1ZHCA

Solution structure of hp1242 from helicobacter pylori
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
MFHEFRDEISVLKANNPHFDKIFEKHNQLDDDIKTAEQQNASDAEVSHMKKQKLKLKDEIHSMIIEYREKQKSERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of HP1242 from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Unknown function
molecule keywords hypothetical protein HP1242
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04325 DUF465 Protein of unknown function (DUF465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zhcA00
1ZHCA
chains in the Genus database with same CATH superfamily
2V5CA 5FYMA 2I6HA 3CKDA 3RYFE 2VVSA 5HXEA 2WU5A 3OPCA 4HFHA 5AQMB 5L3DB 2LKHA 3H3AA 2NW9A 3A7MA 2VKHA 2MAWA 2K24A 2ZM0A 5F5WA 2JJ9A 4F6RC 5ABFB 3QC9A 4AQYT 4DV7T 2WB5A 3N9NA 5AQOB 5LBQB 3SOLA 3PJAJ 2UXCT 3KDSE 4YY3T 4I50E 1UGOA 2WSSV 4DV0T 1FMVA 2X9HA 4LMKA 1MMAA 4EV6A 2NW8A 2Q9QB 1KF6A 2VURA 2WY2A 3UTKA 4YXDA 1H7CA 4NXMT 3FZMB 3UU5A 4DR6T 3VRBA 1WYBA 4O4HE 2E9XA 5FMNA 4HGAA 5AQSB 4BJNA 5AQQB 4OFZA 3AE9A 3BK9A 2IDOB 4LF5T 2X0HA 4QH4A 3C51A 2LSKA 2Y6XA 2VK9A 3GN5B 2NWBA 2IW5B 2RA1A 2QA7A 3OTOT 2BBJA 1I94T 2UXBT 1ZOYA 2V6XA 3AB3B 3KBTA 2ACZA 3R84B 4ZI2C 3GWHA 2RPAA 1YKEB 4DR2T 3C4WA 3KVAA 2OA5A 5FNVE 1BR1A 2VL0A 1IAPA 3K3OA 2IIUA 3KVBA 3PUQA 4EEBA 5JR9C 1MMGA 3P4QA 1HNWT 3ANWB 4KP3C 1D1AA 3A5XA 4QXCB 4UELA 2G0UA 3MK7C 4TN7B 4Z91A 3AE1A 4ZEYA 4ZI7E 4DV2T 1O3XA 3RRCA 4LFCT 2EHOC 3B57A 1KNRA 2KSRA 3AEFA 2CLYB 2FJAA 2E8IA 4NUUA 4JI5T 4ZI3D 2JRKA 5HEJA 2VQET 2XSAA 2XAGB 4PK4A 4JYAT 2YOEA 3RKOA 1R8IA 4DR1T 5AQIB 3CX7B 4EIWA 2V7MA 3ZSSA 4DV4T 3PUYF 3RIFA 3LK42 3R6NA 1LKXA 2GK9A 3MACA 2LM2A 1MNEA 2PBIA 1AJ3A 2QGSA 3TLTA 3RH3A 1FEWA 1SUMB 4QH1A 4TV8E 3UFGA 3UQ7A 2QRXA 2D2SA 2JMKA 4KI0F 2D0TA 5EK4A 4JEUB 3N2KE 4B3MT 2CLYC 3ZMZB 2P9BA 3CQXC 2K48A 3P4WA 3PUXF 5C2TA 3AEAA 4O4IE 1IJ5A 3IBPA 4EZHA 1KEYA 2BS4A 3F2EA 1MMDA 4EYUA 2EHOA 1ZV4X 2XM1A 3E22E 3JC6C 4QH5A 4ANJA 5CA0E 5LHIB 2D5UA 2CA5A 3QB5A 1E2AA 2WDRA 2XQ3A 3RHWA 4IDPA 2YDRA 3ZKRA 3PUGA 3MXZA 3KV9A 2CE7A 3RX6A 3SFDA 3VR8A 3DJBA 1MIYA 3ZT5A 5L3EB 4DNDA 2C5JA 4IREA 4KUMB 3HKCE 4JV5T 3N5LA 3ZEFB 3FHNA 4OX9T 2D9DA 2HH7A 3RIUA 5CGMA 4B3ST 3PV0F 4HWFA 3SWHA 3N2GE 1S35A 2PFVA 2WWUA 4IHJE 4PW8A 4Z8XA 3T1HT 1CHUA 2JIWA 2E5LT 2VKOA 3AA7B 3EVYA 3CPZA 2BG9C 1X9BA 3E08A 4DBRA 2BKNA 3P4PA 1HNXT 2XQ6A 4H63H 2KLQA 4GOUA 3RPUA 2V7JA 4YTPA 3NKZA 3PUWF 1OEDC 5AQRB 3NRXA 5FY7A 1S94A 3EDVA 4X1YE 4UXNB 4CXYA 4AKRB 5JR9B 3AAIA 2XASB 4JI4T 4QKNA 2IUBA 1D0YA 2DWKA 2KT9A 2XZEA 3RIUC 3UU4A 4A98A 1QSDA 2V6YA 3HKEE 2J62A 2DLRA 2X9YA 5AQUB 2XQ8A 5H6RB 4LMLA 3DTOA 2WBLA 1GQEA 2LSGA 4I43B 3CWZB 5ABHA 1YQ3A 3MJXA 4N78D 1XDOA 4U74A 4XBFB 3IHRA 5A1LA 3PURA 2NP9A 3EABA 4IE0A 4QHOA 3SFEA 2JPFA 5DQWA 3KINB 3LK2B 4IDZA 4PJNA 5HEGA 4TX5A 2DHRA 4X62T 2XY8B 3JAEA 3AE6A 3ANWA 4IL9A 4ISTA 4DMVA 3LG7A 4EYYR 4U2ZA 4OHFA 2NR4A 3C50A 2HPJA 3RQWA 4CI2B 4WBOA 4EAHA 4YTNA 1HS7A 3K3QC 2V5DA 4HKAA 2XQ5A 3UULA 3ZN1B 3VHLA 5L3CB 3AAEB 3AEBA 4JBWF 1FJGT 4U31A 3I0QA 3ONXA 2HN2A 3QB5K 4IT4A 1BR0A 3U3IA 3RLFF 5HWYA 4JI2T 4YJ2E 2K9AA 5JDGA 2CWYA 2NW7A 2LHNA 3I9YA 5JVDE 3ZPOA 3C98B 5FXXA 1T8BA 4HN9A 5LMUT 5KDMC 4JI6T 1UX4A 4C91A 3PDYA 2W61A 4LFAT 1D0XA 2YINA 4E7SA 2JQHA 3UFEA 4NXNT 4GK0E 5AFUL 3RYIE 3S4UA 3ZYLA 3FXDB 4ILCA 2ZM2A 4IDQA 4EOZB 2HPLA 5EZYE 2JMHA 4HFCA 2V1DB 3OKQA 4LF8T 1B7TA 3OBVE 2V7IA 2LSIA 3ZLIA 3ETUA 4U7IA 2X68A 3AXJA 1Z0PA 3MZKB 2CHOA 2XQ4A 2LLYA 4X5TA 4CN4A 1W9RA 5LGNB 1DU2A 5J2TE 4UR9A 2J4GA 2KWHA 4LF7T 2W67A 2X9WA 2VKDA 3L3PA 4YSXA 5KX5E 5LHHB 4X1KE 4J2CA 1OEDA 1W0BA 1U5PA 5J0ZA 5IHYA 4C90A 3K1SA 3QK6A 5LJNA 2BKOA 2W62A 2L3LA 1BR2A 5H6QB 3ZMUB 4CN1A 5LG4A 5BR8T 4YSYA 3ZSTA 2XUEA 4ZI3C 3ZYMA 3HA4A 2VQFT 2XTLA 2XSBA 4QXHB 4U72A 3JC6D 1XDPA 4AISA 3RF1A 3Q5EA 5LYJE 1IBMT 4P09A 5JDNA 1I6ZA 3GN5A 4TUYE 2ODUA 4GKJT 3OVUA 3EHZA 4UF0B 4HTEA 3RI5A 2XQ9A 3I9WA 2IAKA 5HXCA 1WLXA 2JQQA 1XZYA 2UXNB 2ES0A 4OYKA 1UK5A 4O2BE 5IWAT 2BS3A 5KMGP 2A9UA 5LGUB 1ZP0A 4Z90A 2YU2A 2QYWA 5J2UE 4UVAB 2R6GF 5HCMA 1D0ZA 1VCTA 1LVKA 5HXSA 2LSYA 2PG8A 1M62A 2CPTA 3RC3A 3GMIA 4ZOLE 2FJDA 3ZC1A 5HWXA 1UUSA 2WP9A 2KWIB 4HEAA 5TAOA 4AQFC 1D1BA 2W4XA 5HXHA 2UUAT 3ETVA 1XWMA 4TWDA 4LF4T 5FP3A 4U2YA 4LF6T 4NUVA 1X79A 4NIQA 5FXWA 3CX6B 3G06A 3FZHB 3T1YT 2CBJA 2EHOB 2LE8A 3PJAA 3HKDE 4MHCA 4GKKT 1EZ3A 5EK2A 5IUXA 2XAHB 2ACXA 4CXXA 4CN6A 4V1Av 4TWFA 3TLVA 1OEDE 2UU9T 3BQLA 4IGUA 5AQPB 3AA1B 1WYCA 2DI4A 1NEKA 2M67A 2XJ7A 1WFDA 3CK6A 3P4SA 5AQNB 2OLTA 3U78A 4DR5T 2IC9A 1FIOA 1QLBA 3E0ZA 3LK3B 5LHGB 4X65T 5EK3A 2V7LA 5HEOA 2B1EA 3LJCA 3AA0B 3OJAA 4WZXA 4QX8B 2L9QA 2X66A 4K0UA 4UV8B 3EUHA 4FJOA 2LOSA 4PFOA 5AQTB 2HHHT 2ZM6T 4HWIB 2LEHA 2PTFA 5F3JA 5FVKA 4BA9A 3C4ZA 3QOFA 2J1DG 4XZCA 1N33T 3ZYKA 3LBXA 2BZBA 3I0OA 2H88A 1VOMA 4GYSA 5L4HA 3QNUA 3CVRA 5JRCA 5FXVA 3H37A 2YDQA 4UVBB 2HN1A 3RQUA 3ABVA 4KHZF 2WU2A 3O1IA 1N36T 4CXWA 4I4TE 3ESLA 2LHRA 1D1CA 5FY0A 4U7YA 2WDQA 5JDLA 5LP6E 1QUUA 1J5ET 1W09A 2Q9QA 3FZFB 5CFBA 5HAXA 3ZC0A 1FMWA 2XAJB 2MTQA 3AE8A 2CXDA 4UV9B 3UT5E 2CWOA 3ZCIA 1U4QA 4P0BA 2KNDA 5C8YE 3UU8A 1UX5A 4H9PC 3WAJA 5AQGB 3D0TA 4X20E 5LBMA 2V8SV 4G2AA 5L47A 1E7PA 1Z8UA 5LXTE 3N9PA 3HKBE 3Q5XA 2LKGA 2V6YB 3FBLA 4GIWA 4MBQA 5ETWA 1LRZA 3ZCJA 5ABEA 3CIRA 5LNKA 4ILBA 3FB2A 2OV9A 3PUVF 4AIUA 2ODVA 2Q9QC 1T72A 3TLSA 2BVMA 2JQKA 4IL4A 3MA9A 3PUAA 3ZMTB 2QVAA 2I0MA 4O8SA 3AVRA 2LM9A 2UUBT 1Y64B 4DUZT 1OXZA 4B3RT 4MALA 3AAAB 5AQFB 3TLUA 2E2AA 2UXXB 2LOPA 4KMCA 2BBHA 5CJ5A 5JDHA 4KHPT 1HTJF 2NTXA 4ZZBA 2AE9A 1N34T 2E9XC 2BVLA 1E1HB 2X0YA 1HFAA 3JAFA 4PK6A 4TV9E 2CRBA 3V5SA 2FJBA 5M4YA 4DV3T 4B6XA 3NZPA 5E0OA 5LG3A 1SE7A 1IBKT 2DNXA 3LSVA 4UF0A 2JQ9A 2W2UA 3J7Yq 4U33A 3ZN0B 2XHEB 2WZHA 2ZLYA 4WNKA 3Q9DA 3ZMVB 1HR0T 2WDVA 4HFEA 5HXRA 3Q2MA 3RKGA 2W0GA 2WS3A 3FBZA 4NPPA 4QXBB 5FL0A 4L0RA 3DP7A 5JR9A 4WBNE 5LMNT 2VB6A 3NVOA 2VL8A 4TZ4C 4PK5A 2BG9E 2C5IT 1HG2A 1IZNB 3CX8B 3NWIA 1IJ6A 4COFA 4B3TT 3N2OA 1WR0A 1OWAA 4AQGA 4DBQA 1OEDB 3AE2A 2BG9B 2LSJA 5JH7E 4HFIA 4I0UA 4UEMA 2LT3A 3F57A 4YHHT 2BS2A 1HX8A 4CI3B 4I55E 5ABFA 2E9XB 2XAQB 2VKJA 4IDOA 3NRYA 4OYJA 4DV1T 4DR3T 4EEDA 4L5GA 3CQCB 3OYXA 2X51A 3C4XA 2YDSA 4O4LE 4XAXB 3QUJA 1NENA 3AXJB 4YLHA 1L0VA 4LF9T 3W15B 4QWNB 3VKHA 2VASA 3A8YC 1HF8A 3O9XA 4UVCB 1V9DA 2H7VC 4HFVA 2CEAA 2CBIA 2FUPA 2SPCA 4IE5A 2KZ7B 4H63V 4KX6A 3H3MA 3RYHE 2D0UA 4YT0A 3CQGB 3P50A 2XAFB 2LRKA 3JCFA 4DMWA 3PU3A 5LOVE 5L4EA 3NZQA 5AQLB 4PJMA 4BAYB 2WMNA 5BMVE 1YQ4A 4GK5E 4GYRA 5FY1A 3SRZA 1Y01A 1J1JA 1G8XA 2V7KA 2Z6EA 5GONE 3PTRB 1XNQT 3X1DA 1KFYA 5CB4E 4L9IA 2M6BA 2MOZA 3AE7A 5HCJA 3HI2A 2V26A 3N9OA 1HCIA 3BQIA 2I59A 4ZS2A 2Y8DA 4ASKA 5FVLA 4YJ3E 3ZT6A 3RIAA 3Q5WA 4AKHA 4AI6A 3EDUA 2E9XD 3P4RA 1ZKEA 5J1GA 4AXPA 5L2LA 3HR0A 2H3RA 2H7OA 3AE3A 2UUCT 4HFDA 3AVSA 3L8RA 2X9XA 3NBXX 2N1GA 2DWGA 5HEUA 3AE5A 5LCYA 1BR4A 2YN6A 4AKIA 1JNZA 5IYZE 1G73A 1W0AA 3MKDA 1UCUA 4HWCA 2J47A 5JDFA 5JDQA 4PNIA 2W63A 2WWVA 3UUMA 2YEVC 3PE0A 2PJQA 2WCAA 3ZT7A 1NWMX 2BKPA 2CXLA 1XNRT 2YK0A 3FZLB 2CCQA 5LJMA 3P8CD 3ZJ2A 1YKHB 3T8OA 4K0KT 1ZHCA 2C0SA 3P7IA 4IE4A 3ZJ1A 4DIDB 4P0AA 5F8PA 4OK0A 3UU6A 4FI5A 1KK7A 2IHR1 4DO0A 4JI8T 2A2FX 2RP4A 3PUZF 2KMFA 3ZMSB 4O4JE 3I1AA 4TNVA 5AQVB 2M6IA 5JTGA 1UURA 4ZS3A 1YXRA 3TLWA 4ZZCA 2BG9A 4H9OC 4MFRA 3PU8A 2W66A 3B13A 1JNRA 2WQYA 3SS1A 3UQ4A 4JI3T 2CXFA 1VCSA 5LA6E 2CM0A 4G63A 4HFBA 1WCRA 2NTYA 3M3ZB 4DV5T 1N32T 3V5UA 2WAUA 5CA1E 5AQKB 3IF8B 3AA6B 2A3DA 5KXJA 1MMNA 2AXDS 3UUNA 3LDQB 4DUYT 1HG5A 2H89A 4IDNA 4JI1T 3GA8A 1WR6A 4EXTA 1MIVA 4WW0A 5JDMA 1HNZT 3RRWA 4M1PA 2FJEA 2ZM8A 1M7KA 4P1NA 5LGTB 4JI7T 4H9SE 4HE8A 3VU7H 4X66T 1CUNA 5ADXL 4EGWA 2MYSA 2Q9QD 4ZXLA 2DL1A 2KXPB 4KBMB 3OYZA 4H9QC 4LFBT 2UXDT 1YD8G 4U3CA 4ILAA 2FBWA 3L39A 5DABA 4AKLA 4A5XA 4ERRA 4ZHQE 4H9NC 1SHZC 2IMLA 2N9DA 2VWAA 3TKLB 3UUBA 4E7ZA 4IE6A 1SA0E 4PJJA 1WRDA 4YHJA 4AKGA 2EHOD 2XQ7A 1YW0A 3IA3A 4WYVA 5AQJB 1T98A 3RGLA 1J5WA 3C64A 3N9QA 4O2AE 4PFPA 4YSZA 4BJMA 5L3GB 2N2NA 2VVNA 3M65A 4A97A 4H9RC 1IBLT 2XM2A 2X0LB 3KV5A 1MIWA 5FL1A 4ADZA 4HWHA 4CI1B 3UU3A 5JQGE 3AECA 2A72A 2CMRA 5JREA 1XMOT 3VRAA 4X1IE 5L3BB 3EAMA 2MBGA 5FXZA 4HWDA 2B76A 2L8KA 3BQKA 2BDEA 4PJLA 4IIJE 5ABGA 1US7B 4A56A 3UUXB 3F31A 2K5BB 3KFWX 5DQVA 2WZIA 4CQIA 2XQAA 4ISSA 3KV4A 3KV6A 2E5VA 3EI0A 3O1JA 2YU1A 2LJLA 3AEDA 4YFSA 3J9X1 2NOXA 4JUYA 4MLKA 3B5MA 5HEHA 3WI3A 4ZI2D 4DR4T 4DR7T 3K8PC 2IC6A 3Q5DA 4PAGA 2W00A 4Q25A 4UIGA 3AEEA 2WM9A 2XQYA 3AE4A 4F8HA 5L3FB 3K3NA 5JRCB 1T7SA 2WMOA 2ZMAA 2KINB 3HL6A 3RYCE 3JADA 3PUSA 3VR9A 1MNDA 3LBXB 3CMLA 3FXEB 3AEGA 2XPKA 4EZ4A 2MPKA 2Y48B 4ILUA 3N9MA 3ONLC 4DVDA 5AQHB 1KNZA 1NAFA 4QX7B 5FKYA 5HYAA 1XMQT 1KNPA 3IEEA 4DV6T 3RC8A 3N9LA 1LVFA 3O4XE 2CHNA 4AQFA 1VRBA 2DCFA 2K3WA 2YKSA 3L09A 3LFMA 3O1HA 4JEHB 4JLEA 4LMJA 5DJQC 4X64T 5LB7B 1HX1B 4TNWA 2C5KT 2X67A 3WAKA 5C3JA 4CZZB 4IE7A 2F4VT 4EB6E 2LRLA 3FZKB 4TWHA 4JI0T 1ZEEA 3VKGA 3KBUA 3ONJA 4YTMA
chains in the Genus database with same CATH topology
5FYMA 3CKDA 3RYFE 5HXEA 3H3AA 2NW9A 2VKHA 2K24A 2ZM0A 4F6RC 2JJ9A 3QC9A 3N9NA 5LBQB 3SOLA 3KDSE 4I50E 2WSSV 1FMVA 2X9HA 1MMAA 2NW8A 2Q9QB 3UTKA 1H7CA 1WYBA 4O4HE 2E9XA 5FMNA 4HGAA 4BJNA 4OFZA 3BK9A 3C51A 2LSKA 2Y6XA 2VK9A 3GN5B 2NWBA 2IW5B 2RA1A 2QA7A 3AB3B 3KBTA 3R84B 4ZI2C 3GWHA 1YKEB 3C4WA 3KVAA 2OA5A 5FNVE 1BR1A 3K3OA 1IAPA 3KVBA 3PUQA 5JR9C 1MMGA 3ANWB 4KP3C 1D1AA 3A5XA 4UELA 2G0UA 3MK7C 4TN7B 4ZI7E 1O3XA 3RRCA 2EHOC 3B57A 2CLYB 4ZI3D 2E8IA 4NUUA 2JRKA 2XAGB 4PK4A 3RKOA 3CX7B 4EIWA 2V7MA 3LK42 3R6NA 1LKXA 2GK9A 3MACA 1MNEA 2PBIA 1AJ3A 2QGSA 3RH3A 1FEWA 4TV8E 2D2SA 2JMKA 5EK4A 2D0TA 4JEUB 3N2KE 2CLYC 3ZMZB 2P9BA 3CQXC 2K48A 4O4IE 1IJ5A 3IBPA 4EZHA 3F2EA 1MMDA 4EYUA 2EHOA 1ZV4X 3E22E 3JC6C 4ANJA 5CA0E 5LHIB 2D5UA 2CA5A 3PUGA 3MXZA 3KV9A 2CE7A 3RX6A 3DJBA 1MIYA 5L3EB 2C5JA 4KUMB 3HKCE 3N5LA 3ZEFB 3FHNA 2HH7A 3SWHA 3N2GE 1S35A 2PFVA 2WWUA 4IHJE 4PW8A 4Z8XA 2VKOA 3AA7B 3EVYA 3CPZA 3E08A 4DBRA 4H63H 2KLQA 4GOUA 3RPUA 2V7JA 3NRXA 5FY7A 1S94A 3EDVA 4X1YE 4UXNB 4CXYA 4AKRB 5JR9B 3AAIA 2XASB 4QKNA 1D0YA 2DWKA 2KT9A 1QSDA 3HKEE 2DLRA 2X9YA 5H6RB 3DTOA 2WBLA 2LSGA 4I43B 3CWZB 3MJXA 4N78D 4U74A 4XBFB 3IHRA 5A1LA 3PURA 2NP9A 4IE0A 4QHOA 2JPFA 5DQWA 3KINB 3LK2B 4IDZA 4PJNA 4TX5A 2DHRA 4DMVA 3ANWA 4ISTA 4EYYR 3LG7A 4EAHA 4OHFA 3C50A 2HPJA 4CI2B 4WBOA 1HS7A 3K3QC 3UULA 4HKAA 3ZN1B 3VHLA 5L3CB 3AAEB 3I0QA 3ONXA 1BR0A 3U3IA 5HWYA 4YJ2E 2K9AA 2CWYA 2NW7A 2LHNA 3I9YA 5JVDE 3ZPOA 3C98B 5FXXA 4HN9A 5KDMC 1UX4A 4C91A 3PDYA 2W61A 1D0XA 2YINA 4E7SA 3UFEA 4GK0E 5AFUL 3RYIE 3S4UA 3ZYLA 3FXDB 2ZM2A 4EOZB 2HPLA 5EZYE 2JMHA 2V1DB 3OKQA 1B7TA 3OBVE 2V7IA 2LSIA 3ZLIA 3ETUA 2X68A 1Z0PA 3MZKB 5LGNB 5J2TE 2KWHA 2X9WA 2VKDA 3L3PA 5KX5E 5LHHB 4X1KE 4J2CA 1U5PA 5IHYA 4C90A 3QK6A 5LJNA 2W62A 2L3LA 1BR2A 5H6QB 3ZMUB 5LG4A 2XUEA 4ZI3C 3ZYMA 3HA4A 2XTLA 4QXHB 4U72A 3JC6D 5LYJE 4P09A 5JDNA 3GN5A 4TUYE 2ODUA 4UF0B 4HTEA 3I9WA 2IAKA 5HXCA 1WLXA 2JQQA 2UXNB 2ES0A 4OYKA 4O2BE 5KMGP 5LGUB 2YU2A 5J2UE 4UVAB 1D0ZA 5HXSA 1LVKA 2LSYA 2PG8A 5HWXA 3RC3A 3GMIA 4ZOLE 3ZC1A 2KWIB 4HEAA 5TAOA 4AQFC 1D1BA 5HXHA 3ETVA 5FP3A 4NUVA 1X79A 5FXWA 3CX6B 2EHOB 2LE8A 3HKDE 4MHCA 1EZ3A 5EK2A 2XAHB 2ACXA 4CXXA 4V1Av 3BQLA 4IGUA 3AA1B 1WYCA 2DI4A 2M67A 3U78A 2IC9A 1FIOA 3E0ZA 5LHGB 3LK3B 5EK3A 2V7LA 2B1EA 3LJCA 3AA0B 3OJAA 4DNDA 4QX8B 2L9QA 2X66A 4K0UA 4UV8B 3EUHA 4FJOA 2LOSA 4PFOA 2LEHA 5F3JA 4BA9A 3C4ZA 2J1DG 4XZCA 3ZYKA 3LBXA 2BZBA 3I0OA 1VOMA 4GYSA 3CVRA 5JRCA 5FXVA 3H37A 4UVBB 3O1IA 4CXWA 4I4TE 3ESLA 2LHRA 1D1CA 5FY0A 5JDLA 5LP6E 1QUUA 3ZC0A 2Q9QA 5HAXA 1FMWA 2XAJB 2MTQA 4UV9B 2CXDA 3UT5E 2CWOA 3ZCIA 1U4QA 4P0BA 2KNDA 5C8YE 1UX5A 4H9PC 3WAJA 3D0TA 4X20E 5LBMA 4G2AA 5LXTE 3N9PA 3HKBE 3Q5XA 3FBLA 4GIWA 5ETWA 1LRZA 3ZCJA 5LNKA 3FB2A 2ODVA 2Q9QC 2BVMA 3MA9A 3PUAA 3ZMTB 4O8SA 3AVRA 2LM9A 1Y64B 1OXZA 4MALA 3AAAB 2UXXB 2LOPA 4KMCA 5JDHA 1HTJF 2NTXA 2E9XC 2BVLA 1E1HB 3V5SA 1HFAA 4PK6A 4TV9E 5LGTB 5M4YA 4B6XA 3NZPA 5E0OA 2DNXA 4UF0A 3J7Yq 3ZN0B 2XHEB 2ZLYA 4WNKA 3Q9DA 3ZMVB 5HXRA 3Q2MA 2W0GA 3FBZA 4QXBB 5JR9A 4L0RA 3DP7A 4WBNE 2VB6A 2VL8A 4TZ4C 4PK5A 2C5IT 1HG2A 1IZNB 3CX8B 1IJ6A 3N2OA 1OWAA 4AQGA 4DBQA 5JH7E 2LSJA 4UEMA 2LT3A 3F57A 1HX8A 4CI3B 4I55E 2E9XB 2XAQB 2VKJA 4OYJA 3NRYA 4L5GA 3CQCB 3OYXA 2X51A 3C4XA 4O4LE 4XAXB 3QUJA 4YLHA 3W15B 4QWNB 3VKHA 2VASA 1HF8A 3O9XA 4UVCB 1V9DA 2H7VC 4HFVA 2CEAA 4QXCB 2SPCA 4IE5A 3RYHE 2KZ7B 4H63V 2D0UA 3CQGB 2XAFB 4DMWA 3PU3A 5LOVE 3NZQA 4BAYB 4PJMA 2WMNA 5BMVE 4GK5E 4GYRA 5FY1A 3SRZA 1G8XA 2V7KA 2Z6EA 5GONE 3PTRB 5CB4E 4L9IA 2MOZA 3HI2A 2V26A 3N9OA 1HCIA 3BQIA 2I59A 4ZS2A 2Y8DA 4ASKA 4YJ3E 3Q5WA 4AKHA 4AI6A 3EDUA 2E9XD 4AXPA 1ZKEA 5J1GA 5L2LA 3HR0A 2H3RA 2H7OA 3AVSA 2X9XA 3NBXX 2N1GA 2DWGA 5LCYA 1BR4A 4AKIA 5IYZE 1G73A 3MKDA 1UCUA 5JDFA 5JDQA 4PNIA 2W63A 3UUMA 2YEVC 3PE0A 2PJQA 1NWMX 2CXLA 2YK0A 2CCQA 5LJMA 3P8CD 3ZJ2A 1YKHB 3T8OA 1ZHCA 2C0SA 3P7IA 4IE4A 3ZJ1A 4P0AA 5F8PA 4OK0A 4FI5A 1KK7A 4DO0A 2A2FX 2RP4A 2KMFA 3ZMSB 4O4JE 3I1AA 4ZS3A 4H9OC 4MFRA 3PU8A 3B13A 3SS1A 2CXFA 5LA6E 2CM0A 4G63A 2NTYA 3V5UA 2WAUA 5CA1E 3IF8B 3AA6B 2A3DA 1MMNA 3UUNA 1HG5A 3GA8A 1WR6A 4EXTA 1MIVA 4WW0A 5JDMA 3RRWA 4M1PA 2ZM8A 4H9SE 4HE8A 3VU7H 1CUNA 5ADXL 2MYSA 2Q9QD 2KXPB 4KBMB 3OYZA 4H9QC 1YD8G 5L3DB 4AKLA 5DABA 4ERRA 4ZHQE 4H9NC 1SHZC 2N9DA 2VWAA 3TKLB 4E7ZA 4IE6A 1SA0E 4PJJA 1WRDA 4YHJA 4AKGA 2EHOD 1YW0A 1T98A 5L3GB 3N9QA 3C64A 4PFPA 4O2AE 4BJMA 2N2NA 3M65A 4H9RC 2X0LB 3KV5A 1MIWA 4ADZA 4CI1B 5JQGE 2A72A 2CMRA 5JREA 4X1IE 5L3BB 2MBGA 5FXZA 3BQKA 2L8KA 2BDEA 4PJLA 4IIJE 4A56A 1US7B 5JDGA 3UUXB 3F31A 2K5BB 3KFWX 5DQVA 4CQIA 4ISSA 3KV4A 3KV6A 3O1JA 2YU1A 2LJLA 4YFSA 3J9X1 2NOXA 4JUYA 4MLKA 3WI3A 4ZI2D 3K8PC 2IC6A 4UIGA 4PAGA 2W00A 2WM9A 2XQYA 5L3FB 3K3NA 5JRCB 2ZMAA 2WMOA 2KINB 3HL6A 3RYCE 3PUSA 1MNDA 3LBXB 3CMLA 3FXEB 4EZ4A 4ILUA 2Y48B 3N9MA 4DVDA 1KNZA 1NAFA 4QX7B 5HYAA 3IEEA 3RC8A 3N9LA 1LVFA 3O4XE 4AQFA 1VRBA 2DCFA 3L09A 3LFMA 3O1HA 4JEHB 4JLEA 5DJQC 2C5KT 2X67A 3WAKA 4CZZB 4IE7A 4EB6E 1ZEEA 3VKGA 3KBUA 4MBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHC A; 
#chains in the Genus database with same CATH topology
 2V5C A;  5FYM A;  2I6H A;  3CKD A;  3RYF E;  2VVS A;  5HXE A;  2WU5 A;  3OPC A;  4HFH A;  5AQM B;  5L3D B;  2LKH A;  3H3A A;  2NW9 A;  3A7M A;  2VKH A;  2MAW A;  2K24 A;  2ZM0 A;  5F5W A;  2JJ9 A;  4F6R C;  5ABF B;  3QC9 A;  4AQY T;  4DV7 T;  2WB5 A;  3N9N A;  5AQO B;  5LBQ B;  3SOL A;  3PJA J;  2UXC T;  3KDS E;  4YY3 T;  4I50 E;  1UGO A;  2WSS V;  4DV0 T;  1FMV A;  2X9H A;  4LMK A;  1MMA A;  4EV6 A;  2NW8 A;  2Q9Q B;  1KF6 A;  2VUR A;  2WY2 A;  3UTK A;  4YXD A;  1H7C A;  4NXM T;  3FZM B;  3UU5 A;  4DR6 T;  3VRB A;  1WYB A;  4O4H E;  2E9X A;  5FMN A;  4HGA A;  5AQS B;  4BJN A;  5AQQ B;  4OFZ A;  3AE9 A;  3BK9 A;  2IDO B;  4LF5 T;  2X0H A;  4QH4 A;  3C51 A;  2LSK A;  2Y6X A;  2VK9 A;  3GN5 B;  2NWB A;  2IW5 B;  2RA1 A;  2QA7 A;  3OTO T;  2BBJ A;  1I94 T;  2UXB T;  1ZOY A;  2V6X A;  3AB3 B;  3KBT A;  2ACZ A;  3R84 B;  4ZI2 C;  3GWH A;  2RPA A;  1YKE B;  4DR2 T;  3C4W A;  3KVA A;  2OA5 A;  5FNV E;  1BR1 A;  2VL0 A;  1IAP A;  3K3O A;  2IIU A;  3KVB A;  3PUQ A;  4EEB A;  5JR9 C;  1MMG A;  3P4Q A;  1HNW T;  3ANW B;  4KP3 C;  1D1A A;  3A5X A;  4QXC B;  4UEL A;  2G0U A;  3MK7 C;  4TN7 B;  4Z91 A;  3AE1 A;  4ZEY A;  4ZI7 E;  4DV2 T;  1O3X A;  3RRC A;  4LFC T;  2EHO C;  3B57 A;  1KNR A;  2KSR A;  3AEF A;  2CLY B;  2FJA A;  2E8I A;  4NUU A;  4JI5 T;  4ZI3 D;  2JRK A;  5HEJ A;  2VQE T;  2XSA A;  2XAG B;  4PK4 A;  4JYA T;  2YOE A;  3RKO A;  1R8I A;  4DR1 T;  5AQI B;  3CX7 B;  4EIW A;  2V7M A;  3ZSS A;  4DV4 T;  3PUY F;  3RIF A;  3LK4 2;  3R6N A;  1LKX A;  2GK9 A;  3MAC A;  2LM2 A;  1MNE A;  2PBI A;  1AJ3 A;  2QGS A;  3TLT A;  3RH3 A;  1FEW A;  1SUM B;  4QH1 A;  4TV8 E;  3UFG A;  3UQ7 A;  2QRX A;  2D2S A;  2JMK A;  4KI0 F;  2D0T A;  5EK4 A;  4JEU B;  3N2K E;  4B3M T;  2CLY C;  3ZMZ B;  2P9B A;  3CQX C;  2K48 A;  3P4W A;  3PUX F;  5C2T A;  3AEA A;  4O4I E;  1IJ5 A;  3IBP A;  4EZH A;  1KEY A;  2BS4 A;  3F2E A;  1MMD A;  4EYU A;  2EHO A;  1ZV4 X;  2XM1 A;  3E22 E;  3JC6 C;  4QH5 A;  4ANJ A;  5CA0 E;  5LHI B;  2D5U A;  2CA5 A;  3QB5 A;  1E2A A;  2WDR A;  2XQ3 A;  3RHW A;  4IDP A;  2YDR A;  3ZKR A;  3PUG A;  3MXZ A;  3KV9 A;  2CE7 A;  3RX6 A;  3SFD A;  3VR8 A;  3DJB A;  1MIY A;  3ZT5 A;  5L3E B;  4DND A;  2C5J A;  4IRE A;  4KUM B;  3HKC E;  4JV5 T;  3N5L A;  3ZEF B;  3FHN A;  4OX9 T;  2D9D A;  2HH7 A;  3RIU A;  5CGM A;  4B3S T;  3PV0 F;  4HWF A;  3SWH A;  3N2G E;  1S35 A;  2PFV A;  2WWU A;  4IHJ E;  4PW8 A;  4Z8X A;  3T1H T;  1CHU A;  2JIW A;  2E5L T;  2VKO A;  3AA7 B;  3EVY A;  3CPZ A;  2BG9 C;  1X9B A;  3E08 A;  4DBR A;  2BKN A;  3P4P A;  1HNX T;  2XQ6 A;  4H63 H;  2KLQ A;  4GOU A;  3RPU A;  2V7J A;  4YTP A;  3NKZ A;  3PUW F;  1OED C;  5AQR B;  3NRX A;  5FY7 A;  1S94 A;  3EDV A;  4X1Y E;  4UXN B;  4CXY A;  4AKR B;  5JR9 B;  3AAI A;  2XAS B;  4JI4 T;  4QKN A;  2IUB A;  1D0Y A;  2DWK A;  2KT9 A;  2XZE A;  3RIU C;  3UU4 A;  4A98 A;  1QSD A;  2V6Y A;  3HKE E;  2J62 A;  2DLR A;  2X9Y A;  5AQU B;  2XQ8 A;  5H6R B;  4LML A;  3DTO A;  2WBL A;  1GQE A;  2LSG A;  4I43 B;  3CWZ B;  5ABH A;  1YQ3 A;  3MJX A;  4N78 D;  1XDO A;  4U74 A;  4XBF B;  3IHR A;  5A1L A;  3PUR A;  2NP9 A;  3EAB A;  4IE0 A;  4QHO A;  3SFE A;  2JPF A;  5DQW A;  3KIN B;  3LK2 B;  4IDZ A;  4PJN A;  5HEG A;  4TX5 A;  2DHR A;  4X62 T;  2XY8 B;  3JAE A;  3AE6 A;  3ANW A;  4IL9 A;  4IST A;  4DMV A;  3LG7 A;  4EYY R;  4U2Z A;  4OHF A;  2NR4 A;  3C50 A;  2HPJ A;  3RQW A;  4CI2 B;  4WBO A;  4EAH A;  4YTN A;  1HS7 A;  3K3Q C;  2V5D A;  4HKA A;  2XQ5 A;  3UUL A;  3ZN1 B;  3VHL A;  5L3C B;  3AAE B;  3AEB A;  4JBW F;  1FJG T;  4U31 A;  3I0Q A;  3ONX A;  2HN2 A;  3QB5 K;  4IT4 A;  1BR0 A;  3U3I A;  3RLF F;  5HWY A;  4JI2 T;  4YJ2 E;  2K9A A;  5JDG A;  2CWY A;  2NW7 A;  2LHN A;  3I9Y A;  5JVD E;  3ZPO A;  3C98 B;  5FXX A;  1T8B A;  4HN9 A;  5LMU T;  5KDM C;  4JI6 T;  1UX4 A;  4C91 A;  3PDY A;  2W61 A;  4LFA T;  1D0X A;  2YIN A;  4E7S A;  2JQH A;  3UFE A;  4NXN T;  4GK0 E;  5AFU L;  3RYI E;  3S4U A;  3ZYL A;  3FXD B;  4ILC A;  2ZM2 A;  4IDQ A;  4EOZ B;  2HPL A;  5EZY E;  2JMH A;  4HFC A;  2V1D B;  3OKQ A;  4LF8 T;  1B7T A;  3OBV E;  2V7I A;  2LSI A;  3ZLI A;  3ETU A;  4U7I A;  2X68 A;  3AXJ A;  1Z0P A;  3MZK B;  2CHO A;  2XQ4 A;  2LLY A;  4X5T A;  4CN4 A;  1W9R A;  5LGN B;  1DU2 A;  5J2T E;  4UR9 A;  2J4G A;  2KWH A;  4LF7 T;  2W67 A;  2X9W A;  2VKD A;  3L3P A;  4YSX A;  5KX5 E;  5LHH B;  4X1K E;  4J2C A;  1OED A;  1W0B A;  1U5P A;  5J0Z A;  5IHY A;  4C90 A;  3K1S A;  3QK6 A;  5LJN A;  2BKO A;  2W62 A;  2L3L A;  1BR2 A;  5H6Q B;  3ZMU B;  4CN1 A;  5LG4 A;  5BR8 T;  4YSY A;  3ZST A;  2XUE A;  4ZI3 C;  3ZYM A;  3HA4 A;  2VQF T;  2XTL A;  2XSB A;  4QXH B;  4U72 A;  3JC6 D;  1XDP A;  4AIS A;  3RF1 A;  3Q5E A;  5LYJ E;  1IBM T;  4P09 A;  5JDN A;  1I6Z A;  3GN5 A;  4TUY E;  2ODU A;  4GKJ T;  3OVU A;  3EHZ A;  4UF0 B;  4HTE A;  3RI5 A;  2XQ9 A;  3I9W A;  2IAK A;  5HXC A;  1WLX A;  2JQQ A;  1XZY A;  2UXN B;  2ES0 A;  4OYK A;  1UK5 A;  4O2B E;  5IWA T;  2BS3 A;  5KMG P;  2A9U A;  5LGU B;  1ZP0 A;  4Z90 A;  2YU2 A;  2QYW A;  5J2U E;  4UVA B;  2R6G F;  5HCM A;  1D0Z A;  1VCT A;  1LVK A;  5HXS A;  2LSY A;  2PG8 A;  1M62 A;  2CPT A;  3RC3 A;  3GMI A;  4ZOL E;  2FJD A;  3ZC1 A;  5HWX A;  1UUS A;  2WP9 A;  2KWI B;  4HEA A;  5TAO A;  4AQF C;  1D1B A;  2W4X A;  5HXH A;  2UUA T;  3ETV A;  1XWM A;  4TWD A;  4LF4 T;  5FP3 A;  4U2Y A;  4LF6 T;  4NUV A;  1X79 A;  4NIQ A;  5FXW A;  3CX6 B;  3G06 A;  3FZH B;  3T1Y T;  2CBJ A;  2EHO B;  2LE8 A;  3PJA A;  3HKD E;  4MHC A;  4GKK T;  1EZ3 A;  5EK2 A;  5IUX A;  2XAH B;  2ACX A;  4CXX A;  4CN6 A;  4V1A v;  4TWF A;  3TLV A;  1OED E;  2UU9 T;  3BQL A;  4IGU A;  5AQP B;  3AA1 B;  1WYC A;  2DI4 A;  1NEK A;  2M67 A;  2XJ7 A;  1WFD A;  3CK6 A;  3P4S A;  5AQN B;  2OLT A;  3U78 A;  4DR5 T;  2IC9 A;  1FIO A;  1QLB A;  3E0Z A;  3LK3 B;  5LHG B;  4X65 T;  5EK3 A;  2V7L A;  5HEO A;  2B1E A;  3LJC A;  3AA0 B;  3OJA A;  4WZX A;  4QX8 B;  2L9Q A;  2X66 A;  4K0U A;  4UV8 B;  3EUH A;  4FJO A;  2LOS A;  4PFO A;  5AQT B;  2HHH T;  2ZM6 T;  4HWI B;  2LEH A;  2PTF A;  5F3J A;  5FVK A;  4BA9 A;  3C4Z A;  3QOF A;  2J1D G;  4XZC A;  1N33 T;  3ZYK A;  3LBX A;  2BZB A;  3I0O A;  2H88 A;  1VOM A;  4GYS A;  5L4H A;  3QNU A;  3CVR A;  5JRC A;  5FXV A;  3H37 A;  2YDQ A;  4UVB B;  2HN1 A;  3RQU A;  3ABV A;  4KHZ F;  2WU2 A;  3O1I A;  1N36 T;  4CXW A;  4I4T E;  3ESL A;  2LHR A;  1D1C A;  5FY0 A;  4U7Y A;  2WDQ A;  5JDL A;  5LP6 E;  1QUU A;  1J5E T;  1W09 A;  2Q9Q A;  3FZF B;  5CFB A;  5HAX A;  3ZC0 A;  1FMW A;  2XAJ B;  2MTQ A;  3AE8 A;  2CXD A;  4UV9 B;  3UT5 E;  2CWO A;  3ZCI A;  1U4Q A;  4P0B A;  2KND A;  5C8Y E;  3UU8 A;  1UX5 A;  4H9P C;  3WAJ A;  5AQG B;  3D0T A;  4X20 E;  5LBM A;  2V8S V;  4G2A A;  5L47 A;  1E7P A;  1Z8U A;  5LXT E;  3N9P A;  3HKB E;  3Q5X A;  2LKG A;  2V6Y B;  3FBL A;  4GIW A;  4MBQ A;  5ETW A;  1LRZ A;  3ZCJ A;  5ABE A;  3CIR A;  5LNK A;  4ILB A;  3FB2 A;  2OV9 A;  3PUV F;  4AIU A;  2ODV A;  2Q9Q C;  1T72 A;  3TLS A;  2BVM A;  2JQK A;  4IL4 A;  3MA9 A;  3PUA A;  3ZMT B;  2QVA A;  2I0M A;  4O8S A;  3AVR A;  2LM9 A;  2UUB T;  1Y64 B;  4DUZ T;  1OXZ A;  4B3R T;  4MAL A;  3AAA B;  5AQF B;  3TLU A;  2E2A A;  2UXX B;  2LOP A;  4KMC A;  2BBH A;  5CJ5 A;  5JDH A;  4KHP T;  1HTJ F;  2NTX A;  4ZZB A;  2AE9 A;  1N34 T;  2E9X C;  2BVL A;  1E1H B;  2X0Y A;  1HFA A;  3JAF A;  4PK6 A;  4TV9 E;  2CRB A;  3V5S A;  2FJB A;  5M4Y A;  4DV3 T;  4B6X A;  3NZP A;  5E0O A;  5LG3 A;  1SE7 A;  1IBK T;  2DNX A;  3LSV A;  4UF0 A;  2JQ9 A;  2W2U A;  3J7Y q;  4U33 A;  3ZN0 B;  2XHE B;  2WZH A;  2ZLY A;  4WNK A;  3Q9D A;  3ZMV B;  1HR0 T;  2WDV A;  4HFE A;  5HXR A;  3Q2M A;  3RKG A;  2W0G A;  2WS3 A;  3FBZ A;  4NPP A;  4QXB B;  5FL0 A;  4L0R A;  3DP7 A;  5JR9 A;  4WBN E;  5LMN T;  2VB6 A;  3NVO A;  2VL8 A;  4TZ4 C;  4PK5 A;  2BG9 E;  2C5I T;  1HG2 A;  1IZN B;  3CX8 B;  3NWI A;  1IJ6 A;  4COF A;  4B3T T;  3N2O A;  1WR0 A;  1OWA A;  4AQG A;  4DBQ A;  1OED B;  3AE2 A;  2BG9 B;  2LSJ A;  5JH7 E;  4HFI A;  4I0U A;  4UEM A;  2LT3 A;  3F57 A;  4YHH T;  2BS2 A;  1HX8 A;  4CI3 B;  4I55 E;  5ABF A;  2E9X B;  2XAQ B;  2VKJ A;  4IDO A;  3NRY A;  4OYJ A;  4DV1 T;  4DR3 T;  4EED A;  4L5G A;  3CQC B;  3OYX A;  2X51 A;  3C4X A;  2YDS A;  4O4L E;  4XAX B;  3QUJ A;  1NEN A;  3AXJ B;  4YLH A;  1L0V A;  4LF9 T;  3W15 B;  4QWN B;  3VKH A;  2VAS A;  3A8Y C;  1HF8 A;  3O9X A;  4UVC B;  1V9D A;  2H7V C;  4HFV A;  2CEA A;  2CBI A;  2FUP A;  2SPC A;  4IE5 A;  2KZ7 B;  4H63 V;  4KX6 A;  3H3M A;  3RYH E;  2D0U A;  4YT0 A;  3CQG B;  3P50 A;  2XAF B;  2LRK A;  3JCF A;  4DMW A;  3PU3 A;  5LOV E;  5L4E A;  3NZQ A;  5AQL B;  4PJM A;  4BAY B;  2WMN A;  5BMV E;  1YQ4 A;  4GK5 E;  4GYR A;  5FY1 A;  3SRZ A;  1Y01 A;  1J1J A;  1G8X A;  2V7K A;  2Z6E A;  5GON E;  3PTR B;  1XNQ T;  3X1D A;  1KFY A;  5CB4 E;  4L9I A;  2M6B A;  2MOZ A;  3AE7 A;  5HCJ A;  3HI2 A;  2V26 A;  3N9O A;  1HCI A;  3BQI A;  2I59 A;  4ZS2 A;  2Y8D A;  4ASK A;  5FVL A;  4YJ3 E;  3ZT6 A;  3RIA A;  3Q5W A;  4AKH A;  4AI6 A;  3EDU A;  2E9X D;  3P4R A;  1ZKE A;  5J1G A;  4AXP A;  5L2L A;  3HR0 A;  2H3R A;  2H7O A;  3AE3 A;  2UUC T;  4HFD A;  3AVS A;  3L8R A;  2X9X A;  3NBX X;  2N1G A;  2DWG A;  5HEU A;  3AE5 A;  5LCY A;  1BR4 A;  2YN6 A;  4AKI A;  1JNZ A;  5IYZ E;  1G73 A;  1W0A A;  3MKD A;  1UCU A;  4HWC A;  2J47 A;  5JDF A;  5JDQ A;  4PNI A;  2W63 A;  2WWV A;  3UUM A;  2YEV C;  3PE0 A;  2PJQ A;  2WCA A;  3ZT7 A;  1NWM X;  2BKP A;  2CXL A;  1XNR T;  2YK0 A;  3FZL B;  2CCQ A;  5LJM A;  3P8C D;  3ZJ2 A;  1YKH B;  3T8O A;  4K0K T;  1ZHC A;  2C0S A;  3P7I A;  4IE4 A;  3ZJ1 A;  4DID B;  4P0A A;  5F8P A;  4OK0 A;  3UU6 A;  4FI5 A;  1KK7 A;  2IHR 1;  4DO0 A;  4JI8 T;  2A2F X;  2RP4 A;  3PUZ F;  2KMF A;  3ZMS B;  4O4J E;  3I1A A;  4TNV A;  5AQV B;  2M6I A;  5JTG A;  1UUR A;  4ZS3 A;  1YXR A;  3TLW A;  4ZZC A;  2BG9 A;  4H9O C;  4MFR A;  3PU8 A;  2W66 A;  3B13 A;  1JNR A;  2WQY A;  3SS1 A;  3UQ4 A;  4JI3 T;  2CXF A;  1VCS A;  5LA6 E;  2CM0 A;  4G63 A;  4HFB A;  1WCR A;  2NTY A;  3M3Z B;  4DV5 T;  1N32 T;  3V5U A;  2WAU A;  5CA1 E;  5AQK B;  3IF8 B;  3AA6 B;  2A3D A;  5KXJ A;  1MMN A;  2AXD S;  3UUN A;  3LDQ B;  4DUY T;  1HG5 A;  2H89 A;  4IDN A;  4JI1 T;  3GA8 A;  1WR6 A;  4EXT A;  1MIV A;  4WW0 A;  5JDM A;  1HNZ T;  3RRW A;  4M1P A;  2FJE A;  2ZM8 A;  1M7K A;  4P1N A;  5LGT B;  4JI7 T;  4H9S E;  4HE8 A;  3VU7 H;  4X66 T;  1CUN A;  5ADX L;  4EGW A;  2MYS A;  2Q9Q D;  4ZXL A;  2DL1 A;  2KXP B;  4KBM B;  3OYZ A;  4H9Q C;  4LFB T;  2UXD T;  1YD8 G;  4U3C A;  4ILA A;  2FBW A;  3L39 A;  5DAB A;  4AKL A;  4A5X A;  4ERR A;  4ZHQ E;  4H9N C;  1SHZ C;  2IML A;  2N9D A;  2VWA A;  3TKL B;  3UUB A;  4E7Z A;  4IE6 A;  1SA0 E;  4PJJ A;  1WRD A;  4YHJ A;  4AKG A;  2EHO D;  2XQ7 A;  1YW0 A;  3IA3 A;  4WYV A;  5AQJ B;  1T98 A;  3RGL A;  1J5W A;  3C64 A;  3N9Q A;  4O2A E;  4PFP A;  4YSZ A;  4BJM A;  5L3G B;  2N2N A;  2VVN A;  3M65 A;  4A97 A;  4H9R C;  1IBL T;  2XM2 A;  2X0L B;  3KV5 A;  1MIW A;  5FL1 A;  4ADZ A;  4HWH A;  4CI1 B;  3UU3 A;  5JQG E;  3AEC A;  2A72 A;  2CMR A;  5JRE A;  1XMO T;  3VRA A;  4X1I E;  5L3B B;  3EAM A;  2MBG A;  5FXZ A;  4HWD A;  2B76 A;  2L8K A;  3BQK A;  2BDE A;  4PJL A;  4IIJ E;  5ABG A;  1US7 B;  4A56 A;  3UUX B;  3F31 A;  2K5B B;  3KFW X;  5DQV A;  2WZI A;  4CQI A;  2XQA A;  4ISS A;  3KV4 A;  3KV6 A;  2E5V A;  3EI0 A;  3O1J A;  2YU1 A;  2LJL A;  3AED A;  4YFS A;  3J9X 1;  2NOX A;  4JUY A;  4MLK A;  3B5M A;  5HEH A;  3WI3 A;  4ZI2 D;  4DR4 T;  4DR7 T;  3K8P C;  2IC6 A;  3Q5D A;  4PAG A;  2W00 A;  4Q25 A;  4UIG A;  3AEE A;  2WM9 A;  2XQY A;  3AE4 A;  4F8H A;  5L3F B;  3K3N A;  5JRC B;  1T7S A;  2WMO A;  2ZMA A;  2KIN B;  3HL6 A;  3RYC E;  3JAD A;  3PUS A;  3VR9 A;  1MND A;  3LBX B;  3CML A;  3FXE B;  3AEG A;  2XPK A;  4EZ4 A;  2MPK A;  2Y48 B;  4ILU A;  3N9M A;  3ONL C;  4DVD A;  5AQH B;  1KNZ A;  1NAF A;  4QX7 B;  5FKY A;  5HYA A;  1XMQ T;  1KNP A;  3IEE A;  4DV6 T;  3RC8 A;  3N9L A;  1LVF A;  3O4X E;  2CHN A;  4AQF A;  1VRB A;  2DCF A;  2K3W A;  2YKS A;  3L09 A;  3LFM A;  3O1H A;  4JEH B;  4JLE A;  4LMJ A;  5DJQ C;  4X64 T;  5LB7 B;  1HX1 B;  4TNW A;  2C5K T;  2X67 A;  3WAK A;  5C3J A;  4CZZ B;  4IE7 A;  2F4V T;  4EB6 E;  2LRL A;  3FZK B;  4TWH A;  4JI0 T;  1ZEE A;  3VKG A;  3KBU A;  3ONJ A;  4YTM A; 
#chains in the Genus database with same CATH homology
 5FYM A;  3CKD A;  3RYF E;  5HXE A;  3H3A A;  2NW9 A;  2VKH A;  2K24 A;  2ZM0 A;  4F6R C;  2JJ9 A;  3QC9 A;  3N9N A;  5LBQ B;  3SOL A;  3KDS E;  4I50 E;  2WSS V;  1FMV A;  2X9H A;  1MMA A;  2NW8 A;  2Q9Q B;  3UTK A;  1H7C A;  1WYB A;  4O4H E;  2E9X A;  5FMN A;  4HGA A;  4BJN A;  4OFZ A;  3BK9 A;  3C51 A;  2LSK A;  2Y6X A;  2VK9 A;  3GN5 B;  2NWB A;  2IW5 B;  2RA1 A;  2QA7 A;  3AB3 B;  3KBT A;  3R84 B;  4ZI2 C;  3GWH A;  1YKE B;  3C4W A;  3KVA A;  2OA5 A;  5FNV E;  1BR1 A;  3K3O A;  1IAP A;  3KVB A;  3PUQ A;  5JR9 C;  1MMG A;  3ANW B;  4KP3 C;  1D1A A;  3A5X A;  4UEL A;  2G0U A;  3MK7 C;  4TN7 B;  4ZI7 E;  1O3X A;  3RRC A;  2EHO C;  3B57 A;  2CLY B;  4ZI3 D;  2E8I A;  4NUU A;  2JRK A;  2XAG B;  4PK4 A;  3RKO A;  3CX7 B;  4EIW A;  2V7M A;  3LK4 2;  3R6N A;  1LKX A;  2GK9 A;  3MAC A;  1MNE A;  2PBI A;  1AJ3 A;  2QGS A;  3RH3 A;  1FEW A;  4TV8 E;  2D2S A;  2JMK A;  5EK4 A;  2D0T A;  4JEU B;  3N2K E;  2CLY C;  3ZMZ B;  2P9B A;  3CQX C;  2K48 A;  4O4I E;  1IJ5 A;  3IBP A;  4EZH A;  3F2E A;  1MMD A;  4EYU A;  2EHO A;  1ZV4 X;  3E22 E;  3JC6 C;  4ANJ A;  5CA0 E;  5LHI B;  2D5U A;  2CA5 A;  3PUG A;  3MXZ A;  3KV9 A;  2CE7 A;  3RX6 A;  3DJB A;  1MIY A;  5L3E B;  2C5J A;  4KUM B;  3HKC E;  3N5L A;  3ZEF B;  3FHN A;  2HH7 A;  3SWH A;  3N2G E;  1S35 A;  2PFV A;  2WWU A;  4IHJ E;  4PW8 A;  4Z8X A;  2VKO A;  3AA7 B;  3EVY A;  3CPZ A;  3E08 A;  4DBR A;  4H63 H;  2KLQ A;  4GOU A;  3RPU A;  2V7J A;  3NRX A;  5FY7 A;  1S94 A;  3EDV A;  4X1Y E;  4UXN B;  4CXY A;  4AKR B;  5JR9 B;  3AAI A;  2XAS B;  4QKN A;  1D0Y A;  2DWK A;  2KT9 A;  1QSD A;  3HKE E;  2DLR A;  2X9Y A;  5H6R B;  3DTO A;  2WBL A;  2LSG A;  4I43 B;  3CWZ B;  3MJX A;  4N78 D;  4U74 A;  4XBF B;  3IHR A;  5A1L A;  3PUR A;  2NP9 A;  4IE0 A;  4QHO A;  2JPF A;  5DQW A;  3KIN B;  3LK2 B;  4IDZ A;  4PJN A;  4TX5 A;  2DHR A;  4DMV A;  3ANW A;  4IST A;  4EYY R;  3LG7 A;  4EAH A;  4OHF A;  3C50 A;  2HPJ A;  4CI2 B;  4WBO A;  1HS7 A;  3K3Q C;  3UUL A;  4HKA A;  3ZN1 B;  3VHL A;  5L3C B;  3AAE B;  3I0Q A;  3ONX A;  1BR0 A;  3U3I A;  5HWY A;  4YJ2 E;  2K9A A;  2CWY A;  2NW7 A;  2LHN A;  3I9Y A;  5JVD E;  3ZPO A;  3C98 B;  5FXX A;  4HN9 A;  5KDM C;  1UX4 A;  4C91 A;  3PDY A;  2W61 A;  1D0X A;  2YIN A;  4E7S A;  3UFE A;  4GK0 E;  5AFU L;  3RYI E;  3S4U A;  3ZYL A;  3FXD B;  2ZM2 A;  4EOZ B;  2HPL A;  5EZY E;  2JMH A;  2V1D B;  3OKQ A;  1B7T A;  3OBV E;  2V7I A;  2LSI A;  3ZLI A;  3ETU A;  2X68 A;  1Z0P A;  3MZK B;  5LGN B;  5J2T E;  2KWH A;  2X9W A;  2VKD A;  3L3P A;  5KX5 E;  5LHH B;  4X1K E;  4J2C A;  1U5P A;  5IHY A;  4C90 A;  3QK6 A;  5LJN A;  2W62 A;  2L3L A;  1BR2 A;  5H6Q B;  3ZMU B;  5LG4 A;  2XUE A;  4ZI3 C;  3ZYM A;  3HA4 A;  2XTL A;  4QXH B;  4U72 A;  3JC6 D;  5LYJ E;  4P09 A;  5JDN A;  3GN5 A;  4TUY E;  2ODU A;  4UF0 B;  4HTE A;  3I9W A;  2IAK A;  5HXC A;  1WLX A;  2JQQ A;  2UXN B;  2ES0 A;  4OYK A;  4O2B E;  5KMG P;  5LGU B;  2YU2 A;  5J2U E;  4UVA B;  1D0Z A;  5HXS A;  1LVK A;  2LSY A;  2PG8 A;  5HWX A;  3RC3 A;  3GMI A;  4ZOL E;  3ZC1 A;  2KWI B;  4HEA A;  5TAO A;  4AQF C;  1D1B A;  5HXH A;  3ETV A;  5FP3 A;  4NUV A;  1X79 A;  5FXW A;  3CX6 B;  2EHO B;  2LE8 A;  3HKD E;  4MHC A;  1EZ3 A;  5EK2 A;  2XAH B;  2ACX A;  4CXX A;  4V1A v;  3BQL A;  4IGU A;  3AA1 B;  1WYC A;  2DI4 A;  2M67 A;  3U78 A;  2IC9 A;  1FIO A;  3E0Z A;  5LHG B;  3LK3 B;  5EK3 A;  2V7L A;  2B1E A;  3LJC A;  3AA0 B;  3OJA A;  4DND A;  4QX8 B;  2L9Q A;  2X66 A;  4K0U A;  4UV8 B;  3EUH A;  4FJO A;  2LOS A;  4PFO A;  2LEH A;  5F3J A;  4BA9 A;  3C4Z A;  2J1D G;  4XZC A;  3ZYK A;  3LBX A;  2BZB A;  3I0O A;  1VOM A;  4GYS A;  3CVR A;  5JRC A;  5FXV A;  3H37 A;  4UVB B;  3O1I A;  4CXW A;  4I4T E;  3ESL A;  2LHR A;  1D1C A;  5FY0 A;  5JDL A;  5LP6 E;  1QUU A;  3ZC0 A;  2Q9Q A;  5HAX A;  1FMW A;  2XAJ B;  2MTQ A;  4UV9 B;  2CXD A;  3UT5 E;  2CWO A;  3ZCI A;  1U4Q A;  4P0B A;  2KND A;  5C8Y E;  1UX5 A;  4H9P C;  3WAJ A;  3D0T A;  4X20 E;  5LBM A;  4G2A A;  5LXT E;  3N9P A;  3HKB E;  3Q5X A;  3FBL A;  4GIW A;  5ETW A;  1LRZ A;  3ZCJ A;  5LNK A;  3FB2 A;  2ODV A;  2Q9Q C;  2BVM A;  3MA9 A;  3PUA A;  3ZMT B;  4O8S A;  3AVR A;  2LM9 A;  1Y64 B;  1OXZ A;  4MAL A;  3AAA B;  2UXX B;  2LOP A;  4KMC A;  5JDH A;  1HTJ F;  2NTX A;  2E9X C;  2BVL A;  1E1H B;  3V5S A;  1HFA A;  4PK6 A;  4TV9 E;  5LGT B;  5M4Y A;  4B6X A;  3NZP A;  5E0O A;  2DNX A;  4UF0 A;  3J7Y q;  3ZN0 B;  2XHE B;  2ZLY A;  4WNK A;  3Q9D A;  3ZMV B;  5HXR A;  3Q2M A;  2W0G A;  3FBZ A;  4QXB B;  5JR9 A;  4L0R A;  3DP7 A;  4WBN E;  2VB6 A;  2VL8 A;  4TZ4 C;  4PK5 A;  2C5I T;  1HG2 A;  1IZN B;  3CX8 B;  1IJ6 A;  3N2O A;  1OWA A;  4AQG A;  4DBQ A;  5JH7 E;  2LSJ A;  4UEM A;  2LT3 A;  3F57 A;  1HX8 A;  4CI3 B;  4I55 E;  2E9X B;  2XAQ B;  2VKJ A;  4OYJ A;  3NRY A;  4L5G A;  3CQC B;  3OYX A;  2X51 A;  3C4X A;  4O4L E;  4XAX B;  3QUJ A;  4YLH A;  3W15 B;  4QWN B;  3VKH A;  2VAS A;  1HF8 A;  3O9X A;  4UVC B;  1V9D A;  2H7V C;  4HFV A;  2CEA A;  4QXC B;  2SPC A;  4IE5 A;  3RYH E;  2KZ7 B;  4H63 V;  2D0U A;  3CQG B;  2XAF B;  4DMW A;  3PU3 A;  5LOV E;  3NZQ A;  4BAY B;  4PJM A;  2WMN A;  5BMV E;  4GK5 E;  4GYR A;  5FY1 A;  3SRZ A;  1G8X A;  2V7K A;  2Z6E A;  5GON E;  3PTR B;  5CB4 E;  4L9I A;  2MOZ A;  3HI2 A;  2V26 A;  3N9O A;  1HCI A;  3BQI A;  2I59 A;  4ZS2 A;  2Y8D A;  4ASK A;  4YJ3 E;  3Q5W A;  4AKH A;  4AI6 A;  3EDU A;  2E9X D;  4AXP A;  1ZKE A;  5J1G A;  5L2L A;  3HR0 A;  2H3R A;  2H7O A;  3AVS A;  2X9X A;  3NBX X;  2N1G A;  2DWG A;  5LCY A;  1BR4 A;  4AKI A;  5IYZ E;  1G73 A;  3MKD A;  1UCU A;  5JDF A;  5JDQ A;  4PNI A;  2W63 A;  3UUM A;  2YEV C;  3PE0 A;  2PJQ A;  1NWM X;  2CXL A;  2YK0 A;  2CCQ A;  5LJM A;  3P8C D;  3ZJ2 A;  1YKH B;  3T8O A;  1ZHC A;  2C0S A;  3P7I A;  4IE4 A;  3ZJ1 A;  4P0A A;  5F8P A;  4OK0 A;  4FI5 A;  1KK7 A;  4DO0 A;  2A2F X;  2RP4 A;  2KMF A;  3ZMS B;  4O4J E;  3I1A A;  4ZS3 A;  4H9O C;  4MFR A;  3PU8 A;  3B13 A;  3SS1 A;  2CXF A;  5LA6 E;  2CM0 A;  4G63 A;  2NTY A;  3V5U A;  2WAU A;  5CA1 E;  3IF8 B;  3AA6 B;  2A3D A;  1MMN A;  3UUN A;  1HG5 A;  3GA8 A;  1WR6 A;  4EXT A;  1MIV A;  4WW0 A;  5JDM A;  3RRW A;  4M1P A;  2ZM8 A;  4H9S E;  4HE8 A;  3VU7 H;  1CUN A;  5ADX L;  2MYS A;  2Q9Q D;  2KXP B;  4KBM B;  3OYZ A;  4H9Q C;  1YD8 G;  5L3D B;  4AKL A;  5DAB A;  4ERR A;  4ZHQ E;  4H9N C;  1SHZ C;  2N9D A;  2VWA A;  3TKL B;  4E7Z A;  4IE6 A;  1SA0 E;  4PJJ A;  1WRD A;  4YHJ A;  4AKG A;  2EHO D;  1YW0 A;  1T98 A;  5L3G B;  3N9Q A;  3C64 A;  4PFP A;  4O2A E;  4BJM A;  2N2N A;  3M65 A;  4H9R C;  2X0L B;  3KV5 A;  1MIW A;  4ADZ A;  4CI1 B;  5JQG E;  2A72 A;  2CMR A;  5JRE A;  4X1I E;  5L3B B;  2MBG A;  5FXZ A;  3BQK A;  2L8K A;  2BDE A;  4PJL A;  4IIJ E;  4A56 A;  1US7 B;  5JDG A;  3UUX B;  3F31 A;  2K5B B;  3KFW X;  5DQV A;  4CQI A;  4ISS A;  3KV4 A;  3KV6 A;  3O1J A;  2YU1 A;  2LJL A;  4YFS A;  3J9X 1;  2NOX A;  4JUY A;  4MLK A;  3WI3 A;  4ZI2 D;  3K8P C;  2IC6 A;  4UIG A;  4PAG A;  2W00 A;  2WM9 A;  2XQY A;  5L3F B;  3K3N A;  5JRC B;  2ZMA A;  2WMO A;  2KIN B;  3HL6 A;  3RYC E;  3PUS A;  1MND A;  3LBX B;  3CML A;  3FXE B;  4EZ4 A;  4ILU A;  2Y48 B;  3N9M A;  4DVD A;  1KNZ A;  1NAF A;  4QX7 B;  5HYA A;  3IEE A;  3RC8 A;  3N9L A;  1LVF A;  3O4X E;  4AQF A;  1VRB A;  2DCF A;  3L09 A;  3LFM A;  3O1H A;  4JEH B;  4JLE A;  5DJQ C;  2C5K T;  2X67 A;  3WAK A;  4CZZ B;  4IE7 A;  4EB6 E;  1ZEE A;  3VKG A;  3KBU A;  4MBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...