5A 4UINL 3HI6H 5ENWB 1HZHL 1KG0B 3O6KH 3QUZC 3O2VH 1P84K 1BMGA 5T3XL 5GRZA 1B4JL 4HUWB 5C0FA 5E56A 2XPGB 3G6JE 4FQ1L 1MRCH 2IWGA 4KHXH 5DFVC 1KPVB 1X4XA 2YPKA 2RAMA 3D2UD 5DQDL 4HQQH 4YH6A 1KN2L 2ZWLT 3BIBX 3VXSB 3QUYA 4QHMA 4WUUB 3MV9E 2NQCA 2Q7YB 1QLRA 5HYJB 3CH1A 1F45A 3MRLA 2OI9C 4JFDA 4JRYB 4Y0GA 1H8SA 2F58L 5TDNB 3WJJC 4JFFB 4PY7B 3OG4B 3KVQA 3PXJA 3KYMB 1P1ZA 3L3JB 1MLBA 2VH5L 2BMKB 5E9DA 3RRQA 2EYTB 4QRRD 3WXVH 3LV3B 1W0VB 4JO4L 2Z92A 2NY6D 4WU5B 2AK4D 2AJVL 1AKJA 3PGCA 3TPUB 4D0DB 3S34L 4WEMB 1XGYL 2KQNA 5IV2B 5D6CA 1B6UA 1HNGA 4UV4H 1CGXA 4P5TC 3IDYB 3ME0A 3MRPA 2DMCA 2FATH 3VXUB 3STLA 3BPLB 3ILQC 3H42L 4YBLC 4P23A 1P9MC 2DLIA 4D9RD 4PGBB 5T3ZL 4HG4K 5L7XH 3S36L 5CIPB 4YHNB 1DQLH 4CGTA 4KH2A 4M6MH 4MWFA 4R0LB 1AGFB 2AJXL 3MQIA 4ODWB 4YXHL 3T2OA 5AAMA 4KAQL 1NLDL 1G9NL 4FXLA 4YHZL 1ZSDB 4Z5RB 5C0DB 1JWMB 1MCBA 1YEKL 4WUKH 1P53A 4XP9L 4M93B 1MNUL 4R7DA 5L9DL 4QKXB 1PX4A 1NDMA 1NBVL 1HH6B 3HB3D 3V2AR 3DV6A 5TJWK 1FCCA 3GMRA 5L2JA 3EO1B 3SDCB 3LKOA 4X4ME 5T1MB 1IZKA 3AXLA 4OQ1A 1K4DA 3CCHB 4ZUSB 1S8DB 3U46A 1B9ZA 43CAA 4MVBC 5BW7A 3BHBA 4F9PA 5GRUH 4FQ2L 3SDDA 5H35B 1CBVH 3PWVA 2B2XL 4S0SD 2FR4B 2J8OA 2QLVB 5I1IH 2CLRA 3D85B 5HHMB 1IM3A 1QRNA 3EHBC 3REWB 1A6UH 2C3GA 3FO2A 2NYYD 2EDHA 5IJKC 4JDTL 1U8LA 1BD2D 5CLWA 4F58L 2HT2D 2WBKA 2NLJA 1NC4B 3SPVA 1NMAH 1GHFH 1UKTA 4M6OH 4PGEB 2GSGA 2DOCA 4F9LA 5DK2B 3CK0L 1G1CA 3UTZA 3HC3L 3JWDC 3V9FA 3LDBB 3O81A 4UINH 3Q6GL 5D8JL 3WNMA 1I7TA 2YXFA 5GGVL 3P3YA 2XTJE 2F8XC 4L9LC 1RUKL 4MJ6B 1OB1A 4LDOB 4L4VB 3SY0B 5IBTH 4GRLD 4P2QD 1IGCL 4TTDC 5DYOB 5JMRA 2BY0A 2APBA 1E0OB 3DYMA 4HH9A 1A7PH 3M8OH 4NQDD 5DEFA 2A6KB 1UVQA 3HR5A 1VFUA 3JTTA 1A1OA 2J4WL 5JO5B 3P30L 1NDGA 2BSTA 1FPTH 3IJHB 3MXVH 4O00A 3T4AB 4LARH 1BZQK 4UU9A 5JW4R 4MA7L 5LGJB 1FC1A 4R4NC 1QLRB 1WWBX 3G6JF 4NZTL 1QLEH 5DMKA 2DQDL 2NY5C 3QUMA 1T7XA 3PL6A 2F53D 5GS0D 1C1EH 3TJHC 3KG5A 3ARFB 1MHPL 3VXQA 5IHZA 4H25B 4NP4H 2AK1H 3GSRA 3ZE2F 4S1SH 3GEWB 1S7XA 5E2WH 2QQNL 5JXED 3VXUD 1PQZA 3MLZL 5ID1B 1ZTXH 5F7UA 3G9AB 4NQDE 1IC5L 3FOLA 1NCAH 2OYPA 3B6SA 5FV1L 4IRZH 3TLRA 3FB6B 2LTQC 2CMRH 3NACL 2W60B 3CSGA 5JZ7C 1INEL 3IU4L 3QWOA 4FA8A 2DJUA 3AGVA 1JNNL 3LRHA 4L5FH 5FYJU 5H37G 5GHWH 1S7QA 5C86A 5J12C 5F9DC 2D0GA 2YD6A 1DLHB 4XWOD 4M5ZL 1D6EA 1E4KC 4PJBA 3T3PF 4YFLF 1C7TA 4D9LH 5FA4A 4DKEH 4I9WE 4QRTA 3SCMC 3SDCD 1MI5D 1DLFH 2RBLA 2YBRB 2Z4QA 3HMXL 3EYOB 4Z7WB 3RY4A 5I1GH 4ONHA 5I66A 5EU6B 2OX5A 1ZHLA 1OF2A 4U0RB 2Y23A 4JB9L 3C87A 3OJVC 1PYWB 2E8ZA 4NIKB 2CRIA 5JUEH 3B3IB 1FNFA 4CBPA 5I1EL 4FZ8L 4QCIB 5I75C 3D85D 4DZ8A 2LAAA 3TPUA 5F9WC 4APQC 1OSZB 3GSNL 4FP8L 4R97B 5SWSA 1KT2B 2V17L 3LKQA 5FUZL 4R2GD 4GG8A 1J1XL 3OJDA 1OF2B 2R56H 4FHBD 5EDXA 3SCMA 3STBA 3T1WA 2X7LB 3PWJB 3ARFA 3D3VB 2W91A 4I4WA 1NMAL 2J5LB 2FJHB 4M43L 4ELME 4R3SA 5JQHC 3NFSH 3WUWG 1HSBA 3Q1SH 2AJUL 3QI9A 1LNUA 3FRPG 1UC6A 4MSWB 1LDSA 1XF3B 4YHKH 4EBQH 4Y4FC 3BUTA 4JFXB 3QUYB 2EXYC 4QHMB 1WCQA 2WP3T 3MA7B 1DEDA 3BYTA 4MNQA 2NY1B 4KRNA 5D2NE 4LP4A 1VESA 1CCZA 4MQ7A 1JWUA 4JN1H 4S10A 3L5IA 5KVEH 1YY8B 3NCJL 3HLAB 4LASL 1CS6A 4OIIH 4OLVL 4H88H 3O6MH 4H1LB 4BH7B 1K4DB 4C59B 4N8CL 4PJ8A 3GJFB 4L4JA 5BO1L 3GMPA 1VGEH 3U30B 2Q1EA 2DQFB 3QDGA 5BV7L 3CVHL 4HJ0C 4MAUH 2V9TA 4W6XB 3RWEA 2OJEA 4O2CB 2GJZB 1FO0A 4I3GA 1RIUL 5B38G 4WIQA 3LKPA 2YWZA 4LHUA 2KL6A 3NABL 2ZUQB 2H9GA 2PNDA 2X41A 2WWMC 2R29L 5BV7B 3MV7A 5TE7H 2FATL 4DWHA 1DDHB 3S37X 3FB5A 4MD5A 3S36X 3AU1A 4PLKC 4J6RL 5FO9B 3IRZA 4JG0H 4KJYA 4OZGE 2EDLA 4EBQL 3TT1L 1OPGL 4UTBH 1OGTA 3GMRB 4GBXB 4JG1H 2HH0L 4F7TA 1MI5B 2YD4A 2PETA 1ETZB 1ORSB 4XAKE 4J3XA 3JV4B 4HEME 3R1GH 5BRZA 3WBDA 2ZUSA 1HXYA 3CDYA 5GGQH 5A2KH 1JZ3A 5KN5B 4PD4K 1FL5B 4A6YA 2UYLB 4UQ2B 3MCLL 2Y5EA 4XPBH 3BI9X 3D9AL 1DUZA 5EBWB 5EIVA 5D70L 1YNKL 1MQKL 3V4UL 4NO0B 4MA3B 4R4FH 4LEOA 4G8FA 5HVHC 4M48L 1EFXD 3NFPA 1YMME 2VTFA 4YWGL 5IB3A 4RGMB 1VGKB 3PDGA 3MBEA 2F74A 3FT2A 5FYKD 1MWAL 3BSZH 2X09A 3QIUC 3KPRE 4UT6L 3C5JA 4NQVA 1JGEB 1I7TB 4N68A 3RWGA 1M1SA 1C12B 5IMOA 3CFDB 5IMMB 2JIXB 3GBNH 4BZ2L 5C3LD 3KPOA 1KYOJ 1OAZL 3ARQA 1E6OH 3U0PB 1NGPH 1T5XA 3EJYC 1A6VL 2R69H 5KSAB 1MFAH 3I84A 3LQMA 3HFML 3VDAA 3OPZH 1EX0A 3T4AA 3WIIL 2XQBL 3KS0J 3OKOA 2A6IB 2Q8AL 2P8PA 3G5YA 1V3JA 3MBEC 2YRLA 3L3GA 3RWGB 1CDJA 4XI5C 2VIRA 4X7SH 4WFHE 4L4VE 1RUML 4LLUA 4KDWA 1FLTX 1YY8A 1N64L 3DX6A 1INEH 1JRHL 1P9MA 1MWAB 4H1LA 3DETD 3UCRA 4JCMA 1A0QL 5J89A 1AD0B 2V7NB 5HHOB 5HYFA 1BZ9A 3SDYH 3O41A 1AXSA 3HMWL 3B6SB 2A74A 2HA1A 1JTTA 3AUVA 4Z7QF 4LCYB 4EUPB 4TRPH 5FUCE 4K07A 2OMBA 1WEJH 2E7MA 3V6OC 4A2MA 1DQTA 1A7QH 3GMOA 2Y9RT 2D03H 3C6LD 3K74B 4XXCC 3IDIB 4LHUB 4ODTL 4HJGA 1QFWM 3S98A 1PAMA 5MEND 2NY2C 2C7UB 1N5AB 2XNAB 5FA4B 2OZ4L 2VLRA 5K93A 4B0MM 2VE6B 4LHQB 5I76B 1YDPA 1MHEA 4JEGB 2FEDC 4JM2B 1JNLH 5KOVC 1HK6A 2ESVA 3H9ZA 3NFNB 1CDGA 2FZ3A 3RHWK 1AXTH 4OI9A 2XN9A 4NFBA 4ZXBD 1KN4L 3BRFA 2HFGL 2IFFL 3RIFF 4N5ED 3RU8L 2KUTA 5TDPA 4E5XB 3MBXL 3AM8C 4KROB 2APWA 1KTRL 5ESAB 4LSDA 1F58L 2A6IA 5B4MD 5SWSE 3T4YA 1RMFL 1EFQA 3TO4D 3D0VB 4QRPB 1ZAGA 5CEZH 1TVHA 1KCSH 2FJHA 1I1YB 4JAMA 3RWDB 3GKZA 4Z77B 5E9DE 4KAQH 4KU1A 3QJHB 1GAFL 1TVBA 4LRNL 5A2FA 2Q6WA 2SEBB 2E8YA 2M2DA 5CP3H 4G6AD 4X5XB 3KJ4C 3MFFA 5DRWB 5EORH 4OI8A 3S35H 3VFMA 3AS2A 4MNQE 2AQ1A 4XBEH 1LEIB 5D2NA 5DWUL 1YN7B 5E95B 4G7VH 1C5CH 4Y1AD 3P2TA 1QFWH 3HG1A 4NBYB 5D1QD 3JSSA 4CNIA 3O4OB 1JN6A 3FJTA 3U1SH 5BO1H 3CFCL 4OFYD 4LRIA 3O2DA 3BZEB 1QVOB 5L0QC 2HTLC 3T0EE 3V7AE 2XNAA 4LLYB 1U3HC 4HUXA 1HXYB 4YHOH 2JLLA 3LB6C 5FKAB 4I0PB 4NKOA 5JIPA 2IAND 4XXDB 3FFCA 3T2NL 3VXTB 4ZYKA 1U95A 4N90E 3P9LA 1CE1H 4KQ3H 1NGZB 5D7JB 5I8EB 3ISWA 3TFKC 3FMGH 5M94B 3Q0HA 1W8NA 5FUZH 1G7LB 1RZIB 3L5JA 4U2ZA 3VRJA 5DJ8B 4Y1AE 3LIZL 3I3BA 1KNOA 1T1ZA 1MREH 4JFFE 1Z2KA 2O5YH 4RMQA 4HEPG 5JW4Q 3FB5B 4MD5B 3C6LB 4M7LL 4CAGA 2CDGA 3QZWB 4ZTOH 5D7LB 5MENB 1OP9A 2QSQA 4HQQL 4OGAD 5DJ0A 3VXTA 2D4DA 4Z0XA 5DD0H 1UEYA 3BGAA 3KPTA 4BELD 1CGTA 1ZA3A 1RJLB 5FECB 2PF6A 3VFGH 2ZPKH 4NBXB 1BVKA 3V0WH 1GYAA 1QEWB 4BFEA 1NGQH 5C0GA 1QKZL 2E6QA 3CLFH 4WI5A 5MI0B 1RK0B 4I48B 3HUJF 5C07B 3GJFK 2GT9B 4L3AA 4PTTB 4LSTH 4JY4A 2AK4B 3B9VA 5DUML 2F54A 4D9QE 3BESR 4OZHF 3KYAA 4Z0XB 3VWKC 2EKSA 4NQXA 3SDYL 1BQLH 2XQYK 3QNXA 3OKKA 1OM3L 1CDBA 2YKLL 5EG6C 1YMMA 4QRPD 1G9NC 4OT1H 1Z6JT 4PRNB 2GFBA 4Y4HB 1BZ7B 4D9QD 1OY3B 4ZD3L 4HS3A 5E8NB 1S7RA 5FGBC 1FH5L 1FZMA 2B0SL 1JHKL 1FFOA 4IOFC 2F9BT 5GRYA 1MY7A 3QAZC 1AR1D 5GGVY 3Q6FB 3FQXA 1A9EB 2I9TA 2YK1L 3V4PL 1RI8A 3WV0A 5E00B 1BEYH 4HSQA 1CXLA 4KMLB 3BEWB 2GITB 3IDIA 2DQTL 4DN3L 5IP4A 1CFVH 5I1HH 3HZKA 4POYA 3UBXA 1RUQL 4WW2B 4LLVB 1OARL 1OAZH 3QUXB 4N8PA 1G84A 3T3ME 4NZUL 3BKCL 4F3FB 4JM2A 5KZCB 1H8NA 4NFDA 5I74B 4OTXH 4K94L 4P23C 4EQ2A 5GZOC 5JXAL 4KI5C 4ISVB 1BM3H 1VDGA 5HHMD 2ITCB 3THMH 1ZA6A 1P2CA 5L8LB 3CC5A 2DIBA 4KFZC 1KV3A 3MNVA 4L4TB 3S4SA 1JNHA 3V52L 3NA9H 3SE4A 1YEJL 1F90H 3OJMB 4N90D 3MOAH 1NC4D 4J3OC 1T4KB 2R9HC 1TLKA 4M5YH 3UPRB 1IT9L 5HTSA 4HIJB 4RSVA 2XQYG 1CFQB 3LKSB 4MZ2A 4MXVE 2YPLD 4QRPA 1OP3K 1AGFA 5EUOB 4HGKC 5H8DA 3O6FA 5JA8B 1ZKAA 2YUZA 4RNRA 1AQDA 3GSUB 3ZO0A 4JPWL 4TVPD 3ZHDA 4X6DE 1QG3A 2NX5E 4HWZB 4QTIL 1J86A 4L4TA 3S4SB 2WUCL 1J0ZA 2Z91A 4JFED 4JG1L 5C0BE 2FDBP 5T1MA 3CSYA 1A3RL 3Q3GB 3QUZD 3FQWB 5LWYH 2CIIB 2G5BB 3HUJE 5DRWA 4WO4C 1I9JH 2ZUYA 3BAEH 4Y2DB 5JDSB 4QRSB 3E1F1 4TVPE 5TE6H 1JJUA 3OMZA 4GKSA 3BQUD 1JGVL 4CL7A 5SX4I 3J8F7 2F53B 4QHNB 3TPKA 3MROB 4OF7A 3ARFD 4YK4B 4Z7NE 4TSAL 3O8XA 3Q2CA 4XHQA 4MB5A 5I1CH 1CBVL 1IM3B 3ZZ1A 4GKZA 4JQXA 3HI1B 3EOTL 1MUJB 1ACYH 1PG7X 2ICES 5T3ZE 5C08A 3ARGC 4OZIE 5KVDL 4ZAKC 3GO1L 5CIPA 1UWEL 4DJMA 4M3KB 3EFFB 4ZFOB 2BVTA 3DVNA 4HUUA 4X7DC 3LN9A 1CE1L 1TZGH 4KQ3L 1JGDB 1HKLH 2PYFB 3OAZH 4JKPL 2A1WL 4YAQB 3IB4A 4JVPA 1UM5L 1IAKB 5JOFB 2VLKA 4LPTA 4HKXA 1I8KB 4P46C 5L7XL 2P48B 2H32H 4JKWA 3BKJH 3PHSA 1N2RB 3G08B 1KIUA 3KNBA 3O9WC 1N26A 2D7OA 1XF2A 1RZ7L 2XG4A 4PGDB 1JK8A 3KYMA 5EU7E 4D2NA 5CEZL 5ILTL 1NPUA 2R2BB 3ZDZF 4LL9A 5I8KL 5CSZA 2XTLA 5C7XL 4PJEE 5IVXB 3KPSA 3P73A 4ZS6D 4NN5C 3VWKA 4ZNCD 2GITA 3GB7A 4IRJA 3CVHB 2NXYC 4RZCB 1BBDH 1R3HB 5T5NG 5CEYB 5KZCD 4TPRL 5T1LA 2FJFA 4ZQKA 3D3VE 3TN0A 3OZ9H 1DR9A 3DO7A 5J56B 2APFA 2XZQL 3Q3GA 3VD7A 3BXNA 1U3YA 5FHBH 5DJ2A 3OXSA 1T21B 3EGSA 4F3FA 4MXQD 5JDSA 5CBAA 3WXVL 2GTZB 4Y19D 3MJ9L 5FOBA 3ZYZA 2GUOB 1TZIB 2GCYB 3S4SG 1Q94A 4U3CA 1GXEA 3LEVL 1GGIL 2CLVA 2OSLB 1ACZA 2B39A 1KTLA 2YPLB 2WBJC 2ADJB 4HFUL 4U6TA 4Y19A 4M62H 5TDNA 1LO0H 3C8KA 3P4OA 3QFJA 1NEZB 3Q1SL 1LP9B 3RX7A 3E6FA 4WFEE 1M4KA 1QO3B 3HZYB 1PLGH 3N1QC 2X1QA 4HGWB 5EO0A 2QQKL 1FORL 4J1UA 4U6HA 5CCKH 1NCCL 2NY3B 4ZUUA 4NKDB 1HWHB 5JHLL 4GRMB 3SO5A 4FQIL 3E3QE 4EXKA 3EKCA 8FABB 1AQKH 4Y4KD 5CUSH 5EOCH 2AEQL 3OQ3B 3UAJD 4DTGH 1QA9A 2C3WA 1MFBH 4RMVA 3QIUD 1EFXA 5C0EB 1BIIB 1LEGA 4RX4A 1GZQA 3MLXL 2EXWC 3NN8B 5IB2A 5JW4N 4X7SL 4L3ED 4OLYH 3A0OA 1FO0H 2XRAH 1QFUH 4Y5YC 3WDJA 4NGHH 1QTYT 4M7JL 4FNLL 4O02L 2EKSB 2MWCA 4NQXB 5E6IC 3DUHA 2OTPA 5DJXA 1DEEB 1U8NA 2XZAH 4RZCA 8FABA 2AS5M 2X44D 3FTGB 3WXWL 4HXAL 1EDQA 1NCWH 2X4NB 2P5EE 1H5BA 4NQEB 2HKFL 4PRIA 4W6WB 4PJ8C 3ARRA 5F7DA 3MRFB 5D7IA 3MRKA 4K8RD 2YRPA 4NKMB 5DFWH 4FQJL 5DI8B 2EEDA 1GGYA 3F6IA 3KPPB 1EEUA 1N7ML 1BBJA 2NW3A 1U8OB 3PQYA 4BKLA 4RIRA 3P4MB 5CWSA 1Z5LA 4UNTA 4YHPA 4NJ9H 4JFOB 4Y16C 2AV7A 1I1AB 2QEJA 3QXDB 1XF5B 4NQSB 4QF1B 5KANG 1KJ2B 4LKCB 2R9HD 4P2RB 4XBPA 4ODHH 3VXME 5JR1L 5JNYB 1MF2L 3MLSH 1F8TH 2JJUA 1OAXL 4MA1C 5CUSL 5EOCL 4X6FA 1NCDL 3TJEL 2CDFA 1SMAA 4FXGA 4WWID 4BKLB 5FO8A 4ODWA 4OCRH 5DEGA 1QSFA 1P4IH 4LMQI 1KXVC 3L7EA 2J6EA 3VMOA 1IBGH 1E4XL 1WGOA 4IDJH 2YKLH 3OKLA 3VRIA 1FBIH 1AY1L 3K80A 3W2DH 1BQSA 1G7HA 1VENA 4MJ5B 1XGUB 4PP1C 5B8CC 3MLRL 4KPHH 2Q20A 3C08L 5C71A 5E70A 1I3RB 5HYQB 1JVKA 4K7FA 4QHUB 4GW1B 4BK5A 5DUMH 2BRRH 2ESVE 5GXBB 3IKKA 3VXRE 1IGML 4YXLH 1LO0L 3HZVA 5FV2A 4M62L 2ZG2A 4M03A 3HMXA 4FTVA 2DKUA 5DJCB 5CLTA 2JIXD 1WFUA 5L2KE 4L4TE 5F93C 5AZEL 3D25B 1A9BA 3U4EA 1AI1H 5SWZA 3QT2A 1Q9LB 4R2GC 1XCQA 1WT5A 4XZUA 1A3LL 3MRKB 1NGYB 3RZCD 1JYVA 2FB4L 5F7MC 2XZZA 2W07A 2B1HH 2EE3A 4UBDD 5EOTA 4Y4KB 2HT4D 4HK0A 2Q86B 1AJ7L 3KJ6H 2NW2A 4WDIB 1EHLH 1BECA 3G9VA 2ORBH 3B2UD 4LOUD 3H9SE 5F7YC 1XGRA 4GG6B 1DANU 2XFXB 3SDAA 4GAJH 4XZUB 2BOCA 5L2KD 4LLDB 1T1XB 4OZIA 5HHOD 3BP6A 1T21A 1WF5A 1ZWIA 2I26N 3RVXC 1S8DA 2F15A 5ILTH 4XNXH 1YEGH 3ULVE 3ARZA 3FRUA 2GJ6D 3G6DH 2DBJA 2KZ1B 2VLKE 3RDTB 1KIQB 4YIQB 4N0UA 5D96C 5FKPA 5C09A 4U3XA 3GMQA 1PY9A 4M8VA 1HE7A 1E4WL 4K7PY 4Z7VE 4Z7NF 3ULUD 3C5ZC 1FHGA 5C6WH 1CTOA 4XCNB 43C9A 1AI1L 3QDMA 4UQ3A 3SPVB 2W92A 4MYWB 3FFCE 4JJHA 3S35L 3TFKD 4MWFB 3V5KB 1DBAH 1ZVSA 4LFHG 5DC9B 3R8QA 1CLZL 8CGTA 3D48R 3L3OB 4U7MA 2CRYA 1P4BH 5EU4A 5E0QA 1S9KC 3DMMD 3U4EB 4JPIB 4OFYA 5HI5D 2IPKA 3IFLH 3LEXB 1JPGA 4DUVA 3N9GL 3VFSA 5E9DB 5LAXA 3ZKMD 2Q76B 1FNGB 4DKFL 2ITDB 3L1OH 3LRSA 2WM0A 3QB7C 4NQTA 3SEPA 4KK5D 4NNPH 5F7LB 2YBRA 5KSBA 3U4AA 3LH2H 3DMMC 4ZOEA 2ERJB 1BF8A 4K94H 4EIGB 3IJSB 1SEQH 5HI4D 2AGJL 3I9GH 1DLFL 3FT3B 3CFIC 4CDHA 1NAMA 3QIWA 4F37K 4JZJA 1HZHH 5BRZB 4ZS7H 5CJXA 3I6KB 1L0YA 5AYUL 1DQJA 5ESVB 2BVQB 3IDGA 3L3IA 4OM1H 1YEDB 3W9DB 4PJ8D 3OKMB 1TTUA 3CXDL 3FQNA 1N8ZB 4JFQA 3OGCB 4Q6IB 4P57A 1R5VB 1EEQA 1G0YR 4UOW1 4WFFE 3LVEA 5CGYC 3D39A 2CK0L 3PUCA 2IANB 2FO4B 5E2WL 1CE6A 3HRPA 4WO4A 5FYKU 1I4FB 5JA9A 4NC1C 1XGPA 4UDUA 4M7JH 1U8NB 3U83A 3WHE1 5IR1B 2ZKHL 2C1OB 5C0NC 1DQMH 4JM2F 5D7LE 2UVEA 3VG0H 1A7PL 4FQHA 4HKBB 1FO0L 3LRGA 1C12A 3IDYC 1ZLSL 4I8DA 4WEBL 2VDOH 3A6CL 4PV8A 4NNXB 3OGCA 3WNLA 4QXUH 3SGDI 3BT2H 2CR3A 5CEZE 4M61B 3M1BA 2XXCB 1UQSA 4LSTL 4L3EE 5EOQH 2SEBA 1E28B 4KTDH 2MOVA 5DD3L 1WQVT 3HZMB 1H3GA 4JPKH 2BHZA 3NA4A 1VKXA 4K23H 3FB6A 1IEHA 2YMXL 2AV7B 5IW6B 2CO7B 4R7DB 3G5VB 2ZG3A 1RZFL 1K6QL 2VUYA 5DT1H 4PD4J 3WL9B 2PXYC 1CFBA 1ZGLP 4LIQH 4OZGF 4YHIA 3MLTA 5CSBA 3DVGA 4LVHB 2DI8A 5IBUB 2E7BA 4ZSOA 4HK0B 3V6ZA 4OAWB 2N7BA 1GOFA 5DEGB 2EKJA 5ESAA 5HGGS 2UWEF 4BSVB 5CKAA 4OSUH 2NX5A 4U7KA 1IILE 3MRIA 1MQ8A 1RJYA 3CFDA 4GRLC 5B38B 4UNUA 5J1AA 2ICWJ 2R39A 5KVMC 3ULVF 1NH6A 1O7VA 5C0BA 1UADC 3UAJC 4CMMA 2B2XH 2JCCA 4WWKC 5J13B 5KSVA 3FHAA 4Y8DC 2MQ0A 5DD0L 1NANH 1CT8A 5D2LA 5I30H 3MGTA 4P2OB 4B50A 2J5LC 5LBSL 1N59B 2J3SA 3NH7H 6FABH 1S9VA 4Y8AA 3NVQA 5AWNL 1Y18B 4OGYH 1CXFA 4M6ML 5FM5O 2EXWD 2UYLA 3EDKA 1EEYB 3RNQB 4FQHB 3SOBL 2J7LA 4I2XB 5BRZD 3RWEB 1OVZA 2BY3A 3GMQB 4TTDD 5IFHH 3B9KB 3SDDC 5E5UB 1MNUH 4S1QH 3OAUL 3MYJB 4X83A 2WIMA 4M1GL 5C1MB 2NY1C 5DD1L 1NLDH 2BJMH 4HX1B 1TETH 3L3DB 1A6TB 3L9RA 3TVMC 3KPMB 3QZWG 2V6HA 3IS0X 3O4LD 4DVBA 1XGYH 3IJHA 4OIIL 1AH1A 5FYJE 2HMID 5MEOB 3GSXB 3PGFL 4QXGL 1CLYL 4XNXL 3RTQB 4CJ0A 1M71A 3Q5YA 2G60H 2XFXA 4FQLH 2YD1A 2IPKB 3HHRB 4JRXE 5HGHB 1W72L 2DL2A 5E6ID 1WAAA 1HN1A 5D1XA 2J88H 4K8RH 3MLUH 1DP0A 1IQWL 3PABB 5IVXF 3U9PH 4XPHH 5FO7A 2BFVH 1DE4B 5E5MA 3BD3A 1S9WB 1M6OB 1M05A 4ZOAA 1FFOB 4OZFH 3TVMA 5TH2A 4V1DD 2PW2B 4FQ1H 5KS9A 1TDQA 3WCYA 1QSVA 2R2EB 3OX8B 5IT2H 4RMSA 1WBXA 3HPJA 2DM2A 2A38A 5MEPB 2Y36L 3NTCL 1DFBL 4TUKH 5IQ7H 4WNQA 1JCKA 3LN5B 1ZLUK 5FYKE 5I16A 3UJIH 2OZ4H 3ZDXF 1E27A 4I0CC 4K71C 1H15A 5I1DA 1F4XH 4YNYA 4P2OA 5HI3C 3FKUS 4NUGH 4HHAB 5DGQA 1MCIA 4X6BB 1EGJL 4TYUA 1AD9A 3IDGB 4DGIL 1DN0A 2DQJL 3KYKH 4FZEH 1U8QB 2D7PA 3VFVA 1WBXB 5EUOE 3WFDL 3WN5A 2PR4L 3VW3L 2Y5TB 4OCSL 1E4XI 4IRSB 1YEEL 4K55A 2C7UA 1JTPA 5IK3B 1P6AB 5D6DA 2BRQA 2W1NA 1U6AH 2F5BL 4HS3B 3GBMH 4TUJB 2XN9D 3EYFA 4D9RE 3NZHL 3QZWA 1N5YL 1TJGH 4L9DA 1QP1A 2YA2A 1R3JB 1U8IA 3UTSD 4ZFFB 1C5BL 4KDTC 5HHNB 3WFEH 4NZJA 4P2OD 3PJSB 3UDWA 4U4BA 4BFIA 2D03L 3OR7A 5KVFL 1KCRH 1C8PA 5E2UH 4LLWA 1I8IA 4PTUB 4NO5A 5CJ5A 2VISA 1RZFH 3NFPB 4HH8A 1JF5A 1QQDB 1S5IL 1OSPL 2YSSA 3ZYOA 5HSFA 3DECA 1YYLH 3C60B 5EB9A 2BDNL 3QUKA 4LU5L 5FO9A 2X4RB 2I60L 2FL5A 2CKBB 2I9LB 2ADIB 2VXSL 1CFTB 3VGGA 1G7IB 2DKSA 5D7JA 3UTQA 4UBDC 2ED8A 2DQHL 1A3QA 4IOIB 2AEIT 1CWVA 4RAVA 3DUSB 2AJSH 4YHLH 1FVDB 1AE6L 3VE0A 3MNVB 4HBCH 3AREA 4ZO6A 2J4WH 4MCYA 4FFZH 4NO3B 2ZZUT 1SYSB 1HILB 5LKNA 3C6LA 4LSRL 5E6IB 4Z7WF 4X6BA 5FCUH 4R4FL 5J9PA 1SEQL 4UAOB 3F7PC 2BNQD 4FS0A 3RVUC 5IB4A 1IKNA 2P24A 1WK0A 4XCYA 1WISA 4H8WH 1LGVA 1U8JA 4L29B 2FZ3B 2VDQH 1H3VA 2FJGB 2VC2L 2JCCB 2B0SH 3SE8L 1MCPL 1A21A 1KENH 4DKAA 1LMKA 5KAQF 3IS1X 3M1BB 3VWJC 3ESUF 4LVNB 4OM1L 3VDCA 1LEKB 5I71B 2EIDA 3KLAB 4JQVA 5IM7A 3UZEA 1NL0L 3WSQH 4MJIB 4S11A 4YQXH 4AYFA 4Z76A 5CEXB 5AYUH 2VITB 1KELH 1V7NH 3IDUA 2MCG1 1RQ5A 3MNWB 4S1DD 1LO3L 4JREC 4OD1L 5HXMA 2UZYB 3WL9A 2UVFA 4ONFL 1MH5B 4JZOA 2JIXA 1G6VK 4YC2B 5HDLA 4WI9A 1OAQH 3C5SB 5IB1A 5EZOH 1OP3H 3PL6D 3GBML 5T5NF 1PKOA 1FFPA 2DQJH 3MJ9H 3KLAA 2GI7A 1ONQB 4L3EB 5FM8A 2ATPA 4EVNA 2GFBB 3PGDA 4Y5VB 4KJWD 3SE9H 4KVCH 1JUFB 1JGUH 3BXNB 3EOBB 4AEFA 3T2NH 5HPMA 3MGOB 3ARED 4IMLA 4LAQH 1YMMD 5IG7A 2RB8A 4MAUL 4HIEB 3WD5H 4O5LH 4P9ML 1IGYA 2R1WA 2XN9E 2P5ED 3RNKA 3MRNB 3TBYA 4PG2A 1QFHA 4PP2A 2P7TA 3ALWA 4HIXL 1MREL 5C2UB 2IQ9L 3BW9A 3UBXG 2CPCA 5CJQH 4YDIL 1A6AB 3N06B 1M6OA 2DYPA 3IF1A 5KVEL 2Q8BL 2IPTL 1F4YL 3DGGA 4Z8FH 2DQUH 3HPLB 5IVXA 1F02I 2ICEA 1GZPB 1I1AD 4OLXH 2YOCA 2X89A 4L29A 3QDHA 1FN4B 2XICA 2JF1A 3MRHB 1J8KA 4PBXA 4C57C 4NN7B 1XZ0B 4PREB 1V3KA 1P7QA 4G8IA 3ZKNC 1E27B 3ARDC 2Q6WB 3H3PL 4P9MH 4AEIH 4DVBB 5JZ7D 4JZNA 4HHAA 2D9CA 1SQ2N 5HJ3A 3G04A 3QH3B 3VA6A 1TCMA 4XB7A 5C8JA 4OLVH 3TZVC 3BJLA 2IALA 3QBTB 5C09E 2IPUG 1T22B 3CFBA 3VXSE 2IPTH 3RGHA 1CICA 2DWEA 3TCLB 2M8XA 1S9XA 3VE0B 3LQAH 4WCYL 5DUPL 5MHSD 3MREB 3WJLA 4P2RE 3VXMB 5IFJB 1QRNE 3GZKA 4TSAH 4OKVB 4PGDA 1NFDF 1CICD 4BA8A 2CIIA 2G5BA 3L3KA 3VXRD 2FECL 1GPOH 5D71L 5F88B 3HE7B 4Z0BL 5F89A 1R24B 4JRXB 1IC7L 4YQXL 1ZEAH 1JPTL 2XT1B 3RX5A 3KXFB 3TZVA 3HR6A 1UM4H 4NQSA 2R15A 4QF1A 1T0MB 4NQCB 4NKQB 5TF1L 5KTEL 1OTUD 1JPFB 2J6EH 3T3MF 4JFFA 4PY7A 5I30L 4G9DA 1FVCA 1TJHL 1FIEA 2IAMC 5FXCH 4WWKD 4KJQD 2AJ3A 4QEGA 3Q6FA 5GGRY 1G7IA 4CMHC 5JPNA 5DUBA 3HMWH 1CD0A 4BH8A 1ZA3B 1CXKA 4HD9A 1WVZA 1CR9H 1QEWA 1MRDH 1IT9H 4K9EL 5L2KB 4MB4A 4W70A 3MXWL 4P59H 1N2RA 3MOAL 3ZKXC 3QDJA 5I2IA 3TF7C 2PYEE 4MNGA 4MXWH 4BUGA 4P3CH 2ZUTA 4N0FA 2ARWA 2E7CA 5HPMB 2D7QA 3MCKB 1J18A 2HVKB 3HNSL 3UZVB 5HHNA 2R8SH 1F4AA 2C4XA 3UPCA 1Q9OB 2ZOLA 3STZA 4LSUH 4AH2B 2EDOA 1HINL 3GSWB 4R0LC 3FFDB 1FZJB 5DZOA 5BVJA 5INCB 1CFVL 2EIZB 1QFUL 5I1HL 1HCFX 1MUJA 3JXAA 2ED9A 2WLYA 5AYQA 3PWUB 2CKBA 1N7MH 2I9LA 4OUUB 1GGBL 4TSCH 4KQ4L 4WHCA 1FL3A 1A9EA 2AEQH 5E8PA 4PJIF 4HAFA 5FUOH 3TVMD 4ZFZA 5ADPH 2YN3A 1JZ5A 4G8GE 1Q72H 4HXAH 5EPMA 4HKXB 3E2HC 2VZOA 4NQCA 2VWEC 5D1XC 4OFKA 1C7SA 1MQKH 2BOCB 3V4UH 3DLQR 2GAZB 1HYRC 3FCTB 4KK8C 4HPOL 4WTZG 4E42B 4NHUA 3G6JA 2QSCH 1ZGLB 1U95B 4KMTH 2XRAL 2G9HB 3PHOA 4KV5F 3IFPA 4RIRB 4KGLA 1MIEL 4EI6A 4HV8B 4GW4A 3UJJL 1CICB 1KYOK 25C8H 4KTEH 3TP4A 2IH3B 5LGHH 5EU6E 2UZIL 1N0XL 1UZ8B 5IUSA 4ZXBC 3PHQA 5GSVB 3HE7D 3DTXB 3BGFB 3CLEL 4OQTA 3BW9B 4M7KH 3HCVA 2A9NH 4P5TA 2JB6B 3KXFD 2WWKT 3TT1H 2WIIB 2KBGA 1AP2B 4NQCD 3EAKA 1ZS8A 5B3NA 1QBLH 3A6BH 4LLAA 4YFEA 5JO5A 2HWZH 2BNQE 3JVGA 2W0FA 1DQQB 1KB5B 2D2OA 2JCCE 3BWAA 3EYQC 4WHTA 4ZTOL 4LHJB 4Q6YA 5EU4B 1HIML 2DTML 2XKNA 4DN4H 2E9BA 4Y5VA 2EC9U 5EBMA 4ODSH 4YGAB 1EMTH 4YK4C 5HYQA 3PWUA 1EAJA 2OTWA 1GH7A 3QRGL 3NIFF 2NW3B 3H3PH 4YHZH 3D87B 3ZE0F 3KAAA 1E4WH 1TXKA 2ZCKH 1IGYB 2DLFH 2J8UF 3FRPA 3ZKND 3WS6A 4BFGA 2ICWI 3LQAL 1GC1L 4WCYH 1UH3A 4YR6B 2HFEA 5GRWA 1WCBA 1H3PL 4G9FB 1F4YH 1DL7L 3ZT7A 1YEGL 5B39A 1QSFD 5IFAH 5DYOA 2XXMB 5C08E 3U1SL 3QQ9D 2EECA 4AIXA 2A6KA 4EEEA 4HS6A 5GGRA 4I18C 4LRNH 3QAZB 4M1CC 2EE6A 5K9OB 1OTSD 3DRTA 1FV1B 2G75A 3T09A 3MRHA 1YEHH 2AEPH 4CADA 1SMOA 5F7EH 3GM8A 5FB8B 3OKEA 4ZFGL 4OI7A 3DTXA 4YJZL 5EO9B 1PYWA 2EIZA 4Z95H 5HGBB 3ECBB 1BWMA 3ZYIA 4ELMB 5FM5M 3FB8A 4OF6A 1ZV5A 1C5DB 1F42A 2OL3L 3BDXA 4PJEA 4AJ0A 3IDMA 1EMTL 4WHYG 4BSJA 2IANA 5DD6A 4IHOB 2IQ9H 3VXSA 4ISVA 5J7CC 1FV1A 2FNBA 4HXBH 3EZJB 3MUY1 5IGXL 4J23A 3BIAX 4K7PX 5EIQA 1CU4L 1U58B 2UUDH 4RBPH 4DAGH 3PNWB 3L5XH 4ODUB 1QBBA 4JZJC 12E8L 1I7ZA 5ACZA 2A9ML 3ARBB 5ALCL 4AM0B 3C09B 1RV6X 1TQCB 4YUEL 1JZ4A 2FIRT 3PL6C 1DBKL 1UQSB 4N0YH 3V5KA 4X6EA 3WEXB 2AW2A 2PYFA 5AZEH 3GIVB 4M7KL 4WDIA 4K3JL 3O2WL 3W11C 3MA7A 4QT5A 3P9MB 4WW1B 4GQPH 2WUCH 5GIRB 5FYLE 1MY5A 1VPOH 1QRNB 4EZMA 1TQBC 2H45A 4OCWL 1OAQL 1YA5A 3MPCA 1MCLA 2BXZA 5BXFA 3O4LB 5IHUH 3JV0A 5SX5K 1FNGA 4PLNC 4Y2DA 4G8EB 4J2XA 3KPNA 2X05A 4X5LA 2XY1A 2NNAA 4DGVL 5E94B 1SM3L 2JB5L 3RZCA 4U1NA 5FK9A 1I1AA 4OZGB 4RGND 1RZGA 2RJMA 3VFRB 5GJSL 4XNZB 1MCQA 3MRIB 1MCKA 3DRQB 2CJUL 4ZXBA 3ARDD 4L4VA 4LSPH 5D7SH 3NIDE 5CJ8A 1UB5B 5IJKA 1BIIA 5IB2B 3DYPA 2PYEA 1DSFL 1QLEL 1MRFH 2D31A 3HFMH 4M1DL 3DVNB 4MSWA 2Q86A 3WHXB 3RKPA 1UJ3B 1QSFB 1T2XA 4P23D 2XWBA 2Q8AH 2ATKB 2DKMA 1S7WB 5HY9B 1FJ1A 2J2ZA 4K3DL 3LKNB 4KJPD 2ADJA 2X4NA 4NQEA 4LSUL 3ZLQC 1SM3H 2JB5H 3RWIA 3LMJH 4C56D 3FO1A 1BEYL 4KK8D 5TFSH 4BUHA 5IOPB 3LSOB 5IIEB 1JPGB 4U49A 1R5VA 1J5OH 4F2MB 3QUML 4NP4L 5BOZG 4HS6B 3ES6A 4N8VA 5CMAB 4DZ8B 4LQFH 4PJEF 3WXWH 4JPVL 4NZTH 4RRPA 5BVPL 1KFAL 1INQA 3NAAL 5MEOA 5IVNA 4U6VL 1JZ8A 1NJ9A 1KLGB 4NQCE 1MRDL 1KF9B 4UT9L 1OL0A 5E2UL 4IRSD 5L2JB 1I75A 4U1MA 1RURH 1IE5A 1YUHB 3FN0H 1CGSH 2O5YL 1UWGH 1EJ6A 4XP4L 4FXGB 3IVKA 1X5GA 3EYQD 2HT4C 2P47B 3BGMB 1WZMA 2A9MH 4WI4A 1D9KC 3ARBD 4J3TA 3BKYH 3P11L 5HVWA 4J4PC 3UTPE 2VDNH 3MUGA 3DHMA 3MRPB 4XH2A 1PSKH 4YZFF 1ZEAL 4G3YH 4B53A 2PYEB 3JTSA 1QOKA 5IQ7L 5GZNC 3C60D 3HC0A 2YC1B 3HNTL 2P1YA 1ZWIB 2R29H 3R4DA 5HHQB 2DD8H 2DYPD 1BOYA 5EH1A 2W0FB 4AEEA 4QNPF 5F1SA 3RPIA 1P4BL 1CIDA 4GKOA 4R4BB 1A7NH 2NX5B 4OZHB 5GRUL 3ULUE 4UQ2A 3L3GB 3GI8H 1N3NB 5FYJH 3TC9A 5I0DA 3SKJH 4JHWL 2GJZA 2YD7A 3MLUL 1DUZB 4H20L 5EBWA 5F8QC 2ZCLL 3S35X 5E1HB 3LAFA 2Q7NA 4BM7A 4Z9KB 1MCEA 1ZLVH 3EW3B 2OBGA 3SDDD 1ITBB 4NKIH 5T33H 3FB8B 4CN4A 4GRWF 4JO2H 1PZ5B 4Y5YB 1MJUH 4LSSH 3O6ML 2BNQB 5DVOA 1HHGA 3UMTA 1MHCA 2NY7L 3L3IB 2HMIC 1MJJB 4RRPG 5GS0L 3OKMA 5ICXA 2DLFL 1N6QL 5C7XH 1U8PA 1X5FA 2A1WH 2VOTA 5IW1B 3ARBA 3QI9C 4OZIB 5FIEA 4MJID 4GXVL 4JGJA 1QPXA 4GW1A 1JIBA 4P49A 4GXUN 5F70A 1NGWB 4XGZB 3F6LA 2XWBB 1RUAH 1X3DA 3N1MC 1I9JL 4H5SA 4MD0B 3QFDA 4NN7C 1MCCA 3OKEB 3GSQA 4YGVA 4PP1D 1XCQB 2O5ZH 4GAYA 1ZANH 3B4NA 1S7QB 1Q1JL 3GSNH 4MA1B 4ACPA 3V4VH 3OR6B 1FAIH 3CCHA 4ZUSA 5EU5B 3HAEB 1A1OB 4G80A 2R56L 3ALPA 3QA3B 2P46B 2RCSH 5TE4L 3WNKA 4PGZA 2ZOKB 3O41B 4PJFE 4AMKL 5JHDE 1CF8H 5E94A 5CINL 4UT7H 1INQB 4TULL 2Z35B 2F54E 4NSKA 4JQVC 4MNQB 1FG2B 3V79C 5DQDH 5ITBL 4E0RB 4JFPA 4ODUA 1ZT1B 4MCZA 2WWKO 4BFIB 1IAIL 4LLDA 1HHJB 2X1OA 3GRWL 3GHBL 4XMPL 3MYJA 1B0RA 2ERJC 3C08H 2X1XR 5MERA 3AMLA 5E2VH 1CFSA 3L3DA 3O2VL 1XF4A 4OSUL 4L8CA 6CGTA 4PJAE 1MAMH 5JW5A 1KCUL 4NPYB 4FQXB 2G5RA 1MRFL 1J10A 1D7FA 4ENED 3P0YL 4F9LC 1KENL 4E0RA 5C09B 3VGAC 1KBGH 3PWJA 1NSNH 1L6ZA 4P4RB 4G6KH 3QG7H 4LU5H 3RA7L 1NEZG 2VDRL 1F3DH 2EDQA 2Z8WC 1IGFH 1Y6KR 3OPZL 3LKRA 5DEFB 4UIKL 3VXPB 5I8OL 4Q7DA 4RWYH 1MPAL 5CEZD 5A3IC 3R0MA 3HE6D 4JO1H 3EOAB 3SKUD 1GGTA 3H9YA 1E6OL 4O4YH 2A6DA 3DOSA 3DX8B 3MRBB 1BREA 2HJFB 1WIPA 1NUDA 4ONHB 5I66B 1X9QA 3MLZH 2DB8A 4JE4B 3QDGD 2HJLB 2B8OT 4OT1L 2DL9A 3U0PA 1VEMA 3MRNA 2R23B 3MJ7B 2ZNXA 4MZ3A 2VDLL 2X42A 4U1LA 1DVFA 1A64A 3DXAE 3EOYG 1Z9MA 2C4FU 2H3NA 5JMOC 4LCUA 3VFNA 3TA3C 4JFHE 5JIHA 4NSKB 5J12B 4JRXD 1GJIA 5DJ0B 1T3FB 1NUGA 2R1YA 5DO2C 4E9LA 1EBPA 4NQEE 2VZTA 4JVUA 5HGHA 4YX2L 2BSSB 3TNMA 4PV8B 4Y4FA 4XTRC 1CF8L 5ID0B 1RU9H 1WWWX 3H9HB 5EIIB 5BS0D 4AK1A 2PXYB 1VGKA 1H3TA 4L3EA 2OK0L 4N0YL 5J0BA 5E6ZA 3GJEB 2WBWB 4PGCA 5ERWA 2OP4L 3OXRA 1CD1B 3BH9A 4U6XA 5C2BH 3BO8A 2FECI 4S1DC 1EK3A 5IKCA 4Q58C 2R2EA 5TQ2L 2IH1B 1CLCA 1YN6B 1OLLA 4YGVB 4ODVH 2EDWA 4EN3C 3B9KA 2V2WA 1UZ6F 1B88A 2IF7A 3V7MA 1QR1B 5BCAA 4FG6D 3AY4C 2Q76A 3NCEB 1WICA 1KJ3H 2R1XB 3NIGF 2YSSB 1IQWH 3QHFH 3VI4F 4U1JB 1TTFA 3OKDB 3GMPB 2YEZA 4NNPL 1H5BC 5HBBA 4OGXL 3AB0C 5CKGA 4X5XA 1KIRA 3M17A 3V0WL 4PR5B 3GIZH 5SX5H 1NUFA 4GLRH 3V0VB 3UJIL 4CVWA 3UO1H 5C0CA 2O93L 5ICXB 2ICEB 4KY1L 2GKIA 2H1PL 4G6JL 1QHPA 5IB1B 2NY7H 4XVUC 4FQXD 3LQZA 2F53E 1ND0B 1K9TA 4PRID 2XOTA 5L6YH 1Q8MA 4HUMB 1RZKH 1NAMB 2ENYA 1RK0A 4I48A 3L95B 3CFCH 4JGMA 4HPYH 4LLYA 3N0PB 5T33L 5C0ND 4XP9H 3NCYP 3U7WL 2GK0A 3TVMB 4XCFL 4H5SB 4MD0A 4NO2B 5C8JB 3H42H 2HG5A 4I2XA 1F00I 1EZVX 2EDBA 5CIPH 4HAGA 2GIYA 2FJGA 1XR9B 4P57B 3UTTB 1QFOA 2QJDA 4XBEL 1DBJL 3QFJD 4Q74A 3GJFA 4YBQC 4G80B 2NY2D 4FQCH 2AXGB 3V95A 1MAKA 2DQIH 1J1OL 4OF3A 5I76A 3W0WD 3Q48A 1NQBA 2XZCH 4WFHD 3DGGB 1L6XA 5BV7C 3X13A 4NKIL 5IROC 1I3GL 5DRXA 1T1YA 4J8RA 4ZOCA 1AQDB 1T89C 1WAAE 1WSST 5CZKA 3SDAD 4R3SB 4IRSA 4KDTA 4YEFA 1CFSB 4HMEA 4QTIH 2CSPA 4K7PL 3RL1B 3UTSA 1A7NL 3ZKMC 1SBSH 4XC1H 4MJ4A 5TPWL 4O51A 4F15C 4ONGH 1I7RB 2P45B 4WRLA 4S0TD 2B1HL 3KPQB 3HI5H 2RFXB 2HRPH 2J8UA 2VB5A 3TO4C 2JK5B 1MRCL 4KRPB 3W81A 4PB9L 3VD4A 3U9UA 3WSQL 1RVFL 1S7TB 4RISH 3P9WB 2VLMD 1F5WA 4LCWB 5FOJA 1Q9WB 5F6HI 4H8WL 3EO9H 3F12B 1DCLA 3QUMH 1LP9E 5E4EC 5BZDB 4M9PA 3L3KB 5I6XB 3ABZA 2QADD 3E3QC 1LO4H 5IKCB 3MRQA 2I9TB 2Z31A 5C6TH 5EUOA 4JZOB 2VDQL 1DQML 1SJEB 5HGDB 2C3XA 3MLYH 4IRZL 5D1ZB 4UV7H 1Q9KB 1KELL 1V7NL 4MDIA 5C0GB 1NAKH 1NMCB 3NPSB 1U3JA 5J6GB 2MNUA 5C0CD 1IBGL 4PJ5D 5HHOA 3EYUH 4MAYB 2R2BA 1BPVA 2E9WA 4DQOH 5A2IH 3G04B 2A73B 1Y6MR 3D2UA 5I15L 4M6NH 2R1YB 3NZ8B 4XP6H 3CXDH 2EO1A 4GQ9H 3ULVC 4IJ3C 4O4YL 5EO1A 4C54A 5CSGA 3QNXB 5FYJD 35C8H 1MPAH 1I1YA 4Z77A 1BX2A 2ARJQ 4P59L 3M07A 3CVIL 2AJYH 2Y07H 4NWUL 2JJTA 4NC0B 2ESVD 1CR9L 4XVJL 5H94B 1I7RA 4GW5B 4DN3H 5C08B 1EBAA 1MJ8H 4RWYL 3IF1B 3OXRB 4XMPH 3TBVA 4MHHI 4DGYL 3BZDA 4TTGA 5T1KB 2IH1A 4P46A 4QWWD 3WN5B 1A14H 3T2QA 5D7SL 4EI6B 3WKNA 2EE2A 4P3CL 4X6DA 1IGTA 4ZD3H 4LGPB 1LK2A 3VGDA 1QD0A 4PJBE 3INUL 3DXAA 3FT2B 1XF2B 1FLRH 2RQ8A 4PRHE 2D7MA 2YEZB 1NAKL 4P2QE 3S8WA 3BYYA 4LPUA 4K9EH 3C5JB 3EOBA 1OT2A 2F54B 4PR5A 1QYGL 4N9GA 1R3JA 1U8IB 2IG2H 1ED3A 3GM0A 3P9LB 3QCUL 4DW2L 1PLGL 2GEEA 4J1UB 4U6HB 1TPXB 1JZ2A 4PFEA 4JQIL 4M7ZC 3T0AA 4P4KD 4EDWH 4JM2C 1QRND 5E4IA 3VXOA 1JYXA 5L2KA 3FQUA 5IFJA 1EGJH 1ZANL 1B0GA 5C70A 4M48H 1S7RB 4ELMA 3MNWA 3MZGB 4X98A 4P48A 3G6JB 2MQ3A 3WS6C 3E8UH 1XGTB 3REVA 1YN7A 4LCWD 4PJ7B 1IC4L 4G42A 4KWUA 3SGEH 3W5NA 2A0LC 1CGWA 5DJXB 4QYOA 4UDTB 5ETUB 2PO6B 1IAKA 2FH8A 3MV9B 2CLVB 2OSLA 3IDNA 5IT2L 1A4KB 2H6PA 3SO3C 2QADB 2D7NA 1YPZF 5AUMB 4JRYE 3BH8A 2YRZA 3MJ8B 3U4BH 5DJDA 4HCRA 2QR0B 1AFVH 3D69B 4MNHA 3EYFB 1UG9A 5F6HJ 1FZKA 2BCKA 1XIWD 3MO1A 1A5FL 2NTSP 5T1KA 5IMKB 1D5ZB 3ZTJH 3SJVE 1OPGH 3PQYB 4IIQA 1FSKB 4MAYD 1J1PH 1CTNA 3BUYB 3BFOA 3WFCH 4WFFD 5GGSY 2DD8L 3QDMD 3C60A 2WWMD 1IMHC 2UUDK 4OFIA 4RQQA 4IS6B 4Z7OF 1BFOB 2BJML 4ZS6C 1CDYA 1JHTB 2ESVB 3NGBB 1VADB 1AKJB 2JK5A 1KB9K 3FT4B 3RI5K 4YAQA 1TZIA 1JHLH 3RVVD 5C08D 1S7TA 3RU8H 2YHGA 2VLKB 4OZGA 3CFJA 4Y7MA 3MGAA 4A6YH 1B0GB 1HILA 1T1WA 4LRIC 5E2TH 4LASH 4YHYC 4OIAA 1TZGL 2WIIA 1YNTB 3MRCB 3NMEA 3SE4C 3T4YB 3B8YA 3FFCB 1HQRB 4YHNA 2UY7A 4RA0C 4I77H 2E9JA 4M43H 3EDEA 5SWSD 2UZIH 3L5HA 5BMFH 1FRGL 2P5WB 3QUZA 4R96B 4EOWH 4L9LB 4GG6E 1LVEA 3BD5A 4OD3L 1HQ4A 4TOYH 1BZ7A 1QYGH 3PIQB 1LEGB 2IMNA 1A7QL 4JFZL 3GMMB 5FYLH 3AREC 1SEBB 5DJ2B 5HDQH 1CG9B 2Z92B 1NL0H 4EKXA 1LK3H 3DPBA 5HI4C 3CLEH 3ULSA 1Q72L 3VG9C 5A1AA 1OWRM 4FP8H 1NCBH 1BP3B 5HVFB 4PG9A 1XGRB 4N5UA 1V3MA 5HYEA 1T66D 3WIHA 3MX0A 4QGYA 1FZJA 4Z7VB 3V52H 5D7IE 4BJLA 3VXSD 2XIDA 5I9QC 1DSFH 4FXKA 4JDVA 4PGBA 4PJGE 1G1YA 4LIQL 5E1AB 1T04B 3DHJA 1Q0XH 3BE1H 5C0IA 3MRQB 1Z9LA 5CJOH 4OF5A 4Z6AT 2VAJA 1FE8H 4OLUL 1P2CB 1A4KA 1OOAA 1L0XA 4LSRH 3QXDA 4K3DH 3ROOA 2ZNWA 3GNML 2NY6B 4CVZB 4XT1C 3CPLA 4LCWE 3PQYD 3BH8B 3CFKA 4ORZC 4BZ2H 3EO1A 3T0EC 4EDXB 3DO7B 1VFAB 2AJYL 5IOPA 1G9EA 2PUQT 4PS4L 1A22B 2AJSL 2CK0H 4M1DH 1I8MB 3EGSB 1A7RL 3FZUC 4UIMA 2NTFB 3C5ZB 3VI3E 5J6HB 4WFED 1A7OH 3MXVL 4IDLA 1TCRA 4RNRB 3V5DA 1IGJB 2ZKHH 3VRLE 1XT5A 2LFGA 3O4OC 4DZBA 3U79A 3PHQB 5GSVA 4X0KB 1FE8L 4OLUH 2PR4H 1BQHA 2XA3A 5F96H 1NGPL 2EYSB 2QQQA 3VFSB 5KW9L 2F19H 5CSZB 3MRRB 1QNZH 1BQLL 5FA3A 1DUYA 1MJ7H 3GDBA 2BOBB 1HHKA 1ODAA 1G7JB 1ADQL 1RHFA 2MHAB 3HC4L 5FDYA 5SWQB 4QYOB 2MTPA 3QXVA 3J7HA 3S6CA 3U0WL 1HKFA 4TVSa 1OAYL 2OJZL 2AV1A 2CQVA 4O2FB 3KLDA 3O3DA 3T77B 1VACB 3AAZA 3NTCH 3QJFA 4TUKL 5JW3H 5DJYA 1SJHB 4B7LA 1FORH 1QKZH 5CCKL 1WLHA 4FXKB 4NRYB 2AGJH 4FABL 3H3KA 1UWXH 3FT3A 4POUB 1PKQA 3SQOL 4MQXD 1HQRA 3BGFC 4Y4KA 3FQXB 4XC1L 1G6RA 4FQ2H 1J1OH 1H3WM 5FO8B 1U93B 1WBYB 4XGZA 1YEIH 1OGAE 4YLQT 2Z4QB 1PEZA 3L7EB 2FR4A 3BPCB 4M7LH 3H9SA 4OLWL 2Z8VC 3T77A 2N7AA 4X6CB 1EVUA 2N1KA 1JPTH 1SJHA 3GMMA 4HUWA 1UACL 1S78D 3X12A 4LAJH 2Y36H 3HE6B 5KVGL 4Q9QL 3OKNA 3DBXB 1ZS8B 5T1LD 3PE9A 4PJAB 3RGVD 2F8VA 5H2BA 3ARGB 5GGUA 3UEZA 4GRLB 2MJWA 1GL4B 4HW6A 4GRMA 4QHLB 1EGJA 2IMMA 4KHTL 2C1OA 3V6OA 4JRYA 3L7FA 4JHBA 3DV6B 5D5MA 2DQUL 3OAUH 2VABA 4ZQKB 4RGMC 4CU6A 3VFWA 1XF1A 4HS8H 1JI1A 1R5IB 4ZUTA 3QDME 1WFTA 1CFQA 3LKSA 4Y5XA 5DMGC 3GIZL 2MCPH 3MO1B 4XPGL 5A3ID 4UV4L 1ULVA 5C9JA 1U92B 4O2EA 2R2HA 1RIVL 2VO5A 4ZODA 4V1DA 4N9OB 5CFHA 1J12A 4YHKL 1LILA 1RZ7H 4GRLA 3RY6A 1S9YB 2Z31D 2FGWL 4E41B 5KS9E 4PJHF 1HHIB 3VCLA 4WI6A 1B90A 3AFLA 5I8CB 5IHBA 1BFVL 4AM0A 4I3RH 4JFEE 3RY5A 3TBWB 1MSPA 2E5EA 4HKJA 1W72A 4QCIA 3O0RL 1PZ5A 4Y5YA 1CYGA 5EORL 5EU5A 1MCOH 1KN2H 2HLAB 3IFOB 1KN4H 1KSRA 4XVSH 4LVHC 2R0LL 2C3HA 1S7WA 1M7DB 1RY7B 1EHXA 2X89D 4FZ8H 5HI3D 1FIGL 4OCMC 3O3BB 2XTJC 5FKPB 4M4PA 4MXQC 1UKQA 4AZ8A 5I75B 3BP5A 4LGSB 3NCBB 1HHJA 4QHKJ 4XCNA 1U41A 1X5KA 3I75A 2W38A 3MTRA 3FO0L 3C9NB 4WV1A 1FYTE 4WJ5B 1OLZA 1FQ9C 1B4JH 1UENA 1KGCD 2AXFB 2VN7A 1A3RH 2WBJD 3NA9L 5FOBB 4OCYH 1BAFL 1DQJB 5ESVA 2NY0C 1BVLA 4PJIA 4U1NB 3DO3A 2HKHH 1FBIL 3F7VA 2R4RH 3LD8B 3VFUA 1KACB 2VDOL 3CNKA 1MIEH 4ZNEE 4ZO7A 5I73B 1NCUA 3I75B 4ODHL 5JR1H 4ONFH 2DMKA 5F1KC 5AZ2L 3QUYC 4Y5XB 1OAKH 1RHHB 5GJTL 1U3ZA 1G6RB 1RZJC 5DT1L 2R2HB 5DK2A 5I1GL 1TCRB 4JM4L 3V5DB 1D5MA 2YMXH 4PGCB 3KPRB 5IJVA 1XGPB 3RUGA 3CVHA 1A7RH 5KAQG 2ICWA 5DZLA 5B21A 2FIKA 3UTTD 3JWDH 5ALBH 4OZFA 1DVFC 4I4WB 1MHPH 1L9NA 3ARGD 3WUWA 3CH8A 5FUOL 3QUYD 2D7TH 3BX7C 3MGTB 3ES6B 4N8VB 4I13B 1HHKB 3QEQA 1KCUH 4U1JA 2IBZX 3O45A 1EEZA 3QXTA 3T0WA 5TDOB 3KYOB 4TN9A 3L3OA 1G6RL 3HNVL 2EH7H 4KJYB 1OW0A 5DMYA 1T3FA 3OX8A 1MOEA 1YECL 5DJAA 5E24E 3SDAB 3GGWA 2A6JB 5IBTL 5FM4A 1VSCA 1FGNH 1S7UB 3DSFH 1FC2D 4HGMA 3WLBB 3EIFA 5KSAA 5TQ0L 2Z93B 4QWWC 4NRXA 5SWZD 1YNLL 2B1AH 3VI3F 2BNRD 1YJDH 2FO4A 3CLFL 1MVUA 3MJ9A 2P8MB 5CJBA 3FRUB 5GGTH 5BZWB 5DLMH 3QXUA 1UGNA 1CXHA 5E8DH 1T7YA 1DN0B 4KKAC 4GUPA 4KRPD 4QRQA 1UXSB 4XBPB 5L0QB 4KI5F 1Y6NR 3LN4B 2DQEL 2VLME 2FWOB 3V8OA 3BKMH 4M6AA 5DR5H 4AMKH 1RZJL 1U2CA 3MOQA 1KIPB 3WS3B 1U3HA 1WBZB 1MAJA 2APVA 1CLZH 2H3NB 4BYHA 5I18L 4OM0H 2NNAB 4KVNL 3K46A 4IRSC 1EXUB 5AG8A 4G8GB 3EFDL 1M7IA 4WI8A 4DOHB 4GAGH 3HC3H 2NXZC 1K8DA 3A6OA 4UTBL 1UJTA 2QQKH 4HG4J 5DMKB 3ZL4L 5FCSH 3QIWC 3REWA 3VJ6B 3JV5A 1S5HA 5D7IB 4R7NB 3TJHD 1U8LB 1ND0A 1RUAL 3DURA 2YD2A 5DFVD 1CK0H 2HH0H 4DFIA 4X4YB 4RFNC 1ZGLM 3C8DA 2DN7A 3L95A 3F65A 1F13A 5FYLD 4G5ZH 5CGYD 2VKWA 4YPGA 2VAAB 1OGAA 4NO0D 5KG9B 3DX8A 3MRBA 4I3SL 4G6AC 3C2SA 5DXWA 3BPOB 5EUKA 5JTWA 1FG2A 4JFDE 1G9MH 5FHAL 2J8UB 4C4KO 3LPGA 3MYZA 2BC4A 3UC0L 4CMMB 3O11A 3JTSB 1MLBB 3KPRD 4U1HA 3RAJL 4X7FC 5ACLA 3QCTL 2ORBL 4WHYH 1R3LB 4N8CH 3F8UB 4PJCF 4R90H 2EDEA 3VGFA 2H32B 4RMTA 1DE4A 2P8MA 3BN3B 5E5MB 3VU2A 1BBDL 4TUJA 3NCYS 1LD9A 1F4HA 1UWEH 1DBJH 4X9GA 3SOBH 1A47A 4PJFF 4WEUD 4XPGH 2MCPL 3S36H 4FQLL 4QY8A 5DDHA 4RAHA 2OR9L 4YBLB 4HULB 4TSBH 3WMSA 1GVIA 4TNWF 4L8SA 5CGMA 2ADGB 5FYJL 1ACYL 1KJMA 2F54D 5HYIA 3GMLB 5INDB 5KJRH 2J1KA 1F3JB 1TIUA 4ZTPH 4Z7OE 3OHXB 5D6DC 3MUGB 2VLJD 1F11A 3MA9H 2W59A 1NDMB 2HJKA 2OXHA 4KZEH 1IEAB 5EC1B 3WE6A 1X7QA 3SDCA 3LEYH 3HRZB 5JW3L 1ZT7A 3NFSL 5DDHB 4NRZA 3UO1L 1H3XA 5GS2H 4F8QA 3QQ4B 2GTWB 1LE9B 5EZOL 3PABA 3D6GA 3TWCL 3P77B 2NW2B 4AL8L 4LSVH 1W0YT 1SY6L 3RPIB 5AD0A 5DR5L 3SBWA 4C83B 4P3WA 3EO0B 4RAUA 2HWZL 1KEGL 5JLZA 4I1NB 4KHXL 5EC1A 3WE6B 4PYHA 3LEXA 4PV9A 4NWTL 4IDJL 4XPAL 1CGSL 3R06A 1I8IB 2VUOA 4U1HB 3WFHB 3GSOB 5LAXB 5ITFB 4JFFD 5ID0A 4LLQA 3TN0D 1EERB 3LDBC 4POZC 4YDKL 1RSFA 1TVBB 5ID1A 3WFZA 4KDVA 4LPXA 1XIWB 3SKOB 5IF0B 1HOCA 1A14L 2FRGP 5SV4A 1ZMYA 3U36A 5AD0B 3INUH 3TT3H 5DLML 1A6ZA 2RFXA 1RU9L 4RAUB 2YR3A 2UWEA 2P43B 5I1LB 1Z0MA 2VC2H 5C0RH 4YX2H 1HSAB 3FAXA 3MV01 3IJSA 2V5RA 3EJYD 1A6WH 4IM8A 1YC7A 3QDMB 2IQAA 4Q0XH 2R23A 3OAYK 1MFDL 2CIKB 4RDQF 3U7AA 3HR5B 4IMKA 3AS3A 1UXWB 1MFEH 2UZXB 4X80L 3RUGF 3KPSD 1AKJD 4X9IA 1QZ1A 1R5WA 4NWUH 5EUKB 1CLOH 2I60H 4M7LT 3PQYE 1D9KA 4CDGC 1PX3A 1C16A 2ADFL 3LB6D 2V7HB 4GBXA 4QOKE 4WFGE 4P4RA 3VFOB 1VPOL 4DTGL 2XZAL 4NO5B 3DVIA 3IDNB 3IU3B 3O8XC 3O4LE 4JM4H 5D2NC 1S7XB 3S37H 4I0PC 2EDJA 4XTRD 5J6GA 1N5AA 1OM3H 3UXFA 3V6ZB 5KSUA 1D3CA 5ISZD 3QULA 3ALXA 2LVEA 1CE6B 3IFNH 5HGAB 4D0CA 4OJFH 1FL5A 4Z18A 4U6XB 5MEQB 3MRDA 4D0BB 1K8DB 2R69L 2VDRH 3D9AH 4O02H 1D5ZA 3TNNB 4KKLC 3EO9L 4PRDA 1YYML 4AEHH 5GGVH 1UB6A 3B83A 1Y0LB 1JN6B 4I0PD 3SGKC 3VXOB 3IU3A 5MERB 2X4TA 1NCCH 1CT8B 1C08B 2VLJB 1D6EB 1IZJA 3TO4A 1EV2E 4X8XA 5D7JD 1BD2B 1JPFA 3BSZL 3H2WA 4K9EC 4U0RC 3TIEB 1AQKL 3H7LA 2H2SD 1P5VA 2YS4A 1QSFE 3WIFA 4V2CB 1A4JB 3PV6A 2V2TB 4HK3N 4PJGB 3RZWA 2OL3H 3KYKL 1JE6A 4PJCB 1A8JH 5DURB