1ZHIA

Complex of the s. cerevisiae orc1 and sir1 interacting domains
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
195
Chain Sequence
GWEIITTDEQGNIIDGGTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the Sir1-origin recognition complex interaction in transcriptional silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/replication
molecule keywords Origin recognition complex subunit 1
total genus 50
structure length 195
sequence length 205
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zhiA00
4DOVA 3PT9A 1M4ZA 4KUDK 4JJNK 4FT2A 4BB7A 4KULA 4KUIA 4FSXA 3TU4K 1W4SA 2FVUA 4FT4A 3PTAA 4LD9K 4DOWA 2FL7A 4DA4A 1ZHIA 1ZBXA
chains in the Genus database with same CATH superfamily
1QCOA 1Q81U 1WX6A 1SG5A 2ROTA 2NUTA 4CC3A 2QQAA 2ZPEB 2QQSA 2LP5A 3TQ7P 4PJLA 1GCQC 2D8JA 2QQBA 5CKFA 2M0YA 3JRZA 4M77B 1JB0E 4AMCA 3C95A 4HVUA 4M4ZA 3FDRA 1X75C 5GAMd 2M51A 3KFVA 4JS4A 4J9DA 2YRCA 4M77F 2FZKB 2E3IA 1ZSZA 3CXCA 2OTLQ 2LT4A 1XNIA 1T0HA 2VKNA 1VUBA 3E9GA 5D7UA 2CZ0B 2L2PA 1MMAA 3Q1JA 4HVVA 3DB4A 3VJPA 2QA4A 4LNPA 4IIOA 2OJ2A 1UGQB 4M78G 1JJ2S 4RTZA 4FSSA 1FX7A 1VQ7Q 3JCMX 4BDYA 4D6WA 3OBWA 3OYNA 4XQ3A 1E6GA 1M9SA 3VS0A 3CPWS 1QCFA 3VU3C 1MV0B 3EFOA 4RKUE 1ZQ1A 4R55A 1UB4A 2Z0WA 2GF7A 1AOJA 2P4TA 2RI2A 4F7UA 4XU3A 1YJWT 4C5IA 2D8HA 1WPYA 2QQRA 4VUBA 4HCCA 4TVRA 3NPFA 1PNJA 2KAFA 2RJDA 2G6FX 2PUOB 2KI7A 5KYNA 3OYBA 3L2VA 4F7UF 2CT3A 5GANf 1YJWA 1T3SA 2K3BA 2NUZA 4XTUA 3CC7Q 1R0BG 1WJSA 4DBQA 3UATA 1VYTA 3J81E 4F7UB 1QMCA 3OW2S 2KT1A 4J6XA 1VQ7A 3A8MB 1QVFS 3P8BB 2VGMA 4PJOD 4PJOG 2HQXA 1GFCA 1SF9A 4QVDA 1JJ2P 1TH7A 1CKBA 5LJ5g 4GLMA 5GAOm 4E47A 5KCHA 3LWHA 3HL8A 3TSZA 1KK7A 2ZPGB 2FG0A 4M7AA 2A0FB 2LQNA 2RA2A 3QHSA 2O88A 3C94A 1VQMT 4EMHA 1WGSA 2EGCA 2WSEE 1VQLQ 2D1XA 3EG9B 1VQ8T 4Z89A 1M30A 4LDYA 2RI3A 3PIOA 4WTOB 1OU9A 3FB9A 4CI0C 3PGGA 2EWNA 5IXBA 2RH2A 1UE9A 4HT9A 3LH0A 1CSKA 1YP5A 4C8QD 1G83A 3WXMB 4BE1A 3L2QA 1KG1A 2MF2A 1YI2Q 2VASA 3S6WA 2HKNA 4NS5A 1KC8C 3EG9A 2DL4A 2X9HA 2V1QA 2CP5A 1NYFA 3MP8A 5DY9A 2LC4A 4E6RA 3V8KA 3CCET 3CQTA 5FRNA 1MMDA 5CR2A 2YUPA 5DLOA 4M78D 3CC7A 4C5HA 3V8LA 3G6EA 1O75A 3JCMg 1RAIB 1K8AU 2K3YA 4KT0E 4EMGA 3OS0A 5AT1B 2IG0A 2M9UA 1N8RR 3EAEA 1I5OB 4DQ2A 2RN8A 4F14A 5GANg 5CCAA 1K9MU 3CD6Q 2M0OA 5AYFA 3VS1A 1VQ5T 5GAN5 2XIDA 2CP6A 3MP6A 2QAZA 1D1BA 4M7AC 1VQPQ 5FWBA 2KYBA 4M78A 3JCMJ 1RAFB 2VWFA 1G5VA 3O5ZA 4N4GA 5GAMg 5A2QE 3JCMW 3CMEQ 1X43A 2X4XA 3GLXA 4OB2B 4NL3A 3OS5A 1VQOT 1W2BA 4BY6C 3A98A 2DTOA 5FWCA 3OYEA 1VQPT 3JB9H 2FB7A 1WXBA 3KUFA 3RKWA 1M3BA 4M75B 2LQ8A 3OYDA 2CUDA 1W1FA 2V8KA 1Q81R 2PU9B 4O5VA 5KYUB 5LJ3e 2K5FA 5CVIA 2FYKA 2VV5A 1SRLA 4M78B 2X3XD 4C92B 3TVTA 3HP9A 2DKGA 3J7AF 4CRIA 2K6DA 1K0XA 1KJWA 3RKYA 1LNXA 2JXBA 2DVJA 4E7HA 3E9FA 4Q5WA 5GANe 2A7YA 2A37A 3JCMQ 3VV0A 5EC7A 3CCEQ 2E12A 2F2VA 4JJNK 1GBQA 4MDWA 3WVDB 1KHIA 3MO8A 3CBMA 3NGPA 2B86A 3R6OA 4MZPA 4MZTA 3M5AA 3ME9A 4FM4B 5LJ5j 3META 2CS7A 3PE0A 4AG2C 3OYFA 4LE9A 4FL6A 4PJNA 3CMAQ 3RERA 5GMKm 2CP7A 3L2UA 1UFFA 2R5MA 3G4SQ 4BI3A 2EW3A 1WHJA 3M55A 5L23A 2HSPA 3VS6A 2I0NA 5I2MA 2ECZA 2KRMA 1X2KA 2ESWA 1UGSB 1WA7A 2DZCA 3MEWA 1M2VB 1VQLA 3JCMb 4M7DE 4IUVA 4N4IA 3JB9G 2XHCA 2L0AA 1I5LA 3RNJA 4RCCA 2OAUA 4J7IA 2O9VA 4D8DA 3QIIA 3EGDA 3CMAT 3HHTB 2DL8A 4M75F 3P8DA 4PJMA 1M2OA 2P4RA 4M7DB 2HL3A 3LYIA 3I9QA 1VQNA 5A0GA 2YHTA 4C92G 1P92A 2H3EB 7AT1B 3VUBA 1C1AA 3O8VA 4E7SA 2BZ8A 4C8QF 1MV3A 4HCZA 1A0NB 4E7LA 2JVVA 5I11A 1ZUUA 3CXCS 3ZL7C 1AWXA 1HXDA 3TREA 3QWXX 2LNHB 1D09B 1Z9ZA 3BE3A 5GANd 5GANj 1W70A 1YHQT 1G3YA 3CMAA 2OTJA 4JZ3A 1GRIA 2EGAA 2NYSA 4HXJA 3CMET 3EGXB 3VS7A 2DVEA 5HCKA 3V7SA 5C6SA 2ZPBB 8AT1B 2K79A 3OS2A 3OS1A 9ATCB 3OMGA 4O6JA 2RNAA 2LJ3A 1YBYA 2RHXA 3GBQA 4KUIA 1NJIR 2CP3A 2KRSA 1UHCA 2W0ZA 2K3XA 4JUVA 2EQMA 2YT6A 3PVQA 2J6OA 1RI0A 3M0TA 1NEGA 2RJFA 1K76A 3DKMA 1VQ6T 4M7DA 2PQWA 1VQ4T 3S3OA 3SEMA 1OEBA 4DBFA 4C5GA 2MPXC 3NTKA 2X3WD 4LDWA 1SHGA 2EQJA 3I56T 4J9FA 1IRXA 1TSFA 5LJ5f 3P8HA 3JCMh 4LD6A 1Q86U 4FCYA 2DBKA 1NPPA 1IGQA 1M8MA 5GAOq 1CKAA 5GAN4 3G1JA 5LJ3d 4AG1C 1HK9A 2Y90A 2AZVA 4L5GA 4PJOF 2QASA 3TU4K 2KYMA 1Y0MA 1ARKA 2RQVA 2IIMA 3UF4A 2WSCE 2K9GA 2F2XA 1O9SA 5GAMh 2BZXA 3OYMA 3BW1A 3G71Q 3CPWP 3UDCA 1KQ1A 1KD1C 3QZ9B 2RK2A 2L3PA 2HSEB 2ZAEA 1PSFA 4CC2A 3CCLQ 2BKDN 3E1SA 2M02A 4M77C 1ZX6A 3HTRA 4FW2A 5GANh 2KQWA 4FW1A 2A36A 5KCOA 2GTOA 3MEUA 3MHXA 1UEBA 2RQRA 1YHQQ 3JCMV 1HSQA 1AEYA 1BU1A 2DIQA 2SRCA 4RTYA 2COWA 2ZGWA 3FEOA 2RMOA 2DL3A 2EQUA 1TU0B 3PVLA 1HD3A 1IB8A 2E64A 5KE2A 2KK4A 4M75C 2LJ0A 1F1BB 2CP0A 4BD3A 2FL7A 1UTIA 2AT1B 3U23A 1PCXA 3G4SA 2CT4A 3V8JA 2J6FA 4BY6B 4JZ4A 2KR3A 1OZ2A 3M9QA 4J6YA 3DLLA 1NE8A 1PRLC 4JPBW 3EFRA 2DLPA 4C5EA 3JCMe 4E7IA 2RHZA 1IXDA 3ZEHA 1VA7A 4FYVB 4YTLA 4PJOB 3LLRA 1VQKA 1B34B 1Q7YR 4M7DD 3HSBA 3EG0A 2XICA 1KFZA 3QSUA 2YDLA 3CMEA 1BBZA 4E7ZA 1R8OB 4M77A 4N4HA 4JRPA 1Y71A 2GTJA 4AFSC 4LXCA 3CCQQ 3UA7A 1V1CA 1OI1A 1M90U 3G4ST 2W10A 4C8QG 5HKCA 2QEXA 2H3JA 1RABB 3QJ6A 2EQIA 4IIMA 1YITQ 5GAOl 3CCRQ 4M7AD 1XQHA 1TUGB 3C0CA 2CUBA 5KYXB 1YJ9T 3HPWA 4A54A 2LQWA 1AWWA 4B6MA 4F04B 5GAMf 3A8LB 2RHIA 2HBPA 2NUTB 1VQKQ 1EZZB 2JMAA 4XU2A 3BDLA 3VS5A 5L8RE 1YJNA 2P0KA 3E19A 3VRZA 1LVKA 1N6AA 2HBWA 4E7JA 2R58A 3M57A 4DBRA 2D0NA 4DOWA 4M7AE 1U8RA 2C0TA 2DYBA 2LVMA 4C0FA 2RHUA 1VQ9Q 3H9NA 3VS3A 1DJ7B 3RMSA 4AFUC 2DO3A 1I4K1 2KT8A 1ZSZB 1QCNA 4PJJA 4KGXB 2JTMA 4M77G 4X1VA 3J80E 1WIEA 2YSQA 5HK3A 4A53A 1IGUA 1YCYA 1B3QA 2EQKA 1TUCA 1WYXA 1AWOA 2O31A 2MI6A 1Y96B 4KBMB 1RL2A 1U1TA 1QVFA 3L2WA 1U3OA 4N0AC 4OGCA 2RM4A 3REBB 4RMOA 5FLXE 2CP2A 2R5AA 1OYXA 5KYUA 3OBYA 4LDVA 3A1PA 2E6ZA 2DRKA 4PFPA 5LJ3f 3HRSA 3FJ5A 2BZYA 4M77E 2XMFA 2HAXA 2K2MA 1M5Q1 4DOVA 3A8HB 3VS4A 5GAN3 2VGNA 5KYYA 4RTUA 2O2OA 3JSCA 6AT1B 4XU0A 3H0IA 3RKXA 3EG1A 3QDFA 4D8KA 1EX4A 2MOXA 3OYJA 4V2SA 1V29B 4IUQA 1K1ZA 2HQHA 2HZYA 4RCBA 3M59A 4J5YA 4FU6A 4II1A 1LOJA 4KGZB 3ER0A 3H6ZA 1WI7A 1M3CA 1YI2A 3DB3A 3VYHB 2LJ1A 3UA6A 1MHNA 1RACB 5CO7A 2J05A 5KYYB 4QVZA 1YWPA 2MWPA 1K73U 2EJ9A 4C92F 3OYYA 1AZEA 4BI4A 5CKEA 2F5KA 1MGQA 1WHKA 3GNFB 3HFNA 3GPLA 1VQ8Q 4J9BA 1QWFA 1D1CA 1Q82U 2DILA 2KSSA 1IO6A 4XK8E 1X27A 5D6WA 2RQUA 2EKHA 4JRIA 4C8QC 5DM7R 2V8JA 5DLQE 2KROA 3EGDB 2LCCA 2LQKA 3E2UA 3LX7A 4L6V5 5A0DA 4JJBA 1S72T 1MMGA 3GNGA 4RTXA 1ZLMA 2DD5A 4ZN3A 3CCVA 1YFNA 1VQKT 1YIJA 1H92A 4EMKC 4GY5A 3M53A 4NOYA 1Y96A 3LGFA 5J39A 1G3WA 3ASKA 5EG2A 1PWTA 2LT1A 4BB7A 4Y92A 1YJ9Q 4BE0A 1PC0A 2DM1A 5GAOp 3I5SA 3I56Q 1E7OA 1W6XA 4MMLA 1VQ9A 1WHHA 3CCRT 5FU7C 1QKXA 2Y4YA 5CQYA 1Q86C 4Z88A 4BACA 1IHVA 2JTFA 2D9TA 4X34A 1H641 4IUPA 2H8HA 2LCSA 4HKEA 3TCJA 1JXMA 1PD0A 4JLGA 4MMKA 1RLQC 5CIUA 2EAYA 4KRTA 2YUQA 3M0UA 3URGA 2CGHA 4Y91A 3AT1B 5IHNA 1WJQA 5GAOn 3OYCA 2DFUA 2E4HA 2XDDA 1OPLA 1OULA 1WQWA 4JRKA 1YJNT 3ZFJA 2K7AA 1UDLA 2JS0A 5IAYA 2ABLA 2RQTA 4A63B 3IQLA 1WJRA 4RTWA 4XTXA 1KD1U 5D6YA 2F5TX 3CPWA 1WLPB 3JCMf 2GFUA 3T9NA 3VYGA 1Y7XA 2OTLT 2XG8D 3C4SA 5GAN8 1UHFA 3OW2A 1IZ6A 3QDRB 1LPLA 2GFAA 2ZPFB 3QYHB 4OMFB 1VYUA 3ULRB 5LJ3j 1M8VA 4ME7A 2DEQA 1ZUYA 1Q81C 1RLPC 5HY6A 2HCKA 4M77D 2IVWA 4J9EA 3CCUT 2FZCB 3M58A 4PK4A 2L3RA 3CEYA 2DNUA 4LDXA 2D0QB 1D3BB 3M0RA 5KH6A 1Z9QA 1VQPA 2LZ6B 4ELYC 4M78E 5GJVB 3FJPA 4QW2A 3CXCP 2YWWA 2KXDA 2VC8A 4PFZA 3WVEB 4FYYB 1S72Q 1NYGA 4M75E 2LTOA 2L5QA 1WDXA 2EYZA 1VQ4A 2JM8A 4QVCA 5CKDA 4FYWB 5LJ5h 3EG3A 4LD9K 1NEBA 4Z8AA 1WHGA 1QVPA 3MKDA 3EGUA 4JLIA 1GBRA 2DTIA 3CCUA 1AZGB 1LCKA 2M1HA 2WSFE 2MYSA 3QPHA 1J3TA 4IUTA 3CCVQ 4JRQA 2X4JA 2LRQA 4QKUA 2QDLA 1VIEA 4A4FA 3CCST 3G7ZA 1M4ZA 1OU8A 2EKOA 3CCMQ 3JAME 2JMCA 1BK2A 1EFNA 1VIFA 3QWYA 1WHLA 2E5QA 5M9OA 1QVGA 4LN2A 1Q82R 2GCXA 2JM9A 1PD1A 1JU5C 3LGLA 1VOMA 1PKSA 1IREB 2LDMA 3H8ZA 3M0QA 3JCMc 2DRMA 2JTEA 4EPCA 2FRYA 3VS2A 4PJOC 3CCQA 3JB9I 3NTHA 2EYQA 1M1KC 2LX7A 1QQJA 4AFQC 4FSXA 2OI3A 2KXCA 2NWMA 1X2QA 2E3HA 1V76A 2O4XB 1JO8A 1QVFP 5D6XA 1ZSGA 4HVWA 3OYAA 4ZTJA 1I0CA 2DERA 1RAGB 4KH1B 4Y28E 2K57A 2WACA 4ORZA 4RG2A 4LUDA 2DXCA 2VYTA 1BI1A 1U5SA 1RAHB 4KGVB 1NPRA 3NHNA 1BI0A 3OQ5A 1D0XA 4OB0B 1GCPA 1KC8U 1KQ2A 2K5LA 3EH1A 3OYIA 3CCMA 3RESA 4ZGEB 2DBMA 2XI9A 4KULA 3CD6T 1QP2A 3CBPA 4J7FA 2E70A 4DEYA 5IHIA 1NJIC 3CPFA 4J9IA 4J9GA 1XJWB 1FXXA 1PM3A 2KE9A 3OW2P 5I22A 1R0CB 2EVRA 1K8AC 2BTTA 3M56A 1NM7A 1YJ9A 2EFIA 2DXBA 4CC4B 2FZGB 1K73R 2HKQB 4ANJA 3VUZA 1GCQA 2VUBA 2FVUA 1OOTA 2L3SA 3L42A 4EMKB 1OX8A 2DA9A 2COZA 2XDPA 5CQXA 2ATCB 4XTYA 1U1SA 2DX1A 3TSWA 1YITT 4R0KA 3NFCA 1K9MC 1M90R 4C0DB 2ZCFB 2DJZA 1BI2A 2DYIA 3RIRA 1MNDA 4XAXB 3CCQT 1Y07A 5LJ3h 3CCEA 3OYHA 3CC4Q 1UGVA 5I2SA 2KGTA 1NG2A 8ATCB 4RUGA 2KY9A 2YRDA 1N8RC 3BFMA 2P0QA 4M7AG 2QTVA 1N5ZA 2BUDA 5GMKl 3SB2A 2IPOB 3SFMA 5GMKi 4AFZC 4KUDK 1D0ZA 5KE3A 2CREA 2DEUA 2EIFA 3G6ET 3F70A 2A3LA 2AKKA 2AIRB 3H0FA 4PJOA 3GF5A 1OQKA 4HCKA 3C12A 3QUIA 1G2BA 4ZGDB 1VQNT 2HMAA 1H3ZA 3OYGA 1I81A 1NBEB 3R6NA 1I1JA 2CSIA 2RB6A 5LJ5d 4E2FB 1X6GA 2QXFA 4A4EA 5FU6B 3EG2A 3M54A 1NLOC 1Y57A 1OX9A 3M0SA 1BYMA 4F7UG 2JS2A 3CC7T 4JJCA 3HFOA 2NLUA 2COYA 4F17A 1KQSA 1KHCA 1K8AR 1K0SA 3GOXA 2HEQA 4X9DA 4KH0B 1YITA 2DMOA 2XD0A 1M27C 3FRNA 1WXTA 4OF1A 4XTVA 5C0MA 3S3MA 1RI9A 2PVGB 1ZA2B 2ZZDA 3REAB 3QYGB 3MCAB 1UUEA 1VQOA 2QEXT 2HD0A 1UJ0A 2XU8A 3EFOB 2JUFA 2QTXA 1VQ9T 3GIBA 3HRUA 2VXFA 1KQSP 2VXEA 3MJXA 3FLGA 2E41A 2C0OA 2ED0A 2RF0A 2A08A 2O01E 2JNGA 1TS9A 2QQ9A 1FMVA 1UGPB 2DXTA 4C8QE 5CAIA 1JRIA 2P0PA 4EDUA 2EYXA 2R57A 1D0YA 1N9SA 4CC7A 3OA6A 1AD5A 3JB9D 3UPUA 3JCMd 1UECA 3L1AA 3JB9J 2C0IA 2EYWA 3QJYA 5LJ3g 5GJWB 3CCLA 5KYXA 4J9HA 2PNIA 1X69A 4C8QB 1VQ6A 2QG9B 1ZA1B 2MIOA 3CCMT 1JJ2A 3SWNC 3CCSQ 1GFDA 1NLPC 2PVOB 4PFOA 3LWIA 1EIFA 2V26A 3CCVT 4QQ6A 3CC4T 3SD4A 2EJFA 4N0AA 1MMNA 2YUNA 1PKTA 1BB9A 1VQLT 2VB6A 5KYWB 4PKCC 2YUOA 4C92E 1B07A 3NTIA 5FW9A 3SWNB 1W2BS 1D1AA 4QQGA 1KC8R 2E6NA 5I21A 4C0ZA 3MP1A 3AHUA 1OV3A 1Q86R 1T3LA 4P5NA 2K4YA 2KBTA 2LCLA 4B9XA 1SSFA 1TXQA 2FPFA 2HDAA 1K4US 4IURA 1RAEB 2AKLA 2LMJA 1Q95G 4UC4A 1PSEA 1NZ9A 1U06A 3X25B 1JXOA 5J3BA 1RUWA 3I56A 2FHDA 3SDZA 2KVQG 3CC2Q 5CKHA 1SRMA 5GAN6 4OMQA 3H0HA 4ESRA 2LNVA 2ED1A 4MZMA 2JOYA 3MEVA 1Q7YU 5HK0A 3DLMA 2X35A 1PG5B 1FYNA 4OGEA 4M7AB 3RUXA 1XTDA 1QVGP 3CCUQ 2QK0A 3D7SB 3CCJQ 4LDUA 3CCJT 4ATOA 2RO0A 1TUDA 4NL2A 1S72A 1XOVA 1KQSS 1TWBA 1TG0A 2AZSA 1B34A 4QQDA 5GAN7 2G3RA 4M78C 4PNOA 3CC2T 2CDTA 4OB3B 1PRMC 4C8QA 1I8FA 2DJQA 2SEMA 4B9WA 2MCNA 4ZNXA 2DZ9A 1HYOA 3CCSA 1KIKA 1UG1A 2YXYA 3X20B 1G3SA 1M1KU 1M1GA 2M16A 4OMNA 4PLIA 1W2BP 4J83A 2BIVA 3CCLT 1AVZC 4RTTA 5LJ5e 1M1KR 1BKBA 4ZN1A 2DIGA 2QDYB 1JBMA 3EHQA 1RADB 4OMMA 4EIKA 2XDBA 3CBOA 1QP3A 3G71T 2RK1A 3EH2A 4ZGJB 2RJEA 3N5BB 2RI5A 2E5KA 2FO0A 4WCIA 1FMWA 3JCMP 5GAN2 1TTHB 2YRVA 1BIBA 4A4HA 3G71A 5IT9E 1LJOA 5KYWA 2OAWA 1MNEA 4M75G 3PMTA 1VYVA 3KBGA 1OZ3A 4M75D 4PL6A 3BDUA 3OY9A 2DD4A 2K2VA 4DEXA 1KD1R 3MEAA 2AHJB 2L8DA 5IH2A 4OVAA 1ZUKA 3SHWA 1I07A 4BDZA 1YHQA 2ENMA 5FRMA 2GNCA 4JDSA 4L59A 2VVKA 1ZBXA 1NJIU 1VQ4Q 1SEMA 4LUEA 1C6VX 1TOVA 2MWOA 1VQ6Q 4C92C 2CSQA 1WXUA 2BE9B 4M75A 2QGFB 1YWOA 3PMIA 4ELZC 1B7TA 2J7IA 4PLLA 1PHTA 3JB9F 1QWEA 1UGRB 3A8GB 1R77A 2OX7A 5CK9A 2MK5A 1KSWA 4E7KA 2EGEA 1SKUB 4DA4A 1H8KA 2CYZB 5LL6S 2CZ7B 2I2LA 1QW1A 3CC4A 2QEXQ 4FIBA 3X28B 1T0JA 3TEEA 1VQOQ 1X6OA 2OTJQ 2CKKA 3CCRA 1D3BA 2A28A 2RD1A 4ZTFA 1M90C 2O9SA 1M1FA 2YLBA 1BI3A 3L2RA 2E65A 2QA4T 2J06A 4R56A 1E6HA 3CCJA 2DK3A 1YIJT 3FIFA 4XTZA 2RQWA 3QKJA 1QLYA 4FYXB 2BE7D 5GAMe 2J6KA 2YLCA 1AHJB 1K9AA 2CZ1B 1G8XA 3PFSA 4RTVA 1VQ8A 3RBBB 2E10A 1JQQA 1MUZA 2F1LA 4XTWA 4C0DC 2B8AA 2JN0A 3HKSA 4MDXA 3V7CA 2NUPB 4OMOA 4M7DG 2V1RA 2GBQA 4OMPA 2DE0X 2DETA 1W4SA 1GXIE 1FWZA 2KNBB 1YN8A 4A4KA 5GMKj 3QBYA 1SPKA 4IKFA 1YI2T 3I55Q 3G6EQ 1WHMA 3MPUB 1N27A 1G3TA 1BIAA 1YJNQ 2HQEA 1QVGS 2QA4Q 4OMLA 3UWNA 2ROLA 3PIPA 4M78F 4K11A 4A4GA 3PNWC 1GL5A 3OB9A 1N8RU 5A0LA 4Z02A 2OTJT 2DXUA 2PVDB 2FRWA 3PTAA 4X9CA 2DL7A 2CH4W 3H41A 4F7UE 3CC2A 2KMTA 1VQMQ 1JEGA 2FPEA 4GLKA 1ABQA 2GQVA 3X24B 4C92A 4DBHA 4QT7A 4BE2A 2O4XA 3EHRA 3I35A 4WF2A 3CD6A 3A8OB 4HT8A 2GQIA 5J26A 4J8OA 5IN1A 1M3AA 2QYZA 3S3NA 1OPKA 5GMKe 2HNIA 3EGXA 2DPPB 2V8IA 2F2WA 2X4WA 3EFSA 4HA8A 2FPDA 5CKBA 2HL5C 1ZSZC 4BUGA 4F16A 3KXTA 4RG8A 1WZOA 2NUPA 5GAMj 2DL5A 1AWJA 5IHKA 2MMPA 1ACMB 1ZHIA 1YJWQ 3PT9A 1K73C 1WQ7A 1SHFA 1UJYA 2D6FA 1X6BA 4XU1A 2XKOC 3LH5A 2CZ6B 5FROA 2EYYA 2DAQA 1M2VA 3OYKA 2KRNA 4GBQA 3RR6A 4JJDA 1K9MR 3OSVA 3QZ5B 3OSSC 1H3HA 3I5RA 1VQ7T 1YNZA 4PJOE 1Q82C 2X51A 3I55T 1YCSB 1VQ5Q 3JV3A 2JW4A 4EMKA 3M0PA 1S1NA 4C0GA 3QO3A 2RHYA 5GMKh 2PUKB 5GAOr 1ZBJA 2JZ2A 2EBPA 4AT1B 1N9RA 3OYLA 2E1HA 1IHWA 3QXEB 2Y4XA 3UT1A 2EPDA 3A5ZB 2KEAA 4BI8B 2X4YA 1C0MA 2GGRA 4M7DC 2FEIA 1VQNQ 3INZA 2ZPHB 3VKIA 1Q7YC 1AT1B 4JS5A 2MAMA 3ZBDA 4IUUA 1RAAB 2QGGA 2ZPIB 1YIJQ 3V7RA 3OMCA 3FC3A 3X26B 2KDSA 3BY7A 2LX9A 2L3QA 1HJDA 2OTLA 1X01A 3I55A 2JT4A 2P84A 4FT2A 1BCOA 4OB1B 1QKWA 1WNLA 3THKA 3GP8A 4HCBA 3L2ZA 1VQMA 2DTHA 1VQ5A 4M7DF 3M4YA 2RPNA 2XK0A 5IXFA 2EJGA 2PZ1A 2K5IA 2JJ9A 3HRTA 3NMZC 2CH4A 2RJCA 1FMKA 4J9CA 5FU6C 4J6WA 3RDVA 1ABOA 2DF6A 3SWNA 3QG1A 2AK5A 2F69A 3M4GA 4C92D 1WFWA 3RMQA 4M7AF 4OP0A 5FU7B 2C06A 2L89A 2QI2A 1SSHA 1BCMA 2PTKA 3LW5E 4FT4A 3VRYA 5ECAA
chains in the Genus database with same CATH topology
2FHDA 2PQWA 3SDZA 3QDRB 2KVQG 5CKHA 1Q81U 1VQ4T 2GFAA 3S3OA 5GAN6 2ZPFB 3QYHB 4OMFB 1M8VA 5LJ3j 2QQAA 1VQ6T 2ZPEB 2LNVA 2QQSA 4ME7A 2DEQA 4MZMA 2JOYA 3MEVA 4C5GA 1Q7YU 3NTKA 1Q81C 5HK0A 3DLMA 2X35A 4M7DA 4LDWA 4OGEA 4M7AB 3RUXA 5HY6A 2QQBA 1XTDA 2EQJA 5CKFA 3I56T 4M77D 2IVWA 4LDUA 3CCJT 3CCUT 4ATOA 2RO0A 5LJ5f 3P8HA 3M58A 4NL2A 3JRZA 3JCMh 1S72A 4LD6A 1XOVA 2L3RA 1Q86U 4M77B 1KQSS 1NPPA 3CEYA 1JB0E 3C95A 4LDXA 1B34A 1D3BB 2D0QB 4QQDA 5GAOq 5GAN7 2G3RA 5KH6A 4M78C 4PNOA 1VQPA 3CC2T 3FDRA 1X75C 5GAN4 4ELYC 4M78E 5LJ3d 4OB3B 1HK9A 4C8QA 5GAMd 2Y90A 4JS4A 3FJPA 1I8FA 4B9WA 4M77F 4L5GA 4PJOF 2DZ9A 4QW2A 3CXCA 3CCSA 2LT4A 3TU4K 1XNIA 1VUBA 3X20B 2VC8A 1G3SA 3E9GA 3WVEB 1M1KU 1M1GA 4M75E 2LTOA 2M16A 4PLIA 2CZ0B 2L5QA 2WSCE 3Q1JA 4J83A 1VQ4A 2BIVA 4QVCA 3DB4A 3VJPA 5CKDA 5LJ5h 3CCLT 1O9SA 5GAMh 4LD9K 2QA4A 5LJ5e 3OYMA 1BKBA 4ZN1A 1UGQB 3BW1A 1QVPA 4M78G 1JJ2S 1FX7A 3UDCA 2DIGA 2QDYB 4JLIA 1KQ1A 1KD1C 1JBMA 3QZ9B 3JCMX 2XDBA 3CBOA 1QP3A 2DTIA 3G71T 3CCUA 4D6WA 4BDYA 2RK2A 3OBWA 2RK1A 4ZGJB 1PSFA 2M1HA 2RJEA 2WSFE 3N5BB 2RI5A 2BKDN 3E1SA 3OYNA 3QPHA 4M77C 4XQ3A 1M9SA 4IUTA 3JCMP 5GAN2 5GANh 4JRQA 2X4JA 2YRVA 1BIBA 2KQWA 3CPWS 4A4HA 3G71A 5IT9E 5KCOA 1LJOA 3VU3C 3MEUA 3MHXA 2LRQA 4A4FA 1VIEA 4RKUE 1UEBA 1ZQ1A 3CCST 4M75G 4R55A 3JCMV 1M4ZA 1UB4A 2EKOA 1OZ3A 3BDUA 3G7ZA 3KBGA 3PMTA 2DIQA 2GF7A 2P4TA 2RI2A 2DD4A 4F7UA 3JAME 4XU3A 3OY9A 1VIFA 2ZGWA 1YJWT 5M9OA 2E5QA 4C5IA 3FEOA 2EQUA 1QVGA 2K2VA 1WPYA 3MEAA 2QQRA 4VUBA 4HCCA 4TVRA 2KAFA 2RJDA 2AHJB 2E64A 2L8DA 2GCXA 2PUOB 5KE2A 3OYBA 4OVAA 2KK4A 4M75C 3L2VA 4F7UF 3LGLA 5GANf 1YJWA 4BDZA 1YHQA 5FRMA 4BD3A 2FL7A 4JDSA 4L59A 1IREB 2LDMA 3H8ZA 4XTUA 3JCMc 3G4SA 1ZBXA 1NJIU 4PJOC 4EPCA 1WJSA 3V8JA 3J81E 4F7UB 4BY6B 3CCQA 3JB9I 3NTHA 3OW2S 2EYQA 2MWOA 4J6XA 1OZ2A 4C92C 1M1KC 3M9QA 4J6YA 4M75A 3DLLA 1VQ7A 3PMIA 3A8MB 1NE8A 4ELZC 3JCMe 3EFRA 4FSXA 4C5EA 1QVFS 3P8BB 4PLLA 4E7IA 2VGMA 2RHZA 4PJOD 3JB9F 4PJOG 2HQXA 3ZEHA 1UGRB 3A8GB 4QVDA 2O4XB 1TH7A 5LJ5g 5CK9A 4YTLA 5D6XA 4PJOB 3LLRA 1VQKA 3OYAA 5GAOm 1B34B 4E7KA 4DA4A 4ZTJA 4E47A 5KCHA 3HSBA 4M7DD 3LWHA 3HL8A 2CYZB 2XICA 5LL6S 3QSUA 2ZPGB 4M7AA 2RA2A 2CZ7B 3QHSA 2I2LA 4Y28E 3C94A 2K57A 2WACA 1VQMT 4EMHA 1QW1A 3CMEA 1WGSA 3CC4A 2WSEE 4RG2A 4FIBA 3X28B 1VQ8T 2DXCA 1R8OB 2VYTA 4M77A 4N4HA 3TEEA 1X6OA 1BI1A 2CKKA 3CCRA 1D3BA 4JRPA 1Y71A 2RD1A 4LDYA 2RI3A 4ZTFA 1M90C 1NPRA 1M1FA 3PIOA 3FB9A 4CI0C 1BI0A 2YLBA 3PGGA 2EWNA 1OI1A 1BI3A 1M90U 3OQ5A 3L2RA 3G4ST 2E65A 2RH2A 4OB0B 2QA4T 4HT9A 4R56A 3LH0A 1KC8U 4C8QD 4C8QG 5HKCA 2QEXA 3WXMB 4BE1A 2K5LA 2H3JA 3L2QA 3QJ6A 1KQ2A 1KG1A 2MF2A 3CCJA 3OYIA 5GAOl 2DK3A 3S6WA 3CCMA 4NS5A 1YIJT 3RESA 4ZGEB 3FIFA 1KC8C 2XI9A 4KULA 1XQHA 1QP2A 4XTZA 3CD6T 4M7AD 3CBPA 3QKJA 4J7FA 2E70A 1YJ9T 1NJIC 3CPFA 3HPWA 4A54A 3MP8A 5DY9A 5GAMe 2LC4A 2YLCA 1AHJB 2CZ1B 1FXXA 5GAMf 3A8LB 3V8KA 3PFSA 3CCET 2RHIA 1VQ8A 1K8AC 5FRNA 5CR2A 2E10A 2HBPA 5DLOA 4M78D 3M56A 3CC7A 4C5HA 3V8LA 3G6EA 1O75A 1YJ9A 4XU2A 4XTWA 4C0DC 3BDLA 3JCMg 2B8AA 2EFIA 2DXBA 2JN0A 3HKSA 5L8RE 3V7CA 1YJNA 1K8AU 4MDXA 2K3YA 4M7DG 4KT0E 4EMGA 2P0KA 3E19A 3OS0A 2IG0A 3VUZA 1N6AA 2M9UA 2VUBA 1GXIE 1W4SA 1FWZA 2FVUA 3EAEA 4E7JA 3L42A 4DQ2A 4EMKB 4A4KA 5GMKj 5GANg 2R58A 3QBYA 5CCAA 2XDPA 3M57A 5CQXA 1K9MU 2M0OA 4IKFA 5AYFA 4DOWA 4M7AE 4XTYA 1U1SA 1VQ5T 5GAN5 1YI2T 1YITT 2XIDA 1U8RA 3NFCA 1N27A 3MP6A 1K9MC 1G3TA 2LVMA 4C0DB 2RHUA 4C0FA 1BIAA 2ZCFB 2DJZA 2HQEA 1BI2A 1QVGS 3RIRA 1DJ7B 4XAXB 3RMSA 4M7AC 2DO3A 3UWNA 3CCQT 1I4K1 3PIPA 4M78F 4M78A 3JCMJ 4A4GA 1Y07A 3PNWC 1G5VA 2JTMA 4N4GA 5GAMg 5LJ3h 5A2QE 3OB9A 4M77G 3CCEA 3OYHA 3JCMW 5A0LA 3J80E 1N8RU 4Z02A 2X4XA 5I2SA 3GLXA 2DXUA 4OB2B 5HK3A 3OS5A 4A53A 2PVDB 4NL3A 1VQOT 2OTJT 1W2BA 4BY6C 1YCYA 3PTAA 2KY9A 4X9CA 2DTOA 3BFMA 2EQKA 4F7UE 2P0QA 3OYEA 2KMTA 1VQPT 2FB7A 3RKWA 3KUFA 2BUDA 5GMKl 4M7AG 3SB2A 4M75B 2LQ8A 3SFMA 3OYDA 5GMKi 4GLKA 2V8KA 4KUDK 2MI6A 1Y96B 4KBMB 1RL2A 2PU9B 1U1TA 2GQVA 4O5VA 5KE3A 3X24B 4C92A 5LJ3e 2K5FA 1QVFA 2EIFA 2FYKA 5CVIA 4N0AC 3L2WA 3G6ET 3F70A 2A3LA 4OGCA 2RM4A 2VV5A 4BE2A 2O4XA 4RMOA 5FLXE 2R5AA 1OYXA 4M78B 4WF2A 4C92B 4PJOA 3OBYA 4LDVA 3GF5A 3A8OB 4HT8A 3CD6A 2E6ZA 3HP9A 2DKGA 3J7AF 5J26A 5LJ3f 3C12A 3HRSA 3QUIA 4J8OA 4CRIA 5IN1A 4ZGDB 1VQNT 4M77E 3OYGA 1I81A 3RKYA 1LNXA 1H3ZA 3S3NA 5GMKe 4E7HA 2RB6A 5LJ5d 2HAXA 3E9FA 2HNIA 2QXFA 4Q5WA 4A4EA 5GANe 5FU6B 1M5Q1 4DOVA 2A7YA 2DPPB 3A8HB 3JCMQ 3M54A 5GAN3 2V8IA 2VGNA 3VV0A 2X4WA 3EFSA 4HA8A 1BYMA 4F7UG 3CC7T 3JSCA 2E12A 4JJNK 3HFOA 2NLUA 4XU0A 4MDWA 3WVDB 1KHIA 3RKXA 5CKBA 3MO8A 3CBMA 1KQSA 3R6OA 4MZPA 1KHCA 4BUGA 3OYJA 3KXTA 4V2SA 1V29B 4IUQA 4MZTA 4RG8A 3M5AA 3ME9A 4FM4B 3GOXA 4RCBA 5GAMj 3M59A 4X9DA 5LJ5j 4J5YA 4FU6A 3META 4II1A 1LOJA 2CS7A 2MMPA 1ZHIA 3ER0A 3H6ZA 4M75D 4PL6A 3OYFA 4FL6A 3PT9A 1YI2A 1YITA 1K73C 3DB3A 3VYHB 1WQ7A 3RERA 1MHNA 5CO7A 5GMKm 3L2UA 2D6FA 4XU1A 2R5MA 4QVZA 2XKOC 2XD0A 3FRNA 4BI3A 2CZ6B 4OF1A 3M55A 2MWPA 4XTVA 5FROA 5C0MA 3S3MA 1K73U 2EJ9A 5I2MA 2DAQA 2PVGB 4C92F 2ZZDA 3OYKA 3OYYA 4BI4A 5CKEA 3QYGB 2F5KA 1UGSB 2DZCA 1MGQA 3MEWA 3MCAB 3OSVA 1VQLA 3GNFB 3JCMb 4M7DE 3QZ5B 3HFNA 4IUVA 3GPLA 4N4IA 3JB9G 2QEXT 2XHCA 1VQOA 2HD0A 1I5LA 3OSSC 2XU8A 1Q82U 4RCCA 2OAUA 2KSSA 2JUFA 4J7IA 2QTXA 4XK8E 1VQ9T 1VQ7T 3CC2A 5D6WA 3QIIA 3GIBA 3HRUA 4JRIA 3HHTB 1Q82C 2VXFA 4C8QC 3I55T 3CMAT 4PJOE 5DM7R 2V8JA 2VXEA 4EMKA 5DLQE 3FLGA 4C0GA 2LCCA 2LQKA 3LX7A 3P8DA 4M75F 3QO3A 2RHYA 2E41A 2PUKB 5GMKh 5GAOr 4L6V5 2JZ2A 5A0DA 3JB9H 1S72T 3LYIA 4M7DB 2O01E 2JNGA 1N9RA 3OYLA 2E1HA 1VQNA 5A0GA 3GNGA 2QQ9A 3QXEB 2Y4XA 2YHTA 1UGPB 3UT1A 2DXTA 2DD5A 4C92G 4ZN3A 3CCVA 4C8QE 5CAIA 1JRIA 3A5ZB 1VQKT 1YIJA 1P92A 4EMKC 4GY5A 3M53A 4NOYA 2P0PA 4EDUA 3VUBA 2R57A 1Y96A 3LGFA 1N9SA 1G3WA 3O8VA 5J39A 3ASKA 4BI8B 3OA6A 2X4YA 3JB9D 3UPUA 5EG2A 2LT1A 4BB7A 4C8QF 3JCMd 3L1AA 4HCZA 3JB9J 4M7DC 4E7LA 3INZA 3QJYA 2JVVA 2ZPHB 3VKIA 5LJ3g 4BE0A 1Q7YC 4JS5A 5GAOp 3CCLA 2MAMA 3CXCS 4MMLA 1HXDA 3ZBDA 1VQ9A 4IUUA 3TREA 3CCRT 2ZPIB 5FU7C 4C8QB 3V7RA 1VQ6A 3OMCA 3FC3A 5GANd 3X26B 5GANj 2KDSA 2Y4YA 5CQYA 3BY7A 2LX9A 3CCMT 1Q86C 4BACA 1YHQT 1JJ2A 3SWNC 2JTFA 2OTLA 2D9TA 1G3YA 4X34A 3CMAA 1H641 4IUPA 1X01A 3I55A 2OTJA 4HKEA 3TCJA 2PVOB 4FT2A 3LWIA 1EIFA 4OB1B 1WNLA 4JLGA 4MMKA 3GP8A 3CCVT 3L2ZA 1VQMA 4HCBA 2DTHA 4QQ6A 5CIUA 3CMET 2EAYA 3CC4T 1VQ5A 3SD4A 4M7DF 2EJFA 3M4YA 4N0AA 2DVEA 3URGA 2CGHA 4Y91A 3V7SA 5C6SA 1VQLT 2ZPBB 2XK0A 1WJQA 2EJGA 5GAOn 4PKCC 3OS1A 2K5IA 4C92E 2XDDA 3OS2A 3OYCA 3NTIA 3SWNB 3OMGA 3HRTA 1WQWA 1W2BS 4QQGA 2RJCA 4JRKA 4O6JA 3ZFJA 5IAYA 2E6NA 1YJNT 5FU6C 5I21A 1WJRA 4J6WA 4C0ZA 3SWNA 1YBYA 3MP1A 3QG1A 3AHUA 4XTXA 2F69A 2RHXA 3M4GA 4C92D 1KD1U 5D6YA 3RMQA 4KUIA 2F5TX 4M7AF 4OP0A 5FU7B 4P5NA 1N8RC 3CPWA 2K4YA 2LCLA 4B9XA 2C06A 2K3XA 1SSFA 4JUVA 3JCMf 2L89A 2GFUA 2QI2A 2EQMA 3T9NA 3VYGA 3LW5E 1Y7XA 1RI0A 4FT4A 2OTLT 2XG8D 4IURA 2RJFA 3C4SA 3DKMA 4UC4A 5GAN8 1PSEA 1NZ9A 3OW2A 3X25B 1IZ6A 5J3BA 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOV A;  3PT9 A;  1M4Z A;  4KUD K;  4JJN K;  4FT2 A;  4BB7 A;  4KUL A;  4KUI A;  4FSX A;  3TU4 K;  1W4S A;  2FVU A;  4FT4 A;  3PTA A;  4LD9 K;  4DOW A;  2FL7 A;  4DA4 A;  1ZHI A;  1ZBX A; 
#chains in the Genus database with same CATH topology
 1QCO A;  1Q81 U;  1WX6 A;  1SG5 A;  2ROT A;  2NUT A;  4CC3 A;  2QQA A;  2ZPE B;  2QQS A;  2LP5 A;  3TQ7 P;  4PJL A;  1GCQ C;  2D8J A;  2QQB A;  5CKF A;  2M0Y A;  3JRZ A;  4M77 B;  1JB0 E;  4AMC A;  3C95 A;  4HVU A;  4M4Z A;  3FDR A;  1X75 C;  5GAM d;  2M51 A;  3KFV A;  4JS4 A;  4J9D A;  2YRC A;  4M77 F;  2FZK B;  2E3I A;  1ZSZ A;  3CXC A;  2OTL Q;  2LT4 A;  1XNI A;  1T0H A;  2VKN A;  1VUB A;  3E9G A;  5D7U A;  2CZ0 B;  2L2P A;  1MMA A;  3Q1J A;  4HVV A;  3DB4 A;  3VJP A;  2QA4 A;  4LNP A;  4IIO A;  2OJ2 A;  1UGQ B;  4M78 G;  1JJ2 S;  4RTZ A;  4FSS A;  1FX7 A;  1VQ7 Q;  3JCM X;  4BDY A;  4D6W A;  3OBW A;  3OYN A;  4XQ3 A;  1E6G A;  1M9S A;  3VS0 A;  3CPW S;  1QCF A;  3VU3 C;  1MV0 B;  3EFO A;  4RKU E;  1ZQ1 A;  4R55 A;  1UB4 A;  2Z0W A;  2GF7 A;  1AOJ A;  2P4T A;  2RI2 A;  4F7U A;  4XU3 A;  1YJW T;  4C5I A;  2D8H A;  1WPY A;  2QQR A;  4VUB A;  4HCC A;  4TVR A;  3NPF A;  1PNJ A;  2KAF A;  2RJD A;  2G6F X;  2PUO B;  2KI7 A;  5KYN A;  3OYB A;  3L2V A;  4F7U F;  2CT3 A;  5GAN f;  1YJW A;  1T3S A;  2K3B A;  2NUZ A;  4XTU A;  3CC7 Q;  1R0B G;  1WJS A;  4DBQ A;  3UAT A;  1VYT A;  3J81 E;  4F7U B;  1QMC A;  3OW2 S;  2KT1 A;  4J6X A;  1VQ7 A;  3A8M B;  1QVF S;  3P8B B;  2VGM A;  4PJO D;  4PJO G;  2HQX A;  1GFC A;  1SF9 A;  4QVD A;  1JJ2 P;  1TH7 A;  1CKB A;  5LJ5 g;  4GLM A;  5GAO m;  4E47 A;  5KCH A;  3LWH A;  3HL8 A;  3TSZ A;  1KK7 A;  2ZPG B;  2FG0 A;  4M7A A;  2A0F B;  2LQN A;  2RA2 A;  3QHS A;  2O88 A;  3C94 A;  1VQM T;  4EMH A;  1WGS A;  2EGC A;  2WSE E;  1VQL Q;  2D1X A;  3EG9 B;  1VQ8 T;  4Z89 A;  1M30 A;  4LDY A;  2RI3 A;  3PIO A;  4WTO B;  1OU9 A;  3FB9 A;  4CI0 C;  3PGG A;  2EWN A;  5IXB A;  2RH2 A;  1UE9 A;  4HT9 A;  3LH0 A;  1CSK A;  1YP5 A;  4C8Q D;  1G83 A;  3WXM B;  4BE1 A;  3L2Q A;  1KG1 A;  2MF2 A;  1YI2 Q;  2VAS A;  3S6W A;  2HKN A;  4NS5 A;  1KC8 C;  3EG9 A;  2DL4 A;  2X9H A;  2V1Q A;  2CP5 A;  1NYF A;  3MP8 A;  5DY9 A;  2LC4 A;  4E6R A;  3V8K A;  3CCE T;  3CQT A;  5FRN A;  1MMD A;  5CR2 A;  2YUP A;  5DLO A;  4M78 D;  3CC7 A;  4C5H A;  3V8L A;  3G6E A;  1O75 A;  3JCM g;  1RAI B;  1K8A U;  2K3Y A;  4KT0 E;  4EMG A;  3OS0 A;  5AT1 B;  2IG0 A;  2M9U A;  1N8R R;  3EAE A;  1I5O B;  4DQ2 A;  2RN8 A;  4F14 A;  5GAN g;  5CCA A;  1K9M U;  3CD6 Q;  2M0O A;  5AYF A;  3VS1 A;  1VQ5 T;  5GAN 5;  2XID A;  2CP6 A;  3MP6 A;  2QAZ A;  1D1B A;  4M7A C;  1VQP Q;  5FWB A;  2KYB A;  4M78 A;  3JCM J;  1RAF B;  2VWF A;  1G5V A;  3O5Z A;  4N4G A;  5GAM g;  5A2Q E;  3JCM W;  3CME Q;  1X43 A;  2X4X A;  3GLX A;  4OB2 B;  4NL3 A;  3OS5 A;  1VQO T;  1W2B A;  4BY6 C;  3A98 A;  2DTO A;  5FWC A;  3OYE A;  1VQP T;  3JB9 H;  2FB7 A;  1WXB A;  3KUF A;  3RKW A;  1M3B A;  4M75 B;  2LQ8 A;  3OYD A;  2CUD A;  1W1F A;  2V8K A;  1Q81 R;  2PU9 B;  4O5V A;  5KYU B;  5LJ3 e;  2K5F A;  5CVI A;  2FYK A;  2VV5 A;  1SRL A;  4M78 B;  2X3X D;  4C92 B;  3TVT A;  3HP9 A;  2DKG A;  3J7A F;  4CRI A;  2K6D A;  1K0X A;  1KJW A;  3RKY A;  1LNX A;  2JXB A;  2DVJ A;  4E7H A;  3E9F A;  4Q5W A;  5GAN e;  2A7Y A;  2A37 A;  3JCM Q;  3VV0 A;  5EC7 A;  3CCE Q;  2E12 A;  2F2V A;  4JJN K;  1GBQ A;  4MDW A;  3WVD B;  1KHI A;  3MO8 A;  3CBM A;  3NGP A;  2B86 A;  3R6O A;  4MZP A;  4MZT A;  3M5A A;  3ME9 A;  4FM4 B;  5LJ5 j;  3MET A;  2CS7 A;  3PE0 A;  4AG2 C;  3OYF A;  4LE9 A;  4FL6 A;  4PJN A;  3CMA Q;  3RER A;  5GMK m;  2CP7 A;  3L2U A;  1UFF A;  2R5M A;  3G4S Q;  4BI3 A;  2EW3 A;  1WHJ A;  3M55 A;  5L23 A;  2HSP A;  3VS6 A;  2I0N A;  5I2M A;  2ECZ A;  2KRM A;  1X2K A;  2ESW A;  1UGS B;  1WA7 A;  2DZC A;  3MEW A;  1M2V B;  1VQL A;  3JCM b;  4M7D E;  4IUV A;  4N4I A;  3JB9 G;  2XHC A;  2L0A A;  1I5L A;  3RNJ A;  4RCC A;  2OAU A;  4J7I A;  2O9V A;  4D8D A;  3QII A;  3EGD A;  3CMA T;  3HHT B;  2DL8 A;  4M75 F;  3P8D A;  4PJM A;  1M2O A;  2P4R A;  4M7D B;  2HL3 A;  3LYI A;  3I9Q A;  1VQN A;  5A0G A;  2YHT A;  4C92 G;  1P92 A;  2H3E B;  7AT1 B;  3VUB A;  1C1A A;  3O8V A;  4E7S A;  2BZ8 A;  4C8Q F;  1MV3 A;  4HCZ A;  1A0N B;  4E7L A;  2JVV A;  5I11 A;  1ZUU A;  3CXC S;  3ZL7 C;  1AWX A;  1HXD A;  3TRE A;  3QWX X;  2LNH B;  1D09 B;  1Z9Z A;  3BE3 A;  5GAN d;  5GAN j;  1W70 A;  1YHQ T;  1G3Y A;  3CMA A;  2OTJ A;  4JZ3 A;  1GRI A;  2EGA A;  2NYS A;  4HXJ A;  3CME T;  3EGX B;  3VS7 A;  2DVE A;  5HCK A;  3V7S A;  5C6S A;  2ZPB B;  8AT1 B;  2K79 A;  3OS2 A;  3OS1 A;  9ATC B;  3OMG A;  4O6J A;  2RNA A;  2LJ3 A;  1YBY A;  2RHX A;  3GBQ A;  4KUI A;  1NJI R;  2CP3 A;  2KRS A;  1UHC A;  2W0Z A;  2K3X A;  4JUV A;  2EQM A;  2YT6 A;  3PVQ A;  2J6O A;  1RI0 A;  3M0T A;  1NEG A;  2RJF A;  1K76 A;  3DKM A;  1VQ6 T;  4M7D A;  2PQW A;  1VQ4 T;  3S3O A;  3SEM A;  1OEB A;  4DBF A;  4C5G A;  2MPX C;  3NTK A;  2X3W D;  4LDW A;  1SHG A;  2EQJ A;  3I56 T;  4J9F A;  1IRX A;  1TSF A;  5LJ5 f;  3P8H A;  3JCM h;  4LD6 A;  1Q86 U;  4FCY A;  2DBK A;  1NPP A;  1IGQ A;  1M8M A;  5GAO q;  1CKA A;  5GAN 4;  3G1J A;  5LJ3 d;  4AG1 C;  1HK9 A;  2Y90 A;  2AZV A;  4L5G A;  4PJO F;  2QAS A;  3TU4 K;  2KYM A;  1Y0M A;  1ARK A;  2RQV A;  2IIM A;  3UF4 A;  2WSC E;  2K9G A;  2F2X A;  1O9S A;  5GAM h;  2BZX A;  3OYM A;  3BW1 A;  3G71 Q;  3CPW P;  3UDC A;  1KQ1 A;  1KD1 C;  3QZ9 B;  2RK2 A;  2L3P A;  2HSE B;  2ZAE A;  1PSF A;  4CC2 A;  3CCL Q;  2BKD N;  3E1S A;  2M02 A;  4M77 C;  1ZX6 A;  3HTR A;  4FW2 A;  5GAN h;  2KQW A;  4FW1 A;  2A36 A;  5KCO A;  2GTO A;  3MEU A;  3MHX A;  1UEB A;  2RQR A;  1YHQ Q;  3JCM V;  1HSQ A;  1AEY A;  1BU1 A;  2DIQ A;  2SRC A;  4RTY A;  2COW A;  2ZGW A;  3FEO A;  2RMO A;  2DL3 A;  2EQU A;  1TU0 B;  3PVL A;  1HD3 A;  1IB8 A;  2E64 A;  5KE2 A;  2KK4 A;  4M75 C;  2LJ0 A;  1F1B B;  2CP0 A;  4BD3 A;  2FL7 A;  1UTI A;  2AT1 B;  3U23 A;  1PCX A;  3G4S A;  2CT4 A;  3V8J A;  2J6F A;  4BY6 B;  4JZ4 A;  2KR3 A;  1OZ2 A;  3M9Q A;  4J6Y A;  3DLL A;  1NE8 A;  1PRL C;  4JPB W;  3EFR A;  2DLP A;  4C5E A;  3JCM e;  4E7I A;  2RHZ A;  1IXD A;  3ZEH A;  1VA7 A;  4FYV B;  4YTL A;  4PJO B;  3LLR A;  1VQK A;  1B34 B;  1Q7Y R;  4M7D D;  3HSB A;  3EG0 A;  2XIC A;  1KFZ A;  3QSU A;  2YDL A;  3CME A;  1BBZ A;  4E7Z A;  1R8O B;  4M77 A;  4N4H A;  4JRP A;  1Y71 A;  2GTJ A;  4AFS C;  4LXC A;  3CCQ Q;  3UA7 A;  1V1C A;  1OI1 A;  1M90 U;  3G4S T;  2W10 A;  4C8Q G;  5HKC A;  2QEX A;  2H3J A;  1RAB B;  3QJ6 A;  2EQI A;  4IIM A;  1YIT Q;  5GAO l;  3CCR Q;  4M7A D;  1XQH A;  1TUG B;  3C0C A;  2CUB A;  5KYX B;  1YJ9 T;  3HPW A;  4A54 A;  2LQW A;  1AWW A;  4B6M A;  4F04 B;  5GAM f;  3A8L B;  2RHI A;  2HBP A;  2NUT B;  1VQK Q;  1EZZ B;  2JMA A;  4XU2 A;  3BDL A;  3VS5 A;  5L8R E;  1YJN A;  2P0K A;  3E19 A;  3VRZ A;  1LVK A;  1N6A A;  2HBW A;  4E7J A;  2R58 A;  3M57 A;  4DBR A;  2D0N A;  4DOW A;  4M7A E;  1U8R A;  2C0T A;  2DYB A;  2LVM A;  4C0F A;  2RHU A;  1VQ9 Q;  3H9N A;  3VS3 A;  1DJ7 B;  3RMS A;  4AFU C;  2DO3 A;  1I4K 1;  2KT8 A;  1ZSZ B;  1QCN A;  4PJJ A;  4KGX B;  2JTM A;  4M77 G;  4X1V A;  3J80 E;  1WIE A;  2YSQ A;  5HK3 A;  4A53 A;  1IGU A;  1YCY A;  1B3Q A;  2EQK A;  1TUC A;  1WYX A;  1AWO A;  2O31 A;  2MI6 A;  1Y96 B;  4KBM B;  1RL2 A;  1U1T A;  1QVF A;  3L2W A;  1U3O A;  4N0A C;  4OGC A;  2RM4 A;  3REB B;  4RMO A;  5FLX E;  2CP2 A;  2R5A A;  1OYX A;  5KYU A;  3OBY A;  4LDV A;  3A1P A;  2E6Z A;  2DRK A;  4PFP A;  5LJ3 f;  3HRS A;  3FJ5 A;  2BZY A;  4M77 E;  2XMF A;  2HAX A;  2K2M A;  1M5Q 1;  4DOV A;  3A8H B;  3VS4 A;  5GAN 3;  2VGN A;  5KYY A;  4RTU A;  2O2O A;  3JSC A;  6AT1 B;  4XU0 A;  3H0I A;  3RKX A;  3EG1 A;  3QDF A;  4D8K A;  1EX4 A;  2MOX A;  3OYJ A;  4V2S A;  1V29 B;  4IUQ A;  1K1Z A;  2HQH A;  2HZY A;  4RCB A;  3M59 A;  4J5Y A;  4FU6 A;  4II1 A;  1LOJ A;  4KGZ B;  3ER0 A;  3H6Z A;  1WI7 A;  1M3C A;  1YI2 A;  3DB3 A;  3VYH B;  2LJ1 A;  3UA6 A;  1MHN A;  1RAC B;  5CO7 A;  2J05 A;  5KYY B;  4QVZ A;  1YWP A;  2MWP A;  1K73 U;  2EJ9 A;  4C92 F;  3OYY A;  1AZE A;  4BI4 A;  5CKE A;  2F5K A;  1MGQ A;  1WHK A;  3GNF B;  3HFN A;  3GPL A;  1VQ8 Q;  4J9B A;  1QWF A;  1D1C A;  1Q82 U;  2DIL A;  2KSS A;  1IO6 A;  4XK8 E;  1X27 A;  5D6W A;  2RQU A;  2EKH A;  4JRI A;  4C8Q C;  5DM7 R;  2V8J A;  5DLQ E;  2KRO A;  3EGD B;  2LCC A;  2LQK A;  3E2U A;  3LX7 A;  4L6V 5;  5A0D A;  4JJB A;  1S72 T;  1MMG A;  3GNG A;  4RTX A;  1ZLM A;  2DD5 A;  4ZN3 A;  3CCV A;  1YFN A;  1VQK T;  1YIJ A;  1H92 A;  4EMK C;  4GY5 A;  3M53 A;  4NOY A;  1Y96 A;  3LGF A;  5J39 A;  1G3W A;  3ASK A;  5EG2 A;  1PWT A;  2LT1 A;  4BB7 A;  4Y92 A;  1YJ9 Q;  4BE0 A;  1PC0 A;  2DM1 A;  5GAO p;  3I5S A;  3I56 Q;  1E7O A;  1W6X A;  4MML A;  1VQ9 A;  1WHH A;  3CCR T;  5FU7 C;  1QKX A;  2Y4Y A;  5CQY A;  1Q86 C;  4Z88 A;  4BAC A;  1IHV A;  2JTF A;  2D9T A;  4X34 A;  1H64 1;  4IUP A;  2H8H A;  2LCS A;  4HKE A;  3TCJ A;  1JXM A;  1PD0 A;  4JLG A;  4MMK A;  1RLQ C;  5CIU A;  2EAY A;  4KRT A;  2YUQ A;  3M0U A;  3URG A;  2CGH A;  4Y91 A;  3AT1 B;  5IHN A;  1WJQ A;  5GAO n;  3OYC A;  2DFU A;  2E4H A;  2XDD A;  1OPL A;  1OUL A;  1WQW A;  4JRK A;  1YJN T;  3ZFJ A;  2K7A A;  1UDL A;  2JS0 A;  5IAY A;  2ABL A;  2RQT A;  4A63 B;  3IQL A;  1WJR A;  4RTW A;  4XTX A;  1KD1 U;  5D6Y A;  2F5T X;  3CPW A;  1WLP B;  3JCM f;  2GFU A;  3T9N A;  3VYG A;  1Y7X A;  2OTL T;  2XG8 D;  3C4S A;  5GAN 8;  1UHF A;  3OW2 A;  1IZ6 A;  3QDR B;  1LPL A;  2GFA A;  2ZPF B;  3QYH B;  4OMF B;  1VYU A;  3ULR B;  5LJ3 j;  1M8V A;  4ME7 A;  2DEQ A;  1ZUY A;  1Q81 C;  1RLP C;  5HY6 A;  2HCK A;  4M77 D;  2IVW A;  4J9E A;  3CCU T;  2FZC B;  3M58 A;  4PK4 A;  2L3R A;  3CEY A;  2DNU A;  4LDX A;  2D0Q B;  1D3B B;  3M0R A;  5KH6 A;  1Z9Q A;  1VQP A;  2LZ6 B;  4ELY C;  4M78 E;  5GJV B;  3FJP A;  4QW2 A;  3CXC P;  2YWW A;  2KXD A;  2VC8 A;  4PFZ A;  3WVE B;  4FYY B;  1S72 Q;  1NYG A;  4M75 E;  2LTO A;  2L5Q A;  1WDX A;  2EYZ A;  1VQ4 A;  2JM8 A;  4QVC A;  5CKD A;  4FYW B;  5LJ5 h;  3EG3 A;  4LD9 K;  1NEB A;  4Z8A A;  1WHG A;  1QVP A;  3MKD A;  3EGU A;  4JLI A;  1GBR A;  2DTI A;  3CCU A;  1AZG B;  1LCK A;  2M1H A;  2WSF E;  2MYS A;  3QPH A;  1J3T A;  4IUT A;  3CCV Q;  4JRQ A;  2X4J A;  2LRQ A;  4QKU A;  2QDL A;  1VIE A;  4A4F A;  3CCS T;  3G7Z A;  1M4Z A;  1OU8 A;  2EKO A;  3CCM Q;  3JAM E;  2JMC A;  1BK2 A;  1EFN A;  1VIF A;  3QWY A;  1WHL A;  2E5Q A;  5M9O A;  1QVG A;  4LN2 A;  1Q82 R;  2GCX A;  2JM9 A;  1PD1 A;  1JU5 C;  3LGL A;  1VOM A;  1PKS A;  1IRE B;  2LDM A;  3H8Z A;  3M0Q A;  3JCM c;  2DRM A;  2JTE A;  4EPC A;  2FRY A;  3VS2 A;  4PJO C;  3CCQ A;  3JB9 I;  3NTH A;  2EYQ A;  1M1K C;  2LX7 A;  1QQJ A;  4AFQ C;  4FSX A;  2OI3 A;  2KXC A;  2NWM A;  1X2Q A;  2E3H A;  1V76 A;  2O4X B;  1JO8 A;  1QVF P;  5D6X A;  1ZSG A;  4HVW A;  3OYA A;  4ZTJ A;  1I0C A;  2DER A;  1RAG B;  4KH1 B;  4Y28 E;  2K57 A;  2WAC A;  4ORZ A;  4RG2 A;  4LUD A;  2DXC A;  2VYT A;  1BI1 A;  1U5S A;  1RAH B;  4KGV B;  1NPR A;  3NHN A;  1BI0 A;  3OQ5 A;  1D0X A;  4OB0 B;  1GCP A;  1KC8 U;  1KQ2 A;  2K5L A;  3EH1 A;  3OYI A;  3CCM A;  3RES A;  4ZGE B;  2DBM A;  2XI9 A;  4KUL A;  3CD6 T;  1QP2 A;  3CBP A;  4J7F A;  2E70 A;  4DEY A;  5IHI A;  1NJI C;  3CPF A;  4J9I A;  4J9G A;  1XJW B;  1FXX A;  1PM3 A;  2KE9 A;  3OW2 P;  5I22 A;  1R0C B;  2EVR A;  1K8A C;  2BTT A;  3M56 A;  1NM7 A;  1YJ9 A;  2EFI A;  2DXB A;  4CC4 B;  2FZG B;  1K73 R;  2HKQ B;  4ANJ A;  3VUZ A;  1GCQ A;  2VUB A;  2FVU A;  1OOT A;  2L3S A;  3L42 A;  4EMK B;  1OX8 A;  2DA9 A;  2COZ A;  2XDP A;  5CQX A;  2ATC B;  4XTY A;  1U1S A;  2DX1 A;  3TSW A;  1YIT T;  4R0K A;  3NFC A;  1K9M C;  1M90 R;  4C0D B;  2ZCF B;  2DJZ A;  1BI2 A;  2DYI A;  3RIR A;  1MND A;  4XAX B;  3CCQ T;  1Y07 A;  5LJ3 h;  3CCE A;  3OYH A;  3CC4 Q;  1UGV A;  5I2S A;  2KGT A;  1NG2 A;  8ATC B;  4RUG A;  2KY9 A;  2YRD A;  1N8R C;  3BFM A;  2P0Q A;  4M7A G;  2QTV A;  1N5Z A;  2BUD A;  5GMK l;  3SB2 A;  2IPO B;  3SFM A;  5GMK i;  4AFZ C;  4KUD K;  1D0Z A;  5KE3 A;  2CRE A;  2DEU A;  2EIF A;  3G6E T;  3F70 A;  2A3L A;  2AKK A;  2AIR B;  3H0F A;  4PJO A;  3GF5 A;  1OQK A;  4HCK A;  3C12 A;  3QUI A;  1G2B A;  4ZGD B;  1VQN T;  2HMA A;  1H3Z A;  3OYG A;  1I81 A;  1NBE B;  3R6N A;  1I1J A;  2CSI A;  2RB6 A;  5LJ5 d;  4E2F B;  1X6G A;  2QXF A;  4A4E A;  5FU6 B;  3EG2 A;  3M54 A;  1NLO C;  1Y57 A;  1OX9 A;  3M0S A;  1BYM A;  4F7U G;  2JS2 A;  3CC7 T;  4JJC A;  3HFO A;  2NLU A;  2COY A;  4F17 A;  1KQS A;  1KHC A;  1K8A R;  1K0S A;  3GOX A;  2HEQ A;  4X9D A;  4KH0 B;  1YIT A;  2DMO A;  2XD0 A;  1M27 C;  3FRN A;  1WXT A;  4OF1 A;  4XTV A;  5C0M A;  3S3M A;  1RI9 A;  2PVG B;  1ZA2 B;  2ZZD A;  3REA B;  3QYG B;  3MCA B;  1UUE A;  1VQO A;  2QEX T;  2HD0 A;  1UJ0 A;  2XU8 A;  3EFO B;  2JUF A;  2QTX A;  1VQ9 T;  3GIB A;  3HRU A;  2VXF A;  1KQS P;  2VXE A;  3MJX A;  3FLG A;  2E41 A;  2C0O A;  2ED0 A;  2RF0 A;  2A08 A;  2O01 E;  2JNG A;  1TS9 A;  2QQ9 A;  1FMV A;  1UGP B;  2DXT A;  4C8Q E;  5CAI A;  1JRI A;  2P0P A;  4EDU A;  2EYX A;  2R57 A;  1D0Y A;  1N9S A;  4CC7 A;  3OA6 A;  1AD5 A;  3JB9 D;  3UPU A;  3JCM d;  1UEC A;  3L1A A;  3JB9 J;  2C0I A;  2EYW A;  3QJY A;  5LJ3 g;  5GJW B;  3CCL A;  5KYX A;  4J9H A;  2PNI A;  1X69 A;  4C8Q B;  1VQ6 A;  2QG9 B;  1ZA1 B;  2MIO A;  3CCM T;  1JJ2 A;  3SWN C;  3CCS Q;  1GFD A;  1NLP C;  2PVO B;  4PFO A;  3LWI A;  1EIF A;  2V26 A;  3CCV T;  4QQ6 A;  3CC4 T;  3SD4 A;  2EJF A;  4N0A A;  1MMN A;  2YUN A;  1PKT A;  1BB9 A;  1VQL T;  2VB6 A;  5KYW B;  4PKC C;  2YUO A;  4C92 E;  1B07 A;  3NTI A;  5FW9 A;  3SWN B;  1W2B S;  1D1A A;  4QQG A;  1KC8 R;  2E6N A;  5I21 A;  4C0Z A;  3MP1 A;  3AHU A;  1OV3 A;  1Q86 R;  1T3L A;  4P5N A;  2K4Y A;  2KBT A;  2LCL A;  4B9X A;  1SSF A;  1TXQ A;  2FPF A;  2HDA A;  1K4U S;  4IUR A;  1RAE B;  2AKL A;  2LMJ A;  1Q95 G;  4UC4 A;  1PSE A;  1NZ9 A;  1U06 A;  3X25 B;  1JXO A;  5J3B A;  1RUW A;  3I56 A;  2FHD A;  3SDZ A;  2KVQ G;  3CC2 Q;  5CKH A;  1SRM A;  5GAN 6;  4OMQ A;  3H0H A;  4ESR A;  2LNV A;  2ED1 A;  4MZM A;  2JOY A;  3MEV A;  1Q7Y U;  5HK0 A;  3DLM A;  2X35 A;  1PG5 B;  1FYN A;  4OGE A;  4M7A B;  3RUX A;  1XTD A;  1QVG P;  3CCU Q;  2QK0 A;  3D7S B;  3CCJ Q;  4LDU A;  3CCJ T;  4ATO A;  2RO0 A;  1TUD A;  4NL2 A;  1S72 A;  1XOV A;  1KQS S;  1TWB A;  1TG0 A;  2AZS A;  1B34 A;  4QQD A;  5GAN 7;  2G3R A;  4M78 C;  4PNO A;  3CC2 T;  2CDT A;  4OB3 B;  1PRM C;  4C8Q A;  1I8F A;  2DJQ A;  2SEM A;  4B9W A;  2MCN A;  4ZNX A;  2DZ9 A;  1HYO A;  3CCS A;  1KIK A;  1UG1 A;  2YXY A;  3X20 B;  1G3S A;  1M1K U;  1M1G A;  2M16 A;  4OMN A;  4PLI A;  1W2B P;  4J83 A;  2BIV A;  3CCL T;  1AVZ C;  4RTT A;  5LJ5 e;  1M1K R;  1BKB A;  4ZN1 A;  2DIG A;  2QDY B;  1JBM A;  3EHQ A;  1RAD B;  4OMM A;  4EIK A;  2XDB A;  3CBO A;  1QP3 A;  3G71 T;  2RK1 A;  3EH2 A;  4ZGJ B;  2RJE A;  3N5B B;  2RI5 A;  2E5K A;  2FO0 A;  4WCI A;  1FMW A;  3JCM P;  5GAN 2;  1TTH B;  2YRV A;  1BIB A;  4A4H A;  3G71 A;  5IT9 E;  1LJO A;  5KYW A;  2OAW A;  1MNE A;  4M75 G;  3PMT A;  1VYV A;  3KBG A;  1OZ3 A;  4M75 D;  4PL6 A;  3BDU A;  3OY9 A;  2DD4 A;  2K2V A;  4DEX A;  1KD1 R;  3MEA A;  2AHJ B;  2L8D A;  5IH2 A;  4OVA A;  1ZUK A;  3SHW A;  1I07 A;  4BDZ A;  1YHQ A;  2ENM A;  5FRM A;  2GNC A;  4JDS A;  4L59 A;  2VVK A;  1ZBX A;  1NJI U;  1VQ4 Q;  1SEM A;  4LUE A;  1C6V X;  1TOV A;  2MWO A;  1VQ6 Q;  4C92 C;  2CSQ A;  1WXU A;  2BE9 B;  4M75 A;  2QGF B;  1YWO A;  3PMI A;  4ELZ C;  1B7T A;  2J7I A;  4PLL A;  1PHT A;  3JB9 F;  1QWE A;  1UGR B;  3A8G B;  1R77 A;  2OX7 A;  5CK9 A;  2MK5 A;  1KSW A;  4E7K A;  2EGE A;  1SKU B;  4DA4 A;  1H8K A;  2CYZ B;  5LL6 S;  2CZ7 B;  2I2L A;  1QW1 A;  3CC4 A;  2QEX Q;  4FIB A;  3X28 B;  1T0J A;  3TEE A;  1VQO Q;  1X6O A;  2OTJ Q;  2CKK A;  3CCR A;  1D3B A;  2A28 A;  2RD1 A;  4ZTF A;  1M90 C;  2O9S A;  1M1F A;  2YLB A;  1BI3 A;  3L2R A;  2E65 A;  2QA4 T;  2J06 A;  4R56 A;  1E6H A;  3CCJ A;  2DK3 A;  1YIJ T;  3FIF A;  4XTZ A;  2RQW A;  3QKJ A;  1QLY A;  4FYX B;  2BE7 D;  5GAM e;  2J6K A;  2YLC A;  1AHJ B;  1K9A A;  2CZ1 B;  1G8X A;  3PFS A;  4RTV A;  1VQ8 A;  3RBB B;  2E10 A;  1JQQ A;  1MUZ A;  2F1L A;  4XTW A;  4C0D C;  2B8A A;  2JN0 A;  3HKS A;  4MDX A;  3V7C A;  2NUP B;  4OMO A;  4M7D G;  2V1R A;  2GBQ A;  4OMP A;  2DE0 X;  2DET A;  1W4S A;  1GXI E;  1FWZ A;  2KNB B;  1YN8 A;  4A4K A;  5GMK j;  3QBY A;  1SPK A;  4IKF A;  1YI2 T;  3I55 Q;  3G6E Q;  1WHM A;  3MPU B;  1N27 A;  1G3T A;  1BIA A;  1YJN Q;  2HQE A;  1QVG S;  2QA4 Q;  4OML A;  3UWN A;  2ROL A;  3PIP A;  4M78 F;  4K11 A;  4A4G A;  3PNW C;  1GL5 A;  3OB9 A;  1N8R U;  5A0L A;  4Z02 A;  2OTJ T;  2DXU A;  2PVD B;  2FRW A;  3PTA A;  4X9C A;  2DL7 A;  2CH4 W;  3H41 A;  4F7U E;  3CC2 A;  2KMT A;  1VQM Q;  1JEG A;  2FPE A;  4GLK A;  1ABQ A;  2GQV A;  3X24 B;  4C92 A;  4DBH A;  4QT7 A;  4BE2 A;  2O4X A;  3EHR A;  3I35 A;  4WF2 A;  3CD6 A;  3A8O B;  4HT8 A;  2GQI A;  5J26 A;  4J8O A;  5IN1 A;  1M3A A;  2QYZ A;  3S3N A;  1OPK A;  5GMK e;  2HNI A;  3EGX A;  2DPP B;  2V8I A;  2F2W A;  2X4W A;  3EFS A;  4HA8 A;  2FPD A;  5CKB A;  2HL5 C;  1ZSZ C;  4BUG A;  4F16 A;  3KXT A;  4RG8 A;  1WZO A;  2NUP A;  5GAM j;  2DL5 A;  1AWJ A;  5IHK A;  2MMP A;  1ACM B;  1ZHI A;  1YJW Q;  3PT9 A;  1K73 C;  1WQ7 A;  1SHF A;  1UJY A;  2D6F A;  1X6B A;  4XU1 A;  2XKO C;  3LH5 A;  2CZ6 B;  5FRO A;  2EYY A;  2DAQ A;  1M2V A;  3OYK A;  2KRN A;  4GBQ A;  3RR6 A;  4JJD A;  1K9M R;  3OSV A;  3QZ5 B;  3OSS C;  1H3H A;  3I5R A;  1VQ7 T;  1YNZ A;  4PJO E;  1Q82 C;  2X51 A;  3I55 T;  1YCS B;  1VQ5 Q;  3JV3 A;  2JW4 A;  4EMK A;  3M0P A;  1S1N A;  4C0G A;  3QO3 A;  2RHY A;  5GMK h;  2PUK B;  5GAO r;  1ZBJ A;  2JZ2 A;  2EBP A;  4AT1 B;  1N9R A;  3OYL A;  2E1H A;  1IHW A;  3QXE B;  2Y4X A;  3UT1 A;  2EPD A;  3A5Z B;  2KEA A;  4BI8 B;  2X4Y A;  1C0M A;  2GGR A;  4M7D C;  2FEI A;  1VQN Q;  3INZ A;  2ZPH B;  3VKI A;  1Q7Y C;  1AT1 B;  4JS5 A;  2MAM A;  3ZBD A;  4IUU A;  1RAA B;  2QGG A;  2ZPI B;  1YIJ Q;  3V7R A;  3OMC A;  3FC3 A;  3X26 B;  2KDS A;  3BY7 A;  2LX9 A;  2L3Q A;  1HJD A;  2OTL A;  1X01 A;  3I55 A;  2JT4 A;  2P84 A;  4FT2 A;  1BCO A;  4OB1 B;  1QKW A;  1WNL A;  3THK A;  3GP8 A;  4HCB A;  3L2Z A;  1VQM A;  2DTH A;  1VQ5 A;  4M7D F;  3M4Y A;  2RPN A;  2XK0 A;  5IXF A;  2EJG A;  2PZ1 A;  2K5I A;  2JJ9 A;  3HRT A;  3NMZ C;  2CH4 A;  2RJC A;  1FMK A;  4J9C A;  5FU6 C;  4J6W A;  3RDV A;  1ABO A;  2DF6 A;  3SWN A;  3QG1 A;  2AK5 A;  2F69 A;  3M4G A;  4C92 D;  1WFW A;  3RMQ A;  4M7A F;  4OP0 A;  5FU7 B;  2C06 A;  2L89 A;  2QI2 A;  1SSH A;  1BCM A;  2PTK A;  3LW5 E;  4FT4 A;  3VRY A;  5ECA A; 
#chains in the Genus database with same CATH homology
 2FHD A;  2PQW A;  3SDZ A;  3QDR B;  2KVQ G;  5CKH A;  1Q81 U;  1VQ4 T;  2GFA A;  3S3O A;  5GAN 6;  2ZPF B;  3QYH B;  4OMF B;  1M8V A;  5LJ3 j;  2QQA A;  1VQ6 T;  2ZPE B;  2LNV A;  2QQS A;  4ME7 A;  2DEQ A;  4MZM A;  2JOY A;  3MEV A;  4C5G A;  1Q7Y U;  3NTK A;  1Q81 C;  5HK0 A;  3DLM A;  2X35 A;  4M7D A;  4LDW A;  4OGE A;  4M7A B;  3RUX A;  5HY6 A;  2QQB A;  1XTD A;  2EQJ A;  5CKF A;  3I56 T;  4M77 D;  2IVW A;  4LDU A;  3CCJ T;  3CCU T;  4ATO A;  2RO0 A;  5LJ5 f;  3P8H A;  3M58 A;  4NL2 A;  3JRZ A;  3JCM h;  1S72 A;  4LD6 A;  1XOV A;  2L3R A;  1Q86 U;  4M77 B;  1KQS S;  1NPP A;  3CEY A;  1JB0 E;  3C95 A;  4LDX A;  1B34 A;  1D3B B;  2D0Q B;  4QQD A;  5GAO q;  5GAN 7;  2G3R A;  5KH6 A;  4M78 C;  4PNO A;  1VQP A;  3CC2 T;  3FDR A;  1X75 C;  5GAN 4;  4ELY C;  4M78 E;  5LJ3 d;  4OB3 B;  1HK9 A;  4C8Q A;  5GAM d;  2Y90 A;  4JS4 A;  3FJP A;  1I8F A;  4B9W A;  4M77 F;  4L5G A;  4PJO F;  2DZ9 A;  4QW2 A;  3CXC A;  3CCS A;  2LT4 A;  3TU4 K;  1XNI A;  1VUB A;  3X20 B;  2VC8 A;  1G3S A;  3E9G A;  3WVE B;  1M1K U;  1M1G A;  4M75 E;  2LTO A;  2M16 A;  4PLI A;  2CZ0 B;  2L5Q A;  2WSC E;  3Q1J A;  4J83 A;  1VQ4 A;  2BIV A;  4QVC A;  3DB4 A;  3VJP A;  5CKD A;  5LJ5 h;  3CCL T;  1O9S A;  5GAM h;  4LD9 K;  2QA4 A;  5LJ5 e;  3OYM A;  1BKB A;  4ZN1 A;  1UGQ B;  3BW1 A;  1QVP A;  4M78 G;  1JJ2 S;  1FX7 A;  3UDC A;  2DIG A;  2QDY B;  4JLI A;  1KQ1 A;  1KD1 C;  1JBM A;  3QZ9 B;  3JCM X;  2XDB A;  3CBO A;  1QP3 A;  2DTI A;  3G71 T;  3CCU A;  4D6W A;  4BDY A;  2RK2 A;  3OBW A;  2RK1 A;  4ZGJ B;  1PSF A;  2M1H A;  2RJE A;  2WSF E;  3N5B B;  2RI5 A;  2BKD N;  3E1S A;  3OYN A;  3QPH A;  4M77 C;  4XQ3 A;  1M9S A;  4IUT A;  3JCM P;  5GAN 2;  5GAN h;  4JRQ A;  2X4J A;  2YRV A;  1BIB A;  2KQW A;  3CPW S;  4A4H A;  3G71 A;  5IT9 E;  5KCO A;  1LJO A;  3VU3 C;  3MEU A;  3MHX A;  2LRQ A;  4A4F A;  1VIE A;  4RKU E;  1UEB A;  1ZQ1 A;  3CCS T;  4M75 G;  4R55 A;  3JCM V;  1M4Z A;  1UB4 A;  2EKO A;  1OZ3 A;  3BDU A;  3G7Z A;  3KBG A;  3PMT A;  2DIQ A;  2GF7 A;  2P4T A;  2RI2 A;  2DD4 A;  4F7U A;  3JAM E;  4XU3 A;  3OY9 A;  1VIF A;  2ZGW A;  1YJW T;  5M9O A;  2E5Q A;  4C5I A;  3FEO A;  2EQU A;  1QVG A;  2K2V A;  1WPY A;  3MEA A;  2QQR A;  4VUB A;  4HCC A;  4TVR A;  2KAF A;  2RJD A;  2AHJ B;  2E64 A;  2L8D A;  2GCX A;  2PUO B;  5KE2 A;  3OYB A;  4OVA A;  2KK4 A;  4M75 C;  3L2V A;  4F7U F;  3LGL A;  5GAN f;  1YJW A;  4BDZ A;  1YHQ A;  5FRM A;  4BD3 A;  2FL7 A;  4JDS A;  4L59 A;  1IRE B;  2LDM A;  3H8Z A;  4XTU A;  3JCM c;  3G4S A;  1ZBX A;  1NJI U;  4PJO C;  4EPC A;  1WJS A;  3V8J A;  3J81 E;  4F7U B;  4BY6 B;  3CCQ A;  3JB9 I;  3NTH A;  3OW2 S;  2EYQ A;  2MWO A;  4J6X A;  1OZ2 A;  4C92 C;  1M1K C;  3M9Q A;  4J6Y A;  4M75 A;  3DLL A;  1VQ7 A;  3PMI A;  3A8M B;  1NE8 A;  4ELZ C;  3JCM e;  3EFR A;  4FSX A;  4C5E A;  1QVF S;  3P8B B;  4PLL A;  4E7I A;  2VGM A;  2RHZ A;  4PJO D;  3JB9 F;  4PJO G;  2HQX A;  3ZEH A;  1UGR B;  3A8G B;  4QVD A;  2O4X B;  1TH7 A;  5LJ5 g;  5CK9 A;  4YTL A;  5D6X A;  4PJO B;  3LLR A;  1VQK A;  3OYA A;  5GAO m;  1B34 B;  4E7K A;  4DA4 A;  4ZTJ A;  4E47 A;  5KCH A;  3HSB A;  4M7D D;  3LWH A;  3HL8 A;  2CYZ B;  2XIC A;  5LL6 S;  3QSU A;  2ZPG B;  4M7A A;  2RA2 A;  2CZ7 B;  3QHS A;  2I2L A;  4Y28 E;  3C94 A;  2K57 A;  2WAC A;  1VQM T;  4EMH A;  1QW1 A;  3CME A;  1WGS A;  3CC4 A;  2WSE E;  4RG2 A;  4FIB A;  3X28 B;  1VQ8 T;  2DXC A;  1R8O B;  2VYT A;  4M77 A;  4N4H A;  3TEE A;  1X6O A;  1BI1 A;  2CKK A;  3CCR A;  1D3B A;  4JRP A;  1Y71 A;  2RD1 A;  4LDY A;  2RI3 A;  4ZTF A;  1M90 C;  1NPR A;  1M1F A;  3PIO A;  3FB9 A;  4CI0 C;  1BI0 A;  2YLB A;  3PGG A;  2EWN A;  1OI1 A;  1BI3 A;  1M90 U;  3OQ5 A;  3L2R A;  3G4S T;  2E65 A;  2RH2 A;  4OB0 B;  2QA4 T;  4HT9 A;  4R56 A;  3LH0 A;  1KC8 U;  4C8Q D;  4C8Q G;  5HKC A;  2QEX A;  3WXM B;  4BE1 A;  2K5L A;  2H3J A;  3L2Q A;  3QJ6 A;  1KQ2 A;  1KG1 A;  2MF2 A;  3CCJ A;  3OYI A;  5GAO l;  2DK3 A;  3S6W A;  3CCM A;  4NS5 A;  1YIJ T;  3RES A;  4ZGE B;  3FIF A;  1KC8 C;  2XI9 A;  4KUL A;  1XQH A;  1QP2 A;  4XTZ A;  3CD6 T;  4M7A D;  3CBP A;  3QKJ A;  4J7F A;  2E70 A;  1YJ9 T;  1NJI C;  3CPF A;  3HPW A;  4A54 A;  3MP8 A;  5DY9 A;  5GAM e;  2LC4 A;  2YLC A;  1AHJ B;  2CZ1 B;  1FXX A;  5GAM f;  3A8L B;  3V8K A;  3PFS A;  3CCE T;  2RHI A;  1VQ8 A;  1K8A C;  5FRN A;  5CR2 A;  2E10 A;  2HBP A;  5DLO A;  4M78 D;  3M56 A;  3CC7 A;  4C5H A;  3V8L A;  3G6E A;  1O75 A;  1YJ9 A;  4XU2 A;  4XTW A;  4C0D C;  3BDL A;  3JCM g;  2B8A A;  2EFI A;  2DXB A;  2JN0 A;  3HKS A;  5L8R E;  3V7C A;  1YJN A;  1K8A U;  4MDX A;  2K3Y A;  4M7D G;  4KT0 E;  4EMG A;  2P0K A;  3E19 A;  3OS0 A;  2IG0 A;  3VUZ A;  1N6A A;  2M9U A;  2VUB A;  1GXI E;  1W4S A;  1FWZ A;  2FVU A;  3EAE A;  4E7J A;  3L42 A;  4DQ2 A;  4EMK B;  4A4K A;  5GMK j;  5GAN g;  2R58 A;  3QBY A;  5CCA A;  2XDP A;  3M57 A;  5CQX A;  1K9M U;  2M0O A;  4IKF A;  5AYF A;  4DOW A;  4M7A E;  4XTY A;  1U1S A;  1VQ5 T;  5GAN 5;  1YI2 T;  1YIT T;  2XID A;  1U8R A;  3NFC A;  1N27 A;  3MP6 A;  1K9M C;  1G3T A;  2LVM A;  4C0D B;  2RHU A;  4C0F A;  1BIA A;  2ZCF B;  2DJZ A;  2HQE A;  1BI2 A;  1QVG S;  3RIR A;  1DJ7 B;  4XAX B;  3RMS A;  4M7A C;  2DO3 A;  3UWN A;  3CCQ T;  1I4K 1;  3PIP A;  4M78 F;  4M78 A;  3JCM J;  4A4G A;  1Y07 A;  3PNW C;  1G5V A;  2JTM A;  4N4G A;  5GAM g;  5LJ3 h;  5A2Q E;  3OB9 A;  4M77 G;  3CCE A;  3OYH A;  3JCM W;  5A0L A;  3J80 E;  1N8R U;  4Z02 A;  2X4X A;  5I2S A;  3GLX A;  2DXU A;  4OB2 B;  5HK3 A;  3OS5 A;  4A53 A;  2PVD B;  4NL3 A;  1VQO T;  2OTJ T;  1W2B A;  4BY6 C;  1YCY A;  3PTA A;  2KY9 A;  4X9C A;  2DTO A;  3BFM A;  2EQK A;  4F7U E;  2P0Q A;  3OYE A;  2KMT A;  1VQP T;  2FB7 A;  3RKW A;  3KUF A;  2BUD A;  5GMK l;  4M7A G;  3SB2 A;  4M75 B;  2LQ8 A;  3SFM A;  3OYD A;  5GMK i;  4GLK A;  2V8K A;  4KUD K;  2MI6 A;  1Y96 B;  4KBM B;  1RL2 A;  2PU9 B;  1U1T A;  2GQV A;  4O5V A;  5KE3 A;  3X24 B;  4C92 A;  5LJ3 e;  2K5F A;  1QVF A;  2EIF A;  2FYK A;  5CVI A;  4N0A C;  3L2W A;  3G6E T;  3F70 A;  2A3L A;  4OGC A;  2RM4 A;  2VV5 A;  4BE2 A;  2O4X A;  4RMO A;  5FLX E;  2R5A A;  1OYX A;  4M78 B;  4WF2 A;  4C92 B;  4PJO A;  3OBY A;  4LDV A;  3GF5 A;  3A8O B;  4HT8 A;  3CD6 A;  2E6Z A;  3HP9 A;  2DKG A;  3J7A F;  5J26 A;  5LJ3 f;  3C12 A;  3HRS A;  3QUI A;  4J8O A;  4CRI A;  5IN1 A;  4ZGD B;  1VQN T;  4M77 E;  3OYG A;  1I81 A;  3RKY A;  1LNX A;  1H3Z A;  3S3N A;  5GMK e;  4E7H A;  2RB6 A;  5LJ5 d;  2HAX A;  3E9F A;  2HNI A;  2QXF A;  4Q5W A;  4A4E A;  5GAN e;  5FU6 B;  1M5Q 1;  4DOV A;  2A7Y A;  2DPP B;  3A8H B;  3JCM Q;  3M54 A;  5GAN 3;  2V8I A;  2VGN A;  3VV0 A;  2X4W A;  3EFS A;  4HA8 A;  1BYM A;  4F7U G;  3CC7 T;  3JSC A;  2E12 A;  4JJN K;  3HFO A;  2NLU A;  4XU0 A;  4MDW A;  3WVD B;  1KHI A;  3RKX A;  5CKB A;  3MO8 A;  3CBM A;  1KQS A;  3R6O A;  4MZP A;  1KHC A;  4BUG A;  3OYJ A;  3KXT A;  4V2S A;  1V29 B;  4IUQ A;  4MZT A;  4RG8 A;  3M5A A;  3ME9 A;  4FM4 B;  3GOX A;  4RCB A;  5GAM j;  3M59 A;  4X9D A;  5LJ5 j;  4J5Y A;  4FU6 A;  3MET A;  4II1 A;  1LOJ A;  2CS7 A;  2MMP A;  1ZHI A;  3ER0 A;  3H6Z A;  4M75 D;  4PL6 A;  3OYF A;  4FL6 A;  3PT9 A;  1YI2 A;  1YIT A;  1K73 C;  3DB3 A;  3VYH B;  1WQ7 A;  3RER A;  1MHN A;  5CO7 A;  5GMK m;  3L2U A;  2D6F A;  4XU1 A;  2R5M A;  4QVZ A;  2XKO C;  2XD0 A;  3FRN A;  4BI3 A;  2CZ6 B;  4OF1 A;  3M55 A;  2MWP A;  4XTV A;  5FRO A;  5C0M A;  3S3M A;  1K73 U;  2EJ9 A;  5I2M A;  2DAQ A;  2PVG B;  4C92 F;  2ZZD A;  3OYK A;  3OYY A;  4BI4 A;  5CKE A;  3QYG B;  2F5K A;  1UGS B;  2DZC A;  1MGQ A;  3MEW A;  3MCA B;  3OSV A;  1VQL A;  3GNF B;  3JCM b;  4M7D E;  3QZ5 B;  3HFN A;  4IUV A;  3GPL A;  4N4I A;  3JB9 G;  2QEX T;  2XHC A;  1VQO A;  2HD0 A;  1I5L A;  3OSS C;  2XU8 A;  1Q82 U;  4RCC A;  2OAU A;  2KSS A;  2JUF A;  4J7I A;  2QTX A;  4XK8 E;  1VQ9 T;  1VQ7 T;  3CC2 A;  5D6W A;  3QII A;  3GIB A;  3HRU A;  4JRI A;  3HHT B;  1Q82 C;  2VXF A;  4C8Q C;  3I55 T;  3CMA T;  4PJO E;  5DM7 R;  2V8J A;  2VXE A;  4EMK A;  5DLQ E;  3FLG A;  4C0G A;  2LCC A;  2LQK A;  3LX7 A;  3P8D A;  4M75 F;  3QO3 A;  2RHY A;  2E41 A;  2PUK B;  5GMK h;  5GAO r;  4L6V 5;  2JZ2 A;  5A0D A;  3JB9 H;  1S72 T;  3LYI A;  4M7D B;  2O01 E;  2JNG A;  1N9R A;  3OYL A;  2E1H A;  1VQN A;  5A0G A;  3GNG A;  2QQ9 A;  3QXE B;  2Y4X A;  2YHT A;  1UGP B;  3UT1 A;  2DXT A;  2DD5 A;  4C92 G;  4ZN3 A;  3CCV A;  4C8Q E;  5CAI A;  1JRI A;  3A5Z B;  1VQK T;  1YIJ A;  1P92 A;  4EMK C;  4GY5 A;  3M53 A;  4NOY A;  2P0P A;  4EDU A;  3VUB A;  2R57 A;  1Y96 A;  3LGF A;  1N9S A;  1G3W A;  3O8V A;  5J39 A;  3ASK A;  4BI8 B;  3OA6 A;  2X4Y A;  3JB9 D;  3UPU A;  5EG2 A;  2LT1 A;  4BB7 A;  4C8Q F;  3JCM d;  3L1A A;  4HCZ A;  3JB9 J;  4M7D C;  4E7L A;  3INZ A;  3QJY A;  2JVV A;  2ZPH B;  3VKI A;  5LJ3 g;  4BE0 A;  1Q7Y C;  4JS5 A;  5GAO p;  3CCL A;  2MAM A;  3CXC S;  4MML A;  1HXD A;  3ZBD A;  1VQ9 A;  4IUU A;  3TRE A;  3CCR T;  2ZPI B;  5FU7 C;  4C8Q B;  3V7R A;  1VQ6 A;  3OMC A;  3FC3 A;  5GAN d;  3X26 B;  5GAN j;  2KDS A;  2Y4Y A;  5CQY A;  3BY7 A;  2LX9 A;  3CCM T;  1Q86 C;  4BAC A;  1YHQ T;  1JJ2 A;  3SWN C;  2JTF A;  2OTL A;  2D9T A;  1G3Y A;  4X34 A;  3CMA A;  1H64 1;  4IUP A;  1X01 A;  3I55 A;  2OTJ A;  4HKE A;  3TCJ A;  2PVO B;  4FT2 A;  3LWI A;  1EIF A;  4OB1 B;  1WNL A;  4JLG A;  4MMK A;  3GP8 A;  3CCV T;  3L2Z A;  1VQM A;  4HCB A;  2DTH A;  4QQ6 A;  5CIU A;  3CME T;  2EAY A;  3CC4 T;  1VQ5 A;  3SD4 A;  4M7D F;  2EJF A;  3M4Y A;  4N0A A;  2DVE A;  3URG A;  2CGH A;  4Y91 A;  3V7S A;  5C6S A;  1VQL T;  2ZPB B;  2XK0 A;  1WJQ A;  2EJG A;  5GAO n;  4PKC C;  3OS1 A;  2K5I A;  4C92 E;  2XDD A;  3OS2 A;  3OYC A;  3NTI A;  3SWN B;  3OMG A;  3HRT A;  1WQW A;  1W2B S;  4QQG A;  2RJC A;  4JRK A;  4O6J A;  3ZFJ A;  5IAY A;  2E6N A;  1YJN T;  5FU6 C;  5I21 A;  1WJR A;  4J6W A;  4C0Z A;  3SWN A;  1YBY A;  3MP1 A;  3QG1 A;  3AHU A;  4XTX A;  2F69 A;  2RHX A;  3M4G A;  4C92 D;  1KD1 U;  5D6Y A;  3RMQ A;  4KUI A;  2F5T X;  4M7A F;  4OP0 A;  5FU7 B;  4P5N A;  1N8R C;  3CPW A;  2K4Y A;  2LCL A;  4B9X A;  2C06 A;  2K3X A;  1SSF A;  4JUV A;  3JCM f;  2L89 A;  2GFU A;  2QI2 A;  2EQM A;  3T9N A;  3VYG A;  3LW5 E;  1Y7X A;  1RI0 A;  4FT4 A;  2OTL T;  2XG8 D;  4IUR A;  2RJF A;  3C4S A;  3DKM A;  4UC4 A;  5GAN 8;  1PSE A;  1NZ9 A;  3OW2 A;  3X25 B;  1IZ6 A;  5J3B A;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...