1ZHCA

Solution structure of hp1242 from helicobacter pylori
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
MFHEFRDEISVLKANNPHFDKIFEKHNQLDDDIKTAEQQNASDAEVSHMKKQKLKLKDEIHSMIIEYREKQKSERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein HP1242
publication title Solution structure of HP1242 from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04325 DUF465 Protein of unknown function (DUF465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zhcA00
1ZHCA
chains in the Genus database with same CATH superfamily
5M4YA 1HFAA 5FL0A 4DO0A 1B7TA 2KZ7B 4DV4T 1LRZA 5IWAT 1D1AA 2UUAT 4GK5E 3SFDA 1KNZA 2DWKA 4AKIA 2V1DB 4MBQA 3QC9A 5KX5E 2CPTA 4V1Av 2PTFA 1JNZA 4AQGA 2X9HA 5AQHB 4JI8T 5CJ5A 2PG8A 4DUZT 4LF4T 2UXNB 4HWDA 2KMFA 2WMNA 5L4EA 4TWDA 1QUUA 2XM2A 4P1NA 4O2BE 2I0MA 3P4PA 4JI6T 2V7JA 3T1YT 4ADZA 4YHHT 5AQJB 4JI1T 2IC9A 4QWNB 4NXMT 2H7VC 4I55E 3UUXB 4YJ3E 1HS7A 4PJJA 2V6XA 1HX1B 2G0UA 3H37A 2WAUA 3Q5DA 2R6GF 1US7B 1D0ZA 5FNVE 2DNXA 4UELA 2CM0A 1OEDC 3N2OA 1IAPA 2YINA 4DR7T 3ZC1A 4AIUA 2Y8DA 3CQCB 3A8YC 3TKLB 3HKDE 2LKHA 1DU2A 2JQQA 3RC8A 2UUCT 4OHFA 2E9XD 4NPPA 3QNUA 3R6NA 2LRKA 2XUEA 1WYCA 2UXDT 3AEDA 5FP3A 3UFGA 1MMGA 3JADA 5J2TE 4IE0A 4Z8XA 4HFDA 4QKNA 2Z6EA 4LF8T 2LLYA 2MYSA 2H89A 1LKXA 3PV0F 4YFSA 3ZJ2A 4DR2T 1U5PA 3RYIE 5LGTB 2B1EA 4TX5A 5DABA 5L3DB 1WR0A 3ZT5A 3WAKA 5CA1E 3N9MA 3O4XE 3ZMSB 1Z8UA 1T72A 2CCQA 2VKHA 2M67A 4IDPA 2KLQA 2IHR1 3OYXA 5AQUB 1VRBA 2Q9QD 2MPKA 4EOZB 4UIGA 5JREA 5JRCA 1UK5A 2W0GA 3RYFE 2LEHA 4ASKA 3RRCA 2VVSA 4LF6T 3O1IA 2QGSA 2NR4A 1XMOT 1JNRA 1ZEEA 2FJAA 3ZSSA 3UT5E 4YHJA 2LHNA 5JVDE 2BG9B 4NUVA 2W00A 3ONLC 4GYRA 3J9X1 3M65A 4H63H 1S94A 4LMJA 3PUGA 3U3IA 4O2AE 3VHLA 2LHRA 4LFAT 4CN6A 2IW5B 5FVLA 5AQLB 2VQET 5LBQB 3JC6D 3O1JA 1D1BA 4U72A 4YTPA 3P4RA 4HFCA 2DL1A 2XAJB 2K9AA 2W66A 3NRXA 2D2SA 4H9SE 2E9XA 3CQGB 2CE7A 2X68A 4ZZCA 4WYVA 3Q2MA 4EV6A 4EB6E 3KVAA 3SOLA 4UVCB 4BJNA 5L3CB 4IREA 5HWXA 1Y01A 2HN2A 3FBLA 2YDRA 3BQKA 1J1JA 4ZI3C 3I0OA 2E9XB 3EI0A 3KV4A 4PNIA 3UUBA 4I4TE 3G06A 2DHRA 3CX7B 3GN5A 3W15B 5FXZA 5C8YE 1UX4A 3VR9A 3EABA 1LVFA 5A1LA 3K3OA 4BJMA 1G73A 4CN4A 2YN6A 2WWVA 3F2EA 2VURA 5J2UE 1V9DA 2IMLA 3MKDA 1MIYA 3GN5B 2Q9QA 4ZXLA 4YJ2E 5L2LA 3FZKB 4DV0T 4N78D 2XZEA 2WB5A 4KHZF 3C50A 3C64A 3AVRA 4Q25A 4JV5T 4YTMA 1XZYA 2AXDS 4LF5T 2C5JA 4C90A 4YSYA 1YKHB 4U2YA 5H6QB 3IF8B 2LRLA 3DTOA 1W0AA 4PAGA 4BAYB 2Q9QB 3WI3A 2KNDA 3N5LA 5CB4E 3O9XA 2W61A 3B13A 4GK0E 2LM9A 4B6XA 1OXZA 5FVKA 3QK6A 2C0SA 3R84B 3SWHA 3FB2A 1NAFA 3C4XA 4IE5A 3VKGA 3MA9A 3NWIA 1NENA 4MHCA 2K5BB 4NXNT 4MALA 4UVAB 3N2KE 3FXDB 1NEKA 1YXRA 2L9QA 2YU1A 4I43B 4DV1T 3NRYA 4IT4A 2BG9C 3AEAA 2JPFA 4MLKA 3EVYA 4U3CA 5KXJA 2LE8A 2DLRA 2PFVA 5FY7A 2V7IA 3N9NA 4H9RC 3AXJB 4KUMB 2W2UA 3AEGA 3RHWA 4DV3T 3MZKB 4JLEA 3SS1A 3OPCA 4IE7A 2VL0A 2OV9A 2D9DA 1SUMB 2SPCA 1J5ET 2CBIA 3IHRA 2JMHA 2BS3A 1IBMT 5FYMA 2WQYA 4GOUA 3FBZA 5LJMA 2V5CA 5LOVE 4A98A 3N9PA 1YW0A 2E9XC 4PJLA 1KEYA 2XASB 3TLUA 4WW0A 2YK0A 2NW9A 4OYJA 2LJLA 3ZT6A 3ZEFB 4HTEA 4K0UA 2J47A 3ETVA 2JQ9A 2X9WA 4HFIA 2UU9T 2RP4A 2ZM2A 4X64T 4EZ4A 2XJ7A 2P9BA 4Z90A 2CXFA 4H9PC 2YKSA 4IDNA 2ZM8A 2X9XA 4U74A 4TV9E 4AKGA 5CFBA 3ZN1B 4KP3C 4HE8A 4HFBA 2IIUA 5LHHB 3PUAA 4XBFB 4UF0B 2E8IA 5J1GA 1MIWA 4GIWA 4DR4T 5F3JA 1HR0T 2MOZA 3RF1A 2XQ6A 4AKHA 2Q9QC 5EK3A 2LSYA 3RKGA 4JUYA 3OTOT 1W9RA 4B3MT 3KBUA 1CUNA 4TWHA 2ZLYA 2KINB 5AQVB 5HEHA 3FZFB 4A56A 3KV5A 1QSDA 1XWMA 2W4XA 2XHEB 2A2FX 4LFBT 2LSIA 5CGMA 4UVBB 4HEAA 4X1YE 2XQ8A 1SHZC 4QH5A 1WR6A 2F4VT 3RIUC 3P50A 4DIDB 1KNRA 2RA1A 4ZS3A 4A97A 4QH1A 2VKDA 3JC6C 4DNDA 1IJ6A 4OYKA 4HKAA 5JDLA 2V7LA 5F8PA 2QVAA 1N33T 2ZM6T 3FXEB 3ANWA 3UULA 4CXYA 1FIOA 1O3XA 3CQXC 1Z0PA 1KF6A 1D0YA 4M1PA 3ZN0B 3NZPA 5FKYA 4ANJA 5L3FB 3MXZA 4I0UA 4OX9T 2UXBT 3ANWB 4X62T 3EUHA 1N32T 4UR9A 5JQGE 2C5KT 3FZLB 3OYZA 2LSKA 3IBPA 2CLYB 3RKOA 2CWYA 1WFDA 3PE0A 3WAJA 5H6RB 1ZHCA 2XQ3A 4IIJE 3LBXA 2LOPA 4FI5A 1L0VA 2XQ9A 5LXTE 2BKOA 4HWFA 1BR0A 2LKGA 4EGWA 4X5TA 4DUYT 5DQVA 3L09A 3AB3B 3KV6A 2BVLA 2BDEA 3LG7A 4DMVA 4IE4A 4YT0A 3T8OA 2K48A 3LBXB 4KI0F 4OFZA 2XQAA 3HL6A 5ETWA 5LBMA 2H88A 4LF7T 2WDQA 2VASA 4B3ST 3ZC0A 3Q5EA 2FJBA 5ABEA 5AQOB 3Q9DA 3VU7H 4QXBB 2WP9A 3QOFA 4BA9A 4PJMA 2IDOB 5EK2A 3RC3A 1E7PA 2YDSA 2XQYA 3A5XA 2WDVA 2XSBA 2VB6A 1CHUA 3P4SA 1HCIA 4ZOLE 5IUXA 2XY8B 4KBMB 3PUWF 2WSSV 4JYAT 2HN1A 4X1KE 3P4WA 4HFVA 3UUNA 3LJCA 4WBOA 2ACZA 3EAMA 1WYBA 4K0KT 3ONXA 5DQWA 2X0HA 3PDYA 5JRCB 2ACXA 5AQNB 2XQ5A 3KFWX 4Z91A 3I9YA 3RLFF 2BKNA 3A7MA 2W63A 3DP7A 2WY2A 5KMGP 2X0YA 5ABFA 3BQIA 5E0OA 3RPUA 4DMWA 3LK42 3ZJ1A 5J0ZA 5L3GB 2QA7A 2N2NA 2CLYC 4KHPT 5ABFB 1SE7A 2DCFA 4GYSA 3RX6A 5CA0E 1YQ4A 2X0LB 1ZOYA 4YTNA 5ABGA 3AA0B 5JDMA 2VWAA 4CI1B 3AA7B 4COFA 2NOXA 3IA3A 3CK6A 4PK6A 2XQ7A 5AQPB 1FEWA 3EHZA 2L3LA 3J7Yq 2MAWA 3E0ZA 5LMUT 2HHHT 4CN1A 1G8XA 5AQGB 4DR6T 3N9LA 2CRBA 3AAAB 4P09A 1S35A 5JDFA 2WZHA 3ZSTA 2J1DG 2YU2A 4WZXA 5JTGA 1N34T 4B3RT 4U7IA 3HA4A 2UXCT 3UU5A 1VCTA 5FL1A 3RH3A 4DV2T 2JMKA 2V6YA 4ZEYA 1H7CA 3RIAA 4QX8B 4UEMA 1I6ZA 5HXCA 4HWCA 4IHJE 3AE1A 2BKPA 3TLVA 5HEGA 4EZHA 3L3PA 4CXXA 4L9IA 2XSAA 4HGAA 2X9YA 2X66A 3ESLA 2OLTA 2V6YB 1E1HB 3UFEA 2B76A 3ETUA 4PK4A 4EEDA 1IZNB 3OBVE 3AA6B 2WBLA 2N1GA 1T98A 2BZBA 4ZS2A 3AAEB 2HPJA 2WU2A 2MTQA 4ILCA 1HX8A 4IL4A 4O8SA 4PJNA 3GWHA 3ZCIA 3ZYMA 4DVDA 5TAOA 3KDSE 4JI3T 1HF8A 3ZYLA 3HKBE 5FMNA 2ODUA 2H3RA 3UU4A 3RQWA 2NP9A 2BBHA 1FMVA 4WBNE 3T1HT 4TWFA 4QHOA 4P0BA 2K3WA 1BR4A 2D0TA 3F57A 2V7MA 4DBQA 3QB5K 4DR1T 5HEUA 2EHOD 3AE2A 3NKZA 1WLXA 4L0RA 2A72A 2LOSA 3K3NA 2XAGB 5LGUB 3JCFA 3UUMA 4NUUA 1EZ3A 1QLBA 3PUZF 2D0UA 2C5IT 3FZHB 2NW7A 3FZMB 3HKCE 3V5SA 5AQSB 1ZP0A 2XAQB 3OJAA 4HN9A 4UV8B 3AEBA 2WM9A 2CHNA 5ADXL 2HPLA 4LMKA 4PFOA 5FXWA 2GK9A 2WMOA 3VR8A 2BG9E 5FXXA 3RI5A 5LJNA 4LFCT 1UCUA 3FHNA 1XDOA 2CXDA 2MBGA 2E5VA 4YSXA 1VCSA 3EDVA 4UXNB 3C51A 3L39A 4ZI3D 2VQFT 2HH7A 5AQQB 3AE5A 5LG3A 3Q5WA 3KVBA 5FXVA 4KMCA 5AQKB 2CWOA 1XDPA 5HAXA 4ISSA 4ZI2D 3BQLA 2X51A 3VKHA 5L3EB 4ZI7E 1X9BA 3QB5A 5AQTB 1T7SA 4JI0T 2ZM0A 2J62A 1HNXT 3ZCJA 2IUBA 2Y48B 4U31A 3KINB 4F6RC 5HEOA 2CHOA 5ABHA 1HNWT 2M6BA 4FJOA 4XAXB 4DR3T 2E2AA 3PUVF 3GMIA 4U33A 2V26A 4JBWF 2DWGA 2CXLA 4JI5T 1XNQT 3ZLIA 3AVSA 1HG2A 1ZV4X 2X67A 2L8KA 2FBWA 3PUSA 3CMLA 3ZMVB 2I6HA 2W62A 2EHOA 3UU6A 1UURA 1BR2A 4TZ4C 2BS4A 2JJ9A 4O4JE 4CQIA 4PW8A 4LF9T 3JAFA 1XNRT 4QXCB 1HG5A 3CKDA 2FJDA 1HTJF 1MIVA 2PBIA 3C98B 1MMDA 2EHOB 4DV6T 4U2ZA 3H3MA 3HI2A 4JI2T 3ZKRA 3K1SA 4YY3T 1I94T 1YKEB 5JDNA 4ILBA 2N9DA 4G2AA 3TLSA 2KWHA 3PU3A 5IHYA 1Y64B 4IE6A 3PURA 1M7KA 4DR5T 3P4QA 2WDRA 2YOEA 2XPKA 3V5UA 2LSGA 2YDQA 3L8RA 3NVOA 4EXTA 2JIWA 4AQFA 3HR0A 3ABVA 4MFRA 4CI3B 4TUYE 2BBJA 5LNKA 3U78A 2WZIA 2BS2A 4EIWA 3RGLA 2NWBA 2VKOA 5AQIB 2XTLA 4YLHA 4O4IE 4EAHA 4L5GA 3ZMUB 5JDQA 3PUQA 1W09A 2E5LT 5JR9A 4LMLA 2BVMA 3I0QA 3NZQA 3RQUA 5AQFB 3KV9A 1KK7A 1XMQT 2VL8A 2NTYA 1OEDE 4O4LE 2QRXA 1MNEA 4YSZA 2VKJA 3UQ7A 2VK9A 4OK0A 1MMAA 2IAKA 4EEBA 5JR9B 1NWMX 3LFMA 1YQ3A 2D5UA 1VOMA 5C3JA 2Y6XA 2KXPB 2M6IA 3D0TA 2BG9A 1UX5A 4AXPA 2VVNA 4QX7B 2JQHA 2JQKA 2XAFB 5JDHA 4GKKT 3RIFA 4A5XA 2PJQA 3AE8A 3IEEA 3OVUA 4X65T 3VRBA 3ZT7A 2RPAA 3CPZA 3B5MA 4IGUA 2J4GA 3Q5XA 2WCAA 1KFYA 2V5DA 4QXHB 3LSVA 4JEHB 1GQEA 2EHOC 3N2GE 1LVKA 1W0BA 4E7ZA 3HKEE 2ZMAA 3C4ZA 4H63V 4CI2B 1YD8G 3LK3B 1IBLT 4ILAA 5LYJE 5LHGB 1N36T 2V7KA 3CX6B 5LCYA 2DI4A 2KWIB 2W67A 2K24A 2XM1A 1D1CA 4ZHQE 1HNZT 3N9QA 3AE7A 2V8SV 1M62A 2LT3A 3UQ4A 5AQMB 4HFHA 5LA6E 3K3QC 3AA1B 5EZYE 3VRAA 4CZZB 3N9OA 3AECA 3I9WA 5LP6E 3CVRA 2I59A 3CIRA 5KDMC 1FMWA 4WNKA 2XAHB 3OKQA 3E08A 4B3TT 4AKRB 4ZZBA 4ISTA 3UU8A 4ZI2C 4JI4T 3H3AA 1SA0E 5JDGA 4X1IE 5LB7B 2YEVC 3AAIA 3UU3A 4GKJT 1D0XA 3M3ZB 4AQFC 2WU5A 4CXWA 2FJEA 5HXRA 5AFUL 4TNWA 5FY0A 4YXDA 3ZPOA 4X20E 1BR1A 4JI7T 3DJBA 2CEAA 1UUSA 4UV9B 3RRWA 5BR8T 4HWHA 4F8HA 4EYYR 1ZKEA 2LSJA 5LHIB 4E7SA 3AE6A 3CX8B 3TLWA 3CWZB 5JR9C 3AE4A 1OWAA 5HYAA 3BK9A 5HCJA 1IBKT 2CBJA 3AE3A 3X1DA 4IDQA 3RIUA 4AQYT 4I50E 2H7OA 5LMNT 2KSRA 3MJXA 5L47A 3PJAA 3ONJA 3RYCE 2JRKA 5EK4A 4JEUB 1WRDA 2LM2A 3PUXF 2WS3A 5LG4A 1AJ3A 4ILUA 3P8CD 1E2AA 3AXJA 3PU8A 4J2CA 4C91A 4AI6A 5HXEA 3S4UA 1X79A 3P7IA 3C4WA 3AE9A 2UUBT 4HWIB 5HXSA 2CMRA 4TV8E 2XQ4A 3KBTA 3MK7C 4XZCA 1MNDA 3O1HA 2FUPA 4H9OC 2ODVA 4G63A 5JH7E 1OEDA 4H9QC 4HFEA 3EDUA 3TLTA 2A9UA 2CA5A 3LDQB 4H9NC 3K8PC 4IL9A 2WWUA 4IDOA 4PK5A 1OEDB 4U7YA 5HWYA 3E22E 3NBXX 2IC6A 3PJAJ 1J5WA 3LK2B 5HEJA 5L3BB 2NTXA 1UGOA 5IYZE 4X66T 3PTRB 1KNPA 4AISA 3RYHE 3MACA 4IDZA 3SFEA 4NIQA 4KX6A 3JAEA 4UF0A 4PFPA 5LGNB 5GONE 2UXXB 1T8BA 4DV5T 5C2TA 3QUJA 3F31A 1MMNA 1U4QA 3SRZA 2ES0A 4EYUA 1R8IA 3PUYF 2QYWA 3ZMTB 4DV7T 2A3DA 5L4HA 5F5WA 5FY1A 4P0AA 2NW8A 4DBRA 2KT9A 5HXHA 4AKLA 1FJGT 4TNVA 2OA5A 4O4HE 1WCRA 5HCMA 2AE9A 4ERRA 5AQRB 3AEFA 4TN7B 5DJQC 3ZMZB 3AEEA 3I1AA 1IJ5A 3B57A 4QH4A 3UTKA 5BMVE 3GA8A 3ZYKA
chains in the Genus database with same CATH topology
4MLKA 3EVYA 4GYSA 3RX6A 4EIWA 5CA0E 5M4YA 1HFAA 2NWBA 2X0LB 2VKOA 4DO0A 1B7TA 2LE8A 2KZ7B 2XTLA 4YLHA 2DLRA 3AA0B 1LRZA 2PFVA 5JDMA 1D1AA 2VWAA 5FY7A 4CI1B 4O4IE 3AA7B 2V7IA 2NOXA 3N9NA 4H9RC 4GK5E 5F3JA 1KNZA 4PK6A 2DWKA 4KUMB 4EAHA 4L5GA 2V1DB 4AKIA 4MBQA 3ZMUB 3QC9A 5JDQA 3PUQA 5KX5E 1FEWA 4V1Av 2L3LA 3MZKB 5JR9A 3J7Yq 4JLEA 2BVMA 3I0QA 3SS1A 4AQGA 4IE7A 2X9HA 3E0ZA 3NZQA 2PG8A 1G8XA 2UXNB 3KV9A 1KK7A 2KMFA 3N9LA 2WMNA 1QUUA 2VL8A 2NTYA 3AAAB 2SPCA 4P09A 3IHRA 2JMHA 1S35A 5FYMA 4O4LE 4GOUA 5JDFA 3FBZA 2J1DG 2YU2A 4O2BE 1MNEA 5LJMA 2VKJA 2VK9A 4OK0A 5LOVE 3HA4A 3N9PA 1MMAA 1YW0A 2E9XC 2V7JA 2IAKA 4PJLA 4ADZA 5JR9B 3RH3A 2IC9A 4QWNB 2XASB 1NWMX 3LFMA 4WW0A 2YK0A 2NW9A 2D5UA 2H7VC 2JMKA 1VOMA 1H7CA 4OYJA 2LJLA 3ZEFB 2Y6XA 4HTEA 4QX8B 4K0UA 4UEMA 5HXCA 2KXPB 3D0TA 4I55E 3ETVA 3UUXB 2X9WA 1UX5A 4AXPA 4IHJE 4YJ3E 2RP4A 2ZM2A 1HS7A 4QX7B 4EZ4A 4EZHA 2XAFB 4PJJA 5JDHA 3L3PA 2G0UA 3H37A 4CXXA 4L9IA 2PJQA 2WAUA 3IEEA 2P9BA 2CXFA 4H9PC 1US7B 1D0ZA 4HGAA 3CPZA 2X9YA 2X66A 3ESLA 5FNVE 4IGUA 2DNXA 2ZM8A 2X9XA 3Q5XA 4U74A 1E1HB 3UFEA 4TV9E 4UELA 4AKGA 3ZN1B 4KP3C 2CM0A 4HE8A 5LHHB 3PUAA 4XBFB 4QXHB 3ETUA 4JEHB 3N2OA 1IAPA 2EHOC 4PK4A 4UF0B 3N2GE 2E8IA 2YINA 1LVKA 1IZNB 3ZC1A 5J1GA 1MIWA 2Y8DA 3CQCB 4GIWA 4E7ZA 3OBVE 3AA6B 2WBLA 2N1GA 1T98A 3HKEE 2ZMAA 3TKLB 2MOZA 3C4ZA 4H63V 4CI2B 1YD8G 3HKDE 4AKHA 2BZBA 3LK3B 4ZS2A 3AAEB 2JQQA 3RC8A 2HPJA 2Q9QC 5EK3A 2LSYA 5LYJE 4JUYA 2MTQA 1HX8A 3KBUA 4O8SA 4PJNA 3GWHA 4OHFA 3ZCIA 5LHGB 2E9XD 2V7KA 3CX6B 3R6NA 5LCYA 2DI4A 2KWIB 1WYCA 2XUEA 5TAOA 3ZYMA 4DVDA 2K24A 5FP3A 3KDSE 1D1CA 1MMGA 1CUNA 4ZHQE 1HF8A 2ZLYA 3ZYLA 3N9QA 3HKBE 5FMNA 5J2TE 2KINB 4IE0A 4Z8XA 2LT3A 2ODUA 2H3RA 2NP9A 5LA6E 4QKNA 3K3QC 3AA1B 1FMVA 2Z6EA 4A56A 4WBNE 5EZYE 2MYSA 4CZZB 3KV5A 1LKXA 1QSDA 4YFSA 2XHEB 2A2FX 3N9OA 2LSIA 3I9WA 3ZJ2A 1U5PA 5LP6E 4QHOA 3CVRA 3RYIE 4UVBB 2I59A 4P0BA 5LGTB 4HEAA 5KDMC 1BR4A 2D0TA 1FMWA 2B1EA 3F57A 4WNKA 4X1YE 2V7MA 2XAHB 3OKQA 4DBQA 1SHZC 3E08A 4TX5A 1WR6A 5DABA 4AKRB 5L3DB 4ISTA 3WAKA 2RA1A 4ZS3A 4ZI2C 5CA1E 3N9MA 2EHOD 3H3AA 1SA0E 2VKDA 3JC6C 3O4XE 3ZMSB 4DNDA 1WLXA 5JDGA 4L0RA 2A72A 4X1IE 2YEVC 1IJ6A 3AAIA 2LOSA 3K3NA 2CCQA 2VKHA 4OYKA 4HKAA 1D0XA 5JDLA 2V7LA 2M67A 5F8PA 2KLQA 2XAGB 5LGUB 3OYXA 3FXEB 3UUMA 1VRBA 3ANWA 4AQFC 4NUUA 2Q9QD 4EOZB 1EZ3A 4CXWA 4UIGA 3UULA 5HXRA 4CXYA 5AFUL 1FIOA 5FY0A 1O3XA 3ZPOA 3CQXC 1Z0PA 2D0UA 1BR1A 4X20E 2C5IT 5JREA 2NW7A 1D0YA 5JRCA 4M1PA 2W0GA 3HKCE 3DJBA 3RYFE 2LEHA 4ASKA 2CEAA 3RRCA 3V5SA 4HN9A 2XAQB 3OJAA 4UV8B 2WM9A 4UV9B 3ZN0B 3RRWA 5ADXL 2HPLA 5FXWA 3NZPA 4PFOA 3O1IA 2QGSA 2GK9A 4ANJA 5L3FB 2WMOA 3MXZA 4EYYR 1ZKEA 2LSJA 5FXXA 3ANWB 5LJNA 1UCUA 1ZEEA 3EUHA 5LHIB 3FHNA 2CXDA 3UT5E 4E7SA 2MBGA 3CX8B 5JQGE 2C5KT 3EDVA 4YHJA 2LHNA 2LSKA 3OYZA 5JVDE 4UXNB 4NUVA 2W00A 3IBPA 3C51A 4ZI3D 3CWZB 4GYRA 2HH7A 3J9X1 2CLYB 5JR9C 3M65A 3RKOA 4H63H 2CWYA 1S94A 1OWAA 5HYAA 3BK9A 3Q5WA 3PUGA 3KVBA 5FXVA 4KMCA 3U3IA 3PE0A 4O2AE 3WAJA 5H6RB 3VHLA 1ZHCA 2CWOA 2LHRA 2IW5B 5HAXA 4ISSA 4ZI2D 4IIJE 3BQLA 4I50E 3LBXA 5LBQB 3JC6D 2X51A 2H7OA 3O1JA 3VKHA 5L3EB 4ZI7E 1D1BA 2LOPA 4U72A 2ZM0A 4FI5A 3MJXA 3ZCJA 2XAJB 2JRKA 2K9AA 3NRXA 4JEUB 5EK4A 1WRDA 3RYCE 5LXTE 2D2SA 1BR0A 4H9SE 2E9XA 3CQGB 2CE7A 2X68A 5DQVA 2Y48B 3Q2MA 3L09A 3AB3B 3KV6A 3KINB 5LG4A 4EB6E 2BVLA 2BDEA 3LG7A 4F6RC 4DMVA 3KVAA 1AJ3A 4ILUA 3P8CD 4IE4A 3SOLA 4UVCB 3T8OA 4FJOA 3PU8A 4XAXB 4BJNA 5L3CB 4J2CA 4C91A 2K48A 3LBXB 4OFZA 4AI6A 5HXEA 3HL6A 5HWXA 3S4UA 1X79A 3P7IA 3FBLA 5ETWA 3C4WA 5LBMA 3GMIA 3BQKA 4ZI3C 2V26A 3I0OA 2E9XB 2VASA 3KV4A 5HXSA 3ZC0A 2DWGA 4PNIA 2CXLA 2CMRA 4TV8E 3KBTA 3MK7C 4XZCA 3Q9DA 4I4TE 3ZLIA 1MNDA 3AVSA 3O1HA 3VU7H 2DHRA 3CX7B 3GN5A 1HG2A 1ZV4X 2X67A 3W15B 2L8KA 3PUSA 4QXBB 3CMLA 4H9OC 2ODVA 5FXZA 3ZMVB 4G63A 5JH7E 4H9QC 5C8YE 4BA9A 1UX4A 4PJMA 5EK2A 3RC3A 3EDUA 1LVFA 5A1LA 3K3OA 2W62A 2XQYA 4BJMA 2EHOA 3A5XA 1G73A 2CA5A 2VB6A 1BR2A 4TZ4C 4H9NC 3F2EA 5J2UE 1V9DA 3K8PC 1HCIA 2JJ9A 4O4JE 4CQIA 4PW8A 3MKDA 1MIYA 4ZOLE 2WWUA 3GN5B 2Q9QA 4QXCB 4YJ2E 5L2LA 1HG5A 4N78D 4PK5A 4KBMB 3CKDA 1HTJF 2WSSV 5HWYA 3E22E 3NBXX 1MIVA 2IC6A 2PBIA 4X1KE 3C50A 3C98B 3LK2B 1MMDA 2EHOB 3C64A 3AVRA 5L3BB 2C5JA 2NTXA 4C90A 5IYZE 4HFVA 3UUNA 1YKHB 3PTRB 3LJCA 3HI2A 4WBOA 5H6QB 3IF8B 3RYHE 3MACA 1WYBA 3ONXA 4IDZA 5DQWA 3DTOA 1YKEB 4PAGA 4BAYB 4UF0A 5JDNA 2Q9QB 2N9DA 4PFPA 3WI3A 3PDYA 2KNDA 4G2AA 5JRCB 5LGNB 2ACXA 3N5LA 5GONE 5CB4E 2UXXB 3O9XA 3QUJA 2KWHA 2W61A 3B13A 4GK0E 3F31A 2LM9A 3PU3A 1MMNA 1U4QA 3SRZA 4B6XA 3KFWX 1OXZA 5IHYA 2ES0A 4EYUA 3I9YA 1Y64B 2C0SA 3QK6A 3R84B 3SWHA 3FB2A 3ZMTB 4IE6A 1NAFA 2W63A 2A3DA 3C4XA 3DP7A 5KMGP 4IE5A 5FY1A 3BQIA 3PURA 3VKGA 3MA9A 4P0AA 2NW8A 5E0OA 4DBRA 2KT9A 4MHCA 2K5BB 3RPUA 5HXHA 4AKLA 4MALA 4UVAB 3N2KE 4DMWA 3V5UA 2LSGA 3LK42 3FXDB 2L9QA 2OA5A 4O4HE 3ZJ1A 4ERRA 2YU1A 4I43B 4TN7B 5DJQC 4EXTA 4AQFA 3NRYA 3HR0A 4MFRA 3ZMZB 2QA7A 4CI3B 5L3GB 4TUYE 3I1AA 1IJ5A 2N2NA 3B57A 2CLYC 3UTKA 5LNKA 3U78A 5BMVE 3GA8A 2JPFA 2DCFA 3ZYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHC A; 
#chains in the Genus database with same CATH topology
 5M4Y A;  1HFA A;  5FL0 A;  4DO0 A;  1B7T A;  2KZ7 B;  4DV4 T;  1LRZ A;  5IWA T;  1D1A A;  2UUA T;  4GK5 E;  3SFD A;  1KNZ A;  2DWK A;  4AKI A;  2V1D B;  4MBQ A;  3QC9 A;  5KX5 E;  2CPT A;  4V1A v;  2PTF A;  1JNZ A;  4AQG A;  2X9H A;  5AQH B;  4JI8 T;  5CJ5 A;  2PG8 A;  4DUZ T;  4LF4 T;  2UXN B;  4HWD A;  2KMF A;  2WMN A;  5L4E A;  4TWD A;  1QUU A;  2XM2 A;  4P1N A;  4O2B E;  2I0M A;  3P4P A;  4JI6 T;  2V7J A;  3T1Y T;  4ADZ A;  4YHH T;  5AQJ B;  4JI1 T;  2IC9 A;  4QWN B;  4NXM T;  2H7V C;  4I55 E;  3UUX B;  4YJ3 E;  1HS7 A;  4PJJ A;  2V6X A;  1HX1 B;  2G0U A;  3H37 A;  2WAU A;  3Q5D A;  2R6G F;  1US7 B;  1D0Z A;  5FNV E;  2DNX A;  4UEL A;  2CM0 A;  1OED C;  3N2O A;  1IAP A;  2YIN A;  4DR7 T;  3ZC1 A;  4AIU A;  2Y8D A;  3CQC B;  3A8Y C;  3TKL B;  3HKD E;  2LKH A;  1DU2 A;  2JQQ A;  3RC8 A;  2UUC T;  4OHF A;  2E9X D;  4NPP A;  3QNU A;  3R6N A;  2LRK A;  2XUE A;  1WYC A;  2UXD T;  3AED A;  5FP3 A;  3UFG A;  1MMG A;  3JAD A;  5J2T E;  4IE0 A;  4Z8X A;  4HFD A;  4QKN A;  2Z6E A;  4LF8 T;  2LLY A;  2MYS A;  2H89 A;  1LKX A;  3PV0 F;  4YFS A;  3ZJ2 A;  4DR2 T;  1U5P A;  3RYI E;  5LGT B;  2B1E A;  4TX5 A;  5DAB A;  5L3D B;  1WR0 A;  3ZT5 A;  3WAK A;  5CA1 E;  3N9M A;  3O4X E;  3ZMS B;  1Z8U A;  1T72 A;  2CCQ A;  2VKH A;  2M67 A;  4IDP A;  2KLQ A;  2IHR 1;  3OYX A;  5AQU B;  1VRB A;  2Q9Q D;  2MPK A;  4EOZ B;  4UIG A;  5JRE A;  5JRC A;  1UK5 A;  2W0G A;  3RYF E;  2LEH A;  4ASK A;  3RRC A;  2VVS A;  4LF6 T;  3O1I A;  2QGS A;  2NR4 A;  1XMO T;  1JNR A;  1ZEE A;  2FJA A;  3ZSS A;  3UT5 E;  4YHJ A;  2LHN A;  5JVD E;  2BG9 B;  4NUV A;  2W00 A;  3ONL C;  4GYR A;  3J9X 1;  3M65 A;  4H63 H;  1S94 A;  4LMJ A;  3PUG A;  3U3I A;  4O2A E;  3VHL A;  2LHR A;  4LFA T;  4CN6 A;  2IW5 B;  5FVL A;  5AQL B;  2VQE T;  5LBQ B;  3JC6 D;  3O1J A;  1D1B A;  4U72 A;  4YTP A;  3P4R A;  4HFC A;  2DL1 A;  2XAJ B;  2K9A A;  2W66 A;  3NRX A;  2D2S A;  4H9S E;  2E9X A;  3CQG B;  2CE7 A;  2X68 A;  4ZZC A;  4WYV A;  3Q2M A;  4EV6 A;  4EB6 E;  3KVA A;  3SOL A;  4UVC B;  4BJN A;  5L3C B;  4IRE A;  5HWX A;  1Y01 A;  2HN2 A;  3FBL A;  2YDR A;  3BQK A;  1J1J A;  4ZI3 C;  3I0O A;  2E9X B;  3EI0 A;  3KV4 A;  4PNI A;  3UUB A;  4I4T E;  3G06 A;  2DHR A;  3CX7 B;  3GN5 A;  3W15 B;  5FXZ A;  5C8Y E;  1UX4 A;  3VR9 A;  3EAB A;  1LVF A;  5A1L A;  3K3O A;  4BJM A;  1G73 A;  4CN4 A;  2YN6 A;  2WWV A;  3F2E A;  2VUR A;  5J2U E;  1V9D A;  2IML A;  3MKD A;  1MIY A;  3GN5 B;  2Q9Q A;  4ZXL A;  4YJ2 E;  5L2L A;  3FZK B;  4DV0 T;  4N78 D;  2XZE A;  2WB5 A;  4KHZ F;  3C50 A;  3C64 A;  3AVR A;  4Q25 A;  4JV5 T;  4YTM A;  1XZY A;  2AXD S;  4LF5 T;  2C5J A;  4C90 A;  4YSY A;  1YKH B;  4U2Y A;  5H6Q B;  3IF8 B;  2LRL A;  3DTO A;  1W0A A;  4PAG A;  4BAY B;  2Q9Q B;  3WI3 A;  2KND A;  3N5L A;  5CB4 E;  3O9X A;  2W61 A;  3B13 A;  4GK0 E;  2LM9 A;  4B6X A;  1OXZ A;  5FVK A;  3QK6 A;  2C0S A;  3R84 B;  3SWH A;  3FB2 A;  1NAF A;  3C4X A;  4IE5 A;  3VKG A;  3MA9 A;  3NWI A;  1NEN A;  4MHC A;  2K5B B;  4NXN T;  4MAL A;  4UVA B;  3N2K E;  3FXD B;  1NEK A;  1YXR A;  2L9Q A;  2YU1 A;  4I43 B;  4DV1 T;  3NRY A;  4IT4 A;  2BG9 C;  3AEA A;  2JPF A;  4MLK A;  3EVY A;  4U3C A;  5KXJ A;  2LE8 A;  2DLR A;  2PFV A;  5FY7 A;  2V7I A;  3N9N A;  4H9R C;  3AXJ B;  4KUM B;  2W2U A;  3AEG A;  3RHW A;  4DV3 T;  3MZK B;  4JLE A;  3SS1 A;  3OPC A;  4IE7 A;  2VL0 A;  2OV9 A;  2D9D A;  1SUM B;  2SPC A;  1J5E T;  2CBI A;  3IHR A;  2JMH A;  2BS3 A;  1IBM T;  5FYM A;  2WQY A;  4GOU A;  3FBZ A;  5LJM A;  2V5C A;  5LOV E;  4A98 A;  3N9P A;  1YW0 A;  2E9X C;  4PJL A;  1KEY A;  2XAS B;  3TLU A;  4WW0 A;  2YK0 A;  2NW9 A;  4OYJ A;  2LJL A;  3ZT6 A;  3ZEF B;  4HTE A;  4K0U A;  2J47 A;  3ETV A;  2JQ9 A;  2X9W A;  4HFI A;  2UU9 T;  2RP4 A;  2ZM2 A;  4X64 T;  4EZ4 A;  2XJ7 A;  2P9B A;  4Z90 A;  2CXF A;  4H9P C;  2YKS A;  4IDN A;  2ZM8 A;  2X9X A;  4U74 A;  4TV9 E;  4AKG A;  5CFB A;  3ZN1 B;  4KP3 C;  4HE8 A;  4HFB A;  2IIU A;  5LHH B;  3PUA A;  4XBF B;  4UF0 B;  2E8I A;  5J1G A;  1MIW A;  4GIW A;  4DR4 T;  5F3J A;  1HR0 T;  2MOZ A;  3RF1 A;  2XQ6 A;  4AKH A;  2Q9Q C;  5EK3 A;  2LSY A;  3RKG A;  4JUY A;  3OTO T;  1W9R A;  4B3M T;  3KBU A;  1CUN A;  4TWH A;  2ZLY A;  2KIN B;  5AQV B;  5HEH A;  3FZF B;  4A56 A;  3KV5 A;  1QSD A;  1XWM A;  2W4X A;  2XHE B;  2A2F X;  4LFB T;  2LSI A;  5CGM A;  4UVB B;  4HEA A;  4X1Y E;  2XQ8 A;  1SHZ C;  4QH5 A;  1WR6 A;  2F4V T;  3RIU C;  3P50 A;  4DID B;  1KNR A;  2RA1 A;  4ZS3 A;  4A97 A;  4QH1 A;  2VKD A;  3JC6 C;  4DND A;  1IJ6 A;  4OYK A;  4HKA A;  5JDL A;  2V7L A;  5F8P A;  2QVA A;  1N33 T;  2ZM6 T;  3FXE B;  3ANW A;  3UUL A;  4CXY A;  1FIO A;  1O3X A;  3CQX C;  1Z0P A;  1KF6 A;  1D0Y A;  4M1P A;  3ZN0 B;  3NZP A;  5FKY A;  4ANJ A;  5L3F B;  3MXZ A;  4I0U A;  4OX9 T;  2UXB T;  3ANW B;  4X62 T;  3EUH A;  1N32 T;  4UR9 A;  5JQG E;  2C5K T;  3FZL B;  3OYZ A;  2LSK A;  3IBP A;  2CLY B;  3RKO A;  2CWY A;  1WFD A;  3PE0 A;  3WAJ A;  5H6R B;  1ZHC A;  2XQ3 A;  4IIJ E;  3LBX A;  2LOP A;  4FI5 A;  1L0V A;  2XQ9 A;  5LXT E;  2BKO A;  4HWF A;  1BR0 A;  2LKG A;  4EGW A;  4X5T A;  4DUY T;  5DQV A;  3L09 A;  3AB3 B;  3KV6 A;  2BVL A;  2BDE A;  3LG7 A;  4DMV A;  4IE4 A;  4YT0 A;  3T8O A;  2K48 A;  3LBX B;  4KI0 F;  4OFZ A;  2XQA A;  3HL6 A;  5ETW A;  5LBM A;  2H88 A;  4LF7 T;  2WDQ A;  2VAS A;  4B3S T;  3ZC0 A;  3Q5E A;  2FJB A;  5ABE A;  5AQO B;  3Q9D A;  3VU7 H;  4QXB B;  2WP9 A;  3QOF A;  4BA9 A;  4PJM A;  2IDO B;  5EK2 A;  3RC3 A;  1E7P A;  2YDS A;  2XQY A;  3A5X A;  2WDV A;  2XSB A;  2VB6 A;  1CHU A;  3P4S A;  1HCI A;  4ZOL E;  5IUX A;  2XY8 B;  4KBM B;  3PUW F;  2WSS V;  4JYA T;  2HN1 A;  4X1K E;  3P4W A;  4HFV A;  3UUN A;  3LJC A;  4WBO A;  2ACZ A;  3EAM A;  1WYB A;  4K0K T;  3ONX A;  5DQW A;  2X0H A;  3PDY A;  5JRC B;  2ACX A;  5AQN B;  2XQ5 A;  3KFW X;  4Z91 A;  3I9Y A;  3RLF F;  2BKN A;  3A7M A;  2W63 A;  3DP7 A;  2WY2 A;  5KMG P;  2X0Y A;  5ABF A;  3BQI A;  5E0O A;  3RPU A;  4DMW A;  3LK4 2;  3ZJ1 A;  5J0Z A;  5L3G B;  2QA7 A;  2N2N A;  2CLY C;  4KHP T;  5ABF B;  1SE7 A;  2DCF A;  4GYS A;  3RX6 A;  5CA0 E;  1YQ4 A;  2X0L B;  1ZOY A;  4YTN A;  5ABG A;  3AA0 B;  5JDM A;  2VWA A;  4CI1 B;  3AA7 B;  4COF A;  2NOX A;  3IA3 A;  3CK6 A;  4PK6 A;  2XQ7 A;  5AQP B;  1FEW A;  3EHZ A;  2L3L A;  3J7Y q;  2MAW A;  3E0Z A;  5LMU T;  2HHH T;  4CN1 A;  1G8X A;  5AQG B;  4DR6 T;  3N9L A;  2CRB A;  3AAA B;  4P09 A;  1S35 A;  5JDF A;  2WZH A;  3ZST A;  2J1D G;  2YU2 A;  4WZX A;  5JTG A;  1N34 T;  4B3R T;  4U7I A;  3HA4 A;  2UXC T;  3UU5 A;  1VCT A;  5FL1 A;  3RH3 A;  4DV2 T;  2JMK A;  2V6Y A;  4ZEY A;  1H7C A;  3RIA A;  4QX8 B;  4UEM A;  1I6Z A;  5HXC A;  4HWC A;  4IHJ E;  3AE1 A;  2BKP A;  3TLV A;  5HEG A;  4EZH A;  3L3P A;  4CXX A;  4L9I A;  2XSA A;  4HGA A;  2X9Y A;  2X66 A;  3ESL A;  2OLT A;  2V6Y B;  1E1H B;  3UFE A;  2B76 A;  3ETU A;  4PK4 A;  4EED A;  1IZN B;  3OBV E;  3AA6 B;  2WBL A;  2N1G A;  1T98 A;  2BZB A;  4ZS2 A;  3AAE B;  2HPJ A;  2WU2 A;  2MTQ A;  4ILC A;  1HX8 A;  4IL4 A;  4O8S A;  4PJN A;  3GWH A;  3ZCI A;  3ZYM A;  4DVD A;  5TAO A;  3KDS E;  4JI3 T;  1HF8 A;  3ZYL A;  3HKB E;  5FMN A;  2ODU A;  2H3R A;  3UU4 A;  3RQW A;  2NP9 A;  2BBH A;  1FMV A;  4WBN E;  3T1H T;  4TWF A;  4QHO A;  4P0B A;  2K3W A;  1BR4 A;  2D0T A;  3F57 A;  2V7M A;  4DBQ A;  3QB5 K;  4DR1 T;  5HEU A;  2EHO D;  3AE2 A;  3NKZ A;  1WLX A;  4L0R A;  2A72 A;  2LOS A;  3K3N A;  2XAG B;  5LGU B;  3JCF A;  3UUM A;  4NUU A;  1EZ3 A;  1QLB A;  3PUZ F;  2D0U A;  2C5I T;  3FZH B;  2NW7 A;  3FZM B;  3HKC E;  3V5S A;  5AQS B;  1ZP0 A;  2XAQ B;  3OJA A;  4HN9 A;  4UV8 B;  3AEB A;  2WM9 A;  2CHN A;  5ADX L;  2HPL A;  4LMK A;  4PFO A;  5FXW A;  2GK9 A;  2WMO A;  3VR8 A;  2BG9 E;  5FXX A;  3RI5 A;  5LJN A;  4LFC T;  1UCU A;  3FHN A;  1XDO A;  2CXD A;  2MBG A;  2E5V A;  4YSX A;  1VCS A;  3EDV A;  4UXN B;  3C51 A;  3L39 A;  4ZI3 D;  2VQF T;  2HH7 A;  5AQQ B;  3AE5 A;  5LG3 A;  3Q5W A;  3KVB A;  5FXV A;  4KMC A;  5AQK B;  2CWO A;  1XDP A;  5HAX A;  4ISS A;  4ZI2 D;  3BQL A;  2X51 A;  3VKH A;  5L3E B;  4ZI7 E;  1X9B A;  3QB5 A;  5AQT B;  1T7S A;  4JI0 T;  2ZM0 A;  2J62 A;  1HNX T;  3ZCJ A;  2IUB A;  2Y48 B;  4U31 A;  3KIN B;  4F6R C;  5HEO A;  2CHO A;  5ABH A;  1HNW T;  2M6B A;  4FJO A;  4XAX B;  4DR3 T;  2E2A A;  3PUV F;  3GMI A;  4U33 A;  2V26 A;  4JBW F;  2DWG A;  2CXL A;  4JI5 T;  1XNQ T;  3ZLI A;  3AVS A;  1HG2 A;  1ZV4 X;  2X67 A;  2L8K A;  2FBW A;  3PUS A;  3CML A;  3ZMV B;  2I6H A;  2W62 A;  2EHO A;  3UU6 A;  1UUR A;  1BR2 A;  4TZ4 C;  2BS4 A;  2JJ9 A;  4O4J E;  4CQI A;  4PW8 A;  4LF9 T;  3JAF A;  1XNR T;  4QXC B;  1HG5 A;  3CKD A;  2FJD A;  1HTJ F;  1MIV A;  2PBI A;  3C98 B;  1MMD A;  2EHO B;  4DV6 T;  4U2Z A;  3H3M A;  3HI2 A;  4JI2 T;  3ZKR A;  3K1S A;  4YY3 T;  1I94 T;  1YKE B;  5JDN A;  4ILB A;  2N9D A;  4G2A A;  3TLS A;  2KWH A;  3PU3 A;  5IHY A;  1Y64 B;  4IE6 A;  3PUR A;  1M7K A;  4DR5 T;  3P4Q A;  2WDR A;  2YOE A;  2XPK A;  3V5U A;  2LSG A;  2YDQ A;  3L8R A;  3NVO A;  4EXT A;  2JIW A;  4AQF A;  3HR0 A;  3ABV A;  4MFR A;  4CI3 B;  4TUY E;  2BBJ A;  5LNK A;  3U78 A;  2WZI A;  2BS2 A;  4EIW A;  3RGL A;  2NWB A;  2VKO A;  5AQI B;  2XTL A;  4YLH A;  4O4I E;  4EAH A;  4L5G A;  3ZMU B;  5JDQ A;  3PUQ A;  1W09 A;  2E5L T;  5JR9 A;  4LML A;  2BVM A;  3I0Q A;  3NZQ A;  3RQU A;  5AQF B;  3KV9 A;  1KK7 A;  1XMQ T;  2VL8 A;  2NTY A;  1OED E;  4O4L E;  2QRX A;  1MNE A;  4YSZ A;  2VKJ A;  3UQ7 A;  2VK9 A;  4OK0 A;  1MMA A;  2IAK A;  4EEB A;  5JR9 B;  1NWM X;  3LFM A;  1YQ3 A;  2D5U A;  1VOM A;  5C3J A;  2Y6X A;  2KXP B;  2M6I A;  3D0T A;  2BG9 A;  1UX5 A;  4AXP A;  2VVN A;  4QX7 B;  2JQH A;  2JQK A;  2XAF B;  5JDH A;  4GKK T;  3RIF A;  4A5X A;  2PJQ A;  3AE8 A;  3IEE A;  3OVU A;  4X65 T;  3VRB A;  3ZT7 A;  2RPA A;  3CPZ A;  3B5M A;  4IGU A;  2J4G A;  3Q5X A;  2WCA A;  1KFY A;  2V5D A;  4QXH B;  3LSV A;  4JEH B;  1GQE A;  2EHO C;  3N2G E;  1LVK A;  1W0B A;  4E7Z A;  3HKE E;  2ZMA A;  3C4Z A;  4H63 V;  4CI2 B;  1YD8 G;  3LK3 B;  1IBL T;  4ILA A;  5LYJ E;  5LHG B;  1N36 T;  2V7K A;  3CX6 B;  5LCY A;  2DI4 A;  2KWI B;  2W67 A;  2K24 A;  2XM1 A;  1D1C A;  4ZHQ E;  1HNZ T;  3N9Q A;  3AE7 A;  2V8S V;  1M62 A;  2LT3 A;  3UQ4 A;  5AQM B;  4HFH A;  5LA6 E;  3K3Q C;  3AA1 B;  5EZY E;  3VRA A;  4CZZ B;  3N9O A;  3AEC A;  3I9W A;  5LP6 E;  3CVR A;  2I59 A;  3CIR A;  5KDM C;  1FMW A;  4WNK A;  2XAH B;  3OKQ A;  3E08 A;  4B3T T;  4AKR B;  4ZZB A;  4IST A;  3UU8 A;  4ZI2 C;  4JI4 T;  3H3A A;  1SA0 E;  5JDG A;  4X1I E;  5LB7 B;  2YEV C;  3AAI A;  3UU3 A;  4GKJ T;  1D0X A;  3M3Z B;  4AQF C;  2WU5 A;  4CXW A;  2FJE A;  5HXR A;  5AFU L;  4TNW A;  5FY0 A;  4YXD A;  3ZPO A;  4X20 E;  1BR1 A;  4JI7 T;  3DJB A;  2CEA A;  1UUS A;  4UV9 B;  3RRW A;  5BR8 T;  4HWH A;  4F8H A;  4EYY R;  1ZKE A;  2LSJ A;  5LHI B;  4E7S A;  3AE6 A;  3CX8 B;  3TLW A;  3CWZ B;  5JR9 C;  3AE4 A;  1OWA A;  5HYA A;  3BK9 A;  5HCJ A;  1IBK T;  2CBJ A;  3AE3 A;  3X1D A;  4IDQ A;  3RIU A;  4AQY T;  4I50 E;  2H7O A;  5LMN T;  2KSR A;  3MJX A;  5L47 A;  3PJA A;  3ONJ A;  3RYC E;  2JRK A;  5EK4 A;  4JEU B;  1WRD A;  2LM2 A;  3PUX F;  2WS3 A;  5LG4 A;  1AJ3 A;  4ILU A;  3P8C D;  1E2A A;  3AXJ A;  3PU8 A;  4J2C A;  4C91 A;  4AI6 A;  5HXE A;  3S4U A;  1X79 A;  3P7I A;  3C4W A;  3AE9 A;  2UUB T;  4HWI B;  5HXS A;  2CMR A;  4TV8 E;  2XQ4 A;  3KBT A;  3MK7 C;  4XZC A;  1MND A;  3O1H A;  2FUP A;  4H9O C;  2ODV A;  4G63 A;  5JH7 E;  1OED A;  4H9Q C;  4HFE A;  3EDU A;  3TLT A;  2A9U A;  2CA5 A;  3LDQ B;  4H9N C;  3K8P C;  4IL9 A;  2WWU A;  4IDO A;  4PK5 A;  1OED B;  4U7Y A;  5HWY A;  3E22 E;  3NBX X;  2IC6 A;  3PJA J;  1J5W A;  3LK2 B;  5HEJ A;  5L3B B;  2NTX A;  1UGO A;  5IYZ E;  4X66 T;  3PTR B;  1KNP A;  4AIS A;  3RYH E;  3MAC A;  4IDZ A;  3SFE A;  4NIQ A;  4KX6 A;  3JAE A;  4UF0 A;  4PFP A;  5LGN B;  5GON E;  2UXX B;  1T8B A;  4DV5 T;  5C2T A;  3QUJ A;  3F31 A;  1MMN A;  1U4Q A;  3SRZ A;  2ES0 A;  4EYU A;  1R8I A;  3PUY F;  2QYW A;  3ZMT B;  4DV7 T;  2A3D A;  5L4H A;  5F5W A;  5FY1 A;  4P0A A;  2NW8 A;  4DBR A;  2KT9 A;  5HXH A;  4AKL A;  1FJG T;  4TNV A;  2OA5 A;  4O4H E;  1WCR A;  5HCM A;  2AE9 A;  4ERR A;  5AQR B;  3AEF A;  4TN7 B;  5DJQ C;  3ZMZ B;  3AEE A;  3I1A A;  1IJ5 A;  3B57 A;  4QH4 A;  3UTK A;  5BMV E;  3GA8 A;  3ZYK A; 
#chains in the Genus database with same CATH homology
 4MLK A;  3EVY A;  4GYS A;  3RX6 A;  4EIW A;  5CA0 E;  5M4Y A;  1HFA A;  2NWB A;  2X0L B;  2VKO A;  4DO0 A;  1B7T A;  2LE8 A;  2KZ7 B;  2XTL A;  4YLH A;  2DLR A;  3AA0 B;  1LRZ A;  2PFV A;  5JDM A;  1D1A A;  2VWA A;  5FY7 A;  4CI1 B;  4O4I E;  3AA7 B;  2V7I A;  2NOX A;  3N9N A;  4H9R C;  4GK5 E;  5F3J A;  1KNZ A;  4PK6 A;  2DWK A;  4KUM B;  4EAH A;  4L5G A;  2V1D B;  4AKI A;  4MBQ A;  3ZMU B;  3QC9 A;  5JDQ A;  3PUQ A;  5KX5 E;  1FEW A;  4V1A v;  2L3L A;  3MZK B;  5JR9 A;  3J7Y q;  4JLE A;  2BVM A;  3I0Q A;  3SS1 A;  4AQG A;  4IE7 A;  2X9H A;  3E0Z A;  3NZQ A;  2PG8 A;  1G8X A;  2UXN B;  3KV9 A;  1KK7 A;  2KMF A;  3N9L A;  2WMN A;  1QUU A;  2VL8 A;  2NTY A;  3AAA B;  2SPC A;  4P09 A;  3IHR A;  2JMH A;  1S35 A;  5FYM A;  4O4L E;  4GOU A;  5JDF A;  3FBZ A;  2J1D G;  2YU2 A;  4O2B E;  1MNE A;  5LJM A;  2VKJ A;  2VK9 A;  4OK0 A;  5LOV E;  3HA4 A;  3N9P A;  1MMA A;  1YW0 A;  2E9X C;  2V7J A;  2IAK A;  4PJL A;  4ADZ A;  5JR9 B;  3RH3 A;  2IC9 A;  4QWN B;  2XAS B;  1NWM X;  3LFM A;  4WW0 A;  2YK0 A;  2NW9 A;  2D5U A;  2H7V C;  2JMK A;  1VOM A;  1H7C A;  4OYJ A;  2LJL A;  3ZEF B;  2Y6X A;  4HTE A;  4QX8 B;  4K0U A;  4UEM A;  5HXC A;  2KXP B;  3D0T A;  4I55 E;  3ETV A;  3UUX B;  2X9W A;  1UX5 A;  4AXP A;  4IHJ E;  4YJ3 E;  2RP4 A;  2ZM2 A;  1HS7 A;  4QX7 B;  4EZ4 A;  4EZH A;  2XAF B;  4PJJ A;  5JDH A;  3L3P A;  2G0U A;  3H37 A;  4CXX A;  4L9I A;  2PJQ A;  2WAU A;  3IEE A;  2P9B A;  2CXF A;  4H9P C;  1US7 B;  1D0Z A;  4HGA A;  3CPZ A;  2X9Y A;  2X66 A;  3ESL A;  5FNV E;  4IGU A;  2DNX A;  2ZM8 A;  2X9X A;  3Q5X A;  4U74 A;  1E1H B;  3UFE A;  4TV9 E;  4UEL A;  4AKG A;  3ZN1 B;  4KP3 C;  2CM0 A;  4HE8 A;  5LHH B;  3PUA A;  4XBF B;  4QXH B;  3ETU A;  4JEH B;  3N2O A;  1IAP A;  2EHO C;  4PK4 A;  4UF0 B;  3N2G E;  2E8I A;  2YIN A;  1LVK A;  1IZN B;  3ZC1 A;  5J1G A;  1MIW A;  2Y8D A;  3CQC B;  4GIW A;  4E7Z A;  3OBV E;  3AA6 B;  2WBL A;  2N1G A;  1T98 A;  3HKE E;  2ZMA A;  3TKL B;  2MOZ A;  3C4Z A;  4H63 V;  4CI2 B;  1YD8 G;  3HKD E;  4AKH A;  2BZB A;  3LK3 B;  4ZS2 A;  3AAE B;  2JQQ A;  3RC8 A;  2HPJ A;  2Q9Q C;  5EK3 A;  2LSY A;  5LYJ E;  4JUY A;  2MTQ A;  1HX8 A;  3KBU A;  4O8S A;  4PJN A;  3GWH A;  4OHF A;  3ZCI A;  5LHG B;  2E9X D;  2V7K A;  3CX6 B;  3R6N A;  5LCY A;  2DI4 A;  2KWI B;  1WYC A;  2XUE A;  5TAO A;  3ZYM A;  4DVD A;  2K24 A;  5FP3 A;  3KDS E;  1D1C A;  1MMG A;  1CUN A;  4ZHQ E;  1HF8 A;  2ZLY A;  3ZYL A;  3N9Q A;  3HKB E;  5FMN A;  5J2T E;  2KIN B;  4IE0 A;  4Z8X A;  2LT3 A;  2ODU A;  2H3R A;  2NP9 A;  5LA6 E;  4QKN A;  3K3Q C;  3AA1 B;  1FMV A;  2Z6E A;  4A56 A;  4WBN E;  5EZY E;  2MYS A;  4CZZ B;  3KV5 A;  1LKX A;  1QSD A;  4YFS A;  2XHE B;  2A2F X;  3N9O A;  2LSI A;  3I9W A;  3ZJ2 A;  1U5P A;  5LP6 E;  4QHO A;  3CVR A;  3RYI E;  4UVB B;  2I59 A;  4P0B A;  5LGT B;  4HEA A;  5KDM C;  1BR4 A;  2D0T A;  1FMW A;  2B1E A;  3F57 A;  4WNK A;  4X1Y E;  2V7M A;  2XAH B;  3OKQ A;  4DBQ A;  1SHZ C;  3E08 A;  4TX5 A;  1WR6 A;  5DAB A;  4AKR B;  5L3D B;  4IST A;  3WAK A;  2RA1 A;  4ZS3 A;  4ZI2 C;  5CA1 E;  3N9M A;  2EHO D;  3H3A A;  1SA0 E;  2VKD A;  3JC6 C;  3O4X E;  3ZMS B;  4DND A;  1WLX A;  5JDG A;  4L0R A;  2A72 A;  4X1I E;  2YEV C;  1IJ6 A;  3AAI A;  2LOS A;  3K3N A;  2CCQ A;  2VKH A;  4OYK A;  4HKA A;  1D0X A;  5JDL A;  2V7L A;  2M67 A;  5F8P A;  2KLQ A;  2XAG B;  5LGU B;  3OYX A;  3FXE B;  3UUM A;  1VRB A;  3ANW A;  4AQF C;  4NUU A;  2Q9Q D;  4EOZ B;  1EZ3 A;  4CXW A;  4UIG A;  3UUL A;  5HXR A;  4CXY A;  5AFU L;  1FIO A;  5FY0 A;  1O3X A;  3ZPO A;  3CQX C;  1Z0P A;  2D0U A;  1BR1 A;  4X20 E;  2C5I T;  5JRE A;  2NW7 A;  1D0Y A;  5JRC A;  4M1P A;  2W0G A;  3HKC E;  3DJB A;  3RYF E;  2LEH A;  4ASK A;  2CEA A;  3RRC A;  3V5S A;  4HN9 A;  2XAQ B;  3OJA A;  4UV8 B;  2WM9 A;  4UV9 B;  3ZN0 B;  3RRW A;  5ADX L;  2HPL A;  5FXW A;  3NZP A;  4PFO A;  3O1I A;  2QGS A;  2GK9 A;  4ANJ A;  5L3F B;  2WMO A;  3MXZ A;  4EYY R;  1ZKE A;  2LSJ A;  5FXX A;  3ANW B;  5LJN A;  1UCU A;  1ZEE A;  3EUH A;  5LHI B;  3FHN A;  2CXD A;  3UT5 E;  4E7S A;  2MBG A;  3CX8 B;  5JQG E;  2C5K T;  3EDV A;  4YHJ A;  2LHN A;  2LSK A;  3OYZ A;  5JVD E;  4UXN B;  4NUV A;  2W00 A;  3IBP A;  3C51 A;  4ZI3 D;  3CWZ B;  4GYR A;  2HH7 A;  3J9X 1;  2CLY B;  5JR9 C;  3M65 A;  3RKO A;  4H63 H;  2CWY A;  1S94 A;  1OWA A;  5HYA A;  3BK9 A;  3Q5W A;  3PUG A;  3KVB A;  5FXV A;  4KMC A;  3U3I A;  3PE0 A;  4O2A E;  3WAJ A;  5H6R B;  3VHL A;  1ZHC A;  2CWO A;  2LHR A;  2IW5 B;  5HAX A;  4ISS A;  4ZI2 D;  4IIJ E;  3BQL A;  4I50 E;  3LBX A;  5LBQ B;  3JC6 D;  2X51 A;  2H7O A;  3O1J A;  3VKH A;  5L3E B;  4ZI7 E;  1D1B A;  2LOP A;  4U72 A;  2ZM0 A;  4FI5 A;  3MJX A;  3ZCJ A;  2XAJ B;  2JRK A;  2K9A A;  3NRX A;  4JEU B;  5EK4 A;  1WRD A;  3RYC E;  5LXT E;  2D2S A;  1BR0 A;  4H9S E;  2E9X A;  3CQG B;  2CE7 A;  2X68 A;  5DQV A;  2Y48 B;  3Q2M A;  3L09 A;  3AB3 B;  3KV6 A;  3KIN B;  5LG4 A;  4EB6 E;  2BVL A;  2BDE A;  3LG7 A;  4F6R C;  4DMV A;  3KVA A;  1AJ3 A;  4ILU A;  3P8C D;  4IE4 A;  3SOL A;  4UVC B;  3T8O A;  4FJO A;  3PU8 A;  4XAX B;  4BJN A;  5L3C B;  4J2C A;  4C91 A;  2K48 A;  3LBX B;  4OFZ A;  4AI6 A;  5HXE A;  3HL6 A;  5HWX A;  3S4U A;  1X79 A;  3P7I A;  3FBL A;  5ETW A;  3C4W A;  5LBM A;  3GMI A;  3BQK A;  4ZI3 C;  2V26 A;  3I0O A;  2E9X B;  2VAS A;  3KV4 A;  5HXS A;  3ZC0 A;  2DWG A;  4PNI A;  2CXL A;  2CMR A;  4TV8 E;  3KBT A;  3MK7 C;  4XZC A;  3Q9D A;  4I4T E;  3ZLI A;  1MND A;  3AVS A;  3O1H A;  3VU7 H;  2DHR A;  3CX7 B;  3GN5 A;  1HG2 A;  1ZV4 X;  2X67 A;  3W15 B;  2L8K A;  3PUS A;  4QXB B;  3CML A;  4H9O C;  2ODV A;  5FXZ A;  3ZMV B;  4G63 A;  5JH7 E;  4H9Q C;  5C8Y E;  4BA9 A;  1UX4 A;  4PJM A;  5EK2 A;  3RC3 A;  3EDU A;  1LVF A;  5A1L A;  3K3O A;  2W62 A;  2XQY A;  4BJM A;  2EHO A;  3A5X A;  1G73 A;  2CA5 A;  2VB6 A;  1BR2 A;  4TZ4 C;  4H9N C;  3F2E A;  5J2U E;  1V9D A;  3K8P C;  1HCI A;  2JJ9 A;  4O4J E;  4CQI A;  4PW8 A;  3MKD A;  1MIY A;  4ZOL E;  2WWU A;  3GN5 B;  2Q9Q A;  4QXC B;  4YJ2 E;  5L2L A;  1HG5 A;  4N78 D;  4PK5 A;  4KBM B;  3CKD A;  1HTJ F;  2WSS V;  5HWY A;  3E22 E;  3NBX X;  1MIV A;  2IC6 A;  2PBI A;  4X1K E;  3C50 A;  3C98 B;  3LK2 B;  1MMD A;  2EHO B;  3C64 A;  3AVR A;  5L3B B;  2C5J A;  2NTX A;  4C90 A;  5IYZ E;  4HFV A;  3UUN A;  1YKH B;  3PTR B;  3LJC A;  3HI2 A;  4WBO A;  5H6Q B;  3IF8 B;  3RYH E;  3MAC A;  1WYB A;  3ONX A;  4IDZ A;  5DQW A;  3DTO A;  1YKE B;  4PAG A;  4BAY B;  4UF0 A;  5JDN A;  2Q9Q B;  2N9D A;  4PFP A;  3WI3 A;  3PDY A;  2KND A;  4G2A A;  5JRC B;  5LGN B;  2ACX A;  3N5L A;  5GON E;  5CB4 E;  2UXX B;  3O9X A;  3QUJ A;  2KWH A;  2W61 A;  3B13 A;  4GK0 E;  3F31 A;  2LM9 A;  3PU3 A;  1MMN A;  1U4Q A;  3SRZ A;  4B6X A;  3KFW X;  1OXZ A;  5IHY A;  2ES0 A;  4EYU A;  3I9Y A;  1Y64 B;  2C0S A;  3QK6 A;  3R84 B;  3SWH A;  3FB2 A;  3ZMT B;  4IE6 A;  1NAF A;  2W63 A;  2A3D A;  3C4X A;  3DP7 A;  5KMG P;  4IE5 A;  5FY1 A;  3BQI A;  3PUR A;  3VKG A;  3MA9 A;  4P0A A;  2NW8 A;  5E0O A;  4DBR A;  2KT9 A;  4MHC A;  2K5B B;  3RPU A;  5HXH A;  4AKL A;  4MAL A;  4UVA B;  3N2K E;  4DMW A;  3V5U A;  2LSG A;  3LK4 2;  3FXD B;  2L9Q A;  2OA5 A;  4O4H E;  3ZJ1 A;  4ERR A;  2YU1 A;  4I43 B;  4TN7 B;  5DJQ C;  4EXT A;  4AQF A;  3NRY A;  3HR0 A;  4MFR A;  3ZMZ B;  2QA7 A;  4CI3 B;  5L3G B;  4TUY E;  3I1A A;  1IJ5 A;  2N2N A;  3B57 A;  2CLY C;  3UTK A;  5LNK A;  3U78 A;  5BMV E;  3GA8 A;  2JPF A;  2DCF A;  3ZYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...