1ZHCA

Solution structure of hp1242 from helicobacter pylori
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
b'MFHEFRDEISVLKANNPHFDKIFEKHNQLDDDIKTAEQQNASDAEVSHMKKQKLKLKDEIHSMIIEYREKQKSERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein HP1242
publication title Solution structure of HP1242 from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04325 DUF465 Protein of unknown function (DUF465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zhcA00
1ZHCA
chains in the Genus database with same CATH superfamily
1OEDA 4JI4T 2M6BA 3O1IA 2VURA 5CJ5A 3MKDA 3X1DA 4COFA 5L4EA 2J1DG 5IUXA 3B57A 2UUCT 3UU3A 2ODUA 2XQ5A 2X67A 4AISA 4HFBA 4ZS3A 1KF6A 2E9XD 3PUQA 2KNDA 3KV4A 1KFYA 5IWAT 2DHRA 2VL8A 4ILUA 5JDGA 4KP3C 5LOVE 2BVMA 3N9PA 2KLQA 3UULA 4GYRA 5L2LA 2NW9A 3ZN0B 1UK5A 5HWXA 4BJNA 3OBVE 4LMKA 5CFBA 3SOLA 3CQCB 4IE4A 1S35A 3F2EA 1UUSA 2CBIA 5AQHB 5AQOB 2DCFA 1DU2A 3KVAA 3UT5E 2RPAA 3VR9A 3NRXA 2LKGA 2XHEB 4J2CA 2EHOD 5JR9B 5LGTB 2C5KT 4Z8XA 2WSSV 2A9UA 2IIUA 4AQYT 2V5CA 3AAIA 5A1LA 3FHNA 2LM2A 5AQNB 2N1GA 4E7ZA 2W0GA 1HX8A 1W0AA 4NXMT 5HXSA 3NZQA 3N9QA 4NIQA 4ANJA 2XAGB 2Z6EA 4B6XA 2BG9A 1NAFA 4EYYR 3BQKA 2XAFB 3PJAJ 3JAEA 3N5LA 3AXJB 5FMNA 2L9QA 1XDOA 3N9LA 3CKDA 4UEMA 4IDZA 2UXXB 2BDEA 2H7VC 3CQXC 2V6YB 4U2YA 2LM9A 4ZOLE 2CXFA 3FB2A 2DLRA 3O4XE 3ABVA 4IL4A 2VQFT 2UXCT 3Q5DA 3JCFA 1HG5A 5LNKA 4PK4A 2BG9E 2V8SV 5HYAA 1MNEA 4DR7T 2K9AA 4ILBA 3NBXX 1SUMB 3RIAA 1VCSA 2WZHA 4ZEYA 2J4GA 1N34T 2KWHA 1YXRA 4NUVA 2LEHA 3P8CD 4DR5T 2LSYA 4KHZF 4ZI2C 3CPZA 2CMRA 4PAGA 1SHZC 3MJXA 4Z91A 3HA4A 2IC9A 2CHNA 3LK3B 3E22E 3PE0A 3FZMB 3PUWF 4KX6A 2CE7A 1UCUA 2DWGA 4JLEA 3ZT7A 2WDQA 3TLSA 4G2AA 4KI0F 3RQUA 4Z90A 2VKHA 2DNXA 4H63V 5L3BB 1W09A 1Y01A 5FY7A 4LF9T 2KMFA 5LCYA 2CM0A 4B3ST 3G06A 4AI6A 3F57A 2XQAA 1M62A 2WDVA 4YSYA 3K1SA 3ONJA 3RIFA 2D5UA 3U78A 2EHOA 4H9NC 4YT0A 4EEDA 3OJAA 2BZBA 2XZEA 1J1JA 3EVYA 1N32T 4WW0A 4QX8B 3EDVA 2BKOA 3O1JA 4QXCB 4EGWA 2CLYB 3MACA 4YTPA 5ABFA 3K3NA 2UXNB 4NUUA 1MIWA 2XQ4A 1LVFA 3UQ7A 5LP6E 3I9YA 4O4LE 3SFEA 3MA9A 2MPKA 4YTMA 3KDSE 3AECA 4X1KE 3J9X1 4JEUB 2WP9A 3V5SA 1AJ3A 1X9BA 2IAKA 3OPCA 4CXWA 5TAOA 3DTOA 4YJ2E 2BG9B 4UR9A 3UUMA 3BK9A 3ZT5A 4PW8A 1FMVA 2Y6XA 2D2SA 3U3IA 1ZOYA 4Q25A 3NRYA 5M4YA 1X79A 5JDFA 5EK3A 3NZPA 4BJMA 1JNRA 2W66A 2WM9A 5LGNB 2NW8A 1WLXA 2VKDA 5HWYA 3RF1A 3V5UA 3HKDE 2H3RA 4AKHA 1T72A 4O4JE 4AKRB 5LYJE 1T8BA 4LF7T 2ACXA 5FKYA 1WYBA 2E2AA 4TN7B 5C2TA 3HL6A 1CUNA 3C64A 1IJ6A 1OWAA 2VASA 5AQSB 2WZIA 2FJAA 1J5ET 2V6XA 3IBPA 3OKQA 4IIJE 5FVKA 1Z0PA 3UUNA 3N2GE 2D0TA 4ILAA 4CXXA 4IREA 4A97A 3UUBA 3NKZA 4E7SA 2NOXA 2H89A 4JI0T 3IA3A 1WR0A 5FL0A 3ETVA 5JR9A 1MMAA 4P09A 3EUHA 3K3QC 2OV9A 4MFRA 2JRKA 3KFWX 4EZ4A 2YU2A 1XZYA 2PBIA 2JPFA 2RA1A 1GQEA 4DV5T 2YU1A 4N78D 2I6HA 3PUYF 1D0YA 3L39A 1SE7A 4IGUA 3AE1A 5L47A 4DR3T 2XM1A 4F6RC 1WR6A 1OEDC 3AXJA 4EAHA 2WWVA 1IBKT 3T1YT 2BS2A 4IDNA 2J62A 1HG2A 3AA1B 4AKGA 3ETUA 1MIYA 4CN6A 5CA1E 4WBOA 3CWZB 2YDRA 5LBMA 4XZCA 1XNRT 1T98A 2SPCA 2QVAA 4ZI3D 4I43B 3VHLA 4LF6T 1KNZA 3EABA 5HCJA 4DO0A 1US7B 1KK7A 3FZKB 3AE5A 4AKIA 4ADZA 3AE7A 4ERRA 1R8IA 2XY8B 3F31A 4C91A 2JQHA 2BKPA 5H6RB 2Q9QA 3MXZA 4JI5T 3CX8B 2XQ9A 1WCRA 3E0ZA 4QH5A 2FJBA 4HFEA 3IF8B 4WZXA 1ZV4X 2IC6A 4DR4T 3ZPOA 2V7MA 4EOZB 4BA9A 2XAQB 4HEAA 3RYHE 2X9HA 4TUYE 5LG3A 5AQTB 2XSAA 3L09A 3RQWA 1MMNA 2N9DA 3AAEB 2H88A 2CWYA 3HKEE 4TNWA 2X9XA 5F8PA 3UQ4A 4OFZA 4JI6T 3P4RA 1UX5A 3WAKA 1W0BA 2XQ6A 5DQWA 2YDSA 4HFDA 2WMNA 3TLTA 5FXWA 5BMVE 3VR8A 3AVSA 2W67A 4H63H 2NWBA 4ZHQE 2CA5A 5AQMB 3B13A 3UTKA 2UUBT 5L4HA 2JJ9A 5J2TE 2MTQA 3OYXA 3PUGA 4CN4A 4DR2T 5AFUL 3CX7B 5L3EB 2LSJA 2LRLA 3QC9A 1D0XA 2ZM6T 4X1YE 4YFSA 2MAWA 3KINB 3T8OA 3ZT6A 5JRCA 2ZM8A 2ACZA 4HE8A 2XM2A 4WNKA 3A5XA 3C4WA 2B76A 1VRBA 1YKEB 3AE4A 4QH4A 2XAJB 2WU5A 2LT3A 4ZS2A 3E08A 1G73A 1XWMA 4WYVA 2E9XC 3C4XA 4DV2T 1Z8UA 4LFCT 2VKOA 2W4XA 3L3PA 2CCQA 1KNRA 1HS7A 2V7LA 3ZYKA 2FJEA 3PTRB 2V1DB 2VVNA 2CPTA 5EZYE 4PJJA 5AQRB 4CZZB 3LG7A 2HPLA 1LKXA 3DJBA 5LJMA 4JI8T 5CA0E 5JDHA 4OX9T 1HR0T 3AE8A 5FXVA 1BR2A 4QH1A 4O2BE 4ILCA 3ZC0A 2D9DA 2QRXA 5LB7B 5J2UE 2EHOC 3RHWA 3AE3A 3ZSTA 5L3GB 2XSBA 2DL1A 5AQQB 1LRZA 2WY2A 2Q9QB 4YLHA 4HGAA 2HN1A 4DV4T 3HR0A 3TLWA 3IEEA 3I9WA 3QUJA 1WYCA 4DBRA 3RH3A 2I59A 3AE9A 1D0ZA 4G63A 1HFAA 2KWIB 3ZLIA 3AEFA 2WWUA 2A72A 5JDQA 4JI1T 3FBLA 3GN5A 3K3OA 3Q2MA 2X68A 2YKSA 1BR0A 4MALA 3RC3A 4JI2T 3GMIA 2UU9T 4ISSA 3VKGA 4HFCA 1G8XA 4FJOA 2HHHT 3C4ZA 2K48A 2KT9A 3HKBE 4GIWA 4HWCA 5ADXL 1QSDA 2UUAT 5FL1A 4IE6A 2CRBA 4YTNA 2X9YA 5C3JA 2UXBT 3AE6A 1MMDA 3JC6D 2PFVA 2W00A 3QNUA 3R84B 1ZHCA 5FXZA 5C8YE 4C90A 2YDQA 1NWMX 4KHPT 1J5WA 3ONLC 3ZMUB 4HTEA 1FEWA 5FY1A 4FI5A 5JRCB 4QWNB 2WDRA 2ZLYA 3RPUA 2DWKA 3KBTA 3TKLB 2WU2A 5DABA 4UV9B 3BQIA 3PUSA 2WCAA 2OLTA 2XTLA 4DV6T 3FZLB 5AQUB 3RGLA 1YKHB 4ASKA 5JR9C 3H37A 3RRWA 4EV6A 2OA5A 2Q9QD 2LHNA 3RI5A 4DBQA 2E5VA 2CBJA 3QOFA 2YINA 4LMJA 2NTYA 5KX5E 3RYFE 3VRBA 5F3JA 1VCTA 5AQGB 3GA8A 3M65A 4HKAA 1U4QA 2ODVA 2K5BB 3AE2A 4B3RT 4OYJA 2V26A 4GK5E 4U7IA 4DUYT 3OTOT 4YHJA 5LBQB 3PDYA 4EIWA 2LLYA 3LDQB 3AA0B 4LF5T 2IW5B 3PURA 4XBFB 4I0UA 1XDPA 5AQFB 2A3DA 5GONE 4LFBT 3RX6A 5HCMA 2JMKA 5LJNA 4QKNA 1D1AA 3SFDA 1UURA 2A2FX 3ZYLA 4IDPA 3O1HA 4HWDA 1N36T 1WRDA 1HNXT 1IBLT 4YSXA 3ANWB 4TWFA 5LHIB 3P4WA 2CXDA 5ABEA 2BBHA 3ZCIA 4AIUA 3RIUA 3ZMTB 1XNQT 2B1EA 3GN5B 3QK6A 4JV5T 2J47A 2WMOA 1IJ5A 3P4SA 1IAPA 2V5DA 3ZJ2A 4X65T 4DV7T 1D1BA 4EZHA 3RRCA 3FXEB 4QXHB 1XMQT 3PUVF 2NTXA 4ZZCA 5F5WA 3LBXB 2NW7A 3EHZA 4TV9E 2H7OA 3O9XA 4HFIA 4ZZBA 1SA0E 5L3DB 2RP4A 2YEVC 4L9IA 2R6GF 5JDNA 5JQGE 3AVRA 4IDOA 1FJGT 2Y48B 5IYZE 2E8IA 1E7PA 1CHUA 2F4VT 4P0AA 2UXDT 4U2ZA 2LE8A 3ZSSA 5KXJA 4UF0B 3LK42 4GKKT 2FUPA 3FZHB 5EK4A 4DR6T 2XQ3A 4H9OC 5HXHA 2VB6A 3RLFF 4HWIB 2IMLA 4P0BA 3PU8A 2L3LA 4JUYA 2JQ9A 5DJQC 2FJDA 3H3MA 5FXXA 2D0UA 2CLYC 2YN6A 1NEKA 4YXDA 3TLUA 3JADA 2W61A 4UELA 5ABGA 5LGUB 3VU7H 2FBWA 4IHJE 4I4TE 5L3FB 1B7TA 3CVRA 3PUZF 2I0MA 3RC8A 4UV8B 2KXPB 2L8KA 3CK6A 1LVKA 2CXLA 4WBNE 4JI7T 2VL0A 3AA6B 2CEAA 3ZJ1A 2PG8A 3FZFB 3VKHA 4U33A 2XJ7A 2BG9C 2VQET 2X0YA 5HAXA 4ZI3C 4X1IE 3PUAA 4IE5A 4DR1T 3WI3A 4IE7A 3FXDB 4QXBB 3DP7A 5ETWA 5LG4A 2YK0A 1NENA 4PJMA 2WBLA 2C0SA 3P4QA 2CWOA 3CIRA 2WQYA 3N2KE 5FP3A 4GYSA 4K0KT 3KBUA 2XQ7A 3UUXB 2VK9A 4MHCA 4IL9A 4DMWA 1OEDE 2PJQA 4LFAT 3W15B 1W9RA 4AQFA 3AAAB 1L0VA 3CQGB 4ZXLA 2N2NA 4GK0E 3ZN1B 1BR4A 5AQVB 5FVLA 3UFGA 3C50A 3Q5EA 3NVOA 1FMWA 4I50E 2NR4A 4HN9A 4H9SE 4AQGA 3K8PC 2M67A 5CGMA 4O8SA 2X0LB 2P9BA 2LJLA 5AQLB 2GK9A 1YW0A 4UIGA 2E5LT 3PU3A 3UU8A 4ZI2D 1M7KA 4EB6E 2LOSA 5HXEA 4PJNA 3B5MA 4MBQA 1N33T 1YQ3A 1ZKEA 5LMNT 3QB5A 4AXPA 4V1Av 3AEEA 4LF4T 2XASB 5LA6E 4JEHB 3AEGA 3N2OA 4O4HE 3SRZA 3C98B 2C5JA 1S94A 4PK5A 5LMUT 1O3XA 5E0OA 2BKNA 4U72A 5AQIB 4CI1B 2C5IT 4OK0A 4X66T 3D0TA 1VOMA 2QYWA 3KV6A 2X0HA 1T7SA 1MIVA 3IHRA 1XMOT 4HWFA 3PUXF 2HPJA 4H9RC 4OHFA 1MNDA 4KUMB 5J1GA 1HTJF 2HH7A 2W2UA 3LFMA 4PFOA 1IBMT 2NP9A 3ZMSB 3J7Yq 2IUBA 3TLVA 3ANWA 4GKJT 4DUZT 2VVSA 5FNVE 2V7KA 4CI2B 3SS1A 2MYSA 1KEYA 3LK2B 1YQ4A 5JH7E 3A8YC 4H9PC 3UU5A 2BS4A 5HEJA 2E9XA 4B3MT 4K0UA 3RKOA 4EYUA 2ZM0A 4DV3T 3AEAA 4HFVA 1OEDB 3ESLA 4CI3B 4TWDA 3WAJA 2X51A 3UU6A 5H6QB 3GWHA 2JQKA 3LBXA 5HXRA 1QUUA 4IDQA 3CMLA 4UVCB 4F8HA 3UFEA 4EXTA 2DI4A 2JQQA 4YHHT 2IDOB 2W63A 4ISTA 5BR8T 2XPKA 4O2AE 4QHOA 3CX6B 4BAYB 5L3CB 1Y64B 5JREA 5LHHB 2KINB 3L8RA 2KZ7B 3ZMVB 4UVAB 5HEUA 1ZP0A 4DNDA 4YSZA 2V7JA 2XAHB 4UF0A 4EEBA 3P4PA 4B3TT 5FY0A 1MMGA 3PJAA 5J0ZA 4DV0T 4JYAT 1HNWT 4DIDB 4CQIA 2PTFA 4H9QC 1HF8A 1JNZA 3M3ZB 5EK2A 4TNVA 3ZYMA 4HFHA 3ZC1A 2WS3A 4I55E 3OVUA 4L5GA 5KDMC 4AKLA 2CHOA 4U31A 4TZ4C 1FIOA 3I0OA 4LMLA 3R6NA 2LRKA 3RIUC 3AEBA 1D1CA 2HN2A 2XUEA 1WFDA 4L0RA 1H7CA 3UU4A 4U7YA 3JC6C 2LSIA 3ONXA 4LF8T 4U74A 4X20E 3N9MA 3ZEFB 3ZCJA 2LOPA 2X9WA 4U3CA 4QX7B 3Q5XA 2X66A 2W62A 3LSVA 2JMHA 4P1NA 5AQPB 3KVBA 2QGSA 3AA7B 3NWIA 2BVLA 4NPPA 3N9NA 2BS3A 4DMVA 2VWAA 3KV5A 3RYCE 2ZMAA 4IT4A 5LHGB 2YOEA 4X64T 2LKHA 4XAXB 3BQLA 1I6ZA 2AE9A 5JVDE 5HEHA 5JDMA 4YY3T 3RYIE 3PV0F 5HXCA 4X5TA 5ABHA 3ZKRA 1HNZT 1V9DA 3RKGA 4UVBB 4CN1A 3P50A 2WAUA 1ZEEA 5AQKB 2Q9QC 3C51A 2MOZA 4PFPA 3Q5WA 5HEGA 4CXYA 2E9XB 1U5PA 2V7IA 4KMCA 2VKJA 1HX1B 3Q9DA 2G0UA 3EAMA 1I94T 1UGOA 2JIWA 3LJCA 2M6IA 2QA7A 4PJLA 4A56A 3QB5K 4MLKA 1QLBA 2ES0A 3A7MA 3ZMZB 2AXDS 2BBJA 5FYMA 3MK7C 2ZM2A 2LHRA 4O4IE 4TV8E 5DQVA 1E2AA 5CB4E 3EI0A 5JDLA 4TX5A 3JAFA 2MBGA 4DV1T 4A5XA 5LXTE 4M1PA 3KV9A 3P7IA 4HWHA 5AQJB 3AEDA 1OXZA 4GOUA 3VRAA 4KBMB 3HI2A 2IHR1 2EHOB 2V6YA 1EZ3A 2LSKA 4ZI7E 2K24A 4PNIA 3I0QA 4PK6A 3SWHA 2LSGA 4UXNB 3H3AA 2KSRA 5JTGA 1IZNB 4TWHA 4A98A 4DVDA 2XQ8A 2K3WA 5IHYA 3MZKB 2Y8DA 5ABFB 1HCIA 3S4UA 1YD8G 3T1HT 4OYKA 1E1HB 4JBWF 3I1AA 4AQFC 4JI3T 3HKCE 3N9OA 1UX4A 3AB3B 4NXNT 4YJ3E 3FBZA 5KMGP 4IE0A 5HEOA 2WB5A 1KNPA 2XQYA 1BR1A 3OYZA 3EDUA 4X62T
chains in the Genus database with same CATH topology
1FEWA 3ETVA 4O4HE 5JR9A 3SRZA 3C98B 2C5JA 1MMAA 4P09A 1S94A 3EUHA 3K3QC 3O1IA 5FY1A 4MFRA 4FI5A 4PK5A 1O3XA 3MKDA 5JRCB 4QWNB 2JRKA 3KFWX 5E0OA 4EZ4A 2YU2A 2ZLYA 4U72A 2J1DG 3RPUA 2C5IT 3B57A 4OK0A 4CI1B 2DWKA 3KBTA 3TKLB 3D0TA 2ODUA 2PBIA 2X67A 1VOMA 2JPFA 5DABA 4ZS3A 2RA1A 3KV6A 4UV9B 2E9XD 3BQIA 3PUQA 2YU1A 2KNDA 3KV4A 4N78D 3PUSA 1MIVA 3IHRA 2XTLA 2DHRA 1D0YA 2VL8A 2HPJA 4H9RC 4IGUA 1MNDA 4ILUA 4OHFA 5JDGA 1YKHB 4KUMB 4KP3C 5J1GA 5LOVE 1HTJF 2HH7A 3LFMA 4PFOA 4ASKA 4F6RC 1WR6A 2BVMA 3N9PA 2KLQA 3UULA 5JR9C 2NP9A 3H37A 4GYRA 3ZMSB 4EAHA 3J7Yq 3RRWA 5L2LA 2NW9A 3ZN0B 2OA5A 3ANWA 2Q9QD 2LHNA 4DBQA 5FNVE 5HWXA 2YINA 1HG2A 3AA1B 2V7KA 4BJNA 4CI2B 4AKGA 3ETUA 1MIYA 3SS1A 3OBVE 2NTYA 2MYSA 5KX5E 5CA1E 4WBOA 3RYFE 3CWZB 5F3JA 5LBMA 4XZCA 3SOLA 3LK2B 5JH7E 3CQCB 1T98A 4IE4A 3GA8A 1S35A 2SPCA 3F2EA 4H9PC 4ZI3D 2E9XA 4I43B 4K0UA 3M65A 3VHLA 2DCFA 3KVAA 4HKAA 3RKOA 4EYUA 3UT5E 1U4QA 2ODVA 1KNZA 3NRXA 2K5BB 2XHEB 4J2CA 2ZM0A 2EHOD 4HFVA 5JR9B 5LGTB 4OYJA 4DO0A 1US7B 2V26A 1KK7A 3ESLA 4GK5E 4CI3B 2C5KT 4Z8XA 3WAJA 4AKIA 2X51A 4ADZA 2WSSV 4YHJA 5H6QB 3GWHA 4ERRA 3AAIA 5A1LA 3F31A 3FHNA 5LBQB 4C91A 2N1GA 4E7ZA 3PDYA 4EIWA 2W0GA 3LBXA 5HXRA 5H6RB 1QUUA 1HX8A 2Q9QA 3MXZA 3CX8B 3AA0B 5HXSA 2IW5B 3CMLA 3NZQA 3PURA 3N9QA 4ANJA 4UVCB 3E0ZA 2XAGB 4XBFB 3UFEA 4EXTA 2DI4A 2JQQA 2W63A 2A3DA 4ISTA 2Z6EA 5GONE 4B6XA 3IF8B 4O2AE 1NAFA 3RX6A 4QHOA 3CX6B 4BAYB 1ZV4X 2IC6A 2JMKA 4EYYR 3BQKA 2XAFB 5LJNA 5L3CB 1Y64B 4QKNA 1D1AA 3ZPOA 2V7MA 5JREA 2A2FX 5LHHB 3N5LA 4EOZB 2KINB 5FMNA 3ZYLA 2L9QA 3O1HA 1WRDA 4BA9A 2KZ7B 2XAQB 4HEAA 3RYHE 3N9LA 2X9HA 3CKDA 4UEMA 3ZMVB 4TUYE 4IDZA 4UVAB 2UXXB 3ANWB 3L09A 4DNDA 5LHIB 1MMNA 2BDEA 2V7JA 2N9DA 2XAHB 4UF0A 2H7VC 3CQXC 3AAEB 2CXDA 2LM9A 2CWYA 4ZOLE 2CXFA 3HKEE 3FB2A 2DLRA 3O4XE 5FY0A 2X9XA 5F8PA 4OFZA 3ZCIA 1MMGA 3ZMTB 2B1EA 3GN5B 1UX5A 3QK6A 2WMOA 3WAKA 1IJ5A 5DQWA 1HG5A 4CQIA 1IAPA 2WMNA 5FXWA 5LNKA 5BMVE 3ZJ2A 4PK4A 4H9QC 1HF8A 3AVSA 4H63H 1D1BA 2NWBA 4ZHQE 2CA5A 4EZHA 5EK2A 5HYAA 3ZYMA 1MNEA 3RRCA 2K9AA 3FXEB 3ZC1A 3B13A 3UTKA 4QXHB 2NTXA 4I55E 2JJ9A 3NBXX 5J2TE 2MTQA 4L5GA 5KDMC 4AKLA 3LBXB 2NW7A 3OYXA 4TZ4C 2KWHA 1FIOA 3PUGA 4TV9E 2H7OA 3O9XA 3I0OA 3R6NA 4NUVA 1SA0E 5L3DB 2RP4A 2YEVC 1D1CA 2XUEA 2LEHA 4L9IA 5AFUL 4L0RA 3CX7B 3P8CD 5L3EB 2LSJA 1H7CA 2LSYA 5JDNA 5JQGE 3AVRA 4ZI2C 3QC9A 3JC6C 1D0XA 3CPZA 2CMRA 2Y48B 2LSIA 4PAGA 2E8IA 4X1YE 5IYZE 4YFSA 3ONXA 4U74A 4X20E 3KINB 1SHZC 3MJXA 3N9MA 3HA4A 3T8OA 3ZEFB 2IC9A 3ZCJA 4P0AA 5JRCA 2ZM8A 2LE8A 4HE8A 2LOPA 2X9WA 3LK3B 4WNKA 3E22E 3A5XA 3C4WA 4QX7B 3PE0A 3Q5XA 4UF0B 2X66A 2CE7A 1VRBA 2W62A 3LK42 1UCUA 1YKEB 2DWGA 4JLEA 2JMHA 5EK4A 3KVBA 4H9OC 2QGSA 5HXHA 2VB6A 4G2AA 3AA7B 2BVLA 2XAJB 5L3BB 2VKHA 2DNXA 3N9NA 4H63V 4DMVA 2LT3A 2VWAA 4P0BA 3KV5A 3PU8A 5FY7A 3RYCE 2ZMAA 4ZS2A 2KMFA 2L3LA 5LHGB 5LCYA 3E08A 4JUYA 1G73A 2CM0A 5DJQC 4AI6A 5FXXA 2D0UA 2E9XC 3C4XA 2CLYC 3F57A 2VKOA 2W61A 4UELA 4XAXB 3BQLA 3L3PA 2CCQA 5LGUB 5JVDE 2D5UA 3VU7H 1HS7A 2V7LA 3ZYKA 3PTRB 3U78A 5JDMA 2V1DB 2EHOA 4H9NC 4IHJE 3OJAA 5EZYE 2BZBA 4I4TE 5L3FB 4PJJA 3RYIE 1B7TA 3CVRA 5HXCA 4CZZB 3EVYA 3LG7A 2HPLA 3RC8A 4WW0A 1LKXA 1V9DA 4UV8B 4UVBB 2KXPB 2L8KA 2WAUA 3DJBA 4QX8B 1ZEEA 3EDVA 1LVKA 2CXLA 5LJMA 2Q9QC 3C51A 3O1JA 5CA0E 2MOZA 5JDHA 4WBNE 4QXCB 5FXVA 4PFPA 1BR2A 3AA6B 2CEAA 3Q5WA 3ZJ1A 4CXYA 2E9XB 2CLYB 2PG8A 3MACA 3VKHA 1U5PA 2V7IA 4KMCA 2VKJA 3Q9DA 4O2BE 2G0UA 3ZC0A 3K3NA 2UXNB 4NUUA 1MIWA 5HAXA 3LJCA 2QA7A 4PJLA 4ZI3C 1LVFA 4X1IE 5J2UE 3PUAA 4IE5A 4A56A 5LP6E 4MLKA 3I9YA 4O4LE 2EHOC 3MA9A 2ES0A 3WI3A 3ZMZB 3KDSE 4IE7A 4X1KE 5L3GB 3FXDB 5FYMA 3J9X1 4QXBB 3DP7A 3MK7C 4JEUB 2ZM2A 5ETWA 2LHRA 5LG4A 2YK0A 4O4IE 1LRZA 4PJMA 3V5SA 1AJ3A 2Q9QB 2WBLA 2C0SA 4TV8E 4YLHA 2IAKA 5DQVA 5CB4E 4HGAA 5JDLA 4CXWA 4TX5A 2MBGA 2CWOA 5TAOA 3DTOA 4YJ2E 3N2KE 5FP3A 3HR0A 4GYSA 5LXTE 3UUMA 3IEEA 3I9WA 4M1PA 3QUJA 3BK9A 3KBUA 3KV9A 3P7IA 4PW8A 1WYCA 4DBRA 3RH3A 2I59A 1FMVA 3UUXB 2VK9A 2Y6XA 4MHCA 2D2SA 4DMWA 1OXZA 3U3IA 2PJQA 1D0ZA 4GOUA 4KBMB 4G63A 3W15B 3HI2A 1HFAA 3NRYA 2EHOB 2KWIB 4AQFA 1EZ3A 3ZLIA 2LSKA 4ZI7E 5M4YA 2WWUA 3AAAB 2A72A 2K24A 4PNIA 3CQGB 5JDQA 1X79A 2N2NA 4GK0E 5JDFA 5EK3A 3I0QA 3FBLA 3ZN1B 1BR4A 4PK6A 3SWHA 3GN5A 3NZPA 4BJMA 3C50A 2LSGA 3K3OA 3H3AA 3Q2MA 2X68A 4UXNB 1BR0A 4MALA 1IZNB 1FMWA 2WM9A 4I50E 5LGNB 3RC3A 2NW8A 3GMIA 4ISSA 4DVDA 1WLXA 2VKDA 4HN9A 5HWYA 4H9SE 3VKGA 4AQGA 3K8PC 3V5UA 2M67A 5IHYA 3MZKB 2Y8DA 1G8XA 4FJOA 1HCIA 3C4ZA 2K48A 4O8SA 3HKDE 3S4UA 1YD8G 2H3RA 4AKHA 2KT9A 3HKBE 4GIWA 2X0LB 4OYKA 5ADXL 2P9BA 4O4JE 4AKRB 5LYJE 1QSDA 2ACXA 2LJLA 2GK9A 1E1HB 1YW0A 4UIGA 1WYBA 4IE6A 3I1AA 4TN7B 4AQFC 3HL6A 1CUNA 2X9YA 3PU3A 3C64A 1IJ6A 1OWAA 2VASA 4ZI2D 1MMDA 3JC6D 2PFVA 3HKCE 4EB6E 3N9OA 2W00A 1UX4A 3AB3B 2LOSA 3IBPA 3R84B 4YJ3E 5HXEA 3OKQA 3FBZA 1ZHCA 4IIJE 4PJNA 5FXZA 1Z0PA 3UUNA 5KMGP 3N2GE 2D0TA 5C8YE 4MBQA 4CXXA 4C90A 1NWMX 1ZKEA 4IE0A 4AXPA 4E7SA 2XQYA 2NOXA 4V1Av 1BR1A 3OYZA 2XASB 5LA6E 4JEHB 3EDUA 3ZMUB 3N2OA 4HTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHC A; 
#chains in the Genus database with same CATH topology
 1OED A;  4JI4 T;  2M6B A;  3O1I A;  2VUR A;  5CJ5 A;  3MKD A;  3X1D A;  4COF A;  5L4E A;  2J1D G;  5IUX A;  3B57 A;  2UUC T;  3UU3 A;  2ODU A;  2XQ5 A;  2X67 A;  4AIS A;  4HFB A;  4ZS3 A;  1KF6 A;  2E9X D;  3PUQ A;  2KND A;  3KV4 A;  1KFY A;  5IWA T;  2DHR A;  2VL8 A;  4ILU A;  5JDG A;  4KP3 C;  5LOV E;  2BVM A;  3N9P A;  2KLQ A;  3UUL A;  4GYR A;  5L2L A;  2NW9 A;  3ZN0 B;  1UK5 A;  5HWX A;  4BJN A;  3OBV E;  4LMK A;  5CFB A;  3SOL A;  3CQC B;  4IE4 A;  1S35 A;  3F2E A;  1UUS A;  2CBI A;  5AQH B;  5AQO B;  2DCF A;  1DU2 A;  3KVA A;  3UT5 E;  2RPA A;  3VR9 A;  3NRX A;  2LKG A;  2XHE B;  4J2C A;  2EHO D;  5JR9 B;  5LGT B;  2C5K T;  4Z8X A;  2WSS V;  2A9U A;  2IIU A;  4AQY T;  2V5C A;  3AAI A;  5A1L A;  3FHN A;  2LM2 A;  5AQN B;  2N1G A;  4E7Z A;  2W0G A;  1HX8 A;  1W0A A;  4NXM T;  5HXS A;  3NZQ A;  3N9Q A;  4NIQ A;  4ANJ A;  2XAG B;  2Z6E A;  4B6X A;  2BG9 A;  1NAF A;  4EYY R;  3BQK A;  2XAF B;  3PJA J;  3JAE A;  3N5L A;  3AXJ B;  5FMN A;  2L9Q A;  1XDO A;  3N9L A;  3CKD A;  4UEM A;  4IDZ A;  2UXX B;  2BDE A;  2H7V C;  3CQX C;  2V6Y B;  4U2Y A;  2LM9 A;  4ZOL E;  2CXF A;  3FB2 A;  2DLR A;  3O4X E;  3ABV A;  4IL4 A;  2VQF T;  2UXC T;  3Q5D A;  3JCF A;  1HG5 A;  5LNK A;  4PK4 A;  2BG9 E;  2V8S V;  5HYA A;  1MNE A;  4DR7 T;  2K9A A;  4ILB A;  3NBX X;  1SUM B;  3RIA A;  1VCS A;  2WZH A;  4ZEY A;  2J4G A;  1N34 T;  2KWH A;  1YXR A;  4NUV A;  2LEH A;  3P8C D;  4DR5 T;  2LSY A;  4KHZ F;  4ZI2 C;  3CPZ A;  2CMR A;  4PAG A;  1SHZ C;  3MJX A;  4Z91 A;  3HA4 A;  2IC9 A;  2CHN A;  3LK3 B;  3E22 E;  3PE0 A;  3FZM B;  3PUW F;  4KX6 A;  2CE7 A;  1UCU A;  2DWG A;  4JLE A;  3ZT7 A;  2WDQ A;  3TLS A;  4G2A A;  4KI0 F;  3RQU A;  4Z90 A;  2VKH A;  2DNX A;  4H63 V;  5L3B B;  1W09 A;  1Y01 A;  5FY7 A;  4LF9 T;  2KMF A;  5LCY A;  2CM0 A;  4B3S T;  3G06 A;  4AI6 A;  3F57 A;  2XQA A;  1M62 A;  2WDV A;  4YSY A;  3K1S A;  3ONJ A;  3RIF A;  2D5U A;  3U78 A;  2EHO A;  4H9N C;  4YT0 A;  4EED A;  3OJA A;  2BZB A;  2XZE A;  1J1J A;  3EVY A;  1N32 T;  4WW0 A;  4QX8 B;  3EDV A;  2BKO A;  3O1J A;  4QXC B;  4EGW A;  2CLY B;  3MAC A;  4YTP A;  5ABF A;  3K3N A;  2UXN B;  4NUU A;  1MIW A;  2XQ4 A;  1LVF A;  3UQ7 A;  5LP6 E;  3I9Y A;  4O4L E;  3SFE A;  3MA9 A;  2MPK A;  4YTM A;  3KDS E;  3AEC A;  4X1K E;  3J9X 1;  4JEU B;  2WP9 A;  3V5S A;  1AJ3 A;  1X9B A;  2IAK A;  3OPC A;  4CXW A;  5TAO A;  3DTO A;  4YJ2 E;  2BG9 B;  4UR9 A;  3UUM A;  3BK9 A;  3ZT5 A;  4PW8 A;  1FMV A;  2Y6X A;  2D2S A;  3U3I A;  1ZOY A;  4Q25 A;  3NRY A;  5M4Y A;  1X79 A;  5JDF A;  5EK3 A;  3NZP A;  4BJM A;  1JNR A;  2W66 A;  2WM9 A;  5LGN B;  2NW8 A;  1WLX A;  2VKD A;  5HWY A;  3RF1 A;  3V5U A;  3HKD E;  2H3R A;  4AKH A;  1T72 A;  4O4J E;  4AKR B;  5LYJ E;  1T8B A;  4LF7 T;  2ACX A;  5FKY A;  1WYB A;  2E2A A;  4TN7 B;  5C2T A;  3HL6 A;  1CUN A;  3C64 A;  1IJ6 A;  1OWA A;  2VAS A;  5AQS B;  2WZI A;  2FJA A;  1J5E T;  2V6X A;  3IBP A;  3OKQ A;  4IIJ E;  5FVK A;  1Z0P A;  3UUN A;  3N2G E;  2D0T A;  4ILA A;  4CXX A;  4IRE A;  4A97 A;  3UUB A;  3NKZ A;  4E7S A;  2NOX A;  2H89 A;  4JI0 T;  3IA3 A;  1WR0 A;  5FL0 A;  3ETV A;  5JR9 A;  1MMA A;  4P09 A;  3EUH A;  3K3Q C;  2OV9 A;  4MFR A;  2JRK A;  3KFW X;  4EZ4 A;  2YU2 A;  1XZY A;  2PBI A;  2JPF A;  2RA1 A;  1GQE A;  4DV5 T;  2YU1 A;  4N78 D;  2I6H A;  3PUY F;  1D0Y A;  3L39 A;  1SE7 A;  4IGU A;  3AE1 A;  5L47 A;  4DR3 T;  2XM1 A;  4F6R C;  1WR6 A;  1OED C;  3AXJ A;  4EAH A;  2WWV A;  1IBK T;  3T1Y T;  2BS2 A;  4IDN A;  2J62 A;  1HG2 A;  3AA1 B;  4AKG A;  3ETU A;  1MIY A;  4CN6 A;  5CA1 E;  4WBO A;  3CWZ B;  2YDR A;  5LBM A;  4XZC A;  1XNR T;  1T98 A;  2SPC A;  2QVA A;  4ZI3 D;  4I43 B;  3VHL A;  4LF6 T;  1KNZ A;  3EAB A;  5HCJ A;  4DO0 A;  1US7 B;  1KK7 A;  3FZK B;  3AE5 A;  4AKI A;  4ADZ A;  3AE7 A;  4ERR A;  1R8I A;  2XY8 B;  3F31 A;  4C91 A;  2JQH A;  2BKP A;  5H6R B;  2Q9Q A;  3MXZ A;  4JI5 T;  3CX8 B;  2XQ9 A;  1WCR A;  3E0Z A;  4QH5 A;  2FJB A;  4HFE A;  3IF8 B;  4WZX A;  1ZV4 X;  2IC6 A;  4DR4 T;  3ZPO A;  2V7M A;  4EOZ B;  4BA9 A;  2XAQ B;  4HEA A;  3RYH E;  2X9H A;  4TUY E;  5LG3 A;  5AQT B;  2XSA A;  3L09 A;  3RQW A;  1MMN A;  2N9D A;  3AAE B;  2H88 A;  2CWY A;  3HKE E;  4TNW A;  2X9X A;  5F8P A;  3UQ4 A;  4OFZ A;  4JI6 T;  3P4R A;  1UX5 A;  3WAK A;  1W0B A;  2XQ6 A;  5DQW A;  2YDS A;  4HFD A;  2WMN A;  3TLT A;  5FXW A;  5BMV E;  3VR8 A;  3AVS A;  2W67 A;  4H63 H;  2NWB A;  4ZHQ E;  2CA5 A;  5AQM B;  3B13 A;  3UTK A;  2UUB T;  5L4H A;  2JJ9 A;  5J2T E;  2MTQ A;  3OYX A;  3PUG A;  4CN4 A;  4DR2 T;  5AFU L;  3CX7 B;  5L3E B;  2LSJ A;  2LRL A;  3QC9 A;  1D0X A;  2ZM6 T;  4X1Y E;  4YFS A;  2MAW A;  3KIN B;  3T8O A;  3ZT6 A;  5JRC A;  2ZM8 A;  2ACZ A;  4HE8 A;  2XM2 A;  4WNK A;  3A5X A;  3C4W A;  2B76 A;  1VRB A;  1YKE B;  3AE4 A;  4QH4 A;  2XAJ B;  2WU5 A;  2LT3 A;  4ZS2 A;  3E08 A;  1G73 A;  1XWM A;  4WYV A;  2E9X C;  3C4X A;  4DV2 T;  1Z8U A;  4LFC T;  2VKO A;  2W4X A;  3L3P A;  2CCQ A;  1KNR A;  1HS7 A;  2V7L A;  3ZYK A;  2FJE A;  3PTR B;  2V1D B;  2VVN A;  2CPT A;  5EZY E;  4PJJ A;  5AQR B;  4CZZ B;  3LG7 A;  2HPL A;  1LKX A;  3DJB A;  5LJM A;  4JI8 T;  5CA0 E;  5JDH A;  4OX9 T;  1HR0 T;  3AE8 A;  5FXV A;  1BR2 A;  4QH1 A;  4O2B E;  4ILC A;  3ZC0 A;  2D9D A;  2QRX A;  5LB7 B;  5J2U E;  2EHO C;  3RHW A;  3AE3 A;  3ZST A;  5L3G B;  2XSB A;  2DL1 A;  5AQQ B;  1LRZ A;  2WY2 A;  2Q9Q B;  4YLH A;  4HGA A;  2HN1 A;  4DV4 T;  3HR0 A;  3TLW A;  3IEE A;  3I9W A;  3QUJ A;  1WYC A;  4DBR A;  3RH3 A;  2I59 A;  3AE9 A;  1D0Z A;  4G63 A;  1HFA A;  2KWI B;  3ZLI A;  3AEF A;  2WWU A;  2A72 A;  5JDQ A;  4JI1 T;  3FBL A;  3GN5 A;  3K3O A;  3Q2M A;  2X68 A;  2YKS A;  1BR0 A;  4MAL A;  3RC3 A;  4JI2 T;  3GMI A;  2UU9 T;  4ISS A;  3VKG A;  4HFC A;  1G8X A;  4FJO A;  2HHH T;  3C4Z A;  2K48 A;  2KT9 A;  3HKB E;  4GIW A;  4HWC A;  5ADX L;  1QSD A;  2UUA T;  5FL1 A;  4IE6 A;  2CRB A;  4YTN A;  2X9Y A;  5C3J A;  2UXB T;  3AE6 A;  1MMD A;  3JC6 D;  2PFV A;  2W00 A;  3QNU A;  3R84 B;  1ZHC A;  5FXZ A;  5C8Y E;  4C90 A;  2YDQ A;  1NWM X;  4KHP T;  1J5W A;  3ONL C;  3ZMU B;  4HTE A;  1FEW A;  5FY1 A;  4FI5 A;  5JRC B;  4QWN B;  2WDR A;  2ZLY A;  3RPU A;  2DWK A;  3KBT A;  3TKL B;  2WU2 A;  5DAB A;  4UV9 B;  3BQI A;  3PUS A;  2WCA A;  2OLT A;  2XTL A;  4DV6 T;  3FZL B;  5AQU B;  3RGL A;  1YKH B;  4ASK A;  5JR9 C;  3H37 A;  3RRW A;  4EV6 A;  2OA5 A;  2Q9Q D;  2LHN A;  3RI5 A;  4DBQ A;  2E5V A;  2CBJ A;  3QOF A;  2YIN A;  4LMJ A;  2NTY A;  5KX5 E;  3RYF E;  3VRB A;  5F3J A;  1VCT A;  5AQG B;  3GA8 A;  3M65 A;  4HKA A;  1U4Q A;  2ODV A;  2K5B B;  3AE2 A;  4B3R T;  4OYJ A;  2V26 A;  4GK5 E;  4U7I A;  4DUY T;  3OTO T;  4YHJ A;  5LBQ B;  3PDY A;  4EIW A;  2LLY A;  3LDQ B;  3AA0 B;  4LF5 T;  2IW5 B;  3PUR A;  4XBF B;  4I0U A;  1XDP A;  5AQF B;  2A3D A;  5GON E;  4LFB T;  3RX6 A;  5HCM A;  2JMK A;  5LJN A;  4QKN A;  1D1A A;  3SFD A;  1UUR A;  2A2F X;  3ZYL A;  4IDP A;  3O1H A;  4HWD A;  1N36 T;  1WRD A;  1HNX T;  1IBL T;  4YSX A;  3ANW B;  4TWF A;  5LHI B;  3P4W A;  2CXD A;  5ABE A;  2BBH A;  3ZCI A;  4AIU A;  3RIU A;  3ZMT B;  1XNQ T;  2B1E A;  3GN5 B;  3QK6 A;  4JV5 T;  2J47 A;  2WMO A;  1IJ5 A;  3P4S A;  1IAP A;  2V5D A;  3ZJ2 A;  4X65 T;  4DV7 T;  1D1B A;  4EZH A;  3RRC A;  3FXE B;  4QXH B;  1XMQ T;  3PUV F;  2NTX A;  4ZZC A;  5F5W A;  3LBX B;  2NW7 A;  3EHZ A;  4TV9 E;  2H7O A;  3O9X A;  4HFI A;  4ZZB A;  1SA0 E;  5L3D B;  2RP4 A;  2YEV C;  4L9I A;  2R6G F;  5JDN A;  5JQG E;  3AVR A;  4IDO A;  1FJG T;  2Y48 B;  5IYZ E;  2E8I A;  1E7P A;  1CHU A;  2F4V T;  4P0A A;  2UXD T;  4U2Z A;  2LE8 A;  3ZSS A;  5KXJ A;  4UF0 B;  3LK4 2;  4GKK T;  2FUP A;  3FZH B;  5EK4 A;  4DR6 T;  2XQ3 A;  4H9O C;  5HXH A;  2VB6 A;  3RLF F;  4HWI B;  2IML A;  4P0B A;  3PU8 A;  2L3L A;  4JUY A;  2JQ9 A;  5DJQ C;  2FJD A;  3H3M A;  5FXX A;  2D0U A;  2CLY C;  2YN6 A;  1NEK A;  4YXD A;  3TLU A;  3JAD A;  2W61 A;  4UEL A;  5ABG A;  5LGU B;  3VU7 H;  2FBW A;  4IHJ E;  4I4T E;  5L3F B;  1B7T A;  3CVR A;  3PUZ F;  2I0M A;  3RC8 A;  4UV8 B;  2KXP B;  2L8K A;  3CK6 A;  1LVK A;  2CXL A;  4WBN E;  4JI7 T;  2VL0 A;  3AA6 B;  2CEA A;  3ZJ1 A;  2PG8 A;  3FZF B;  3VKH A;  4U33 A;  2XJ7 A;  2BG9 C;  2VQE T;  2X0Y A;  5HAX A;  4ZI3 C;  4X1I E;  3PUA A;  4IE5 A;  4DR1 T;  3WI3 A;  4IE7 A;  3FXD B;  4QXB B;  3DP7 A;  5ETW A;  5LG4 A;  2YK0 A;  1NEN A;  4PJM A;  2WBL A;  2C0S A;  3P4Q A;  2CWO A;  3CIR A;  2WQY A;  3N2K E;  5FP3 A;  4GYS A;  4K0K T;  3KBU A;  2XQ7 A;  3UUX B;  2VK9 A;  4MHC A;  4IL9 A;  4DMW A;  1OED E;  2PJQ A;  4LFA T;  3W15 B;  1W9R A;  4AQF A;  3AAA B;  1L0V A;  3CQG B;  4ZXL A;  2N2N A;  4GK0 E;  3ZN1 B;  1BR4 A;  5AQV B;  5FVL A;  3UFG A;  3C50 A;  3Q5E A;  3NVO A;  1FMW A;  4I50 E;  2NR4 A;  4HN9 A;  4H9S E;  4AQG A;  3K8P C;  2M67 A;  5CGM A;  4O8S A;  2X0L B;  2P9B A;  2LJL A;  5AQL B;  2GK9 A;  1YW0 A;  4UIG A;  2E5L T;  3PU3 A;  3UU8 A;  4ZI2 D;  1M7K A;  4EB6 E;  2LOS A;  5HXE A;  4PJN A;  3B5M A;  4MBQ A;  1N33 T;  1YQ3 A;  1ZKE A;  5LMN T;  3QB5 A;  4AXP A;  4V1A v;  3AEE A;  4LF4 T;  2XAS B;  5LA6 E;  4JEH B;  3AEG A;  3N2O A;  4O4H E;  3SRZ A;  3C98 B;  2C5J A;  1S94 A;  4PK5 A;  5LMU T;  1O3X A;  5E0O A;  2BKN A;  4U72 A;  5AQI B;  4CI1 B;  2C5I T;  4OK0 A;  4X66 T;  3D0T A;  1VOM A;  2QYW A;  3KV6 A;  2X0H A;  1T7S A;  1MIV A;  3IHR A;  1XMO T;  4HWF A;  3PUX F;  2HPJ A;  4H9R C;  4OHF A;  1MND A;  4KUM B;  5J1G A;  1HTJ F;  2HH7 A;  2W2U A;  3LFM A;  4PFO A;  1IBM T;  2NP9 A;  3ZMS B;  3J7Y q;  2IUB A;  3TLV A;  3ANW A;  4GKJ T;  4DUZ T;  2VVS A;  5FNV E;  2V7K A;  4CI2 B;  3SS1 A;  2MYS A;  1KEY A;  3LK2 B;  1YQ4 A;  5JH7 E;  3A8Y C;  4H9P C;  3UU5 A;  2BS4 A;  5HEJ A;  2E9X A;  4B3M T;  4K0U A;  3RKO A;  4EYU A;  2ZM0 A;  4DV3 T;  3AEA A;  4HFV A;  1OED B;  3ESL A;  4CI3 B;  4TWD A;  3WAJ A;  2X51 A;  3UU6 A;  5H6Q B;  3GWH A;  2JQK A;  3LBX A;  5HXR A;  1QUU A;  4IDQ A;  3CML A;  4UVC B;  4F8H A;  3UFE A;  4EXT A;  2DI4 A;  2JQQ A;  4YHH T;  2IDO B;  2W63 A;  4IST A;  5BR8 T;  2XPK A;  4O2A E;  4QHO A;  3CX6 B;  4BAY B;  5L3C B;  1Y64 B;  5JRE A;  5LHH B;  2KIN B;  3L8R A;  2KZ7 B;  3ZMV B;  4UVA B;  5HEU A;  1ZP0 A;  4DND A;  4YSZ A;  2V7J A;  2XAH B;  4UF0 A;  4EEB A;  3P4P A;  4B3T T;  5FY0 A;  1MMG A;  3PJA A;  5J0Z A;  4DV0 T;  4JYA T;  1HNW T;  4DID B;  4CQI A;  2PTF A;  4H9Q C;  1HF8 A;  1JNZ A;  3M3Z B;  5EK2 A;  4TNV A;  3ZYM A;  4HFH A;  3ZC1 A;  2WS3 A;  4I55 E;  3OVU A;  4L5G A;  5KDM C;  4AKL A;  2CHO A;  4U31 A;  4TZ4 C;  1FIO A;  3I0O A;  4LML A;  3R6N A;  2LRK A;  3RIU C;  3AEB A;  1D1C A;  2HN2 A;  2XUE A;  1WFD A;  4L0R A;  1H7C A;  3UU4 A;  4U7Y A;  3JC6 C;  2LSI A;  3ONX A;  4LF8 T;  4U74 A;  4X20 E;  3N9M A;  3ZEF B;  3ZCJ A;  2LOP A;  2X9W A;  4U3C A;  4QX7 B;  3Q5X A;  2X66 A;  2W62 A;  3LSV A;  2JMH A;  4P1N A;  5AQP B;  3KVB A;  2QGS A;  3AA7 B;  3NWI A;  2BVL A;  4NPP A;  3N9N A;  2BS3 A;  4DMV A;  2VWA A;  3KV5 A;  3RYC E;  2ZMA A;  4IT4 A;  5LHG B;  2YOE A;  4X64 T;  2LKH A;  4XAX B;  3BQL A;  1I6Z A;  2AE9 A;  5JVD E;  5HEH A;  5JDM A;  4YY3 T;  3RYI E;  3PV0 F;  5HXC A;  4X5T A;  5ABH A;  3ZKR A;  1HNZ T;  1V9D A;  3RKG A;  4UVB B;  4CN1 A;  3P50 A;  2WAU A;  1ZEE A;  5AQK B;  2Q9Q C;  3C51 A;  2MOZ A;  4PFP A;  3Q5W A;  5HEG A;  4CXY A;  2E9X B;  1U5P A;  2V7I A;  4KMC A;  2VKJ A;  1HX1 B;  3Q9D A;  2G0U A;  3EAM A;  1I94 T;  1UGO A;  2JIW A;  3LJC A;  2M6I A;  2QA7 A;  4PJL A;  4A56 A;  3QB5 K;  4MLK A;  1QLB A;  2ES0 A;  3A7M A;  3ZMZ B;  2AXD S;  2BBJ A;  5FYM A;  3MK7 C;  2ZM2 A;  2LHR A;  4O4I E;  4TV8 E;  5DQV A;  1E2A A;  5CB4 E;  3EI0 A;  5JDL A;  4TX5 A;  3JAF A;  2MBG A;  4DV1 T;  4A5X A;  5LXT E;  4M1P A;  3KV9 A;  3P7I A;  4HWH A;  5AQJ B;  3AED A;  1OXZ A;  4GOU A;  3VRA A;  4KBM B;  3HI2 A;  2IHR 1;  2EHO B;  2V6Y A;  1EZ3 A;  2LSK A;  4ZI7 E;  2K24 A;  4PNI A;  3I0Q A;  4PK6 A;  3SWH A;  2LSG A;  4UXN B;  3H3A A;  2KSR A;  5JTG A;  1IZN B;  4TWH A;  4A98 A;  4DVD A;  2XQ8 A;  2K3W A;  5IHY A;  3MZK B;  2Y8D A;  5ABF B;  1HCI A;  3S4U A;  1YD8 G;  3T1H T;  4OYK A;  1E1H B;  4JBW F;  3I1A A;  4AQF C;  4JI3 T;  3HKC E;  3N9O A;  1UX4 A;  3AB3 B;  4NXN T;  4YJ3 E;  3FBZ A;  5KMG P;  4IE0 A;  5HEO A;  2WB5 A;  1KNP A;  2XQY A;  1BR1 A;  3OYZ A;  3EDU A;  4X62 T; 
#chains in the Genus database with same CATH homology
 1FEW A;  3ETV A;  4O4H E;  5JR9 A;  3SRZ A;  3C98 B;  2C5J A;  1MMA A;  4P09 A;  1S94 A;  3EUH A;  3K3Q C;  3O1I A;  5FY1 A;  4MFR A;  4FI5 A;  4PK5 A;  1O3X A;  3MKD A;  5JRC B;  4QWN B;  2JRK A;  3KFW X;  5E0O A;  4EZ4 A;  2YU2 A;  2ZLY A;  4U72 A;  2J1D G;  3RPU A;  2C5I T;  3B57 A;  4OK0 A;  4CI1 B;  2DWK A;  3KBT A;  3TKL B;  3D0T A;  2ODU A;  2PBI A;  2X67 A;  1VOM A;  2JPF A;  5DAB A;  4ZS3 A;  2RA1 A;  3KV6 A;  4UV9 B;  2E9X D;  3BQI A;  3PUQ A;  2YU1 A;  2KND A;  3KV4 A;  4N78 D;  3PUS A;  1MIV A;  3IHR A;  2XTL A;  2DHR A;  1D0Y A;  2VL8 A;  2HPJ A;  4H9R C;  4IGU A;  1MND A;  4ILU A;  4OHF A;  5JDG A;  1YKH B;  4KUM B;  4KP3 C;  5J1G A;  5LOV E;  1HTJ F;  2HH7 A;  3LFM A;  4PFO A;  4ASK A;  4F6R C;  1WR6 A;  2BVM A;  3N9P A;  2KLQ A;  3UUL A;  5JR9 C;  2NP9 A;  3H37 A;  4GYR A;  3ZMS B;  4EAH A;  3J7Y q;  3RRW A;  5L2L A;  2NW9 A;  3ZN0 B;  2OA5 A;  3ANW A;  2Q9Q D;  2LHN A;  4DBQ A;  5FNV E;  5HWX A;  2YIN A;  1HG2 A;  3AA1 B;  2V7K A;  4BJN A;  4CI2 B;  4AKG A;  3ETU A;  1MIY A;  3SS1 A;  3OBV E;  2NTY A;  2MYS A;  5KX5 E;  5CA1 E;  4WBO A;  3RYF E;  3CWZ B;  5F3J A;  5LBM A;  4XZC A;  3SOL A;  3LK2 B;  5JH7 E;  3CQC B;  1T98 A;  4IE4 A;  3GA8 A;  1S35 A;  2SPC A;  3F2E A;  4H9P C;  4ZI3 D;  2E9X A;  4I43 B;  4K0U A;  3M65 A;  3VHL A;  2DCF A;  3KVA A;  4HKA A;  3RKO A;  4EYU A;  3UT5 E;  1U4Q A;  2ODV A;  1KNZ A;  3NRX A;  2K5B B;  2XHE B;  4J2C A;  2ZM0 A;  2EHO D;  4HFV A;  5JR9 B;  5LGT B;  4OYJ A;  4DO0 A;  1US7 B;  2V26 A;  1KK7 A;  3ESL A;  4GK5 E;  4CI3 B;  2C5K T;  4Z8X A;  3WAJ A;  4AKI A;  2X51 A;  4ADZ A;  2WSS V;  4YHJ A;  5H6Q B;  3GWH A;  4ERR A;  3AAI A;  5A1L A;  3F31 A;  3FHN A;  5LBQ B;  4C91 A;  2N1G A;  4E7Z A;  3PDY A;  4EIW A;  2W0G A;  3LBX A;  5HXR A;  5H6R B;  1QUU A;  1HX8 A;  2Q9Q A;  3MXZ A;  3CX8 B;  3AA0 B;  5HXS A;  2IW5 B;  3CML A;  3NZQ A;  3PUR A;  3N9Q A;  4ANJ A;  4UVC B;  3E0Z A;  2XAG B;  4XBF B;  3UFE A;  4EXT A;  2DI4 A;  2JQQ A;  2W63 A;  2A3D A;  4IST A;  2Z6E A;  5GON E;  4B6X A;  3IF8 B;  4O2A E;  1NAF A;  3RX6 A;  4QHO A;  3CX6 B;  4BAY B;  1ZV4 X;  2IC6 A;  2JMK A;  4EYY R;  3BQK A;  2XAF B;  5LJN A;  5L3C B;  1Y64 B;  4QKN A;  1D1A A;  3ZPO A;  2V7M A;  5JRE A;  2A2F X;  5LHH B;  3N5L A;  4EOZ B;  2KIN B;  5FMN A;  3ZYL A;  2L9Q A;  3O1H A;  1WRD A;  4BA9 A;  2KZ7 B;  2XAQ B;  4HEA A;  3RYH E;  3N9L A;  2X9H A;  3CKD A;  4UEM A;  3ZMV B;  4TUY E;  4IDZ A;  4UVA B;  2UXX B;  3ANW B;  3L09 A;  4DND A;  5LHI B;  1MMN A;  2BDE A;  2V7J A;  2N9D A;  2XAH B;  4UF0 A;  2H7V C;  3CQX C;  3AAE B;  2CXD A;  2LM9 A;  2CWY A;  4ZOL E;  2CXF A;  3HKE E;  3FB2 A;  2DLR A;  3O4X E;  5FY0 A;  2X9X A;  5F8P A;  4OFZ A;  3ZCI A;  1MMG A;  3ZMT B;  2B1E A;  3GN5 B;  1UX5 A;  3QK6 A;  2WMO A;  3WAK A;  1IJ5 A;  5DQW A;  1HG5 A;  4CQI A;  1IAP A;  2WMN A;  5FXW A;  5LNK A;  5BMV E;  3ZJ2 A;  4PK4 A;  4H9Q C;  1HF8 A;  3AVS A;  4H63 H;  1D1B A;  2NWB A;  4ZHQ E;  2CA5 A;  4EZH A;  5EK2 A;  5HYA A;  3ZYM A;  1MNE A;  3RRC A;  2K9A A;  3FXE B;  3ZC1 A;  3B13 A;  3UTK A;  4QXH B;  2NTX A;  4I55 E;  2JJ9 A;  3NBX X;  5J2T E;  2MTQ A;  4L5G A;  5KDM C;  4AKL A;  3LBX B;  2NW7 A;  3OYX A;  4TZ4 C;  2KWH A;  1FIO A;  3PUG A;  4TV9 E;  2H7O A;  3O9X A;  3I0O A;  3R6N A;  4NUV A;  1SA0 E;  5L3D B;  2RP4 A;  2YEV C;  1D1C A;  2XUE A;  2LEH A;  4L9I A;  5AFU L;  4L0R A;  3CX7 B;  3P8C D;  5L3E B;  2LSJ A;  1H7C A;  2LSY A;  5JDN A;  5JQG E;  3AVR A;  4ZI2 C;  3QC9 A;  3JC6 C;  1D0X A;  3CPZ A;  2CMR A;  2Y48 B;  2LSI A;  4PAG A;  2E8I A;  4X1Y E;  5IYZ E;  4YFS A;  3ONX A;  4U74 A;  4X20 E;  3KIN B;  1SHZ C;  3MJX A;  3N9M A;  3HA4 A;  3T8O A;  3ZEF B;  2IC9 A;  3ZCJ A;  4P0A A;  5JRC A;  2ZM8 A;  2LE8 A;  4HE8 A;  2LOP A;  2X9W A;  3LK3 B;  4WNK A;  3E22 E;  3A5X A;  3C4W A;  4QX7 B;  3PE0 A;  3Q5X A;  4UF0 B;  2X66 A;  2CE7 A;  1VRB A;  2W62 A;  3LK4 2;  1UCU A;  1YKE B;  2DWG A;  4JLE A;  2JMH A;  5EK4 A;  3KVB A;  4H9O C;  2QGS A;  5HXH A;  2VB6 A;  4G2A A;  3AA7 B;  2BVL A;  2XAJ B;  5L3B B;  2VKH A;  2DNX A;  3N9N A;  4H63 V;  4DMV A;  2LT3 A;  2VWA A;  4P0B A;  3KV5 A;  3PU8 A;  5FY7 A;  3RYC E;  2ZMA A;  4ZS2 A;  2KMF A;  2L3L A;  5LHG B;  5LCY A;  3E08 A;  4JUY A;  1G73 A;  2CM0 A;  5DJQ C;  4AI6 A;  5FXX A;  2D0U A;  2E9X C;  3C4X A;  2CLY C;  3F57 A;  2VKO A;  2W61 A;  4UEL A;  4XAX B;  3BQL A;  3L3P A;  2CCQ A;  5LGU B;  5JVD E;  2D5U A;  3VU7 H;  1HS7 A;  2V7L A;  3ZYK A;  3PTR B;  3U78 A;  5JDM A;  2V1D B;  2EHO A;  4H9N C;  4IHJ E;  3OJA A;  5EZY E;  2BZB A;  4I4T E;  5L3F B;  4PJJ A;  3RYI E;  1B7T A;  3CVR A;  5HXC A;  4CZZ B;  3EVY A;  3LG7 A;  2HPL A;  3RC8 A;  4WW0 A;  1LKX A;  1V9D A;  4UV8 B;  4UVB B;  2KXP B;  2L8K A;  2WAU A;  3DJB A;  4QX8 B;  1ZEE A;  3EDV A;  1LVK A;  2CXL A;  5LJM A;  2Q9Q C;  3C51 A;  3O1J A;  5CA0 E;  2MOZ A;  5JDH A;  4WBN E;  4QXC B;  5FXV A;  4PFP A;  1BR2 A;  3AA6 B;  2CEA A;  3Q5W A;  3ZJ1 A;  4CXY A;  2E9X B;  2CLY B;  2PG8 A;  3MAC A;  3VKH A;  1U5P A;  2V7I A;  4KMC A;  2VKJ A;  3Q9D A;  4O2B E;  2G0U A;  3ZC0 A;  3K3N A;  2UXN B;  4NUU A;  1MIW A;  5HAX A;  3LJC A;  2QA7 A;  4PJL A;  4ZI3 C;  1LVF A;  4X1I E;  5J2U E;  3PUA A;  4IE5 A;  4A56 A;  5LP6 E;  4MLK A;  3I9Y A;  4O4L E;  2EHO C;  3MA9 A;  2ES0 A;  3WI3 A;  3ZMZ B;  3KDS E;  4IE7 A;  4X1K E;  5L3G B;  3FXD B;  5FYM A;  3J9X 1;  4QXB B;  3DP7 A;  3MK7 C;  4JEU B;  2ZM2 A;  5ETW A;  2LHR A;  5LG4 A;  2YK0 A;  4O4I E;  1LRZ A;  4PJM A;  3V5S A;  1AJ3 A;  2Q9Q B;  2WBL A;  2C0S A;  4TV8 E;  4YLH A;  2IAK A;  5DQV A;  5CB4 E;  4HGA A;  5JDL A;  4CXW A;  4TX5 A;  2MBG A;  2CWO A;  5TAO A;  3DTO A;  4YJ2 E;  3N2K E;  5FP3 A;  3HR0 A;  4GYS A;  5LXT E;  3UUM A;  3IEE A;  3I9W A;  4M1P A;  3QUJ A;  3BK9 A;  3KBU A;  3KV9 A;  3P7I A;  4PW8 A;  1WYC A;  4DBR A;  3RH3 A;  2I59 A;  1FMV A;  3UUX B;  2VK9 A;  2Y6X A;  4MHC A;  2D2S A;  4DMW A;  1OXZ A;  3U3I A;  2PJQ A;  1D0Z A;  4GOU A;  4KBM B;  4G63 A;  3W15 B;  3HI2 A;  1HFA A;  3NRY A;  2EHO B;  2KWI B;  4AQF A;  1EZ3 A;  3ZLI A;  2LSK A;  4ZI7 E;  5M4Y A;  2WWU A;  3AAA B;  2A72 A;  2K24 A;  4PNI A;  3CQG B;  5JDQ A;  1X79 A;  2N2N A;  4GK0 E;  5JDF A;  5EK3 A;  3I0Q A;  3FBL A;  3ZN1 B;  1BR4 A;  4PK6 A;  3SWH A;  3GN5 A;  3NZP A;  4BJM A;  3C50 A;  2LSG A;  3K3O A;  3H3A A;  3Q2M A;  2X68 A;  4UXN B;  1BR0 A;  4MAL A;  1IZN B;  1FMW A;  2WM9 A;  4I50 E;  5LGN B;  3RC3 A;  2NW8 A;  3GMI A;  4ISS A;  4DVD A;  1WLX A;  2VKD A;  4HN9 A;  5HWY A;  4H9S E;  3VKG A;  4AQG A;  3K8P C;  3V5U A;  2M67 A;  5IHY A;  3MZK B;  2Y8D A;  1G8X A;  4FJO A;  1HCI A;  3C4Z A;  2K48 A;  4O8S A;  3HKD E;  3S4U A;  1YD8 G;  2H3R A;  4AKH A;  2KT9 A;  3HKB E;  4GIW A;  2X0L B;  4OYK A;  5ADX L;  2P9B A;  4O4J E;  4AKR B;  5LYJ E;  1QSD A;  2ACX A;  2LJL A;  2GK9 A;  1E1H B;  1YW0 A;  4UIG A;  1WYB A;  4IE6 A;  3I1A A;  4TN7 B;  4AQF C;  3HL6 A;  1CUN A;  2X9Y A;  3PU3 A;  3C64 A;  1IJ6 A;  1OWA A;  2VAS A;  4ZI2 D;  1MMD A;  3JC6 D;  2PFV A;  3HKC E;  4EB6 E;  3N9O A;  2W00 A;  1UX4 A;  3AB3 B;  2LOS A;  3IBP A;  3R84 B;  4YJ3 E;  5HXE A;  3OKQ A;  3FBZ A;  1ZHC A;  4IIJ E;  4PJN A;  5FXZ A;  1Z0P A;  3UUN A;  5KMG P;  3N2G E;  2D0T A;  5C8Y E;  4MBQ A;  4CXX A;  4C90 A;  1NWM X;  1ZKE A;  4IE0 A;  4AXP A;  4E7S A;  2XQY A;  2NOX A;  4V1A v;  1BR1 A;  3OYZ A;  2XAS B;  5LA6 E;  4JEH B;  3EDU A;  3ZMU B;  3N2O A;  4HTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...