1ZHIA

Complex of the s. cerevisiae orc1 and sir1 interacting domains
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
195
Chain Sequence
b'GWEIITTDEQGNIIDGGTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title Structural basis of the Sir1-origin recognition complex interaction in transcriptional silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/replication
total genus 50
structure length 195
sequence length 205
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zhiA00
4FT2A 4KUIA 4BB7A 4FT4A 3TU4K 1ZBXA 4DOWA 3PTAA 4KUDK 4KULA 4FSXA 2FL7A 2FVUA 4DA4A 4LD9K 3PT9A 1ZHIA 1W4SA 1M4ZA 4DOVA 4JJNK
chains in the Genus database with same CATH superfamily
3MEAA 1BIAA 1YIJA 3M0SA 3M5AA 4QQGA 4WF2A 2DRKA 1S72Q 1Q7YR 1NM7A 4LN2A 1AZEA 1OI1A 5GAMg 2K3XA 3CCSA 3CCEA 2F2WA 1YI2Q 1KQSS 2GBQA 3CCQT 2K3BA 3QKJA 4J8OA 4N0AA 4AFZC 3LX7A 2L5QA 1G3YA 1OQKA 2R5AA 4JZ4A 1K8AU 2DBKA 3OYCA 3I5SA 1OEBA 2FPDA 4FW2A 4FYVB 1K73R 3VS6A 3RKWA 3JRZA 3UF4A 5GJVB 1WPYA 4QVZA 2E70A 1ZUYA 5HCKA 3CXCS 2W0ZA 2QQAA 1W70A 4JRIA 1X69A 2QTXA 4OMFB 4PFPA 4QQDA 2QK0A 5FU7C 1NEGA 5EG2A 4CC4B 4ZTFA 5FWBA 2QEXQ 2RB6A 1PD1A 1ABOA 1PM3A 1M1GA 3VS4A 4JDSA 4HA8A 1M1FA 5DY9A 1Y71A 2H3EB 2KSSA 9ATCB 1BIBA 2DEUA 1M4ZA 2RQTA 2RO0A 1R8OB 3V7RA 1K1ZA 4ZGJB 1VOMA 2LDMA 4J9IA 1UECA 2RQVA 1R0CB 4P5NA 1XNIA 4A4FA 2DL5A 1M90C 4OB1B 1KIKA 4QVDA 4KGXB 2DMOA 4KH1B 4BACA 4HCZA 3EHRA 4EIKA 1JJ2S 2MAMA 2B86A 2YT6A 4R56A 3HSBA 2HQHA 3V7CA 1EIFA 4PK4A 3CD6Q 3CCQQ 4KUIA 3DLMA 2HKQB 2CZ7B 1YCYA 3H6ZA 2E1HA 2O4XB 4J6WA 1OPKA 4XTYA 4IUVA 1C6VX 3L2VA 3ZL7C 2RQRA 3M0QA 3OSSC 1RLQC 4II1A 3EG2A 2FZGB 2KRMA 2V1RA 3OA6A 2RHYA 2NUTB 2KEAA 3IQLA 2A7YA 1NLPC 3TSWA 1N8RR 5GAMd 2EVRA 4M7AD 4J9HA 4C8QE 1SKUB 3I9QA 5D6XA 2W10A 1VYTA 2KYBA 4PJMA 3NGPA 2EJGA 5ECAA 3FDRA 3CCMA 3VS2A 3JCMe 2YUNA 3JCMc 4GLKA 2E12A 2GF7A 3GNFB 1RI9A 2DL4A 3ZBDA 1NBEB 1KQSA 1NLOC 1Y57A 5IHNA 4M7DE 1A0NB 2EGCA 4BD3A 4X34A 1YHQQ 4M77G 3QDRB 3CC4Q 3JCMb 1M1KC 1D0ZA 2FO0A 1VQ5A 5GAOq 4OB0B 5I2SA 3PIPA 1D09B 3DKMA 2RD1A 2CP0A 4ZGEB 3M0RA 3EGDB 4OMPA 2HKNA 1M2VA 2QAZA 3LGFA 1K9AA 3E19A 3CC2A 1YWPA 1OU8A 3C4SA 1O75A 4M77A 4N4IA 3QWXX 1TWBA 2KQWA 3ASKA 4OVAA 3VS3A 1YJWA 4WCIA 1R77A 1VQNQ 4BI8B 4OB2B 1JBMA 1D0YA 1UTIA 2NUPB 2DYIA 2FVUA 2LT1A 1YJNT 4J9DA 2M1HA 1VQ4A 2KYMA 1BK2A 3F70A 2E65A 1S72A 2R57A 4A4KA 2DXCA 4C0FA 3MP8A 2OAWA 2LMJA 2GCXA 3SFMA 4L5GA 3QBYA 5DLQE 1Q86U 2X51A 3VU3C 4PJNA 4ELYC 1WFWA 1QP3A 1KJWA 2IVWA 2XMFA 3PVLA 4N4GA 4X1VA 2ECZA 5GAN3 2P4RA 4AFUC 1QCFA 4EMKB 3FEOA 1KC8R 1AWXA 2ZPIB 4XK8E 2FB7A 3G71T 2XICA 2FPEA 1H641 4UC4A 2KVQG 1WLPB 1VIFA 4FYYB 4XU2A 2VVKA 4M7AE 1CKBA 2ROTA 2VWFA 2DXUA 2VUBA 4M7DF 1ZSZB 3X26B 4DBRA 3A8GB 2JTEA 4KGZB 4Z8AA 5C0MA 3OYGA 4F17A 2QEXA 2X4JA 5GAN4 4C0DB 4IUTA 1WGSA 4OB3B 1X2KA 2KE9A 1QKXA 1VQOA 4RTTA 1KHIA 3BFMA 2E6NA 4BUGA 2YHTA 4M7DA 1U1SA 3CC7Q 3VS7A 5KCOA 1SSFA 4Y91A 2D9TA 2M0YA 3TSZA 2K79A 3I55A 1TOVA 5KYUA 3JCMg 4CC3A 3V8JA 2J7IA 4FT4A 1YJNQ 3QG1A 3H8ZA 2D6FA 3A5ZB 1I5OB 1BCMA 1AOJA 2YSQA 1F1BB 1AT1B 1Q81C 4RKUE 4A4HA 2MCNA 4HCKA 1RAGB 1K73U 4M75F 1BB9A 2QXFA 2HEQA 3CCEQ 3QXEB 3THKA 3M54A 5CCAA 1WA7A 1XJWB 4FL6A 1OULA 1Z9ZA 3GOXA 2EQIA 2EYXA 2AT1B 2XD0A 2DXBA 4JLGA 3JB9I 2DF6A 2FPFA 4M75A 4QKUA 2L3QA 2D0QB 2FZCB 4OF1A 4M78G 3OYYA 4LDYA 3G71Q 3RERA 4EMKC 3VRZA 1PNJA 1K76A 3G7ZA 2DVEA 2EFIA 1KQ2A 2ZZDA 2XHCA 2F1LA 5A2QE 4E7ZA 3EHQA 3CCMT 2ED0A 2LQNA 4M78F 4E47A 4KRTA 2RHUA 2P84A 1K9MC 1ZSZC 2PTKA 1RABB 3EG3A 5AYFA 4J7FA 3OYFA 1M5Q1 3EG9B 2EWNA 2KT8A 2JTFA 2O31A 2ZPFB 4C0DC 1D3BB 1I07A 2BUDA 2ZPBB 1QVFP 4M7AF 1MGQA 2PVOB 3M0PA 4QQ6A 2MF2A 2CP7A 4M78A 1G8XA 2EQMA 1SPKA 4MDWA 1AHJB 5KYWB 4D8DA 2JMCA 3RBBB 2Z0WA 4PJOG 2IIMA 4XTWA 3QYGB 3L2RA 2E5KA 1Q82C 5DM7R 3M53A 1N8RU 2CDTA 4OMLA 4RG8A 3OYBA 4HXJA 2XDPA 3QWYA 4ZTJA 3M57A 2K6DA 1JO8A 5KYNA 2AHJB 4J9CA 3PMIA 4CRIA 4KT0E 3CCRT 3JCMd 1KD1C 3VKIA 1IZ6A 2I2LA 4PL6A 3GIBA 3V8LA 1YJWT 2JXBA 2DL3A 4PJOA 3LGLA 1D1AA 4PJJA 3E2UA 1Z9QA 4J9FA 3A8HB 2YUPA 2MOXA 2YRDA 4JPBW 2A3LA 1LVKA 4LDVA 1VQ4T 3E1SA 4JRQA 2EYZA 4HVVA 4NL2A 5GAMf 3J81E 5LJ3j 3J80E 4LDUA 3CCMQ 3KBGA 3NMZC 5GAOm 2YRCA 1M90R 3CMAT 5GANj 3G6ET 3HL8A 1VQPA 1K8AC 4C0ZA 3UATA 4F16A 1NG2A 1QP2A 3ME9A 2DLPA 4RUGA 3OQ5A 2DJZA 2P0PA 3NHNA 2GNCA 2QI2A 3X24B 4F7UB 5HY6A 4BE1A 3L42A 4LD6A 3NTIA 3OMGA 1QVFS 2AIRB 2KDSA 2C0OA 4Z02A 3EFOB 5CO7A 2DERA 3P8DA 5LJ3h 5CVIA 3VUBA 4Z89A 3OYNA 2EW3A 4DQ2A 4QT7A 2KK4A 3MEUA 2DRMA 2JZ2A 2PVDB 2DETA 5GANh 1UB4A 1RUWA 1V1CA 4F04B 4ZN3A 3C12A 1E6HA 5L8RE 2LJ3A 3LH0A 4IUQA 1JB0E 2X4XA 4BB7A 3KUFA 2QQRA 1VQOT 4CI0C 4J7IA 2KI7A 4FSXA 1YJWQ 3X25B 3VJPA 1TG0A 3I35A 4FM4B 4DBFA 5LJ3e 3SD4A 3OYMA 4F14A 1VQ4Q 2COZA 2BTTA 1VA7A 3GBQA 5FLXE 1M1KR 2AKKA 2ZGWA 1DJ7B 4XU0A 7AT1B 4RTVA 1M3CA 2COWA 3CMAQ 2LTOA 1X6OA 2YUOA 3G6EQ 2YWWA 4C92G 5I11A 5D7UA 2K5IA 4IURA 1MUZA 3HHTB 3M4GA 3TREA 2DBMA 3PNWC 4E7IA 3H0FA 1JXOA 4MDXA 3EH1A 3HFNA 2RQUA 1I5LA 3M0UA 1VYVA 5GAN5 4E7LA 4C92F 2RJEA 1N9RA 1WQWA 3G71A 2E5QA 1PRMC 5CKEA 2OI3A 2R5MA 2J6OA 2G6FX 2QQ9A 1OX8A 3QZ9B 4JJCA 2HCKA 1WHKA 1U5SA 3INZA 4XTXA 2GGRA 2HBPA 3BDUA 1NEBA 4C92A 2EYQA 1HXDA 4EMHA 5FW9A 1H92A 4LXCA 3UT1A 2QA4T 2DEQA 1VQOQ 5GAN7 2WSCE 4LUEA 3RMSA 3URGA 3I55Q 2ZPGB 4DBQA 8ATCB 2JJ9A 2F69A 2RN8A 2DPPB 2ATCB 2QQSA 1HK9A 4OMMA 5IXBA 1PG5B 1MMDA 1QVFA 6AT1B 2KGTA 1Q95G 3LWHA 1VQ9A 3AHUA 3SWNA 2JOYA 1ZA1B 1J3TA 5GMKj 4MZPA 1GCQA 3VS0A 4A4GA 5J26A 5HKCA 4GLMA 2LCCA 5FRNA 4JZ3A 4BY6B 3UWNA 4E7KA 2ZPEB 2CGHA 2J6KA 2LCSA 2CP3A 2CSQA 1E6GA 2CT4A 3AT1B 3META 2YRVA 3R6NA 2DX1A 1JEGA 4ESRA 1VQKT 2IG0A 3MEWA 2CP2A 2GTJA 1TS9A 2LCLA 4N0AC 4MMKA 1PSFA 5HK0A 4R55A 4BE0A 3M59A 1VYUA 5GJWB 4R0KA 4K11A 2HAXA 1KHCA 4OP0A 3TQ7P 3FRNA 3L2UA 4HKEA 3PT9A 1ZQ1A 5D6WA 2L0AA 1QCNA 3RUXA 4JUVA 5GMKh 1QLYA 4MZMA 1VQPT 2M51A 1Q81R 2YXYA 2C0IA 4OGEA 5M9OA 2D8JA 2QA4Q 2EKHA 3WVDB 5LJ3g 4HT9A 3H0IA 2CZ6B 1B07A 4JLIA 2BE9B 4J9EA 4MZTA 3G4ST 2X35A 2OAUA 3M56A 3VRYA 4XU1A 1NJIC 1UHCA 2CH4W 2EYYA 1ZUKA 1HD3A 3FJ5A 1GL5A 1B3QA 2A36A 2Y90A 2XK0A 4Q5WA 2F5KA 4PJOD 3RIRA 2DE0X 2E64A 1BU1A 3G1JA 1R0BG 2V26A 2HNIA 3EGUA 2DL7A 1U3OA 1BBZA 3EGXA 1VUBA 1D1BA 2PUOB 1B7TA 3CCRA 8AT1B 1RAIB 3PGGA 4GBQA 3OBYA 4C5GA 3M4YA 1QKWA 1K9MR 1M90U 1TUDA 4LE9A 1WJQA 1AVZC 2RM4A 3A8OB 4RTYA 4FYXB 2JVVA 3MHXA 4BY6C 4ELZC 1TU0B 2QDYB 3JCMf 2BKDN 5IHIA 1M2VB 1OPLA 2JS0A 1VQKQ 4PLIA 4M77B 2OJ2A 4L59A 3JB9D 5CQYA 1JRIA 2RI2A 2DVJA 1ZSGA 2K57A 1WIEA 3HPWA 3CCJA 1I1JA 1OYXA 4C8QG 3CPWP 3CMAA 1UJ0A 1PKTA 1VQ6T 3G6EA 1M8MA 5LJ5j 1NYFA 1Q82R 1VQPQ 2RMOA 4ZGDB 2DILA 2LX7A 2KBTA 4C8QF 2HQEA 2EGAA 4DBHA 3ER0A 3MEVA 5KE3A 3G4SQ 3I5RA 1M3AA 4M7DG 1SRLA 2DJQA 1AD5A 1IHWA 4EMKA 2EYWA 3X20B 1KD1R 2FRWA 3CBOA 2RI3A 1VQ7T 2LQKA 1OU9A 1S1NA 1WDXA 4C8QA 3OSVA 2RJCA 5CKHA 2LVMA 3KFVA 1WHGA 2YUQA 5I2MA 1ZSZA 1HSQA 5LJ3d 3R6OA 1X6GA 1GXIE 4ORZA 1WHHA 1G2BA 5LJ5h 4ATOA 3LYIA 2LC4A 5GANd 2KR3A 2AZSA 1M1KU 1Q7YU 1IRXA 3REAB 1E7OA 3OB9A 2FL7A 1I0CA 4RTZA 2DTHA 3RNJA 4A53A 1MV0B 1ARKA 2GQIA 2YLCA 2GTOA 3FB9A 1D1CA 1K8AR 5D6YA 1VQ8T 2RPNA 3JAME 1WXBA 2LP5A 4M75G 5GAOl 4LDWA 3RKXA 4XTVA 2D8HA 1X01A 2L89A 2MK5A 4RTXA 1IO6A 4J6XA 3DB4A 1U8RA 1MMGA 3JB9H 4M77C 1WXUA 1T0JA 5C6SA 2GQVA 1YFNA 3VS5A 2EKOA 2DNUA 5KYUB 4LUDA 5GAOp 3VYGA 1VQ9T 1VQ6Q 3GP8A 1WXTA 1QCOA 3EFSA 1BCOA 2COYA 1B34A 3JCMW 2P4TA 4DEYA 4JJBA 1SSHA 4DEXA 3DB3A 3JCMV 1ABQA 1X2QA 4F7UE 3P8HA 1CSKA 1GBQA 1D0XA 2PZ1A 2XIDA 1MMAA 4EMGA 5FROA 4DOVA 2JW4A 4AFSC 1UDLA 1UFFA 2BIVA 2EBPA 2A28A 2RQWA 3RESA 4AG2C 2CZ1B 1OZ2A 1PD0A 2KRNA 2F2VA 3LWIA 3RDVA 2GFUA 4J9BA 3WVEB 4M7AG 3MKDA 2HD0A 2CP6A 3NPFA 1VIEA 1UJYA 1YN8A 1ZX6A 3H41A 3S3NA 1ZLMA 3L2ZA 3QJYA 4A63B 1RADB 2QA4A 2BE7D 5GMKm 3L2QA 2LNHB 1RACB 2K3YA 2LZ6B 1T3SA 1WNLA 2O01E 3CCLA 1VQ8Q 4J9GA 3H0HA 3JCMX 5IHKA 2KAFA 3LLRA 3SDZA 5KYWA 1PWTA 1YJ9A 2X4WA 2GFAA 3A8LB 2JUFA 3JCMJ 1MNDA 2NWMA 3M9QA 4B9WA 4M7AA 4M78B 3I56A 2K2VA 3C95A 2DZCA 1VQ9Q 3VV0A 1WHMA 2C0TA 1I4K1 3OS1A 5KYYB 2L2PA 2HL5C 1FX7A 3EAEA 2JTMA 1NZ9A 2X3WD 4PJLA 2DK3A 2RH2A 2Y4YA 3PMTA 4BE2A 3E9GA 3P8BB 3LH5A 1RAHB 1QWFA 1Q81U 1VQKA 4FIBA 2YLBA 4X9CA 2QG9B 3NTKA 3FLGA 4V2SA 4VUBA 3EH2A 2JNGA 2RJDA 3N5BB 2CZ0B 4M4ZA 1YP5A 4KBMB 2ED1A 3OY9A 4ZNXA 3MP1A 3HP9A 1X27A 2R58A 3CCJT 3CCUA 4PJOB 3QPHA 3CMET 2CP5A 4F7UF 2JMAA 2L3PA 3QO3A 4B9XA 2BZXA 3QJ6A 1SG5A 4YTLA 3JV3A 4KULA 1WJSA 4ZN1A 2LNVA 3CPWA 2XI9A 3G4SA 1C1AA 1OZ3A 1X43A 2CKKA 4RTUA 4M77D 1GBRA 3SHWA 2G3RA 2NLUA 5A0GA 3T9NA 5KYXA 2DD5A 2F2XA 3HRSA 3JCMP 1AWJA 3D7SB 2LJ0A 2VC8A 1Y96A 1G3SA 1BI3A 4IIOA 1UGRB 3CXCP 1TXQA 4FCYA 2ZAEA 4O5VA 4M78C 1M9SA 3PE0A 1IXDA 3CBMA 2ZPHB 3CCRQ 3RKYA 5A0LA 4FU6A 1IB8A 2QASA 2X9HA 2SEMA 2A0FB 2KMTA 2RA2A 3J7AF 3V7SA 1Q82U 1VQLT 2V8KA 4EDUA 2X4YA 1QVGP 1UHFA 3A8MB 2K2MA 5IAYA 3DLLA 1NYGA 1RI0A 1NJIR 4XU3A 5FRMA 5GANe 3OYIA 4IUUA 2PVGB 1JQQA 2L8DA 4C5EA 3QZ5B 1KC8U 3CCJQ 2OTJA 2A08A 1KD1U 2LRQA 1VQ6A 1U06A 2I0NA 1PCXA 2CSIA 3EFRA 4PJOC 1JJ2P 1ACMB 2DYBA 3M58A 1NPRA 1WI7A 1BI1A 2E41A 4JJDA 2CH4A 1LOJA 1AWOA 4HT8A 1YITT 4MMLA 1TUGB 2HMAA 3CD6T 1HJDA 2DZ9A 4M7DD 4DA4A 2M0OA 2ESWA 3LW5E 1VQ7A 2FHDA 2FYKA 4D6WA 1W1FA 1SF9A 3RMQA 2DKGA 1QW1A 1W2BP 1O9SA 2YDLA 1GFCA 1AWWA 4Y92A 2D1XA 1OV3A 2V8IA 1RAEB 4Y28E 3S3MA 4PFOA 3VS1A 4ANJA 2LQWA 1I8FA 5LJ5d 4PLLA 5LJ3f 2DTOA 3C0CA 2X3XD 2PQWA 3VYHB 2WACA 3CQTA 5GANf 2QDLA 2XG8D 1EZZB 1YCSB 4C92B 1VQ8A 1VQLQ 1QMCA 3CCLT 1UEBA 4AG1C 1NPPA 2H3JA 1PC0A 2AZVA 4M77E 3PTAA 5IH2A 1JU5C 2EGEA 4M75D 1KG1A 1N6AA 4J83A 3A1PA 2HSEB 1YJ9T 2DIQA 1YHQT 2H8HA 3OMCA 1QVGS 3CC4T 1FMKA 3I56T 2OTLT 1VQMA 2PUKB 1ZBJA 2EJ9A 2PU9B 4BDYA 1GFDA 4OMOA 2RI5A 2DM1A 2V8JA 1LCKA 1Y0MA 2J6FA 2RK1A 2RJFA 3ZEHA 2AK5A 2VV5A 1K4US 2O4XA 2CYZB 1ZUUA 4LD9K 5FU6B 2E4HA 3SWNB 1YITQ 2ZCFB 2K4YA 2KXCA 3M0TA 2NUTA 1SRMA 3JCMh 2SRCA 5HK3A 4L6V5 4M78D 5GAOn 3CCVA 4OMNA 3M55A 2P0QA 3X28B 4IKFA 2F5TX 4PKCC 1Q86C 4JS4A 1VQNT 5AT1B 3CCUT 3PIOA 2BZYA 1EX4A 3JSCA 1W2BS 1KFZA 5CKFA 4FT2A 2ENMA 1T3LA 2P0KA 1IREB 2XDDA 4IIMA 2J06A 3O8VA 2O2OA 1T0HA 3OS0A 1G5VA 2MMPA 5GANg 2CUDA 1H8KA 3CCLQ 3NTHA 3JB9J 3VUZA 4RCBA 3S3OA 4NOYA 1RAFB 4C92C 3FJPA 5GAN8 3E9FA 5FWCA 3SEMA 1IGQA 5GAOr 1YJ9Q 1WZOA 1YWOA 1ZBXA 5J39A 3HRTA 5KH6A 5GMKe 1SEMA 3QDFA 5J3BA 4E7HA 3I56Q 2OTLQ 2PNIA 4JS5A 1I81A 4EPCA 1Q7YC 3EGDA 4M77F 5LL6S 4BI3A 1KK7A 2DAQA 5CKBA 5KCHA 3OYLA 1UE9A 2EJFA 2K9GA 2VGMA 1SHGA 1YNZA 3CXCA 2KXDA 3OW2P 3EGXB 2V1QA 2MI6A 3QYHB 3GF5A 5FU6C 4AMCA 3OYHA 3SWNC 5CQXA 2NUPA 5IXFA 2RHXA 1HYOA 1M27C 3BY7A 1K73C 1OX9A 3GPLA 5GAN6 1GCQC 5I21A 4M75E 3CC7T 5GMKl 2XU8A 2MYSA 2M16A 2OTJT 3CMEA 3CCUQ 3MCAB 3CEYA 4C5HA 1QVGA 1PKSA 1UGPB 1AZGB 4E6RA 1G3TA 2DD4A 1ZHIA 3PVQA 4NL3A 1YIJT 2HBWA 2FZKB 4PFZA 3OYEA 2A37A 4C5IA 1YI2A 4HCBA 2EIFA 2MPXC 3CCST 3CCET 1M2OA 1OOTA 2EQUA 3UDCA 1JJ2A 2XDBA 4A54A 4RG2A 3OBWA 5EC7A 2L3RA 2DL8A 1CKAA 1IGUA 4TVRA 5IN1A 2NUZA 1MMNA 3MJXA 1PRLC 4M78E 3OS2A 2DO3A 2LQ8A 4N4HA 4XTUA 1Y7XA 2KT1A 2E3HA 2QGFB 4DOWA 1NJIU 5CKDA 2FG0A 4C8QB 1TUCA 2JN0A 2KROA 1AEYA 4RTWA 2DFUA 1W2BA 3GNGA 4FW1A 4GY5A 3A98A 3OYKA 2CT3A 1V76A 1M8VA 5CIUA 1RAAB 1BKBA 3ULRB 3Q1JA 1VQLA 3UPUA 1W4SA 3UA6A 3TVTA 2LJ1A 4WTOB 1LNXA 2RF0A 2RNAA 2DTIA 1EFNA 3MPUB 4HVUA 3OW2S 3TEEA 4M7DB 1N8RC 4KUDK 4E7SA 5LJ5e 4KH0B 1UG1A 4PJOE 2IPOB 1G3WA 1BI2A 1MHNA 1UGQB 1XTDA 2OTJQ 2OX7A 5GAMj 1VQMT 1WYXA 1RLPC 1W6XA 2CREA 1QQJA 1WHLA 3OS5A 3CPWS 2MWPA 3QHSA 3SB2A 2E3IA 3UA7A 4C0GA 4C92D 1YIJQ 1M30A 3BW1A 2L3SA 3CPFA 1YITA 3BE3A 3CBPA 2CUBA 1PSEA 5IT9E 3QUIA 3CD6A 3CCQA 3CCSQ 3FC3A 2QGGA 1B34B 3RR6A 1VQ7Q 2JM9A 2JM8A 3CCVT 1MV3A 1Y07A 2K5LA 4M75B 5CK9A 1PHTA 3OYJA 4OGCA 2VXFA 2HL3A 5GAMh 2Y4XA 2HDAA 3EG0A 1FMVA 4OMQA 4RCCA 1FWZA 1NE8A 4PNOA 3REBB 4RMOA 2KY9A 2VB6A 1SHFA 4IUPA 3EG9A 2WSFE 4JRKA 3QSUA 4XQ3A 1QVPA 1U1TA 5LJ5f 4C8QC 1D3BA 3HTRA 4A4EA 3NFCA 4XAXB 1IHVA 2EPDA 2M02A 2KRSA 4NS5A 4KGVB 4JRPA 1K0SA 2O9VA 2FRYA 2M9UA 1M3BA 1YHQA 5GAMe 2E6ZA 2EAYA 5CR2A 1H3ZA 2O88A 3CC4A 3H9NA 3TU4K 2OTLA 1XOVA 4M7DC 4B6MA 2LT4A 1MNEA 2VYTA 3HKSA 2LX9A 1BI0A 1VQMQ 3L2WA 1X75C 1TTHB 2K7AA 5GAN2 4ME7A 1VQ5T 2HZYA 2NYSA 1G83A 5KYYA 1WHJA 2HSPA 3QIIA 2FEIA 3O5ZA 4M7AB 1BYMA 4HVWA 2RHIA 4AFQC 1ZA2B 1UGVA 3GLXA 2JS2A 2WSEE 2XKOC 4PJOF 5DLOA 1JXMA 5A0DA 3V8KA 4F7UG 2EQKA 4X9DA 3CC2T 2QYZA 1KC8C 2D0NA 3CCVQ 3MO8A 4J6YA 2ABLA 1N9SA 2VASA 2KNBB 3OW2A 1VQNA 4XTZA 1FXXA 1N5ZA 3L1AA 2RK2A 3TCJA 3BDLA 3KXTA 3JB9G 2J05A 4M75C 4QVCA 1KSWA 1X6BA 3FIFA 3U23A 2DXTA 3OYAA 4LDXA 4E7JA 2MIOA 1N27A 1KQSP 4BDZA 3S6WA 4FSSA 4QW2A 2B8AA 3ZFJA 1FYNA 1S72T 3HRUA 4D8KA 1TH7A 2DA9A 4C92E 4Z88A 2DIGA 2ROLA 1YBYA 5GMKi 3JB9F 2QTVA 3MP6A 5LJ5g 1YI2T 2E10A 5I22A 4J5YA 4F7UA 1C0MA 2AKLA 1K9MU 2VGNA 2BZ8A 3EFOA 4AT1B 1UUEA 1QWEA 1KQ1A 1LJOA 4CC2A 3WXMB 4O6JA 2O9SA 1GCPA 5KYXB 2VKNA 3PFSA 1VQ5Q 4HCCA 1Q86R 4LNPA 3JCMQ 1Y96B 1FMWA 1UGSB 2QQBA 3OYDA 5FU7B 3EG1A 5KE2A 1P92A 5CAIA 4M7AC 4E2FB 1RL2A 1XQHA 2EQJA 1H3HA 1WX6A 2QEXT 3HFOA 4JJNK 5L23A 3CC2Q 2VXEA 2JT4A 4CC7A 1K0XA 2MWOA 3CC7A 2CS7A 2C06A 3C94A 1V29B 1TSFA 2RHZA 4FYWB 3I55T 1WJRA 1GRIA 3CMEQ 1WQ7A 1LPLA 4C8QD 1YJNA 2K5FA 4BI4A 2HQXA
chains in the Genus database with same CATH topology
3MEAA 1BIAA 1YIJA 3M5AA 4QQGA 4FT2A 4MMKA 5CKFA 4WF2A 5LJ5h 4ATOA 1N8RU 2P0KA 3LYIA 4RG8A 3G4ST 3OYBA 2LC4A 1IREB 5GANd 2XDPA 2XDDA 1OI1A 4ZTJA 5GAMg 2K3XA 1M1KU 1Q7YU 3M57A 3O8VA 3CCSA 3CCEA 1KQSS 3OS0A 2AHJB 3PMIA 4CRIA 3OB9A 2FL7A 4KT0E 3CCQT 1G5VA 3QKJA 2MMPA 4J8OA 3OYIA 2DTHA 4N0AA 5GANg 4A53A 3CCRT 3R6OA 3FB9A 2YLCA 3JCMd 1KD1C 3NTHA 3JB9J 3VUZA 5D6YA 4RCBA 3VKIA 3S3OA 1IZ6A 2I2LA 4NOYA 4PL6A 3LX7A 2L5QA 1VQ8T 4C92C 1G3YA 3V8LA 2R5AA 3FJPA 5GAN8 3JAME 1K8AU 3GIBA 3E9FA 4M75G 5GAOl 1YJWT 4LDWA 3OYCA 5GAOr 3RKXA 4XTVA 4PJOA 1ZBXA 1X01A 5J39A 3HRTA 3LGLA 2L89A 4J6XA 5KH6A 3DB4A 5GMKe 1U8RA 5J3BA 3JB9H 4E7HA 3A8HB 3RKWA 4M77C 4JS5A 5C6SA 2A3LA 4LDVA 1I81A 2GQVA 3E1SA 3JRZA 4EPCA 4JRQA 1VQ4T 1Q7YC 1WPYA 4NL2A 4QVZA 2E70A 2EKOA 5GAMf 5LJ3j 3J81E 3J80E 3CXCS 4LDUA 5GAOp 3VYGA 1VQ9T 3GP8A 3KBGA 2QQAA 4M77F 5LL6S 4BI3A 5GAOm 3CMAT 2DAQA 3EFSA 5GANj 5CKBA 5IT9E 4JRIA 5KCHA 3HL8A 3OYLA 3G6ET 1VQPA 1K8AC 2QTXA 1B34A 2EJFA 4OMFB 3JCMW 2VGMA 2P4TA 4QQDA 4C0ZA 3CXCA 5FU7C 5EG2A 4ZTFA 3DB3A 2RB6A 3JCMV 1QP2A 2MI6A 3ME9A 3QYHB 4F7UE 3GF5A 5FU6C 3OYHA 3P8HA 3SWNC 1M1GA 3OQ5A 2DJZA 2RHXA 2P0PA 4JDSA 5CQXA 4HA8A 3CD6T 1M1FA 2QI2A 3X24B 5DY9A 4F7UB 1Y71A 2XIDA 2KSSA 3BY7A 1BIBA 4EMGA 1M4ZA 5FROA 3GPLA 5GAN6 1K73C 5HY6A 2RO0A 1R8OB 3V7RA 4DOVA 5I21A 4ZGJB 3L42A 4M75E 4BE1A 3CC7T 4LD6A 3NTIA 3OMGA 2LDMA 5GMKl 1QVFS 2KDSA 2BIVA 2XU8A 3RESA 2M16A 4Z02A 2OTJT 3CMEA 5CO7A 3MCAB 2CZ1B 1OZ2A 3P8DA 3CEYA 4P5NA 1XNIA 2GFUA 4A4FA 4C5HA 3LWIA 1UGPB 1QVGA 1M90C 5LJ3h 5CVIA 3VUBA 3OYNA 3WVEB 4M7AG 4OB1B 4DQ2A 4QVDA 2KK4A 2HD0A 1G3TA 3MEUA 4BACA 1VIEA 3S3NA 4HCZA 2DD4A 2JZ2A 2PVDB 1ZHIA 5GANh 3L2ZA 3QJYA 1UB4A 2MAMA 4ZN3A 4NL3A 1YIJT 1JJ2S 3C12A 2QA4A 4R56A 3HSBA 3OYEA 5L8RE 3LH0A 3V7CA 4IUQA 1EIFA 5GMKm 3L2QA 1JB0E 4C5IA 2X4XA 4KUIA 1YI2A 4BB7A 4HCBA 3DLMA 2CZ7B 2EIFA 1YCYA 2K3YA 3KUFA 3CCST 3CCET 2QQRA 1WNLA 2EQUA 3UDCA 1VQOT 1JJ2A 4CI0C 2O01E 3H6ZA 2XDBA 4A54A 3CCLA 2E1HA 4RG2A 4J7IA 3OBWA 2O4XB 4J6WA 2L3RA 3JCMX 4XTYA 4IUVA 4FSXA 3L2VA 2KAFA 3LLRA 4TVRA 3SDZA 3X25B 5IN1A 3OSSC 4II1A 3VJPA 1YJ9A 2X4WA 4FM4B 4M78E 5LJ3e 3OS2A 2DO3A 3OA6A 2GFAA 2RHYA 3SD4A 3A8LB 2JUFA 2LQ8A 3JCMJ 2A7YA 3M9QA 4N4HA 4B9WA 3OYMA 4XTUA 1Y7XA 5GAMd 4M7AA 4M7AD 4M78B 3I56A 4C8QE 5FLXE 2K2VA 2ZGWA 4DOWA 1DJ7B 1NJIU 3C95A 4XU0A 5D6XA 5CKDA 2DZCA 3VV0A 4C8QB 2JN0A 2EJGA 1I4K1 3OS1A 3FDRA 3CCMA 1W2BA 3GNGA 2LTOA 1X6OA 3JCMe 4GY5A 3OYKA 3JCMc 1M8VA 4GLKA 2E12A 1FX7A 5CIUA 1BKBA 4C92G 3Q1JA 2GF7A 2K5IA 3GNFB 4IURA 1VQLA 3UPUA 1W4SA 3HHTB 3EAEA 3M4GA 3TREA 2JTMA 1NZ9A 3PNWC 3ZBDA 2DK3A 2RH2A 2Y4YA 3PMTA 4E7IA 1KQSA 4BE2A 3E9GA 3P8BB 4M7DE 4MDXA 1LNXA 3HFNA 5HK0A 1Q81U 2DTIA 1VQKA 4BD3A 4X34A 1I5LA 4FIBA 4R55A 4BE0A 2YLBA 4M77G 4X9CA 5GAN5 3QDRB 3TEEA 3OW2S 4E7LA 3NTKA 4M7DB 3FLGA 4C92F 2RJEA 1N8RC 1N9RA 1WQWA 4KUDK 4VUBA 5LJ5e 2JNGA 3JCMb 2RJDA 3G71A 4V2SA 3N5BB 2CZ0B 2E5QA 1M1KC 5CKEA 4PJOE 1G3WA 4KBMB 1BI2A 1MHNA 1UGQB 1XTDA 3MP1A 3OY9A 1VQ5A 2R5MA 3HP9A 2QQ9A 3QZ9B 5GAMj 2R58A 3CCJT 1VQMT 3CCUA 5GAOq 4OB0B 4PJOB 3QPHA 5I2SA 3CMET 3PIPA 4F7UF 3INZA 4XTXA 3OS5A 3DKMA 2HBPA 3BDUA 3CPWS 2MWPA 2RD1A 3QHSA 3SB2A 3QO3A 4C0GA 4C92A 4C92D 2EYQA 4ZGEB 1HXDA 4B9XA 3QJ6A 4EMHA 3BW1A 4YTLA 4KULA 1WJSA 3CPFA 2LNVA 4ZN1A 1YITA 3UT1A 3CBPA 3CPWA 1PSEA 2XI9A 3LGFA 3QUIA 3E19A 3G4SA 1OZ3A 3CCQA 3FC3A 2QA4T 3CC2A 3CD6A 3C4SA 2CKKA 2DEQA 1O75A 4M77A 4M77D 4N4IA 5GAN7 2WSCE 2KQWA 1B34B 2G3RA 2NLUA 3ASKA 4OVAA 5A0GA 3T9NA 3RMSA 3URGA 2ZPGB 3CCVT 1YJWA 1Y07A 2F69A 2DD5A 2K5LA 4BI8B 4OB2B 1JBMA 4M75B 3HRSA 2DPPB 5CK9A 2QQSA 3JCMP 1HK9A 3OYJA 2VC8A 4OGCA 2VXFA 2FVUA 1Y96A 2LT1A 5GAMh 1G3SA 1BI3A 1YJNT 1QVFA 2Y4XA 2M1HA 1VQ4A 3F70A 1UGRB 4RCCA 1FWZA 2E65A 1S72A 1NE8A 4PNOA 4O5VA 4M78C 2R57A 4A4KA 4RMOA 2KY9A 1M9SA 3LWHA 1VQ9A 3AHUA 2DXCA 3SWNA 4IUPA 3QSUA 2WSFE 4JRKA 4C0FA 4XQ3A 1QVPA 2JOYA 3CBMA 3MP8A 1U1TA 2ZPHB 2GCXA 3SFMA 5GMKj 3RKYA 5A0LA 4C8QC 1D3BA 4L5GA 4MZPA 5LJ5f 4FU6A 4A4GA 3QBYA 5J26A 5DLQE 5HKCA 1Q86U 4A4EA 2LCCA 3VU3C 3NFCA 5FRNA 2KMTA 4XAXB 4BY6B 3UWNA 2RA2A 3J7AF 4E7KA 2ZPEB 3V7SA 4ELYC 2CGHA 1Q82U 1VQLT 1QP3A 2V8KA 4NS5A 2IVWA 3META 2YRVA 4EDUA 4JRPA 4N4GA 2X4YA 2M9UA 1YHQA 5GAMe 2E6ZA 2EAYA 3A8MB 5GAN3 5CR2A 1H3ZA 4EMKB 5IAYA 1VQKT 3DLLA 3FEOA 2IG0A 3MEWA 3CC4A 1RI0A 4XU3A 5FRMA 3TU4K 5GANe 2ZPIB 2OTLA 1XOVA 2LCLA 4XK8E 4M7DC 4N0AC 2LT4A 1PSFA 2VYTA 2FB7A 2PVGB 2XICA 4IUUA 1H641 2L8DA 3HKSA 2LX9A 3QZ5B 4UC4A 4C5EA 2KVQG 1BI0A 1KC8U 2OTJA 3M59A 1VIFA 1X75C 4XU2A 3L2WA 1KD1U 2LRQA 2HAXA 1VQ6A 5GAN2 1KHCA 4ME7A 1VQ5T 4OP0A 4M7AE 3FRNA 3L2UA 2DXUA 2VUBA 4HKEA 4M7DF 3PT9A 3X26B 3EFRA 3QIIA 1ZQ1A 4PJOC 3A8GB 5D6WA 4M7AB 3M58A 1BYMA 1NPRA 3RUXA 4JUVA 5GMKh 1BI1A 2RHIA 4MZMA 5C0MA 1VQPT 3OYGA 4OGEA 3GLXA 2WSEE 2QEXA 2E41A 2X4JA 2XKOC 5M9OA 5GAN4 3WVDB 4C0DB 5LJ3g 4IUTA 1LOJA 1WGSA 4PJOF 4HT8A 2CZ6B 4HT9A 5DLOA 1YITT 4OB3B 4JLIA 4MMLA 5A0DA 3V8KA 4MZTA 1VQOA 4F7UG 1KHIA 2X35A 2EQKA 2E6NA 3BFMA 2OAUA 3M56A 2YHTA 2DZ9A 4X9DA 4BUGA 1U1SA 4XU1A 1NJIC 4M7DA 1KC8C 4M7DD 4DA4A 2M0OA 5KCOA 1SSFA 3LW5E 2D9TA 3MO8A 4Y91A 1VQ7A 4J6YA 2FHDA 2FYKA 3I55A 1N9SA 4D6WA 3RMQA 3OW2A 2DKGA 2Y90A 1QW1A 1VQNA 4XTZA 1FXXA 2XK0A 3L1AA 3JCMg 4Q5WA 2F5KA 2RK2A 3TCJA 3V8JA 3BDLA 1O9SA 4FT4A 3QG1A 3RIRA 3KXTA 3H8ZA 3JB9G 4PJOD 4M75C 4QVCA 2E64A 2D6FA 3A5ZB 2HNIA 3FIFA 2V8IA 2DXTA 3OYAA 4LDXA 4Y28E 4E7JA 3S3MA 1Q81C 1N27A 4RKUE 3S6WA 4A4HA 4BDZA 4QW2A 1I8FA 2B8AA 4PLLA 3ZFJA 5LJ5d 5LJ3f 1K73U 1S72T 3HRUA 4M75F 1VUBA 2QXFA 1TH7A 2DTOA 2PUOB 4C92E 2DIGA 2PQWA 1YBYA 3QXEB 5GMKi 3CCRA 3JB9F 3MP6A 3VYHB 2WACA 2E10A 5LJ5g 5GANf 1YI2T 3PGGA 2XG8D 3OBYA 3M54A 4C5GA 4J5YA 4F7UA 3M4YA 4C92B 5CCAA 1VQ8A 4FL6A 1M90U 3GOXA 1WJQA 3CCLT 1UEBA 2RM4A 3A8OB 2JVVA 3MHXA 4BY6C 4ELZC 1NPPA 2DXBA 1K9MU 2XD0A 2H3JA 4JLGA 2QDYB 2VGNA 3JCMf 2BKDN 4M77E 3PTAA 3JB9I 4M75A 4M75D 1KG1A 1N6AA 4J83A 1YJ9T 4PLIA 2DIQA 2D0QB 1YHQT 4M77B 4L59A 4OF1A 3OMCA 1KQ1A 3OYYA 4M78G 5CQYA 1LJOA 3G71T 3JB9D 4LDYA 3RERA 1JRIA 3WXMB 4O6JA 4EMKC 2RI2A 3CC4T 1QVGS 2K57A 3G7ZA 3I56T 2OTLT 3HPWA 3CCJA 2DVEA 3PFSA 1VQMA 2PUKB 1OYXA 2EFIA 4C8QG 1KQ2A 2EJ9A 4HCCA 2ZZDA 2XHCA 2PU9B 4BDYA 3CMAA 5A2QE 2RI5A 3JCMQ 1Y96B 1VQ6T 3G6EA 3CCMT 2V8JA 5LJ5j 1UGSB 2QQBA 4M78F 3OYDA 4E47A 5FU7B 2RHUA 2RK1A 2RJFA 3ZEHA 1K9MC 5KE2A 2VV5A 1P92A 2O4XA 5AYFA 2CYZB 4J7FA 4ZGDB 5CAIA 1M5Q1 3OYFA 4M7AC 4LD9K 5FU6B 1RL2A 4C8QF 2HQEA 3SWNB 1XQHA 2EQJA 2ZCFB 2EWNA 2QEXT 2K4YA 3HFOA 4JJNK 3ER0A 3MEVA 5KE3A 2JTFA 2ZPFB 4M7DG 2VXEA 1D3BB 4C0DC 2BUDA 2ZPBB 4M7AF 3JCMh 4EMKA 1MGQA 2MWOA 2PVOB 3CC7A 2CS7A 5HK3A 4L6V5 4QQ6A 3X20B 2MF2A 4M78D 4M78A 5GAOn 3CCVA 3CBOA 3M55A 2EQMA 2P0QA 3X28B 2C06A 3CC2T 3C94A 2RI3A 4MDWA 4IKFA 1AHJB 1V29B 2F5TX 2LQKA 1VQ7T 2RHZA 4PKCC 1WJRA 3I55T 4PJOG 4C8QA 1WQ7A 4C8QD 1Q86C 4XTWA 4JS4A 1VQNT 3CCUT 3OSVA 2RJCA 3PIOA 1YJNA 3QYGB 5CKHA 2LVMA 3L2RA 2K5FA 4BI4A 5I2MA 1Q82C 3JSCA 5LJ3d 3M53A 5DM7R 1W2BS 1GXIE 2HQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT2 A;  4KUI A;  4BB7 A;  4FT4 A;  3TU4 K;  1ZBX A;  4DOW A;  3PTA A;  4KUD K;  4KUL A;  4FSX A;  2FL7 A;  2FVU A;  4DA4 A;  4LD9 K;  3PT9 A;  1ZHI A;  1W4S A;  1M4Z A;  4DOV A;  4JJN K; 
#chains in the Genus database with same CATH topology
 3MEA A;  1BIA A;  1YIJ A;  3M0S A;  3M5A A;  4QQG A;  4WF2 A;  2DRK A;  1S72 Q;  1Q7Y R;  1NM7 A;  4LN2 A;  1AZE A;  1OI1 A;  5GAM g;  2K3X A;  3CCS A;  3CCE A;  2F2W A;  1YI2 Q;  1KQS S;  2GBQ A;  3CCQ T;  2K3B A;  3QKJ A;  4J8O A;  4N0A A;  4AFZ C;  3LX7 A;  2L5Q A;  1G3Y A;  1OQK A;  2R5A A;  4JZ4 A;  1K8A U;  2DBK A;  3OYC A;  3I5S A;  1OEB A;  2FPD A;  4FW2 A;  4FYV B;  1K73 R;  3VS6 A;  3RKW A;  3JRZ A;  3UF4 A;  5GJV B;  1WPY A;  4QVZ A;  2E70 A;  1ZUY A;  5HCK A;  3CXC S;  2W0Z A;  2QQA A;  1W70 A;  4JRI A;  1X69 A;  2QTX A;  4OMF B;  4PFP A;  4QQD A;  2QK0 A;  5FU7 C;  1NEG A;  5EG2 A;  4CC4 B;  4ZTF A;  5FWB A;  2QEX Q;  2RB6 A;  1PD1 A;  1ABO A;  1PM3 A;  1M1G A;  3VS4 A;  4JDS A;  4HA8 A;  1M1F A;  5DY9 A;  1Y71 A;  2H3E B;  2KSS A;  9ATC B;  1BIB A;  2DEU A;  1M4Z A;  2RQT A;  2RO0 A;  1R8O B;  3V7R A;  1K1Z A;  4ZGJ B;  1VOM A;  2LDM A;  4J9I A;  1UEC A;  2RQV A;  1R0C B;  4P5N A;  1XNI A;  4A4F A;  2DL5 A;  1M90 C;  4OB1 B;  1KIK A;  4QVD A;  4KGX B;  2DMO A;  4KH1 B;  4BAC A;  4HCZ A;  3EHR A;  4EIK A;  1JJ2 S;  2MAM A;  2B86 A;  2YT6 A;  4R56 A;  3HSB A;  2HQH A;  3V7C A;  1EIF A;  4PK4 A;  3CD6 Q;  3CCQ Q;  4KUI A;  3DLM A;  2HKQ B;  2CZ7 B;  1YCY A;  3H6Z A;  2E1H A;  2O4X B;  4J6W A;  1OPK A;  4XTY A;  4IUV A;  1C6V X;  3L2V A;  3ZL7 C;  2RQR A;  3M0Q A;  3OSS C;  1RLQ C;  4II1 A;  3EG2 A;  2FZG B;  2KRM A;  2V1R A;  3OA6 A;  2RHY A;  2NUT B;  2KEA A;  3IQL A;  2A7Y A;  1NLP C;  3TSW A;  1N8R R;  5GAM d;  2EVR A;  4M7A D;  4J9H A;  4C8Q E;  1SKU B;  3I9Q A;  5D6X A;  2W10 A;  1VYT A;  2KYB A;  4PJM A;  3NGP A;  2EJG A;  5ECA A;  3FDR A;  3CCM A;  3VS2 A;  3JCM e;  2YUN A;  3JCM c;  4GLK A;  2E12 A;  2GF7 A;  3GNF B;  1RI9 A;  2DL4 A;  3ZBD A;  1NBE B;  1KQS A;  1NLO C;  1Y57 A;  5IHN A;  4M7D E;  1A0N B;  2EGC A;  4BD3 A;  4X34 A;  1YHQ Q;  4M77 G;  3QDR B;  3CC4 Q;  3JCM b;  1M1K C;  1D0Z A;  2FO0 A;  1VQ5 A;  5GAO q;  4OB0 B;  5I2S A;  3PIP A;  1D09 B;  3DKM A;  2RD1 A;  2CP0 A;  4ZGE B;  3M0R A;  3EGD B;  4OMP A;  2HKN A;  1M2V A;  2QAZ A;  3LGF A;  1K9A A;  3E19 A;  3CC2 A;  1YWP A;  1OU8 A;  3C4S A;  1O75 A;  4M77 A;  4N4I A;  3QWX X;  1TWB A;  2KQW A;  3ASK A;  4OVA A;  3VS3 A;  1YJW A;  4WCI A;  1R77 A;  1VQN Q;  4BI8 B;  4OB2 B;  1JBM A;  1D0Y A;  1UTI A;  2NUP B;  2DYI A;  2FVU A;  2LT1 A;  1YJN T;  4J9D A;  2M1H A;  1VQ4 A;  2KYM A;  1BK2 A;  3F70 A;  2E65 A;  1S72 A;  2R57 A;  4A4K A;  2DXC A;  4C0F A;  3MP8 A;  2OAW A;  2LMJ A;  2GCX A;  3SFM A;  4L5G A;  3QBY A;  5DLQ E;  1Q86 U;  2X51 A;  3VU3 C;  4PJN A;  4ELY C;  1WFW A;  1QP3 A;  1KJW A;  2IVW A;  2XMF A;  3PVL A;  4N4G A;  4X1V A;  2ECZ A;  5GAN 3;  2P4R A;  4AFU C;  1QCF A;  4EMK B;  3FEO A;  1KC8 R;  1AWX A;  2ZPI B;  4XK8 E;  2FB7 A;  3G71 T;  2XIC A;  2FPE A;  1H64 1;  4UC4 A;  2KVQ G;  1WLP B;  1VIF A;  4FYY B;  4XU2 A;  2VVK A;  4M7A E;  1CKB A;  2ROT A;  2VWF A;  2DXU A;  2VUB A;  4M7D F;  1ZSZ B;  3X26 B;  4DBR A;  3A8G B;  2JTE A;  4KGZ B;  4Z8A A;  5C0M A;  3OYG A;  4F17 A;  2QEX A;  2X4J A;  5GAN 4;  4C0D B;  4IUT A;  1WGS A;  4OB3 B;  1X2K A;  2KE9 A;  1QKX A;  1VQO A;  4RTT A;  1KHI A;  3BFM A;  2E6N A;  4BUG A;  2YHT A;  4M7D A;  1U1S A;  3CC7 Q;  3VS7 A;  5KCO A;  1SSF A;  4Y91 A;  2D9T A;  2M0Y A;  3TSZ A;  2K79 A;  3I55 A;  1TOV A;  5KYU A;  3JCM g;  4CC3 A;  3V8J A;  2J7I A;  4FT4 A;  1YJN Q;  3QG1 A;  3H8Z A;  2D6F A;  3A5Z B;  1I5O B;  1BCM A;  1AOJ A;  2YSQ A;  1F1B B;  1AT1 B;  1Q81 C;  4RKU E;  4A4H A;  2MCN A;  4HCK A;  1RAG B;  1K73 U;  4M75 F;  1BB9 A;  2QXF A;  2HEQ A;  3CCE Q;  3QXE B;  3THK A;  3M54 A;  5CCA A;  1WA7 A;  1XJW B;  4FL6 A;  1OUL A;  1Z9Z A;  3GOX A;  2EQI A;  2EYX A;  2AT1 B;  2XD0 A;  2DXB A;  4JLG A;  3JB9 I;  2DF6 A;  2FPF A;  4M75 A;  4QKU A;  2L3Q A;  2D0Q B;  2FZC B;  4OF1 A;  4M78 G;  3OYY A;  4LDY A;  3G71 Q;  3RER A;  4EMK C;  3VRZ A;  1PNJ A;  1K76 A;  3G7Z A;  2DVE A;  2EFI A;  1KQ2 A;  2ZZD A;  2XHC A;  2F1L A;  5A2Q E;  4E7Z A;  3EHQ A;  3CCM T;  2ED0 A;  2LQN A;  4M78 F;  4E47 A;  4KRT A;  2RHU A;  2P84 A;  1K9M C;  1ZSZ C;  2PTK A;  1RAB B;  3EG3 A;  5AYF A;  4J7F A;  3OYF A;  1M5Q 1;  3EG9 B;  2EWN A;  2KT8 A;  2JTF A;  2O31 A;  2ZPF B;  4C0D C;  1D3B B;  1I07 A;  2BUD A;  2ZPB B;  1QVF P;  4M7A F;  1MGQ A;  2PVO B;  3M0P A;  4QQ6 A;  2MF2 A;  2CP7 A;  4M78 A;  1G8X A;  2EQM A;  1SPK A;  4MDW A;  1AHJ B;  5KYW B;  4D8D A;  2JMC A;  3RBB B;  2Z0W A;  4PJO G;  2IIM A;  4XTW A;  3QYG B;  3L2R A;  2E5K A;  1Q82 C;  5DM7 R;  3M53 A;  1N8R U;  2CDT A;  4OML A;  4RG8 A;  3OYB A;  4HXJ A;  2XDP A;  3QWY A;  4ZTJ A;  3M57 A;  2K6D A;  1JO8 A;  5KYN A;  2AHJ B;  4J9C A;  3PMI A;  4CRI A;  4KT0 E;  3CCR T;  3JCM d;  1KD1 C;  3VKI A;  1IZ6 A;  2I2L A;  4PL6 A;  3GIB A;  3V8L A;  1YJW T;  2JXB A;  2DL3 A;  4PJO A;  3LGL A;  1D1A A;  4PJJ A;  3E2U A;  1Z9Q A;  4J9F A;  3A8H B;  2YUP A;  2MOX A;  2YRD A;  4JPB W;  2A3L A;  1LVK A;  4LDV A;  1VQ4 T;  3E1S A;  4JRQ A;  2EYZ A;  4HVV A;  4NL2 A;  5GAM f;  3J81 E;  5LJ3 j;  3J80 E;  4LDU A;  3CCM Q;  3KBG A;  3NMZ C;  5GAO m;  2YRC A;  1M90 R;  3CMA T;  5GAN j;  3G6E T;  3HL8 A;  1VQP A;  1K8A C;  4C0Z A;  3UAT A;  4F16 A;  1NG2 A;  1QP2 A;  3ME9 A;  2DLP A;  4RUG A;  3OQ5 A;  2DJZ A;  2P0P A;  3NHN A;  2GNC A;  2QI2 A;  3X24 B;  4F7U B;  5HY6 A;  4BE1 A;  3L42 A;  4LD6 A;  3NTI A;  3OMG A;  1QVF S;  2AIR B;  2KDS A;  2C0O A;  4Z02 A;  3EFO B;  5CO7 A;  2DER A;  3P8D A;  5LJ3 h;  5CVI A;  3VUB A;  4Z89 A;  3OYN A;  2EW3 A;  4DQ2 A;  4QT7 A;  2KK4 A;  3MEU A;  2DRM A;  2JZ2 A;  2PVD B;  2DET A;  5GAN h;  1UB4 A;  1RUW A;  1V1C A;  4F04 B;  4ZN3 A;  3C12 A;  1E6H A;  5L8R E;  2LJ3 A;  3LH0 A;  4IUQ A;  1JB0 E;  2X4X A;  4BB7 A;  3KUF A;  2QQR A;  1VQO T;  4CI0 C;  4J7I A;  2KI7 A;  4FSX A;  1YJW Q;  3X25 B;  3VJP A;  1TG0 A;  3I35 A;  4FM4 B;  4DBF A;  5LJ3 e;  3SD4 A;  3OYM A;  4F14 A;  1VQ4 Q;  2COZ A;  2BTT A;  1VA7 A;  3GBQ A;  5FLX E;  1M1K R;  2AKK A;  2ZGW A;  1DJ7 B;  4XU0 A;  7AT1 B;  4RTV A;  1M3C A;  2COW A;  3CMA Q;  2LTO A;  1X6O A;  2YUO A;  3G6E Q;  2YWW A;  4C92 G;  5I11 A;  5D7U A;  2K5I A;  4IUR A;  1MUZ A;  3HHT B;  3M4G A;  3TRE A;  2DBM A;  3PNW C;  4E7I A;  3H0F A;  1JXO A;  4MDX A;  3EH1 A;  3HFN A;  2RQU A;  1I5L A;  3M0U A;  1VYV A;  5GAN 5;  4E7L A;  4C92 F;  2RJE A;  1N9R A;  1WQW A;  3G71 A;  2E5Q A;  1PRM C;  5CKE A;  2OI3 A;  2R5M A;  2J6O A;  2G6F X;  2QQ9 A;  1OX8 A;  3QZ9 B;  4JJC A;  2HCK A;  1WHK A;  1U5S A;  3INZ A;  4XTX A;  2GGR A;  2HBP A;  3BDU A;  1NEB A;  4C92 A;  2EYQ A;  1HXD A;  4EMH A;  5FW9 A;  1H92 A;  4LXC A;  3UT1 A;  2QA4 T;  2DEQ A;  1VQO Q;  5GAN 7;  2WSC E;  4LUE A;  3RMS A;  3URG A;  3I55 Q;  2ZPG B;  4DBQ A;  8ATC B;  2JJ9 A;  2F69 A;  2RN8 A;  2DPP B;  2ATC B;  2QQS A;  1HK9 A;  4OMM A;  5IXB A;  1PG5 B;  1MMD A;  1QVF A;  6AT1 B;  2KGT A;  1Q95 G;  3LWH A;  1VQ9 A;  3AHU A;  3SWN A;  2JOY A;  1ZA1 B;  1J3T A;  5GMK j;  4MZP A;  1GCQ A;  3VS0 A;  4A4G A;  5J26 A;  5HKC A;  4GLM A;  2LCC A;  5FRN A;  4JZ3 A;  4BY6 B;  3UWN A;  4E7K A;  2ZPE B;  2CGH A;  2J6K A;  2LCS A;  2CP3 A;  2CSQ A;  1E6G A;  2CT4 A;  3AT1 B;  3MET A;  2YRV A;  3R6N A;  2DX1 A;  1JEG A;  4ESR A;  1VQK T;  2IG0 A;  3MEW A;  2CP2 A;  2GTJ A;  1TS9 A;  2LCL A;  4N0A C;  4MMK A;  1PSF A;  5HK0 A;  4R55 A;  4BE0 A;  3M59 A;  1VYU A;  5GJW B;  4R0K A;  4K11 A;  2HAX A;  1KHC A;  4OP0 A;  3TQ7 P;  3FRN A;  3L2U A;  4HKE A;  3PT9 A;  1ZQ1 A;  5D6W A;  2L0A A;  1QCN A;  3RUX A;  4JUV A;  5GMK h;  1QLY A;  4MZM A;  1VQP T;  2M51 A;  1Q81 R;  2YXY A;  2C0I A;  4OGE A;  5M9O A;  2D8J A;  2QA4 Q;  2EKH A;  3WVD B;  5LJ3 g;  4HT9 A;  3H0I A;  2CZ6 B;  1B07 A;  4JLI A;  2BE9 B;  4J9E A;  4MZT A;  3G4S T;  2X35 A;  2OAU A;  3M56 A;  3VRY A;  4XU1 A;  1NJI C;  1UHC A;  2CH4 W;  2EYY A;  1ZUK A;  1HD3 A;  3FJ5 A;  1GL5 A;  1B3Q A;  2A36 A;  2Y90 A;  2XK0 A;  4Q5W A;  2F5K A;  4PJO D;  3RIR A;  2DE0 X;  2E64 A;  1BU1 A;  3G1J A;  1R0B G;  2V26 A;  2HNI A;  3EGU A;  2DL7 A;  1U3O A;  1BBZ A;  3EGX A;  1VUB A;  1D1B A;  2PUO B;  1B7T A;  3CCR A;  8AT1 B;  1RAI B;  3PGG A;  4GBQ A;  3OBY A;  4C5G A;  3M4Y A;  1QKW A;  1K9M R;  1M90 U;  1TUD A;  4LE9 A;  1WJQ A;  1AVZ C;  2RM4 A;  3A8O B;  4RTY A;  4FYX B;  2JVV A;  3MHX A;  4BY6 C;  4ELZ C;  1TU0 B;  2QDY B;  3JCM f;  2BKD N;  5IHI A;  1M2V B;  1OPL A;  2JS0 A;  1VQK Q;  4PLI A;  4M77 B;  2OJ2 A;  4L59 A;  3JB9 D;  5CQY A;  1JRI A;  2RI2 A;  2DVJ A;  1ZSG A;  2K57 A;  1WIE A;  3HPW A;  3CCJ A;  1I1J A;  1OYX A;  4C8Q G;  3CPW P;  3CMA A;  1UJ0 A;  1PKT A;  1VQ6 T;  3G6E A;  1M8M A;  5LJ5 j;  1NYF A;  1Q82 R;  1VQP Q;  2RMO A;  4ZGD B;  2DIL A;  2LX7 A;  2KBT A;  4C8Q F;  2HQE A;  2EGA A;  4DBH A;  3ER0 A;  3MEV A;  5KE3 A;  3G4S Q;  3I5R A;  1M3A A;  4M7D G;  1SRL A;  2DJQ A;  1AD5 A;  1IHW A;  4EMK A;  2EYW A;  3X20 B;  1KD1 R;  2FRW A;  3CBO A;  2RI3 A;  1VQ7 T;  2LQK A;  1OU9 A;  1S1N A;  1WDX A;  4C8Q A;  3OSV A;  2RJC A;  5CKH A;  2LVM A;  3KFV A;  1WHG A;  2YUQ A;  5I2M A;  1ZSZ A;  1HSQ A;  5LJ3 d;  3R6O A;  1X6G A;  1GXI E;  4ORZ A;  1WHH A;  1G2B A;  5LJ5 h;  4ATO A;  3LYI A;  2LC4 A;  5GAN d;  2KR3 A;  2AZS A;  1M1K U;  1Q7Y U;  1IRX A;  3REA B;  1E7O A;  3OB9 A;  2FL7 A;  1I0C A;  4RTZ A;  2DTH A;  3RNJ A;  4A53 A;  1MV0 B;  1ARK A;  2GQI A;  2YLC A;  2GTO A;  3FB9 A;  1D1C A;  1K8A R;  5D6Y A;  1VQ8 T;  2RPN A;  3JAM E;  1WXB A;  2LP5 A;  4M75 G;  5GAO l;  4LDW A;  3RKX A;  4XTV A;  2D8H A;  1X01 A;  2L89 A;  2MK5 A;  4RTX A;  1IO6 A;  4J6X A;  3DB4 A;  1U8R A;  1MMG A;  3JB9 H;  4M77 C;  1WXU A;  1T0J A;  5C6S A;  2GQV A;  1YFN A;  3VS5 A;  2EKO A;  2DNU A;  5KYU B;  4LUD A;  5GAO p;  3VYG A;  1VQ9 T;  1VQ6 Q;  3GP8 A;  1WXT A;  1QCO A;  3EFS A;  1BCO A;  2COY A;  1B34 A;  3JCM W;  2P4T A;  4DEY A;  4JJB A;  1SSH A;  4DEX A;  3DB3 A;  3JCM V;  1ABQ A;  1X2Q A;  4F7U E;  3P8H A;  1CSK A;  1GBQ A;  1D0X A;  2PZ1 A;  2XID A;  1MMA A;  4EMG A;  5FRO A;  4DOV A;  2JW4 A;  4AFS C;  1UDL A;  1UFF A;  2BIV A;  2EBP A;  2A28 A;  2RQW A;  3RES A;  4AG2 C;  2CZ1 B;  1OZ2 A;  1PD0 A;  2KRN A;  2F2V A;  3LWI A;  3RDV A;  2GFU A;  4J9B A;  3WVE B;  4M7A G;  3MKD A;  2HD0 A;  2CP6 A;  3NPF A;  1VIE A;  1UJY A;  1YN8 A;  1ZX6 A;  3H41 A;  3S3N A;  1ZLM A;  3L2Z A;  3QJY A;  4A63 B;  1RAD B;  2QA4 A;  2BE7 D;  5GMK m;  3L2Q A;  2LNH B;  1RAC B;  2K3Y A;  2LZ6 B;  1T3S A;  1WNL A;  2O01 E;  3CCL A;  1VQ8 Q;  4J9G A;  3H0H A;  3JCM X;  5IHK A;  2KAF A;  3LLR A;  3SDZ A;  5KYW A;  1PWT A;  1YJ9 A;  2X4W A;  2GFA A;  3A8L B;  2JUF A;  3JCM J;  1MND A;  2NWM A;  3M9Q A;  4B9W A;  4M7A A;  4M78 B;  3I56 A;  2K2V A;  3C95 A;  2DZC A;  1VQ9 Q;  3VV0 A;  1WHM A;  2C0T A;  1I4K 1;  3OS1 A;  5KYY B;  2L2P A;  2HL5 C;  1FX7 A;  3EAE A;  2JTM A;  1NZ9 A;  2X3W D;  4PJL A;  2DK3 A;  2RH2 A;  2Y4Y A;  3PMT A;  4BE2 A;  3E9G A;  3P8B B;  3LH5 A;  1RAH B;  1QWF A;  1Q81 U;  1VQK A;  4FIB A;  2YLB A;  4X9C A;  2QG9 B;  3NTK A;  3FLG A;  4V2S A;  4VUB A;  3EH2 A;  2JNG A;  2RJD A;  3N5B B;  2CZ0 B;  4M4Z A;  1YP5 A;  4KBM B;  2ED1 A;  3OY9 A;  4ZNX A;  3MP1 A;  3HP9 A;  1X27 A;  2R58 A;  3CCJ T;  3CCU A;  4PJO B;  3QPH A;  3CME T;  2CP5 A;  4F7U F;  2JMA A;  2L3P A;  3QO3 A;  4B9X A;  2BZX A;  3QJ6 A;  1SG5 A;  4YTL A;  3JV3 A;  4KUL A;  1WJS A;  4ZN1 A;  2LNV A;  3CPW A;  2XI9 A;  3G4S A;  1C1A A;  1OZ3 A;  1X43 A;  2CKK A;  4RTU A;  4M77 D;  1GBR A;  3SHW A;  2G3R A;  2NLU A;  5A0G A;  3T9N A;  5KYX A;  2DD5 A;  2F2X A;  3HRS A;  3JCM P;  1AWJ A;  3D7S B;  2LJ0 A;  2VC8 A;  1Y96 A;  1G3S A;  1BI3 A;  4IIO A;  1UGR B;  3CXC P;  1TXQ A;  4FCY A;  2ZAE A;  4O5V A;  4M78 C;  1M9S A;  3PE0 A;  1IXD A;  3CBM A;  2ZPH B;  3CCR Q;  3RKY A;  5A0L A;  4FU6 A;  1IB8 A;  2QAS A;  2X9H A;  2SEM A;  2A0F B;  2KMT A;  2RA2 A;  3J7A F;  3V7S A;  1Q82 U;  1VQL T;  2V8K A;  4EDU A;  2X4Y A;  1QVG P;  1UHF A;  3A8M B;  2K2M A;  5IAY A;  3DLL A;  1NYG A;  1RI0 A;  1NJI R;  4XU3 A;  5FRM A;  5GAN e;  3OYI A;  4IUU A;  2PVG B;  1JQQ A;  2L8D A;  4C5E A;  3QZ5 B;  1KC8 U;  3CCJ Q;  2OTJ A;  2A08 A;  1KD1 U;  2LRQ A;  1VQ6 A;  1U06 A;  2I0N A;  1PCX A;  2CSI A;  3EFR A;  4PJO C;  1JJ2 P;  1ACM B;  2DYB A;  3M58 A;  1NPR A;  1WI7 A;  1BI1 A;  2E41 A;  4JJD A;  2CH4 A;  1LOJ A;  1AWO A;  4HT8 A;  1YIT T;  4MML A;  1TUG B;  2HMA A;  3CD6 T;  1HJD A;  2DZ9 A;  4M7D D;  4DA4 A;  2M0O A;  2ESW A;  3LW5 E;  1VQ7 A;  2FHD A;  2FYK A;  4D6W A;  1W1F A;  1SF9 A;  3RMQ A;  2DKG A;  1QW1 A;  1W2B P;  1O9S A;  2YDL A;  1GFC A;  1AWW A;  4Y92 A;  2D1X A;  1OV3 A;  2V8I A;  1RAE B;  4Y28 E;  3S3M A;  4PFO A;  3VS1 A;  4ANJ A;  2LQW A;  1I8F A;  5LJ5 d;  4PLL A;  5LJ3 f;  2DTO A;  3C0C A;  2X3X D;  2PQW A;  3VYH B;  2WAC A;  3CQT A;  5GAN f;  2QDL A;  2XG8 D;  1EZZ B;  1YCS B;  4C92 B;  1VQ8 A;  1VQL Q;  1QMC A;  3CCL T;  1UEB A;  4AG1 C;  1NPP A;  2H3J A;  1PC0 A;  2AZV A;  4M77 E;  3PTA A;  5IH2 A;  1JU5 C;  2EGE A;  4M75 D;  1KG1 A;  1N6A A;  4J83 A;  3A1P A;  2HSE B;  1YJ9 T;  2DIQ A;  1YHQ T;  2H8H A;  3OMC A;  1QVG S;  3CC4 T;  1FMK A;  3I56 T;  2OTL T;  1VQM A;  2PUK B;  1ZBJ A;  2EJ9 A;  2PU9 B;  4BDY A;  1GFD A;  4OMO A;  2RI5 A;  2DM1 A;  2V8J A;  1LCK A;  1Y0M A;  2J6F A;  2RK1 A;  2RJF A;  3ZEH A;  2AK5 A;  2VV5 A;  1K4U S;  2O4X A;  2CYZ B;  1ZUU A;  4LD9 K;  5FU6 B;  2E4H A;  3SWN B;  1YIT Q;  2ZCF B;  2K4Y A;  2KXC A;  3M0T A;  2NUT A;  1SRM A;  3JCM h;  2SRC A;  5HK3 A;  4L6V 5;  4M78 D;  5GAO n;  3CCV A;  4OMN A;  3M55 A;  2P0Q A;  3X28 B;  4IKF A;  2F5T X;  4PKC C;  1Q86 C;  4JS4 A;  1VQN T;  5AT1 B;  3CCU T;  3PIO A;  2BZY A;  1EX4 A;  3JSC A;  1W2B S;  1KFZ A;  5CKF A;  4FT2 A;  2ENM A;  1T3L A;  2P0K A;  1IRE B;  2XDD A;  4IIM A;  2J06 A;  3O8V A;  2O2O A;  1T0H A;  3OS0 A;  1G5V A;  2MMP A;  5GAN g;  2CUD A;  1H8K A;  3CCL Q;  3NTH A;  3JB9 J;  3VUZ A;  4RCB A;  3S3O A;  4NOY A;  1RAF B;  4C92 C;  3FJP A;  5GAN 8;  3E9F A;  5FWC A;  3SEM A;  1IGQ A;  5GAO r;  1YJ9 Q;  1WZO A;  1YWO A;  1ZBX A;  5J39 A;  3HRT A;  5KH6 A;  5GMK e;  1SEM A;  3QDF A;  5J3B A;  4E7H A;  3I56 Q;  2OTL Q;  2PNI A;  4JS5 A;  1I81 A;  4EPC A;  1Q7Y C;  3EGD A;  4M77 F;  5LL6 S;  4BI3 A;  1KK7 A;  2DAQ A;  5CKB A;  5KCH A;  3OYL A;  1UE9 A;  2EJF A;  2K9G A;  2VGM A;  1SHG A;  1YNZ A;  3CXC A;  2KXD A;  3OW2 P;  3EGX B;  2V1Q A;  2MI6 A;  3QYH B;  3GF5 A;  5FU6 C;  4AMC A;  3OYH A;  3SWN C;  5CQX A;  2NUP A;  5IXF A;  2RHX A;  1HYO A;  1M27 C;  3BY7 A;  1K73 C;  1OX9 A;  3GPL A;  5GAN 6;  1GCQ C;  5I21 A;  4M75 E;  3CC7 T;  5GMK l;  2XU8 A;  2MYS A;  2M16 A;  2OTJ T;  3CME A;  3CCU Q;  3MCA B;  3CEY A;  4C5H A;  1QVG A;  1PKS A;  1UGP B;  1AZG B;  4E6R A;  1G3T A;  2DD4 A;  1ZHI A;  3PVQ A;  4NL3 A;  1YIJ T;  2HBW A;  2FZK B;  4PFZ A;  3OYE A;  2A37 A;  4C5I A;  1YI2 A;  4HCB A;  2EIF A;  2MPX C;  3CCS T;  3CCE T;  1M2O A;  1OOT A;  2EQU A;  3UDC A;  1JJ2 A;  2XDB A;  4A54 A;  4RG2 A;  3OBW A;  5EC7 A;  2L3R A;  2DL8 A;  1CKA A;  1IGU A;  4TVR A;  5IN1 A;  2NUZ A;  1MMN A;  3MJX A;  1PRL C;  4M78 E;  3OS2 A;  2DO3 A;  2LQ8 A;  4N4H A;  4XTU A;  1Y7X A;  2KT1 A;  2E3H A;  2QGF B;  4DOW A;  1NJI U;  5CKD A;  2FG0 A;  4C8Q B;  1TUC A;  2JN0 A;  2KRO A;  1AEY A;  4RTW A;  2DFU A;  1W2B A;  3GNG A;  4FW1 A;  4GY5 A;  3A98 A;  3OYK A;  2CT3 A;  1V76 A;  1M8V A;  5CIU A;  1RAA B;  1BKB A;  3ULR B;  3Q1J A;  1VQL A;  3UPU A;  1W4S A;  3UA6 A;  3TVT A;  2LJ1 A;  4WTO B;  1LNX A;  2RF0 A;  2RNA A;  2DTI A;  1EFN A;  3MPU B;  4HVU A;  3OW2 S;  3TEE A;  4M7D B;  1N8R C;  4KUD K;  4E7S A;  5LJ5 e;  4KH0 B;  1UG1 A;  4PJO E;  2IPO B;  1G3W A;  1BI2 A;  1MHN A;  1UGQ B;  1XTD A;  2OTJ Q;  2OX7 A;  5GAM j;  1VQM T;  1WYX A;  1RLP C;  1W6X A;  2CRE A;  1QQJ A;  1WHL A;  3OS5 A;  3CPW S;  2MWP A;  3QHS A;  3SB2 A;  2E3I A;  3UA7 A;  4C0G A;  4C92 D;  1YIJ Q;  1M30 A;  3BW1 A;  2L3S A;  3CPF A;  1YIT A;  3BE3 A;  3CBP A;  2CUB A;  1PSE A;  5IT9 E;  3QUI A;  3CD6 A;  3CCQ A;  3CCS Q;  3FC3 A;  2QGG A;  1B34 B;  3RR6 A;  1VQ7 Q;  2JM9 A;  2JM8 A;  3CCV T;  1MV3 A;  1Y07 A;  2K5L A;  4M75 B;  5CK9 A;  1PHT A;  3OYJ A;  4OGC A;  2VXF A;  2HL3 A;  5GAM h;  2Y4X A;  2HDA A;  3EG0 A;  1FMV A;  4OMQ A;  4RCC A;  1FWZ A;  1NE8 A;  4PNO A;  3REB B;  4RMO A;  2KY9 A;  2VB6 A;  1SHF A;  4IUP A;  3EG9 A;  2WSF E;  4JRK A;  3QSU A;  4XQ3 A;  1QVP A;  1U1T A;  5LJ5 f;  4C8Q C;  1D3B A;  3HTR A;  4A4E A;  3NFC A;  4XAX B;  1IHV A;  2EPD A;  2M02 A;  2KRS A;  4NS5 A;  4KGV B;  4JRP A;  1K0S A;  2O9V A;  2FRY A;  2M9U A;  1M3B A;  1YHQ A;  5GAM e;  2E6Z A;  2EAY A;  5CR2 A;  1H3Z A;  2O88 A;  3CC4 A;  3H9N A;  3TU4 K;  2OTL A;  1XOV A;  4M7D C;  4B6M A;  2LT4 A;  1MNE A;  2VYT A;  3HKS A;  2LX9 A;  1BI0 A;  1VQM Q;  3L2W A;  1X75 C;  1TTH B;  2K7A A;  5GAN 2;  4ME7 A;  1VQ5 T;  2HZY A;  2NYS A;  1G83 A;  5KYY A;  1WHJ A;  2HSP A;  3QII A;  2FEI A;  3O5Z A;  4M7A B;  1BYM A;  4HVW A;  2RHI A;  4AFQ C;  1ZA2 B;  1UGV A;  3GLX A;  2JS2 A;  2WSE E;  2XKO C;  4PJO F;  5DLO A;  1JXM A;  5A0D A;  3V8K A;  4F7U G;  2EQK A;  4X9D A;  3CC2 T;  2QYZ A;  1KC8 C;  2D0N A;  3CCV Q;  3MO8 A;  4J6Y A;  2ABL A;  1N9S A;  2VAS A;  2KNB B;  3OW2 A;  1VQN A;  4XTZ A;  1FXX A;  1N5Z A;  3L1A A;  2RK2 A;  3TCJ A;  3BDL A;  3KXT A;  3JB9 G;  2J05 A;  4M75 C;  4QVC A;  1KSW A;  1X6B A;  3FIF A;  3U23 A;  2DXT A;  3OYA A;  4LDX A;  4E7J A;  2MIO A;  1N27 A;  1KQS P;  4BDZ A;  3S6W A;  4FSS A;  4QW2 A;  2B8A A;  3ZFJ A;  1FYN A;  1S72 T;  3HRU A;  4D8K A;  1TH7 A;  2DA9 A;  4C92 E;  4Z88 A;  2DIG A;  2ROL A;  1YBY A;  5GMK i;  3JB9 F;  2QTV A;  3MP6 A;  5LJ5 g;  1YI2 T;  2E10 A;  5I22 A;  4J5Y A;  4F7U A;  1C0M A;  2AKL A;  1K9M U;  2VGN A;  2BZ8 A;  3EFO A;  4AT1 B;  1UUE A;  1QWE A;  1KQ1 A;  1LJO A;  4CC2 A;  3WXM B;  4O6J A;  2O9S A;  1GCP A;  5KYX B;  2VKN A;  3PFS A;  1VQ5 Q;  4HCC A;  1Q86 R;  4LNP A;  3JCM Q;  1Y96 B;  1FMW A;  1UGS B;  2QQB A;  3OYD A;  5FU7 B;  3EG1 A;  5KE2 A;  1P92 A;  5CAI A;  4M7A C;  4E2F B;  1RL2 A;  1XQH A;  2EQJ A;  1H3H A;  1WX6 A;  2QEX T;  3HFO A;  4JJN K;  5L23 A;  3CC2 Q;  2VXE A;  2JT4 A;  4CC7 A;  1K0X A;  2MWO A;  3CC7 A;  2CS7 A;  2C06 A;  3C94 A;  1V29 B;  1TSF A;  2RHZ A;  4FYW B;  3I55 T;  1WJR A;  1GRI A;  3CME Q;  1WQ7 A;  1LPL A;  4C8Q D;  1YJN A;  2K5F A;  4BI4 A;  2HQX A; 
#chains in the Genus database with same CATH homology
 3MEA A;  1BIA A;  1YIJ A;  3M5A A;  4QQG A;  4FT2 A;  4MMK A;  5CKF A;  4WF2 A;  5LJ5 h;  4ATO A;  1N8R U;  2P0K A;  3LYI A;  4RG8 A;  3G4S T;  3OYB A;  2LC4 A;  1IRE B;  5GAN d;  2XDP A;  2XDD A;  1OI1 A;  4ZTJ A;  5GAM g;  2K3X A;  1M1K U;  1Q7Y U;  3M57 A;  3O8V A;  3CCS A;  3CCE A;  1KQS S;  3OS0 A;  2AHJ B;  3PMI A;  4CRI A;  3OB9 A;  2FL7 A;  4KT0 E;  3CCQ T;  1G5V A;  3QKJ A;  2MMP A;  4J8O A;  3OYI A;  2DTH A;  4N0A A;  5GAN g;  4A53 A;  3CCR T;  3R6O A;  3FB9 A;  2YLC A;  3JCM d;  1KD1 C;  3NTH A;  3JB9 J;  3VUZ A;  5D6Y A;  4RCB A;  3VKI A;  3S3O A;  1IZ6 A;  2I2L A;  4NOY A;  4PL6 A;  3LX7 A;  2L5Q A;  1VQ8 T;  4C92 C;  1G3Y A;  3V8L A;  2R5A A;  3FJP A;  5GAN 8;  3JAM E;  1K8A U;  3GIB A;  3E9F A;  4M75 G;  5GAO l;  1YJW T;  4LDW A;  3OYC A;  5GAO r;  3RKX A;  4XTV A;  4PJO A;  1ZBX A;  1X01 A;  5J39 A;  3HRT A;  3LGL A;  2L89 A;  4J6X A;  5KH6 A;  3DB4 A;  5GMK e;  1U8R A;  5J3B A;  3JB9 H;  4E7H A;  3A8H B;  3RKW A;  4M77 C;  4JS5 A;  5C6S A;  2A3L A;  4LDV A;  1I81 A;  2GQV A;  3E1S A;  3JRZ A;  4EPC A;  4JRQ A;  1VQ4 T;  1Q7Y C;  1WPY A;  4NL2 A;  4QVZ A;  2E70 A;  2EKO A;  5GAM f;  5LJ3 j;  3J81 E;  3J80 E;  3CXC S;  4LDU A;  5GAO p;  3VYG A;  1VQ9 T;  3GP8 A;  3KBG A;  2QQA A;  4M77 F;  5LL6 S;  4BI3 A;  5GAO m;  3CMA T;  2DAQ A;  3EFS A;  5GAN j;  5CKB A;  5IT9 E;  4JRI A;  5KCH A;  3HL8 A;  3OYL A;  3G6E T;  1VQP A;  1K8A C;  2QTX A;  1B34 A;  2EJF A;  4OMF B;  3JCM W;  2VGM A;  2P4T A;  4QQD A;  4C0Z A;  3CXC A;  5FU7 C;  5EG2 A;  4ZTF A;  3DB3 A;  2RB6 A;  3JCM V;  1QP2 A;  2MI6 A;  3ME9 A;  3QYH B;  4F7U E;  3GF5 A;  5FU6 C;  3OYH A;  3P8H A;  3SWN C;  1M1G A;  3OQ5 A;  2DJZ A;  2RHX A;  2P0P A;  4JDS A;  5CQX A;  4HA8 A;  3CD6 T;  1M1F A;  2QI2 A;  3X24 B;  5DY9 A;  4F7U B;  1Y71 A;  2XID A;  2KSS A;  3BY7 A;  1BIB A;  4EMG A;  1M4Z A;  5FRO A;  3GPL A;  5GAN 6;  1K73 C;  5HY6 A;  2RO0 A;  1R8O B;  3V7R A;  4DOV A;  5I21 A;  4ZGJ B;  3L42 A;  4M75 E;  4BE1 A;  3CC7 T;  4LD6 A;  3NTI A;  3OMG A;  2LDM A;  5GMK l;  1QVF S;  2KDS A;  2BIV A;  2XU8 A;  3RES A;  2M16 A;  4Z02 A;  2OTJ T;  3CME A;  5CO7 A;  3MCA B;  2CZ1 B;  1OZ2 A;  3P8D A;  3CEY A;  4P5N A;  1XNI A;  2GFU A;  4A4F A;  4C5H A;  3LWI A;  1UGP B;  1QVG A;  1M90 C;  5LJ3 h;  5CVI A;  3VUB A;  3OYN A;  3WVE B;  4M7A G;  4OB1 B;  4DQ2 A;  4QVD A;  2KK4 A;  2HD0 A;  1G3T A;  3MEU A;  4BAC A;  1VIE A;  3S3N A;  4HCZ A;  2DD4 A;  2JZ2 A;  2PVD B;  1ZHI A;  5GAN h;  3L2Z A;  3QJY A;  1UB4 A;  2MAM A;  4ZN3 A;  4NL3 A;  1YIJ T;  1JJ2 S;  3C12 A;  2QA4 A;  4R56 A;  3HSB A;  3OYE A;  5L8R E;  3LH0 A;  3V7C A;  4IUQ A;  1EIF A;  5GMK m;  3L2Q A;  1JB0 E;  4C5I A;  2X4X A;  4KUI A;  1YI2 A;  4BB7 A;  4HCB A;  3DLM A;  2CZ7 B;  2EIF A;  1YCY A;  2K3Y A;  3KUF A;  3CCS T;  3CCE T;  2QQR A;  1WNL A;  2EQU A;  3UDC A;  1VQO T;  1JJ2 A;  4CI0 C;  2O01 E;  3H6Z A;  2XDB A;  4A54 A;  3CCL A;  2E1H A;  4RG2 A;  4J7I A;  3OBW A;  2O4X B;  4J6W A;  2L3R A;  3JCM X;  4XTY A;  4IUV A;  4FSX A;  3L2V A;  2KAF A;  3LLR A;  4TVR A;  3SDZ A;  3X25 B;  5IN1 A;  3OSS C;  4II1 A;  3VJP A;  1YJ9 A;  2X4W A;  4FM4 B;  4M78 E;  5LJ3 e;  3OS2 A;  2DO3 A;  3OA6 A;  2GFA A;  2RHY A;  3SD4 A;  3A8L B;  2JUF A;  2LQ8 A;  3JCM J;  2A7Y A;  3M9Q A;  4N4H A;  4B9W A;  3OYM A;  4XTU A;  1Y7X A;  5GAM d;  4M7A A;  4M7A D;  4M78 B;  3I56 A;  4C8Q E;  5FLX E;  2K2V A;  2ZGW A;  4DOW A;  1DJ7 B;  1NJI U;  3C95 A;  4XU0 A;  5D6X A;  5CKD A;  2DZC A;  3VV0 A;  4C8Q B;  2JN0 A;  2EJG A;  1I4K 1;  3OS1 A;  3FDR A;  3CCM A;  1W2B A;  3GNG A;  2LTO A;  1X6O A;  3JCM e;  4GY5 A;  3OYK A;  3JCM c;  1M8V A;  4GLK A;  2E12 A;  1FX7 A;  5CIU A;  1BKB A;  4C92 G;  3Q1J A;  2GF7 A;  2K5I A;  3GNF B;  4IUR A;  1VQL A;  3UPU A;  1W4S A;  3HHT B;  3EAE A;  3M4G A;  3TRE A;  2JTM A;  1NZ9 A;  3PNW C;  3ZBD A;  2DK3 A;  2RH2 A;  2Y4Y A;  3PMT A;  4E7I A;  1KQS A;  4BE2 A;  3E9G A;  3P8B B;  4M7D E;  4MDX A;  1LNX A;  3HFN A;  5HK0 A;  1Q81 U;  2DTI A;  1VQK A;  4BD3 A;  4X34 A;  1I5L A;  4FIB A;  4R55 A;  4BE0 A;  2YLB A;  4M77 G;  4X9C A;  5GAN 5;  3QDR B;  3TEE A;  3OW2 S;  4E7L A;  3NTK A;  4M7D B;  3FLG A;  4C92 F;  2RJE A;  1N8R C;  1N9R A;  1WQW A;  4KUD K;  4VUB A;  5LJ5 e;  2JNG A;  3JCM b;  2RJD A;  3G71 A;  4V2S A;  3N5B B;  2CZ0 B;  2E5Q A;  1M1K C;  5CKE A;  4PJO E;  1G3W A;  4KBM B;  1BI2 A;  1MHN A;  1UGQ B;  1XTD A;  3MP1 A;  3OY9 A;  1VQ5 A;  2R5M A;  3HP9 A;  2QQ9 A;  3QZ9 B;  5GAM j;  2R58 A;  3CCJ T;  1VQM T;  3CCU A;  5GAO q;  4OB0 B;  4PJO B;  3QPH A;  5I2S A;  3CME T;  3PIP A;  4F7U F;  3INZ A;  4XTX A;  3OS5 A;  3DKM A;  2HBP A;  3BDU A;  3CPW S;  2MWP A;  2RD1 A;  3QHS A;  3SB2 A;  3QO3 A;  4C0G A;  4C92 A;  4C92 D;  2EYQ A;  4ZGE B;  1HXD A;  4B9X A;  3QJ6 A;  4EMH A;  3BW1 A;  4YTL A;  4KUL A;  1WJS A;  3CPF A;  2LNV A;  4ZN1 A;  1YIT A;  3UT1 A;  3CBP A;  3CPW A;  1PSE A;  2XI9 A;  3LGF A;  3QUI A;  3E19 A;  3G4S A;  1OZ3 A;  3CCQ A;  3FC3 A;  2QA4 T;  3CC2 A;  3CD6 A;  3C4S A;  2CKK A;  2DEQ A;  1O75 A;  4M77 A;  4M77 D;  4N4I A;  5GAN 7;  2WSC E;  2KQW A;  1B34 B;  2G3R A;  2NLU A;  3ASK A;  4OVA A;  5A0G A;  3T9N A;  3RMS A;  3URG A;  2ZPG B;  3CCV T;  1YJW A;  1Y07 A;  2F69 A;  2DD5 A;  2K5L A;  4BI8 B;  4OB2 B;  1JBM A;  4M75 B;  3HRS A;  2DPP B;  5CK9 A;  2QQS A;  3JCM P;  1HK9 A;  3OYJ A;  2VC8 A;  4OGC A;  2VXF A;  2FVU A;  1Y96 A;  2LT1 A;  5GAM h;  1G3S A;  1BI3 A;  1YJN T;  1QVF A;  2Y4X A;  2M1H A;  1VQ4 A;  3F70 A;  1UGR B;  4RCC A;  1FWZ A;  2E65 A;  1S72 A;  1NE8 A;  4PNO A;  4O5V A;  4M78 C;  2R57 A;  4A4K A;  4RMO A;  2KY9 A;  1M9S A;  3LWH A;  1VQ9 A;  3AHU A;  2DXC A;  3SWN A;  4IUP A;  3QSU A;  2WSF E;  4JRK A;  4C0F A;  4XQ3 A;  1QVP A;  2JOY A;  3CBM A;  3MP8 A;  1U1T A;  2ZPH B;  2GCX A;  3SFM A;  5GMK j;  3RKY A;  5A0L A;  4C8Q C;  1D3B A;  4L5G A;  4MZP A;  5LJ5 f;  4FU6 A;  4A4G A;  3QBY A;  5J26 A;  5DLQ E;  5HKC A;  1Q86 U;  4A4E A;  2LCC A;  3VU3 C;  3NFC A;  5FRN A;  2KMT A;  4XAX B;  4BY6 B;  3UWN A;  2RA2 A;  3J7A F;  4E7K A;  2ZPE B;  3V7S A;  4ELY C;  2CGH A;  1Q82 U;  1VQL T;  1QP3 A;  2V8K A;  4NS5 A;  2IVW A;  3MET A;  2YRV A;  4EDU A;  4JRP A;  4N4G A;  2X4Y A;  2M9U A;  1YHQ A;  5GAM e;  2E6Z A;  2EAY A;  3A8M B;  5GAN 3;  5CR2 A;  1H3Z A;  4EMK B;  5IAY A;  1VQK T;  3DLL A;  3FEO A;  2IG0 A;  3MEW A;  3CC4 A;  1RI0 A;  4XU3 A;  5FRM A;  3TU4 K;  5GAN e;  2ZPI B;  2OTL A;  1XOV A;  2LCL A;  4XK8 E;  4M7D C;  4N0A C;  2LT4 A;  1PSF A;  2VYT A;  2FB7 A;  2PVG B;  2XIC A;  4IUU A;  1H64 1;  2L8D A;  3HKS A;  2LX9 A;  3QZ5 B;  4UC4 A;  4C5E A;  2KVQ G;  1BI0 A;  1KC8 U;  2OTJ A;  3M59 A;  1VIF A;  1X75 C;  4XU2 A;  3L2W A;  1KD1 U;  2LRQ A;  2HAX A;  1VQ6 A;  5GAN 2;  1KHC A;  4ME7 A;  1VQ5 T;  4OP0 A;  4M7A E;  3FRN A;  3L2U A;  2DXU A;  2VUB A;  4HKE A;  4M7D F;  3PT9 A;  3X26 B;  3EFR A;  3QII A;  1ZQ1 A;  4PJO C;  3A8G B;  5D6W A;  4M7A B;  3M58 A;  1BYM A;  1NPR A;  3RUX A;  4JUV A;  5GMK h;  1BI1 A;  2RHI A;  4MZM A;  5C0M A;  1VQP T;  3OYG A;  4OGE A;  3GLX A;  2WSE E;  2QEX A;  2E41 A;  2X4J A;  2XKO C;  5M9O A;  5GAN 4;  3WVD B;  4C0D B;  5LJ3 g;  4IUT A;  1LOJ A;  1WGS A;  4PJO F;  4HT8 A;  2CZ6 B;  4HT9 A;  5DLO A;  1YIT T;  4OB3 B;  4JLI A;  4MML A;  5A0D A;  3V8K A;  4MZT A;  1VQO A;  4F7U G;  1KHI A;  2X35 A;  2EQK A;  2E6N A;  3BFM A;  2OAU A;  3M56 A;  2YHT A;  2DZ9 A;  4X9D A;  4BUG A;  1U1S A;  4XU1 A;  1NJI C;  4M7D A;  1KC8 C;  4M7D D;  4DA4 A;  2M0O A;  5KCO A;  1SSF A;  3LW5 E;  2D9T A;  3MO8 A;  4Y91 A;  1VQ7 A;  4J6Y A;  2FHD A;  2FYK A;  3I55 A;  1N9S A;  4D6W A;  3RMQ A;  3OW2 A;  2DKG A;  2Y90 A;  1QW1 A;  1VQN A;  4XTZ A;  1FXX A;  2XK0 A;  3L1A A;  3JCM g;  4Q5W A;  2F5K A;  2RK2 A;  3TCJ A;  3V8J A;  3BDL A;  1O9S A;  4FT4 A;  3QG1 A;  3RIR A;  3KXT A;  3H8Z A;  3JB9 G;  4PJO D;  4M75 C;  4QVC A;  2E64 A;  2D6F A;  3A5Z B;  2HNI A;  3FIF A;  2V8I A;  2DXT A;  3OYA A;  4LDX A;  4Y28 E;  4E7J A;  3S3M A;  1Q81 C;  1N27 A;  4RKU E;  3S6W A;  4A4H A;  4BDZ A;  4QW2 A;  1I8F A;  2B8A A;  4PLL A;  3ZFJ A;  5LJ5 d;  5LJ3 f;  1K73 U;  1S72 T;  3HRU A;  4M75 F;  1VUB A;  2QXF A;  1TH7 A;  2DTO A;  2PUO B;  4C92 E;  2DIG A;  2PQW A;  1YBY A;  3QXE B;  5GMK i;  3CCR A;  3JB9 F;  3MP6 A;  3VYH B;  2WAC A;  2E10 A;  5LJ5 g;  5GAN f;  1YI2 T;  3PGG A;  2XG8 D;  3OBY A;  3M54 A;  4C5G A;  4J5Y A;  4F7U A;  3M4Y A;  4C92 B;  5CCA A;  1VQ8 A;  4FL6 A;  1M90 U;  3GOX A;  1WJQ A;  3CCL T;  1UEB A;  2RM4 A;  3A8O B;  2JVV A;  3MHX A;  4BY6 C;  4ELZ C;  1NPP A;  2DXB A;  1K9M U;  2XD0 A;  2H3J A;  4JLG A;  2QDY B;  2VGN A;  3JCM f;  2BKD N;  4M77 E;  3PTA A;  3JB9 I;  4M75 A;  4M75 D;  1KG1 A;  1N6A A;  4J83 A;  1YJ9 T;  4PLI A;  2DIQ A;  2D0Q B;  1YHQ T;  4M77 B;  4L59 A;  4OF1 A;  3OMC A;  1KQ1 A;  3OYY A;  4M78 G;  5CQY A;  1LJO A;  3G71 T;  3JB9 D;  4LDY A;  3RER A;  1JRI A;  3WXM B;  4O6J A;  4EMK C;  2RI2 A;  3CC4 T;  1QVG S;  2K57 A;  3G7Z A;  3I56 T;  2OTL T;  3HPW A;  3CCJ A;  2DVE A;  3PFS A;  1VQM A;  2PUK B;  1OYX A;  2EFI A;  4C8Q G;  1KQ2 A;  2EJ9 A;  4HCC A;  2ZZD A;  2XHC A;  2PU9 B;  4BDY A;  3CMA A;  5A2Q E;  2RI5 A;  3JCM Q;  1Y96 B;  1VQ6 T;  3G6E A;  3CCM T;  2V8J A;  5LJ5 j;  1UGS B;  2QQB A;  4M78 F;  3OYD A;  4E47 A;  5FU7 B;  2RHU A;  2RK1 A;  2RJF A;  3ZEH A;  1K9M C;  5KE2 A;  2VV5 A;  1P92 A;  2O4X A;  5AYF A;  2CYZ B;  4J7F A;  4ZGD B;  5CAI A;  1M5Q 1;  3OYF A;  4M7A C;  4LD9 K;  5FU6 B;  1RL2 A;  4C8Q F;  2HQE A;  3SWN B;  1XQH A;  2EQJ A;  2ZCF B;  2EWN A;  2QEX T;  2K4Y A;  3HFO A;  4JJN K;  3ER0 A;  3MEV A;  5KE3 A;  2JTF A;  2ZPF B;  4M7D G;  2VXE A;  1D3B B;  4C0D C;  2BUD A;  2ZPB B;  4M7A F;  3JCM h;  4EMK A;  1MGQ A;  2MWO A;  2PVO B;  3CC7 A;  2CS7 A;  5HK3 A;  4L6V 5;  4QQ6 A;  3X20 B;  2MF2 A;  4M78 D;  4M78 A;  5GAO n;  3CCV A;  3CBO A;  3M55 A;  2EQM A;  2P0Q A;  3X28 B;  2C06 A;  3CC2 T;  3C94 A;  2RI3 A;  4MDW A;  4IKF A;  1AHJ B;  1V29 B;  2F5T X;  2LQK A;  1VQ7 T;  2RHZ A;  4PKC C;  1WJR A;  3I55 T;  4PJO G;  4C8Q A;  1WQ7 A;  4C8Q D;  1Q86 C;  4XTW A;  4JS4 A;  1VQN T;  3CCU T;  3OSV A;  2RJC A;  3PIO A;  1YJN A;  3QYG B;  5CKH A;  2LVM A;  3L2R A;  2K5F A;  4BI4 A;  5I2M A;  1Q82 C;  3JSC A;  5LJ3 d;  3M53 A;  5DM7 R;  1W2B S;  1GXI E;  2HQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...