1ZHIA

Complex of the s. cerevisiae orc1 and sir1 interacting domains
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
195
Chain Sequence
GWEIITTDEQGNIIDGGTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title Structural basis of the Sir1-origin recognition complex interaction in transcriptional silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/replication
total genus 50
structure length 195
sequence length 205
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zhiA00
4KUDK 4FSXA 4BB7A 4DA4A 1ZHIA 2FL7A 4LD9K 4FT4A 4JJNK 4KUIA 3PTAA 2FVUA 1ZBXA 1M4ZA 3TU4K 4DOVA 1W4SA 4DOWA 4FT2A 4KULA 3PT9A
chains in the Genus database with same CATH superfamily
4IURA 3EG0A 4FYVB 2HQEA 3NFCA 1IB8A 2JNGA 1KQSS 1MV3A 4X34A 5GAN6 2V8IA 2GTJA 1AZGB 1N27A 2XD0A 1RUWA 2EW3A 4J8OA 2B8AA 1RI9A 1TS9A 3UA6A 1Z9QA 1PWTA 2LCLA 4OB2B 1ZX6A 2ECZA 4A4KA 4KGVB 2BKDN 2MF2A 4R55A 3GLXA 3CPFA 3C4SA 3X24B 1NLPC 5CKDA 2M0OA 1S72Q 1HD3A 4C8QA 3G1JA 2FPDA 4AFSC 3CCJA 9ATCB 3VS5A 3FJPA 5FW9A 2BZYA 3ZFJA 4OB1B 1FX7A 2DFUA 2V8JA 2CP2A 3MJXA 4ELZC 1KSWA 4GY5A 1FMWA 1RAIB 1WGSA 3LGLA 3M55A 3EHRA 2K5LA 2QGFB 4N0AA 4HKEA 3HRSA 3RBBB 1WX6A 1UFFA 3M59A 4IUUA 1BB9A 1FMKA 1X43A 1VQ8A 1KJWA 4E7KA 3EFRA 4FSXA 2DL3A 5DM7R 2DZ9A 3OYBA 3CXCP 3HSBA 1U1TA 4C5HA 4F04B 3PIPA 4JJDA 1YCSB 2KYMA 4JRKA 3RDVA 2QYZA 1W2BA 2I0NA 1NPRA 4LNPA 1YJNQ 2DVEA 2JS2A 1NJIR 2DO3A 3CPWS 4KULA 3LH0A 3UWNA 1VQMQ 4J9CA 4FT4A 5KYYA 2HD0A 4OMMA 1K9MU 4JJNK 3CD6T 3I55T 2RHUA 2YRDA 1VQLA 2FPFA 1KC8R 3JCMe 4JUVA 4IIOA 3VUZA 1JEGA 1RACB 2HDAA 3I35A 4XK8E 4X9CA 1N5ZA 3HHTB 4FL6A 2ABLA 4IIMA 2V1QA 1AZEA 3C0CA 1Q7YR 2FG0A 5GANe 1XQHA 1ZUUA 3FB9A 5HKCA 3L42A 1LOJA 2HKNA 4J9GA 4BUGA 3M5AA 4E7HA 1W1FA 3CCVT 2HL3A 1VIFA 4OMOA 1IHVA 2CYZB 3CCMT 4M7AD 2QXFA 2FL7A 3I56T 4C5IA 2CH4A 1QVFP 3HTRA 1UGPB 2LJ0A 4FYWB 1VQNA 2JMAA 1KK7A 4J83A 1GFCA 3FRNA 2ZCFB 2DF6A 2A3LA 3BW1A 3UA7A 2V8KA 3CCVQ 3THKA 2QQBA 2NUPB 3JCMW 2D6FA 2KE9A 3JCMQ 2EAYA 3CCMQ 5LJ5e 3CC2Q 4PJNA 3JB9H 1PCXA 2L3PA 3I56Q 1XNIA 3M57A 4M75F 5CKFA 2CKKA 2E12A 3CC4T 4XU3A 5FU6B 2QK0A 2W10A 1D09B 1YI2T 1SF9A 4M75C 2GQIA 3EFOA 2IG0A 1M2VA 3A5ZB 3DLLA 4M77B 2L0AA 1UEBA 3X28B 4X1VA 2KXCA 5FU7B 2XG8D 3RMSA 1M3BA 1Q81U 4TVRA 1K9MC 4RTXA 2O9VA 1OEBA 3ME9A 3GF5A 4XTUA 4M7DF 1M5Q1 4QQGA 2JXBA 4OP0A 1GBRA 2F2XA 1UG1A 2RPNA 1WHGA 4EMKB 1YI2Q 3OSSC 2VYTA 1G3TA 3OS1A 1VQ4T 4M7DC 1QKWA 2MIOA 2NLUA 2D0NA 3TCJA 1Q95G 1X27A 5GANd 2L8DA 2KT8A 4NS5A 1R0BG 4M4ZA 2SEMA 3HFOA 2JZ2A 3VS7A 3FLGA 3DKMA 3M9QA 4V2SA 4M77E 1PSFA 2D8HA 2RQTA 1QWEA 1VQKA 1Y57A 1U3OA 1VUBA 2RNAA 2LJ3A 1YHQT 2J6OA 1G5VA 2K3BA 2BE7D 4M75A 2FPEA 4FW1A 3BY7A 3HP9A 4CC4B 4PJJA 1QQJA 3L2VA 3EG9A 3PFSA 3KFVA 4LDYA 1GCPA 1WXTA 4F16A 2DPPB 3S3NA 2HZYA 5GJWB 4ELYC 1UUEA 1VQ7T 1NE8A 2QA4T 1PD1A 1XTDA 3E9FA 5GMKh 1Y7XA 1WHLA 2KRSA 1YJWQ 3VYHB 5L8RE 4ORZA 2CUDA 4C8QB 1RADB 1U06A 3L2UA 1UECA 1IHWA 4C92E 1YHQQ 2A7YA 1QVFA 3M0UA 1UB4A 1O9SA 5CR2A 2HAXA 2KK4A 4A4FA 2LCCA 2X4WA 2MAMA 1YCYA 2XU8A 2DD4A 4LD6A 3RNJA 3CCST 2RO0A 2DL5A 2E64A 3ZEHA 3C95A 1Z9ZA 3SWNC 4CI0C 2DL7A 2XK0A 2RJCA 3QHSA 5L23A 2QA4Q 2R5AA 4PJOF 3HKSA 1M8MA 5M9OA 2EQMA 1KHCA 5HK0A 2XDDA 1TTHB 2Y90A 3V8LA 5GAOn 1F1BB 4C8QE 2E70A 5GAN8 4E6RA 3CCLA 2LVMA 4MZPA 4C0DB 4PJOC 2MI6A 3PVQA 1Q81C 2RI5A 4FSSA 2PTKA 3ASKA 3CCSQ 1VQ6A 1E6HA 1M3AA 1WQWA 3VYGA 3TVTA 1X75C 3TQ7P 1SRMA 2BE9B 4CRIA 4M7AG 2CP0A 3INZA 5KYYB 1QP2A 5KYNA 1PD0A 2DK3A 3P8DA 3EH2A 1M1KU 2GBQA 1MMNA 2DERA 5DLQE 4Z02A 1N9SA 5IHIA 4M78D 1G8XA 3F70A 4RCBA 3G71T 2JTEA 2K9GA 2FYKA 3BE3A 3JCMX 3CCUT 1QVGA 1OX9A 2GQVA 3BFMA 4ANJA 1RI0A 1W6XA 1K9MR 3SWNA 1HK9A 3QG1A 4M77G 5GAMe 1SEMA 1YJ9T 1G3SA 1WHHA 2QQSA 4XAXB 1QMCA 2CREA 1PM3A 2KI7A 4II1A 4B9XA 5GMKl 4RG2A 1PSEA 2KSSA 5D6XA 1S1NA 3O8VA 4PJOA 1IO6A 2J6KA 3M0RA 4M78B 3G71Q 3A8LB 3CCUQ 4BI8B 2VC8A 3U23A 2LZ6B 3QO3A 3EGUA 2ZGWA 3V8JA 4D8KA 2F69A 2HBPA 5KYUA 3SD4A 2VASA 3JB9G 1NM7A 3S3OA 2QASA 3JRZA 2LX9A 2ZZDA 4DOWA 2DILA 5GANj 4KUDK 4JS4A 1N8RR 3MP8A 4LD9K 1IXDA 4NOYA 2D1XA 2G3RA 1NJIC 4N4IA 3KBGA 1VOMA 2LQKA 3OS5A 3P8HA 5GMKm 2KY9A 2RQVA 2EIFA 2RHZA 1X2QA 3G6ET 2RI2A 2RHYA 2LQ8A 2VGMA 2KRMA 2LP5A 4YTLA 3OW2S 3CCET 4PK4A 3HRUA 3ER0A 4KH1B 5J3BA 2Y4XA 1RAEB 5GAOm 3EFOB 3HPWA 2QAZA 2O4XA 1M2VB 4A4EA 2CZ1B 2BIVA 3H0IA 4DBRA 4O5VA 2JM9A 3LLRA 1H3HA 3AHUA 4PLLA 1E6GA 1AVZC 2CSIA 4FIBA 4LDVA 4IUTA 1VQ9T 2YWWA 1M30A 3JCMb 3RKWA 3LW5E 2G6FX 3EAEA 2PQWA 1YIJA 1BI0A 3CBPA 3VJPA 4LDXA 1M1KC 2A36A 4J9HA 3CQTA 3CCEQ 4OB3B 3NTHA 1UDLA 1XJWB 4L6V5 1TXQA 4AMCA 3FEOA 3L2ZA 2GFUA 1Q81R 2AZSA 2CUBA 3JCMJ 4IUVA 1GFDA 3QWYA 1N6AA 4C92A 4JZ3A 3OBYA 4C0FA 2OTLA 2VKNA 1VQ9Q 2K57A 4N4HA 1PKTA 2YUOA 2O01E 4RTWA 4M75B 3S3MA 1K76A 2RK1A 1KIKA 1RAHB 1VYTA 5GAOq 4AG2C 3A8MB 5GMKi 3EG9B 3I5SA 2XDBA 2NYSA 4RKUE 2V1RA 1NPPA 1V1CA 3CMEA 2E6NA 5LJ3h 3MP1A 3V7RA 2HEQA 4EIKA 3JCMf 3M0SA 1VYUA 2FZGB 1SPKA 2LCSA 2HSEB 4J9BA 1ZSZA 3WXMB 2HQXA 4BD3A 2KRNA 4PFPA 5GMKj 1O75A 1UHCA 4JRPA 2L3RA 4JLGA 2PZ1A 2LMJA 2KROA 1N9RA 2IIMA 2EJFA 5GANf 2VB6A 1YJNT 3BDLA 2DXBA 4M75E 2R5MA 2FEIA 2LX7A 3VS2A 2K3XA 2JUFA 4IUPA 1EIFA 2SRCA 4Y28E 2P0PA 1VQMT 2M9UA 2YUPA 2KR3A 2PVOB 2QGGA 4C5GA 5IAYA 4ATOA 1NYGA 2EQKA 3I55A 3H41A 3CD6A 3RR6A 2PU9B 1PRMC 2EQIA 4M78G 4X9DA 2R58A 1GL5A 2CZ0B 2F2VA 2F2WA 2ZPEB 1YNZA 4RTVA 1T0JA 2DX1A 1Y96A 1UGQB 1RABB 3CXCS 3QUIA 2DLPA 5I2SA 2JVVA 1YITQ 2KVQG 1T3SA 8ATCB 1Y0MA 5CAIA 4A53A 4M7DE 1TUCA 2CS7A 4E7SA 3QJYA 1D1AA 3CCJT 4R0KA 2XICA 2FO0A 5LJ3d 1PG5B 2GTOA 1ZA2B 4AFQC 1E7OA 2DXCA 2XHCA 1AWJA 3NMZC 3OSVA 1KD1U 3QXEB 1Y07A 1HSQA 1NZ9A 3OYLA 2LJ1A 3QZ5B 2EGCA 3QIIA 1C1AA 4ZGDB 1D1CA 2RHIA 3FDRA 1K73R 4WF2A 4OB0B 4DA4A 4F14A 3VRZA 4XU1A 3PTAA 4WTOB 2LTOA 3KUFA 5GJVB 5FWBA 3SWNB 4ZGJB 3O5ZA 4E7ZA 2YUNA 1M9SA 1UGSB 3CCJQ 1M1KR 1K0SA 1HYOA 5EG2A 4QT7A 3NHNA 1QCFA 5GAN7 4JJBA 1UTIA 1WJRA 1QLYA 5KCHA 4A63B 3CC2T 4GLKA 3TEEA 3JCMh 2RJDA 1W70A 1OQKA 3E19A 4PJOB 1IGUA 2LQNA 3CC4A 3CC7A 1WXUA 2E3IA 1N8RU 3M0PA 4OF1A 3HRTA 4OMFB 5GANg 4J5YA 1VQ8Q 2WSFE 4QKUA 4XTZA 4EMGA 3MP6A 5KYUB 5GANh 4ZN1A 1KQSA 1U5SA 2FVUA 4RTZA 4M77D 1M4ZA 3DB4A 3RESA 3VS1A 4XTVA 4LN2A 1C6VX 2L2PA 2P4RA 2MPXC 1CKBA 3GP8A 1QW1A 2JN0A 2DETA 4M75G 1WQ7A 2EYYA 4C0GA 3M54A 1SRLA 3VS0A 1J3TA 2FZKB 5CQXA 5FLXE 4RTUA 1NLOC 2JTFA 2E65A 4PJOE 1JU5C 4BACA 1MHNA 1AWXA 2C0TA 3EG3A 1HJDA 2KNBB 1VQLQ 1YP5A 1TH7A 3OYEA 3X26B 3MPUB 2CP7A 1VQ4A 2AT1B 3J80E 4A54A 2KBTA 2YSQA 2O4XB 3LWHA 4F17A 3WVEB 1LCKA 2DL8A 3JB9D 3RIRA 1VQNT 1ZA1B 4L5GA 1RAFB 4FYXB 2YT6A 1WLPB 3JCMd 5LJ5h 3CMAT 3E9GA 1Q82R 2WSCE 4MMLA 2MWPA 4AFZC 3OS0A 1QVGP 1KD1C 6AT1B 2YUQA 2ED1A 1B07A 1U1SA 1D3BA 3PMIA 3VS6A 1MGQA 2HKQB 3SFMA 2EQUA 4E2FB 1G2BA 3OYAA 2HMAA 4ZTFA 1QVPA 2DTHA 2CH4W 3JSCA 1VQ7A 1OV3A 4MMKA 3E2UA 2RJFA 3N5BB 3C94A 1YJWT 1ZLMA 1VQNQ 2JMCA 4C8QD 1WI7A 4C92B 1VQOT 1UHFA 1JB0E 3OS2A 3CMAQ 1JJ2S 3CPWA 4Y92A 4J6WA 1MV0B 3MEVA 1MNEA 2KQWA 3D7SB 4JS5A 1AD5A 2COZA 4ZN3A 1AHJB 2OAWA 2E1HA 2RH2A 4N4GA 1N8RC 4XQ3A 1AWOA 2Y4YA 3DB3A 2VGNA 4BDZA 3H8ZA 1VYVA 5I21A 2J6FA 1LVKA 2L3QA 4LDWA 2RQWA 4HT9A 5ECAA 2DYBA 4OMPA 1VQOQ 5LJ3j 1ZSZB 2OI3A 1AEYA 5LJ5d 1DJ7B 3QPHA 1CSKA 4OGEA 1D1BA 3CBOA 1PNJA 3JB9I 1WPYA 1X69A 4HCZA 4M7DA 2RA2A 2JTMA 4QQDA 3TSWA 1K4US 3M0QA 1HXDA 1VQKT 1SHFA 2JW4A 1X2KA 2MK5A 3G4SA 3OY9A 2VV5A 4JJCA 1D0XA 1TUDA 1M1GA 1G3WA 2EFIA 5GAOp 1UGVA 2BZ8A 2E6ZA 2OTJA 2DL4A 2EGAA 3MCAB 3META 3EG1A 3L2QA 1B7TA 3QSUA 2RI3A 3JCMc 2AHJB 1G3YA 3PGGA 5CK9A 3EG2A 2X3WD 1OU9A 4AFUC 4EMHA 1K73U 1VQKQ 1YJ9A 1M27C 2V26A 4Z88A 3QZ9B 1MMDA 2H8HA 1SSFA 4KT0E 3V7CA 3SEMA 2X3XD 4FU6A 1VQPA 3PIOA 4P5NA 1SSHA 2CP6A 4BE0A 1U8RA 1NG2A 1OZ3A 2K5IA 1UE9A 2DBMA 3H0FA 3NGPA 4BY6C 2KT1A 3UDCA 4CC2A 2M16A 1EZZB 2DNUA 5GAN5 4PJLA 4M7AF 1YFNA 2DE0X 2EQJA 2BTTA 3QWXX 2E10A 4BI4A 2QQAA 3OYJA 2A28A 2K6DA 2QDYB 4AT1B 4M7AC 2X9HA 1KD1R 2YHTA 3CCLT 2PNIA 4Q5WA 1OOTA 5HK3A 3OYFA 1KFZA 5A0GA 1VQ6T 2K5FA 2QEXT 3CCQT 2LNHB 5GAOl 3ULRB 1ABOA 2CGHA 3G6EA 1GCQC 3QJ6A 4J7FA 3CCEA 1M2OA 4J9FA 3JB9J 1IREB 5LJ3f 1WYXA 5FU7C 3LH5A 3OYYA 5GAMh 1WXBA 2L3SA 7AT1B 1JJ2A 3L2RA 4C92G 1QCNA 3X25B 3CCLQ 2EPDA 1SHGA 2KAFA 5I2MA 2DTOA 3HL8A 2EJ9A 4FT2A 1K0XA 3EFSA 1BI3A 3MHXA 1JO8A 4OMQA 1VQ6Q 1AOJA 1MNDA 4EMKC 5A0LA 1BKBA 1GBQA 2QEXQ 3CCQQ 1NYFA 4MDXA 3TSZA 3PNWC 3OYMA 1W2BS 2EWNA 4RG8A 1OPKA 2GNCA 4RMOA 4M7AA 2ESWA 1Q82U 3VUBA 2LT4A 1JXMA 1K1ZA 2DM1A 4C8QG 4J9EA 4ZGEB 1K73C 2ENMA 2QI2A 3JCMP 4B9WA 1S72A 5GAN4 1I07A 2E3HA 1I1JA 1VIEA 2P0KA 2GFAA 2P84A 1VQ5T 5IN1A 1H3ZA 2NUTA 4ESRA 3MO8A 4QQ6A 2YRCA 3MEWA 2ZPFB 1AT1B 4M75D 3L1AA 3IQLA 5LJ5j 5I11A 4BDYA 1D3BB 2EYXA 3OYNA 5CVIA 4HCCA 2K7AA 5GAMd 2AK5A 2K2MA 4BI3A 4KGZB 4EDUA 1B34A 3VRYA 1XOVA 4K11A 2RJEA 3I9QA 2COYA 2K79A 3V7SA 4F7UF 2E4HA 4E7IA 2H3EB 1VQ5Q 5GAN2 1IRXA 4BE1A 4J9DA 2E5KA 1ZQ1A 5CCAA 1YWPA 1I8FA 2K3YA 4DEYA 4KGXB 1ZBJA 5KYWA 2CZ7B 4QVCA 1YJNA 3G7ZA 2RMOA 2DA9A 1WZOA 2CDTA 5LJ3g 5IT9E 2H3JA 1B3QA 3VU3C 4XTWA 1ACMB 1ZHIA 4NL2A 2GGRA 3FIFA 1VQMA 1KQSP 3EGXA 4KUIA 1FWZA 1KQ2A 2CT3A 2I2LA 2KXDA 1KG1A 3H9NA 2C0OA 2NUZA 1YIJT 3CCRT 2XDPA 4C0DC 5KCOA 2WACA 3T9NA 2RB6A 2PUKB 2MMPA 3LYIA 2IPOB 3R6NA 1R77A 4DEXA 1YITT 4BB7A 4C0ZA 5FRMA 1MUZA 3EGDA 5I22A 4M7DB 2ED0A 3EH1A 3SHWA 1PRLC 1LPLA 8AT1B 2OTLT 3GIBA 3OQ5A 5KE2A 1SG5A 5GAOr 1Q82C 1YIJQ 1QCOA 1FMVA 3CCRQ 2LRQA 1BIBA 3H6ZA 2C0IA 1ARKA 2AKLA 2VVKA 4F7UA 2K4YA 2P0QA 3CMET 4HXJA 1OX8A 1WNLA 2DD5A 4JPBW 1BBZA 4M78F 2B86A 1I4K1 4FW2A 1BCMA 1ZUYA 2OTLQ 4Z89A 2DYIA 1MMAA 4OGCA 3LWIA 1M90U 2D0QB 2GCXA 3V8KA 3CCVA 5LJ5f 4M78C 2X4XA 1EX4A 5CO7A 5KYXA 3CCMA 2KEAA 1WJSA 3OW2A 3CC2A 3P8BB 2BZXA 3I56A 4PJOD 2LC4A 2X51A 4PLIA 1GRIA 3VS4A 3CPWP 1TU0B 3MKDA 3CMEQ 2RQUA 2HNIA 4KRTA 2E5QA 1OPLA 2LNVA 4PJMA 4JRIA 2PVGB 1VQ8T 4KBMB 2AKKA 3OBWA 4A4HA 2C06A 1K8AU 3QDFA 3X20B 5J39A 3A8GB 4EPCA 3OYIA 5AT1B 1BI2A 1TG0A 1UJYA 3JCMg 4J6XA 2HQHA 1PC0A 2NWMA 3A8OB 3WVDB 1I5LA 4ZTJA 2EKOA 5CQYA 2YXYA 2HBWA 1LNXA 1ZUKA 4UC4A 3QBYA 1D0ZA 1FXXA 1QVFS 2QDLA 1WDXA 1IZ6A 4DOVA 3UT1A 3J7AF 5J26A 1OI1A 3SB2A 4DBFA 3CD6Q 3I55Q 2XMFA 3BDUA 1YI2A 1VQLT 1X6BA 3M0TA 2JS0A 2D8JA 3GPLA 3RUXA 2VWFA 4M78A 4JDSA 1KQ1A 4JLIA 2FB7A 1X6OA 2DEUA 1WHMA 3M58A 3M4GA 4QVZA 1BCOA 3QKJA 2DJQA 3I5RA 4BY6B 5GAMj 2RF0A 2LDMA 5AYFA 3CMAA 3RKXA 1IGQA 3URGA 2JT4A 3FJ5A 1JBMA 5D7UA 3GNFB 4GBQA 3DLMA 1X01A 3RERA 1ABQA 5IXBA 3TU4K 2F5KA 4AG1C 5CKBA 4M7AB 1RL2A 1TWBA 4XU2A 2ATCB 2ROTA 4MDWA 2CT4A 1BIAA 4FCYA 5CIUA 5LJ5g 1OZ2A 3GBQA 3CC7T 4HT8A 1GXIE 2JM8A 4IUQA 1YJWA 3ZBDA 2RM4A 5LL6S 1RAGB 4C92D 1CKAA 2DRKA 1VQOA 3LX7A 1M90C 2X35A 1YHQA 1QP3A 4M7DG 2NUTB 1M3CA 2J05A 1Q86U 3FC3A 4CC7A 3KXTA 1QVGS 2F5TX 1R8OB 1NEBA 2DMOA 2WSEE 3M53A 4IKFA 5D6WA 1PKSA 1OU8A 4LE9A 2RN8A 2MWOA 5GAN3 1FYNA 2MYSA 4M7AE 2DBKA 2D9TA 4CC3A 3PVLA 3CXCA 4Z8AA 2X4JA 1B34B 2QA4A 3R6OA 2AZVA 3Q1JA 3CC4Q 2A0FB 3CC7Q 1K8AC 1TOVA 1ZSGA 2ZPGB 2COWA 1OULA 1Y71A 1WHKA 2PVDB 2KGTA 3GOXA 3OYKA 5GMKe 2L5QA 3CBMA 2O31A 3LGFA 5KYWB 2LQWA 2DIQA 4D6WA 2DXTA 4BE2A 3CCSA 2EYWA 1JQQA 2L89A 2MOXA 3M4YA 2VUBA 1YWOA 1JJ2P 4LDUA 3EGXB 1BU1A 2QG9B 2YLBA 4XTYA 4PFZA 2HCKA 4E47A 1NEGA 5D6YA 3AT1B 3MEAA 1VQ4Q 1C0MA 2Z0WA 3JAME 4ME7A 3EHQA 2DJZA 2EJGA 4HVUA 2DRMA 3OYHA 3QYGB 5DLOA 1TSFA 1RLQC 1V76A 2M0YA 3EGDB 5GAMf 5C0MA 2DXUA 4E7JA 5IHNA 4XTXA 2CSQA 2W0ZA 1BK2A 1SKUB 1R0CB 3OA6A 1G83A 2QQ9A 4A4GA 3JCMV 3H0HA 1OYXA 1BI1A 1PHTA 1VA7A 2DKGA 4PJOG 2RQRA 4JRQA 2FHDA 4HVWA 2OX7A 4HCBA 5A2QE 1WA7A 2M1HA 2K2VA 2A37A 1X6GA 2RD1A 1Y96B 2EKHA 1D0YA 3VV0A 3ZL7C 3G71A 4F7UB 3PE0A 2ZPBB 1QKXA 3CCUA 1I81A 1VQ7Q 4O6JA 2KDSA 1NJIU 2IVWA 2EVRA 2EYZA 5HCKA 1Q86C 3A1PA 4VUBA 3UPUA 5KH6A 4R56A 1KC8U 2HSPA 1I5OB 5DY9A 2P4TA 2ZAEA 4MZTA 5KYXB 3SDZA 1EFNA 1ZBXA 3CEYA 4LXCA 2A08A 2FRWA 2QTVA 2QEXA 3CCQA 2O9SA 3G4ST 1JRIA 2JOYA 2R57A 3MEUA 5FRNA 1YBYA 1WFWA 1Q7YU 4F7UE 1UJ0A 4FYYB 3QDRB 2O88A 2CZ6B 1M90R 4J7IA 1A0NB 4Y91A 3JV3A 2OTJT 1MMGA 5FROA 3GNGA 2KMTA 4PFOA 5KE3A 2RK2A 1WHJA 5EC7A 3M56A 3OMCA 1WIEA 2FRYA 1W4SA 5FU6C 3VS3A 2XIDA 2YRVA 3OB9A 4M77F 2VXFA 2EGEA 4DQ2A 3G4SQ 1WJQA 1K8AR 2ROLA 2YDLA 4DBQA 4GLMA 2DAQA 5GAMg 1VQPT 4OVAA 5CKHA 4M77C 2FZCB 3OYDA 4RTTA 2OTJQ 2DEQA 4RUGA 3S6WA 2J7IA 2QTXA 2XI9A 2GF7A 2LT1A 4LUDA 4QVDA 5IXFA 2OAUA 2JJ9A 1NBEB 2ZPIB 1VQ5A 4OMLA 2XKOC 1VQ9A 2O2OA 4J9IA 3C12A 2CP3A 1H641 1YJ9Q 1LJOA 3REBB 5IHKA 2HL5C 3JB9F 4C92F 3OYGA 4KH0B 2NUPA 4FM4B 4HA8A 2OJ2A 1VQPQ 1V29B 4L59A 1H8KA 3NTIA 3OYCA 1YN8A 4XU0A 1AWWA 3L2WA 3QYHB 4C5EA 4C92C 4E7LA 2DVJA 4PNOA 4M78E 3NPFA 1W2BP 5FWCA 3RMQA 4NL3A 5A0DA 4LUEA 1T3LA 4OMNA 4HCKA 3OW2P 4WCIA 3UATA 3RKYA 1JXOA 3A8HB 1KC8C 1T0HA 2YLCA 1GCQA 2X4YA 2MCNA 3HFNA 2DIGA 1RAAB 2ZPHB 2E41A 3OMGA 4M77A 2KYBA 4C8QF 5CKEA 4HVVA 2EYQA 1TUGB 4ZNXA 2J06A 2AIRB 4MZMA 4RTYA 3UF4A 3A98A 1I0CA 2CP5A 4QW2A 1Q7YC 2VXEA 2RHXA 4RCCA 3NTKA 4C8QC 1UGRB 2DZCA 2M51A 1ZSZC 1RLPC 3CCRA 1M1FA 3PT9A 3REAB 3G6EQ 4EMKA 4PKCC 1Q86R 4F7UG 3J81E 1KHIA 2F1LA 4J6YA 1K9AA 2M02A 2EBPA 1H92A 4B6MA 3TREA 1QWFA 5C6SA 2QQRA 4PL6A 5LJ3e 1YITA 4D8DA 4DBHA 1BYMA 2DTIA 1M8VA 1P92A 3PMTA 4N0AC 2BUDA 4M7DD 3E1SA 3VKIA 4JZ4A 1S72T 5IH2A 2PUOB 5HY6A
chains in the Genus database with same CATH topology
4IURA 3WVDB 1YJ9T 1G3SA 3MEVA 1I5LA 4ZTJA 2EKOA 2HQEA 3NFCA 5CQYA 2KQWA 2QQSA 4XAXB 1LNXA 2JNGA 4UC4A 3QBYA 4JS5A 1KQSS 4B9XA 4II1A 4ZN3A 1FXXA 1AHJB 5GMKl 4RG2A 4X34A 1QVFS 2E1HA 2RH2A 4N4GA 1N8RC 1IZ6A 1PSEA 2KSSA 4XQ3A 5D6XA 3UT1A 4DOVA 5GAN6 2V8IA 3J7AF 2Y4YA 3DB3A 1OI1A 1N27A 2VGNA 3O8VA 5J26A 3SB2A 4BDZA 2XD0A 4J8OA 2B8AA 3H8ZA 4PJOA 3BDUA 1YI2A 1VQLT 5I21A 4M78B 2LCLA 4OB2B 4LDWA 4J6WA 3A8LB 4HT9A 3GPLA 4BI8B 4A4KA 2VC8A 3RUXA 2BKDN 2MF2A 4R55A 4M78A 5LJ3j 3GLXA 3CPFA 3QO3A 4JDSA 1KQ1A 3C4SA 4JLIA 5LJ5d 1DJ7B 2ZGWA 2FB7A 3V8JA 3X24B 5CKDA 2M0OA 3QPHA 1X6OA 3M58A 2F69A 3M4GA 2HBPA 4OGEA 4QVZA 3QKJA 3SD4A 3CBOA 4C8QA 3JB9I 1WPYA 4BY6B 3JB9G 5GAMj 4HCZA 3S3OA 2LDMA 3CCJA 4M7DA 2RA2A 2JTMA 3JRZA 4QQDA 2LX9A 5AYFA 2ZZDA 3CMAA 3FJPA 4DOWA 3RKXA 3URGA 3ZFJA 5GANj 1HXDA 1FX7A 4OB1B 1VQKT 4KUDK 4JS4A 1JBMA 3G4SA 2V8JA 3MP8A 4LD9K 4ELZC 3GNFB 4GY5A 4NOYA 3OY9A 2VV5A 3DLMA 1X01A 1WGSA 3RERA 2G3RA 1NJIC 3LGLA 4N4IA 3KBGA 3OS5A 2LQKA 3TU4K 3M55A 2F5KA 3P8HA 5CKBA 2K5LA 1M1GA 1RL2A 4M7AB 1G3WA 2KY9A 2EIFA 4N0AA 2RHZA 5GMKm 2EFIA 4XU2A 5GAOp 4HKEA 3HRSA 3G6ET 2RI2A 2VGMA 2LQ8A 2RHYA 4MDWA 2E6ZA 1BIAA 4YTLA 3OW2S 3CCET 3M59A 2OTJA 3MCAB 3HRUA 5CIUA 3ER0A 3META 4IUUA 1VQ8A 3L2QA 5J3BA 1OZ2A 5LJ5g 3CC7T 2Y4XA 4HT8A 1GXIE 4E7KA 4IUQA 1YJWA 3EFRA 5GAOm 4FSXA 3QSUA 3ZBDA 2RM4A 5LL6S 4C92D 2RI3A 3HPWA 3JCMc 2O4XA 5DM7R 2DZ9A 1VQOA 2AHJB 1G3YA 3LX7A 4A4EA 2CZ1B 3PGGA 1U1TA 2BIVA 4C5HA 3OYBA 1M90C 3HSBA 5CK9A 3PIPA 2X35A 4O5VA 1YHQA 3LLRA 1QP3A 4M7DG 3AHUA 4PLLA 4JRKA 4EMHA 1K73U 1Q86U 1W2BA 3FC3A 3KXTA 1YJ9A 1QVGS 1NPRA 2F5TX 1R8OB 4FIBA 3QZ9B 4LDVA 4IUTA 1SSFA 4KT0E 3V7CA 1VQ9T 2DVEA 2WSEE 3M53A 3RKWA 3JCMb 3LW5E 4IKFA 5D6WA 4FU6A 3EAEA 2PQWA 1VQPA 3PIOA 2DO3A 4P5NA 3CPWS 4KULA 2MWOA 1BI0A 3CBPA 3LH0A 3VJPA 5GAN3 1YIJA 4LDXA 1M1KC 3UWNA 4BE0A 1U8RA 1OZ3A 2K5IA 4M7AE 2D9TA 4FT4A 3CXCA 2HD0A 4OB3B 1K9MU 4JJNK 4BY6C 3CD6T 3UDCA 3I55T 2RHUA 2X4JA 3NTHA 1B34B 2QA4A 2M16A 3R6OA 3Q1JA 1VQLA 1K8AC 4L6V5 5GAN5 3JCMe 2ZPGB 4M7AF 4JUVA 1Y71A 3FEOA 3L2ZA 2GFUA 3VUZA 2EQJA 2E10A 3JCMJ 4BI4A 4XK8E 2PVDB 4X9CA 4IUVA 3GOXA 3OYKA 3HHTB 2QQAA 1N6AA 3OYJA 4FL6A 4C92A 2QDYB 3OBYA 2L5QA 3CBMA 4C0FA 5GMKe 2OTLA 4M7AC 3LGFA 2YHTA 3CCLT 2DIQA 4D6WA 4Q5WA 2DXTA 4BE2A 5GANe 5HK3A 3CCSA 2K57A 1XQHA 4N4HA 3FB9A 5HKCA 3L42A 1LOJA 3OYFA 2O01E 2L89A 4BUGA 3M4YA 4M75B 3S3MA 5A0GA 2VUBA 3M5AA 4E7HA 2RK1A 1VQ6T 3CCVT 5GAOq 4LDUA 1VIFA 2K5FA 2QEXT 3CCQT 3A8MB 5GMKi 2CYZB 3CCMT 4M7AD 5GAOl 2YLBA 4XTYA 2QXFA 2XDBA 1VQ8T 2CGHA 4RKUE 3G6EA 2FL7A 1NPPA 4E47A 3I56T 3CMEA 2E6NA 5D6YA 3QJ6A 4J7FA 5LJ3h 3CCEA 3MP1A 4C5IA 3V7RA 3MEAA 3JB9J 3JCMf 1UGPB 1IREB 5LJ3f 3JAME 4ME7A 2DJZA 5FU7C 2EJGA 3OYYA 1VQNA 5GAMh 3WXMB 2HQXA 4BD3A 3OYHA 3QYGB 1JJ2A 3L2RA 4C92G 5DLOA 3X25B 5GMKj 1O75A 2KAFA 5I2MA 2DTOA 5GAMf 2DXUA 5C0MA 3HL8A 2EJ9A 4E7JA 4J83A 4JRPA 4XTXA 4FT2A 2L3RA 3EFSA 1BI3A 3FRNA 2ZCFB 3MHXA 4JLGA 2A3LA 3BW1A 1N9RA 2V8KA 2EJFA 3OA6A 5GANf 2QQ9A 1YJNT 3BDLA 4EMKC 2DXBA 2QQBA 4M75E 4A4GA 5A0LA 2R5MA 3JCMV 3JCMW 1OYXA 3JCMQ 1BI1A 1BKBA 2D6FA 2EAYA 2DKGA 2K3XA 4MDXA 2JUFA 4PJOG 4JRQA 4IUPA 2FHDA 3PNWC 5LJ5e 3OYMA 1EIFA 1W2BS 4Y28E 3JB9H 2P0PA 1VQMT 4HCBA 2EWNA 1XNIA 2M9UA 3M57A 4RG8A 5A2QE 4M75F 2M1HA 5CKFA 2K2VA 2PVOB 4C5GA 5IAYA 2CKKA 3CD6A 2EQKA 3I55A 4ATOA 2E12A 2RD1A 1Y96B 3VV0A 4RMOA 1Q82U 3VUBA 2PU9B 4M7AA 2LT4A 4M78G 3CC4T 3G71A 4XU3A 4X9DA 2R58A 2CZ0B 4F7UB 5FU6B 2ZPEB 2ZPBB 3CCUA 1I81A 4O6JA 2KDSA 1Y96A 1UGQB 4C8QG 1YI2T 3CXCS 3QUIA 4ZGEB 4M75C 1NJIU 2IVWA 5I2SA 1K73C 2QI2A 3JCMP 4B9WA 1Q86C 2JVVA 1S72A 5GAN4 2KVQG 2IG0A 4VUBA 1VIEA 5CAIA 3UPUA 3A5ZB 2P0KA 2GFAA 3DLLA 1VQ5T 5IN1A 4M77B 5KH6A 1UEBA 4A53A 1H3ZA 3X28B 4R56A 1KC8U 3MO8A 4QQ6A 3MEWA 5DY9A 5FU7B 4M7DE 2XG8D 3RMSA 2CS7A 2ZPFB 2P4TA 3QJYA 4M75D 3L1AA 4MZTA 4TVRA 1Q81U 3CCJT 1K9MC 3SDZA 5LJ5j 2XICA 1ZBXA 3CEYA 5LJ3d 3ME9A 3GF5A 4BDYA 1D3BB 2DXCA 4XTUA 1M5Q1 4M7DF 2QEXA 2XHCA 4QQGA 3CCQA 4OP0A 3OYNA 3G4ST 5CVIA 4HCCA 1JRIA 2JOYA 2R57A 3MEUA 5FRNA 3OSVA 1YBYA 4EMKB 1KD1U 5GAMd 3QXEB 4BI3A 1Y07A 1Q7YU 4F7UE 4EDUA 1NZ9A 3OYLA 3OSSC 1B34A 3QDRB 2CZ6B 3QZ5B 1XOVA 2VYTA 3QIIA 1G3TA 4ZGDB 3OS1A 2RJEA 2RHIA 4J7IA 3V7SA 1VQ4T 3FDRA 4M7DC 2NLUA 3TCJA 5GANd 4WF2A 4OB0B 2L8DA 4DA4A 4F7UF 4NS5A 4Y91A 2OTJT 5FROA 4E7IA 3HFOA 3GNGA 2KMTA 4XU1A 2JZ2A 3PTAA 5GAN2 2LTOA 3KUFA 3FLGA 3DKMA 5KE3A 4BE1A 3M9QA 2RK2A 3SWNB 4V2SA 4M77E 3M56A 4ZGJB 1PSFA 1ZQ1A 5CCAA 1M9SA 3OMCA 1I8FA 1UGSB 2K3YA 1VQKA 1VUBA 2CZ7B 1W4SA 5FU6C 1YHQT 5EG2A 2XIDA 4QVCA 2YRVA 1YJNA 3OB9A 3G7ZA 4M77F 2VXFA 5GAN7 5IT9E 5LJ3g 1G5VA 2H3JA 4DQ2A 1WJRA 1WJQA 4M75A 5KCHA 3VU3C 4XTWA 1ZHIA 3CC2T 4NL2A 4GLKA 3TEEA 3BY7A 3HP9A 3FIFA 1VQMA 3JCMh 4KUIA 2RJDA 1FWZA 2DAQA 1KQ2A 3L2VA 2I2LA 5GAMg 1KG1A 3E19A 1VQPT 4PJOB 3PFSA 4OVAA 4LDYA 1YIJT 5CKHA 3CCRT 4M77C 3CC4A 3CC7A 2DPPB 3S3NA 1N8RU 2XDPA 4OF1A 4C0DC 2WACA 3HRTA 5KCOA 4OMFB 3T9NA 3OYDA 5GANg 4ELYC 2RB6A 2DEQA 4J5YA 1VQ7T 1NE8A 3S6WA 2QA4T 1XTDA 2PUKB 2MMPA 3LYIA 2WSFE 3E9FA 5GMKh 1Y7XA 2QTXA 3VYHB 5L8RE 2XI9A 2GF7A 2LT1A 4XTZA 4EMGA 1YITT 4QVDA 4BB7A 3MP6A 4C0ZA 5GANh 4C8QB 5FRMA 4ZN1A 2OAUA 3L2UA 1KQSA 2FVUA 2ZPIB 4M77D 4C92E 1M4ZA 3DB4A 3RESA 1VQ5A 2A7YA 2XKOC 1VQ9A 1QVFA 4M7DB 1UB4A 1O9SA 3C12A 4XTVA 5CR2A 2HAXA 1H641 1LJOA 3GP8A 2KK4A 4A4FA 2OTLT 1QW1A 3GIBA 3JB9F 2LCCA 2JN0A 2MAMA 2X4WA 3OQ5A 4C92F 1YCYA 3OYGA 4M75G 2XU8A 4FM4B 2DD4A 1WQ7A 4HA8A 5KE2A 4LD6A 3CCST 5GAOr 2RO0A 4C0GA 1Q82C 2E64A 3M54A 3ZEHA 1V29B 4L59A 3NTIA 2LRQA 5CQXA 5FLXE 4PJOE 2JTFA 2E65A 3C95A 1BIBA 3OYCA 4M7DD 3SWNC 4BACA 4XU0A 3H6ZA 4CI0C 1MHNA 3L2WA 2XK0A 3QYHB 2RJCA 3QHSA 4C5EA 4C92C 4E7LA 1TH7A 2R5AA 4PJOF 3HKSA 4PNOA 3X26B 2K4YA 4M78E 4F7UA 3OYEA 2P0QA 5M9OA 2EQMA 1VQ4A 1KHCA 3RMQA 3J80E 4NL3A 3CMET 5HK0A 4A54A 5A0DA 2XDDA 2Y90A 3V8LA 1WNLA 5GAOn 2O4XB 2E70A 3RKYA 2DD5A 4C8QE 5GAN8 3A8HB 1KC8C 3LWHA 2LVMA 4MZPA 4M78F 3WVEB 3CCLA 2YLCA 1I4K1 4C0DB 3JB9D 2X4YA 3RIRA 1VQNT 4PJOC 2MI6A 4L5GA 1Q81C 3HFNA 1JJ2S 2DIGA 2ZPHB 2E41A 2RI5A 3OMGA 4M77A 4OGCA 4C8QF 3JCMd 5LJ5h 3LWIA 3ASKA 1M90U 5CKEA 2D0QB 3CMAT 2GCXA 1VQ6A 2EYQA 3V8KA 3E9GA 3CCVA 1WQWA 4MZMA 3VYGA 2WSCE 4MMLA 1X75C 5LJ5f 2MWPA 4M78C 2X4XA 4QW2A 5CO7A 3OS0A 3CCMA 1KD1C 4M7AG 4CRIA 1WJSA 2VXEA 2RHXA 4RCCA 3OW2A 1Q7YC 3P8BB 3CC2A 3NTKA 3I56A 3INZA 1U1SA 1D3BA 4C8QC 1UGRB 2DZCA 3PMIA 4PJOD 2LC4A 1MGQA 4PLIA 1QP2A 2EQUA 3SFMA 3OYAA 3CCRA 1M1FA 3PT9A 2DK3A 3P8DA 4ZTFA 1QVPA 4EMKA 4PKCC 1M1KU 4F7UG 2HNIA 2DTHA 3J81E 2E5QA 5DLQE 3JSCA 4Z02A 1KHIA 1N9SA 1VQ7A 2LNVA 4M78D 2PVGB 4JRIA 4J6YA 3F70A 4KBMB 4MMKA 3OBWA 4RCBA 2RJFA 3N5BB 4A4HA 3G71T 2FYKA 3JCMX 3C94A 3TREA 1YJWT 2C06A 5C6SA 2QQRA 4PL6A 3CCUT 5LJ3e 1QVGA 1K8AU 3X20B 4C8QD 1YITA 5J39A 4C92B 3A8GB 1VQOT 2GQVA 1BYMA 1JB0E 4EPCA 2DTIA 3OS2A 1P92A 3BFMA 3OYIA 1RI0A 3PMTA 4N0AC 2BUDA 1M8VA 3SWNA 1BI2A 3E1SA 1HK9A 3QG1A 4M77G 3JCMg 3VKIA 4J6XA 3CPWA 1S72T 5GAMe 2PUOB 5HY6A 3A8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD K;  4FSX A;  4BB7 A;  4DA4 A;  1ZHI A;  2FL7 A;  4LD9 K;  4FT4 A;  4JJN K;  4KUI A;  3PTA A;  2FVU A;  1ZBX A;  1M4Z A;  3TU4 K;  4DOV A;  1W4S A;  4DOW A;  4FT2 A;  4KUL A;  3PT9 A; 
#chains in the Genus database with same CATH topology
 4IUR A;  3EG0 A;  4FYV B;  2HQE A;  3NFC A;  1IB8 A;  2JNG A;  1KQS S;  1MV3 A;  4X34 A;  5GAN 6;  2V8I A;  2GTJ A;  1AZG B;  1N27 A;  2XD0 A;  1RUW A;  2EW3 A;  4J8O A;  2B8A A;  1RI9 A;  1TS9 A;  3UA6 A;  1Z9Q A;  1PWT A;  2LCL A;  4OB2 B;  1ZX6 A;  2ECZ A;  4A4K A;  4KGV B;  2BKD N;  2MF2 A;  4R55 A;  3GLX A;  3CPF A;  3C4S A;  3X24 B;  1NLP C;  5CKD A;  2M0O A;  1S72 Q;  1HD3 A;  4C8Q A;  3G1J A;  2FPD A;  4AFS C;  3CCJ A;  9ATC B;  3VS5 A;  3FJP A;  5FW9 A;  2BZY A;  3ZFJ A;  4OB1 B;  1FX7 A;  2DFU A;  2V8J A;  2CP2 A;  3MJX A;  4ELZ C;  1KSW A;  4GY5 A;  1FMW A;  1RAI B;  1WGS A;  3LGL A;  3M55 A;  3EHR A;  2K5L A;  2QGF B;  4N0A A;  4HKE A;  3HRS A;  3RBB B;  1WX6 A;  1UFF A;  3M59 A;  4IUU A;  1BB9 A;  1FMK A;  1X43 A;  1VQ8 A;  1KJW A;  4E7K A;  3EFR A;  4FSX A;  2DL3 A;  5DM7 R;  2DZ9 A;  3OYB A;  3CXC P;  3HSB A;  1U1T A;  4C5H A;  4F04 B;  3PIP A;  4JJD A;  1YCS B;  2KYM A;  4JRK A;  3RDV A;  2QYZ A;  1W2B A;  2I0N A;  1NPR A;  4LNP A;  1YJN Q;  2DVE A;  2JS2 A;  1NJI R;  2DO3 A;  3CPW S;  4KUL A;  3LH0 A;  3UWN A;  1VQM Q;  4J9C A;  4FT4 A;  5KYY A;  2HD0 A;  4OMM A;  1K9M U;  4JJN K;  3CD6 T;  3I55 T;  2RHU A;  2YRD A;  1VQL A;  2FPF A;  1KC8 R;  3JCM e;  4JUV A;  4IIO A;  3VUZ A;  1JEG A;  1RAC B;  2HDA A;  3I35 A;  4XK8 E;  4X9C A;  1N5Z A;  3HHT B;  4FL6 A;  2ABL A;  4IIM A;  2V1Q A;  1AZE A;  3C0C A;  1Q7Y R;  2FG0 A;  5GAN e;  1XQH A;  1ZUU A;  3FB9 A;  5HKC A;  3L42 A;  1LOJ A;  2HKN A;  4J9G A;  4BUG A;  3M5A A;  4E7H A;  1W1F A;  3CCV T;  2HL3 A;  1VIF A;  4OMO A;  1IHV A;  2CYZ B;  3CCM T;  4M7A D;  2QXF A;  2FL7 A;  3I56 T;  4C5I A;  2CH4 A;  1QVF P;  3HTR A;  1UGP B;  2LJ0 A;  4FYW B;  1VQN A;  2JMA A;  1KK7 A;  4J83 A;  1GFC A;  3FRN A;  2ZCF B;  2DF6 A;  2A3L A;  3BW1 A;  3UA7 A;  2V8K A;  3CCV Q;  3THK A;  2QQB A;  2NUP B;  3JCM W;  2D6F A;  2KE9 A;  3JCM Q;  2EAY A;  3CCM Q;  5LJ5 e;  3CC2 Q;  4PJN A;  3JB9 H;  1PCX A;  2L3P A;  3I56 Q;  1XNI A;  3M57 A;  4M75 F;  5CKF A;  2CKK A;  2E12 A;  3CC4 T;  4XU3 A;  5FU6 B;  2QK0 A;  2W10 A;  1D09 B;  1YI2 T;  1SF9 A;  4M75 C;  2GQI A;  3EFO A;  2IG0 A;  1M2V A;  3A5Z B;  3DLL A;  4M77 B;  2L0A A;  1UEB A;  3X28 B;  4X1V A;  2KXC A;  5FU7 B;  2XG8 D;  3RMS A;  1M3B A;  1Q81 U;  4TVR A;  1K9M C;  4RTX A;  2O9V A;  1OEB A;  3ME9 A;  3GF5 A;  4XTU A;  4M7D F;  1M5Q 1;  4QQG A;  2JXB A;  4OP0 A;  1GBR A;  2F2X A;  1UG1 A;  2RPN A;  1WHG A;  4EMK B;  1YI2 Q;  3OSS C;  2VYT A;  1G3T A;  3OS1 A;  1VQ4 T;  4M7D C;  1QKW A;  2MIO A;  2NLU A;  2D0N A;  3TCJ A;  1Q95 G;  1X27 A;  5GAN d;  2L8D A;  2KT8 A;  4NS5 A;  1R0B G;  4M4Z A;  2SEM A;  3HFO A;  2JZ2 A;  3VS7 A;  3FLG A;  3DKM A;  3M9Q A;  4V2S A;  4M77 E;  1PSF A;  2D8H A;  2RQT A;  1QWE A;  1VQK A;  1Y57 A;  1U3O A;  1VUB A;  2RNA A;  2LJ3 A;  1YHQ T;  2J6O A;  1G5V A;  2K3B A;  2BE7 D;  4M75 A;  2FPE A;  4FW1 A;  3BY7 A;  3HP9 A;  4CC4 B;  4PJJ A;  1QQJ A;  3L2V A;  3EG9 A;  3PFS A;  3KFV A;  4LDY A;  1GCP A;  1WXT A;  4F16 A;  2DPP B;  3S3N A;  2HZY A;  5GJW B;  4ELY C;  1UUE A;  1VQ7 T;  1NE8 A;  2QA4 T;  1PD1 A;  1XTD A;  3E9F A;  5GMK h;  1Y7X A;  1WHL A;  2KRS A;  1YJW Q;  3VYH B;  5L8R E;  4ORZ A;  2CUD A;  4C8Q B;  1RAD B;  1U06 A;  3L2U A;  1UEC A;  1IHW A;  4C92 E;  1YHQ Q;  2A7Y A;  1QVF A;  3M0U A;  1UB4 A;  1O9S A;  5CR2 A;  2HAX A;  2KK4 A;  4A4F A;  2LCC A;  2X4W A;  2MAM A;  1YCY A;  2XU8 A;  2DD4 A;  4LD6 A;  3RNJ A;  3CCS T;  2RO0 A;  2DL5 A;  2E64 A;  3ZEH A;  3C95 A;  1Z9Z A;  3SWN C;  4CI0 C;  2DL7 A;  2XK0 A;  2RJC A;  3QHS A;  5L23 A;  2QA4 Q;  2R5A A;  4PJO F;  3HKS A;  1M8M A;  5M9O A;  2EQM A;  1KHC A;  5HK0 A;  2XDD A;  1TTH B;  2Y90 A;  3V8L A;  5GAO n;  1F1B B;  4C8Q E;  2E70 A;  5GAN 8;  4E6R A;  3CCL A;  2LVM A;  4MZP A;  4C0D B;  4PJO C;  2MI6 A;  3PVQ A;  1Q81 C;  2RI5 A;  4FSS A;  2PTK A;  3ASK A;  3CCS Q;  1VQ6 A;  1E6H A;  1M3A A;  1WQW A;  3VYG A;  3TVT A;  1X75 C;  3TQ7 P;  1SRM A;  2BE9 B;  4CRI A;  4M7A G;  2CP0 A;  3INZ A;  5KYY B;  1QP2 A;  5KYN A;  1PD0 A;  2DK3 A;  3P8D A;  3EH2 A;  1M1K U;  2GBQ A;  1MMN A;  2DER A;  5DLQ E;  4Z02 A;  1N9S A;  5IHI A;  4M78 D;  1G8X A;  3F70 A;  4RCB A;  3G71 T;  2JTE A;  2K9G A;  2FYK A;  3BE3 A;  3JCM X;  3CCU T;  1QVG A;  1OX9 A;  2GQV A;  3BFM A;  4ANJ A;  1RI0 A;  1W6X A;  1K9M R;  3SWN A;  1HK9 A;  3QG1 A;  4M77 G;  5GAM e;  1SEM A;  1YJ9 T;  1G3S A;  1WHH A;  2QQS A;  4XAX B;  1QMC A;  2CRE A;  1PM3 A;  2KI7 A;  4II1 A;  4B9X A;  5GMK l;  4RG2 A;  1PSE A;  2KSS A;  5D6X A;  1S1N A;  3O8V A;  4PJO A;  1IO6 A;  2J6K A;  3M0R A;  4M78 B;  3G71 Q;  3A8L B;  3CCU Q;  4BI8 B;  2VC8 A;  3U23 A;  2LZ6 B;  3QO3 A;  3EGU A;  2ZGW A;  3V8J A;  4D8K A;  2F69 A;  2HBP A;  5KYU A;  3SD4 A;  2VAS A;  3JB9 G;  1NM7 A;  3S3O A;  2QAS A;  3JRZ A;  2LX9 A;  2ZZD A;  4DOW A;  2DIL A;  5GAN j;  4KUD K;  4JS4 A;  1N8R R;  3MP8 A;  4LD9 K;  1IXD A;  4NOY A;  2D1X A;  2G3R A;  1NJI C;  4N4I A;  3KBG A;  1VOM A;  2LQK A;  3OS5 A;  3P8H A;  5GMK m;  2KY9 A;  2RQV A;  2EIF A;  2RHZ A;  1X2Q A;  3G6E T;  2RI2 A;  2RHY A;  2LQ8 A;  2VGM A;  2KRM A;  2LP5 A;  4YTL A;  3OW2 S;  3CCE T;  4PK4 A;  3HRU A;  3ER0 A;  4KH1 B;  5J3B A;  2Y4X A;  1RAE B;  5GAO m;  3EFO B;  3HPW A;  2QAZ A;  2O4X A;  1M2V B;  4A4E A;  2CZ1 B;  2BIV A;  3H0I A;  4DBR A;  4O5V A;  2JM9 A;  3LLR A;  1H3H A;  3AHU A;  4PLL A;  1E6G A;  1AVZ C;  2CSI A;  4FIB A;  4LDV A;  4IUT A;  1VQ9 T;  2YWW A;  1M30 A;  3JCM b;  3RKW A;  3LW5 E;  2G6F X;  3EAE A;  2PQW A;  1YIJ A;  1BI0 A;  3CBP A;  3VJP A;  4LDX A;  1M1K C;  2A36 A;  4J9H A;  3CQT A;  3CCE Q;  4OB3 B;  3NTH A;  1UDL A;  1XJW B;  4L6V 5;  1TXQ A;  4AMC A;  3FEO A;  3L2Z A;  2GFU A;  1Q81 R;  2AZS A;  2CUB A;  3JCM J;  4IUV A;  1GFD A;  3QWY A;  1N6A A;  4C92 A;  4JZ3 A;  3OBY A;  4C0F A;  2OTL A;  2VKN A;  1VQ9 Q;  2K57 A;  4N4H A;  1PKT A;  2YUO A;  2O01 E;  4RTW A;  4M75 B;  3S3M A;  1K76 A;  2RK1 A;  1KIK A;  1RAH B;  1VYT A;  5GAO q;  4AG2 C;  3A8M B;  5GMK i;  3EG9 B;  3I5S A;  2XDB A;  2NYS A;  4RKU E;  2V1R A;  1NPP A;  1V1C A;  3CME A;  2E6N A;  5LJ3 h;  3MP1 A;  3V7R A;  2HEQ A;  4EIK A;  3JCM f;  3M0S A;  1VYU A;  2FZG B;  1SPK A;  2LCS A;  2HSE B;  4J9B A;  1ZSZ A;  3WXM B;  2HQX A;  4BD3 A;  2KRN A;  4PFP A;  5GMK j;  1O75 A;  1UHC A;  4JRP A;  2L3R A;  4JLG A;  2PZ1 A;  2LMJ A;  2KRO A;  1N9R A;  2IIM A;  2EJF A;  5GAN f;  2VB6 A;  1YJN T;  3BDL A;  2DXB A;  4M75 E;  2R5M A;  2FEI A;  2LX7 A;  3VS2 A;  2K3X A;  2JUF A;  4IUP A;  1EIF A;  2SRC A;  4Y28 E;  2P0P A;  1VQM T;  2M9U A;  2YUP A;  2KR3 A;  2PVO B;  2QGG A;  4C5G A;  5IAY A;  4ATO A;  1NYG A;  2EQK A;  3I55 A;  3H41 A;  3CD6 A;  3RR6 A;  2PU9 B;  1PRM C;  2EQI A;  4M78 G;  4X9D A;  2R58 A;  1GL5 A;  2CZ0 B;  2F2V A;  2F2W A;  2ZPE B;  1YNZ A;  4RTV A;  1T0J A;  2DX1 A;  1Y96 A;  1UGQ B;  1RAB B;  3CXC S;  3QUI A;  2DLP A;  5I2S A;  2JVV A;  1YIT Q;  2KVQ G;  1T3S A;  8ATC B;  1Y0M A;  5CAI A;  4A53 A;  4M7D E;  1TUC A;  2CS7 A;  4E7S A;  3QJY A;  1D1A A;  3CCJ T;  4R0K A;  2XIC A;  2FO0 A;  5LJ3 d;  1PG5 B;  2GTO A;  1ZA2 B;  4AFQ C;  1E7O A;  2DXC A;  2XHC A;  1AWJ A;  3NMZ C;  3OSV A;  1KD1 U;  3QXE B;  1Y07 A;  1HSQ A;  1NZ9 A;  3OYL A;  2LJ1 A;  3QZ5 B;  2EGC A;  3QII A;  1C1A A;  4ZGD B;  1D1C A;  2RHI A;  3FDR A;  1K73 R;  4WF2 A;  4OB0 B;  4DA4 A;  4F14 A;  3VRZ A;  4XU1 A;  3PTA A;  4WTO B;  2LTO A;  3KUF A;  5GJV B;  5FWB A;  3SWN B;  4ZGJ B;  3O5Z A;  4E7Z A;  2YUN A;  1M9S A;  1UGS B;  3CCJ Q;  1M1K R;  1K0S A;  1HYO A;  5EG2 A;  4QT7 A;  3NHN A;  1QCF A;  5GAN 7;  4JJB A;  1UTI A;  1WJR A;  1QLY A;  5KCH A;  4A63 B;  3CC2 T;  4GLK A;  3TEE A;  3JCM h;  2RJD A;  1W70 A;  1OQK A;  3E19 A;  4PJO B;  1IGU A;  2LQN A;  3CC4 A;  3CC7 A;  1WXU A;  2E3I A;  1N8R U;  3M0P A;  4OF1 A;  3HRT A;  4OMF B;  5GAN g;  4J5Y A;  1VQ8 Q;  2WSF E;  4QKU A;  4XTZ A;  4EMG A;  3MP6 A;  5KYU B;  5GAN h;  4ZN1 A;  1KQS A;  1U5S A;  2FVU A;  4RTZ A;  4M77 D;  1M4Z A;  3DB4 A;  3RES A;  3VS1 A;  4XTV A;  4LN2 A;  1C6V X;  2L2P A;  2P4R A;  2MPX C;  1CKB A;  3GP8 A;  1QW1 A;  2JN0 A;  2DET A;  4M75 G;  1WQ7 A;  2EYY A;  4C0G A;  3M54 A;  1SRL A;  3VS0 A;  1J3T A;  2FZK B;  5CQX A;  5FLX E;  4RTU A;  1NLO C;  2JTF A;  2E65 A;  4PJO E;  1JU5 C;  4BAC A;  1MHN A;  1AWX A;  2C0T A;  3EG3 A;  1HJD A;  2KNB B;  1VQL Q;  1YP5 A;  1TH7 A;  3OYE A;  3X26 B;  3MPU B;  2CP7 A;  1VQ4 A;  2AT1 B;  3J80 E;  4A54 A;  2KBT A;  2YSQ A;  2O4X B;  3LWH A;  4F17 A;  3WVE B;  1LCK A;  2DL8 A;  3JB9 D;  3RIR A;  1VQN T;  1ZA1 B;  4L5G A;  1RAF B;  4FYX B;  2YT6 A;  1WLP B;  3JCM d;  5LJ5 h;  3CMA T;  3E9G A;  1Q82 R;  2WSC E;  4MML A;  2MWP A;  4AFZ C;  3OS0 A;  1QVG P;  1KD1 C;  6AT1 B;  2YUQ A;  2ED1 A;  1B07 A;  1U1S A;  1D3B A;  3PMI A;  3VS6 A;  1MGQ A;  2HKQ B;  3SFM A;  2EQU A;  4E2F B;  1G2B A;  3OYA A;  2HMA A;  4ZTF A;  1QVP A;  2DTH A;  2CH4 W;  3JSC A;  1VQ7 A;  1OV3 A;  4MMK A;  3E2U A;  2RJF A;  3N5B B;  3C94 A;  1YJW T;  1ZLM A;  1VQN Q;  2JMC A;  4C8Q D;  1WI7 A;  4C92 B;  1VQO T;  1UHF A;  1JB0 E;  3OS2 A;  3CMA Q;  1JJ2 S;  3CPW A;  4Y92 A;  4J6W A;  1MV0 B;  3MEV A;  1MNE A;  2KQW A;  3D7S B;  4JS5 A;  1AD5 A;  2COZ A;  4ZN3 A;  1AHJ B;  2OAW A;  2E1H A;  2RH2 A;  4N4G A;  1N8R C;  4XQ3 A;  1AWO A;  2Y4Y A;  3DB3 A;  2VGN A;  4BDZ A;  3H8Z A;  1VYV A;  5I21 A;  2J6F A;  1LVK A;  2L3Q A;  4LDW A;  2RQW A;  4HT9 A;  5ECA A;  2DYB A;  4OMP A;  1VQO Q;  5LJ3 j;  1ZSZ B;  2OI3 A;  1AEY A;  5LJ5 d;  1DJ7 B;  3QPH A;  1CSK A;  4OGE A;  1D1B A;  3CBO A;  1PNJ A;  3JB9 I;  1WPY A;  1X69 A;  4HCZ A;  4M7D A;  2RA2 A;  2JTM A;  4QQD A;  3TSW A;  1K4U S;  3M0Q A;  1HXD A;  1VQK T;  1SHF A;  2JW4 A;  1X2K A;  2MK5 A;  3G4S A;  3OY9 A;  2VV5 A;  4JJC A;  1D0X A;  1TUD A;  1M1G A;  1G3W A;  2EFI A;  5GAO p;  1UGV A;  2BZ8 A;  2E6Z A;  2OTJ A;  2DL4 A;  2EGA A;  3MCA B;  3MET A;  3EG1 A;  3L2Q A;  1B7T A;  3QSU A;  2RI3 A;  3JCM c;  2AHJ B;  1G3Y A;  3PGG A;  5CK9 A;  3EG2 A;  2X3W D;  1OU9 A;  4AFU C;  4EMH A;  1K73 U;  1VQK Q;  1YJ9 A;  1M27 C;  2V26 A;  4Z88 A;  3QZ9 B;  1MMD A;  2H8H A;  1SSF A;  4KT0 E;  3V7C A;  3SEM A;  2X3X D;  4FU6 A;  1VQP A;  3PIO A;  4P5N A;  1SSH A;  2CP6 A;  4BE0 A;  1U8R A;  1NG2 A;  1OZ3 A;  2K5I A;  1UE9 A;  2DBM A;  3H0F A;  3NGP A;  4BY6 C;  2KT1 A;  3UDC A;  4CC2 A;  2M16 A;  1EZZ B;  2DNU A;  5GAN 5;  4PJL A;  4M7A F;  1YFN A;  2DE0 X;  2EQJ A;  2BTT A;  3QWX X;  2E10 A;  4BI4 A;  2QQA A;  3OYJ A;  2A28 A;  2K6D A;  2QDY B;  4AT1 B;  4M7A C;  2X9H A;  1KD1 R;  2YHT A;  3CCL T;  2PNI A;  4Q5W A;  1OOT A;  5HK3 A;  3OYF A;  1KFZ A;  5A0G A;  1VQ6 T;  2K5F A;  2QEX T;  3CCQ T;  2LNH B;  5GAO l;  3ULR B;  1ABO A;  2CGH A;  3G6E A;  1GCQ C;  3QJ6 A;  4J7F A;  3CCE A;  1M2O A;  4J9F A;  3JB9 J;  1IRE B;  5LJ3 f;  1WYX A;  5FU7 C;  3LH5 A;  3OYY A;  5GAM h;  1WXB A;  2L3S A;  7AT1 B;  1JJ2 A;  3L2R A;  4C92 G;  1QCN A;  3X25 B;  3CCL Q;  2EPD A;  1SHG A;  2KAF A;  5I2M A;  2DTO A;  3HL8 A;  2EJ9 A;  4FT2 A;  1K0X A;  3EFS A;  1BI3 A;  3MHX A;  1JO8 A;  4OMQ A;  1VQ6 Q;  1AOJ A;  1MND A;  4EMK C;  5A0L A;  1BKB A;  1GBQ A;  2QEX Q;  3CCQ Q;  1NYF A;  4MDX A;  3TSZ A;  3PNW C;  3OYM A;  1W2B S;  2EWN A;  4RG8 A;  1OPK A;  2GNC A;  4RMO A;  4M7A A;  2ESW A;  1Q82 U;  3VUB A;  2LT4 A;  1JXM A;  1K1Z A;  2DM1 A;  4C8Q G;  4J9E A;  4ZGE B;  1K73 C;  2ENM A;  2QI2 A;  3JCM P;  4B9W A;  1S72 A;  5GAN 4;  1I07 A;  2E3H A;  1I1J A;  1VIE A;  2P0K A;  2GFA A;  2P84 A;  1VQ5 T;  5IN1 A;  1H3Z A;  2NUT A;  4ESR A;  3MO8 A;  4QQ6 A;  2YRC A;  3MEW A;  2ZPF B;  1AT1 B;  4M75 D;  3L1A A;  3IQL A;  5LJ5 j;  5I11 A;  4BDY A;  1D3B B;  2EYX A;  3OYN A;  5CVI A;  4HCC A;  2K7A A;  5GAM d;  2AK5 A;  2K2M A;  4BI3 A;  4KGZ B;  4EDU A;  1B34 A;  3VRY A;  1XOV A;  4K11 A;  2RJE A;  3I9Q A;  2COY A;  2K79 A;  3V7S A;  4F7U F;  2E4H A;  4E7I A;  2H3E B;  1VQ5 Q;  5GAN 2;  1IRX A;  4BE1 A;  4J9D A;  2E5K A;  1ZQ1 A;  5CCA A;  1YWP A;  1I8F A;  2K3Y A;  4DEY A;  4KGX B;  1ZBJ A;  5KYW A;  2CZ7 B;  4QVC A;  1YJN A;  3G7Z A;  2RMO A;  2DA9 A;  1WZO A;  2CDT A;  5LJ3 g;  5IT9 E;  2H3J A;  1B3Q A;  3VU3 C;  4XTW A;  1ACM B;  1ZHI A;  4NL2 A;  2GGR A;  3FIF A;  1VQM A;  1KQS P;  3EGX A;  4KUI A;  1FWZ A;  1KQ2 A;  2CT3 A;  2I2L A;  2KXD A;  1KG1 A;  3H9N A;  2C0O A;  2NUZ A;  1YIJ T;  3CCR T;  2XDP A;  4C0D C;  5KCO A;  2WAC A;  3T9N A;  2RB6 A;  2PUK B;  2MMP A;  3LYI A;  2IPO B;  3R6N A;  1R77 A;  4DEX A;  1YIT T;  4BB7 A;  4C0Z A;  5FRM A;  1MUZ A;  3EGD A;  5I22 A;  4M7D B;  2ED0 A;  3EH1 A;  3SHW A;  1PRL C;  1LPL A;  8AT1 B;  2OTL T;  3GIB A;  3OQ5 A;  5KE2 A;  1SG5 A;  5GAO r;  1Q82 C;  1YIJ Q;  1QCO A;  1FMV A;  3CCR Q;  2LRQ A;  1BIB A;  3H6Z A;  2C0I A;  1ARK A;  2AKL A;  2VVK A;  4F7U A;  2K4Y A;  2P0Q A;  3CME T;  4HXJ A;  1OX8 A;  1WNL A;  2DD5 A;  4JPB W;  1BBZ A;  4M78 F;  2B86 A;  1I4K 1;  4FW2 A;  1BCM A;  1ZUY A;  2OTL Q;  4Z89 A;  2DYI A;  1MMA A;  4OGC A;  3LWI A;  1M90 U;  2D0Q B;  2GCX A;  3V8K A;  3CCV A;  5LJ5 f;  4M78 C;  2X4X A;  1EX4 A;  5CO7 A;  5KYX A;  3CCM A;  2KEA A;  1WJS A;  3OW2 A;  3CC2 A;  3P8B B;  2BZX A;  3I56 A;  4PJO D;  2LC4 A;  2X51 A;  4PLI A;  1GRI A;  3VS4 A;  3CPW P;  1TU0 B;  3MKD A;  3CME Q;  2RQU A;  2HNI A;  4KRT A;  2E5Q A;  1OPL A;  2LNV A;  4PJM A;  4JRI A;  2PVG B;  1VQ8 T;  4KBM B;  2AKK A;  3OBW A;  4A4H A;  2C06 A;  1K8A U;  3QDF A;  3X20 B;  5J39 A;  3A8G B;  4EPC A;  3OYI A;  5AT1 B;  1BI2 A;  1TG0 A;  1UJY A;  3JCM g;  4J6X A;  2HQH A;  1PC0 A;  2NWM A;  3A8O B;  3WVD B;  1I5L A;  4ZTJ A;  2EKO A;  5CQY A;  2YXY A;  2HBW A;  1LNX A;  1ZUK A;  4UC4 A;  3QBY A;  1D0Z A;  1FXX A;  1QVF S;  2QDL A;  1WDX A;  1IZ6 A;  4DOV A;  3UT1 A;  3J7A F;  5J26 A;  1OI1 A;  3SB2 A;  4DBF A;  3CD6 Q;  3I55 Q;  2XMF A;  3BDU A;  1YI2 A;  1VQL T;  1X6B A;  3M0T A;  2JS0 A;  2D8J A;  3GPL A;  3RUX A;  2VWF A;  4M78 A;  4JDS A;  1KQ1 A;  4JLI A;  2FB7 A;  1X6O A;  2DEU A;  1WHM A;  3M58 A;  3M4G A;  4QVZ A;  1BCO A;  3QKJ A;  2DJQ A;  3I5R A;  4BY6 B;  5GAM j;  2RF0 A;  2LDM A;  5AYF A;  3CMA A;  3RKX A;  1IGQ A;  3URG A;  2JT4 A;  3FJ5 A;  1JBM A;  5D7U A;  3GNF B;  4GBQ A;  3DLM A;  1X01 A;  3RER A;  1ABQ A;  5IXB A;  3TU4 K;  2F5K A;  4AG1 C;  5CKB A;  4M7A B;  1RL2 A;  1TWB A;  4XU2 A;  2ATC B;  2ROT A;  4MDW A;  2CT4 A;  1BIA A;  4FCY A;  5CIU A;  5LJ5 g;  1OZ2 A;  3GBQ A;  3CC7 T;  4HT8 A;  1GXI E;  2JM8 A;  4IUQ A;  1YJW A;  3ZBD A;  2RM4 A;  5LL6 S;  1RAG B;  4C92 D;  1CKA A;  2DRK A;  1VQO A;  3LX7 A;  1M90 C;  2X35 A;  1YHQ A;  1QP3 A;  4M7D G;  2NUT B;  1M3C A;  2J05 A;  1Q86 U;  3FC3 A;  4CC7 A;  3KXT A;  1QVG S;  2F5T X;  1R8O B;  1NEB A;  2DMO A;  2WSE E;  3M53 A;  4IKF A;  5D6W A;  1PKS A;  1OU8 A;  4LE9 A;  2RN8 A;  2MWO A;  5GAN 3;  1FYN A;  2MYS A;  4M7A E;  2DBK A;  2D9T A;  4CC3 A;  3PVL A;  3CXC A;  4Z8A A;  2X4J A;  1B34 B;  2QA4 A;  3R6O A;  2AZV A;  3Q1J A;  3CC4 Q;  2A0F B;  3CC7 Q;  1K8A C;  1TOV A;  1ZSG A;  2ZPG B;  2COW A;  1OUL A;  1Y71 A;  1WHK A;  2PVD B;  2KGT A;  3GOX A;  3OYK A;  5GMK e;  2L5Q A;  3CBM A;  2O31 A;  3LGF A;  5KYW B;  2LQW A;  2DIQ A;  4D6W A;  2DXT A;  4BE2 A;  3CCS A;  2EYW A;  1JQQ A;  2L89 A;  2MOX A;  3M4Y A;  2VUB A;  1YWO A;  1JJ2 P;  4LDU A;  3EGX B;  1BU1 A;  2QG9 B;  2YLB A;  4XTY A;  4PFZ A;  2HCK A;  4E47 A;  1NEG A;  5D6Y A;  3AT1 B;  3MEA A;  1VQ4 Q;  1C0M A;  2Z0W A;  3JAM E;  4ME7 A;  3EHQ A;  2DJZ A;  2EJG A;  4HVU A;  2DRM A;  3OYH A;  3QYG B;  5DLO A;  1TSF A;  1RLQ C;  1V76 A;  2M0Y A;  3EGD B;  5GAM f;  5C0M A;  2DXU A;  4E7J A;  5IHN A;  4XTX A;  2CSQ A;  2W0Z A;  1BK2 A;  1SKU B;  1R0C B;  3OA6 A;  1G83 A;  2QQ9 A;  4A4G A;  3JCM V;  3H0H A;  1OYX A;  1BI1 A;  1PHT A;  1VA7 A;  2DKG A;  4PJO G;  2RQR A;  4JRQ A;  2FHD A;  4HVW A;  2OX7 A;  4HCB A;  5A2Q E;  1WA7 A;  2M1H A;  2K2V A;  2A37 A;  1X6G A;  2RD1 A;  1Y96 B;  2EKH A;  1D0Y A;  3VV0 A;  3ZL7 C;  3G71 A;  4F7U B;  3PE0 A;  2ZPB B;  1QKX A;  3CCU A;  1I81 A;  1VQ7 Q;  4O6J A;  2KDS A;  1NJI U;  2IVW A;  2EVR A;  2EYZ A;  5HCK A;  1Q86 C;  3A1P A;  4VUB A;  3UPU A;  5KH6 A;  4R56 A;  1KC8 U;  2HSP A;  1I5O B;  5DY9 A;  2P4T A;  2ZAE A;  4MZT A;  5KYX B;  3SDZ A;  1EFN A;  1ZBX A;  3CEY A;  4LXC A;  2A08 A;  2FRW A;  2QTV A;  2QEX A;  3CCQ A;  2O9S A;  3G4S T;  1JRI A;  2JOY A;  2R57 A;  3MEU A;  5FRN A;  1YBY A;  1WFW A;  1Q7Y U;  4F7U E;  1UJ0 A;  4FYY B;  3QDR B;  2O88 A;  2CZ6 B;  1M90 R;  4J7I A;  1A0N B;  4Y91 A;  3JV3 A;  2OTJ T;  1MMG A;  5FRO A;  3GNG A;  2KMT A;  4PFO A;  5KE3 A;  2RK2 A;  1WHJ A;  5EC7 A;  3M56 A;  3OMC A;  1WIE A;  2FRY A;  1W4S A;  5FU6 C;  3VS3 A;  2XID A;  2YRV A;  3OB9 A;  4M77 F;  2VXF A;  2EGE A;  4DQ2 A;  3G4S Q;  1WJQ A;  1K8A R;  2ROL A;  2YDL A;  4DBQ A;  4GLM A;  2DAQ A;  5GAM g;  1VQP T;  4OVA A;  5CKH A;  4M77 C;  2FZC B;  3OYD A;  4RTT A;  2OTJ Q;  2DEQ A;  4RUG A;  3S6W A;  2J7I A;  2QTX A;  2XI9 A;  2GF7 A;  2LT1 A;  4LUD A;  4QVD A;  5IXF A;  2OAU A;  2JJ9 A;  1NBE B;  2ZPI B;  1VQ5 A;  4OML A;  2XKO C;  1VQ9 A;  2O2O A;  4J9I A;  3C12 A;  2CP3 A;  1H64 1;  1YJ9 Q;  1LJO A;  3REB B;  5IHK A;  2HL5 C;  3JB9 F;  4C92 F;  3OYG A;  4KH0 B;  2NUP A;  4FM4 B;  4HA8 A;  2OJ2 A;  1VQP Q;  1V29 B;  4L59 A;  1H8K A;  3NTI A;  3OYC A;  1YN8 A;  4XU0 A;  1AWW A;  3L2W A;  3QYH B;  4C5E A;  4C92 C;  4E7L A;  2DVJ A;  4PNO A;  4M78 E;  3NPF A;  1W2B P;  5FWC A;  3RMQ A;  4NL3 A;  5A0D A;  4LUE A;  1T3L A;  4OMN A;  4HCK A;  3OW2 P;  4WCI A;  3UAT A;  3RKY A;  1JXO A;  3A8H B;  1KC8 C;  1T0H A;  2YLC A;  1GCQ A;  2X4Y A;  2MCN A;  3HFN A;  2DIG A;  1RAA B;  2ZPH B;  2E41 A;  3OMG A;  4M77 A;  2KYB A;  4C8Q F;  5CKE A;  4HVV A;  2EYQ A;  1TUG B;  4ZNX A;  2J06 A;  2AIR B;  4MZM A;  4RTY A;  3UF4 A;  3A98 A;  1I0C A;  2CP5 A;  4QW2 A;  1Q7Y C;  2VXE A;  2RHX A;  4RCC A;  3NTK A;  4C8Q C;  1UGR B;  2DZC A;  2M51 A;  1ZSZ C;  1RLP C;  3CCR A;  1M1F A;  3PT9 A;  3REA B;  3G6E Q;  4EMK A;  4PKC C;  1Q86 R;  4F7U G;  3J81 E;  1KHI A;  2F1L A;  4J6Y A;  1K9A A;  2M02 A;  2EBP A;  1H92 A;  4B6M A;  3TRE A;  1QWF A;  5C6S A;  2QQR A;  4PL6 A;  5LJ3 e;  1YIT A;  4D8D A;  4DBH A;  1BYM A;  2DTI A;  1M8V A;  1P92 A;  3PMT A;  4N0A C;  2BUD A;  4M7D D;  3E1S A;  3VKI A;  4JZ4 A;  1S72 T;  5IH2 A;  2PUO B;  5HY6 A; 
#chains in the Genus database with same CATH homology
 4IUR A;  3WVD B;  1YJ9 T;  1G3S A;  3MEV A;  1I5L A;  4ZTJ A;  2EKO A;  2HQE A;  3NFC A;  5CQY A;  2KQW A;  2QQS A;  4XAX B;  1LNX A;  2JNG A;  4UC4 A;  3QBY A;  4JS5 A;  1KQS S;  4B9X A;  4II1 A;  4ZN3 A;  1FXX A;  1AHJ B;  5GMK l;  4RG2 A;  4X34 A;  1QVF S;  2E1H A;  2RH2 A;  4N4G A;  1N8R C;  1IZ6 A;  1PSE A;  2KSS A;  4XQ3 A;  5D6X A;  3UT1 A;  4DOV A;  5GAN 6;  2V8I A;  3J7A F;  2Y4Y A;  3DB3 A;  1OI1 A;  1N27 A;  2VGN A;  3O8V A;  5J26 A;  3SB2 A;  4BDZ A;  2XD0 A;  4J8O A;  2B8A A;  3H8Z A;  4PJO A;  3BDU A;  1YI2 A;  1VQL T;  5I21 A;  4M78 B;  2LCL A;  4OB2 B;  4LDW A;  4J6W A;  3A8L B;  4HT9 A;  3GPL A;  4BI8 B;  4A4K A;  2VC8 A;  3RUX A;  2BKD N;  2MF2 A;  4R55 A;  4M78 A;  5LJ3 j;  3GLX A;  3CPF A;  3QO3 A;  4JDS A;  1KQ1 A;  3C4S A;  4JLI A;  5LJ5 d;  1DJ7 B;  2ZGW A;  2FB7 A;  3V8J A;  3X24 B;  5CKD A;  2M0O A;  3QPH A;  1X6O A;  3M58 A;  2F69 A;  3M4G A;  2HBP A;  4OGE A;  4QVZ A;  3QKJ A;  3SD4 A;  3CBO A;  4C8Q A;  3JB9 I;  1WPY A;  4BY6 B;  3JB9 G;  5GAM j;  4HCZ A;  3S3O A;  2LDM A;  3CCJ A;  4M7D A;  2RA2 A;  2JTM A;  3JRZ A;  4QQD A;  2LX9 A;  5AYF A;  2ZZD A;  3CMA A;  3FJP A;  4DOW A;  3RKX A;  3URG A;  3ZFJ A;  5GAN j;  1HXD A;  1FX7 A;  4OB1 B;  1VQK T;  4KUD K;  4JS4 A;  1JBM A;  3G4S A;  2V8J A;  3MP8 A;  4LD9 K;  4ELZ C;  3GNF B;  4GY5 A;  4NOY A;  3OY9 A;  2VV5 A;  3DLM A;  1X01 A;  1WGS A;  3RER A;  2G3R A;  1NJI C;  3LGL A;  4N4I A;  3KBG A;  3OS5 A;  2LQK A;  3TU4 K;  3M55 A;  2F5K A;  3P8H A;  5CKB A;  2K5L A;  1M1G A;  1RL2 A;  4M7A B;  1G3W A;  2KY9 A;  2EIF A;  4N0A A;  2RHZ A;  5GMK m;  2EFI A;  4XU2 A;  5GAO p;  4HKE A;  3HRS A;  3G6E T;  2RI2 A;  2VGM A;  2LQ8 A;  2RHY A;  4MDW A;  2E6Z A;  1BIA A;  4YTL A;  3OW2 S;  3CCE T;  3M59 A;  2OTJ A;  3MCA B;  3HRU A;  5CIU A;  3ER0 A;  3MET A;  4IUU A;  1VQ8 A;  3L2Q A;  5J3B A;  1OZ2 A;  5LJ5 g;  3CC7 T;  2Y4X A;  4HT8 A;  1GXI E;  4E7K A;  4IUQ A;  1YJW A;  3EFR A;  5GAO m;  4FSX A;  3QSU A;  3ZBD A;  2RM4 A;  5LL6 S;  4C92 D;  2RI3 A;  3HPW A;  3JCM c;  2O4X A;  5DM7 R;  2DZ9 A;  1VQO A;  2AHJ B;  1G3Y A;  3LX7 A;  4A4E A;  2CZ1 B;  3PGG A;  1U1T A;  2BIV A;  4C5H A;  3OYB A;  1M90 C;  3HSB A;  5CK9 A;  3PIP A;  2X35 A;  4O5V A;  1YHQ A;  3LLR A;  1QP3 A;  4M7D G;  3AHU A;  4PLL A;  4JRK A;  4EMH A;  1K73 U;  1Q86 U;  1W2B A;  3FC3 A;  3KXT A;  1YJ9 A;  1QVG S;  1NPR A;  2F5T X;  1R8O B;  4FIB A;  3QZ9 B;  4LDV A;  4IUT A;  1SSF A;  4KT0 E;  3V7C A;  1VQ9 T;  2DVE A;  2WSE E;  3M53 A;  3RKW A;  3JCM b;  3LW5 E;  4IKF A;  5D6W A;  4FU6 A;  3EAE A;  2PQW A;  1VQP A;  3PIO A;  2DO3 A;  4P5N A;  3CPW S;  4KUL A;  2MWO A;  1BI0 A;  3CBP A;  3LH0 A;  3VJP A;  5GAN 3;  1YIJ A;  4LDX A;  1M1K C;  3UWN A;  4BE0 A;  1U8R A;  1OZ3 A;  2K5I A;  4M7A E;  2D9T A;  4FT4 A;  3CXC A;  2HD0 A;  4OB3 B;  1K9M U;  4JJN K;  4BY6 C;  3CD6 T;  3UDC A;  3I55 T;  2RHU A;  2X4J A;  3NTH A;  1B34 B;  2QA4 A;  2M16 A;  3R6O A;  3Q1J A;  1VQL A;  1K8A C;  4L6V 5;  5GAN 5;  3JCM e;  2ZPG B;  4M7A F;  4JUV A;  1Y71 A;  3FEO A;  3L2Z A;  2GFU A;  3VUZ A;  2EQJ A;  2E10 A;  3JCM J;  4BI4 A;  4XK8 E;  2PVD B;  4X9C A;  4IUV A;  3GOX A;  3OYK A;  3HHT B;  2QQA A;  1N6A A;  3OYJ A;  4FL6 A;  4C92 A;  2QDY B;  3OBY A;  2L5Q A;  3CBM A;  4C0F A;  5GMK e;  2OTL A;  4M7A C;  3LGF A;  2YHT A;  3CCL T;  2DIQ A;  4D6W A;  4Q5W A;  2DXT A;  4BE2 A;  5GAN e;  5HK3 A;  3CCS A;  2K57 A;  1XQH A;  4N4H A;  3FB9 A;  5HKC A;  3L42 A;  1LOJ A;  3OYF A;  2O01 E;  2L89 A;  4BUG A;  3M4Y A;  4M75 B;  3S3M A;  5A0G A;  2VUB A;  3M5A A;  4E7H A;  2RK1 A;  1VQ6 T;  3CCV T;  5GAO q;  4LDU A;  1VIF A;  2K5F A;  2QEX T;  3CCQ T;  3A8M B;  5GMK i;  2CYZ B;  3CCM T;  4M7A D;  5GAO l;  2YLB A;  4XTY A;  2QXF A;  2XDB A;  1VQ8 T;  2CGH A;  4RKU E;  3G6E A;  2FL7 A;  1NPP A;  4E47 A;  3I56 T;  3CME A;  2E6N A;  5D6Y A;  3QJ6 A;  4J7F A;  5LJ3 h;  3CCE A;  3MP1 A;  4C5I A;  3V7R A;  3MEA A;  3JB9 J;  3JCM f;  1UGP B;  1IRE B;  5LJ3 f;  3JAM E;  4ME7 A;  2DJZ A;  5FU7 C;  2EJG A;  3OYY A;  1VQN A;  5GAM h;  3WXM B;  2HQX A;  4BD3 A;  3OYH A;  3QYG B;  1JJ2 A;  3L2R A;  4C92 G;  5DLO A;  3X25 B;  5GMK j;  1O75 A;  2KAF A;  5I2M A;  2DTO A;  5GAM f;  2DXU A;  5C0M A;  3HL8 A;  2EJ9 A;  4E7J A;  4J83 A;  4JRP A;  4XTX A;  4FT2 A;  2L3R A;  3EFS A;  1BI3 A;  3FRN A;  2ZCF B;  3MHX A;  4JLG A;  2A3L A;  3BW1 A;  1N9R A;  2V8K A;  2EJF A;  3OA6 A;  5GAN f;  2QQ9 A;  1YJN T;  3BDL A;  4EMK C;  2DXB A;  2QQB A;  4M75 E;  4A4G A;  5A0L A;  2R5M A;  3JCM V;  3JCM W;  1OYX A;  3JCM Q;  1BI1 A;  1BKB A;  2D6F A;  2EAY A;  2DKG A;  2K3X A;  4MDX A;  2JUF A;  4PJO G;  4JRQ A;  4IUP A;  2FHD A;  3PNW C;  5LJ5 e;  3OYM A;  1EIF A;  1W2B S;  4Y28 E;  3JB9 H;  2P0P A;  1VQM T;  4HCB A;  2EWN A;  1XNI A;  2M9U A;  3M57 A;  4RG8 A;  5A2Q E;  4M75 F;  2M1H A;  5CKF A;  2K2V A;  2PVO B;  4C5G A;  5IAY A;  2CKK A;  3CD6 A;  2EQK A;  3I55 A;  4ATO A;  2E12 A;  2RD1 A;  1Y96 B;  3VV0 A;  4RMO A;  1Q82 U;  3VUB A;  2PU9 B;  4M7A A;  2LT4 A;  4M78 G;  3CC4 T;  3G71 A;  4XU3 A;  4X9D A;  2R58 A;  2CZ0 B;  4F7U B;  5FU6 B;  2ZPE B;  2ZPB B;  3CCU A;  1I81 A;  4O6J A;  2KDS A;  1Y96 A;  1UGQ B;  4C8Q G;  1YI2 T;  3CXC S;  3QUI A;  4ZGE B;  4M75 C;  1NJI U;  2IVW A;  5I2S A;  1K73 C;  2QI2 A;  3JCM P;  4B9W A;  1Q86 C;  2JVV A;  1S72 A;  5GAN 4;  2KVQ G;  2IG0 A;  4VUB A;  1VIE A;  5CAI A;  3UPU A;  3A5Z B;  2P0K A;  2GFA A;  3DLL A;  1VQ5 T;  5IN1 A;  4M77 B;  5KH6 A;  1UEB A;  4A53 A;  1H3Z A;  3X28 B;  4R56 A;  1KC8 U;  3MO8 A;  4QQ6 A;  3MEW A;  5DY9 A;  5FU7 B;  4M7D E;  2XG8 D;  3RMS A;  2CS7 A;  2ZPF B;  2P4T A;  3QJY A;  4M75 D;  3L1A A;  4MZT A;  4TVR A;  1Q81 U;  3CCJ T;  1K9M C;  3SDZ A;  5LJ5 j;  2XIC A;  1ZBX A;  3CEY A;  5LJ3 d;  3ME9 A;  3GF5 A;  4BDY A;  1D3B B;  2DXC A;  4XTU A;  1M5Q 1;  4M7D F;  2QEX A;  2XHC A;  4QQG A;  3CCQ A;  4OP0 A;  3OYN A;  3G4S T;  5CVI A;  4HCC A;  1JRI A;  2JOY A;  2R57 A;  3MEU A;  5FRN A;  3OSV A;  1YBY A;  4EMK B;  1KD1 U;  5GAM d;  3QXE B;  4BI3 A;  1Y07 A;  1Q7Y U;  4F7U E;  4EDU A;  1NZ9 A;  3OYL A;  3OSS C;  1B34 A;  3QDR B;  2CZ6 B;  3QZ5 B;  1XOV A;  2VYT A;  3QII A;  1G3T A;  4ZGD B;  3OS1 A;  2RJE A;  2RHI A;  4J7I A;  3V7S A;  1VQ4 T;  3FDR A;  4M7D C;  2NLU A;  3TCJ A;  5GAN d;  4WF2 A;  4OB0 B;  2L8D A;  4DA4 A;  4F7U F;  4NS5 A;  4Y91 A;  2OTJ T;  5FRO A;  4E7I A;  3HFO A;  3GNG A;  2KMT A;  4XU1 A;  2JZ2 A;  3PTA A;  5GAN 2;  2LTO A;  3KUF A;  3FLG A;  3DKM A;  5KE3 A;  4BE1 A;  3M9Q A;  2RK2 A;  3SWN B;  4V2S A;  4M77 E;  3M56 A;  4ZGJ B;  1PSF A;  1ZQ1 A;  5CCA A;  1M9S A;  3OMC A;  1I8F A;  1UGS B;  2K3Y A;  1VQK A;  1VUB A;  2CZ7 B;  1W4S A;  5FU6 C;  1YHQ T;  5EG2 A;  2XID A;  4QVC A;  2YRV A;  1YJN A;  3OB9 A;  3G7Z A;  4M77 F;  2VXF A;  5GAN 7;  5IT9 E;  5LJ3 g;  1G5V A;  2H3J A;  4DQ2 A;  1WJR A;  1WJQ A;  4M75 A;  5KCH A;  3VU3 C;  4XTW A;  1ZHI A;  3CC2 T;  4NL2 A;  4GLK A;  3TEE A;  3BY7 A;  3HP9 A;  3FIF A;  1VQM A;  3JCM h;  4KUI A;  2RJD A;  1FWZ A;  2DAQ A;  1KQ2 A;  3L2V A;  2I2L A;  5GAM g;  1KG1 A;  3E19 A;  1VQP T;  4PJO B;  3PFS A;  4OVA A;  4LDY A;  1YIJ T;  5CKH A;  3CCR T;  4M77 C;  3CC4 A;  3CC7 A;  2DPP B;  3S3N A;  1N8R U;  2XDP A;  4OF1 A;  4C0D C;  2WAC A;  3HRT A;  5KCO A;  4OMF B;  3T9N A;  3OYD A;  5GAN g;  4ELY C;  2RB6 A;  2DEQ A;  4J5Y A;  1VQ7 T;  1NE8 A;  3S6W A;  2QA4 T;  1XTD A;  2PUK B;  2MMP A;  3LYI A;  2WSF E;  3E9F A;  5GMK h;  1Y7X A;  2QTX A;  3VYH B;  5L8R E;  2XI9 A;  2GF7 A;  2LT1 A;  4XTZ A;  4EMG A;  1YIT T;  4QVD A;  4BB7 A;  3MP6 A;  4C0Z A;  5GAN h;  4C8Q B;  5FRM A;  4ZN1 A;  2OAU A;  3L2U A;  1KQS A;  2FVU A;  2ZPI B;  4M77 D;  4C92 E;  1M4Z A;  3DB4 A;  3RES A;  1VQ5 A;  2A7Y A;  2XKO C;  1VQ9 A;  1QVF A;  4M7D B;  1UB4 A;  1O9S A;  3C12 A;  4XTV A;  5CR2 A;  2HAX A;  1H64 1;  1LJO A;  3GP8 A;  2KK4 A;  4A4F A;  2OTL T;  1QW1 A;  3GIB A;  3JB9 F;  2LCC A;  2JN0 A;  2MAM A;  2X4W A;  3OQ5 A;  4C92 F;  1YCY A;  3OYG A;  4M75 G;  2XU8 A;  4FM4 B;  2DD4 A;  1WQ7 A;  4HA8 A;  5KE2 A;  4LD6 A;  3CCS T;  5GAO r;  2RO0 A;  4C0G A;  1Q82 C;  2E64 A;  3M54 A;  3ZEH A;  1V29 B;  4L59 A;  3NTI A;  2LRQ A;  5CQX A;  5FLX E;  4PJO E;  2JTF A;  2E65 A;  3C95 A;  1BIB A;  3OYC A;  4M7D D;  3SWN C;  4BAC A;  4XU0 A;  3H6Z A;  4CI0 C;  1MHN A;  3L2W A;  2XK0 A;  3QYH B;  2RJC A;  3QHS A;  4C5E A;  4C92 C;  4E7L A;  1TH7 A;  2R5A A;  4PJO F;  3HKS A;  4PNO A;  3X26 B;  2K4Y A;  4M78 E;  4F7U A;  3OYE A;  2P0Q A;  5M9O A;  2EQM A;  1VQ4 A;  1KHC A;  3RMQ A;  3J80 E;  4NL3 A;  3CME T;  5HK0 A;  4A54 A;  5A0D A;  2XDD A;  2Y90 A;  3V8L A;  1WNL A;  5GAO n;  2O4X B;  2E70 A;  3RKY A;  2DD5 A;  4C8Q E;  5GAN 8;  3A8H B;  1KC8 C;  3LWH A;  2LVM A;  4MZP A;  4M78 F;  3WVE B;  3CCL A;  2YLC A;  1I4K 1;  4C0D B;  3JB9 D;  2X4Y A;  3RIR A;  1VQN T;  4PJO C;  2MI6 A;  4L5G A;  1Q81 C;  3HFN A;  1JJ2 S;  2DIG A;  2ZPH B;  2E41 A;  2RI5 A;  3OMG A;  4M77 A;  4OGC A;  4C8Q F;  3JCM d;  5LJ5 h;  3LWI A;  3ASK A;  1M90 U;  5CKE A;  2D0Q B;  3CMA T;  2GCX A;  1VQ6 A;  2EYQ A;  3V8K A;  3E9G A;  3CCV A;  1WQW A;  4MZM A;  3VYG A;  2WSC E;  4MML A;  1X75 C;  5LJ5 f;  2MWP A;  4M78 C;  2X4X A;  4QW2 A;  5CO7 A;  3OS0 A;  3CCM A;  1KD1 C;  4M7A G;  4CRI A;  1WJS A;  2VXE A;  2RHX A;  4RCC A;  3OW2 A;  1Q7Y C;  3P8B B;  3CC2 A;  3NTK A;  3I56 A;  3INZ A;  1U1S A;  1D3B A;  4C8Q C;  1UGR B;  2DZC A;  3PMI A;  4PJO D;  2LC4 A;  1MGQ A;  4PLI A;  1QP2 A;  2EQU A;  3SFM A;  3OYA A;  3CCR A;  1M1F A;  3PT9 A;  2DK3 A;  3P8D A;  4ZTF A;  1QVP A;  4EMK A;  4PKC C;  1M1K U;  4F7U G;  2HNI A;  2DTH A;  3J81 E;  2E5Q A;  5DLQ E;  3JSC A;  4Z02 A;  1KHI A;  1N9S A;  1VQ7 A;  2LNV A;  4M78 D;  2PVG B;  4JRI A;  4J6Y A;  3F70 A;  4KBM B;  4MMK A;  3OBW A;  4RCB A;  2RJF A;  3N5B B;  4A4H A;  3G71 T;  2FYK A;  3JCM X;  3C94 A;  3TRE A;  1YJW T;  2C06 A;  5C6S A;  2QQR A;  4PL6 A;  3CCU T;  5LJ3 e;  1QVG A;  1K8A U;  3X20 B;  4C8Q D;  1YIT A;  5J39 A;  4C92 B;  3A8G B;  1VQO T;  2GQV A;  1BYM A;  1JB0 E;  4EPC A;  2DTI A;  3OS2 A;  1P92 A;  3BFM A;  3OYI A;  1RI0 A;  3PMT A;  4N0A C;  2BUD A;  1M8V A;  3SWN A;  1BI2 A;  3E1S A;  1HK9 A;  3QG1 A;  4M77 G;  3JCM g;  3VKI A;  4J6X A;  3CPW A;  1S72 T;  5GAM e;  2PUO B;  5HY6 A;  3A8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...