1ZHBB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for CD8+ T cell-dependent recognition of non-homologous peptide ligands: implications for molecular mimicry in autoreactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zhbB00
3FO1B 1MFDL 3RGVB 5IVXE 2J8UB 5GGUB 4D2NA 1A21A 1U42A 3ILQC 4X80L 3G5XA 1VPOL 1ZVHA 5F1SA 1XF4B 5IFAL 4FQLL 2V6HA 1INEH 1A2YB 3QXAA 1A5FL 1Q8MA 1UADC 5DC4B 5L88L 4PY8J 4FMKA 4JY5L 2XICA 5J11B 3WN5B 1EEZA 4Z7WA 1AGBA 1R3JA 4Z7WB 2P24B 3PV6B 2EDYA 1AHWA 4U05A 3VFTB 3F6LA 1S7SB 1SY6L 2LABA 4M02A 4UU9A 1BQUA 4MWFB 1P4BL 3B83A 1AGDB 2EDFA 2VITB 5C09B 4OZFB 1BJ1H 2BMKB 2F53E 3V0VA 4YHZL 5C71A 2G60H 5GGTA 3V0VB 1ZA6A 2R2HB 3MBEB 1QR4A 3V5KB 1IZJA 2DQEH 4HS6B 3RX5A 3ULUE 3EOYG 3JVGC 3CVIL 4NP4L 2ZZUT 1IGJA 3OJMB 1AGEA 3IDGB 2DQCH 2V5TA 2H2SD 4QXGL 4F58L 1L9NA 3WE6A 2Y5TB 4Z5RB 4LKXB 3MYJA 4Y19B 4XPFL 3I3BA 4EN3D 5JIKA 4S10A 3IAQA 5EZIL 5T1DH 4XVJL 1F42A 3SCMD 1QUNA 1MY7A 3L3KB 5D8JL 1E28A 1E28B 1A1MA 5IT2H 4HWZB 2A6DB 4QY8B 2B5IB 5C0BE 4WUUA 4WUUB 3I75A 2PO6B 4ALAL 3ULUF 2BNQD 1QSFB 1AD0A 1DQML 3TN0B 1S7XA 12E8L 3JSSA 4KMLB 3WLWC 4JG0H 4DUWA 4OSUH 2RAMA 4FTVB 3VXNB 3MRBB 3TH3T 3TBTB 1B90A 3BGAA 3GSVB 4GUPA 1QPPA 4F33B 3GSVA 5MP6H 1IAKA 3BW9B 3MGOB 1CDUA 4XNZC 4XGZB 1YEFL 1NMBH 5TGBB 2DAVA 2D0GA 3U7YL 4AYFA 2B20A 2CIKB 1WVZA 3LN4B 1A7RL 3RZCB 3NCBB 2FATL 2VDLL 1LEIB 5C0EB 1CD9B 4Y4HB 3I6GA 4MZ2A 4Z76A 3MV8D 2DWEA 5JW4M 2DWEB 4DEPC 4DK6A 1HH9B 2EICA 3JV4A 3VXSB 3S5LB 1OTUC 3U2SB 4JRXB 4DCQB 3TH4T 5CCKL 3UTTA 4OQTH 3DSNA 1A7NH 1U8IA 2G75A 1BVKA 3BP7B 1XH3A 1A4KB 3TA3C 5F3HB 4K94H 2WBJD 1VADB 3HA0A 1ZGLB 4RAVA 3SDCA 2BHZA 3QIWD 2R1WB 1T03L 2DKMA 4ZUSB 1Y18B 1U93B 5EBWA 5I75C 4PRAB 3OTTA 4R8WL 5D7IB 4PRAA 1OSZB 4KUCD 1MJ8L 5GGVY 4PJXB 3KPLA 3BH9B 1RZGB 4MS8C 1FGNH 5TE6H 3JTTA 1FC2D 1YEGL 1MI5B 1CIUA 3UAJC 2ZCLH 1I8KB 1UB6A 5ACLA 5CJBA 2X9XA 4HIHB 1FL3A 3EO1A 4K8RC 3LEVL 4ZS7L 4LIQH 1H0DB 2VL4A 1L4IA 3OAZK 5INCA 5INCB 4G8FB 4LOUD 4XMKL 1T6VN 2VAJA 5EUKA 4Y4KD 5DFVC 4RGOL 2NTFB 3GRWL 4ZOBA 2NTFA 1FGVL 4I2XE 2NZ9D 2HT3D 2Z8WC 3D3VA 4EXKA 1NMAH 3F7YB 5LBSH 3QUXC 4PREA 4X4ME 3W39A 4O5LL 1JHTB 1FLRL 3W39B 4OKDA 1IC7L 3WUWG 3C6LD 4G43A 1G7IB 4LVNC 1MFCL 4G43B 1EK3A 3OB0H 4LCUA 5A2JH 2HTLD 3GDBA 1Q72L 1N64L 5D2LB 4GO6B 5C3TA 5IJKA 3UDWC 3NCMA 2XZAL 5B3JF 4EUPB 2B8OT 1XGUA 4NKMB 1PG7H 2GJZA 4PRBA 1J18A 3SGJA 3CMOL 5J12C 4U1JA 3WNMA 4HUUA 4TNWF 3MROA 3RX8A 1KFAL 3E2HC 3T0XA 4K2UL 3GI8H 3VI3F 1UM6L 3LHPH 4PJGE 3KPRB 2AI0H 5MEOB 4AEFA 3VXQA 3CFKB 5FEBA 4HFWB 3QSKB 3RGVD 5BVPH 2NY1C 2GSIA 3SDAD 2O61B 2HG5B 4FOMA 1DQLL 4PJXE 1EGJL 2XFXB 1QSEB 3L3OA 2DQCL 4QXGH 3OG6B 5HPOA 3QNZA 1P7HL 4P3CL 1C7TA 1OAKH 3QDMB 5HDQL 5HTSA 4ACPA 1X7QA 1LO0L 3BKJH 2GAZB 4MJID 1BQHA 1DBJL 1BQHB 4PJIE 1J11A 4TNWK 1JI1A 3DUHA 1V3KA 3QO1A 1LE5B 2YN5A 4GJTB 1TTFA 3D85A 5C0RH 5IR1A 3BUTA 2JB5H 1JGUL 4EOWH 2BFVL 4G80B 3CX5J 2Q86B 1GIGL 3C60B 5EOTB 4C57C 4I48B 2BVTA 4PB9H 5TF0A 5IHUH 4JREC 1JZ6A 4WO4C 4Z8FH 5H2BB 4Z95H 4CW1A 4JZNA 3W0WE 4P3CH 4NRXB 4JVWA 4AJ0A 2VB5A 3MYZA 4ESKA 3K8MA 2D0HA 5BRZE 3RNQB 4QWWC 1IAMA 2BVQA 2KL6A 5BQ7A 3VRJB 2DBLH 4HMDA 3WNKA 4KXZI 1X5LA 4M6MH 5FYKD 4H8WL 4YZFE 4FXKB 4RQQB 3OXSA 2CH8A 4K2UH 4GKSA 2YOCA 5EO0B 3DHMA 1MJUH 3KHOA 4NNXA 3NCCB 1KJVB 1R3IL 4ZODA 1E27A 4MAYA 1FG2A 4PJAE 5D1QA 3V8OA 3W9EB 5SX4H 1YDPB 2DLFL 1CLOH 4TQEH 1DR9A 4F9LA 2BOCB 2CJUH 1V3LA 4Z95L 2VLKD 1Q9LA 3UYRL 1RHHB 3B9DA 2EDEA 3ZDYE 3PGFH 4N8VB 5FYLL 5IVXB 3IJSA 1TZIA 4PLOB 4U1NA 2GJ6A 2IQAB 5DO2C 4LLQA 5E99H 4YXHH 5LCVH 4HJGB 2QBWA 5CEXB 5C9KA 2UUDK 2BFVH 3RWJB 4OLZL 1PQZA 5LGJA 4ZO7A 3RWJA 3PWLA 5LGJB 2VLJB 3LPWA 2F53B 5DJ0B 2R2BB 1AJ7L 2VDPH 5TDNB 5DQJB 1MWAA 4OSUL 3OXRB 1RZJC 4WO4A 3OXRA 1NAKL 5FGRA 5EU7E 1MHPH 4DKFL 5I1AA 1YPZE 2UZYB 2WBJB 5J6GA 1N7MH 1MCJA 2DM2A 4KDVA 4HGWA 4R7NB 3D87B 5IHZA 1MIMH 2OP4H 4XBEL 2GCYA 3MLPA 1H8NA 1M05B 4KZEH 3CK0L 5HHNB 5I1JL 4AMKH 1AQKH 1I8LC 1WBYA 3NFSH 1W72H 2C9AA 3T3ME 1JZ7A 2EDTA 2HFGL 5DRXB 1L0YA 2NY0B 5CCKH 3LDBB 4G7VL 5F1IA 1BQHG 4LEXH 3ULVD 5FB8B 3HMXA 5IFHH 1KLUA 1MFCH 2FH8A 2YXFA 5HI4C 1KIPA 1YPZF 1EBPA 5J1AB 3N9GL 1QA9B 4DOHB 1QA9A 1G9EA 1NH6A 5EBLB 1JNHA 2K7PA 1FFPB 3DV6B 5DJAB 1RZ7L 3K4DA 2UZXB 5CJQL 4JFED 4P48A 1MCPL 5GGRA 2DLTA 4JJ5A 4PGCA 4S2SA 1MCLA 4XP9H 2LFGA 2R15A 1NJ9B 4O2CA 5FYKE 1A22B 1W72L 4YWGL 3D85D 2FGWH 5FA4B 4AG4H 1YEIH 2D03H 5JOFB 2XA8H 2ATKB 1CD0A 3KXFE 2D0FA 1S9VB 3UZVB 1EGJA 5HVHB 4PGZA 4U2YA 1VDGA 5CGMA 1N6QL 3QUZB 1TTGA 5I1GL 5SWZA 4LFHD 3D18B 1NUNB 5E2TL 1CL7L 4GBXC 4G6FD 3K8KA 4KKNA 4MQTB 1NBYB 1Q9KB 3DRTB 5I19H 5BOPA 4YAQA 4E0RB 2A77L 4LSDA 4PJDB 3JUZA 2WIIA 4JZJB 3KPOB 1TZGH 4XMLL 2AJSH 3SDAB 4LCWD 3SDAA 1U3YA 4PJ5A 2VLMD 4OZGF 1QSEE 1I7TB 2HN7B 3AAZB 3MGTB 4TVSa 4YHNB 3JV5A 3QDGD 4Q58C 1ZLWH 1FZJA 1IC1A 5SWSB 1JF5A 5E8NA 4JFEA 2LVEA 4F58H 1W0WA 4N0YH 1I8LA 3UEZA 4LQFH 1RPQA 4PRNB 3TZVA 1MCIA 1T2JA 3EFDH 4OCMC 2APVA 1BD2B 4LSSH 4IOFC 3QUYA 3HE6B 5BZWA 3PIQB 4OM0L 2R23A 4GW5A 3M07A 3VGBA 2D7TL 2XQYG 3A6CH 5DF0A 2VIRB 3INUH 3QISA 2R2EA 3CIQA 2R2EB 4XVSL 1I7ZB 5D5MB 2WUBH 3EAKA 1TPXC 1MPAH 5F8QC 1F2QA 5DGRA 3QQ3B 1A3RH 5CZVL 3EJZD 1BM3H 1EUTA 3DPBA 5C08E 4RDQF 1EZVY 4XBPA 4OIBA 1ODAA 3C5JA 3W9DA 1DANT 1OARH 3DYMA 3MJ9A 5DLML 1WQVT 2MCPH 5ACZA 3D0VB 2YRPA 2ED9A 2CIIA 5E8EA 1MCRA 2V5YA 4R4FH 1F4XL 1KG0A 4XMPH 2AJZB 1U8PA 5GGVL 3LH2L 3ZYOA 1U8PB 3ARDC 2Y5EA 4B7LA 1PKQA 4JY4A 3WIHH 3TO4D 4OD1L 5E6IB 3K2UL 3KWWB 1OAXH 4PG9B 3LRGA 4NM4L 2FL5A 3TNMA 5IOPA 1V05A 4NQCB 4LVOB 1ORSB 3F12A 4KI1A 4KK6C 1R5VB 5D7JD 3TCLA 1A64A 2BSTA 4MXWL 4O4YH 4DEPB 1B0WA 2DQIH 4MA7H 1VFAA 1AQDA 3QIUC 4OT1L 4D0DA 1HXMB 1HHGA 1F11A 3QH3A 1HHGB 4NQVB 1OLZA 3BN9C 4UAOC 3KR3L 3WNNA 3T4AA 5ISZE 3HAEB 4FFWC 1TVBB 3RIFK 3MLXL 2FGZA 3OB8A 3QYCA 1B0RB 3PUCA 4JN1H 4KKLC 1A6TB 1FVDB 2F53D 4OCNC 1A7BA 1PLGH 5EB9A 1MPAL 5C0JA 3NZHL 2EZ0C 1IGFL 1NEZB 1WAAE 3WHE0 1JPFB 1NCWH 4LLYA 1H8SA 4G9FB 4UDTB 4UUJB 3RWGA 4NCC1 4X4YB 4WFHE 2PTTB 2YPVL 3OG4B 2A6JA 5L0QC 2BY1A 2Y36L 2R8SH 1INEL 4NO5A 4X6CE 1NGXB 3VXRE 4OGAD 4U1LB 3FO9A 1MHCB 1CFNA 4U1LA 2NW2B 5E08H 4U1SB 2AQ1A 2YS4A 5D7LE 5JUEL 2IMNA 5JR1L 4ONGL 4CMMA 5JPMA 4P2OA 2XA8L 2EH7H 5I0ZA 1I75A 2XWTB 3ELAT 4HGKC 1ZANL 4OAWA 2C3VB 4UBDC 1DSFH 3BH8A 5FGCB 2XTLA 3FQWA 5HBBA 2W0LA 2Y07L 2EC9U 4LSVL 4L8SA 1IKFH 1AGFB 2KDGA 4XNQB 2E8YA 5LVEA 2CLVA 4WUKL 4RISL 5FK9B 3SGDH 4QRTB 4X4XB 3VXMD 3DIFB 2Z91B 4IS6B 5GPRA 5I15L 4ODTH 1UEMA 1MIEL 3MV7D 1XGYL 2IH1B 5JW3H 4KKCC 2ZG3A 4BSVA 4QRQA 2HKHL 4PJ9D 2W92A 3WDIA 3P9LB 3W0WB 5J89A 4M5YH 5D2NA 1CDIA 3FO0L 2HJFA 3MJ8A 4PJXF 4LRIA 4J4PD 1H3TA 5IT2L 4PGBA 2AKRA 5E2UL 1MHEB 2QHRL 4Z7UB 5B4MD 3CDYA 2XN9E 4XHJD 1WBXB 1XR9A 3BKMH 4TSAH 3OSKA 4YHOH 2H2PD 3QUXB 3E8UL 5DJZB 2NY6D 4LCWB 2NXYD 1H3VA 1MQKH 1KELL 1LO0H 4C4KO 4N0FA 5T33H 2JE8A 4GBXB 3ME0A 3V6OA 3WUWB 2W9EL 3BP6A 4P4RA 3UBXI 3WUWA 2PKDA 3LPFA 4X5XA 4MA7L 2VDLH 2WUBL 3T3PF 4WJ5A 1ND0B 1FH5H 4DKEL 2DQHL 3FB6B 5E03A 1IEAA 1YNKH 5IB5A 2FCBA 2VUYA 2XY1A 1QYGH 5FUZL 3L6FB 3MREB 4H1LA 4PTTB 1OSPL 5HXMA 4M1DL 3MREA 4H1LB 2CK2A 2R1XA 4POUB 4YHKH 3T0EA 4PJ8A 2WM0A 1J8HA 3QG6A 4YQXH 4JFFA 2Y4SA 3I9GL 3H3PH 1S7TB 4OIIH 5K9QI 5E5UB 2HJKB 3CSYA 5DMKB 4YBLB 1HINH 2Z92A 4XPTL 2X2YA 1SYSA 1NMCC 2ZSWA 2I5YH 4MNHA 1U6AL 2GHWB 2XTJC 4WEBH 1SYSB 4ZTPL 4ZDHB 3QDHA 2XKSA 3NPSC 3ARYA 1F3DJ 3EDFA 3BHBB 4NRZB 3TPUB 4BJLA 3L9RB 1PZ5B 4N9OB 3UTZB 5B3NA 4QRPB 5D7KD 1NCCH 1RIHL 3LEVH 1RZKC 4URTB 2XKNA 4F8QA 4G6ML 2EC8A 2D9QB 3P4MB 1Q9WB 4NQCD 3DX8B 4X6CB 4IHOA 3SKOA 1RJZA 4NQCE 1S7WA 3RVUD 5F9JB 3TNNB 5F70A 1HSBA 3OKKA 1LE9A 3LEYL 2XNAB 2CO6B 4BZYA 3VRIA 5TQ2H 4ETYA 4BZ2L 1A6ZB 2CMRH 1ZHNB 1A6ZA 2HTLC 3L3IA 1HILA 4XMKH 2FYYB 3VFSB 2FYYA 4HIEA 5SWSE 5EU4A 3IYLW 4RFNB 2GUOB 1G7QA 2BC4B 4OLEA 1EFQA 5DS8A 2BC4A 3O4OC 4LCCB 3IAGC 5IP4A 2W1NA 1T2XA 3NTCH 4KTDH 2RJMA 4ONGH 3MRMB 4P5MA 4HX1A 4JFYA 1RIHH 5C2BL 2D7OA 2DQTL 4GW4A 5H37H 1K8DA 1S7RB 4N0UB 4JKKA 3QPXH 4M48H 1CK0L 4BKLA 4RMWA 1YC8A 4A2LA 1O5DT 1MF2H 1F4WL 4MX7A 4JO1H 1CGUA 2OMBA 2W65B 2YPKB 3FQNA 1FORL 3JV6B 4JAMB 1RIUH 4QLRA 3H42L 3MNZA 5CP3H 4JR9L 5DD1H 3VWKC 1X5FA 3MV8E 5IHBA 1BF8A 3AREA 4IRSA 4HKXA 4QHMA 4NN7B 5E7FA 2AI0L 5I8KL 1HKLH 2V17L 3TF7C 3LKQB 3GI8L 2B4CH 4KDTC 4LAJH 1KPVB 5HDBE 2GQHA 1KPVA 3C8DA 4P49A 1UJ3C 4BH8B 3K3QA 4JN1L 2PW1A 2XRAL 2Q3AA 4G3YL 1HHJA 2VDRH 2DS4A 2ZNXA 5GISH 3E6FA 2V7NA 4UQ2A 4OBRA 5L0QB 3RIAK 1EAPB 1JPSH 4KVNL 4JG1H 4WU7B 3GO1H 1YMMD 1A6PA 4UIKH 4X99B 3U36A 5IEKB 4F7EB 3CVHB 4Q6IB 4S1RH 2QHRH 5J7CC 4OM1H 1MNUH 4GW1A 4UB0H 2OTWA 3G6DL 4K3GA 3UC0L 1FYHB 4LSUH 3PQYD 1U41A 1EA9C 3VXPB 4NNPH 12E8H 3O4LA 2NPLX 1TTUA 4U1HB 4UT7H 4U1HA 4N1HB 4LNRB 1TQCC 5JXEA 1I7RB 4DAGL 3LKRA 4PJ9B 2NX5B 3ZT6A 5C6TL 3UBXG 2V5MA 4MD0B 5MHSD 3L3HA 1G7LA 5E9DD 5GSRB 3VXSE 1BREA 5ICYB 2J2ZA 3GSWB 3M17A 3T0DA 1G7PA 3QDJB 1KJMB 2Y07H 4WFEE 3UP1A 1JNLL 1G7PB 3QDJA 2DQHH 1B6UA 4R2GB 3UTSD 1F02I 2P7TA 2XPGB 2BSED 2D7PA 3P30H 1N2RB 3QCVL 5FO7B 2HT3C 3F6IA 4HULB 2VDQH 1X9QA 1KTDA 4XVSH 1KXVC 3QEHB 4F9PA 3LKOA 4LARH 3VFPB 2CR6A 3QDJE 3RGVA 5LQBL 2FLBT 4G3YH 5HHPA 1NFDF 3VGHA 5HHPB 3MUHL 3VFNB 5K33A 3C5SB 3MRKB 4LSRL 1T83C 1F6AA 1NUGA 1QRNE 3QUZC 4PGDA 3Q2CA 1A2YA 5C8JA 4ZFZA 1IT9H 4DTGL 4H0IA 4PFEA 5EU6E 1G6VK 1LEGB 4LSPL 4KJQD 1LEGA 1U6AH 3DTXB 4I0PB 5FOJA 3QUMH 4JFZL 4OFKA 4C59B 2X89A 2YR3A 2BSSA 1PBYA 3RL1B 3G08A 4KU1A 1HN1A 5C09A 3UZEA 3KYNB 4H8WC 3ARRA 5FF6A 2A1WH 1DVFC 1NLDL 2H41A 3IGAB 1HSAB 1OGTB 4XB7A 4PPTA 4PJDF 2VLRD 5CBEA 1OGTA 4I3GA 3IDGA 4XRCA 3IDIA 5EN2A 1WZLA 3IDIB 4JZOA 2IAMC 3IU4H 4IDJL 5CZKA 1R5WB 4NT6B 5ID1A 1OAUL 4WU5B 4NT6A 5ID1B 4I18B 5F7FA 4G7VH 4RAUB 3H3BC 5DJYA 4OCXH 1S8DB 4TRPH 5KBNC 5KVEH 1XF4A 5DHVH 3EKCA 2DDQL 4JRYE 4JHZA 1Z0NA 3VD7A 1EHLL 2OI9C 3F7PC 2EO9A 4WTZA 1K85A 3NFPB 1Q72H 3VFWB 3NFPA 3NCYP 1GOFA 4AQ1B 2NW3B 1HKFA 2X89D 1EEZB 3DVFA 4S0TD 1KUMA 4FA8A 5JHDB 5IROC 5JHDA 3RVXC 4XXDA 5SWQA 1HCVA 1GPOL 1IKNA 4I77L 4NZRL 1AGDA 2VITA 5IEHB 5J6HB 4IBLT 4KWUA 1DN2A 3BZFB 2OJZL 1CXFA 4PJGF 4RMRA 3V5KA 2NY4C 4HS6A 5E6YA 3O2WL 1DQDL 1KIRA 3OV6A 2VLKA 3KAAA 1RUKL 1X4ZA 4Z5RA 1P4IH 1LEIA 3CDCA 3AREC 3O6FC 1WFUA 4JG1L 4Y4HA 1T7XA 4MA8H 2F74A 2JELL 1UQSB 3FRUB 3NCEB 1MAML 3I3EA 3U9PH 1U58A 2YD4A 3MA7A 1T1ZA 1HQRB 1PGRB 3IFLL 5EUOE 4OUOA 5FGSA 3O8XC 1YEJH 1N3NA 4EVNB 3X17A 1CBVH 1L6ZA 5CIPH 1ZA3B 3VH8G 1KPUB 3IXTB 3UYOD 1XH3B 1G84A 4X6DF 3ZE0F 5C3LD 1MAKA 1KBGL 1D5ZB 4PGEB 2BNQB 1BIIA 3GNML 2WZPD 1LDPH 1Y18A 2HKFL 3IKCB 3C08H 1FN4A 4F33A 4R96A 1OOAA 4R96B 4OLXH 4LLVB 5T3ZH 2E9WA 1YMMB 4ELMF 1JFQH 1YMMA 2IQ9H 2UZIL 4CVZB 2YK1L 4X7EC 1I3UA 1K2DB 5F3BA 1U3HA 1P7KB 1NCAL 4RAHA 3OB0K 4YUEH 4YPGB 1MWAH 4HIHA 2ZUVA 4Q9RH 5HYEA 2C26A 3AM8C 4X6DE 3ZE0E 4Z76B 5ADOL 1MRDH 3AY4A 3CLFH 2L0DA 3PV7A 3QIUA 4U6TA 2ZOKB 1A6AA 5JMRA 3OQ3B 2V2TB 4H88L 4Y4HD 3R4DA 3TIDA 2ZSVA 3QXUA 5CZVH 4UV4H 5J57B 3P9WB 1GOHA 3E2HB 3HN3A 4JM4H 1FRGL 2HWZH 1OP3K 5DGQA 1OTTD 4PJFF 3KNBA 5IF0A 3AVEA 3MFGB 1FV1A 5C0DA 4F9LC 4GXVH 1EVUA 1UCTA 5KVFL 1ONQB 2DQDH 4LP4A 3G6JE 3GMQB 4EUPA 1CI5A 2IGFH 2OS7A 4PJAA 3BVNA 4GKNB 2Y1VA 1C5DB 1IGML 3UTSB 1I1AD 4HUUB 3EYSL 4JO2H 3UTSA 5IVOA 5FA3B 4P2RD 3Q5TA 2X70B 1N5AA 3KPRA 2Y6SD 1H3PH 4OLYL 4BSWB 5IVZB 4OD1H 1KBGH 1NMBL 1N7ML 1KTLB 1HINL 4MCZB 2GJ6E 4Y4KB 4MCZA 5GJSH 4DN4H 1MIML 3KLAA 2XKUA 1JZ4A 3QI9B 5EC1A 2CKBB 1CG9A 4QWWD 5EC1B 3QDMA 4Y8AA 2WWKO 2V2WA 1CZ8L 3ARWA 5EOQL 5F1NB 2V2WB 2H1PL 3G6AA 4YDLB 2LAAA 5BVPL 3D25A 5F7EL 3P77B 3C5ZD 3P77A 5C70A 2VISB 4JFPA 5D7SH 1LE5A 5I1JH 5EPMB 3H7BB 2Z31C 5EPMA 3PWNA 1SY6A 1ORQB 3PWNB 4EIGB 2VZVA 2AJXL 2J6EH 3HC4H 1RUAH 1F4WH 3D0LA 1V7NH 3SE9L 3D2UD 4P5TA 3TJHC 5I9QB 5IBTH 1AR2A 1A6VL 3UTTE 3KPRD 2LVCA 2G5BB 4GS7C 4NZRH 2GI7A 2HTKC 4Q0XL 3M1BA 4HCRA 1F45A 4JZNB 4NUGH 5IM7A 1QFWI 1I1AA 1K9TA 4UAOB 1ED3B 2HA1A 5F7UA 4IJ3C 4QO1A 1AGCB 5HYSG 2OL3A 4Y16D 3QQ4A 2XRAH 2C7UA 1FL6B 5D7IE 1DBML 4ZG1A 4LSVH 3QNZB 5JPNA 5FYLE 1GAFL 1OQXA 4IRSD 4JO4L 4QGYA 3L7EA 3FRPA 4P9HL 1AFVH 3QDMD 3OJDB 4ZO8A 2Z4QA 5EOCJ 5D2LF 1IC4H 4P3DA 4F15C 1WAAF 5L2KA 2DQJL 3TJHD 4U1IA 4QOKB 5L2KB 4Q9RL 4QOKA 3LRSB 5C0BD 4I5BA 1VKXB 2AQ2A 2F8VA 5IMOA 3AMKA 2P1YA 3BJ91 4OJFH 4OLWH 1TIUA 5T1KD 1CS6A 2QJDA 3VGFA 5AYQA 5D70L 2BJMH 1GAFH 5LXGL 3LMJH 1R6VA 1RZIA 4UINH 2DMBA 4PJIF 1KT2A 3OHXA 3MCLH 5JLZB 2BVQB 3RVVD 3I02A 1RZFH 4HK0A 3I02B 2QLVB 1G7JB 1K8IA 1U95B 4ZOAA 3FFCE 2ZPKH 3CVIH 3EFFB 4HCRL 1CVSC 3U4BH 2JJWA 4HEPG 1U92A 1FFRA 1U3ZA 1PVHA 2BVPB 4BQCA 1INDH 4H26A 1RUKH 1EFXB 1T0PB 3MLYH 3FONB 3GEWB 3HB3D 4HGWB 4R7NA 1QEWA 3OZ9H 3PNWB 2FJGA 1QBLL 4OFDA 4AEIL 3ZL4H 2B0SH 2KKQA 1T20A 5CLTA 1T1WB 1MCKA 1FZOB 3LN5B 4NNYB 3DVGA 3QEQA 3HPLB 4CMHC 5KAQF 1BZ9B 5EZIH 4ZUWB 1Y0LA 2QSQA 3S9DB 4NQDD 3SGJC 5FB8A 2P44B 4JVUA 2H26B 2ZCHH 3VDBA 3PP4L 4P4KD 1LO3H 2VRAA 3BEWA 4YDKL 1UG9A 2L7UA 4XPAL 1T0MA 4N5UA 4PRIB 1C1EL 1LK2A 2DL9A 2R2BA 5LAXA 3WD5L 2ICWJ 4WFFE 3RZWA 4N8VG 5D1XD 1LK3H 2F58H 5TDNA 3IVKB 5T5FH 3HC3L 3T0AA 1MWAB 4ONHA 1OAZL 1L7IH 4HV8B 4IOSD 2WINA 2WMPA 2DMCA 4OI8A 1S7UA 3EUUA 1CU4H 2A0LD 5E5MB 5I1AB 3ALWA 5I1KH 5I1IH 2J3SA 1XCTA 4WY7L 2L7JA 1I8IA 5CMAB 5KSAC 5ETUB 1J1OL 3RHWK 3MMEA 4YGAB 2EXWD 1NUFA 4KGJA 1M05A 5SWZB 2OYPA 2R69L 1WIUA 5GRXG 4HZAA 4TQEL 4MQ7B 1EHLH 5EFIA 1NBYA 1Q9KA 5D72L 3WHXA 1JBJA 2O26U 4MAUH 2RCSH 3RWDA 4IRZL 4JANB 2VZOA 1KNOB 5DD3H 1KNOA 4K94L 1PKQE 2M8XA 1NGYB 4HKBB 3ZDXE 3MGTA 3QDAA 3WJLC 3ZYIA 3KPSA 4NC1C 2I60H 3QUML 3HZKA 2BDNH 1BQSA 3SJVB 4JFEB 3P9MA 2VQTA 4LK4A 3O3BB 4M6NL 4FQCH 5IMLA 4RMQA 3OKEB 4OF5A 4LPVA 1H5BC 5IJKC 1G9ML 5DJCB 5DFVD 3T8XB 1NAMB 3I6LE 3MLXH 1LHZA 3TPKA 3O11B 4HIJB 2X4TA 3B6SA 3U0PB 2X4TB 3IDNB 2R23B 4GW5B 4O2FA 2W38A 1BHGA 4N0YL 4LCYA 2H9GA 1JVKA 2WBWB 1ZKAA 1S9VA 3BXNA 5FGBC 2ADGA 4Y1AD 1AFVL 3RWIA 3ARGA 3GJFK 4G6FB 3HTLX 2IWGA 4JE4B 1FNHA 5GHWL 2PUQT 2H8PB 3PWPE 5CUSH 4IJ3B 2M26A 3SE4C 1FGVH 5I1LB 2MPAL 4HPYL 3DRTA 2XQBH 2YRZA 1FPTH 1WC7B 3CFCH 1NGZA 1YMHA 2X4QB 3C5JB 4N0UE 5ESVA 4U6XA 2BOBB 1KYOK 3QNYA 1FVCB 1VCAA 4QRUB 1H3GA 3WLBA 4OUUA 1JUFB 2VXTH 5I73B 1F8TH 3N06B 1BOYA 1J1OH 1JYWA 2N4IA 4D0BA 1BQLL 1UB5A 3PE9A 4L4TD 4EBQH 1FBIH 4V2BA 3U0TA 4KZDH 1X5JA 4JKLA 3WO4C 5E8NB 2X7LB 4ZNCD 5IW1B 3SOBH 4RRPG 2H3NB 3E0GA 4Q2ZB 1PKQB 2H3NA 1KV3A 3S37L 2ENYA 4YJZL 1RAMA 5E6IA 3DV4B 3E3QC 3O4LD 4KQ4H 2WW8A 4PJBB 4OQ1A 2EYTB 5D6CA 2IPUG 4K7FA 3L5WB 1TJIH 3HZVB 2HJLA 5IBUB 4QHKI 1JIBA 1RUQL 4HWEL 1ZLUH 4CADB 1MNUL 1VEOA 4K7PL 4GXUM 4YDKH 4OD2B 3L5XL 2BXZA 4JGUA 4PLNC 2O5ZH 4S1QL 1FO0B 1XF2B 2VXTL 5SX5H 4PJEE 3RA7H 2AW2A 4MGXA 3HE7B 3FB5A 3UCRA 1LP9B 2ZJSL 3DVNA 4XPGL 1LP9A 2Z35A 5LGHL 1A4JA 3QEQD 5KS9A 2IBBA 3AUVA 3FHQA 3BGFC 3HS0B 3PWJB 1CCZA 3WEXB 3FO2A 3FT3A 5EUOA 3WEXA 4PIRF 4PYGA 4E41B 4GKZA 2B7DT 1CGTA 5I1IL 5I1KL 4NZTH 2EDKA 5ACZB 4KJWD 1GHFH 4TUJA 3C6LC 2BSRA 43C9A 2OZ4H 4PTUB 2BSRB 2Y6SC 2QSVA 5JXED 3QFJB 4LLYB 2V7HA 2HVKA 3ROLB 4FFVD 2IPTH 1JRHI 4HWNA 4AENA 3ARED 1TJHH 3CLEH 2EDOA 5C0GB 1INQA 4LEOB 3DBXA 5DVKA 5M94B 3DLQR 1MHCA 3HCVA 3D39D 1K4CB 1WFNA 4JPKL 4HPOL 5C9JA 1GSMA 4PB0L 5ADPL 5DJXA 1AQDB 4R4NC 4JM4L 1QVOB 5KTEH 4XNUH 5FYJH 1JHLL 5E2JA 3RY4A 5HDOA 3N85L 4H0HB 4Z7OE 4UILL 1HZHL 4H88H 2R0WL 1QO3B 4PRPE 3B4NA 4ODTL 3KPSD 3VDAA 4BUHA 3BQUA 5MEND 1S7VB 5HD8C 3WFBL 4GG6A 3QZWB 1QHOA 1NAMH 1QFOA 4GXUN 3SO3C 2E27L 2X6MA 3ZDXF 3BWAA 3RPIA 2D7QA 2B4CC 3RPIB 5I6XC 1VENA 1EXUA 4V1DA 3PJSB 4D9QD 1SEBB 1SMOA 5ANMA 5GSVA 4XXCC 4BSVB 4EDXA 4QHLB 3GJFB 5FHAL 4EDXB 2BZDA 3TO2B 1FPTL 2XQBL 5TDPB 4HH8A 3OKDA 4P5KB 4IDJH 2X41A 2V5SA 3B2VL 2EDJA 4HUXB 3QCUL 3QFDA 4HUXA 3THMH 4WW2C 5FYKU 1SVZA 4RWHA 5C0NC 1LO3L 4MJ5A 1T21B 1EMTH 3RDTA 5IBLD 2F5BL 1Z9OA 2D4FA 2FEDD 5IW6A 2OX5A 5JORA 2IFFL 3RX7A 5F93C 2BY3A 1J0IA 1L0XA 2CRIA 3BP6B 4LHQB 4PJEB 3V4VL 3K81A 2I9LB 1EHNA 4XP4L 2OP4L 4Y5YC 1AGBB 4OFYD 2Z91A 4NQXA 4TVPD 4HWBL 5FYJU 3U6RB 3KS0H 5GJTL 2VR9A 2LQRA 3SKUD 1NGQL 1BWWA 2C3XA 4QXUL 4IRZH 4NQSA 4FZ8L 3Q6FA 3CMOH 5D9SA 5H94B 2FJFB 2R2HA 3W0WD 3CAFA 5AEAA 2DICA 4HJJL 4N8PA 3RNKA 1SBSL 4X0KA 2DQGH 2VSCA 4ZXBD 4JFOB 1V8HA 4MA8L 2E27H 1JCKA 4OZGB 2AJUL 4ZD3H 1KN2L 1S9YB 4LAQH 4WV1B 5ANME 5IBLC 1EV2E 4CVUA 1XR9B 2YD7A 4KQ3L 5CP3A 1CQKA 3U79A 5DJZA 1AHWC 1ZS8A 2APTA 1JWSA 4HMEA 4M7ZB 4N0FB 1NKOA 1A5FH 2CDEB 4GOSA 4D8PA 3UJTL 1GOGA 5F9DC 5I1EL 4TSBH 4QRPA 2Q3ZA 2I24N 1QHPA 2LU4A 4UT7L 2WANA 3GFUA 4XZUA 5DJ2B 3X13B 3EOBA 3H8NA 2V9QA 1CT8B 1QFWH 5ENWB 1AC6A 1FNEA 3GZKA 1U8LA 4JPIA 3I50H 4WTZG 4W68A 5GIRB 3H9HB 1EX0A 1G7HA 5IHUL 3VRIB 2DLHA 1JYNA 1ZHNA 2WBKA 4XVJH 3L3IB 3QZWG 2VNCA 2P8LA 4PRIE 5B8CB 3TYFB 1G7QB 1JYXA 5C0EA 5K59F 1TXKA 1Q1JL 1JPTL 5CEZE 4LCCA 4DTGH 3MRCB 4I9WE 5BCAA 5GS1C 2MFNA 1T22A 3JV4B 3VXSA 3RAJH 2I27N 3MRMA 3UO1L 1DBBL 1SJHA 4L4JA 4X7TA 2D3VA 1K8DB 3QRGH 3REWA 1S9WA 5K9QG 5C08B 1S9WB 2UUDH 1KCRH 5HYJD 1KCSH 3HE7C 4MX7B 4I0KA 1PG7X 4DVBA 5HGDB 1TJGL 4F7PA 2BVOB 1YPZA 1PSKL 4P46C 2X42A 5IJVA 3GBNH 4WGWB 3AREB 4QHMB 2E7CA 5EBWB 5I17B 3VXMA 1RZJL 1KULA 3D9AH 4M1GL 4UOW0 3TNNA 4G8EB 3O2VH 5BS0D 3BH9A 4G8EA 2IFFH 1I1CA 1L7TH 1P6AB 1U9KA 4M7LH 2ZOLA 2VDKH 1JTTA 1ZT1A 1NLBL 1DBBH 1R5IA 32C2B 2GUOA 1MLCB 2P5WB 3MRQA 4WHYG 1MLCA 2MNUA 2IF7A 1I3GL 1BEYH 4OLZH 4GQ9H 3MUZ1 1WIOA 1TDQA 3TFKC 4NBYB 3G6JF 3W11D 1Q94B 4M3JA 3BKYL 5J3HC 4N0UA 5KVGH 5D71H 4I1NB 1E6OL 1KJ3L 1CQYA 4GW1B 4K94C 1ZVYA 4M93B 4WIQA 3SDDD 3V4UL 2F19L 2J6EA 2FEEL 3WKML 1I1YA 1J7VR 4ZTPH 4QTIL 3MRJA 2CSPA 3MRJB 1G7IA 3QT2A 3FQUA 1A8JH 1Z3GH 2AGJL 4ZD3L 3MRGB 5DFWH 5IFHL 2E9IA 4HKXB 4HKJA 3TO4A 4PB0H 3GJEB 5IBTL 4NCC2 4DGIL 5FDWA 2NX5A 4JZJC 1F4XH 5FDWB 4Z78A 5KVEL 2HFGH 3LN9A 4Z78B 2FB4H 4M6AA 4FQCL 4MD0A 4XAKD 4MSWB 2L4OA 2CDGB 1PX4A 4YFLF 5I8CB 3GUTA 4NO0D 3R8QA 2NY5L 4YHML 3NZHH 1FFQA 3FB8B 3TBVA 2W0FA 1JV5B 2O61A 3IFPB 4HIIB 2FBOJ 1DL7H 4HWBA 4M1CC 3DMMC 5TDOA 4P2QD 1MQ8A 3I85A 3ZMRA 3EOTH 3O3EA 5LWYH 3DX6B 1RZKL 1XAUA 5IB2B 2W0PA 3MC0A 4PJ7F 5IB2A 4L4TA 5MEQB 5EC2B 4M8VA 4EI5B 1QSFE 5CP7A 5HJ3A 1HXYB 5DEGB 1QG3A 1HXYA 5DEGA 1AI1H 2XZCL 1QFUH 4KUZH 1WZMA 4S0SD 7FABL 3FQRA 3HB3C 3OJVC 4N9GA 4XNXH 5C8JB 3U4EB 3O3UN 3O6LL 2IANE 2ORBL 4IRJB 4X5LA 2Z8RA 3RWEA 1RIVH 4JRXD 4PUBL 1RIUL 3RKDC 3PWPA 5C0FB 1M7IA 3KHQA 5DHVA 5DVLA 2BSSB 3GMMB 2NY3B 2BJML 1FAIL 2DQFA 2Q1EA 2X44D 2DQFB 5F89B 1G7LB 3ZTNH 4KHXH 4OGYL 3GJFH 3HFML 4TVPL 1RZKH 5E0QA 1A6WH 1CFTA 3D39E 3R06B 3ULVL 1M71A 1CE1H 4J3OC 3QDJD 4J8RB 4OCWH 4WWKC 4YWGH 3MO1A 5DA0B 2C3HA 1DCLA 4XP9L 4H20H 4YBLC 2F8OA 3MUGA 1KCLA 2A0LC 4AG4L 3NIGF 1VFBB 1DSFL 2YC1A 4OM1L 1QBLH 1QKZH 4WI3A 1NCBL 1I85C 2Q8BH 3DMMD 3GSOA 3P4LA 3ZTNL 2AJ3B 2XXCB 4I2XA 3ZTJG 4KMTH 2PO6C 4JJHA 1JGEB 2QADC 4I8DA 3VWKB 1Z5LA 4NGHH 3O6FA 4Y4HC 5DC9B 1S7SA 1P4LA 4YXKL 2IPTL 3KPMB 2XQYK 4OZFA 1HHHB 2RFXA 2WBJC 4TPRL 5FO9A 1W0VA 4HJGA 4XVUD 3UROR 2FIRT 1OAZH 2FR4B 4OZFH 1V3JA 3IDJA 2HAZA 5C09E 3AMLA 1TVDA 4KZEL 5DQ9A 3WE6B 3ZZ1A 3LVEA 4KVCL 4XPHL 4R9HA 4W70A 5FYKH 1M7XA 4LVOC 1OP5K 2F74B 3V4PL 4Z7VF 1L0QA 3I9GH 3WFCH 1RUPH 3OKNA 1BFTA 4MAUL 5TE6L 4E9LA 4C83B 1D5XA 2Y7QB 4JVPA 3QDGB 4KJPD 4LF3A 5DRWB 2VXUH 2A6DA 4IMKC 3RTQD 3CD4A 3RWFB 4EVNA 2VXQL 1DJSA 2NY5H 3MRPB 4YHMH 3AU1A 2HFEB 5BJTB 4KY1H 4JFQA 2FZ3B 3GIZH 1OHQA 2W59A 4QTIH 3KG5A 3VG9C 4DN4L 5KW9H 4K3JH 4OF0A 2EE2A 5F88A 5DRXA 2Z8SA 5I8EA 3HI1B 1E6OH 1HYRC 4XCFL 3H9YA 4YDIL 1J05B 2IBZY 5JXEC 3TBTA 3SGKA 1J05A 5CD5D 3FB7A 4U6VH 3STZA 3S97C 1CZ8H 5JDJA 5CBAA 5JO5B 2FIKB 2QR0A 2EIEA 3F7QA 3T0BA 1IC7H 5FIEA 1S78D 1A7QH 1KCVH 4O51A 4IMLB 5DRZB 1JNHB 3QCUH 1AKJA 3GGWA 1CGSL 4XNYH 3BDBA 3NCFB 2JIXB 1SM3L 5GGRB 3TO4C 3FRUA 3MX0A 2ZWLT 4BZ2H 1RJYB 5F7KC 1CE6A 3SE9H 4JEGB 2V9TA 5F96L 2WAHA 5C0IA 4RMTA 1LMKA 4U1MB 4AMKL 1GZPA 1ZLWK 5KSVA 3TBSA 5F7WC 5KSVB 3MACH 3G04B 1T83A 3GMOA 4HH9A 1NLBH 3QUZA 3GMOB 3GIVA 1GGCH 4LLMA 4RSVA 1AXSA 3D18A 3F8UB 1JWUA 5C1MB 3KVQA 1BIIB 4TNVK 1YQVL 3HG1B 4U7MA 4NBXB 2H6PA 4N0CD 3GSNH 1EPFA 3FT4B 4ISVB 2D31A 3BVNB 3M8OL 2D31B 1D6EB 4UBDD 4EI6B 1HHIB 5JHLH 1T3FB 1HHIA 3TCXA 4YHNA 4M62L 3WFDH 1K2DA 2F54D 3LQMA 4G8GE 4H25A 5SWSA 4YPGA 2OK0L 3P4OA 1A9BA 5MERB 3VFGH 3U9UA 5I1CH 4QRSA 3VGGA 3T77B 3SCMA 1DVFA 4PV9A 2PTVA 3ARBA 1IFHH 5EU7C 4PV9B 3IDYC 2X4RB 4ZS6D 5EUKB 4RWYH 3IDMA 4QRRD 1YA5A 3KXFD 3A6BH 3DROB 3PG2A 4IRJD 1KGCD 1JE6A 4RMUA 2X4UB 4JREB 1HDMA 2BHYA 3UO1H 1HNFA 4LASH 1BBJA 2IG2H 1BBJB 1FYTE 5EZLA 3SE3A 1NCBH 3U1SH 4A6YH 5H35A 4JLRB 3CSPA 4NBZB 4L9LB 2YBRB 3MV9D 3VGEA 4M8QA 3BKCH 2Z9TA 2AABL 1MQKL 1C16A 1C16B 1LK3L 5AAWA 3C5ZA 4YNYB 2BERA 3CCHB 4AH2B 1G9MC 4FZEL 3OR6B 3GSRB 2QQLH 1BJ8A 1I1AB 3HUJE 1A14H 3P3YA 3GSRA 1AY1H 4G42A 4LSUL 5JNYA 3IS1X 1OP9A 4FP8L 3RL2B 5GGTL 1YNTA 3BGMA 1YNLH 4NUJA 5GRVK 5GXBB 3RL2A 4U3CA 4HDIB 4HDIA 1CLZH 4OFIA 1IAIL 2EDDA 3FAXA 4WWKB 4Z7VE 4MQXD 4G7YH 4WWKA 4ZUTA 5D6DC 4NQEA 2IPUK 3D25B 3MV7A 4NHUA 4NQEB 3PHQB 4O58L 3MV7B 4NHUB 4UIMB 1K3IA 4NQVA 2GSGB 4HBQA 1E6JL 2MMXA 4GG6E 4NWTH 2XXMB 1B0GB 1GGYA 4FZEH 3D85B 3D2UB 3ES6B 1RD6A 4GQPH 2HRPL 3WS3A 2ZUYA 1BOGB 2Q86A 4ZO6A 3L95A 1RVFH 3VFVA 3RVTD 3EBAA 4ZFGH 4K71B 3QAZC 1N8ZA 5JTWA 5D5ME 4MCYA 4U1KA 4HUNB 3GRWH 3VRLE 2YMXL 4QGTA 5J4MA 5L8KB 4U31A 4PV8A 1J8HE 3PWVA 4YC2C 3OHXB 1AGCA 5B39G 1I8MB 1IL1B 1G1YA 2C7UB 1IARB 5B21A 2A6KB 4OF8A 3QJHB 3OKLB 5FV2A 4NSKB 4Z7OF 1TVHA 4OGZA 3VWJB 4FXKA 2OSLA 3AS1A 5D72H 3LIZH 4LARL 2LAGB 4PJGB 3V9FA 1HH6A 5GJSL 2HRPH 4PJGA 4M48L 5EO0A 2QQKL 4H5SA 5JZ7C 1SVCP 4Y5XC 1E4KA 5FO8B 3BRDA 3FZUC 5HYQA 1EHAA 2WLZA 4R3SB 1NC4A 2AJVL 3ULSB 2VKWA 5E1AB 3MOBL 4CN1A 3BH8B 3AXLB 1F3RB 5DZLA 4HQQH 4I5BB 5HHMB 3HAEG 5EU3B 5FKPB 3PWUB 5HGAB 3SO5A 4JFHD 3P4NA 5BRZD 4DFIA 3P4NB 1TZHB 4Y5VC 1TZIB 3K2UH 3MV9E 2CO7B 4PY8I 2IQAA 4L5FL 2NXZB 5CGYD 5ESAA 4HS3A 3MLTA 1FZKB 4UOJA 5F8RC 3QNXB 1CICC 2VH5L 5DT1L 5ISZB 5IQ9B 4W6WB 1U8HB 4IDLA 4LHUA 3L3JB 1H15B 2W60A 1U3HD 4LPTA 5HHOA 4D9RD 4GSDL 4M5ZH 2KZ1B 2E8ZA 4CBPA 2B2XL 3D6GA 1AH1A 2R1YB 3UPCA 4PRHD 1C12B 2HJFB 4WUUD 1T04A 4QRRA 1X5GA 4BQBA 1U92B 3WXVH 3OMZA 5GZNC 2VDML 4PGBB 1I9RH 4V1DD 2EDBA 1MHEA 4BYHA 1XCTB 4MNQE 1A14L 2MTPA 2IALA 1GVIA 1S5IL 2IALB 1IKNC 2PYFA 4FABH 5D7LB 5M95B 2DYPB 4W4OC 5LKNA 5J1TC 4L1HA 3WFEH 4LDEB 2P49B 1JL8A 4K55A 2YD1A 1IKFL 4K8RH 4MNQB 3PL6C 2APFA 4AY0A 2YUWA 3IKKA 1Y0LB 3H9SE 1WSST 1GGUA 4DWHA 3CXDL 1DDHA 4J1UB 2GFBA 5IQ7H 1IAOB 4HK3J 1ZXQA 4WJ5B 1XGRA 3B9AA 3U1SL 3VGDA 3ZYJA 1DEEA 5FUOL 3H0TA 3DUSA 1DEEB 1IEAB 5IB5B 3EJYC 5E70A 1UWXK 1IGIH 3REVB 5ILTH 3HUJF 4PRIA 3HZKB 2R1XB 3K8LA 2DM7A 4X6FA 1HWHB 3P0VL 4HUWB 1YYLL 4MJ6B 1S5IH 2GEEA 3WFZA 5TPWH 5CSGA 2WINB 1NAMA 4F2MA 4YHZH 4ZPTA 1A1NA 1R0AL 3PDDA 2XZAH 4CN4A 4FMFA 1SBBA 2Z92B 5J11C 3ARGD 3DUUB 2QSCL 5JA9A 1H9VA 1CDYA 4WUKH 4FFWD 1ETZB 3F7VB 5GZND 2DLIA 3FT2B 3O4LE 2I25N 2XA3A 3TT3H 1P9MA 3RWIB 4IOIA 4ZSOB 4IOIB 1TZGL 4PLKC 4LSPH 3SDDC 3WO3B 3R8BB 4MQ7A 2IC2A 2VN7A 3S5LG 3UMTA 5JW3L 1YJDH 3ESVF 1MRDL 3L3GB 4WCYL 4U6XB 5I1DB 4YXLH 4LCWE 2WIIB 4JZJA 4I0PC 3U7WH 1DZBA 1FFNB 4OZHF 2O5XH 1I3GH 4PJ5B 2FX7H 5GS1B 3BISA 4R97B 2P43B 3U0TB 1TCRA 3VI3E 5A40E 4PRPA 5DMIH 5F9WB 4ELKB 3BMVA 1G6RA 2FATH 5C0CD 1JRHL 1MAJA 5IMLB 2B1HH 5I66A 2DIJA 1Z9SA 2BNUB 2FO4A 4HIJA 5JOPD 1YEFH 2J12B 1CGSH 4ZS7H 3U46A 4G8GB 3BXNB 3I6LD 3V4VH 4DZBA 1NGWB 1I7ZA 4RA3A 2QQLL 1A7NL 4GW4B 3MR9A 4K3EL 3MNWB 3T0WA 3IF1A 4CVWA 3K2MC 4LKCB 5I1LA 1I3VA 4RFEB 1JNNH 4GAJL 5MI0C 3OAUL 5GRUL 3NCJL 3HNVH 5T3XE 1GGCL 1FC1A 2VZ1A 1F4HA 5DJDA 4CRPA 4XX1E 5F72S 4HIXL 1WTLA 1E6JH 4WY7H 4OUUB 3RIAF 2YD9A 4XH2B 1BFVH 6CGTA 3D0VA 3QCTL 3IETA 3HNSH 1VGKB 5ALCH 1GGIL 2CR3A 4L29A 3BRGC 2UYLB 4ZPVA 5EWIL 3CUPB 2EKSA 4LLDA 2FBJH 1AR1D 4QNPF 1PDKA 4JY4B 4LLDB 3WNLA 3GHEH 5ITBH 1MREL 4M6OL 3PL6D 2ADFH 1GZQA 4LHUD 4IIQC 1FDLH 2PXYB 4ZXBA 4I3SH 4U4BA 1EZVX 2EIDA 3TA3B 4WU7A 3VA2C 3PHSA 3MUJA 2DN7A 4J3XA 3CDGA 1VESA 4S11A 5GJTH 4X6BB 1LEKA 2DDQH 3SBWC 1G1CA 5DURB 5MENE 3MLVL 5KSAA 3ALXA 3HI6H 4Y2DA 3WNPA 4L3ED 2JCCF 3ARTA 2C3GA 2LTQC 3LS5H 3Q1SL 4F7CA 5FV1L 3WXVL 5LJYH 1TQBC 4HW6A 5FYJE 3CZFB 1KPRB 3I2CH 3DETC 1VFOA 3WV0A 1IM9A 3KPPB 4NWUL 5JHDE 3FOLA 3STLA 5AUMA 1FQ9C 4PRDA 5KTEL 3I3DA 3S35H 4GKZB 5DK2B 3TIEB 1J5OL 1UWGL 2DQJH 4TUJB 3TVMA 5K9KB 1X3DA 5D7JC 3NZ8B 1WT5C 3FL7A 1JPFA 2DQEL 4OF6A 4HPYH 4UDTA 4OLUL 4V1DB 3QPQD 4FQQA 2MQ0A 1X5YA 4Z6AT 1BZ7A 5BVJA 4N90E 1DBMH 3OKDB 1F4AA 4LOUC 5C07D 3UTSE 3FO9B 5C9JB 4GRLB 3WL9A 2E5EA 2ARJB 2VE6A 1D9KB 2XWBA 4GAGH 4ZUVB 4KDWA 4P2CG 5HGBA 3LKOB 1AE6L 5FFLA 1MCEA 4NPYB 4NDMA 4XC1L 3V6OE 1MREH 3DX7A 3DO3A 3T4YA 3DX7B 2C3VA 3DECA 1WWCA 1A47A 1GL4B 4FQIH 5T3XD 5C92A 3W5NA 1GIGH 4EEEA 1KB5A 2AXGA 2ZUQB 4AZ8A 1KB5B 1JPTH 4GG6B 4XNQA 1WFTA 3QIBB 3DTXA 2H32H 4UQ3A 5MENB 4P46A 35C8H 4X4XA 5L2JA 3BUYB 3SE8H 3MXVH 1R3JB 2XT1B 1U91A 1JJUA 5AG9A 4NZJA 4YBHA 3U6RA 2OBGA 4JRWA 3TYGL 3CGTA 3JWOL 4ZTOH 1BP3B 1NDGB 3RGVC 4XMLH 3B9EA 1EEYA 5BO1H 4M43L 2DRUA 1OP3H 1MWAL 1NSNL 1MFDH 4MXVE 2DLGA 4XC1H 4YO0A 1MVFA 5JQ6L 1HSAA 4ZOCA 1JGVL 3LS4H 5I1HH 3BI9X 3MGAA 1FNLA 1K6QL 4MJ5B 4HXAH 1AIFB 2VZ3A 5DR5L 1KIQB 1Y6NR 5TQ2L 5DJYB 5JORB 1JI2A 2AJXH 2YKLL 2GKIA 3EO0B 4B50A 2ICWB 4FQXC 3NACL 2ZKHH 4BQ9A 5LGKA 2NY4B 3LQAH 4L9LC 3HC3H 1N0XL 3QWOA 1AO7D 2NY6C 3FHAA 2B1AL 3UDWA 4XNYL 3S3JA 2G9HA 1WF5A 4NWTL 3EOBB 4KKBD 4M00A 4U6VL 1CLOL 1CLCA 3V6ZB 2IAMA 5ENWA 4NQXB 3EYFA 2HRLA 4PLKD 3VXNA 4Z0XA 3QEUA 4RGMB 4Z0XB 4B53A 3VRLF 4UZGA 1FGNL 1I1AC 1KEML 4BFIB 5EWIH 1ZHBA 3MBEA 1PAMA 5TGBA 4JO3H 4WHTA 4IMKA 1SEQH 1ZHLB 2X1PA 4NO0A 4TTDC 2XG5A 1KIRB 1U8JA 3IJHB 5HI4D 1U8MA 1KGCE 2HJKA 3CSYB 3AS2A 1ES0B 5JIPA 1NAKH 2JCCB 3LH2H 4DOHE 4LU5H 4WI8A 1J0KA 5C0BA 1QLEL 4MNHB 1ZS8B 5I76A 1A1MB 4G6JH 3S5LA 1YEEL 2QEJA 5HY9B 1UA6L 3ILQD 4LRNL 5DYOB 4LCIH 3QEGH 4PJEF 4JB9H 4GAFB 4YHYB 1EMTL 3BHBA 3TVMD 4C4KT 5CILH 2CDEA 3QO0B 1ZA3A 1BX2B 2X4OB 4DVBB 1U8IB 2G75B 3CDFA 3BSZH 1QSFA 2J1KA 2FSEA 4DVRH 3WSQL 4P4KA 3BGFB 4YH6A 4L8DB 3MLSH 3MOBH 3MLZH 4NQUA 4RAVB 5ITFB 1IAII 4UNUA 4M61B 5JHLL 1MFAL 1WGOA 3LAFA 3MGOA 4M61A 3A6BL 4KJYA 3H9HA 2MKLC 1RZGA 3PDOB 3ALPA 2R0LL 4QKXB 4HCRH 5E8OB 1FFOB 2DD8L 4POYA 4Z7VA 3VG9B 1E4JA 4L3EA 4X9FA 5EBGA 4YPJA 4L3EB 4BK5A 4OBSA 1XEDA 1UM4L 2YPLD 3SQOL 4O9HH 3MCLL 4Y2OA 2FGWL 1ADQH 4KRMB 4KMQA 4M5YL 1YY9C 1S3KL 4J7RA 1F3DH 3RVWC 1Q94A 4HJ0C 1SJHB 1WTGT 2Z31D 2B2XH 3TIDB 3CVHL 2X4PB 4N5EC 1S7RA 4WW1A 5BXFB 3SBWA 1NC2A 4OCRL 1HIMH 3F7YA 3T0VA 4LSTL 2CUMA 4Y8DC 4ELME 1YQ2A 3RI5K 1Q9OA 2EH7L 5DD6A 4HUVB 1A4KA 4HFUH 3HZYA 1FZMA 2OTPA 3SKMB 2R0ZL 3TO4B 4IRSB 5I1EH 1ZGLA 4CMHB 5E6ID 3TZVC 5I17A 4HZLA 5LQBH 2YK1H 1EVTC 1U93A 4HZLB 4ELMA 3R1GH 4P99A 3DMMA 1C08B 2X9YA 5D7JB 1HOCA 5DUPL 5FA3A 3MROB 3UAJD 3HI6L 4G8IB 4LQFL 1DBKL 1RZFL 1QYGL 4Y88A 3MODH 3MOAH 4BH7A 5JHDD 4S1RL 1L7IL 4MD4B 3DXAE 4BH7B 5L2KD 1QLRA 2MHAA 4UQ2B 4MZ3A 3VXQB 3CFKA 4DUVA 1YEJL 1D3CA 5CKGA 4MA1B 3FCTA 1JV5A 1EAPA 2GSIB 1U36A 1G6RL 1ZEAL 2J4WL 4JPWH 3ZKMC 1ZT7A 3KLAB 1QSEA 3QIBC 3QJFA 3U36B 3WXWH 5ICZA 1C5BL 3OPZL 3O9WA 2CKBA 3GRWA 2HMIC 1UH2A 4ZFGL 3SDXB 4UV7H 1OF2B 2NY3C 1OF2A 3O2VL 3PGCA 2BY2A 3RI5F 3CXHK 2VISA 3IAPA 4RBPK 4GMSL 3WFHA 1P6FA 3UTOA 3H7BA 2PO6D 1SMAA 3OKOB 3LQAL 1ZMYA 2CRYA 5DD3L 5DJ6B 2J88L 4G80A 4NZTL 1U8QA 4ZQKB 3V6OC 3IDXH 1QP1A 4XVTL 2VDNH 5EOTA 4DGVH 3IDYB 5DHVB 2EIZA 4P23A 4E5XA 4MLIA 4P23B 5FM5O 3NA9H 2DQTH 4KK5C 1D5BA 3WIHL 2B1AH 1EJOL 3E8UH 1E0OB 1IEBB 5IMKB 1AJ7H 2X1XR 2CRMA 3RZCD 4P2QA 3RNQA 4M6OH 3QQ4B 4P2QB 1P7QB 1RK1B 3VXRD 1EIBA 3JWOC 2XFXA 3L3OB 4LBEB 1N2RA 5FO7A 4PJ7A 1MRFL 4Y4FC 5JPNB 4OGXL 3DX6A 3OXSB 2KPNA 3H7LA 5I8KH 5KG9B 4PGJA 1X7QB 1VSCA 1UXWA 2ED8A 4Q74A 4OZIF 2BXYA 5GRYA 1JTPA 4QXTA 2BNRE 3WO4B 3W9EA 4EI5D 5D1XB 4M7ZC 5L9DL 4XPTH 2P48B 5E95B 1CFQA 5KSUB 3LRSA 1KOAA 4NQTA 1F8TL 2VLLA 5DC0A 1JGEA 4EN3C 2NLJA 2A9NH 2OR8A 4HJ0D 1II4E 2FX9L 5IVXA 4F9PC 2CRZA 3VA6A 4L3EE 3OR7B 1S9XB 2VJXA 2ZG1A 4DVRL 4XCNA 5DMGD 3PP3K 1KT2B 2OK0H 4Z77A 2FHCA 4Y4FD 3SKNB 2HP4A 2YUZA 4JM2B 5DMYA 2ITCA 3PWLB 1NKRA 2M1KA 1IM3B 1FE8L 5CWSB 5DQ9B 2NNAA 2NXYB 4FQ1H 3RVXD 4AIZB 3RZCC 5CWSA 5IGXH 5KSAD 2CGRH 4LQ1A 3ZKXB 4RWYL 2EDLA 1B2WL 2EE6A 5IG7B 1IGTA 2JK5B 1GJIA 4G6KH 4I18A 4P2QE 1E4XH 1OTTC 4I0CC 1I3RB 2A9NL 1VFBA 2YC1B 1OB1B 1EFXA 4AM0B 4Y16C 1FG2B 5D1QB 2EIBA 1C5CL 4TSAL 3FONA 1YDPA 4TTGA 1HNGA 1OW0A 2FJGB 3O8XB 3DO7B 3H2WA 1TQBB 2NY7H 3VFWA 3IU3A 5C0AE 1JHKH 5D93B 1G0DA 3LN5A 3SKJL 3X3FL 2XN9B 1Z5LB 3CVHH 3HPLA 1XF5B 4JO1L 1BJ1J 3QXAB 4XXDB 5SWQB 5DO2D 3HKFA 4XPGH 4XWGL 4H20L 1P4LB 4NJ9H 4KQ3H 1YNLL 4WNQB 4DUXA 2DBLL 4LPXA 3WN5A 3K1KC 1UEYA 4JDTH 3ZE1E 1X5AA 2JELH 4YHPA 2FR4A 2P24A 3PV6A 4O51B 4ORGB 5IWLC 4PJAF 4X6DB 2HT4C 3VCLB 1WWAX 4CDHA 3LKPA 4UNVA 1UZ8A 2QTEA 4DZ8A 2AEIT 1AO7E 4U6HA 3MODL 2NY0C 1JPGB 3IJYA 1AGEB 4U1MA 2PN5A 1UACH 4TULL 4TUOA 3FFCA 4O2EA 2H32B 1N3NB 1FCGA 1YN7A 4NP4H 5A3ID 2HFEA 4HH9B 1AY1L 4PJCF 5BJTA 4JDTL 3U7WL 1WBYB 4POZC 3AC0A 2OJEA 5GGSB 3HI1A 3X14A 4YHOL 5FM5M 4Y4KC 5TE4H 2EH8L 5ESQA 3UXFA 4YAQB 3VFRA 5GS0D 2W9DL 5D5MF 1KCUH 1RULL 2VDNL 4U0QB 5KVDH 2VDOL 4KK9C 4AIXA 1XGPA 3MBED 5I30L 5HDBF 4K8RD 5TFSL 2AEQL 3VXUA 1S7XB 5DSCB 1CD1A 5I0DA 5J1AA 2IADA 3MLUL 1UGNA 1NMCB 5HYJE 1CDBA 3P9MB 1JGVH 1IAKB 1VPOH 3BW9A 1W0WB 5HHVL 3DV6A 4D9LH 4QRSB 4PRNA 3SDDA 3SCMB 1KJ2L 3LN4A 5ECJE 5HHOE 3B6SB 1CL7H 3U0PA 3R1GL 1BBDH 1TETL 1KLGA 3HE6A 2WQRA 3P30L 4GXVL 4N1CA 5B3JE 3KR3H 5IFJB 3SGEI 3TN0D 3HG1D 2EYRB 2AEQH 2VDQL 3KNBB 1AXSB 5H35B 3JTSB 2F19H 1KJ3H 2H6PB 4WWID 1VGEH 1J8HD 5D4QA 4NN5B 3TVMC 3FQTA 5FCUH 3W9DB 3FFDB 2J8UE 3C60C 4C58B 4EI6A 1S7QB 1EAJA 3N1GC 4NN6B 5SWZE 5T5NG 3QQNA 4PJHB 1D5MB 2WWMC 1N5AB 4CGTA 2N7AA 4H25B 5EUOF 3TJEL 1QNZL 2VLRE 5DQDL 1FZJB 1A9BB 1OSZA 4MD5A 4NQDB 3LS5L 3Q1SH 5L6YL 4BFBD 1F58H 3IRPX 3FMGL 4HUKB 4LRIC 3IDXL 3OGOE 2OXHA 1LDPL 1P2CB 3UX9B 1R5VA 2DJUA 4JFZH 5BZWB 4ZUTB 4XWOD 5IB3A 5F1NA 2X4UA 4UIKL 4HC1H 2O5YH 3SQOH 2ESVB 1JZ5A 1IQWL 3NN8B 3RY5A 3RFZC 3K4ZA 4XHJC 5E2WH 1HK6A 4MDIB 1FO0A 3BZDA 3BPOC 2MCPL 4KAQH 3IFNL 1WK0A 3CXHJ 3N1FC 1UJ3A 3V7AE 5F7DB 3QIWB 3QG7H 1ROWA 4FXGB 5F7DA 2OI9B 4MDJB 4NO2A 5J13C 3U4BL 4MAYD 1YEEH 4HK3N 4OF3A 3TM6A 1NPUA 2OR9H 1GH7A 1B0RA 3EOTL 5E1HB 4L8SC 1UACL 4I4WA 1NGQH 3ARDD 5E8EB 4XI5D 2PF6A 5E94A 1U8NA 5IHLB 1KLFA 1N6VA 4HWBH 1U8NB 5JNYB 2YPLA 2GJZB 4F7TB 4XNMA 4WFED 2ZUXA 1EO7A 3PXHA 3MBXH 2QQKH 1JPSL 2A6KA 5IB4A 1SBSH 1BVZA 3EFDL 4NQCA 5JW4R 1A7OL 2FECI 3HCVB 5C86A 3TCLB 4UDUA 1FLTX 4CVXB 5DJXB 4H5SB 1M6OB 1W2KT 4WDIB 3C6LB 4CMMB 3C6LA 4MJIA 2ARJQ 3F58L 3V52H 3VMOA 2WWMD 4O00A 4PG2C 5E1AA 4ODBD 3BT2L 2IANB 1CWVA 3GKWH 5J9PB 4QHNB 3T4AB 3ES6A 4OGAC 3V0WL 2ESVE 1VKXA 4QHUB 3OAYH 2F15A 4JFXB 3P0YH 1KCRL 1AGFA 4JFXA 5JW5A 4FFYH 1P5VA 4YE4L 1FG9C 5JW5B 1OTUD 3E6HA 5I8OL 2YZ8A 4NZUL 5ISZA 4BQ8A 1RV6X 5ERWA 5BMFL 4PY7B 3L5JA 4I48A 2UVEA 4PRPD 1CXEA 2GK0B 5JLZA 3RUGE 2IH1A 5HVWA 1KJ2A 4O4YL 1MH5B 2GTWA 5HD8D 4YXLL 5TDPA 5I2IB 1MCNA 5L8LB 3GSQB 4PJ5E 4OZ4A 1NFIB 3BQUD 3HLAA 3MLUH 4U1SA 3SGKC 2E6QA 3HLAB 4NOBA 3HE6D 3RQ3A 4MVBC 4UILH 3JV0A 3ARFC 2APBA 4R3SA 2YMXH 2HFFA 2GJJA 2HVJB 4LIQE 4Y1AE 1QEWB 2A38A 5I19L 1U3JA 4P59H 3AXLA 3NCJH 5FGBA 1D5IL 3VJ6B 5T1LB 2P5EB 4U0RC 2QSTA 5T1LA 3RUGF 1BBDL 3PWUA 3CH1B 4UV7L 3V79C 1T4KA 5HI5D 3UPRA 3ROOB 5ESAB 1DDHB 3WNOA 4PS4H 3EJJX 3GIZL 4OT1H 3T2PA 5DRNB 4Q9QH 2EEBA 2E9JA 1ZHKB 3KPNB 3MRIA 3L3JA 1SEQL 1SJXA 4XBGA 3IJSB 5TE4L 4D3CH 1CTNA 4K8RL 5ISZD 2GJ6B 4RMVA 4NQSB 4ODUA 1DBJH 3Q6FB 4RBPH 3LPGA 1LO5B 3CXDH 5J1SC 5AYUL 4QRQB 2R9HD 2CK0L 4P0DA 3MRHA 2EXWC 2ZUQC 1C12A 3A0OA 4HGMA 1A7QL 1X6LA 4IRJC 5CEZH 4ZPTB 1A1NB 3UBXA 2R69H 2YN3A 3JWNC 4K07A 1T7YA 3ULUL 4JDVA 3SY0A 1LO4L 1ZGLP 4Z7UA 3QULB 3GMPA 3CMGA 3GMPB 3S35L 3S3PA 3ARBD 3WKMH 2HFTA 4HAFA 5EZJB 3SDCC 1KXTB 1QD0A 3VW3H 3V4UH 5DI8B 4Z7NF 3CFBB 1GC1L 4MNQD 3CFBA 3CFJA 5J6GB 4MNQA 4JQVA 2P5WD 2FX9H 4OB5L 2PCPA 3C8KB 2PCPB 3RU8L 3C8KA 4DGIH 3F62A 1UZ6F 2R29H 5B8CC 5DJ2A 1FO0H 5HHNA 1P69B 4KAQL 1N64H 5CEZD 2O5ZL 3N0PB 5GS1A 2JKXA 1N26A 3KPSB 1JMZA 5EU6A 1HE7A 3LCYA 5GISL 3SJVA 5T3ZL 1A3LH 5IGXL 3FKUS 1FAIH 3MBXL 3OKEA 1WBZB 5GS2D 3EO9H 3KYKH 3W11C 1HILB 2G2RA 2OQJB 2BVUA 2V2XA 3BD5A 5HGHB 1NFDB 1ZT4A 3G9AB 3C9NA 1DLHB 1ETZA 2D4DA 3F7VA 4XP4H 3EGSB 4DZBB 2FHBA 4K23L 5EA0H 1B6DA 4L3CB 4NFDA 4JFEE 3HZMA 5ICXB 3ARGB 4P3WA 4Q0XH 4FQIL 4HBCH 1YEDB 3PGDA 5AYUH 1XR8B 4FQLH 2PYEB 1FSKB 4P2RB 2NR6C 3VMNA 5HDQH 1XCQB 1SY6H 2DB8A 4NCDA 3JWOH 1ULVA 5ALCL 2W65A 3LQAC 4IIQB 1IC4L 4PJ5D 3X11B 4IIQA 3X11A 2NCMA 1U8OA 1CYGA 3ABZA 5F6IB 4Y5VB 5D6DA 1IGYB 4XH2A 3MXWH 1UB5B 3IXAA 3VXMB 3IXAB 4K9EH 4TOYH 3QI9D 2W9DH 1KN4H 3HRZB 3ARGC 4YEEA 2XG4A 2O93L 3KPOA 4BH8A 3QWRA 5I66B 5C2BH 1I7TA 2HN7A 3EYUH 2Y06H 3HR5A 1UT9A 4EQ3A 4NKIL 3L7FB 4S1DC 4X83A 2AXFA 1J12A 3BIAX 2AXFB 1A0QH 4FQHA 5CJ5A 3ULUD 2EEAA 2AJYH 2OCFD 1N0XH 3CVHA 4NWUH 4G7YL 4QEGA 4HX1B 4JFYB 1XF2A 2EDXA 2NYYC 2Y72A 3HPJB 4BKLB 4RGNB 5INDA 1RHFA 4JPVL 5CSZA 2F5AH 2Z35B 1EUUA 3H3KA 2EH8H 5MP6L 5DDHA 4D0CB 4Z7WE 4CNIA 4KI5D 3F58H 3V52L 2VXQH 4QHKJ 2A83A 4X8XA 4J23A 4C56A 2A83B 1IJ9A 2PYEE 5EOCH 2OXGA 1ZWIA 5ID0B 1KCVL 2ZUWA 2YD6A 1WICA 4ZSOE 3O81A 6FABL 1B9ZA 5C07E 1DUYA 5T1MA 3WMSA 3LQZB 1DUZA 1BM3L 2DWDA 5T1MB 4OCYL 1DUZB 2Z8VC 3HI5L 2AK4A 5DUML 4R8WH 4AEIH 3M17B 3GSWA 4YEFA 1CF8H 5F6HI 5HHQA 2A74A 2DL2A 1R3HB 2X4SB 1OPGL 3TBVB 2A74B 8FABB 1CFSB 2DBJA 3VXUE 1WZ1L 3TA3A 4KROD 5HVFB 3MXWL 4HIIA 1H5BB 2P5ED 5GRJL 1CDHA 4XPAH 4M7KL 1K5NB 2DI9A 3DX9B 5DZNA 3KWWA 5IOPB 1QVOA 5K9OA 2P46B 1RURH 4RX4A 3PP4H 3A67H 1Z2KA 5EOCL 5BS0A 3KPQB 1IBGH 3VFNA 4AT6A 2FJHB 4Q9BA 1JN6B 1NBZB 1JN6A 5BV7H 1UKQA 2AXGB 4PRDB 1B4JL 1G9NL 5E2VH 4QRPD 1QSVA 3GK8H 4NO3A 1PY4A 2GJ6D 2IH3A 4OCLC 3CSGA 4NO3B 3RVUC 2VYRE 3BAEH 1CLYL 3VFOB 1QPXA 5CLWA 2AS5M 2IPKA 3S36X 3QXVA 2VTFA 2IPKB 2FX8L 3MSPA 5B38A 1N6UA 2F54E 3G08B 5B38B 5GS0L 3HNVL 5F89A 3EYVB 1F58L 3M8OH 2IEPA 1X4XA 2IFGA 2QKIA 1RQ5A 4CU8A 5KJRH 3HMXH 2ARJA 3NVQA 3TJEH 1P4IL 1HIML 5EIIA 4JY6B 3IS0X 3W82A 4XC3H 3QUMA 5C07A 4P9HH 3QUMB 1KTDB 5C07B 1GYAA 4RFNC 1OARL 2J5LB 4RDQG 4NPYA 5MHSE 1BFOB 4RAUA 1V5JA 3BDXA 3UYPA 4OCRH 2UWEF 3NGBC 3QEQE 4OD3H 3JZ7A 1J0JA 1J86A 1AXTL 4RX4D 2ICWA 3QR2A 3MLVH 3H9SB 3DARA 1PD6A 3BPLC 1NEUA 1G9NC 3GO1L 2VN4A 3X3GL 5TE7H 3V6ZA 3HMXL 4G9FD 3O6FB 2IBZX 3C08L 3C5ZC 4L8SB 4KV5E 3CFCL 3P73A 1JFQL 2UZIH 3RL1A 3DJ9A 4TSCH 4P2YA 4RIRA 2F8XC 3RDTC 4DJMA 4F37F 2DQIL 1RZ8B 3L1OL 3O3DB 2BMKA 1VB9A 4G5ZL 4QRTA 3ZE2E 3VMPA 1AO7A 3NIGE 1N0LA 3DIFA 4IS6A 4KKBC 3WS6C 3QDGE 5D70H 3PHOB 3QEGL 1U3HC 2VC2H 5BZDB 1A3LL 4ENEC 4Y19A 4R6UA 1OAKL 5IROA 5L88H 4ZXBC 2X1WL 2W07A 3EDDA 2NQCA 3PL6A 4K71C 4EKXA 4FQXD 3P9LA 3W0WA 4LF3B 3MJ8B 4JHAH 1K4DB 5DRWA 1DQMH 3SGDI 15C8L 3PABB 3L5XH 1I9JL 3T2NH 3QWOB 3MQIA 2C4XA 2G9HB 2VLRA 2VR5A 1FL5A 3TN0A 2P5EE 4JN2A 3FOMB 4JN2B 1KB9K 1D5ZA 4PGEA 5I30H 1MEXH 2WLYA 4PJCB 5D71L 4U1GC 4FTVA 3EDEA 3STZB 1QSZA 3BZFA 5F97E 2YD3A 3IU4L 1WEJL 3RDTD 3BOVA 5DD5L 1F90L 1ZHLA 4KK5D 5FDYA 1EERB 2XZQH 4IMLA 4YR6B 2CQVA 1U8JB 5GGVH 1U8MB 3CU7A 4JFDA 4R4FL 4H1LH 1N4XH 4KJPC 3MRCA 3RWHA 1J10A 3RUGA 1F13A 1P53A 1T22B 3ARXA 4JFFB 2ZOKA 3VE0A 1PY9A 1HH9A 1MY5A 4G5ZH 2DJ4A 4Y4FA 4KRLB 1ZE3C 1T1ZB 3I50L 1DFBL 4NYLB 1IGCH 5DMKA 4Q6YA 3S3SA 2WP3O 1NCDH 5DR5H 1BX2A 2GTZB 2EE9A 5D7SL 2ADJB 5FYJL 1ZSDB 1OM3H 1S3KH 4Q97A 3HZYB 2FSEB 1UXSB 2IQ9L 3UYRH 3OAUH 5GRUH 5F71A 4QYOA 1YEHL 1VADA 4LFHG 1E4WL 2NY2B 3KXFA 4FQPA 1WZKA 2VKXA 1YEGH 3L9RA 3DMMB 1FN4B 1XGQA 5I71C 4WUUE 2Q20A 3O3AA 1C5DA 2VDPL 3QQ9C 1MJ8H 1X4YA 1RFDL 1LWRA 3MCKB 3QB7C 1XZ0B 1XZ0A 4NZDA 3U82B 4Z7VB 1TJGH 1Y6KR 5E4EC 1S5HB 3WLWD 2XY2A 1MUJA 4MXQD 2ZCKH 5SX4I 1UB6B 1D6VH 2GT9A 3DXAD 4RNRA 2AAVA 4AEHL 3TFKD 3IFLH 4XAWH 1XIWA 3G5YA 3K80A 4LPUA 3QJFB 4MB3A 3VD3A 3G5YB 2HLFD 1WLHA 3O9WB 3SN6N 4APQA 4OKVB 4APQB 3KYAA 2Q87A 4H1LG 4J3TA 3OKMB 1WEJH 4QTHB 3Q6GL 4P23C 3TT1L 3WFEL 1NC2B 5FOBB 1LQSR 4WW2A 4PJBE 2HH0H 4Z9KB 2YEZB 3IFNH 5A1AA 3P11L 2D7MA 4N5ED 1H8OA 4X6EB 5LXGH 3NFSL 3NIFE 3QA3B 4K3HA 4TUKL 5EZOL 4L9LA 4F3FA 3ZSTA 1BFSA 3MRGA 4OZIA 1OW0C 1I4FA 5DK0A 4HKJB 3ARSA 5D1ZC 2OR9L 1KFAH 5J0BA 2JJSA 2WQ8A 1I4FB 5DK0B 3RJDA 3GMQA 3RTQB 5K59E 5KVMC 2K7QA 2IJ0C 5HPMB 4LPYA 2EYSA 3D39B 1CK0H 3D39A 3GMLA 1JPST 4AQOA 4GSDH 4Z0BH 2CUIA 4G42B 4WEUD 4XCEB 4JGMA 4XP1H 2RR3A 2YA1A 1FDLL 3CU1A 1CD8A 5TQ0L 1KACB 3NIFF 4Z7QE 4NNPL 4OCXL 3NA9L 1MFAH 1FL6A 3QI9A 4HS8L 2OL3H 2V7NB 3SDCD 2B4CL 2P4AB 2BX5A 5E9DA 3L7EB 1RUAL 4TN9A 4WTXA 3BO8B 2EO1A 4EI5A 2YWZA 4R97C 5C0RL 1PG7L 1C8PA 4X99A 3ISWA 5JOPE 3RWCB 3WFHB 4M9PA 4R0LB 3TV3L 1I9JH 3T2NL 4LVHB 3RWEB 1U8QB 4HUMB 4ZQKA 5DTFA 1KTKE 2EZ0D 4UT6L 4FFYL 3VFVB 3C60A 4OI7A 3JUYA 4P5TB 2FD6H 4L4TE 4I3RH 1YJDL 4ODHL 2G5BA 5E56A 4OZIE 1NL0L 1OVZA 3VDCA 2VSDA 3M1BB 1XT5A 3OF6D 5H2BA 4KY1L 1KC5H 3ARZA 3LKRB 4PJ9A 2XWJA 3VXRB 1CFTB 1I8MA 3MXVL 1M7DA 3VXRA 4JM2A 5DEFA 2EDHA 2HKHH 2VXSH 3U83A 1A0QL 3GBMH 1M71B 4HPOH 5AD0A 1G7JA 1K8IB 4RFOL 5AZ2L 3VWJA 1MRCH 4OFVA 4J3VA 1A02N 3KPRE 2F54B 1NSNH 2H2PC 3HUJB 2ERJC 1QR1A 4CUCA 1TJHL 4GKSB 4UT6H 5F1KC 1I3RA 3PQYB 3CPLB 5HYQB 4X8JA 4PB9L 3RVVC 4A2MA 4X8JB 5T5NF 3G5ZA 5D1XA 1ZVSB 1TMCB 2BCKB 2CLRB 3IFOB 1NL0H 4Z18A 3VXSD 2EXYD 3DWTA 2FH6A 3MRKA 3GSUA 3G5XB 3O2DL 4XCCH 3EW3B 4NKOA 1A7RH 1F6AB 4PGDB 1XF5A 3S36L 1A3QA 1TZHA 5F6IC 4WI2A 2J8UF 3U7YH 2E7LC 1K6QH 4L4VD 4RA0C 1MFNA 3FTGA 1MLBB 1UWEH 4Z77B 4YHPB 2W60B 4XMPL 3D48R 3VI4F 2P5WE 4X6DA 3T1WA 1E4XI 4ZS6C 2P47B 1DE4A 1NAML 4WRLA 4QNPE 3BIKB 4K3DL 5LAXB 5ACMA 4JM2D 2FWOA 5D7KE 1OAXL 3BZ4A 3I6KB 2R1YA 5T5FL 2J6EL 3HC4L 3GI9L 4U3XA 2P8PB 5DFTA 3U0WH 2OR7A 3HR6A 5CBEB 1J87A 4V1DE 2BVPA 1L9MA 1JNJA 4G9FE 3EZJB 4HEME 2I5YL 4WEBL 2NY1D 3SDAC 3KYMA 4I77H 4Q7DA 3VW3L 4O2EB 2MQ3A 3GMRB 3MRPA 5E2VL 5DVOA 3CX5K 3NABL 1DBAL 3MJ7B 3MMEB 3BPNC 3IU3B 2QL1A 4U2ZA 4HF5L 1UWEL 2VL5B 3L3DB 3S4SB 1AI1L 1T20B 5CAYB 3RU8H 3F5WB 5GRVL 3STBA 3WFCL 2QQNL 5ESQB 3VFRB 2PETA 3WCYA 5C0AD 4PUBH 3EDJA 2NW3A 1TQCB 5CBAB 5SV3A 1KLUB 1WT5A 2ZG2A 5DSCA 4OZFG 1KIPB 3RY6C 1RK0B 3A6CL 5EIVA 2FDBP 1CICD 1MCCA 5JUEH 3EO9L 1YY8A 4NHCL 1FFPA 5A2KH 4XGZA 1ZA6B 2A2QT 3OX8B 2VWEC 4X7SH 1HYSC 4FQ1L 4GMTL 4FZ8H 3IJYB 4APQC 5DK3A 4HWEH 1RJLA 4XI5C 1D6VL 1UZ6E 3TBSB 2Y5TA 2H32A 5SWSD 4MXQC 3QUYC 5FHBH 3DYPA 2BNQE 5TJWK 4QRPE 1U58B 4R0LC 5T3XH 3V95A 3B43A 4MAYC 4X98B 4N0RA 2OZ4A 4OLVL 4LHUG 3U2SA 1XGTB 3NCYS 1XGTA 1NGZB 5ESVB 5B39A 3RP1A 3FQTB 1H3UA 1YY9D 2BOBA 5IVNA 1I1FA 4NZUH 2VQUA 4TNVF 4PJHA 1CD1B 4D0BB 1T3FA 5BRZA 3VU2A 5BRZB 4EBQL 1SYVB 1OQOA 2XOTA 3SDCB 1NCNA 3B3IB 3KDMB 3IKCA 1LO2H 3B3IA 3KDMA 1G6RB 4LSQH 5DD5H 2K9UA 3MLRH 4OLXL 5D7IA 2AVGA 2VDKL 3U9UB 3KPLB 3SDDB 4MXVF 1P4BH 2IAMD 1DVFB 4NQEE 2X4NB 1NC4D 2X4NA 1U3HB 4K7FB 4B41A 1Z9MA 1N4XL 1BEYL 2XIDA 3CFEA 5TFSH 3CFEB 3AB0C 3I6GB 4I18C 2A77H 3O41B 1W72B 4J3UA 4MDIA 1NCAH 3QIUB 4PRHB 3MNWA 4G6AD 4JLRA 1JWMB 3NFNA 5BV7B 1JWMA 1WUNT 2Y9RT 4M8QB 4GMTH 1A4JB 2G5RA 3UTTB 1OM3L 5C6PB 3OPZH 3FO2B 3FT3B 3SE8L 1JHTA 1BVKB 3AROA 3BP7A 4DKEH 1BMGA 3T0ED 3WKNA 4D9QE 3VGAC 1YYMH 5I18H 1JGUH 1FYTA 3EYOA 5D2LA 3EYOB 43C9B 2VUOA 1MHHB 1CF8L 4TTDD 4L29B 1NDMB 2EC9T 3SE3C 2WUCH 2V7HB 4Q2ZA 3BPOB 3O0RH 4U1JB 2YD2A 3JTTB 4PJBA 3CSBA 1F00I 5C0CE 3RPKA 1INQB 1C5BH 1HQ4B 2AQ3A 2P45B 3MRRA 1RURL 2YPLE 3VWJC 3BE1L 3HZVA 2PTUA 4YFLI 4YIQA 3MNVA 5KZCB 1R3KB 1T7ZA 4D0DB 1R3KA 3EDKA 4G8FA 2CLZB 2R29L 1EO5A 1CIDA 3WFDL 25C8H 1IM9D 4L4VB 5I18L 4FXGA 1UM5H 3F7RA 1QFWM 3D3VB 3WDJA 1TVBA 5CGTA 4X5WB 1NBVH 3PWJA 4X5WA 3FJTA 1XIWD 3BP4B 3IRZA 3BP4A 5C2UB 3QO1B 2P42B 1OTSD 3E6HB 4XC3L 1C1EH 5IR1B 4YHLH 2E7LA 2AV7A 2Q6WA 5ERWB 3D0LB 2DD8H 2AV7B 2Q6WB 1NEZA 4XNMB 4NKMA 4I3SL 4PRBB 4RRPA 3BWAB 3SJVD 2YA2A 1JGDA 4KRPD 4M93C 5CINL 4AENB 2MPAH 3E3QE 3BP5B 5E9DE 3EJZC 3NAAL 4DW2L 4WVRA 4CDGC 4QHLA 1TVHB 4W81A 1Q0YL 4NC2B 4NRYB 3WIIL 4OGXH 5MEOA 1SJEA 1ED3A 1RSFA 1OGAD 4IRSC 3QFDB 5C0CB 2HG5A 1WIPA 4Y5YB 5C0CA 1X44A 5JPMB 1E4XL 3HAEH 1T21A 5ALBH 5K9JL 2I9TB 2IANA 2WIMA 1ZAGA 5ABDE 2XWTA 4KHTL 4P2OD 5TF1L 1I9EA 2GAZA 3BPNB 5HI3C 4M43H 1CXLA 3V8CA 3RKPA 1T4KB 5KSBF 4P3DB 2YPVH 4Y2DD 3QZWA 2BOCA 1RUQH 3NMEA 1Q9LB 1VHPA 5T3XL 3GMNA 4XNXL 1ZHKA 4ODHH 5D1ZD 1CFVH 5IW3A 1UKSA 4XBGB 1A1OA 5A2IH 4R4ND 4GG8B 1PYWA 4LL9A 4ODUB 2GTWB 4P57B 4GBXD 1TENA 5CEYA 4OZHA 1OAQL 4QXWA 5D9SB 1ZGLM 3C6SA 4CW1B 3UTQA 5EH1A 1OD7A 3C6SB 1WFOA 1DQQB 4P5KA 1RVFL 2SEBA 4RFOH 1T04B 5KN5B 3U48A 3VRJA 1FJ1B 3HC0A 5B38G 5I1GH 1FJ1A 3HC0B 1U95A 3W5MA 3EFFA 1HEZB 5T1LD 1HEZA 4RGMC 3DSFL 5EZJA 5E99L 4WO4B 5IQ7L 3EO0A 1YEKH 4LCWA 1KJVA 1CGXA 2Q7YA 4OLUH 5DHYA 3LV3B 2GIYA 5JZ7D 3BT2H 5IUSA 3ROOA 1MCPH 4GBXA 5EDXA 1MSPA 2HT2D 1DLFL 3C09C 4JG0L 4MA3A 4GMSH 4J1UA 1EJ6A 5HYFA 2JIXD 1T1WA 3JWDC 1FZOA 2ENSA