1ZHBB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A structural basis for CD8+ T cell-dependent recognition of non-homologous peptide ligands: implications for molecular mimicry in autoreactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zhbB00
1T89C 4ZXBA 3WIHA 5C3TA 1C7SA 3CXHJ 4XPTH 3WMSA 1B6DA 2ATPB 4U1IB 2ZOKB 3TBTB 5HGDA 4JFED 1MH5A 2AXGB 2PW2A 3IAQA 1OTUD 3W0WD 3NZHH 1TCRA 2NY6B 2BSRB 5C0AD 4M5YH 5DZLA 4JFQA 5J9PA 1CTNA 4P59H 5DRZB 4F7CA 3QCUL 3KDMA 3MACH 3NOIA 1SYVA 4KWUA 2J1KA 3UTTD 3BFOA 2NNAA 1HHGB 1I85A 1U8JA 5HYSA 1QQDB 4PV9B 2GYSA 3ARFB 1V7NH 4YDLB 3GGWA 3HC0A 3X3GH 1J8KA 5J12B 3MTRA 4Z95H 4OCLC 3MZGB 2Q8BL 3F7RA 1GOHA 2JJSA 2NXYD 3FN0H 1BBJA 3REWB 1QBMH 3SE8H 4KKAC 4M1DH 4KROC 1XF2A 2ZCKH 2YZ8A 1NGXA 4WNQB 4BSWB 3VH8G 5KAQF 1LHZA 4D3CH 2AJUH 1NL0L 2C3WA 2O93L 2VLRD 2JELH 4L8DA 1MFBH 4L3CA 2Y6SD 4LVEA 5GRUL 1XF4B 1KIQA 4H20L 3MXWH 3V0VA 1NFIB 2GW5A 3LSOB 4NCC1 2FWOA 4ALAH 4PJIE 4X4ME 1NEUA 2NY4C 5H94B 3BT2H 3V0WH 4HD9A 1T5WA 1F4WL 4OZHF 3EYUH 4RDQF 1U42A 4QRUA 2Z92B 2VDRH 5IVOA 2VN4A 3U9UB 4Y5VC 4DN3H 4HQQL 1AHWC 4KHTH 1O7VA 4PS4L 5MI0C 1FZKB 3RWHA 3OKKA 4MWFA 3WUWA 5CSZA 3S35X 2BK8A 4WW2B 3TO4D 4DVRH 3LS5H 3GHBL 2YD9A 1SY6L 3EIFA 2M2DA 5HHOE 2APWA 3I3BA 1V3KA 1NC4D 5IBUB 3DV6A 3TBVA 5EUOA 5DJAA 3GHEH 3ZYOA 3P3YA 2XA3A 3AS1A 4YHKH 2IANA 3V7AG 3G5ZB 2DTSA 4X0KA 5FCUL 3QFDA 4H1LA 5I8EA 4NUJB 3AY4A 1ZLWK 5MEND 1A6ZA 2B39A 1YMHA 4D0CA 3PXJA 1QP1A 1NMAL 1JGEB 5D9SB 5D7JD 1B6UA 4YK4C 1GHFH 4IRSA 4XXDB 1YC8A 1XH3B 4XWGH 3FO2A 5F21B 1BQLH 4JFYA 2SEBA 3MNVB 3D2UA 3QUXC 3CFJB 1SM3H 1NMBL 1RUKL 2B4CH 1J0YA 5E2VH 5IGXL 5L9DL 4N9GA 3EO9H 4OM1H 3B9KA 4OCNC 4ZNEE 5C0IB 3BP7A 2CLVB 3OMZA 4O2EB 1DANU 1DTUA 1XGPA 4NC1E 4GAFB 5J3HD 2P1YA 3S37X 3RJQB 1PZ5A 2AERT 3C8KB 3RNKA 1MPAH 1KTDB 4O4YL 1C16A 4DN4L 4WHTB 3QRGL 1N7ML 4ZUUA 3RBSA 4MJIE 2DDQL 1OAZH 3IGAB 1PKQB 1IAOA 2MCPL 1EO8H 1GGBH 4Y89A 3O6LH 2Q20A 4IOFC 1AJ7H 4GRWE 2ARJQ 1RU9L 1P9MC 3HRZB 1WFTA 2W9DH 2ESVE 1P7KA 3CFEA 2R4SH 5IVXE 3N85H 1N5YH 4EXPX 1WIPA 4QRRA 1MIEH 1PSKL 4ZDHA 3MC0A 4I9WD 3FFDB 4MMXC 4FQHB 1BGXH 1LMKA 4LPCA 3ALXA 4OFIA 4ZXBB 1EBPA 3VFRA 3KR3L 1WT5A 3HB3D 4L4VB 1YEFH 3UTZB 2JTDA 4X98B 1IGYA 3HI1B 5HGDB 3HZMA 2VC2H 3CIQA 1MH5B 1IE5A 1IC5L 5C0FA 2PW2B 3MBED 3EUUA 1S5IL 3NABL 1O7SA 4AIXA 2MTPA 5EC2A 4QTIL 5SV4A 4EI6B 1CXKA 5GS1A 1CDCA 2YA2A 3LZFH 4LNRA 4JFQB 4F57L 2DQTL 4E0RB 3ZDXF 4ODUB 3DVGA 5K9KB 4F7CB 5CEXA 4ZS6D 3KDMB 1ORSA 2A1WL 1SYVB 4JEGB 4U6VH 4M5ZL 4NN7C 4PRIE 4TTDC 2F8XC 5HYSB 3WSQH 5GHWH 4WO4D 5EU4A 2XTJD 5HGBA 3O4LB 5LVEA 4L9DA 3QPQC 3DMMD 4LSUH 1BBJB 4Z7UF 1CICA 3PIQA 3P9LA 1XF2B 3VGEA 4IOSD 3WIIL 3O4OB 1P84K 4JR9L 1T6WA 4J4PA 4L8DB 5L2KD 4L3CB 4WVRA 5E4EB 5EBWB 3K8KA 1KIQB 2ITCB 4LVOB 5E7FA 2UZYB 3MRNB 1F90L 4FFYL 4FFZL 1HQ4B 1VACA 2QQLH 1OSPH 3SOBL 1FO0A 4LCIH 4Q6IC 1S9XA 5IQ7L 3SDXE 3CU7A 5GGSA 2DQEL 3FKUS 2YMXH 4P2CG 35C8L 3ZDYF 2NX5D 5DQDL 1QSFA 3ARWA 4MCZB 5DO2D 5IB3A 4C58B 3WHE0 4XMPH 5CCKL 1I4FA 4Y19A 1A1OA 5D7IA 3OKKB 4MWFB 5CSZB 1T1XA 1M71A 3ULUC 43C9A 1KN2H 1TZGH 3D0LA 5BO1H 4WI8A 5EUOB 5I30L 1IMHC 2OJZH 2W91A 4LCCA 2IANB 2Z35A 4XPHH 4QRSA 1RSFA 4LKXB 3MRLB 3HMXA 3V8CA 1AR1D 1YPZB 5I8EB 3UDWA 3MNZA 4L8CA 3BJ91 2RBLA 2PO6C 1A6ZB 4X6DA 4U1MB 1TPXC 4NRZA 5J11C 2HFFA 1EJOH 3DJ9A 4GRMA 1HKLH 2ED8A 5FUZH 1T80A 4EI5C 4HWEH 1DDHB 4IRSB 4QF1A 4EDXB 1Q72H 4RMVA 5TPWL 3G04B 3ARED 3U9PH 1BHGA 3RBGA 5T1LB 5DJDB 1ZHLA 3D2UB 1MFCL 1W0YT 4HF5L 4FFWC 3OF6A 2MFNA 3BXNB 4D9QE 2CLRA 1G1CA 3O0RL 1GAFL 1P4LA 1F4YL 3D69A 3QHFH 15C8H 4PJHB 5TE7H 3BP7B 3BYTA 1XGPB 2DMKA 3CVHH 4XXCA 4Z7VB 1CL7H 1TNMA 3RNKB 3Q5YA 4NRYA 5GS0H 1C16B 3PUCA 4K9EH 1U91A 2JE8A 4ZUUB 5TDOB 3IFOA 3AS2A 3ORJA 2OL3B 1IAOB 2WM0A 2ICEB 4P2QD 1KPUA 3OBAA 3G6DH 1U2HA 1BZ9A 1YMME 4HFWA 1WWCA 1HE7A 4GS7B 1TZHB 1WFOA 3VI3F 1JNNH 1Z9SA 1EFQA 2GI7A 4H88H 3TH4T 4LLYA 1DQQA 4FNLH 4HGWA 1P7KB 3T0EE 4WFFD 3GK8L 1FVCA 1RFDH 3O41A 2E27H 3I6LE 5FGSA 2EE2A 4QRRB 4ZDHB 1K9TA 3DECA 3AB0C 1DN0B 3D87B 2DQHH 4HDIB 3S88H 1EFXD 1IT9H 1FNSL 3MNWB 3HG1E 25C8H 4S10A 3MLYH 3WKNA 1AO7E 1B90A 1L7IL 1IGYB 1NEZA 3HZMB 3ARDC 4MXVF 2X4QA 3MCKA 3P30L 2J5LC 5C0FB 3ZKMD 4P46C 4YHIB 1A7BA 2BZDA 4PD4K 3MODH 3N1GC 4J3UA 1UACL 1QFWI 2O26U 1ZMYA 3NCJH 4KKBD 4YE4H 4L4TD 3DV4A 3FRUA 4LSVH 4HH9A 3CUPB 1CR9L 1ED3B 4KK6C 4LSPL 4H25B 3X12A 3HA0A 3GMMA 4PJIA 1SVZA 4TVPE 3R8QA 2JJWA 4OF3A 3ILPB 3DSFL 5FYJU 1ORSB 1JI2A 4AZ8A 1HINL 4PV8B 2NY3C 4OGXH 3JWOH 3MV8A 2ADIA 4H5SA 2WLYA 4JCLA 5F3HA 1F8TH 1OAKH 2OQJA 5FDYA 1ZLSH 4D9LL 1GXEA 5EU4B 1CGWA 1A3LH 2KPNA 1C8PA 2CGRL 2X4NA 1MJUL 3NFPB 2AEPH 1BJ1J 1BLNA 1CICB 1RUPL 3PIQB 3TH3T 1RUQH 3MRMA 4QO1A 2NY0B 3VFOA 4LP4A 2Q3ZA 5C0EA 1SMOA 5JORB 1V7ML 2EDRA 5HHOA 4PJ9D 4TVPH 1W0WB 2XY2A 3DUUB 5IJVA 4HUVA 2HTLC 2ZPKL 2WMPA 1D5IL 3QISA 5I1HH 1I7TA 4QRPE 4KRMB 1JHLH 4OCXH 2NYYD 2H8PA 2KDGA 1R5IA 5LGHH 1I1FA 3CPLA 3C5ZA 1FYTE 2YPLD 4JFPA 1KJ3H 4RAUA 4P99A 5CEYA 3VFUA 2R9HD 5IMLA 3P2TA 1U8KB 2HT3C 3PP4L 4HJ0D 4W70A 2FD6H 4PBVC 5IWLA 1H3WM 1GGCH 4OCMC 1I4FB 3KWWB 4Y19B 4NNYA 2RAMA 4OUUB 4GAJL 5D7IB 2DWEA 4FQXD 5HHVL 2C4XA 3SDCA 1OGAD 2QQKL 4QNPF 4M48H 3D0LB 4ZTPH 4F7EB 4OV5A 1M7DA 2Z31A 2GKIA 1MEXH 1T5XA 3ZT6A 5E1AA 3H7LA 3QQ4A 4HIIB 4LCCB 1KFAL 3BQUB 1Y0LB 2Z35B 2W0PA 2X4SA 5FYLL 3LEXA 2WK2A 1FL6B 3FQUA 1AGCA 1U3HD 4LL9A 4K3DH 2RIKA 3WXVL 4L8CB 1N0LA 2RR3A 3GRWH 2E5EA 4S1SL 1NMCB 1DBAL 2OMNA 4NRZB 3EBAA 3P4OA 3TJHC 2XNAA 1OAQH 3ULSA 4L3ED 4QF1B 3ULUL 1MI5E 1I7UA 4X7FC 5SX5K 3QXDA 4N8PA 2P5EB 5JOPD 5E2UL 5L7XL 2VXTL 1CK0H 4D9RD 1ZHLB 3LIZH 2Q7NA 2YSSA 2CLRB 1VFAA 2VN7A 2ZSVA 3D69B 1RULL 2AW2A 4N1CA 4PGZA 3T4YA 3RP1A 1D5BB 4IDJH 5BJTA 4NQVA 2B2XL 2UVEA 4FZEH 1T0PB 4HK3N 4P57A 2ZSWB 3L5XH 4NRYB 3OAYK 4TNVK 2Z9TA 1U91B 4HJGA 4CU8A 3IFOB 1ZANH 2CJUL 1P5VA 1PKOA 2CSPA 4PRHD 4EUPG 1B4JH 4BZ2L 1BZ9B 1P5UA 2EEDA 3MZTA 4HFUH 5ACLA 4KKLD 4MAUL 3G9VA 4LLYB 5TH2A 1DQQB 4Z77A 3ZE1E 4HGWB 3H7BA 2F53B 3OR6A 3MLSL 3S3JA 5KOMC 2QR0B 1FVCB 1KNOA 3V8OA 1A7RH 3O41B 2DWDB 2X6MA 2FR4A 3CLFH 3ESUF 4JKPH 4G6FB 1TLKA 1MHHA 1X5IA 2DLHA 3SDYL 2FGZA 2AJYL 5C0CB 5K9QG 4R0LB 3RX5A 3RZCC 2F54A 3SGKC 2XV6B 1QRNB 2XQYK 4HIEA 3VCLA 3T3PE 2J2ZA 2BXYA 2HMID 1EVTC 1K3ZA 1NLDH 2A6JB 3V6BR 2HLAA 2WV3A 5IQ9A 4Z76B 3VG0L 5DMIH 2QHLA 4QWWD 1FFNA 2VLJA 5B3NA 1RZFL 3FRUB 3MLZH 2HT2C 1IAKA 3H9HA 4OZ4A 3UTPE 3X12B 4E41A 3K4DA 4KZEL 4U0RB 3MRQA 2NLJA 4IM8A 5LGJA 5SWSD 3O2VL 2IGFL 1NQBA 5DUBA 4QHMB 1OP9A 4Y4KA 4H5SB 3IKCA 4JDTH 5F3HB 4PJ7A 2OQJB 3LQZA 2QJDA 1NC2A 5F1NA 2XICA 5T3XL 3L3GA 2X4NB 4RMSA 1DP0A 5GGQH 1ZAGA 5L0QB 1BLNB 3MRMB 4RZCA 2ED7A 1K4CA 2ZJSL 1U8MA 5EO9A 5C7XL 1TVBA 2Q3AA 2ZKHH 4BK5A 4GH7B 4WEUD 3E8UL 1T04A 1M1SA 2AXHA 1MY7A 4RGNB 1JNLL 3SGEH 1NANH 5D5MA 1UKQA 4JM2C 3QIBD 1I7TB 1UZ8A 2R0WL 2WNGA 5C0JA 1SJVA 4KI5C 4RWYH 1DCLA 3I02B 3RWGB 2X4PB 3C5ZB 4P5MB 4RGOL 4RAUB 1U2CA 5CEYB 5CD3A 3CVHA 3RX8A 1MJ8L 3VFUB 5IMLB 1MFAL 4ESKA 1JGUH 3BP6B 4WTZA 1GZQB 2GEEA 3O8XA 3IDUA 4LPWA 1CS6A 3K4ZA 4OIAA 2OCFD 5IMMA 4NNYB 5KANI 2CQVA 2DWEB 4MVBD 3UROR 1K2DA 3SDCB 4I13B 3SO3B 3ROLA 1S7SA 5F9WB 4XAKD 5H35A 1HHKA 5DI8A 3BP4A 1M7DB 2Z31B 4OV5B 1YN6B 1T5XB 3MR9A 3BDXA 4LEOB 1WWAX 3RDTD 4YDJA 3ARZA 5EU6E 4JZJC 3TZVC 4RMUA 1AGCB 3KLHD 4MB4A 3EO1A 3D9AL 3ULVE 3P4OB 2XNAB 1LNUA 3KYAA 4OZIB 3UTTB 3FQRA 3ULSB 2YPKA 3B2VL 1I7UB 2OJEA 3UTQA 2XWJA 2Q8BH 2YSSB 3IDJB 5FOJA 3U0WH 4GLRI 4KHXH 1UQSA 5IVNA 3D0VA 1AE6H 2BC4A 5BOZG 1I1AA 4UDUA 4P5TA 3O6ML 2Y7QA 4H26A 4NQVB 4PIRF 3U7AA 5BZDB 4G43B 5CEZL 4P57B 2FX8L 3H9SE 2DI8A 4F7TB 1XGUA 2AEWA 3TGXA 1R3IL 4LFHG 2ZP0T 4P4RA 4KU1A 3B5TA 1EDQA 2AGJL 1F4WH 3SQBA 4MAYC 4ZNCD 1CU4L 1MFEL 5HHPB 4HQQH 2X40A 4MLSA 5KOVC 5TH2B 1WICA 5JZ7C 3H7BB 3OR6B 4GAYA 1HHIA 4KGLA 1BOGA 1KNOB 1AGDA 1I8LC 1U93A 4LSQL 4EJ1C 4O9HL 3E0GA 1TQCC 1TJGH 3TO4B 4Z7OF 4LCWE 3VGAB 2KZ1B 2QADD 5K33A 4AEFA 2Q1EA 1P4BL 4NKMA 4Z0BH 5JIHA 2JCCF 2F54B 5JMRA 5FCUH 4HIEB 4Q9CA 5CINH 4DW2L 4G80B 3BZFA 2HLAB 3BPLC 2E6PA 1PQZB 5GRYA 4YXKH 2GFBA 5D7JB 3C9NA 3OGCA 2VLJB 4APQC 1IAKB 5FGCB 5GISH 5DR5L 3QDGE 1TVHA 4OZ4B 2CMRL 1REIA 4QRPA 1QSEE 4N0FB 2FBJH 4E41B 1Q9KA 3C8HA 3ULUF 3KPTA 4LOUD 3ZT5A 4RRPG 5LGJB 4JREC 5DUBB 5IGXH 5L9DH 4F2MA 4KV5E 3DYPA 4Y4KB 1MAML 2YD4A 3IKCB 4PJ7B 3L7FA 3LQZB 1NC2B 3T2NL 3ARTA 3GRWA 1HSAA 3PGFH 3ZHDA 1FIGL 1TETL 3INUH 2JJTC 2QSCL 4DKDC 2R1YA 4KJPD 4O4YH 4RZCB 1K4CB 2COQA 2KBGA 4LHUA 1U8MB 5EO9B 1TVBB 3CSPA 3QRGH 1N7MH 5HHQA 4UBDD 1PG7L 4Y4FC 2MKLC 5EBMA 1MAJA 1QVOA 5T5FH 2XACC 5DK3A 1FNGA 3MV11 4KTEH 2XYCA 5JXAL 4HPOL 5D5MB 2XRAL 4X80H 1K8IB 2PKDA 1UZ8B 1V5JA 5C0JB 4XX1E 1R24A 2H32B 4EN3C 2G5BA 2FO4A 2C9AA 2P5WD 2VSDA 2IJ0C 3O3BA 5I9QC 1HYSC 2NY2D 3GBLA 5JOEA 1H9VA 4LBEB 3SJVD 3LV3A 1BQHG 4ONHA 2J6EL 2BNQE 5KVDL 1JGVL 1PSKH 5FM4A 2CD0A 3MRPA 4C55A 5T3ZE 5CGTA 1QKZH 3BGFC 3EDEA 5IMMB 3KR3H 3MA7B 3G08A 4J8RA 1FSKB 3BKML 3HUJF 3IJHA 4PRNA 4OAWA 4G7VH 3ROLB 4MQ7A 3U4EA 4JDZA 1EEZA 4R8WL 2J4WH 5EN2B 1VHPA 1IC5H 1HHKB 2H45A 5DI8B 3M45A 1RZKC 4X8XA 3CCHA 4NO5B 2VXUH 4YDJB 1TENA 3K1DA 3OHXA 4NN5C 1D9KC 3PE9A 5CLWA 1U92A 5DRWA 3QJHB 1S7UB 5D7SL 4OGAD 4P23A 3HE6D 4IDLA 3L3OA 5I15L 4TYUA 4XGZA 5CHNA 3EO1B 4YNYA 2A1WH 4X4ZA 2AVGA 1LNUB 4M5ZH 1CXEA 1YNTB 3FQRB 2EDXA 2UVFA 1P6FA 1H3TA 3TIDA 2OJEB 4HLZH 2PW1A 3OR7B 2R2CA 1BWWA 2H2SD 3QZWG 3UTQB 4M1CD 4P9HL 3DMMB 1BFVL 4M4RA 5I1CL 1HIML 3GNMH 3MQIA 1WV7T 2QKIB 3ARPA 5I1LA 1VERA 3TVMC 4J3OC 1I1AB 5J8OA 3KPRA 4UDUB 5DJCB 5DJZA 1XZ0A 4JR9H 1GL4B 2Y7QB 4KDVA 4H26B 5L2KB 3BP5A 1DLFH 4U6HA 3LB6D 2B7DT 3TO2A 1F90H 2IG2L 1I1CA 2EDNA 3BPNB 4FFYH 1E4JA 4FFZH 4PTUA 4XNQA 5FYKL 1XGUB 5ENWA 1HZHL 3C60D 3UCRA 3SOBH 4P4RB 3V9FA 2OR7A 5IQ7H 1MCOL 2EEBA 35C8H 2IALA 5CGYC 5DQDH 1CTOA 2EIBA 2LTQC 3L9RA 3MYZA 4JG0L 5LBSH 1MIML 1CF8H 4GAYB 1HHIB 3GUTA 1BOGB 2IAMD 1AGDB 4K7PX 2QHRL 4J3SA 2WAHA 5FM5M 5KS9F 3T4AB 4I2XE 1A7NH 4IIQC 4XAWL 3FOMB 2VXQH 4OI7A 4TOYL 3C8DA 4OZHB 5I30H 3U6RA 2O5ZH 4PLOB 4NKMB 4RGMC 2VLKE 3VFTA 4HKBA 5I73C 3DX6B 5F70A 2H41A 1HILB 2WW8A 5HHOD 4P48A 4YC2C 3O3AA 1EO7A 3BZFB 3QI9B 3MUZ1 3D39A 5IB5B 1UG9A 5D6CB 3HI6L 1J0KA 5HGAB 2GFBB 3C9NB 3OGCB 3WN5C 4FQLL 2EO1A 4AENA 1XT5A 2XXMB 1TVHB 3CFBB 3U1SL 5TPWH 5FYJE 3MV9A 1A7PL 3AREB 5I1EH 3TN0B 4KTDH 4XHJD 2FEEI 1MFCH 2OTUA 3REVA 3QNZA 2W0FA 5D93B 1GAFH 4F2MB 1SHMA 4I0PD 4TUKL 2DQUL 3MSPA 3CU1A 3NCYP 3PGDA 1KTRL 3L7FB 1ZWIA 3QXVA 3GMPA 4OI8A 3KPLA 4B53A 5EC1A 3KNBB 1NAKL 5EWIL 1UM5L 1K5NA 4UMGA 1KLFA 5CUSL 4LHUB 3T2QA 1CI5A 5EBMB 1QVOB 1FNGB 3PV7A 1A7QL 1ZT1A 1E4WL 4LK4A 5DT1L 4WUKH 2R23B 1RHHB 3G6JF 4Q9RL 4DGYL 5EU6A 3EYSL 5E6IA 4K3GA 3NFNA 2XZZA 4MJID 1R24B 2G5BB 2FO4B 5MEOB 1JIBA 4CVUA 1JK8A 3VXME 4FQJL 3MRIA 4R7DA 1Z3GH 2ZZUT 3GK8H 5TF1L 4YZFE 4EBQL 1AFVL 1F97A 1NAML 1KYOK 4PJGE 4FQ1L 3NGBB 5EIIB 3MRPB 1KPRA 2XA8H 5SX4H 2ESVD 4JO2H 1RZ8A 4ZFOB 2D03L 4AMKL 3AM8C 2WWMD 3QIUC 3G08B 4HULB 3O3UN 4GAGH 4PRNB 2E9IA 4OAWB 3TNNA 1L7IH 3ARUA 2AAVA 5D8JH 3U4EB 1INEL 1X44A 5TFSH 5ITFA 1JUFA 3B2UC 2F58H 3VXSA 4K71B 3P77B 3WEXA 5BS0D 1FNFA 5ERWB 1UACH 3RKDC 4NZUL 1T3FA 3OHXB 1JN6B 2X7LA 4UI2A 2L7UA 4NOFA 4MQSB 1U92B 3UJTH 1CR9H 1SY6A 4K94C 5D1ZA 4P23B 4LSPH 4NQUA 3L3OB 5TE6H 2GUOB 1ORQB 4Q9BA 4U6XA 3HS0A 5JIPA 4XGZB 5CHNB 3MGOA 3V7AE 4YNYB 3UZVB 1CD1A 4LCUB 2PTTA 4R4FH 3BKYL 1A4JA 4J7RA 5C08E 5EU3A 3L6FB 3GBML 3FB7A 5GGSY 5CBEA 3V5DA 2CGRH 4HW6A 3BE1L 3T1FB 1IARB 1MJUH 2BNRA 4G9FE 4PRID 2KKQA 1K85A 1RUPH 3WS6C 2BCKA 4LQ1A 1I7RA 2A6DB 4K7PY 5I1LB 5TQ2H 4KZDH 4GW4A 5FHAL 3GSWA 4PJ9B 1N64L 1XZ0B 5IG7A 1Y6KR 5FUOL 3Q3GB 1C7TA 3BP5B 3QDMA 4M6AA 2BVUA 1RUML 1ZOXA 1Y6NR 3TO2B 5I16A 5KVGL 3RWCA 4PTUB 4XNQB 5L6YL 4Z7UB 5ENWB 3W9EA 3QIWC 4PJ5B 3LD8B 4HC1L 3QT2A 2P47B 4QXGH 4YBHA 4YUEL 1W72B 5K93A 2NXZD 4HIXL 1QLRA 3PNWA 1JTOA 2V2XB 3L9RB 3PP4H 4DUVA 5IBUG 2G5RA 5F44A 3QDGA 1QSEA 3OKNA 1XIWC 4YJZL 3GUTB 2QSTA 4GAJH 4FQXB 4MSWA 5HHVH 4YHZL 3HAEG 3MLTB 1OGAB 2YD1A 2QQKH 5DVMA 1ZHKA 4I1NB 1KN4H 3FOLA 1NFDE 2IFFH 3U6RB 4HBCH 5KVFL 3SN6N 4PJAF 1A6AA 2DLFH 1IEAB 1L0QA 1J7VR 3LQAL 4X4YA 3WXVH 4UQ2A 1JMZA 4KPHH 4FABH 4S1SH 3WD5L 3D39B 2I25N 3O45A 1F4XL 5IHBA 4L1HA 4V2BA 1LEKB 1ZT7B 4OKDA 3JV4B 4AENB 3ULUH 4GXUM 3CSYB 3MV9B 3CK0L 3A6CL 5L7XH 3H3KA 2VXTH 4FQQA 3ARGC 4XP6L 1JHTA 4XPFL 3REVB 3M8OL 5GS0D 3U7YL 4MXQD 3V4VL 2W0FB 4FFVD 2Q86A 1RULH 3PGDB 2HRLA 3PL6A 1MCNA 1ZWIB 4RISL 1UYWL 3GMPB 1N59A 1MCQA 5EC1B 1PDKA 4KAQL 1AGBB 3AU1A 3C5JA 4I5BB 1T89A 3OGOE 1RZIA 4D9QD 5L88L 5F7EL 4RIRA 1Z9OA 1OF2A 4TN9A 2Q8AH 1AIFB 4MA8H 3QWRD 3CMGA 1FNLA 4HLJA 1BOYA 3JVGC 2BSSA 4PLJD 1R0AL 1H3PL 4PRHB 1LEIA 1B88A 4UT7L 5FKPA 1IC7L 1ZT1B 5F7YC 3TP4A 4XVUD 1JI1A 4MAUH 5A1AA 4N0CC 1JK8B 3MLSH 2Y07L 4R7DB 3RX7A 1JF1B 3ZTNL 1YMMD 1MFDL 4N0YL 1FHGA 3STZA 1RK1A 2NW3A 5FA4A 1A8JH 3FO1A 1KPRB 3A67L 3ZTJG 3V6OC 5BVJA 4LSTL 3T0ED 1RZ8B 2AJYH 2WANA 3WO4B 4HWBL 4ZPVA 2JB5H 3I6LD 4FG6C 3FB6A 3GSQA 1G84A 4ZUSA 4XI5C 4E5XB 2NR6D 5ECJE 5I8KH 5F7DB 4Y1AB 3C08L 1JUFB 5JW4M 4NYLA 3WEXB 4P2OD 5E00A 2I60L 3HG1D 4NPYB 5EZIH 1T3FB 3VG0H 1FP5A 4OD3L 5ESQB 2AV7B 3EJYD 1AO7D 2X7LB 3QBTB 1RZFH 3BDBA 5HYSG 4U49A 2B1HL 5CIPA 3MCG1 1T0NA 5IJKC 2XKUA 4U6XB 1JWSB 2ATKA 3HS0B 3MBXL 1TMCB 3I2CH 5LXGL 1HI6A 1QFUL 3OX8A 1CD1B 2PTTB 3PG2A 1LEGA 3GSNL 5SWSB 2I9LA 4KK8C 5JA8B 5EU3B 3ARXA 4DUWA 3RWEA 1ODAA 4TVPD 5TDNA 1RJYA 5CBEB 1JE6A 4Y5VA 4YQXL 5DGRA 2GK0B 4ZFFA 1AHWA 1RK0A 2QQQA 2ZUYA 4U1GC 2BCKB 5FB8A 1I7RB 4Q2ZA 2JJUA 1KCUL 4UT6L 1NSNL 2XFXA 5CJ5A 3JV0A 4GW4B 1CD8A 2BXZA 4K94L 5C09A 3E8UH 1T7VA 5IG7B 1BD2D 4YO0A 1OP5H 2BDNH 5DD6A 2PYEA 4XZUB 4Y16A 2R0WH 3RWCB 5KBNC 1HWHB 5EOQL 1IBGL 5DMKA 1PFCA 1RVFL 1LK3L 3B3IB 3W9EB 1Q1JH 4PRBA 5ANME 4RGOH 1MJ8H 2BOCA 1S9KC 1MFAH 1IKFL 4JKKA 1BZ7B 1K8DA 5GXBB 3WNNA 1FGNL 1QBLH 3OKNB 1FYTD 4F80A 4MSWB 1LK2A 3VWKC 4H1LG 4YHML 3QUXA 3SEPA 1OAYL 4ZXBC 3Q5OA 3BAEH 4PRAA 4JO4L 1KCVH 4GW5A 4PBXA 3FOLB 3PWNB 1XCQB 1A6AB 4MD5B 3O9WC 4OLVH 4XPAH 4GSDL 1FL3A 2XN9A 3VD9A 2MSPA 4NGHL 5GSRA 4UQ2B 4GG6E 2ENYA 3DX9A 5I2IA 3HHRB 4WWKD 4IRZL 1BIIB 2DMCA 3D9AH 2X1QA 5IVZA 1L0XA 1MCFA 4Q9QL 2DIBA 2YZ1A 1OY3B 4Z7QF 1J05A 3B2VH 4MCYB 4AEHL 4WHYH 1PGRB 1WAAE 2ZUUA 4ZOCA 4S1RL 3S97C 1P9MA 1BP3B 4FQQB 1DBKL 1MI5D 2Q86B 3RAJL 4LVNC 3PL6B 4TSCL 3PWPB 4YGAB 1X5KA 1N59B 1OAXL 1TQBB 1TJHL 1F58H 3AU1B 3MLWH 1FZOA 3X11A 4NO3A 1RZIB 2ITDA 1JTPA 3H42H 1R6VA 1RZGA 2P7TA 1LO2L 4RIRB 2FX8H 2PETA 2A2QT 4H8WH 3OL2A 1R3IH 2BSSB 2YC1B 4KRPD 4NKOB 2NTFA 2AGJH 3B9VA 5FKPB 1LO3L 4LVOC 3E6HA 5B39B 4LCYB 3MYJA 1CU4H 1MFEH 2BRRL 3W5NA 4MNQD 3EZ8A 1QFOA 1DBML 1V8HA 4KRLB 3MRKA 4LSQH 3NIDE 1RK1B 3CVIH 1I3RA 5KSAA 4V1DE 1IGMH 2VITA 4LQFL 4GXVH 5BVJB 2AABH 4WFHE 2QADB 3CZJA 1IQWL 4ZPVB 3VXUE 5IW3A 1HOCA 4ZUSB 4G9FA 2FEDD 3SKMB 4UV4H 1NUDA 2APTA 4KROB 4DW2H 4QHNA 1AI1L 3Q1SL 3VWJD 1D5XB 1FORL 4M43L 4WEMB 5E00B 1T20A 4J3VA 4N5EC 4OCRH 5IW1A 1D5ZA 3KXFE 1UT9A 3S36H 2QSQA 5F7WC 4G3YH 5DR5H 3QDAA 4PRPA 2ADJA 5CIPB 2A74A 2E8YA 1VADA 4XC3L 1D7FA 2NQCA 5MEQB 1FRGL 1HI6B 4IRSC 3OX8B 7CGTA 1KTLB 2Q87A 5DEGB 1LEGB 4Q6IA 4WUUE 4XWOC 1MAMH 2MHAA 3UTPD 2FO1A 1EEYA 2VB5A 3T2NH 3MUHL 4EDWL 4Y5VB 1FIGH 1TETH 1VPOL 3RU8H 2AXFA 4GKNA 5FB8B 4Q2ZB 2YUVA 3IFPA 2XFXB 4Q0XL 1PG7H 3TC9A 4JZOB 3NA4A 2EDDA 1JP5A 4LLVA 1A0QH 4XP1H 5I1GL 4PFEA 4YO0B 2PYEB 3DNKA 4JPKL 1TTGA 4Y16B 4ODTL 4Y7MA 5DD0H 5DMKB 3N9GL 4KI5E 1JRHL 2PO6A 3O2DL 2W65A 1NLBH 2Y9RT 5I6XC 2NY2B 1Q0XL 4GS7C 2BOCB 3GMRB 2B0SH 3K81A 3ABZA 2J6EH 4C4KO 1JGVH 5LJYH 1Z2KA 1ZA6A 4JHZA 1UB5B 4YBQD 1WBZB 4GOSA 1CT8A 1GVIA 1IGFL 1ONQB 1Q9LA 4WWID 1CDGA 4LSRL 2IBBA 3EYOA 5F1KC 1LK2B 5KANG 5HGHA 2P24A 5E8NB 1KIUA 3NCBB 2AJXL 3EKCA 4NKDA 2DRUA 4PRAB 2AJZB 2CLZB 2R1WA 4R8WH 3EFDH 1XGTA 1VEOA 2ED9A 4MX7A 1U6AH 2I5YL 3DI3B 2OZ4L 3B6SA 5EORL 1WZKA 5HI4D 3SGDH 1W2KT 3L3KA 2XN9B 4GBXD 5FOBB 3T3MF 3MV01 1T21B 4M03A 1RMFH 4HKXA 3HUJA 4XCEA 3D48R 1TVDA 3QDJE 5EU6D 2DD8L 1Q0YL 5E6ID 4K7FA 1MJ7L 1EVUA 5I17A 4JJHA 1J05B 4AL8L 1T7WA 3SKJL 3H2WA 4UINL 1MHEB 2Y23A 4EEEA 3QCTL 4L5FL 4DOHB 4PJFF 3ULVD 5ETUB 5F7FA 4UTBL 2C5DC 3IDGB 3L5WB 1Q9WB 3L3DA 3EOTH 5I1CH 5GRZA 5IHUL 3F12A 3SBWC 4J23A 1HXYA 1QSZA 2XQYG 3TA3C 4NM4L 4OIBA 4YDIL 5JNYB 3KPQA 3DRTA 4JLRB 4M6NH 1FZOB 4JB9H 3X11B 2NY0C 4NO3B 2ITDB 1BVZA 3RGVB 2EYTA 4RFOL 1G6RL 5BRZE 1RZGB 2FL5A 1UVQB 2ICWI 5BVPL 2IG2H 2EDTA 2W59A 1HZHH 3KYOA 3QUZD 3ARDA 3RVVC 2NTFB 2EYSA 4GMSH 3FZUD 4P46A 4JG1L 3E6HB 1QFWL 3H9SD 3TPKA 3FMGL 3U2SA 4C54A 4JG0H 1DQLL 1L9NA 3OKMB 2P8LA 4OLXL 5L2JA 2YEZA 5F96L 1CGXA 2CIIA 3MRKB 1I75A 3BO8A 4ODSL 5C70A 3T09A 4XAWH 5I19H 5KSAB 2VITB 2XOTA 4OKVA 1NKOA 5FM5O 3TIEA 4IOIB 5E8DL 1XAUA 4S11A 1JV5A 2ILLA 4PJXF 2YXFA 1YUHB 4LLUA 4LCWD 1MCBA 4QHNB 4JY6A 4LCCC 3BQUC 4HUWB 5E6YA 4OZGE 2FJGA 4L8SB 3RA7H 5KS9A 3IJYA 3HI6H 1T20B 5DQ9A 3OSKA 2JIXB 1GGUA 4FQLH 1EHLL 4Y8AA 4PRPB 4OLWL 2ADJB 3PDOA 4S0TD 3U1SH 4FMFA 4HS3A 2A74B 2JCCB 1RV6X 2KUTA 1GGIH 3LKSA 5GGRA 2DMBA 3SDDD 2YRZA 4PGDA 5KSBE 4OZFB 3W39A 4F15B 2M1KA 3QDGD 2H3NB 3HE7C 2MHAB 4FQ2H 2DQUH 3ARBD 4NN6B 2VZOA 4JCMA 1HDMA 1IGTA 4JJ5B 1UM5H 3NH7H 5CUSH 3DYOA 1EIBA 3CFCH 5I1IL 4UDTA 3HLAA 4U3CA 1ZVYA 5INDB 5ICXB 4M3KB 5DRNA 2O5YL 4XXCC 1NPUA 3VMPA 1AKJD 4CAGA 1K4DA 1CXIA 3TNMA 1E4WH 5DT1H 1X3DA 4NQCE 1G7IB 2GY7B 5J1AB 2DTML 5IOPA 1Z0MA 2K7PA 3PF2A 4NM8L 4DGYH 3QAZB 4W4OA 2FJHA 3QEQA 1RUAH 2B1AH 3AS3A 3OZ9H 4FQJH 2PO6B 4X9FA 2W65B 4ENEC 2QQNH 3WKML 3ROOA 4OV6F 1AFVH 1NAMH 4Y5XC 1WBYB 3WFDL 3DRQB 2Z93A 4O51B 4L3AA 4R9HA 1CT8B 2ESVB 3WLWC 1UXSA 5CP7A 1Q9LB 5IVXB 3EDJA 3EYOB 1EERB 5HGHB 2BNQD 2MKWA 3VXRD 2P24B 5T3ZD 3V52H 4U1KA 2R1WB 1TTUA 3O6FC 1GC1C 4ISVB 4R0LC 2OL3L 3QNYA 5BS0B 4MX7B 1EEQA 2DLEA 5HD8C 1KXVC 2FLRT 2BMKA 3OXSB 2Q6WB 3KPSE 2MQ0A 3UPAA 1GIGL 3BN9C 3S34L 5F93C 1DBJL 2GSIA 4HKXB 2K3TA 3HUJB 3MLUL 4XCEB 1VGEH 3W9DA 2D4DA 3WS3B 2WBJD 5HYQB 4NO2A 1EHNA 3ZYIA 3BKYH 1ZHBA 4PRDA 5I17B 5EOCL 2HH0L 3GBMH 3BOVA 4U0RC 2FECL 5INCA 3RVWC 5A43C 1RZKH 2H2PD 2UZIL 2C1PB 2HFGL 4F8TA 3M07A 1DANT 2WSKA 4NBYB 4N1HB 3VJ6A 2H6PA 1HXYB 4KKCD 3AB0B 5L0QC 3MJ8B 1N64H 4FS0A 3KPQB 3DRTB 4JGUA 4LSDA 4TSAH 4JFFA 5FUOH 4YHYB 2EDBA 5JW3L 4CMHC 2FL5B 1ADQH 3RZCA 4UV7L 3EYFB 1ZHNA 5L6YH 3CFKA 4RGNC 3MOBL 2EH8L 3WDHA 3OTTA 4M61A 4HC1H 1NFKA 3SE4C 1KJ2L 4P46B 4JRYE 4YUEH 3UTSE 5GRWA 3KXFA 4D2NA 3U2SB 7FABL 3C5ZC 2EC9U 2J8UE 2AJVL 2YEZB 5L2JB 4HJJH 4R2GD 3DETC 2CIIB 3MLRH 4XNXL 3BO8B 4YHZH 3F7YA 5HYJA 1JPTL 1T1YA 3VRIA 5FECA 4DAGL 2LE9A 5ACZA 3P0VL 1I8MB 4C57C 1SEBA 3SO3C 1JV5B 2EH7L 1Z6JT 3HC4L 1CG9B 5F9WC 1CE1L 4LLUB 3L5JA 5GJSL 2VOTA 2BJML 2J6EA 2NCMA 2Z31C 3S4SA 3UMTA 3TWCL 1OTUC 4JY6B 2H9GA 3D85D 2DM4A 3WD5H 2D31B 5E99L 2BRQA 2VLKD 2GJ6A 4PY8J 3S5LA 2VSCA 5D71L 2XI9A 3MMEB 4ZFZA 4ZQKB 5IROC 4EZMA 2VMFA 5DXWA 3FHQA 3PDOB 4PJAA 1WZ1L 2HKHL 4HS3B 3MREA 3DHJA 3UBXB 1DSFL 3CK0H 3A6CH 2XZQL 2E7HA 4JRXA 4XP6H 1D3CA 3LKSB 4XPFH 5GGRB 3WFZA 5ISZE 3W39B 5FYJD 5FHBL 4RISH 1UYWH 4HH8A 5I75C 3SKOB 5GS2H 2E7BA 2FSEA 1O5DT 1U58A 3QUXD 4XBEH 5I18L 4JO3H 2BERA 2HWZH 3GMOB 1T03L 4RA0C 4UDTB 3N50A 2A77L 5DRNB 1MWAH 3K8MA 1WFNA 3LKOB 3MLXL 4OLUH 4UT7H 3IDIA 1IC7H 1K4DB 2ZUQB 3TNMB 4B50A 5JIIA 4OSUL 2YUWA 3BKJL 5IOPB 4WGWB 1OT1A 5F9OL 2FJHB 3QEQB 1NBYA 3WBDA 1D6EA 3KJ4B 4PJBE 2X89D 3ZTNH 1MFDH 1SJHA 4IOFD 5ABDE 2Z93B 3NACH 4MYWB 2R2EA 3VXMD 4G9DA 4LSTH 3QFJA 1U8OB 3G6JB 4MA7L 5CP7B 4AK1A 3V6ZA 3TV3H 3TO4C 5D1QA 4QLRA 3VGAC 4OTXL 2BHUA 1BJ8A 4XPGL 3AC0A 4DJMA 4KJQD 5IEKA 4G42A 2I60H 2BMKB 4P2OB 3LY6A 4M4PA 4IRJD 4OD3H 1AO7B 4S2SA 3GM8A 2DM2A 1FFQA 2LU3A 4UUJA 4ZUTA 2B1HH 2GSIB 1S5HA 3NCEB 5D7JC 5EUKA 1A3RH 3B5HA 3MBXH 2W38A 2DIAA 3W9DB 1SQ2N 1TFHA 4LLAA 1DEEA 3GSNH 4WI9A 4C83A 4MAYA 3P73B 3QEHA 3R1GH 4M9PA 3QEUA 2EECA 5IK3B 4ZOBA 2VTFA 3NA9H 1G9MH 1GC1L 4WV1B 5INCB 1S7RA 4Q74A 5C08D 5I8OH 5GGVH 5F7NC 1KCUH 4UT6H 5DEZA 1I8LA 2H6PB 3DBXB 2A73A 2L4OA 4BSJA 4K94H 3UPRA 5J3HC 1CBVH 1GYAA 4G9FD 4NZJA 2VXVH 1BD2B 3PGCB 5KAQG 4I48A 2H26A 1BM3L 5FUCC 3GSXA 3QPXL 3RZCB 5C8JB 1PJ9A 5KSUA 1DQTA 5GIRA 5DTFA 3CFKB 1VEMA 3SGJA 3X17A 1MCJA 4M61B 2FGWL 2YD6A 1CFVL 4OZGA 2CKBL 4ODBD 3OPZL 3E2HC 3T08A 3BSZH 4F37F 4YDKH 1J1XH 1HEZA 4RDQG 4HK0A 4YHPA 1FGNH 4ZOAA 2P8MA 1FYTB 3EFFA 4PG9B 3MRCA 5FA3A 5E5MA 3F7YB 1IM9D 4YHMH 5MHSE 3D5OF 5HYJB 5KSBA 3VRIB 1KELH 1HQRB 2APBA 3GSVA 1BEYH 4JO4H 5IFJA 3MOAL 1VFMA 4I77L 1FSKC 3HB3C 3IB4A 5C0ND 5ACZB 2MPAL 1SEBB 3P4LA 2Z8VC 4YGVA 2P48B 1A47A 4X6CF 4GSDH 3UBXI 4BA8A 2JJTA 4CJ1A 2OYPA 1NAMA 5AWNH 3P40A 3OAUH 2DL9A 5F1SA 3VFPA 2VQ1A 3DI2B 4Y4FA 3CH1A 2GJ6B 3S5LB 2D3VA 2J8HA 4Q9QH 2D2OA 4MDJA 5AYUL 3KG5A 1ERNA 4GQ9L 2D9QB 4AEHH 3T8XA 4PJAB 4XNUH 5H2BB 3MREB 1RZ7L 3BZEA 1ZKAA 2AEQL 4N8VA 2W9EL 3HC3L 4EN3A 4JDVA 3MJ9L 3U0TA 4UIMA 3G9AB 4EI5D 3Q6FA 1E6OH 4LHUG 3MROA 1NGQL 4RMWA 1MI5B 4M6OL 3RAJH 4NCDA 2XTJC 5D70L 1OAXH 3QHZH 3QULA 3DMMC 1TJHH 3SCMD 2FSEB 3BH8A 4WENB 5E8EA 1FGVL 3WL9A 4G6ML 3C2AL 3EO0A 4M7JL 1I1AC 1J8HD 3KPNA 3V4PL 4GKSA 3THMH 3GBNL 3LRSB 3RRQA 4HUNB 3CDYA 4CVWA 3BPNC 4M7LL 1A5FL 2XTLA 4BH8A 1N26A 1HH6A 4FTVA 3KPSA 4XT1C 5E95B 1IZKA 1D9KA 2BRRH 1UH4A 4MS8D 1QO3B 2APFA 2VWEC 3HZVA 4MNQB 1D6EB 1WEJL 5F8QC 3IF1A 3K7UA 3ZDZE 1I9JH 1S78C 2F74A 1A2YA 2JJVA 4YIQA 2DLTA 5BXFA 5FV1L 5DA0B 2R2EB 3DIFB 3GKZA 1YYMH 1KYOJ 3PDGA 1YEIL 5JHDA 1U41A 1BBDH 4HC1A 5D1QB 3R0MA 2V5SA 2DQJL 5DJ0A 3LEVH 3D3VA 5CJOL 2W92A 1EGJH 1QLEL 3VWJB 2ZG1A 4M43H 1ZLWH 3DO3A 1MFNA 3CX5K 4JO1L 2FHBA 5IBLD 4G7YL 4RRPA 5GS3A 5D2LF 4HV8A 2E3VA 4S2SB 5E2WL 3QI9C 4PYGA 4DFIA 3ARDD 4UUJB 4ZUTB 5K9OB 1U8PA 3LDBB 3DXAB 4RAVB 4WTXA 5KZCD 2EC8A 4JFHD 5EUKB 1A6UL 1P4IL 1FRGH 1M6OA 3O3DB 5TF0A 3QRFM 3K2UL 4PUBL 1QSVA 2NY1D 1FZJA 1KBGL 4JRYA 5F1IB 4C83B 4MAYB 4WCYL 3AREC 4Z78A 4OCYL 5DJYA 3TN0C 3QEUB 4XP4L 2JKXA 2D7PA 1Y18A 4EDWH 5TJWK 1S7RB 1NCUA 3CAFA 2A6KA 5TGBB 2ID5A 2JK5B 2J88L 2CXGA 2A73B 4ONFL 4IIQA 3D25B 4Q0XH 4X6FB 5KTEL 1TZIB 5CILL 2VZ1A 3HPLB 5I1GH 1OGTA 4J2XA 5FDWA 3QQNA 2F8VA 2H26B 3AS0A 1CLCA 3GSXB 4TNVF 4JPKH 5IESL 3ARQA 3EYQD 3IS0X 4ODTH 4RMQA 3KLSA 4CVZA 5KSUB 5GIRB 3F65A 3PV6A 2Q7YB 3QQ9D 1PKQE 3RIFF 5E24E 4QTHB 2CDFB 3KYKL 3T1WA 2HTLD 2YRLA 3L7EA 4LIQL 1Q0XH 4YHNB 5DSCA 3QHTC 3PJSA 1U8IA 2DQFA 3ZSTA 1HEZB 4HK0B 4AG4H 5C0BE 4JPVL 4YHPB 1CFQB 1MWAA 1XFPA 5I1KL 2P8MB 4JKMA 3MRCB 3NGBC 5FA3B 5ISZA 2FEEL 1JWMA 5CZXD 1WCQA 4PP1D 1YN7A 4HX1A 2AJXH 3QXTA 4JVPA 5E08H 3GSVB 5IFJB 2VAAA 3F62A 5KSVA 4KJYA 4JHWL 2I5YH 5DS8A 2OZ4H 4ORZC 3VGBA 1NGYB 4K71C 4E42A 4XMLL 3ZKMC 1V3MA 4U05A 1JFQL 4KKBC 2Z91A 4Y4FB 3CH1B 1Q0YH 1UM4H 1E4KC 3MJ6A 1B0GB 3GI8L 2FH6A 4MDJB 2R56L 1T22A 4AL8H 5JR1L 3SKJH 4FN0A 3T8XB 3BZEB 1G7HB 4L5FH 4N8VB 4EIGB 1VKXB 3K1KC 5C0RH 4PJBA 3U0TB 2QV2A 3VDAA 3Q6FB 5IHUH 4JKWA 3I50L 1QR1B 3MROB 5A2IH 5HDQL 3DO7B 4XBGA 2AK1H 3O4LE 1IILE 1MAKA 2Z4QB 3ZTJH 4OQTL 2CDGA 3VXPB 3VXTA 5C6TH 5JQHC 4JN1L 4DKEH 1AGEA 1IGCL 4NJ9L 1BREA 1EMTH 5E8EB 5EO1A 3HKFA 3BGFB 2I07B 5EU7E 1G6RH 3AM8A 3GSNA 3QIUA 2E9JA 4G8GA 5IFHH 4U7SA 5BVPH 4PJFA 3KPNB 4PJ9C 4NKIL 1AD9A 4AM0A 4GKSB 1HXMB 1CFNA 1F42A 1KCKA 4X9BA 4JG1H 4Y4HD 1QFWH 3FMGH 4BH8B 3F58H 4PJCF 4FTVB 4OCSL 1RD6A 2NYYC 4D0DB 3O11B 1DQLH 4GW1A 3LD8C 4LDEB 3BH9A 3IF1B 2YD5A 4QYOA 5GRJH 5ICZA 5AG8A 1A2YB 1S7XA 4HJ0C 4JFOA 4YIQB 4F33A 5BXFB 1DVFD 3RWDA 4W81A 1R5VB 4TUOB 4E9LA 4FQXC 2R39A 3MRFA 3U4BL 5HYEA 1M05A 5JHDB 4HZAA 2HP4A 1X4XA 1E6JL 1MLCB 4HWNA 4V1DD 5I1DA 5DJ0B 5DRXA 3D3VB 4NQSB 4LCWB 5EUOE 3T2OA 4ODHH 4WFHD 3DUSA 3BX7C 4QOKA 5IMKA 4ZO9A 2IANE 3IFNH 1XF1A 4K23L 4XCNB 3VXUD 1KENL 3LRGA 5JXED 1U3HC 1YPZE 3VW3L 3P11L 1EHLH 1I8IA 3H3BC 1YQ2A 1U36A 1U8PB 4OLWH 1MCWM 5DURB 1HKFA 4PJXA 1AP2A 3MRDB 5BQ7A 1M6OB 1VB9A 3KXFD 3QIWA 3FCTA 1S7WB 1JZ2A 4NQEB 5A2KH 1TITA 3ARBB 5DJYB 5JQ6H 1T2JA 2LTQB 1INQA 5J56B 2HKFL 4HS6A 1GZPA 4WUUD 1XIWA 2DQCL 1X4YA 1BF8A 4PJHE 5I1IH 1HNFA 2BVEA 2QEJA 2IPTL 5DHYA 2O5YH 4Z7VE 4QHKI 1MCIA 4P4KD 4WDIB 3HRPA 2XQBL 5HJ3B 3QUML 4U1IA 4NQDB 4M7KH 4Y2DD 4CVZB 4UU9A 4CBPA 3AXLB 4POZD 2AXGA 4OZIF 4G8EB 4P3CL 4HEPG 3OXRA 4HIHB 4ETYA 2A9NL 4OLYH 4Z7NE 2BSRA 3L7EB 1QFHA 1AXIB 4V2CB 4JM2D 1QNZL 4KKLC 3WFDH 4OFYD 3RY5A 2DQFB 2EIDA 3SQOL 1DQDL 5JHLL 1FBIL 1CLYL 2FB4H 4KI5D 1A7OH 5HI5D 4TQEL 3ZE2E 4P9ML 2EYRB 4HGMA 4M62L 4QRRE 5D1XD 1JWMB 3ARGA 2BNQB 3VXRB 1CLZL 3FHAA 4HX1B 3WO4C 4PV9A 3H8NA 2VAAB 5KSVB 2OL3H 3HCVB 4KJYB 4R90L 3FJTA 4HS8L 3KGRA 4G6KL 4FOMA 2FX7L 3T0VA 3BZ4B 1FLRL 1MCRA 5D7KE 2YPVL 1G7LB 3IU4H 4E42B 1D5MA 1C08A 2PXYA 4JGJA 4Z7WF 1DUZB 1S9YA 3MLUH 1BF2A 2Z91B 4MLIA 3L3HA 4GRLB 1QBBA 1XF4A 3TZVD 2NTSP 3BD3A 2MMXA 3L5HA 4ODWA 1OAUL 3O6KL 5EOCH 2LU4A 4ZFOL 5DK0B 5H94A 2B8OT 5T5NF 2W9LA 3QDJD 1MY5A 4FA8A 2MCG1 2HFGH 4X7DC 3JWDL 4RFEA 4QKXB 3U9UA 4HLZG 5E9DA 4I18B 3S36X 3VXTB 3ZE0E 3DLQR 3V6OA 3IXAA 5EO1B 5B39G 2HJLA 5JW3H 4LMQI 3GSNB 3UJIL 1D6VL 4G8GB 5J1SC 4PJFB 3AROA 1KEML 1AD9B 4PJEF 2WUBL 5I1JL 3LKPA 4NSKA 1IM3B 1KC5L 2PR4H 1CD0A 2EH8H 2Z0BA 3P4NA 2B5IB 4Z18A 5BRZD 3GJFB 1UM6L 2IC2A 4NUJA 2M26A 2QTEA 1FE8L 4XNZB 4BM7A 4QYOB 3QUYA 4JPWL 5ICZB 1KB5L 1PG7X 1QSFE 1K6QL 4XNXH 5J06A 4HMCA 1S7XB 4KK5C 1JPTH 5F6HI 1TCMA 1NCWH 1XH3A 3RWDB 1CZ8H 4Y19E 4Q7DA 2EDFA 5JZ7D 5D7IE 1NCAL 2R0KH 3MRFB 3P0VH 3NPZB 3O2DA 3CFJA 5HPMA 1GCFA 3CXHK 2CRMA 4I2XB 5I1DB 3W5MA 4A6YL 2MOVA 2CUMA 3NAAH 1RURL 4N5UA 2VNCA 3DUSB 4UOJA 4ZO6A 5ILTH 3GJFK 5E99H 3RDTC 1J5OL 3BDYL 1W72L 2YKLL 4NC2B 3TESA 2HVJA 3UYRL 4M1GH 3KLHC 1KTDA 4HWUA 5DUML 2D7NA 4PGCA 4PREB 5E94A 4PJXB 5SX5H 1PKQA 1N2RA 2IMMA 5BQ7B 4JFXA 1IGJA 1DFBL 3QIWB 2OZ4A 4DQOL 3FCTB 5B3JE 4APQD 4OT1L 2P5EE 2R1XB 3K74B 4DVBA 5HGGS 2ZOLA 5FHBH 1NBZA 3HRZA 3IAGC 1ROWA 2OX5A 2NZ9D 3LOWA 1XIWB 1HN1A 1W0VA 1J0IA 1T03H 2ICCA 4WY7L 3VWKA 1TQBC 4JFDA 4FQHA 2A77H 5DHYB 1U8NB 3OAYH 3ZHLA 4XRCB 2GT9A 3MLXH 3RWFA 4YAQA 1BVKA 3DGGA 4L4VA 4OF6A 3E1F1 5E2TL 4OSUH 3UTZA 4X98A 4F8QA 3E6FB 3BKJH 3HI1A 4UU9B 3O9WA 3U7WH 3RUGF 1LQSR 3OXRB 2D7TH 3KJ6L 1MRDL 3ZKSD 3EAKA 1F2XK 1UWXH 2XIDA 1ITBB 4NQCD 4EI6A 3WV0A 4NIKB 5FXCH 1G6RA 4JZNA 4HXBL 2VDML 1HHHA 3VH8B 2F53E 1IAII 5CZVL 4E0RA 4KDTA 4H0IA 4ODUA 5K9KA 4MA7H 4FXKB 5EDXA 3GJEB 3ARGB 1QBAA 1OP3K 2FH8A 2QADC 4GLRH 4LFHD 4XPGH 5C0CE 3DX7A 4RFNB 3O4LA 2OI9C 1A6WH 3H6JA 1DJSA 2EO9A 4IRJB 2C7UA 4JQIH 4NUGL 1D5MB 1C08B 2I9TA 2PXYB 4TSBL 4PLNC 3IXTA 43CAB 5C2UB 1S9YB 3FO0L 5EBWA 2V17H 3L3HB 1KGCE 1D9KD 4ONGL 1MVUA 2Y36L 4ODWB 2ITCA 5EA0L 5ESAB 5EZJB 3MRNA 2DBLL 2LAAA 1HQ4A 3V5HA 3RNQA 3TJEL 2BSTA 4ZTOL 1GC1H 4LOUC 4XPBH 4BFIB 2NY5C 3MV8E 1DL7H 4JVUA 1A6TA 3GKWH 3JUYA 2XZCL 4MJ6B 3VRLE 4I3GA 1OPGL 4RFEB 4MCZA 1CE6A 3BD5A 5D7LA 4XCYA 2VDOH 5E9DB 1KJMA 2HTKC 5SWZA 5ADOL 3IXAB 1F6AB 2HJLB 4KJPC 1CXFA 4KK9D 4KQ4H 3QPXH 3Q6GH 5HBBA 4UBDC 5HHXL 3TVMD 4QEGA 4RX4A 3MCLL 1U9KA 4PJDF 2LVEA 5B8CA 3LKPB 4NSKB 2JLLA 3WFBL 4RGNE 2FGWH 3P4NB 1RI8A 1CFVH 4Y16C 2R69H 2CKBH 4G8IA 3TF7C 2BVTA 4LKXA 3MRLA 1QYGL 1RJZA 4K07A 4WI6A 1YPZA 1O0VA 4QXTB 1I9RL 1X7QA 2VE6A 2OR9L 3PWLA 3VE0A 2NY2C 3DVFA 1OTSD 3OB8A 4U1MA 1UCTA 2VDNL 4JRYD 3QUYB 3UTSD 2ZUVA 4AT6B 3AAZA 3TCLB 4N0RA 1CGSH 3LCYA 1IM9B 1DDHA 3W2DL 3RL2A 2ZCHH 4EDXA 2E8ZA 5DDHB 3MOAH 5ALBH 3G04A 3HZKA 1YY9C 3P9MA 2MPAH 5T1LA 5DJDA 1CDUA 2CH8A 5HPMB 3BXNA 4DUXA 4U0QB 2X1XR 3KYNA 4U1GB 4PJHA 1MLBA 4WTWA 5DC9B 2VLLA 5F6IB 3OB0K 1WQVT 2X70B 2ADFL 3MV7B 4G6AD 4LGSB 4Z7VA 1FG9C 2HVJB 3P0YH 3VI4E 1CFSB 2GTWA 1EPFA 3ZLQC 4OGAC 3RVTD 4RQQB 4GQ9H 1PY9A 4LKCA 5GS2D 3MRJA 4PGCB 5TDOA 5E94B 1RZ7H 1OLZA 3C6LD 2OL3A 3Q0HA 2X09A 2AEQH 1OM3L 2W9EH 1N2RB 2ICEA 4JFXB 2GAZA 4HUXB 1IGJB 3NIFF 3LEYH 2RCSL 1NGQH 4LEXL 5GGTL 1TZHA 4M6OH 1JJUA 4DVBB 1ZS8A 4XC1L 2VZUA 2CKNA 5JLZB 1C1EL 2VDPL 2ZOLB 1NBZB 1WZMA 5ISZD 5HI3D 3SCMB 2V7NB 4Z8FH 1IAMA 5EZOL 1VSCA 4QCIB 5EPMA 1W0VB 1FGVH 1KEGL 3QYCA 4G6MH 3C2AH 1FG2A 1DN0A 1J8HB 1JHKL 3VWKB 4JFDB 1NDGB 2FX9L 2EXYC 3V4PH 3FFCB 4HDIA 3C09C 3ZHKA 3RGVC 3QDHA 2GT9B 3LB6C 3OV6A 3RWFB 1N8ZB 1BVKB 3DGGB 3MNWA 4YAQB 3WNPA 1LE5B 5DZOA 3UO1L 1A5FH 3HNVL 1X5HA 5HHMB 3O9WB 4C56A 4LGRB 1P53A 4YHIA 5ALCL 1AQKL 4ZUWB 5KG9A 1M7XA 3WNMA 4UQ3A 1WZLA 2CXKA 1G6RB 4ELMF 1MCPL 3WDIA 2DF3A 3NIGF 4JZNB 3CUPA 1U95B 2HRPH 3R0NA 3RTQD 5E8OB 1HHHB 2RGSA 1ED3A 4H25A 4UT9L 2ARJA 2YD7A 4JKLA 1OLLA 2IAMC 1KG0A 2LAGB 3VFNB 3CC5A 3ILPA 3F7PC 4PV8A 5KSAC 3F7VB 3K4AA 4RBPK 3VFGL 2DQJH 1WTGT 5CJOH 5DWUH 3DX7B 3SBWA 1HHJA 3WUZA 1FJ1A 4LVNB 4KVCH 4XNMA 5DFWH 4JVWA 2F54E 4FQIL 3TA3A 4MXWL 3LHPL 3NFPA 4DKFL 1YJDL 4MB5A 3SKNA 2E7LC 4G7YH 3FN3A 2C7UB 4R4NC 1UJ3C 4S0SD 3EJZD 5T1KA 2I9TB 4L8SC 5IB1A 5JORA 2LVCA 3IXTB 5GGUB 4G6JL 1W0WA 1P4IH 3DUUA 2VLJE 3CLEH 3K2UH 4PUBH 5T33L 3NFSL 2NY1B 5FGCE 1YQVH 2EDKA 1KBGH 1MVUB 1SVCP 1VFUA 1BAFH 1QFWM 2IQ9L 4E41E 2W0KA 2P8PA 4OCYH 4XP4H 2E6JA 3V5HB 1F5WA 3RNQB 2BSTB 3JV6B 5GQBA 4XHJC 4OIIH 1B2WL 5D2LA 5K59E 4F15C 1SYSB 3B8SA 1G7MA 2AQ2A 3NTCH 1ACYL 1A6TB 4NN6C 4PJ7E 1U8KA 1AXTL 2J88H 3TM6A 3BRDA 2AK4A 1QHPA 4IHOB 1CE6B 3MA9L 4ONFH 5D7LB 4XCYB 2CUHA 5KTEH 5CILH 1KJMB 4FXLA 3KWWA 4U1LA 5SWZB 4OUUA 4GXUN 4I0CC 2YOCA 4OGYH 3NPSC 5FO8A 5JDSB 2KQNA 5IESH 1FO0L 4NC1C 1YEHL 4M6MH 5IBTL 4GG8A 1JTTA 4F7EA 5B8CB 5JOFB 4OD1L 2VZVA 4OB5L 3KYKH 4HIIA 4LAQH 5D5ME 4DGVH 3BQUA 5CJQH 1Y0LA 2XKNA 4G8IB 2NY5L 3FQTA 3QAZC 1FL6A 1MRCL 4KY1L 1RJZB 2ORBH 1X7QB 2VE6B 1MCSA 4K7PL 1P7QA 1RHFA 4UAOB 1JRHI 1MF2L 3PWVB 3PWLB 3VE0B 2F15A 5I1KH 3DWTA 5AYQA 1R5WB 5MEPB 3AAZB 1T1WA 3JZ7A 3I9GL 1UKTA 2IH1B 3C6SA 5DUPL 3RL2B 5GZOD 2DQGL 2BOBA 2P5EA 1NCCL 3HE7A 3TBSA 3P4MB 2WWMC 3HZKB 3P9MB 1C5CL 4NO0D 4KC3B 1U8LA 4OBRA 2LV4A 5JPMA 4JFZL 4ZAKD 5MHSD 4YHOL 3E3QC 2H32H 2C1OA 3KYNB 5DD3H 2DJUA 3UBXG 1MLBB 4LLMA 2VLLB 4XPTL 4NP4L 1F6FB 1D5BA 1KTKE 4ZG1A 2BVYA 4MB3A 2GTWB 1Q38A 4PJ8A 1MELA 3GI8H 2ZSWA 2DQDL 2RFXB 4LKCB 5ACMA 5IT2L 1I3VA 5JR1H 2NY6D 3MRJB 4I3SH 4PB0L 1FPTH 4X6CB 2GAZB 2FZ3A 4GT7A 1X5FA 2EDJA 5F9DC 1CFTA 4OM0H 4ZO8A 4X9IA 5JW4N 5I6XB 5HDQH 4L8BA 1ZS8B 4K3EH 1EUTA 3OQ3B 4Y5XA 4F37K 3OAZH 4WHYG 3O81A 5HDBF 1OQXA 2F53A 1ZA3A 5C07A 3HR5A 1FH5L 4JN1H 2QR0A 4NJ9H 4NJAL 1MHCA 2DWDA 5B38A 5EPMB 3ARFD 4S1DD 1IC4L 5I76B 1V7NL 1FG2B 4ZD3L 3SE9L 5JUEL 3X3GL 4NKIH 4YR6A 4YHYC 3SDAA 5C0CA 3O6FA 4R0LA 2J3SA 4Y4HB 1QRNA 6FABL 3DVNA 4XP9H 4C56B 4D3CL 4OCSH 5E56A 1UGNA 2JELL 1MFBL 2A6JA 2HJFB 3RIAF 3B9EA 4Z76A 3GB7B 5KG9B 4UQ3B 4XVSL 4ALAL 2UWEF 5D72L 3BT2L 1DVFB 3V0WL 3JTTB 2ARJB 3HPJA 1X5GA 3EYUL 2DYPD 1KG0B 3CC5B 4TNWK 3S6CA 2VDRL 1KJ2B 2VXSL 5DA4A 2CKBA 4UOW0 4QHMA 4CVXA 3DURA 4OZHE 2C3VB 4KHTL 4O00A 4OQ1A 4P2RA 5D96C 1HHJB 3U48A 1KLUB 5HSFA 1FJ1B 1Q9OB 4XNMB 3TA3B 5C9JB 4DVRL 4FG6D 2G75A 3LS5L 5HYIA 3SKNB 3H9ZA 3P11H 4XH2A 1ZLUH 4PP2B 3DSNA 5T1KB 5IB1B 3PDDA 5D4QA 1Q8MA 4YHKL 2IBZX 1F3DH 1H3GA 3SE4A 1LP9F 1TTFA 2P8PB 2DL2A 3I02A 5D2LB 3RWGA 2X4PA 4P5MA 1XF5B 1GHFL 1JF5A 2HKFH 4MNGA 3B5GA 4K9EC 1G7MB 2DQCH 1SBSH 3BP6A 3QG6B 4XWGL 2GTZB 1GZQA 3TLRA 5J6GB 3V7MA 4K8RD 2AK4B 1QOKA 2IPTH 2R2BA 2IF7A 1SM3L 5HDOA 4U1LB 3CSBA 4ZSOA 2CIKA 4I0KA 2VDLL 4OM1L 4NNPL 3MJ9A 5F88A 3MRHA 5FO8B 5I8CB 4PLJC 4GG8B 5AUMB 2ZUQC 1YN6A 2IEPA 1S3KL 3W0WA 3PQYB 1MPAL 4XVUC 4LEOA 4L29A 4EQ3A 2XKNB 5C0AA 3KLAA 3FQTB 4W4OC 4HEME 3V4UL 3SQOH 1I9EA 1N3NB 2I27N 1FBIH 1FVDA 2A6IB 1OAZL 1P7QB 1CLYH 1ZK9A 3KJ4C 5IROA 1ZEAH 5FK9A 3CZFB 4NBXB 2MJWA 4TQEH 4Q58C 4M62H 1AJ7L 1T1WB 1XGQA 4OZIA 3UTTA 4NRXB 3TBWB 4P5KB 3S4SG 5JW5B 3C6SB 1CLZH 3LH2H 3IVKA 2W9DL 3T0EC 4UIKL 5C0BD 2BOBB 3BGMA 4ETQA 1S9VB 3HE7B 3TBSB 4EUPB 3QCVL 1BECA 1U8LB 4YPGA 3S5LG 1N5YL 4G6KH 4KTYA 1MIEL 5JPMB 2FX7H 2HLFC 1XGYH 3IDJA 1FLRH 2NR6C 1UZ6F 2X10A 4AH2B 4ZXBD 2K7QA 2C1OB 2WP3T 4LLMB 3UEZA 4EXKA 4P2OC 5A3ID 3LS4L 3N1QC 3EJYC 4JN2B 4AJ0A 2VLRA 1PY4A 3MOQA 5BZDA 4G43A 2VC2L 1A4KA 4PJ8B 4PR5B 3GSRA 1IGIH 2OSLB 4F7TA 2ZNWA 4WHDA 3U36A 5A40E 1DEDA 4O58L 3RIFK 2IADB 2FZ3B 3QR2A 5GGVY 3AFLA 3LZFL 1CFTB 4B7LA 5C0DB 3MXVL 4L8BB 4XTRD 5HHPA 1UWXK 2FECI 4WV1C 5IIEA 4Y5XB 3Q2CA 4ELKB 4G5ZL 1J87A 4IEFB 2XT1B 1ZA3B 5C07B 3HR5B 1NUFA 2V2WB 1MHCB 1HCFX 4OCWL 3ZDXE 5B38B 3WSQL 1D6VH 3TO4A 1E4XI 4KGJA 3KPRE 2GJJA 3PP3K 1H3VA 2UYLA 4YR6B 5DHVB 5I1JH 2Y72A 1NC4A 3SDAB 3I6KA 1CFBA 3O6FB 2HJKB 4IMKC 1KT2A 2CRZA 2J8OA 5E8PA 3BZDA 3DVNB 3KYMB 3TCXA 4NOBA 5E4IA 4Z7UE 5MENA 1AQDB 2YS4A 4PJ5E 4G80A 1UFUA 5F9JA 2DBJA 4J12A 1PQZA 4JPWH 1KB5H 4HPYL 4KQ3L 5D7JA 1K6QH 1YYLL 3FAXA 4AEIL 3ZYJA 2IBZY 1OSPL 1MRFL 4N0FA 3EOAB 2V7HA 2VJXA 1TJIL 3HPJB 4N0UA 2YMXL 3T0XA 4KJWC 2N7AA 1VCAA 4PJCB 5DHXB 1OGAE 3QO1A 4OD2B 1I9IL 2PNDA 2CKBB 3EDDA 2VQTA 1U0QA 3SE3C 4CVXB 3DURB 4RCAA 1MREL 3ZDYE 4P2RB 4NFDA 5LAXA 4X6DF 3GIZL 3IKKA 1J5OH 5F1OB 1W72H 2G75B 1H3UA 1IKNC 4CNIB 3G5XA 2WIIA 1QPPA 4XH2B 2EE3A 5BO1L 2C4FT 3UAJC 5DUMH 4WI2A 3UX9B 4CMHB 1HK6A 3D39E 2IAND 1WLHA 4XPHL 5IB2A 3BRGC 3ZL4L 3FRPA 3MRRA 2H1PL 1DFBH 4NFCA 4DQOH 5C92A 2GK2A 3B9AA 2V5RA 4OT1H 5FO9B 4JAMA 1K8IA 1OL0A 3MV9E 1G6VK 2H32A 1WF5A 4U1NB 4HIJA 1EJOL 4D0BB 5HXMA 1KF9B 4MNGB 4IRSD 4EQ2A 4LBEA 5BZWA 5EU5A 4CN6A 1Q72L 1P2CA 3U9PL 4HKZA 4QRQA 1PVHA 2R2BB 3D2UD 2DQIL 4OUOA 1LO5B 4ZSOB 1AD0A 3MA7A 2CIKB 5FEBA 3B9KD 3QHFL 15C8L 2YXMA 5F88B 5TE7L 3MRHB 1A9EA 1FAKT 5EN2A 2YA0A 4JFEB 3BPCA 4KRPC 4P9HC 1MRDH 1CL7L 3MBEA 1VFBB 3PWJB 4OQTA 5JO5A 3W0WB 4NO5A 4L29B 5GS0L 5C0AB 3KLAB 1ZVSB 3CJJA 4K9EL 2APXA 3FAWA 3QJHA 1S7UA 1FVDB 2VDMH 1DUYA 1T2QL 2JF1A 5FK9B 1JWUB 2EDWA 2C3GA 3PHQA 4FZ8L 3QCUH 4LDOB 3RUGA 4KUCD 1XGQB 2QSVA 3LMJL 1YNTA 1JNNL 4H88L 3IVKB 3BGMB 4ETQB 3OR7A 5D1QC 1T7YA 3VI3E 1RFDL 1N6UA 4QRRD 4YPGB 5I75B 2NXYB 3DMMA 3BPOC 4QGTA 4NWUL 3VDBA 3CX2A 4Y1AE 2QKIA 2X9YA 3VXSE 3VWJC 3S88L 2WP3O 4TSBH 4N8VG 1NL0H 5DJCA 4PJIF 3FO0H 4WEBL 4BZYA 2VLRB 5L2KA 5D7KD 4NHUA 5GRUH 4H20H 4HG4J 3BIKB 1A4KB 3LDBC 3GSRB 4LU5L 4WU5A 3MODL 4R26L 3U36B 4ZTOH 2P42B 3LQMA 4YE4L 3LAFA 4YDVA 3U30C 1A1MB 4N9OB 3WE6A 1JGDB 5IHLB 4YLQT 4Z7WB 2XZCH 3DVIA 3FQNB 4LVHC 4BFBD 5D2NA 5IIEB 4AQ1B 1OWRM 4MDIA 2V2TA 2BNRE 4OGXL 4PS4H 3JWOL 3VXQB 2HG5A 5T1MA 2EZ0D 3T4AA 1OAKL 3GHBH 1ZLSL 1S8DA 3FOMA 1SY6H 3NZ8B 2IMNA 4OGZA 4DFHA 1FZMB 4ORGA 5HHXH 2UYLB 3MCLH 4OZHA 5SV3A 1NC4B 1CICD 3WFBH 5DMGC 3QDME 3I6KB 1KT2B 1RZJC 3DX6A 5E8PB 3VU2A 1HILA 1BFTA 3JUZA 3SGJC 5BOPA 4L1DA 4TVPL 1VDGA 5MENB 4J4PD 1EV2E 3QI9A 4LSSL 5F9JB 5IB5A 1NMAH 1DR9A 4QHLA 5D6CA 3ES6B 5HGAA 4PJEB 4YBQC 1JHLL 3QUMA 2N1KA 4OCXL 1LWRA 5LGHL 3CFBA 4NDMA 2V7HB 4X99A 1KJ3L 3AREA 4N0UB 2VABA 3TN0A 2V5YA 3WFHA 1QSFD 1S9WA 1J10A 1YZZA 1NMBH 1RUKH 2IH3B 3QO1B 4LRNL 3NBNA 2FD6L 4UILL 4UB0L 1GGCL 1AR2A 4Y19D 4XVJL 2OS7A 3KAAA 3EW3B 3LN5B 5LAXB 3X14B 3KNBA 4EVNB 5HI4C 4U31A 4D8PA 3G5XB 2WIIB 4M48L 4AQOA 4Z6AT 4PBWD 2OM5A 3KPMB 3QO0A 4DN4H 1MEXL 3RVUD 1N0XL 4GRWF 2DDQH 1T4KA 1N4XL 5IB2B 2EDHA 3C6LB 1OM3H 4QNPE 1OARL 2C3HA 2MCPH 3MRRB 2CR3A 4P2QA 3WDJA 4K3DL 2R23A 1EO5A 4NHCL 4WJ5B 1RHHA 5DGQA 3RGHA 4JAMB 5GGTH 5IVXF 1ND0A 3NCMA 4B0MM 1RU9H 2DI9A 3ULVC 3E2HB 1C1EH 5E5UB 5MEOA 4HIJB 3D18B 3VDCA 5I1AA 1B3JA 5BZWB 2GSGA 2HA1A 5EU5B 3W81A 3G5VA 1EX0A 3PWPE 1WK0A 3RL1B 1P2CB 5EIIA 1JHKH 4HKZB 4QRQB 1FDLL 1YEGL 2HFTA 3LIZL 4U1SB 4ZFOA 3OF6D 3FONA 1AD0B 1CGUA 4U2YA 1YEDA 3UO1H 1A9EB 3HNVH 3WJLA 2IQAA 5EBGA 1SMAA 4HHAA 4BELD 3BPCB 4U3HA 3P77A 1BQSA 3FZUC 3MBEB 1J1OL 5BV7B 1S5IH 5JO5B 4FZEL 1AQKH 3NABH 5ERWA 5CKAA 2AJSL 2VYRE 2EC9T 4QTIH 5EBLA 5LQBL 1JN6A 4L4TA 1BIHA 4O2CA 1E4KA 1ZANL 4R6UA 4F57H 5IF0A 1V3JA 3RVXD 1DUYB 3IRPX 3RTQB 2DQTH 2GUOA 2ZWLT 1ORQA 1B4JL 3PHQB 3W82A 1BX2A 3TYGL 1IVLA 4LCUA 3RUGB 5LKNA 4HSQA 2CDEB 3VFGH 1BJMA 2ZNXA 2F53D 3L6FA 2P4AB 2WUCL 1KCSL 4PG2C 4WO4B 1B0RB 1P69B 2XTJB 3I75A 3T1FA 1GOFA 1ACZA 1A7RL 4FQIH 4MXWH 3LHPH 4ELMA 1LO4L 4DKFH 1JPSL 1KB5A 3P9WB 3CLFL 4G6FD 3PWUB 4JKPL 4MMZC 5JW4R 2A6DA 3OAZK 3QWQB 4EOWL 1T0MA 3WIIH 5C0CD 4OJFL 4PJ9A 4G6JH 5HD8D 1QFPA 3Q3GA 5T33H 3NFSH 4NHUB 1NCBL 3SDXF 1L4IA 1NLDL 4A6YA 3M17A 4WU5B 4Z7UA 5A16B 3SDDC 2DN7A 4PJ5A 1KGCD 1MCDA 2EE9A 2X4RA 4YDVB 5KN5A 2DQEH 3R4DA 1W72A 3LQAC 3WE6B 4YXLL 1ACYH 3ARBC 4HAFA 2NX5B 2V2XA 1AXTH 3DOSA 5D2NB 4DZBA 3MA9H 4MDIB 2V2TB 3GFUA 5CCKH 3MV8D 4JQVC 2HG5B 4FQXA 5T1MB 1DLHA 3MLTA 3DHMA 1OGAA 1KSRA 5DEFA 2LABA 1S8DB 5CIPH 5C09E 4ORGB 1H15A 5GGQL 2CR6A 2XY1A 4X7CC 2PYEE 1I1RA 2VO5A 2NY5H 4LDLB 1IEAA 4W4NA 3T0WA 1MRCH 5M94B 4HUMB 1U3HA 3VRJA 1G7JA 1RIUL 1MF2H 5A2LH 4RGND 4QHLB 1WJ3A 1ZLUK 2XKSA 2EICA 1LEKA 1ZT7A 3I9GH 3JV4A 3UYPA 4PJDB 4HXAL 3QUMB 5DUPH 3M1BA 4L3EA 4RWYL 4HUUB 2DQGH 3C5ZD 4NDMB 1NCCH 3CSYA 5K9JL 4X99B 5GRXG 5FYKU 3V0AC 5L8LB 3WHXA 2VABB 3WFHB 1VFOA 1S9WB 3DTXB 4HF5H 1L9MA 3O0RH 1WTLA 1NCNA 1F4YH 1RZJL 4F9LC 2LFGA 1CDYA 3EGSA 3CSGA 3SDCD 4NP4H 2CK2A 3WIFB 3OJMB 1AGBA 4I5BA 5DJXA 2D7MA 4D8PB 2XN9E 2YK1L 5AAWA 3KHOA 4L9LB 2DQDH 2Z31D 3WLBA 3QO0B 1AIFA 1WCBA 5IT2H 4GRLC 1T4KB 4PB0H 3BKCL 2WBJC 4MZ3A 1NCTA 4PRHA 4P2QB 1WGOA 1QLFA 1ND0B 4AY0A 4DOHE 5IKCB 2H2PC 3KPOB 1JF1A 1FH5H 2UV3A 4NJAH 5I1AB 5CP3H 2GSGB 2R8SL 1KLGB 3G5VB 2HAZA 1IC4H 4I18C 4ZD3H 4KKCC 3SE9H 5JUEH 2X1OA 5EO0A 1I8KA 4LPUA 1EFXB 3FONB 3U0WL 4KHXL 1FNSH 1YNKL 2M8XA 1YEDB 1AE6L 4E5XA 6FABH 2NW2B 2IQAB 4WFEE 5F7DA 1AGFA 4Y1AA 5HHNA 4HHAB 1J11A 3P30H 2P46B 2B5IC 1CDHA 3ULVL 2VERN 3BN3B 4NPYA 4ZS7L 4U3XA 5ESQA 4A2LA 4XVSH 5FF6A 2AV7A 5EBLB 5D72H 4L4TB 1H5BB 4O2CB 4XNZC 5IF0B 3T0AA 2JB6B 3BMVA 4R2GC 1JWSA 2DYPB 3DSFH 3A0OA 1BX2B 4NBZB 1H8NA 1HINH 2W07A 5SWSA 2VXSH 1WSST 1ZT4A 3MFFA 4GJTB 4BUHA 4RMTA 2Q76A 3ZO0A 4D9LH 1FIEA 1P1ZA 1RIVL 3I75B 2UWEA 4CN4A 2GK0A 4ELMB 1TJGL 1KB5B 5CJXC 1X9QA 4RNRB 1T0MB 2DLGA 1V7MH 4OFDA 3PHOB 4Z0BL 2F54D 4Z7OE 4LGPB 2ZPKH 3HAEB 3WFEL 3VG9B 4XZUA 1D5IH 1Z0NA 5CINL 1JPGB 4PRPE 4H0HB 3B8YA 3QIBA 4RA3A 1FFRA 2JCCE 4A6YB 1QACA 3I84A 3M17B 1NJ9A 4YXKL 3B3IA 1GJIA 2VLJD 1I3GL 2XWTA 5CD5D 2X4RB 5FYLE 5KN5B 4F9PC 2YPLB 1CN4A 4X7TB 3IETA 5GISL 4E41D 2N4IA 4LLQA 2FBJL 2CK0L 1BZ7A 5DMJB 4DZBB 1NDMA 2R29L 5HPOA 3FB8A 3FQWA 1LP9A 2EDLA 3MJGX 3BVNA 4Y4KD 5D6DA 2VDLH 1DLHB 4NNPH 1NC2D 3ULUE 5DEFB 3PGFL 4AIZA 5GGTA 2BVQA 1H15B 3INUL 3PWNA 4LARL 1S3KH 1XCQA 1KFAH 1MQKL 5FYLH 4MD5A 4OZFH 3RDTA 3CDFA 1QPXA 3V4UH 1U3HB 3VRJB 4DEPC 1G7JB 5T5FL 1S7QA 1PEZA 4KTEL 4F7PB 1M7IA 1DBAH 4ACPA 4GUPA 4U7KA 1BIIA 4X80L 4Z5RB 5ELIA 1YEKL 3F7QA 1GGYA 1QA9A 4XNYL 5I66B 5CSBA 3M1BB 4L3EB 4MCYA 4UIKH 3WNOA 4CL7A 1G9NC 5C0BB 5E2UH 3WHXB 3QCVH 3H0TB 1KULA 3O8XD 5EFIA 2BVPB 3K8LA 4RFNC 1MVFA 3E3QE 1ZTXL 1QKZL 5BS0E 3PWPA 3OWEA 4KJQC 3EGSB 1ZXQA 4IRJC 4FQPA 3LS4H 3VD5A 4G7VL 5DJXB 2B2XH 4GRWH 2PXYC 2J4WL 1OWWA 3WLBB 1AH1A 1WCBB 6CGTA 3HUJE 1TCRB 2VXUL 2CJUH 5E0QA 4O58H 2YC1A 1M4KA 4NKOA 4M7LT 3N06B 4P49A 4BZ2H 3ZE1F 1QLFB 5B39A 4LCYA 5IM7A 5J9PB 3BISA 4MQXD 3MXVH 5T3ZL 1CD9B 3UXFA 3VMNA 2ICWA 1X5ZA 4G5ZH 1IAIL 4X5WA 3X13A 2NNAB 3BMWA 4OCWH 4F7MA 1U8JB 3IRZA 1VA9A 1FFOA 1FVEA 4DTGL 3GGWB 3HC0B 5EO0B 2AI0L 3W11C 1I8KB 3SDYH 3T3PF 3GNML 1UC6A 1W8NA 1NGXB 4YFEA 2VRAA 1I1AD 3SKMA 4P5TD 1AGFB 5HHNB 1TXKA 3KS0H 5GZND 1D5XA 5T3XE 4OLZL 1DLFL 3RY4A 3WYRA 3V0VB 4HPYH 4KQ3H 1YYLH 1UWEL 5FF6B 4AEIH 1HWGB 2FWOB 2A0LD 2A9ML 3BD4A 4R97C 3ME0A 5HVHB 1W8OA 1MRFH 3NCYS 2VUYA 3QUYC 1T5WB 1TJIH 4KZEH 2EXWD 1MCKA 4QRUB 5MEQA 2EE6A 3AGVA 1A02N 1KTLA 1UH2A 4XMKL 1S78D 5DEGA 3O2VH 2IGFH 4IJ3C 1I9IH 2OXGA 5LBSL 1ZT4B 3MFFB 1MREH 3GDBA 1CF8L 5C0NC 2D9CA 3QWOA 2Q76B 3RWHB 3WUWB 1P1ZB 3GIZH 5T3XH 2UWEB 4F3FA 4MQTB 4PGJA 3TBYA 1A7NL 4PGEA 2VXQL 2X2YA 5F6IC 1CWVA 3TBVB 2ZJSH 3DV6B 5C7XH 5DJAB 3S3PA 2O5ZL 4JE4B 5KS9E 4JZOA 4X0KB 3ZL4H 3QFDB 4H1LB 2H1PH 1JNLH 1GH7A 3RPKA 1P84J 3QIBB 3QI9D 4WU7A 4OLEA 1YMHB 4D0CB 4K55A 5HVWA 4ZPTA 1NJ9B 2P5WA 3JBG7 1J12A 2XWTB 3F8UB 3RIAK 2GCYA 3GMRA 4MHHI 3IETB 3SJVA 4QRPD 3FO2B 4LLQB 4HT1L 4P2YA 1UB5A 4JFYB 2SEBB 1FNAA 1WBZA 3TN0D 5I1EL 3V79C 1NDMB 4KTDL 3SCMC 2VAJA 1OB1A 2DQIH 4KRNA 2GY5A 1ONQA 3FB8B 3FQWB 1LP9B 4D94A 3BVNB 4N9GB 3B9KB 3EHBC 3RJDA 2G60L 4X8JA 5F9AC 5E8NA 1F4AA 4AIZB 2AJZA 2CLZA 4FRWA 2BVQB 5CGMA 1MOEA 5IV2A 3L3IA 1PZ5B 2FJFA 4BZ1L 4LHUD 3RDTB 5CP3A 3ULVF 1VGKA 3QEQE 5FOBA 1T66D 2AJ3A 4MS8C 5FYJL 1T2XA 1S7QB 1T2QH 1T21A 3HE6A 1M7IB 4WUKL 4FZ8H 1CCZA 4GUPB 2KL6A 5CEZE 3LMJH 3LPWA 1QA9B 4P0DA 4KDTC 5CBAA 5E03A 3CFEB 3G6JE 1Z3GL 1MHEA 1R3HA 4BYHA 1I3UA 4UZGA 1NBQA 3WO3B 5ETUA 3K46A 1WBXA 1NKRA 3IDGA 3L5WA 1Q9WA 4NWUH 1F00I 5EFIB 2XA8L 1BZQK 4QT5A 4JO2L 3VFRB 5ID0A 3SY0A 1XGRA 5JNYA 3O6MH 2O61A 4JLRA 5IBLC 4GAGL 4WEBH 5EULV 3RGVA 5D8JL 5F3BA 5TFSL 5CEZH 1UVQA 2F58L 4LU5H 1KCRL 3EZJB 4R26H 2KQMA 1G9NL 3UZEA 3QEGL 3C60A 2NY1C 5EC2B 4HCRL 2VISA 3U46A 4EIZC 5GS1B 4FXGA 2HN7A 3UJTL 4LNRB 5IM7B 3OKYA 3VGDA 4QHUA 4P23D 5TE6L 4X4MA 3DVGB 5CEXB 4LRIC 2ICWB 3OKMA 2DKSA 4X5WB 4R4FL 2Y25A 3GSUA 3X13B 2IAMA 1YECL 4F7MB 4O9HH 3NCFB 1FFOB 1FVEB 1J1PL 4IS6A 5HGBB 4MA1B 2EDOA 5IEHA 1X5YA 4JFFE 4IOIA 1BD2E <