1ZHCA

Solution structure of hp1242 from helicobacter pylori
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
b'MFHEFRDEISVLKANNPHFDKIFEKHNQLDDDIKTAEQQNASDAEVSHMKKQKLKLKDEIHSMIIEYREKQKSERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein HP1242
publication title Solution structure of HP1242 from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04325 DUF465 Protein of unknown function (DUF465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zhcA00
1ZHCA
chains in the Genus database with same CATH superfamily
4LMJA 2NOXA 5AQVB 1CUNA 4TWDA 1HX1B 4AKHA 4X66T 2XTLA 4IDPA 4ISTA 3KVAA 1NENA 5L4EA 4GKKT 2KNDA 1JNZA 3LJCA 4HTEA 1MMGA 3CWZB 4XBFB 3QNUA 4CZZB 4N78D 4TV9E 2J62A 4IE5A 5LG4A 4H9NC 5LMNT 3W15B 2RPAA 5TAOA 3EHZA 4G2AA 2JMHA 2YDRA 3WAJA 2CLYC 3MXZA 3ZCJA 4ZZBA 3RI5A 3RKOA 5FL1A 4PFPA 1VRBA 2VL0A 5HXHA 2GK9A 3AE7A 3AXJB 4YY3T 3NRXA 4U7YA 3ETUA 3DJBA 5AQUB 1ZV4X 2RA1A 3AEBA 3ZMVB 4CXWA 2HPLA 2BG9C 2CPTA 5JDMA 2F4VT 5L2LA 1UX4A 1WFDA 2DWKA 5AFUL 3RGLA 4NUVA 2X66A 3L39A 3P7IA 3PDYA 5AQSB 2BG9E 4QXHB 1E2AA 3NKZA 5LGTB 4Z90A 4IIJE 3E0ZA 4JI1T 5F3JA 2X51A 2UXNB 2XAHB 3MZKB 4V1Av 5AQPB 4JI8T 3Q2MA 5AQOB 4U72A 5HXEA 4ISSA 5L3GB 2YKSA 4ZEYA 5L3FB 4O4IE 1OEDE 2BKPA 2C0SA 3HKEE 3ESLA 1KK7A 1WR0A 2JRKA 5LGUB 4KHZF 2R6GF 2XSAA 4O4LE 1SHZC 4DV5T 5JQGE 2JMKA 3CQGB 4JBWF 3TLWA 4IE4A 1HTJF 3Q5EA 5JTGA 2WWVA 1Y64B 3DP7A 1LVKA 3M65A 1HNZT 3MJXA 2WM9A 1WYBA 2DHRA 2X0HA 2PTFA 2XQ7A 2Q9QB 1HX8A 2CEAA 3KV4A 4HWFA 4PNIA 2OV9A 3OBVE 3K3NA 5HWYA 2IAKA 4NXNT 1HCIA 3UQ4A 4ANJA 2AXDS 3RLFF 3OKQA 2IDOB 4B3RT 3G06A 1V9DA 4AKLA 1IJ6A 3KVBA 3UUXB 1Z0PA 3P4WA 2XPKA 4JV5T 5HXCA 1J1JA 3IHRA 4JI7T 2V6YB 2WZHA 1I94T 4DR2T 1ZP0A 3TKLB 2IHR1 4X65T 4BAYB 4MBQA 5CFBA 2CA5A 4CI2B 4EZ4A 3T1HT 3SRZA 2H88A 5HWXA 2X9XA 1XDPA 3ZJ2A 2Z6EA 2CCQA 1SUMB 3I0QA 4HWDA 3JAFA 2BVMA 3RC3A 2DL1A 1KFYA 2Y8DA 2K48A 3PJAA 2D2SA 3I0OA 5ABGA 3PUAA 5AQNB 2HN2A 2J4GA 1YD8G 3AECA 5HEGA 4H63V 4B3TT 5E0OA 5J1GA 2EHOA 4UVCB 2ZMAA 4MFRA 2LKGA 5J2UE 3TLUA 1J5ET 3PE0A 1W9RA 1N34T 4EZHA 3EDVA 3AA0B 2ZM8A 5GONE 4MLKA 2FBWA 2VB6A 2X68A 2JIWA 5KDMC 1FMVA 3C51A 5LBQB 2Y48B 2D9DA 3P50A 3C4XA 4ILBA 4PK6A 2XHEB 4LMLA 4TWHA 3U3IA 1UGOA 4EYUA 3ZYLA 5AQGB 3RYCE 3ZMUB 2SPCA 4MALA 3ANWA 1MMAA 4X1KE 2FJAA 4AISA 3PUWF 4ZHQE 5IHYA 4YFSA 2XAGB 1BR4A 3C64A 4OX9T 1M7KA 4CI3B 1MIVA 4H9PC 3HL6A 4PK5A 5BMVE 4DBQA 5F8PA 3O1HA 2Q9QA 2CHOA 4HFCA 3E08A 2FJEA 1E7PA 4XZCA 3WAKA 3KV6A 4TNWA 3VR9A 4IDNA 3ZYKA 1IBMT 2JQ9A 4P0BA 3UU6A 3OJAA 2WAUA 3ZSTA 4AQFC 4HFIA 2VKOA 3UULA 1OEDB 2N2NA 3PTRB 1AJ3A 2CMRA 3KV5A 5KMGP 2HH7A 1MNEA 5F5WA 2BS4A 4YSYA 3ZT5A 5AQFB 1BR1A 1UX5A 3PU8A 2LSJA 2P9BA 3BQKA 1XNRT 1KF6A 4GK0E 2V7MA 4A98A 2V6YA 5JDFA 5C8YE 2CWOA 1FJGT 3VU7H 5HYAA 3AEAA 1QSDA 3RF1A 2WS3A 5JR9A 3PU3A 1FEWA 5AQQB 2W0GA 2WP9A 3CK6A 4HN9A 2VURA 1VCTA 3K3OA 5A1LA 4L5GA 2VASA 1IZNB 1YKEB 3AB3B 1MIYA 5JDNA 3RHWA 2G0UA 5HCJA 2E9XC 3CIRA 5AQKB 1JNRA 4AKIA 2JQHA 5C2TA 2C5IT 1LRZA 4CN6A 3RYIE 4QX7B 5JVDE 4GKJT 4JI3T 2UU9T 4DMVA 5LYJE 2WCAA 4DV0T 5AQTB 3ZYMA 3S4UA 4YHHT 3UU3A 2UXBT 2UXXB 3EAMA 2ACXA 1XNQT 4YTMA 2PBIA 2M6IA 4YSXA 4WZXA 1R8IA 5L3BB 3OTOT 3ZC0A 3QOFA 5FY0A 1UURA 4HWCA 4U2YA 4YT0A 2ACZA 2LT3A 4LF5T 4DR6T 4TWFA 2V26A 3N9QA 2DWGA 3ZEFB 1D0ZA 3ONLC 1S94A 2W00A 2ES0A 4ZI3D 5LJNA 2W4XA 3B13A 3P4SA 2CE7A 3RQUA 2DLRA 3ZT7A 2E9XD 2YINA 2KWHA 4JI2T 2YU1A 2DCFA 3CPZA 4EIWA 2QGSA 2YK0A 3IA3A 2X9HA 2X67A 5LNKA 1VCSA 4HE8A 5FVLA 4LF6T 5BR8T 2H3RA 3HKBE 3AEDA 1G8XA 3LSVA 3VKGA 2V7KA 2YEVC 4I4TE 1D0YA 2BG9A 2KZ7B 3C4ZA 3WI3A 1WLXA 4FI5A 3P4PA 5JH7E 4KX6A 5HEHA 4ZI2D 3O9XA 2D0UA 3RIUA 5JREA 2VKHA 1NWMX 4O4JE 2XQ5A 5CB4E 3CVRA 2EHOB 4YJ2E 4U74A 2KLQA 1FIOA 5LCYA 4DR4T 2PFVA 3L09A 5ADXL 2QRXA 3AA6B 2KXPB 4IDOA 4GOUA 3RH3A 4ZS3A 3AEEA 4ILUA 1OEDA 3ABVA 1ZOYA 2K9AA 4QX8B 1XMQT 5ABEA 4WBNE 3AE1A 4HEAA 1T98A 3O1IA 1I6ZA 2YN6A 4UV9B 4IDZA 3CX6B 2WDRA 2XY8B 2H7VC 1GQEA 4ASKA 3FXEB 3C4WA 2LOSA 1D0XA 3V5UA 5J2TE 4ADZA 4U7IA 3AE5A 4JEUB 4I43B 4IL9A 4UF0A 2XQ8A 4IE7A 2WQYA 3UTKA 5EK4A 4B3ST 3KBUA 5HEJA 3ZJ1A 4A56A 3N2KE 5CA1E 3ANWB 2NR4A 2PJQA 5JRCB 4IT4A 5EZYE 4F6RC 4QXBB 3ZLIA 5LA6E 4JI6T 3LK2B 4U2ZA 4AI6A 3NZPA 4UVAB 4LF9T 2CXFA 2N1GA 2QVAA 4B3MT 3EVYA 5LHHB 4DUYT 1B7TA 3LK3B 4QHOA 1HFAA 2AE9A 2BBJA 4I50E 4COFA 4QWNB 5FP3A 3AE9A 4UEMA 1KEYA 5HAXA 4TN7B 1YKHB 4TX5A 2UUBT 2UUAT 2CM0A 2V5CA 4X62T 2JQQA 4GK5E 3F31A 4KBMB 1HR0T 4PJMA 3Q5XA 2YOEA 4HFDA 2V8SV 3FZLB 1UK5A 4LF8T 1FMWA 4GYRA 5FXVA 2CRBA 1N36T 2E9XB 2BVLA 2LHRA 2XAFB 2LSYA 3E22E 5JR9B 5JDLA 3PURA 1YXRA 4E7ZA 3L8RA 4NIQA 2VL8A 2VKJA 3KDSE 4OHFA 2NTXA 4U33A 5EK2A 1YQ4A 2N9DA 2LSIA 2YDSA 1CHUA 4TV8E 4DV6T 3AE6A 4HWHA 5FKYA 1LKXA 2X0YA 3EDUA 1Y01A 3KFWX 2JQKA 2WU5A 4K0UA 4NXMT 1S35A 2WZIA 3ZPOA 1MNDA 2HPJA 3JAEA 4CXYA 5H6QB 2VVSA 3ONXA 5DQVA 1MMNA 2ZM2A 2WDQA 4O2AE 5LJMA 3MA9A 3CMLA 4AKGA 4Q25A 3R84B 4QH4A 2MOZA 4Z91A 2V5DA 5L3DB 4L9IA 3N5LA 1VOMA 1IJ5A 2VWAA 2ODUA 2IC9A 3CQXC 5L4HA 1UCUA 3O1JA 3N9LA 2LEHA 2I0MA 2RP4A 4P0AA 3FZMB 2JPFA 5L3EB 3DTOA 1YW0A 4EXTA 4I55E 5LOVE 2CXDA 4YJ3E 3CX8B 1UUSA 5LB7B 2LLYA 4LFBT 4UR9A 1QLBA 2BKNA 3IBPA 3O4XE 3PUVF 2FJBA 3N2OA 3JADA 3A7MA 2XAJB 4OK0A 1US7B 3FZKB 2CLYB 4DV4T 2UXDT 2E5VA 4P09A 3RKGA 4LFCT 2WBLA 2C5JA 3IF8B 5C3JA 4DV3T 1ZEEA 2WMNA 5JRCA 1X79A 1OWAA 2V7IA 4PJJA 2LRKA 3VRAA 4JI0T 2BG9B 2UXCT 3R6NA 5DQWA 3ZCIA 3NZQA 3UFGA 4LFAT 2I6HA 3N9OA 4OFZA 3UU4A 5AQJB 5HXRA 4ERRA 3H3MA 3RQWA 3VR8A 2XQ6A 2LJLA 3AE8A 1IBLT 1HF8A 4DBRA 4JLEA 5ABHA 2V7LA 2XASB 4Z8XA 4GYSA 4KUMB 2J47A 2K5BB 2E2AA 2WY2A 3ZMZB 4CI1B 4TNVA 2E9XA 2A3DA 3TLSA 2E8IA 2W66A 2XJ7A 4UVBB 4PJNA 4HWIB 2DNXA 4DR7T 4J2CA 2PG8A 3RRCA 3GA8A 3B57A 2OLTA 4UF0B 1BR0A 3X1DA 3ZMSB 5FY1A 5AQLB 4JEHB 2WWUA 3BQLA 4I0UA 3AAAB 5H6RB 2CXLA 4YLHA 3GN5A 4IHJE 5FY7A 4M1PA 1H7CA 4DV1T 3AEGA 3FZHB 1MIWA 3QB5K 3I9WA 4YSZA 2MBGA 3MK7C 3PJAJ 4PFOA 3N9PA 3LFMA 5KXJA 2B76A 2J1DG 1HG2A 4BJMA 1NAFA 3FZFB 2A2FX 2KWIB 3QC9A 4ZI7E 4DV7T 2LRLA 4X1IE 3TLVA 2BS2A 5FVKA 2I59A 1U4QA 4JI4T 2ZM0A 3I1AA 2YU2A 3HI2A 2WDVA 1SE7A 5IYZE 3K8PC 3D0TA 5FYMA 1BR2A 1HNXT 1LVFA 5FXZA 3VHLA 3PUXF 2LM9A 3ZSSA 3HR0A 2VVNA 4IDQA 1O3XA 4DNDA 2MYSA 4X64T 4PW8A 2LOPA 3AE4A 1T7SA 3V5SA 4CXXA 2IC6A 3P8CD 3SS1A 2VQFT 3FHNA 1G73A 3N9MA 2V6XA 3OYXA 2XQAA 2BZBA 5CJ5A 4H9OC 3UUMA 4IE6A 4YHJA 3ZN1B 5J0ZA 2H89A 2FUPA 2X9YA 3AE2A 2W62A 3VRBA 2X9WA 4YTPA 3P4RA 1KNPA 2UUCT 2K3WA 3LBXB 2VKDA 4X20E 3HKDE 3C50A 1KNZA 5ABFA 3J7Yq 4UELA 4GIWA 3EABA 2NP9A 5LHGB 3VKHA 4H9QC 4PK4A 1ZHCA 4DUZT 2JJ9A 4EGWA 4PAGA 1J5WA 4YXDA 3KINB 4QXCB 4DR5T 5AQRB 4JI5T 3SWHA 3ZT6A 4OYKA 4ZOLE 1X9BA 2KINB 3K1SA 5LBMA 4CQIA 3PUQA 3PUYF 3KV9A 3FBZA 2W67A 2FJDA 4XAXB 1XZYA 5AQMB 3RIUC 5JDHA 5JDQA 3ZKRA 4ZZCA 3F2EA 2BBHA 4WW0A 1IAPA 1OEDC 3CX7B 4CN4A 3UT5E 4AQYT 5M4YA 2CBIA 1HS7A 4QKNA 2A9UA 2A72A 2WSSV 3Q5WA 5HEUA 4B6XA 2NTYA 3TLTA 3OVUA 4E7SA 3UUNA 5IWAT 3RYHE 1XDOA 1QUUA 2IMLA 4WNKA 3BK9A 2XQ9A 5IUXA 3EI0A 3RIAA 2KMFA 2XUEA 1SA0E 4O4HE 4U31A 4BJNA 4UV8B 5LHIB 4A97A 2NW7A 4JYAT 2YDQA 5FL0A 1KNRA 2IUBA 1WCRA 5CGMA 3AA7B 5HEOA 4IGUA 5FNVE 5JDGA 3AEFA 2WB5A 4EYYR 3RRWA 4KHPT 1D1BA 5AQIB 3B5MA 2BS3A 2NW9A 4QH1A 5FMNA 3N9NA 3NRYA 4AIUA 3H37A 3UU5A 2XAQB 3OYZA 3RC8A 2BDEA 2B1EA 3L3PA 3P4QA 4ZS2A 3ZN0B 3JC6C 2ZLYA 1IBKT 5DJQC 4EOZB 4PJLA 4X5TA 2Y6XA 4IE0A 4IL4A 4O2BE 3I9YA 3MKDA 4G63A 3ZC1A 5CA0E 4K0KT 4EEBA 4ILAA 3A8YC 3GN5B 2LSKA 2C5KT 5HCMA 4ILCA 4LMKA 2M67A 1OXZA 3GMIA 3N2GE 3LBXA 2IW5B 5FXXA 1ZKEA 4WYVA 4H9RC 3T8OA 4DMWA 2L3LA 2DI4A 3UUBA 1T8BA 4CN1A 3FB2A 2ODVA 4HGAA 5AQHB 3AXJA 4YTNA 4HFBA 2CWYA 4DO0A 2LKHA 3NVOA 3FXDB 2HN1A 3JC6D 3NWIA 4HKAA 4AQGA 3SFDA 3BQIA 4U3CA 1NEKA 5LGNB 5FXWA 5LMUT 4UXNB 2ZM6T 5L47A 3AVSA 1L0VA 3QB5A 3CQCB 4LF7T 4LF4T 4HFVA 3PUGA 2EHOC 3LG7A 2XZEA 3LK42 2LM2A 2KSRA 1WR6A 4QH5A 4AXPA 1HNWT 5LXTE 3NBXX 3T1YT 2MAWA 1HG5A 2K24A 2MTQA 5LG3A 4AQFA 3AVRA 4DIDB 3EUHA 1WRDA 1D1CA 2H7OA 3MACA 4EV6A 1EZ3A 3J9X1 2XQYA 2IIUA 4P1NA 2OA5A 2M6BA 3QK6A 4O8SA 1E1HB 1N32T 2V1DB 2MPKA 1U5PA 5LP6E 1YQ3A 3AE3A 2WMOA 2LE8A 3F57A 1W0AA 3PV0F 4UIGA 5ABFB 1WYCA 2EHOD 2W2UA 4JUYA 2LHNA 4DVDA 3CKDA 4WBOA 3OPCA 4C91A 2VQET 5ETWA 4TUYE 2XM2A 3M3ZB 2CBJA 4A5XA 3JCFA 4HFEA 4EAHA 2Q9QC 2D5UA 4L0RA 1W09A 4HFHA 3QUJA 4KI0F 3LDQB 1Z8UA 3SOLA 4ZXLA 3Q5DA 3FBLA 2WU2A 3A5XA 1W0BA 5L3CB 3UFEA 1T72A 2NW8A 3HA4A 2XQ3A 1N33T 1XMOT 4F8HA 4MHCA 5DABA 2V7JA 3H3AA 2QA7A 1MMDA 3Q9DA 3RYFE 3RX6A 4DR1T 2XSBA 2KT9A 4ZI3C 4FJOA 3ZMTB 3KBTA 2NWBA 3PUSA 5HXSA 4X1YE 3AA1B 5KX5E 1DU2A 2QYWA 1M62A 2L8KA 2L9QA 3ETVA 1D1AA 5JR9C 4NPPA 2E5LT 4C90A 2VK9A 3IEEA 3HKCE 4KMCA 2W61A 4KP3C 4EEDA 3GWHA 3UU8A 3U78A 4DR3T 4OYJA 4BA9A 3C98B 2D0TA 2Q9QD 4EB6E 4NUUA 2XQ4A 2LSGA 3ONJA 4TZ4C 3SFEA 2HHHT 2CHNA 4DV2T 5EK3A 3AAIA 3UQ7A 3K3QC 2BKOA 2XM1A 4IREA 4ZI2C 4H9SE 3AAEB 3RIFA 2X0LB 2W63A 4H63H 3RPUA 4AKRB 1XWMA 3PUZF
chains in the Genus database with same CATH topology
2NOXA 3ONXA 3CX7B 5DQVA 4AQFC 3UT5E 5M4YA 1MMNA 2ZM2A 1CUNA 4O2AE 2VKOA 1HS7A 4QKNA 3UULA 5LJMA 2N2NA 3MA9A 3PTRB 1AJ3A 3CMLA 2CMRA 2A72A 4AKGA 2WSSV 3KV5A 5KMGP 3R84B 3Q5WA 4AKHA 2MOZA 2XTLA 2HH7A 1MNEA 4B6XA 5L3DB 4ISTA 2NTYA 1BR1A 1UX5A 3KVAA 3PU8A 2LSJA 2P9BA 3BQKA 2KNDA 4L9IA 4E7SA 3N5LA 4GK0E 3UUNA 1VOMA 1IJ5A 3LJCA 2V7MA 2VWAA 3RYHE 1QUUA 2ODUA 2IC9A 3CQXC 4WNKA 3BK9A 5JDFA 1UCUA 5C8YE 4HTEA 1MMGA 3O1JA 2CWOA 3N9LA 2KMFA 3VU7H 5HYAA 2XUEA 3CWZB 4XBFB 2LEHA 1QSDA 4CZZB 2RP4A 4N78D 4TV9E 1SA0E 4P0AA 5JR9A 4O4HE 2JPFA 5L3EB 4BJNA 3PU3A 1FEWA 4IE5A 4UV8B 3DTOA 5LG4A 5LHIB 1YW0A 2NW7A 4H9NC 2W0GA 4I55E 4EXTA 5LOVE 4HN9A 3W15B 2CXDA 4YJ3E 3CX8B 5TAOA 3AA7B 4IGUA 5FNVE 4G2AA 5JDGA 2JMHA 3K3OA 5A1LA 3WAJA 4EYYR 4L5GA 3IBPA 2VASA 3O4XE 2CLYC 3MXZA 3N2OA 3ZCJA 1IZNB 1YKEB 3AB3B 1MIYA 3RRWA 5JDNA 2XAJB 2G0UA 3RKOA 4OK0A 1US7B 2CLYB 4PFPA 1D1BA 1VRBA 5HXHA 2GK9A 2NW9A 2E9XC 4P09A 4AKIA 3NRXA 2WBLA 2C5JA 3N9NA 3IF8B 5FMNA 3NRYA 2C5IT 3H37A 1LRZA 2XAQB 3RYIE 4QX7B 5JVDE 1ZEEA 3ETUA 3DJBA 1ZV4X 2WMNA 2RA1A 3OYZA 3ZMVB 5JRCA 3RC8A 1X79A 4CXWA 1OWAA 2HPLA 2BDEA 4DMVA 5LYJE 2B1EA 3L3PA 5JDMA 2V7IA 4PJJA 4ZS2A 3ZN0B 5L2LA 3JC6C 3ZYMA 1UX4A 2DWKA 3S4UA 2ZLYA 5AFUL 2UXXB 5DJQC 4EOZB 4PJLA 2ACXA 2PBIA 2Y6XA 3R6NA 5DQWA 3ZCIA 3NZQA 4NUVA 2X66A 4IE0A 3P7IA 3PDYA 4O2BE 5L3BB 3I9YA 3MKDA 3ZC0A 4G63A 4QXHB 3ZC1A 5FY0A 5CA0E 5LGTB 3N9OA 4IIJE 4OFZA 3E0ZA 3GN5B 2LSKA 2C5KT 5HXRA 4ERRA 5F3JA 2X51A 2UXNB 2LT3A 2XAHB 2M67A 2V26A 3MZKB 4V1Av 3N9QA 2LJLA 1OXZA 2DWGA 3GMIA 1D0ZA 3ZEFB 3Q2MA 1S94A 2W00A 2ES0A 1HF8A 4U72A 4ZI3D 3N2GE 5HXEA 5LJNA 4ISSA 3LBXA 5L3GB 4DBRA 3B13A 2IW5B 4JLEA 5FXXA 2V7LA 2XASB 1ZKEA 2CE7A 2DLRA 4H9RC 4Z8XA 3T8OA 4GYSA 4DMWA 2L3LA 4KUMB 2E9XD 2YINA 2KWHA 2DI4A 5L3FB 3FB2A 4O4IE 2YU1A 2K5BB 2ODVA 4HGAA 2DCFA 3CPZA 4EIWA 2QGSA 2C0SA 3ZMZB 3HKEE 3ESLA 4CI1B 2YK0A 1KK7A 2JRKA 5LGUB 2X9HA 2CWYA 4DO0A 2E9XA 4O4LE 2A3DA 1SHZC 2E8IA 2X67A 5JQGE 3FXDB 5LNKA 2JMKA 4UVBB 4HE8A 3JC6D 4PJNA 3CQGB 2DNXA 4HKAA 1HTJF 2H3RA 3HKBE 4IE4A 4AQGA 4J2CA 3BQIA 2PG8A 1G8XA 1Y64B 3VKGA 2V7KA 2YEVC 3DP7A 4I4TE 5LGNB 1D0YA 5FXWA 1LVKA 3M65A 3RRCA 3GA8A 3B57A 2KZ7B 2WM9A 1WYBA 3MJXA 2DHRA 4UF0B 3C4ZA 1BR0A 4UXNB 3ZMSB 3WI3A 2Q9QB 1HX8A 5FY1A 1WLXA 2CEAA 3AVSA 3KV4A 4FI5A 5JH7E 4PNIA 3CQCB 3OBVE 4HFVA 4JEHB 2WWUA 3K3NA 3BQLA 4ZI2D 3PUGA 3O9XA 2EHOC 3AAAB 3LG7A 3LK42 5HWYA 5H6RB 2D0UA 5JREA 2VKHA 1NWMX 2CXLA 2IAKA 4YLHA 4O4JE 3GN5A 1WR6A 4IHJE 1HCIA 5CB4E 3CVRA 4ANJA 5FY7A 2EHOB 4M1PA 4AXPA 4U74A 4YJ2E 3NBXX 3OKQA 5LXTE 2KLQA 1FIOA 5LCYA 1H7CA 1HG5A 1V9DA 2PFVA 3L09A 5ADXL 4AKLA 3AA6B 1IJ6A 3KVBA 3UUXB 2KXPB 2K24A 4GOUA 3RH3A 4ZS3A 1Z0PA 1MIWA 2MTQA 4ILUA 4AQFA 3AVRA 2K9AA 4QX8B 3I9WA 5HXCA 3IHRA 4WBNE 4HEAA 1T98A 2MBGA 3MK7C 3TKLB 3O1IA 4PFOA 3EUHA 3N9PA 1WRDA 4BAYB 3LFMA 1D1CA 2H7OA 3MACA 4MBQA 4UV9B 2CA5A 4IDZA 4CI2B 3CX6B 1EZ3A 4EZ4A 2J1DG 2H7VC 3J9X1 1HG2A 2XQYA 3SRZA 4ASKA 2OA5A 4BJMA 3FXEB 3QK6A 5HWXA 4O8SA 1E1HB 1NAFA 2V1DB 3C4WA 2X9XA 2LOSA 1D0XA 1U5PA 2A2FX 2KWIB 3QC9A 3V5UA 4AKRB 4ZI7E 3ZJ2A 5J2TE 2Z6EA 2CCQA 4X1IE 4ADZA 5LP6E 3I0QA 4JEUB 2BVMA 3RC3A 4I43B 2I59A 2Y8DA 4UF0A 1U4QA 2K48A 2WMOA 2LE8A 4IE7A 3F57A 2ZM0A 2D2SA 3I1AA 3UTKA 3I0OA 2YU2A 4UIGA 5EK4A 1WYCA 3PUAA 3HI2A 2EHOD 5IYZE 3K8PC 3KBUA 3D0TA 4JUYA 5FYMA 2LHNA 3ZJ1A 4DVDA 1BR2A 1YD8G 4A56A 3CKDA 3N2KE 3ANWB 5CA1E 1LVFA 4WBOA 4H63V 5FXZA 5E0OA 5J1GA 2EHOA 4UVCB 2PJQA 5JRCB 3VHLA 4C91A 2LM9A 5EZYE 4F6RC 4QXBB 5ETWA 3ZLIA 4TUYE 2ZMAA 3HR0A 4MFRA 5J2UE 5LA6E 3LK2B 1O3XA 4DNDA 4AI6A 2MYSA 3NZPA 4UVAB 4PW8A 2LOPA 3PE0A 2CXFA 4EAHA 2N1GA 2D5UA 2Q9QC 3V5SA 4CXXA 2IC6A 3P8CD 3SS1A 4L0RA 3FHNA 1G73A 3QUJA 3N9MA 3OYXA 4EZHA 3EVYA 3EDVA 3SOLA 5LHHB 3AA0B 1B7TA 3LK3B 2ZM8A 4QHOA 2BZBA 5GONE 1HFAA 4H9OC 4MLKA 3UUMA 3FBLA 2VB6A 4IE6A 4YHJA 3A5XA 4I50E 2X68A 5L3CB 3ZN1B 3UFEA 4QWNB 2NW8A 5FP3A 3HA4A 4UEMA 5KDMC 2X9YA 1FMVA 2W62A 4MHCA 5HAXA 5DABA 2V7JA 2X9WA 3H3AA 4TN7B 3C51A 1YKHB 4TX5A 2QA7A 5LBQB 2CM0A 1MMDA 2Y48B 3Q9DA 3LBXB 3RYFE 3RX6A 2VKDA 2JQQA 4GK5E 3C4XA 4X20E 3HKDE 3F31A 2KT9A 2XHEB 4PK6A 4KBMB 4FJOA 4ZI3C 3ZMTB 4PJMA 3C50A 3Q5XA 3KBTA 1KNZA 3J7Yq 4UELA 2NWBA 3U3IA 3PUSA 4EYUA 5HXSA 4X1YE 3AA1B 4GIWA 1FMWA 3ZYLA 5KX5E 4GYRA 3RYCE 5FXVA 3ZMUB 2SPCA 2NP9A 4MALA 3ANWA 2L8KA 2L9QA 5LHGB 1MMAA 2E9XB 3ETVA 1D1AA 5JR9C 3VKHA 4H9QC 4C90A 2BVLA 4PK4A 4X1KE 2LHRA 1ZHCA 2VK9A 2XAFB 2JJ9A 2LSYA 4PAGA 3E22E 5JR9B 3IEEA 3HKCE 4KMCA 3KINB 5JDLA 4QXCB 4ZHQE 2W61A 3PURA 4KP3C 5IHYA 3GWHA 4E7ZA 4YFSA 3U78A 2XAGB 1BR4A 3C64A 4OYJA 4BA9A 2VL8A 2VKJA 3KDSE 3C98B 3SWHA 2D0TA 4OHFA 2Q9QD 4EB6E 4NUUA 4CI3B 4OYKA 4ZOLE 1MIVA 2KINB 4H9PC 3HL6A 2LSGA 4PK5A 5LBMA 2NTXA 3PUQA 5F8PA 4CQIA 4DBQA 5BMVE 5EK2A 2N9DA 4TZ4C 3KV9A 2LSIA 3FBZA 4XAXB 4TV8E 3O1HA 5JDHA 2Q9QA 5EK3A 5JDQA 3AAIA 3K3QC 1LKXA 3E08A 3EDUA 4XZCA 3KFWX 3WAKA 4K0UA 1S35A 4ZI2C 3KV6A 1MNDA 3ZPOA 4H9SE 3ZYKA 3AAEB 3F2EA 2X0LB 4P0BA 4WW0A 2W63A 4H63H 2HPJA 3OJAA 1IAPA 3RPUA 2WAUA 4CXYA 5H6QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHC A; 
#chains in the Genus database with same CATH topology
 4LMJ A;  2NOX A;  5AQV B;  1CUN A;  4TWD A;  1HX1 B;  4AKH A;  4X66 T;  2XTL A;  4IDP A;  4IST A;  3KVA A;  1NEN A;  5L4E A;  4GKK T;  2KND A;  1JNZ A;  3LJC A;  4HTE A;  1MMG A;  3CWZ B;  4XBF B;  3QNU A;  4CZZ B;  4N78 D;  4TV9 E;  2J62 A;  4IE5 A;  5LG4 A;  4H9N C;  5LMN T;  3W15 B;  2RPA A;  5TAO A;  3EHZ A;  4G2A A;  2JMH A;  2YDR A;  3WAJ A;  2CLY C;  3MXZ A;  3ZCJ A;  4ZZB A;  3RI5 A;  3RKO A;  5FL1 A;  4PFP A;  1VRB A;  2VL0 A;  5HXH A;  2GK9 A;  3AE7 A;  3AXJ B;  4YY3 T;  3NRX A;  4U7Y A;  3ETU A;  3DJB A;  5AQU B;  1ZV4 X;  2RA1 A;  3AEB A;  3ZMV B;  4CXW A;  2HPL A;  2BG9 C;  2CPT A;  5JDM A;  2F4V T;  5L2L A;  1UX4 A;  1WFD A;  2DWK A;  5AFU L;  3RGL A;  4NUV A;  2X66 A;  3L39 A;  3P7I A;  3PDY A;  5AQS B;  2BG9 E;  4QXH B;  1E2A A;  3NKZ A;  5LGT B;  4Z90 A;  4IIJ E;  3E0Z A;  4JI1 T;  5F3J A;  2X51 A;  2UXN B;  2XAH B;  3MZK B;  4V1A v;  5AQP B;  4JI8 T;  3Q2M A;  5AQO B;  4U72 A;  5HXE A;  4ISS A;  5L3G B;  2YKS A;  4ZEY A;  5L3F B;  4O4I E;  1OED E;  2BKP A;  2C0S A;  3HKE E;  3ESL A;  1KK7 A;  1WR0 A;  2JRK A;  5LGU B;  4KHZ F;  2R6G F;  2XSA A;  4O4L E;  1SHZ C;  4DV5 T;  5JQG E;  2JMK A;  3CQG B;  4JBW F;  3TLW A;  4IE4 A;  1HTJ F;  3Q5E A;  5JTG A;  2WWV A;  1Y64 B;  3DP7 A;  1LVK A;  3M65 A;  1HNZ T;  3MJX A;  2WM9 A;  1WYB A;  2DHR A;  2X0H A;  2PTF A;  2XQ7 A;  2Q9Q B;  1HX8 A;  2CEA A;  3KV4 A;  4HWF A;  4PNI A;  2OV9 A;  3OBV E;  3K3N A;  5HWY A;  2IAK A;  4NXN T;  1HCI A;  3UQ4 A;  4ANJ A;  2AXD S;  3RLF F;  3OKQ A;  2IDO B;  4B3R T;  3G06 A;  1V9D A;  4AKL A;  1IJ6 A;  3KVB A;  3UUX B;  1Z0P A;  3P4W A;  2XPK A;  4JV5 T;  5HXC A;  1J1J A;  3IHR A;  4JI7 T;  2V6Y B;  2WZH A;  1I94 T;  4DR2 T;  1ZP0 A;  3TKL B;  2IHR 1;  4X65 T;  4BAY B;  4MBQ A;  5CFB A;  2CA5 A;  4CI2 B;  4EZ4 A;  3T1H T;  3SRZ A;  2H88 A;  5HWX A;  2X9X A;  1XDP A;  3ZJ2 A;  2Z6E A;  2CCQ A;  1SUM B;  3I0Q A;  4HWD A;  3JAF A;  2BVM A;  3RC3 A;  2DL1 A;  1KFY A;  2Y8D A;  2K48 A;  3PJA A;  2D2S A;  3I0O A;  5ABG A;  3PUA A;  5AQN B;  2HN2 A;  2J4G A;  1YD8 G;  3AEC A;  5HEG A;  4H63 V;  4B3T T;  5E0O A;  5J1G A;  2EHO A;  4UVC B;  2ZMA A;  4MFR A;  2LKG A;  5J2U E;  3TLU A;  1J5E T;  3PE0 A;  1W9R A;  1N34 T;  4EZH A;  3EDV A;  3AA0 B;  2ZM8 A;  5GON E;  4MLK A;  2FBW A;  2VB6 A;  2X68 A;  2JIW A;  5KDM C;  1FMV A;  3C51 A;  5LBQ B;  2Y48 B;  2D9D A;  3P50 A;  3C4X A;  4ILB A;  4PK6 A;  2XHE B;  4LML A;  4TWH A;  3U3I A;  1UGO A;  4EYU A;  3ZYL A;  5AQG B;  3RYC E;  3ZMU B;  2SPC A;  4MAL A;  3ANW A;  1MMA A;  4X1K E;  2FJA A;  4AIS A;  3PUW F;  4ZHQ E;  5IHY A;  4YFS A;  2XAG B;  1BR4 A;  3C64 A;  4OX9 T;  1M7K A;  4CI3 B;  1MIV A;  4H9P C;  3HL6 A;  4PK5 A;  5BMV E;  4DBQ A;  5F8P A;  3O1H A;  2Q9Q A;  2CHO A;  4HFC A;  3E08 A;  2FJE A;  1E7P A;  4XZC A;  3WAK A;  3KV6 A;  4TNW A;  3VR9 A;  4IDN A;  3ZYK A;  1IBM T;  2JQ9 A;  4P0B A;  3UU6 A;  3OJA A;  2WAU A;  3ZST A;  4AQF C;  4HFI A;  2VKO A;  3UUL A;  1OED B;  2N2N A;  3PTR B;  1AJ3 A;  2CMR A;  3KV5 A;  5KMG P;  2HH7 A;  1MNE A;  5F5W A;  2BS4 A;  4YSY A;  3ZT5 A;  5AQF B;  1BR1 A;  1UX5 A;  3PU8 A;  2LSJ A;  2P9B A;  3BQK A;  1XNR T;  1KF6 A;  4GK0 E;  2V7M A;  4A98 A;  2V6Y A;  5JDF A;  5C8Y E;  2CWO A;  1FJG T;  3VU7 H;  5HYA A;  3AEA A;  1QSD A;  3RF1 A;  2WS3 A;  5JR9 A;  3PU3 A;  1FEW A;  5AQQ B;  2W0G A;  2WP9 A;  3CK6 A;  4HN9 A;  2VUR A;  1VCT A;  3K3O A;  5A1L A;  4L5G A;  2VAS A;  1IZN B;  1YKE B;  3AB3 B;  1MIY A;  5JDN A;  3RHW A;  2G0U A;  5HCJ A;  2E9X C;  3CIR A;  5AQK B;  1JNR A;  4AKI A;  2JQH A;  5C2T A;  2C5I T;  1LRZ A;  4CN6 A;  3RYI E;  4QX7 B;  5JVD E;  4GKJ T;  4JI3 T;  2UU9 T;  4DMV A;  5LYJ E;  2WCA A;  4DV0 T;  5AQT B;  3ZYM A;  3S4U A;  4YHH T;  3UU3 A;  2UXB T;  2UXX B;  3EAM A;  2ACX A;  1XNQ T;  4YTM A;  2PBI A;  2M6I A;  4YSX A;  4WZX A;  1R8I A;  5L3B B;  3OTO T;  3ZC0 A;  3QOF A;  5FY0 A;  1UUR A;  4HWC A;  4U2Y A;  4YT0 A;  2ACZ A;  2LT3 A;  4LF5 T;  4DR6 T;  4TWF A;  2V26 A;  3N9Q A;  2DWG A;  3ZEF B;  1D0Z A;  3ONL C;  1S94 A;  2W00 A;  2ES0 A;  4ZI3 D;  5LJN A;  2W4X A;  3B13 A;  3P4S A;  2CE7 A;  3RQU A;  2DLR A;  3ZT7 A;  2E9X D;  2YIN A;  2KWH A;  4JI2 T;  2YU1 A;  2DCF A;  3CPZ A;  4EIW A;  2QGS A;  2YK0 A;  3IA3 A;  2X9H A;  2X67 A;  5LNK A;  1VCS A;  4HE8 A;  5FVL A;  4LF6 T;  5BR8 T;  2H3R A;  3HKB E;  3AED A;  1G8X A;  3LSV A;  3VKG A;  2V7K A;  2YEV C;  4I4T E;  1D0Y A;  2BG9 A;  2KZ7 B;  3C4Z A;  3WI3 A;  1WLX A;  4FI5 A;  3P4P A;  5JH7 E;  4KX6 A;  5HEH A;  4ZI2 D;  3O9X A;  2D0U A;  3RIU A;  5JRE A;  2VKH A;  1NWM X;  4O4J E;  2XQ5 A;  5CB4 E;  3CVR A;  2EHO B;  4YJ2 E;  4U74 A;  2KLQ A;  1FIO A;  5LCY A;  4DR4 T;  2PFV A;  3L09 A;  5ADX L;  2QRX A;  3AA6 B;  2KXP B;  4IDO A;  4GOU A;  3RH3 A;  4ZS3 A;  3AEE A;  4ILU A;  1OED A;  3ABV A;  1ZOY A;  2K9A A;  4QX8 B;  1XMQ T;  5ABE A;  4WBN E;  3AE1 A;  4HEA A;  1T98 A;  3O1I A;  1I6Z A;  2YN6 A;  4UV9 B;  4IDZ A;  3CX6 B;  2WDR A;  2XY8 B;  2H7V C;  1GQE A;  4ASK A;  3FXE B;  3C4W A;  2LOS A;  1D0X A;  3V5U A;  5J2T E;  4ADZ A;  4U7I A;  3AE5 A;  4JEU B;  4I43 B;  4IL9 A;  4UF0 A;  2XQ8 A;  4IE7 A;  2WQY A;  3UTK A;  5EK4 A;  4B3S T;  3KBU A;  5HEJ A;  3ZJ1 A;  4A56 A;  3N2K E;  5CA1 E;  3ANW B;  2NR4 A;  2PJQ A;  5JRC B;  4IT4 A;  5EZY E;  4F6R C;  4QXB B;  3ZLI A;  5LA6 E;  4JI6 T;  3LK2 B;  4U2Z A;  4AI6 A;  3NZP A;  4UVA B;  4LF9 T;  2CXF A;  2N1G A;  2QVA A;  4B3M T;  3EVY A;  5LHH B;  4DUY T;  1B7T A;  3LK3 B;  4QHO A;  1HFA A;  2AE9 A;  2BBJ A;  4I50 E;  4COF A;  4QWN B;  5FP3 A;  3AE9 A;  4UEM A;  1KEY A;  5HAX A;  4TN7 B;  1YKH B;  4TX5 A;  2UUB T;  2UUA T;  2CM0 A;  2V5C A;  4X62 T;  2JQQ A;  4GK5 E;  3F31 A;  4KBM B;  1HR0 T;  4PJM A;  3Q5X A;  2YOE A;  4HFD A;  2V8S V;  3FZL B;  1UK5 A;  4LF8 T;  1FMW A;  4GYR A;  5FXV A;  2CRB A;  1N36 T;  2E9X B;  2BVL A;  2LHR A;  2XAF B;  2LSY A;  3E22 E;  5JR9 B;  5JDL A;  3PUR A;  1YXR A;  4E7Z A;  3L8R A;  4NIQ A;  2VL8 A;  2VKJ A;  3KDS E;  4OHF A;  2NTX A;  4U33 A;  5EK2 A;  1YQ4 A;  2N9D A;  2LSI A;  2YDS A;  1CHU A;  4TV8 E;  4DV6 T;  3AE6 A;  4HWH A;  5FKY A;  1LKX A;  2X0Y A;  3EDU A;  1Y01 A;  3KFW X;  2JQK A;  2WU5 A;  4K0U A;  4NXM T;  1S35 A;  2WZI A;  3ZPO A;  1MND A;  2HPJ A;  3JAE A;  4CXY A;  5H6Q B;  2VVS A;  3ONX A;  5DQV A;  1MMN A;  2ZM2 A;  2WDQ A;  4O2A E;  5LJM A;  3MA9 A;  3CML A;  4AKG A;  4Q25 A;  3R84 B;  4QH4 A;  2MOZ A;  4Z91 A;  2V5D A;  5L3D B;  4L9I A;  3N5L A;  1VOM A;  1IJ5 A;  2VWA A;  2ODU A;  2IC9 A;  3CQX C;  5L4H A;  1UCU A;  3O1J A;  3N9L A;  2LEH A;  2I0M A;  2RP4 A;  4P0A A;  3FZM B;  2JPF A;  5L3E B;  3DTO A;  1YW0 A;  4EXT A;  4I55 E;  5LOV E;  2CXD A;  4YJ3 E;  3CX8 B;  1UUS A;  5LB7 B;  2LLY A;  4LFB T;  4UR9 A;  1QLB A;  2BKN A;  3IBP A;  3O4X E;  3PUV F;  2FJB A;  3N2O A;  3JAD A;  3A7M A;  2XAJ B;  4OK0 A;  1US7 B;  3FZK B;  2CLY B;  4DV4 T;  2UXD T;  2E5V A;  4P09 A;  3RKG A;  4LFC T;  2WBL A;  2C5J A;  3IF8 B;  5C3J A;  4DV3 T;  1ZEE A;  2WMN A;  5JRC A;  1X79 A;  1OWA A;  2V7I A;  4PJJ A;  2LRK A;  3VRA A;  4JI0 T;  2BG9 B;  2UXC T;  3R6N A;  5DQW A;  3ZCI A;  3NZQ A;  3UFG A;  4LFA T;  2I6H A;  3N9O A;  4OFZ A;  3UU4 A;  5AQJ B;  5HXR A;  4ERR A;  3H3M A;  3RQW A;  3VR8 A;  2XQ6 A;  2LJL A;  3AE8 A;  1IBL T;  1HF8 A;  4DBR A;  4JLE A;  5ABH A;  2V7L A;  2XAS B;  4Z8X A;  4GYS A;  4KUM B;  2J47 A;  2K5B B;  2E2A A;  2WY2 A;  3ZMZ B;  4CI1 B;  4TNV A;  2E9X A;  2A3D A;  3TLS A;  2E8I A;  2W66 A;  2XJ7 A;  4UVB B;  4PJN A;  4HWI B;  2DNX A;  4DR7 T;  4J2C A;  2PG8 A;  3RRC A;  3GA8 A;  3B57 A;  2OLT A;  4UF0 B;  1BR0 A;  3X1D A;  3ZMS B;  5FY1 A;  5AQL B;  4JEH B;  2WWU A;  3BQL A;  4I0U A;  3AAA B;  5H6R B;  2CXL A;  4YLH A;  3GN5 A;  4IHJ E;  5FY7 A;  4M1P A;  1H7C A;  4DV1 T;  3AEG A;  3FZH B;  1MIW A;  3QB5 K;  3I9W A;  4YSZ A;  2MBG A;  3MK7 C;  3PJA J;  4PFO A;  3N9P A;  3LFM A;  5KXJ A;  2B76 A;  2J1D G;  1HG2 A;  4BJM A;  1NAF A;  3FZF B;  2A2F X;  2KWI B;  3QC9 A;  4ZI7 E;  4DV7 T;  2LRL A;  4X1I E;  3TLV A;  2BS2 A;  5FVK A;  2I59 A;  1U4Q A;  4JI4 T;  2ZM0 A;  3I1A A;  2YU2 A;  3HI2 A;  2WDV A;  1SE7 A;  5IYZ E;  3K8P C;  3D0T A;  5FYM A;  1BR2 A;  1HNX T;  1LVF A;  5FXZ A;  3VHL A;  3PUX F;  2LM9 A;  3ZSS A;  3HR0 A;  2VVN A;  4IDQ A;  1O3X A;  4DND A;  2MYS A;  4X64 T;  4PW8 A;  2LOP A;  3AE4 A;  1T7S A;  3V5S A;  4CXX A;  2IC6 A;  3P8C D;  3SS1 A;  2VQF T;  3FHN A;  1G73 A;  3N9M A;  2V6X A;  3OYX A;  2XQA A;  2BZB A;  5CJ5 A;  4H9O C;  3UUM A;  4IE6 A;  4YHJ A;  3ZN1 B;  5J0Z A;  2H89 A;  2FUP A;  2X9Y A;  3AE2 A;  2W62 A;  3VRB A;  2X9W A;  4YTP A;  3P4R A;  1KNP A;  2UUC T;  2K3W A;  3LBX B;  2VKD A;  4X20 E;  3HKD E;  3C50 A;  1KNZ A;  5ABF A;  3J7Y q;  4UEL A;  4GIW A;  3EAB A;  2NP9 A;  5LHG B;  3VKH A;  4H9Q C;  4PK4 A;  1ZHC A;  4DUZ T;  2JJ9 A;  4EGW A;  4PAG A;  1J5W A;  4YXD A;  3KIN B;  4QXC B;  4DR5 T;  5AQR B;  4JI5 T;  3SWH A;  3ZT6 A;  4OYK A;  4ZOL E;  1X9B A;  2KIN B;  3K1S A;  5LBM A;  4CQI A;  3PUQ A;  3PUY F;  3KV9 A;  3FBZ A;  2W67 A;  2FJD A;  4XAX B;  1XZY A;  5AQM B;  3RIU C;  5JDH A;  5JDQ A;  3ZKR A;  4ZZC A;  3F2E A;  2BBH A;  4WW0 A;  1IAP A;  1OED C;  3CX7 B;  4CN4 A;  3UT5 E;  4AQY T;  5M4Y A;  2CBI A;  1HS7 A;  4QKN A;  2A9U A;  2A72 A;  2WSS V;  3Q5W A;  5HEU A;  4B6X A;  2NTY A;  3TLT A;  3OVU A;  4E7S A;  3UUN A;  5IWA T;  3RYH E;  1XDO A;  1QUU A;  2IML A;  4WNK A;  3BK9 A;  2XQ9 A;  5IUX A;  3EI0 A;  3RIA A;  2KMF A;  2XUE A;  1SA0 E;  4O4H E;  4U31 A;  4BJN A;  4UV8 B;  5LHI B;  4A97 A;  2NW7 A;  4JYA T;  2YDQ A;  5FL0 A;  1KNR A;  2IUB A;  1WCR A;  5CGM A;  3AA7 B;  5HEO A;  4IGU A;  5FNV E;  5JDG A;  3AEF A;  2WB5 A;  4EYY R;  3RRW A;  4KHP T;  1D1B A;  5AQI B;  3B5M A;  2BS3 A;  2NW9 A;  4QH1 A;  5FMN A;  3N9N A;  3NRY A;  4AIU A;  3H37 A;  3UU5 A;  2XAQ B;  3OYZ A;  3RC8 A;  2BDE A;  2B1E A;  3L3P A;  3P4Q A;  4ZS2 A;  3ZN0 B;  3JC6 C;  2ZLY A;  1IBK T;  5DJQ C;  4EOZ B;  4PJL A;  4X5T A;  2Y6X A;  4IE0 A;  4IL4 A;  4O2B E;  3I9Y A;  3MKD A;  4G63 A;  3ZC1 A;  5CA0 E;  4K0K T;  4EEB A;  4ILA A;  3A8Y C;  3GN5 B;  2LSK A;  2C5K T;  5HCM A;  4ILC A;  4LMK A;  2M67 A;  1OXZ A;  3GMI A;  3N2G E;  3LBX A;  2IW5 B;  5FXX A;  1ZKE A;  4WYV A;  4H9R C;  3T8O A;  4DMW A;  2L3L A;  2DI4 A;  3UUB A;  1T8B A;  4CN1 A;  3FB2 A;  2ODV A;  4HGA A;  5AQH B;  3AXJ A;  4YTN A;  4HFB A;  2CWY A;  4DO0 A;  2LKH A;  3NVO A;  3FXD B;  2HN1 A;  3JC6 D;  3NWI A;  4HKA A;  4AQG A;  3SFD A;  3BQI A;  4U3C A;  1NEK A;  5LGN B;  5FXW A;  5LMU T;  4UXN B;  2ZM6 T;  5L47 A;  3AVS A;  1L0V A;  3QB5 A;  3CQC B;  4LF7 T;  4LF4 T;  4HFV A;  3PUG A;  2EHO C;  3LG7 A;  2XZE A;  3LK4 2;  2LM2 A;  2KSR A;  1WR6 A;  4QH5 A;  4AXP A;  1HNW T;  5LXT E;  3NBX X;  3T1Y T;  2MAW A;  1HG5 A;  2K24 A;  2MTQ A;  5LG3 A;  4AQF A;  3AVR A;  4DID B;  3EUH A;  1WRD A;  1D1C A;  2H7O A;  3MAC A;  4EV6 A;  1EZ3 A;  3J9X 1;  2XQY A;  2IIU A;  4P1N A;  2OA5 A;  2M6B A;  3QK6 A;  4O8S A;  1E1H B;  1N32 T;  2V1D B;  2MPK A;  1U5P A;  5LP6 E;  1YQ3 A;  3AE3 A;  2WMO A;  2LE8 A;  3F57 A;  1W0A A;  3PV0 F;  4UIG A;  5ABF B;  1WYC A;  2EHO D;  2W2U A;  4JUY A;  2LHN A;  4DVD A;  3CKD A;  4WBO A;  3OPC A;  4C91 A;  2VQE T;  5ETW A;  4TUY E;  2XM2 A;  3M3Z B;  2CBJ A;  4A5X A;  3JCF A;  4HFE A;  4EAH A;  2Q9Q C;  2D5U A;  4L0R A;  1W09 A;  4HFH A;  3QUJ A;  4KI0 F;  3LDQ B;  1Z8U A;  3SOL A;  4ZXL A;  3Q5D A;  3FBL A;  2WU2 A;  3A5X A;  1W0B A;  5L3C B;  3UFE A;  1T72 A;  2NW8 A;  3HA4 A;  2XQ3 A;  1N33 T;  1XMO T;  4F8H A;  4MHC A;  5DAB A;  2V7J A;  3H3A A;  2QA7 A;  1MMD A;  3Q9D A;  3RYF E;  3RX6 A;  4DR1 T;  2XSB A;  2KT9 A;  4ZI3 C;  4FJO A;  3ZMT B;  3KBT A;  2NWB A;  3PUS A;  5HXS A;  4X1Y E;  3AA1 B;  5KX5 E;  1DU2 A;  2QYW A;  1M62 A;  2L8K A;  2L9Q A;  3ETV A;  1D1A A;  5JR9 C;  4NPP A;  2E5L T;  4C90 A;  2VK9 A;  3IEE A;  3HKC E;  4KMC A;  2W61 A;  4KP3 C;  4EED A;  3GWH A;  3UU8 A;  3U78 A;  4DR3 T;  4OYJ A;  4BA9 A;  3C98 B;  2D0T A;  2Q9Q D;  4EB6 E;  4NUU A;  2XQ4 A;  2LSG A;  3ONJ A;  4TZ4 C;  3SFE A;  2HHH T;  2CHN A;  4DV2 T;  5EK3 A;  3AAI A;  3UQ7 A;  3K3Q C;  2BKO A;  2XM1 A;  4IRE A;  4ZI2 C;  4H9S E;  3AAE B;  3RIF A;  2X0L B;  2W63 A;  4H63 H;  3RPU A;  4AKR B;  1XWM A;  3PUZ F; 
#chains in the Genus database with same CATH homology
 2NOX A;  3ONX A;  3CX7 B;  5DQV A;  4AQF C;  3UT5 E;  5M4Y A;  1MMN A;  2ZM2 A;  1CUN A;  4O2A E;  2VKO A;  1HS7 A;  4QKN A;  3UUL A;  5LJM A;  2N2N A;  3MA9 A;  3PTR B;  1AJ3 A;  3CML A;  2CMR A;  2A72 A;  4AKG A;  2WSS V;  3KV5 A;  5KMG P;  3R84 B;  3Q5W A;  4AKH A;  2MOZ A;  2XTL A;  2HH7 A;  1MNE A;  4B6X A;  5L3D B;  4IST A;  2NTY A;  1BR1 A;  1UX5 A;  3KVA A;  3PU8 A;  2LSJ A;  2P9B A;  3BQK A;  2KND A;  4L9I A;  4E7S A;  3N5L A;  4GK0 E;  3UUN A;  1VOM A;  1IJ5 A;  3LJC A;  2V7M A;  2VWA A;  3RYH E;  1QUU A;  2ODU A;  2IC9 A;  3CQX C;  4WNK A;  3BK9 A;  5JDF A;  1UCU A;  5C8Y E;  4HTE A;  1MMG A;  3O1J A;  2CWO A;  3N9L A;  2KMF A;  3VU7 H;  5HYA A;  2XUE A;  3CWZ B;  4XBF B;  2LEH A;  1QSD A;  4CZZ B;  2RP4 A;  4N78 D;  4TV9 E;  1SA0 E;  4P0A A;  5JR9 A;  4O4H E;  2JPF A;  5L3E B;  4BJN A;  3PU3 A;  1FEW A;  4IE5 A;  4UV8 B;  3DTO A;  5LG4 A;  5LHI B;  1YW0 A;  2NW7 A;  4H9N C;  2W0G A;  4I55 E;  4EXT A;  5LOV E;  4HN9 A;  3W15 B;  2CXD A;  4YJ3 E;  3CX8 B;  5TAO A;  3AA7 B;  4IGU A;  5FNV E;  4G2A A;  5JDG A;  2JMH A;  3K3O A;  5A1L A;  3WAJ A;  4EYY R;  4L5G A;  3IBP A;  2VAS A;  3O4X E;  2CLY C;  3MXZ A;  3N2O A;  3ZCJ A;  1IZN B;  1YKE B;  3AB3 B;  1MIY A;  3RRW A;  5JDN A;  2XAJ B;  2G0U A;  3RKO A;  4OK0 A;  1US7 B;  2CLY B;  4PFP A;  1D1B A;  1VRB A;  5HXH A;  2GK9 A;  2NW9 A;  2E9X C;  4P09 A;  4AKI A;  3NRX A;  2WBL A;  2C5J A;  3N9N A;  3IF8 B;  5FMN A;  3NRY A;  2C5I T;  3H37 A;  1LRZ A;  2XAQ B;  3RYI E;  4QX7 B;  5JVD E;  1ZEE A;  3ETU A;  3DJB A;  1ZV4 X;  2WMN A;  2RA1 A;  3OYZ A;  3ZMV B;  5JRC A;  3RC8 A;  1X79 A;  4CXW A;  1OWA A;  2HPL A;  2BDE A;  4DMV A;  5LYJ E;  2B1E A;  3L3P A;  5JDM A;  2V7I A;  4PJJ A;  4ZS2 A;  3ZN0 B;  5L2L A;  3JC6 C;  3ZYM A;  1UX4 A;  2DWK A;  3S4U A;  2ZLY A;  5AFU L;  2UXX B;  5DJQ C;  4EOZ B;  4PJL A;  2ACX A;  2PBI A;  2Y6X A;  3R6N A;  5DQW A;  3ZCI A;  3NZQ A;  4NUV A;  2X66 A;  4IE0 A;  3P7I A;  3PDY A;  4O2B E;  5L3B B;  3I9Y A;  3MKD A;  3ZC0 A;  4G63 A;  4QXH B;  3ZC1 A;  5FY0 A;  5CA0 E;  5LGT B;  3N9O A;  4IIJ E;  4OFZ A;  3E0Z A;  3GN5 B;  2LSK A;  2C5K T;  5HXR A;  4ERR A;  5F3J A;  2X51 A;  2UXN B;  2LT3 A;  2XAH B;  2M67 A;  2V26 A;  3MZK B;  4V1A v;  3N9Q A;  2LJL A;  1OXZ A;  2DWG A;  3GMI A;  1D0Z A;  3ZEF B;  3Q2M A;  1S94 A;  2W00 A;  2ES0 A;  1HF8 A;  4U72 A;  4ZI3 D;  3N2G E;  5HXE A;  5LJN A;  4ISS A;  3LBX A;  5L3G B;  4DBR A;  3B13 A;  2IW5 B;  4JLE A;  5FXX A;  2V7L A;  2XAS B;  1ZKE A;  2CE7 A;  2DLR A;  4H9R C;  4Z8X A;  3T8O A;  4GYS A;  4DMW A;  2L3L A;  4KUM B;  2E9X D;  2YIN A;  2KWH A;  2DI4 A;  5L3F B;  3FB2 A;  4O4I E;  2YU1 A;  2K5B B;  2ODV A;  4HGA A;  2DCF A;  3CPZ A;  4EIW A;  2QGS A;  2C0S A;  3ZMZ B;  3HKE E;  3ESL A;  4CI1 B;  2YK0 A;  1KK7 A;  2JRK A;  5LGU B;  2X9H A;  2CWY A;  4DO0 A;  2E9X A;  4O4L E;  2A3D A;  1SHZ C;  2E8I A;  2X67 A;  5JQG E;  3FXD B;  5LNK A;  2JMK A;  4UVB B;  4HE8 A;  3JC6 D;  4PJN A;  3CQG B;  2DNX A;  4HKA A;  1HTJ F;  2H3R A;  3HKB E;  4IE4 A;  4AQG A;  4J2C A;  3BQI A;  2PG8 A;  1G8X A;  1Y64 B;  3VKG A;  2V7K A;  2YEV C;  3DP7 A;  4I4T E;  5LGN B;  1D0Y A;  5FXW A;  1LVK A;  3M65 A;  3RRC A;  3GA8 A;  3B57 A;  2KZ7 B;  2WM9 A;  1WYB A;  3MJX A;  2DHR A;  4UF0 B;  3C4Z A;  1BR0 A;  4UXN B;  3ZMS B;  3WI3 A;  2Q9Q B;  1HX8 A;  5FY1 A;  1WLX A;  2CEA A;  3AVS A;  3KV4 A;  4FI5 A;  5JH7 E;  4PNI A;  3CQC B;  3OBV E;  4HFV A;  4JEH B;  2WWU A;  3K3N A;  3BQL A;  4ZI2 D;  3PUG A;  3O9X A;  2EHO C;  3AAA B;  3LG7 A;  3LK4 2;  5HWY A;  5H6R B;  2D0U A;  5JRE A;  2VKH A;  1NWM X;  2CXL A;  2IAK A;  4YLH A;  4O4J E;  3GN5 A;  1WR6 A;  4IHJ E;  1HCI A;  5CB4 E;  3CVR A;  4ANJ A;  5FY7 A;  2EHO B;  4M1P A;  4AXP A;  4U74 A;  4YJ2 E;  3NBX X;  3OKQ A;  5LXT E;  2KLQ A;  1FIO A;  5LCY A;  1H7C A;  1HG5 A;  1V9D A;  2PFV A;  3L09 A;  5ADX L;  4AKL A;  3AA6 B;  1IJ6 A;  3KVB A;  3UUX B;  2KXP B;  2K24 A;  4GOU A;  3RH3 A;  4ZS3 A;  1Z0P A;  1MIW A;  2MTQ A;  4ILU A;  4AQF A;  3AVR A;  2K9A A;  4QX8 B;  3I9W A;  5HXC A;  3IHR A;  4WBN E;  4HEA A;  1T98 A;  2MBG A;  3MK7 C;  3TKL B;  3O1I A;  4PFO A;  3EUH A;  3N9P A;  1WRD A;  4BAY B;  3LFM A;  1D1C A;  2H7O A;  3MAC A;  4MBQ A;  4UV9 B;  2CA5 A;  4IDZ A;  4CI2 B;  3CX6 B;  1EZ3 A;  4EZ4 A;  2J1D G;  2H7V C;  3J9X 1;  1HG2 A;  2XQY A;  3SRZ A;  4ASK A;  2OA5 A;  4BJM A;  3FXE B;  3QK6 A;  5HWX A;  4O8S A;  1E1H B;  1NAF A;  2V1D B;  3C4W A;  2X9X A;  2LOS A;  1D0X A;  1U5P A;  2A2F X;  2KWI B;  3QC9 A;  3V5U A;  4AKR B;  4ZI7 E;  3ZJ2 A;  5J2T E;  2Z6E A;  2CCQ A;  4X1I E;  4ADZ A;  5LP6 E;  3I0Q A;  4JEU B;  2BVM A;  3RC3 A;  4I43 B;  2I59 A;  2Y8D A;  4UF0 A;  1U4Q A;  2K48 A;  2WMO A;  2LE8 A;  4IE7 A;  3F57 A;  2ZM0 A;  2D2S A;  3I1A A;  3UTK A;  3I0O A;  2YU2 A;  4UIG A;  5EK4 A;  1WYC A;  3PUA A;  3HI2 A;  2EHO D;  5IYZ E;  3K8P C;  3KBU A;  3D0T A;  4JUY A;  5FYM A;  2LHN A;  3ZJ1 A;  4DVD A;  1BR2 A;  1YD8 G;  4A56 A;  3CKD A;  3N2K E;  3ANW B;  5CA1 E;  1LVF A;  4WBO A;  4H63 V;  5FXZ A;  5E0O A;  5J1G A;  2EHO A;  4UVC B;  2PJQ A;  5JRC B;  3VHL A;  4C91 A;  2LM9 A;  5EZY E;  4F6R C;  4QXB B;  5ETW A;  3ZLI A;  4TUY E;  2ZMA A;  3HR0 A;  4MFR A;  5J2U E;  5LA6 E;  3LK2 B;  1O3X A;  4DND A;  4AI6 A;  2MYS A;  3NZP A;  4UVA B;  4PW8 A;  2LOP A;  3PE0 A;  2CXF A;  4EAH A;  2N1G A;  2D5U A;  2Q9Q C;  3V5S A;  4CXX A;  2IC6 A;  3P8C D;  3SS1 A;  4L0R A;  3FHN A;  1G73 A;  3QUJ A;  3N9M A;  3OYX A;  4EZH A;  3EVY A;  3EDV A;  3SOL A;  5LHH B;  3AA0 B;  1B7T A;  3LK3 B;  2ZM8 A;  4QHO A;  2BZB A;  5GON E;  1HFA A;  4H9O C;  4MLK A;  3UUM A;  3FBL A;  2VB6 A;  4IE6 A;  4YHJ A;  3A5X A;  4I50 E;  2X68 A;  5L3C B;  3ZN1 B;  3UFE A;  4QWN B;  2NW8 A;  5FP3 A;  3HA4 A;  4UEM A;  5KDM C;  2X9Y A;  1FMV A;  2W62 A;  4MHC A;  5HAX A;  5DAB A;  2V7J A;  2X9W A;  3H3A A;  4TN7 B;  3C51 A;  1YKH B;  4TX5 A;  2QA7 A;  5LBQ B;  2CM0 A;  1MMD A;  2Y48 B;  3Q9D A;  3LBX B;  3RYF E;  3RX6 A;  2VKD A;  2JQQ A;  4GK5 E;  3C4X A;  4X20 E;  3HKD E;  3F31 A;  2KT9 A;  2XHE B;  4PK6 A;  4KBM B;  4FJO A;  4ZI3 C;  3ZMT B;  4PJM A;  3C50 A;  3Q5X A;  3KBT A;  1KNZ A;  3J7Y q;  4UEL A;  2NWB A;  3U3I A;  3PUS A;  4EYU A;  5HXS A;  4X1Y E;  3AA1 B;  4GIW A;  1FMW A;  3ZYL A;  5KX5 E;  4GYR A;  3RYC E;  5FXV A;  3ZMU B;  2SPC A;  2NP9 A;  4MAL A;  3ANW A;  2L8K A;  2L9Q A;  5LHG B;  1MMA A;  2E9X B;  3ETV A;  1D1A A;  5JR9 C;  3VKH A;  4H9Q C;  4C90 A;  2BVL A;  4PK4 A;  4X1K E;  2LHR A;  1ZHC A;  2VK9 A;  2XAF B;  2JJ9 A;  2LSY A;  4PAG A;  3E22 E;  5JR9 B;  3IEE A;  3HKC E;  4KMC A;  3KIN B;  5JDL A;  4QXC B;  4ZHQ E;  2W61 A;  3PUR A;  4KP3 C;  5IHY A;  3GWH A;  4E7Z A;  4YFS A;  3U78 A;  2XAG B;  1BR4 A;  3C64 A;  4OYJ A;  4BA9 A;  2VL8 A;  2VKJ A;  3KDS E;  3C98 B;  3SWH A;  2D0T A;  4OHF A;  2Q9Q D;  4EB6 E;  4NUU A;  4CI3 B;  4OYK A;  4ZOL E;  1MIV A;  2KIN B;  4H9P C;  3HL6 A;  2LSG A;  4PK5 A;  5LBM A;  2NTX A;  3PUQ A;  5F8P A;  4CQI A;  4DBQ A;  5BMV E;  5EK2 A;  2N9D A;  4TZ4 C;  3KV9 A;  2LSI A;  3FBZ A;  4XAX B;  4TV8 E;  3O1H A;  5JDH A;  2Q9Q A;  5EK3 A;  5JDQ A;  3AAI A;  3K3Q C;  1LKX A;  3E08 A;  3EDU A;  4XZC A;  3KFW X;  3WAK A;  4K0U A;  1S35 A;  4ZI2 C;  3KV6 A;  1MND A;  3ZPO A;  4H9S E;  3ZYK A;  3AAE B;  3F2E A;  2X0L B;  4P0B A;  4WW0 A;  2W63 A;  4H63 H;  2HPJ A;  3OJA A;  1IAP A;  3RPU A;  2WAU A;  4CXY A;  5H6Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...