1ZI6A

Crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 81
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi6A00
1ODTC 4KE9A 5HFNA 3G7NA 4P08A 3WKBA 3PFBA 2WG1A 3DNMA 1HDEA 5CH5A 2HRRA 1XZBA 1SC9A 3I2FA 2DQYA 3H19A 1XZDA 4OSEA 5JASA 5FPQA 1VLQA 2O7VA 3HC7A 1Q83A 2PSEA 3I1YA 4X00A 5C8ZA 3VVLA 1QONA 3ZLTA 1O6GA 2XQGA 2O2HA 4G5XA 3S2ZA 1UKBA 5D3ZA 2X8BA 1QGED 3ANTA 2OXEA 2YYSA 2K2QB 2Z8ZA 4EY7A 5ALKA 2ZSHA 3K2IA 5BV7A 4DM7A 3GZJA 1VE7A 3CXUA 1QLWA 1XZIA 4X6XA 2WFLA 1K4YA 2HM7A 1R9MA 3RM3A 2OQVA 4B80A 5LKAA 3OURA 4BYMA 1CUEA 4FHZA 1B41A 4BC1A 4KE6A 4V2IA 3IA2A 2WUFA 2XMZA 3DCNA 4GECA 3I2JA 3W9BA 5K3DA 2ZVDA 4L3WA 1XQVA 1ZD4A 3SC2A 5DTIA 3IURA 2CBGA 4XIIA 2D0DA 5A6VA 2BJHA 4CFSA 1UK9A 1E5TA 2J3DA 2PM8A 2PKYX 2BUCA 4Q34A 3NUZA 4HZGA 5JZSA 5LZ5A 3ANSA 4ZWNA 4W9RA 5AM0A 3C70A 4F60A 5HQ3B 4ROTA 1UZAA 4NZZA 1LZKA 5ISMA 3FYUB 1ZJ4A 2GBFA 5AK6A 3I1IA 2HFJA 2JGJA 5FRDA 3D4LA 4UFPA 5FXMA 3HI4A 4N8EA 3FOBA 4Y2TA 2YH2A 2JEZA 5K3FA 4OB7A 3O0DA 5ALIA 2DHEA 1ACLA 5CBKA 5J3JA 3AJAA 3AILA 1LNSA 2AJBA 1LPMA 4EHBA 5JYCA 4EY4A 4OUKX 1TCCA 2JIDA 3O4HA 4N5IX 5JZ9A 5LIPA 1VZ3A 1XZKA 1TK3A 2VF2A 4GHWA 4BCDA 3Q0TA 1P0MA 1IUPA 4J0GA 4JUIA 2X5XA 1VKHA 3STTA 2ORYA 4UBKA 1CUXA 3RLIA 2AJ8A 1Q84A 2PVSA 2RGUA 1PJAA 2DQZA 3ESBA 4W1SA 2WU3A 1CUZA 1YR2A 4WFIA 2WILA 3BDVA 2ZSIA 4J0HA 4CIAA 1IUNA 4AZ0A 5C8VA 4GXNA 5HF5A 4PV7A 3KD2A 5AO9A 1GZ7A 4B0PA 1DX6A 3G8YA 4FTWA 3QH4A 1ZGBA 5CT5A 1YSCA 1B6GA 2JGEA 4DMCA 3WWEA 1VXRA 2XUFA 3VDXA 2XMRA 1UKCA 4G4IA 4Y2RA 1Y7HA 1ETHA 4KRYA 4E14A 7YASA 2WFMA 4GI1A 4DMHA 1IZ7A 1LLFA 3L1JA 5EI5A 5FLKA 1ZD2P 3A2NA 5LZ4A 3H2JA 1XLWA 3AZQA 5A7GA 3O4IA 1QIHA 5HF9A 1ODSA 3WI7A 2Y2VA 1CUFA 4QDUA 3HZOA 5AM1A 3DD5A 3G0GA 1YCDA 4Q3KA 3JW8A 1IUOA 4X97A 4C6HA 3STWA 5E4YA 1CUYA 4GWLA 4X91A 3AIMA 3OC0A 3QMVA 1XZJA 2OG1A 3IULA 5ALOA 5IKXA 4ARBA 1A7UA 1K8QA 5K3BA 1GPKA 1ZD5A 4FWBA 3HYSA 5ALRA 1MNAA 3IDAA 1CQZA 1N8SA 1CRLA 2EDAA 2CMFA 4TGLA 2IITA 2XUJA 3DYIA 3VISA 2QJWA 5A7HA 4GLBA 1F0NA 4B9AA 3JWEA 4Y2YA 1UK6A 3C8DA 4OB6A 4QZVA 2QKYA 5T4HA 4DLNA 3R3XA 3AINA 4RE6A 4AXBA 3H2KA 5FDFA 1BE0A 1E8MA 1WM1A 3STXA 1ISPA 4JH0A 1WCYA 4DMFA 2DR0A 3WWPA 4X92A 3QPCA 1CQWA 1AQLA 2PSJA 3DKRA 1QZ3A 5ALNA 2XQKA 4BDSA 2C5GA 5AM3A 4FOLA 4OYLA 5AI6A 5BWBA 1Z68A 3CN9A 1AURA 5D3KA 2HA0A 3G9TA 1K6EA 2ZYRA 1FFAA 5CW2A 1RP1A 4HS9A 4Q05A 3JYHA 3H0CA 5EHNA 5JAPA 2PX6A 4BZZA 1TIBA 1EDBA 1ZGCA 3W2TA 1H2ZA 2WIKA 1C7JA 3FVRA 1W52X 5JIBA 2HA2A 2Y1KA 2B9VA 2H7CA 3HJUA 3VVMA 2OAEA 4Y2PA 4YX9A 1G66A 3BWXA 3MUOA 2C0PA 1QFMA 5AH0A 5FUMA 1GT6A 2YASA 1EA5A 2HA5A 5JARA 1OXMA 4HTAA 2ZJ6A 4X3CA 4H7FA 3AIOA 1LPSA 2VTVA 3HSSA 1ACJA 1LPOA 2VA9A 5HQ3A 4INZA 1S8OA 4FLMA 1F6WA 4FLEA 4KAJA 2QZPA 4UBJA 4UUQA 3FYUA 4OU5A 5ALUA 3W05A 1K5PA 4LHEA 5AKLA 1XFDA 3UUEA 4I19A 4QDTA 1EK2A 2BFNA 3PF8A 3PF9A 5AOAA 4PSCA 2B61A 3PICA 2XLCA 3E1GA 1CUGA 1W4LA 4MXDA 3WL8A 2H1IA 2O7RA 4OU4A 2QVBA 3ED1A 5BOVA 3H1AA 2RAUA 1M33A 1ZICA 5YASA 2WFZA 5CURA 4BB0A 4FNGA 3BIXA 3I2HA 3BL8A 5ALTA 4DTCA 5ALHA 2QMQA 2VT6A 2RONA 5K3AA 2PUJA 2PSHA 4KAAA 4AB1A 2EEPA 1XZMA 3OM8A 5I8PA 2WU4A 4P92A 2HHAA 3SX4A 3WK5A 2OPHA 3WWCA 4KE8A 3UUFA 3TRDA 2ECFA 4ZGBA 3M83A 1SOMA 1A88A 3D2BA 5IVIA 3C6YA 4G9EA 2JGIA 3DLTA 2GYVA 5SYNA 5ALVA 3ILSA 3IUNA 4QDXA 3D59A 2XUIA 3KOOA 3C87A 3HABA 3AZOA 2BUBA 5AI0A 2QTBA 4W1RA 1XZFA 5C81A 3O9VA 5IVKA 3RK4A 4JNCA 4UPDA 1W76A 2HDWA 2JEYA 1XROA 1GKLA 1Q0ZA 3WIBA 1W1IA 3H2GA 3EQ9A 3C5WP 4B81A 1UK7A 4YASA 5FPPA 4YPVA 2ZYHA 1CUIA 1ZD3A 3R41A 1U2EA 1XKLA 4P9NA 3I28A 1MT3A 3WK6A 2BAGA 4LKOA 2H9YA 2ZJFA 3BIWA 1UOOA 4BATA 1GGVA 2WUDA 5K5EA 2Y6UA 1R50A 4BCCA 5ALXA 2WTMA 4WCVA 4OYYA 4BRZA 1XQWA 2ONCA 3G9UA 3AUKA 3D7RA 4H7DA 5E4TA 2ROQA 3CN7A 5AIBA 4H7EA 2ACKA 5H3HA 2XI4A 5EIHA 3WJ2A 1H22A 4CCYB 5AOBA 1MNQA 5ALDA 1WB5A 3B12A 4U2EA 5EHXA 3IUMA 1QFSA 2JGKA 3PI6A 3UMJA 5KWIA 4J03A 2X76A 4EUSA 1X2EA 1MTZA 3F98A 4H18A 4H7HA 1MX9A 2I3ZA 5AK3A 1WPXA 3D0KA 4MWTA 3V9AA 2OCIA 1WB4A 2QRUA 5CXXA 1L7QA 1J07A 3MVEA 5CT6A 5ALWA 4DMKA 3F8SA 5AK4A 2OCLA 4BAUA 1Y7IA 1D07A 5DYYA 4RPCA 2RHWA 5JAHA 4JYMA 3Q8WA 3A70A 1AUOA 1H2XA 1DINA 1UFOA 2B20A 3A2MA 4EZIA 3P2MA 3WKDA 4UBOA 1YS2X 4DNOA 3WWDA 3K6KA 3IUQA 2XQJA 1XZGA 2NW6A 1ZI6A 3C45A 4BVJA 5AM5A 1J2EA 3FYUC 4PF1A 2RHTA 1RWQA 3SK0A 4XX1A 1EX9A 2JGFA 4X7BA 2WJ3A 3C6XA 4QWWA 1MX5A 2QXTA 1TCBA 3LS2A 5D6OA 1MJ5A 4RGYA 2WLSA 2Y6VA 3H18A 4MWSA 1MX1A 3FWHA 1VE6A 3G0DA 2WIDA 5HFAA 3HRHA 1EB9A 3V1MA 5DJ5A 2B4KA 1ZOIA 5AKEA 2OCKA 1QO9A 4I4CA 1EHYA 4Y2QA 4EY5A 4QA9A 3PUHA 1GXSA 3HEAA 4BBZA 4KJXA 2WJ4A 2PL5A 1EVEA 5T4BA 1UOQA 2WHPB 4HXFB 5LZ8A 4G8BA 4M0MA 1JKMA 1J06A 2DSNA 1SFRA 5JD5A 4X93A 1LPPA 2XMDA 2BGNA 1P0PA 1THTA 1QIDA 4WJLA 3M3DA 1AGYA 2HRQA 2O2IA 1BCRA 2G4LA 1U8EA 3H2HA 3OTQA 3HLKA 5F4ZA 2XB6A 1E8DA 1QIJA 1K63A 2GBCA 3I2IA 1E89A 5AIAA 3D3NA 2QUBA 1EINA 4PO3X 2HU5A 2XMQA 5A7FA 1CPYA 1GPNA 2R8BA 4M0FA 1AC5A 1R4ZA 5JATA 2JGMA 3BE8A 3LIPA 3I6ZA 5AM2A 3TGLA 4QDZA 3WK8A 2PBLA 2W6CX 3ZPXA 1UXOA 4GBGA 4J0KA 4H77A 2GZSA 2GYUA 5ALEA 1FFCA 2Z8XA 1ZI8A 4IO0A 5HKBA 4CG2A 3G0CA 3ZWQA 3DYVA 4AMZA 5CXUA 3R40A 2XT0A 1R3DA 4K6GA 2HA6A 3HACA 4ITVA 4OD0A 1Y37A 3VKFA 2VEOA 3DKKA 1IVYA 4B85A 5EHZA 2V9ZA 1BEEA 4J7AA 4W63A 2HU8A 4J3JA 2XQFA 4L9AA 3FSGA 1YS1X 1YB6A 4DNQA 1G42A 3ZLUA 1G5FA 3QPAA 4UBIA 2XUQA 5EGNA 3IVMA 2OGTA 3FSGD 2LIPA 4Q82A 2DHCA 2PSFA 1DQYA 4UHHA 4F5ZA 2FJPA 2RIPA 2JF0A 3SWWA 3DOIA 4C89A 4DYHA 3NWOA 2V97A 4CG1A 4BTVA 4BRSA 2C7BA 3M81A 3R0VA 3CCCA 1R9NA 3QMMA 1EXWA 2WUGA 5I7UA 4OB8A 5ALZA 2AJLI 1XRNA 5JALA 3F96A 2QOEA 5AHXA 3FBWA 4IH4A 1GQSA 3WK4A 2QJRA 2ZYIA 5D7BA 4QE3A 5LP1A 2RI6A 4UHFA 2QXUA 3DL4A 5KWJA 3I2KA 4P93A 4J0IA 5T4EA 2ES4A 1A8QA 1TKRA 4CCYA 1XRRA 4L72A 3BJMA 2E3JA 4X95A 4C4XA 4EA6A 2VJDA 4A5SA 2XMBA 1JMYA 2FUKA 4B7ZA 4CIBA 5ALLA 2XUAA 3VJMA 3ZV7A 1JMKC 4I3FA 3I2GA 1WPRA 2BCEA 2JBWA 3KWFA 4PSDA 4C4ZA 4B82A 5SYMA 1CR6A 5E2IA 1UK8A 4DGQA 5AJHA 3O95A 4DSZA 3BDIA 1KU0A 5KREA 3STUA 1HLGA 1HKHA 4BCBA 3EQ7A 1XLUA 1XRLA 1XZEA 2QT9A 4E11A 3AFIA 1NU6A 1VOTA 4WDRA 2C5FA 3QVMA 1THGA 1ZIXA 4U2CA 4GDMA 4Q3OA 1E8NA 1BCSA 1LBSA 4D9JA 4OPMA 3D5EA 4KEAA 4Q1VA 3PUIA 2AXEA 1XRPA 1MAHA 2HFKA 2QM0A 5C7YA 3FCYA 3QZUA 1QIEA 4B84A 5DNWA 1PFQA 1XQYA 4BP8A 4KYVA 1VA4A 4DSAA 1YA8A 5ALSA 1IZ8A 5CRIA 4U2BA 1JI3A 2Z3WA 5AOCA 3QITA 4CCWA 4A16A 2XMCA 1A8SA 3I6MA 1LPAB 1X70A 1W6RA 2H7YA 3G0BA 2GBGA 3L1HA 5LZ2A 3BXPA 3KWJA 1AMNA 4K5QA 4NVRA 1SCQA 3GELA 1CLEA 4QLOA 1E66A 2HA4A 5JD4A 3WL6A 4Q3LA 4QNNA 3FVTA 4EY8A 2G5TA 4NMWA 1DQZA 1HPLA 3GBSA 2WUEA 5DYTA 3HXKA 4X94A 1ORWA 5E4JA 5I9IA 2WHPA 2OLEA 2WM2A 3WKCA 4FFVA 5ESRA 2XUKA 1T4MA 1YASA 3G9XA 1AZWA 3FNBA 4N8SA 3AZPA 3WMRA 1YAHA 3RARA 1USWA 3C5VA 5HF6A 5IH7A 3KDAA 2EDCA 3N0TA 4E46A 4WY8A 1L7AA 3V1NA 1LPNA 2Z3ZA 2HA7A 4Z49A 1MAAA 1DU4A 4J0CA 2BKLA 4K6KA 3V1LA 3VJKA 1BROA 2AJDA 1DT3A 3W04A 2DHDA 4X6UA 2ACEA 1LPBB 5AP9A 4TPKA 1BEZA 1DWQA 3WA7A 4BAZA 5ALPA 1XZHA 3T52A 1QE3A 1ODCA 3WWOA 3S8YA 1OILA 3U1TA 3QBJA 2OQIA 1LGYA 3R3ZA 2FJ0A 1AKNA 5AM4A 4Y2VA 2VJBA 4H7KA 4BZWA 1JU4A 5AKJA 4B83A 2HA3A 4FDMA 1CUCA 3ESCA 3C43A 1HBJA 4UHCA 3CCBA 2VT7A 3E3AA 4UFOA 4AN1A 4F21A 2Q0XA 4HVTA 1C7IA 4BVLA 2VJAA 3NOXA 4MYDA 3ZI7A 3K9BA 4MJ3A 4EB0A 3C6BA 3WIOA 2CB9A 1N5RA 1ZIYA 4X90A 4DNPA 2HADA 2YXPX 3PFCA 5KBYA 3FAKA 5CT9A 5AI8A 3G0IA 3R3VA 4Y7DA 5JZBA 1HQDA 1GQRA 5IVDA 1JFRA 3F67A 3L1IA 4KE7A 1FFEA 1SCKA 4U2DA 1XKTA 3TJMA 5JAUA 4MEAA 3V48A 1QIMA 3TEJA 1FSSA 3M82A 4XWGA 3G02A 3IB3A 4N5HX 1CVLA 3OOSA 2GYWA 3V1KA 4XJVA 1UWCA 4GEGA 4IHAA 3QM1A 5AKGA 2QR5A 4MQLA 3DJYA 4G4GA 1XQXA 3EIOA 3W9UA 2PPLA 1QJ4A 1CIJA 1CUVA 3OPMA 5BWCA 2HIHA 4KACA 5HZGA 2G63A 4BAGA 3WJ1A 4LYEA 3VXKA 2ZJ7A 2C0QA 2JGLA 3ESDA 1QIGA 1XZAA 5A71A 3WKAA 4IH1A 3WZMA 2PUHA 4DNFA 3W06A 1ORVA 3R3WA 5AKIA 1Q0RA 4PSUA 1C4XA 1VJ5A 4AX4A 1UT6A 1VZ2A 1AX9A 1JJIA 4J0JA 5DYWA 5FKJA 4WDQA 4BE9A 5JADA 2C58A 5A62A 1CUJA 3O4GA 5DTJA 3D2AA 1EVQA 1W75A 5DNUA 3DL7A 5EIEA 5AK5A 4AO8A 2CZQA 3X3HA 2CJPA 4WFKA 5AKYA 4FMPA 1U65A 3QPDA 3LIIA 5ALJA 1CUWA 3WQHA 4CI9A 1RYYA 5CTAA 4PNZA 4U2GA 3STVA 1XRQA 2VAVA 5HCUA 4B6GA 4S0XA 5AKZA 3FCXA 4BTLA 4BDTA 5JAOA 3GA7A 2VATA 4QEKA 2I03A 1EDEA 4KAFA 3GFFA 5EHQA 4AQDA 2H7XA 4RE5A 2BGRA 4E15A 3O9MA 2IIVA 2GBIA 1WOMA 5JD6A 2WIFA 2V98A 2WQZA 4HXGA 1QTRA 5CH3A 5LLSA 4J0DA 4M0EA 5ALFA 1KEZA 3FLBA 2XMSA 1U4NA 2QS9A 4HAIA 1CUDA 4MYSA 5ALGA 5AKKA 3D2CA 3WZLA 3DDUA 4AO6A 2XE4A 2PU7A 3MUNA 1E3QA 5FOQA 4C4YA 2OAGA 4FLFA 4EBBA 4O08A 1QIIA 4C01A 2WIJA 4H35A 2XUDA 3WKEA 4F0JA 1BRTA 4BVKA 3QMWA 3H1BA 2CEKA 2WHRA 2XLBA 3C6ZA 3OG9A 4L0CA 4H7IA 1JJFA 2CKMA 3LLCA 2HU7A 4N8DA 5CT8A 2J4FA 3WLAA 5CT4A 1MPXA 2VAXA 1YAJA 5AKHA 5ALQA 4FNMA 5LZ7A 2XUGA 4PQEA 4HRYA 4UHEA 1F8UA 3GUUA 1PV1A 4ZV9A 1MN6A 5EFZA 2WKWA 4OCZA 1CUAA 1CUUA 1I6WA 2WIGA 2I3DA 3E4DA 4CG3A 3WA6A 5HKAA 3GROA 5K3EA 4KRXA 3ESAA 1IMJA 4YK7A 1EDDA 2WTNA 2WJ6A 3KSRA 1XZCA 5DLPA 4C87A 3C8HA 2PSDA 1GKKA 1H2WA 1TRHA 3WYDA 4WFJA 4RNCA 3BF8A 4UHDA 1DWPA 1WB6A 2R11A 4FFWA 1NX9A 5K3CA 5DWDA 1L7RA 1VXOA 1BN7A 2WG0A 4ZRDA 4ZI5A 1X2BA 2G5PA 4GW3A 1UKAA 2O2GA 3F9CA 1XLVA 3U0VA 2GZRA 4UBMA 1FJ2A 1BN6A 1KU6A 4Y2SA 5AI9A 4AO7A 4BC0A 4G8DA 5ALMA 3PE6A 1QOZA 3R3YA 4H0CA 5ALYA 4X6YA 4EY6A 1OCEA 1QIKA 3VJLA 4BE4A 2W22A 3N2ZB 5AKXA 2HL6A 4DIUA 1XZLA 1XRMA 4K2AA 3IIIA 2WFLB 3ICWA 5IVHA 5LZ9A 1J1IA 3BJRA 4C88A 4K6HA 4QLAA 1CFJA 1JT2A 2FX5A 3G9ZA 3DS8A 3ZLVA 4AN0A 1TAHA 5FV4A 3H04A 1P0IA 1QIFA 4IH9A 1LBTA 2D5LA 3WK7A 2QUAA 4FBLA 4ARAA 2OCGA 4G8CA 1R1DA 2Y2UA 3BF7A 2XMGA 1G4HA 2VQ6A 1R88A 1HL7A 1ZI9A 3WL7A 4LXGA 5AI4A 3I6YA 3WL5A 3KXPA 3RKSA 3WYNA 3F97A 5AICA 5HK9A 1TCAA 2WG2A 5LKRA 2WHQA 4PW0A 2P8SA 4ZV7A 1NU8A 5FP0A 1YB7A 1DT5A 3EQ8A 5DNVA 3FYTA 2C4HA 4A23A 3FLAA 4KR0A 4WY5A 1DX4A 4IQ4A 4Y2XA 5K3FB 4B0OA 5A2GA 2V96A 3DEAA 4HRXA 4NS4A 2XUPA 4G9GA 5CMLA 3B5EA 5C8XA 5EIAA 3E0XA 3YASA 3MGAA 1JJBA 3A6ZA 3R3UA 1YA4A 1BU8A 2J4CA 2WSLA 2DFPA 2VSQA 1N1MA 4UHBA 4AZ3A 1QTIA 4HXEB 4JEIA 3STYA 3T4UA 1LZLA 1DTEA 4X85A 3LP5A 4Y2JA 4QWMA 4BP9A 2XUOA 5CH8A 1QO7A 4LIPD 4X71A 3QYJA 3AIKA 3FLEA 2CUTA 5AI5A 4MEBA 1EK1A 2ZYSA 4MQMA 1MO2A 5HF8A 2XQIA 1FFDA 4TVKA 2VJCA 1BS9A 4W1PA 2DCMA 2XUHA 4UBNA 1UOPA 3EBLA 1FFBA 4FKBA 4W1QA 4Y9SA 3B3QA 6YASA 1CV2A 3ICVA 1EB8A 4B9EA 3PDCA 4ETWA 1O6FA 1P0QA 1CEXA 5HK8A 4AMYA 4LXHA 4H7JA 1CUBA 2OGZA 3IBTA 3DQZA 1EI9A 3WK9A 1DWOA 3EF3A 4QDOA 3LCRA 3O4JA 2OGSA 4FBMA 4UBLA 4ZREA 4U2FA 2BUAA 4G4JA 1ZJ5A 1CUSA 1EH5A 1WHTA 3NGMA 3IUJA 4LXIA 2UZ0A 1VA5A 1CUHA 1H23A 3H2IA 4G1FA 4JYPA 2XDWA 4ZXFA 1F0PA 4Y2UA 1JU3A 4UFNA 5T4FA 2AJCA 2PU5A 2J3QA 1GPLA 3H17A 1A8UA 1SCIA 2I78A 1MU0A 4LYDA 5LYYA 3A2LA 1H2YA 2Z5GA 3DOHA 1N5MA 5JANA 4XVCA 2IX9A 1TQHA 1T2NA 1WHSA
chains in the Genus database with same CATH superfamily
2Q1YA 1KK3A 3IDQA 3R3JA 1A4UA 1XYVA 2YRWA 3DDOA 5HFNA 3THYB 1VHJA 3G7NA 3WKBA 1QHIA 2C07A 2C98A 2WG1A 1R6AA 3AV0B 3CR7A 1UDCA 3FMIA 2VC2B 1HDEA 5LP6C 1KAQA 2RHJA 4A0SA 2RB4A 4HX2A 4PS0A 5EVCA 1SC9A 3K96A 3A6PC 3OEED 4JY7A 4JVMA 2E82A 4BNVA 5DX1A 4URXR 2P79A 2DR3A 2KWIA 3QYFA 3DNFA 1B8OA 3DL0A 3HR4A 1YJAA 1HE1C 1DAFA 1OFUA 5GV8A 5JASA 1UAAA 4M0CA 1W96A 2G7ZA 3O03A 1FYEA 4GZMA 1MTOA 1VLQA 3MWFA 2CCGA 4UVGA 1DIRA 3RUAA 2C7RA 2QYHA 1E59A 2A5FA 2O7VA 4KXWA 1S89A 3RI3A 4W99A 4MS3A 1RKUA 3ZE7A 3HC7A 4DCNA 1OREA 1QB8A 4N41A 4KN5A 2WHYA 3KNZA 3N5KA 4M2LA 2D2FA 2RGYA 1YZ3A 2C3UA 4NBWA 5FOSA 1QONA 3UB2A 4R1QA 5LM3A 2I2CA 2WT4A 1D1QA 1SBHA 3KQHA 2XQGA 3WTCA 5LUBA 3ANMA 1TU3A 2GZDA 3QU5A 4URWR 4ZYTA 5CCXA 1OLUA 1O96A 2O8BB 3CM0A 3I9KA 1U81A 1QGED 5FQOA 2CXHA 3JVIA 3RANA 4EEKA 1GFWA 1X1CA 4K6CA 2W6QA 2H1OA 4ZOBA 3U44B 2DM6A 3I12A 4K81B 3K2IA 3UK6A 5BV7A 5JZMA 3GGGA 1IBKB 3WTBA 4IWNA 4OXRA 1H3NA 3IQHX 2IPLA 1N34B 4YJHB 1L4EA 1V8DA 4P58A 3S8MA 4BASA 5HIAA 1QLWA 2B4AA 3TPFA 1SKMA 3ZDEA 1XXHA 1VMIA 1C9NA 1YJCA 1XZIA 2QW0X 3CLKA 2IV2X 3R7NA 1TNDA 2WFLA 5HKOA 3CKKA 1B0UA 3F74A 4AMBA 2VDUE 3DZGA 3RM3A 1SU8A 1OB2A 1IQRA 2P2GA 1RRKA 3PYMA 3WJAA 3ZHQA 4B80A 4DAOA 1DBVO 1SY7A 3GCXA 3OURA 1QKIA 5B3JA 3RS4A 5C4GB 4BJ6A 2JFNA 1CUEA 4BYMA 3CRW1 1EP2B 4MGZR 3UXEA 4DBLE 4DKXA 5B2EA 3W5VA 3RJMA 4Y9TA 3WB0A 2ODNA 4MUXA 3TM4A 3LWDA 2A1TR 3BL5A 3JATB 4OQPA 2ZVDA 5K3DA 121PA 1XQVA 3ICOA 1Y1SA 2BGTA 1H4TA 2IOHA 1L6IA 4XX0B 4Y6QA 3PGJA 4I1VA 5DTIA 4XFDA 2P5YA 2AHRA 1V6CA 4ZHQA 4DLXA 2M1ZA 4JBGA 2D0DA 2X7JA 4D81A 5KKCA 2VLBA 3CF6R 5DEIA 4RX1A 3AF6A 3PDWA 3KJFA 1YQEA 3S0JA 3ZV4A 2PKYX 1D8TA 2BUCA 4Q34A 3NUZA 4FYWA 1RRGA 4HZGA 5JZSA 2H6EA 5F7XA 5EZYA 5FA8A 3TK1A 5DF1A 3IGFA 4QFBA 4YQYA 3PL1A 1CJMA 1Q1NA 4RENA 1H2HA 4BZQA 5AM0A 2GJ9A 1ODIA 4QUKA 2VTBA 2PXCA 2I3AA 3BCHA 2WAYA 3L0BA 3BM5A 4JKIA 4YWHA 1JEJA 1QRRA 2BEVA 2WT8A 1TZ2A 4Q12A 3UV6A 1M74A 3R1IA 7REQB 2F6RA 1I2BA 3FWZA 4W5WA 4LJ7A 4YCCA 2ZIZA 1K98A 5B58T 4Q7MB 3C0KA 1LZKA 3OE7D 1I2AA 4QYSA 1U3FA 4HPXB 2QVGA 3FTPA 4ZICA 4ZI7B 1DOAA 1KI2A 5CGZA 4INOA 3R8FA 4PVDA 3QBDA 2JLSA 1XMIA 1EJBA 2A1UB 4N40A 3OQVA 2VHYA 2FZEA 4MWZA 4HRVA 1QMGA 2RK3A 2GCOA 2YWEA 4I3GA 5BSVA 5ESXA 3F0TA 1FVHA 5LSAA 4NBNA 1NW8A 3EDMA 2E55A 1SBTA 4QELA 4HUTA 1AXRA 3HI4A 5CB6A 4YAUA 2EQ5A 1II8A 2ZUDA 3FOBA 3KAKA 3R44A 1GDHA 4ER5A 5K3FA 5EE9A 4FOPA 1DDOA 1NBME 3HXMA 1CEEA 2OVFA 4UAVA 1P7VA 5DHFA 3O8DA 3ZBUA 5IZCC 1T5IA 3GCWA 1EBFA 1GNPA 2C5HA 3DMYA 1NHWA 2YHAA 5JI2E 3TSAA 2H0AA 2O3UA 3TE7A 4HF7A 4ZVOA 4N5MA 3RDPA 3ND8A 2B8WA 3VR5H 2XCLA 3ZI0A 4M8KA 1PEDA 2XZTA 4JODA 2AMLA 2N46A 2HK7A 1K0FA 1E5VA 1N4DA 1XZKA 1QHEA 2WWTA 4CM1A 4DLWA 2GGSA 1C8BA 1KR5A 1TDJA 1SXIA 3EXG2 3GLSA 1POWA 3EVCA 1NGSA 2J5RA 3A6KA 4DWJA 1U9YA 2RE8A 1OQAA 1J2RA 1RLUA 3UHOA 4XGNA 4QTXA 3SM9A 2ECQA 3N6XA 3STTA 1V2GA 3EZ6A 2HNKA 1QQAA 1YUMA 3DE4X 1NUUA 2IV3A 1DHRA 4JOSA 821PA 3F73A 4C30A 1GA6A 3FZGA 5EZ6B 3RLIA 5LP6F 3IOBA 1E4EA 3QEKA 4G4SP 2ANCA 4DPLA 2P0EA 2PLWA 1DFIA 2PVSA 1PJAA 2A1TS 1MA0A 3MD0A 3PVZA 1ZL0A 2TECE 4GQBA 4MR9B 5HS6A 3MTEA 1XHEA 2QNRA 3DCIA 4RK1A 2WU3A 2K2WA 1G17A 4W1SA 5K6AA 3X43A 1ICIA 3FF1A 4R9VA 3SEFA 1JHVA 1WSDA 3WICA 5DSZA 3ZCQA 4DV2B 4G1UC 4HLQB 1A9YA 3BJIC 2C7QA 2IUYA 3UB4A 2G5CA 2OGUA 5BPFA 4DR2B 4A8TA 3CIOA 1G6KA 3HGQA 4J0HA 5EMNA 1D2GA 3NI2A 4UHKA 4UZEA 4DOMA 1KIAA 3H97A 2P7IA 1V47A 3M6IA 4G37A 4IQ0A 4R0NA 1VGVA 3UAOA 2PLAA 3NWPA 3KD2A 1S2IA 5AO9A 3ZH2A 3K9CA 1X42A 5F3RA 5AVZA 1NUPA 5HXAA 2P9QA 2YDXA 3DMTC 5AJZA 2VDWB 4B0PA 4RD2A 4EDHA 2QK4A 3C8UA 3DEIA 4BU0A 3QLEA 4OTZA 2Y1GA 3ZU4A 3B1ZA 3QH4A 4OF4A 4RK4A 1G3UA 3AFHA 1Z36A 4LYFA 1FZQA 2PQ2A 2YXEA 5E7QA 5HX7A 3LX4A 1YT5A 3KELA 4NFLA 3W5UA 2FEKA 1P1JA 2JGEA 3IUPA 3OQBA 1Y1LA 3SLRA 3TAXA 5I51A 4HC4A 4KFSA 1VXRA 4Y2GA 2D13A 2OFWA 2XUFA 2GSWA 4LTNA 5TMDA 1RBYA 4S2UA 5C7OO 1JJVA 3JY6A 5E6SB 2XYRA 1C9JA 5A4KA 1LI4A 2GLTA 1FX0B 1UKCA 3HL4A 4L4SA 1ESDA 4BNJA 2XEDA 3L8YA 4FP9A 3F7TA 1G6OA 1JQJC 1ZCJA 2A59A 3HGMA 2PBZA 3NEPX 3AHCA 3OF5A 4K9NA 4C0XA 4GOJA 2IVFA 1UBCA 3RT9A 1VBNA 2XTZA 3SFTA 4J7CA 1Y7HA 4OJNA 4KUGA 1ETHA 4AYWA 1THMA 2FG7C 2GDZA 4ZDIA 2I34A 3E6AA 1YGPA 3I9MA 2PS0A 2QEQA 1HLDA 2P1RA 5EMJA 1JKIA 1IAVA 4YP7A 3MTDA 5EI5A 4DG5A 3LWBA 4QUIA 3IILA 5C31A 1UL1X 3FOFC 4LRTB 1FMCA 3OCXA 3H2JA 4HH4A 3SXJA 5G0WA 2PKQO 1ZP6A 3VOSA 4JP2A 2EYUA 4CMAA 2W6NA 1UXGA 3JR3A 3IAUA 4ER7A 1N0WA 4ZK2A 1SJ9A 4FEYA 4X20B 4UM9B 1OC2A 2B78A 2B0CA 3OBIA 1FNDA 3NJ8A 1T6YA 3GPCA 4RF5A 1GLNA 1WL8A 4R1OA 2SECE 4A10A 4BBJA 4LV6A 2G1PA 3HZOA 4WH0A 1IY1A 3DD5A 3G0GA 1G0NA 2JPDA 3B7WA 4M36A 4BO2A 1SCUA 2BY4A 3I5AA 2IXTA 1J5EB 2H2HA 3JW8A 3KLMX 1XIVA 3L4BA 4F1WA 1V43A 3EC1A 4F8JA 4JV5B 3DE5X 3G3EA 3H2YA 3SAJA 2X0IA 3K9QO 3PA6A 4GX5A 2UYQA 1I13A 1MAWA 2PK3A 2OBMA 8ABPA 3II6X 2PGXA 1S3FA 3H65A 4MIYA 5C52B 2WQ7A 2ZXUA 3DE3X 5D5PA 3AI7A 4GP7A 4TSRA 3VKVA 1PZMA 2FPMA 1NIPA 4DSNA 1K3TA 4GWLA 4OYHA 1B26A 2O5RA 2IZ0A 2Z2JA 4QL3A 5ITWA 1V4NA 3OC0A 4P3OA 2WINI 3DUFB 3E82A 2GLXA 3MLBA 2HYIC 5BMOA 2MHCA 1QRDA 3F3YA 4B44A 2C4VA 5HTKA 4O02B 1QV6A 3RTAA 2HHCA 2VJMB 3QHQA 5DHUA 1YQQA 4UDXX 5MFPA 1OH8A 2OG1A 2G8NA 3BDAA 1OBFO 3NHLA 1YNOA 2IP4A 2RHGB 2HQBA 4JLNA 1NLYA 1AUQA 1A7UA 2W8BB 4DZRA 1AS2A 2GAOA 1E9EA 3H5WA 4EP1A 3MA0A 2NYVA 1XTQA 1OTXA 2Q2QA 3GLRA 3PXUA 1JXMA 4XE5A 1Q7CA 2FX2A 1JDBB 3HVUA 3IDAA 4FJ0A 5ALRA 1CQZA 3GWZA 3P2KA 1N8SA 4BV3A 1R5BA 1P5ZB 4YCMA 4ZIRB 2C42A 3NIDB 3PKZA 3B2EA 3K70B 1MB4A 4MUNA 2PIDA 2I62A 4PRYA 1YZQA 3DYIA 4TYQA 3VISA 5EAIA 4DSUA 3CVYA 3ZJTA 1F2DA 3LBFA 2CVOA 2HQOA 5T8KA 1F0NA 3ZH9B 2NVUA 3SMQA 4LC0A 3ND7A 3ZCPA 2PT6A 3ETNA 3C8DA 4QPJC 4JI8B 1E1QA 1U8TA 2LNDA 4HPJB 2KBEA 4K28A 5C46F 2NVOA 1Z47A 2QKYA 1P4SA 4J0FA 2GS9A 3OA0A 1CB7A 2RHMA 1KGDA 4I9GA 5JJ5A 4EUFA 4YJDA 1KDRA 4HDSA 2O3JA 4OFXA 4AXBA 5C8YF 1RAEA 3M7IA 2NVWA 3DV2A 2GHIA 3DZDA 3STXA 4PZDA 4RJLA 3O8QA 1MDBA 2P5TB 2QZ9A 4RIEA 3S2GA 1QV7A 4Z1MD 1HFKA 1XTJA 1RC1A 1AUXA 2ZI4A 3AVPA 3THSA 1TJYA 1JVBA 5KYUB 3G7SA 1KJWA 4V39A 1NJGA 4IKEA 3WB1A 1CQWA 4UE2A 4FN5A 3N58A 4C03A 4OUDB 1AQLA 3ZD9A 3CVOA 4E2YA 1DJMA 3A27A 4WZAA 2FKAA 1QR2A 3WAGA 1K6JA 4UTVA 4RDXA 2XQKA 2H51A 4IDOA 4PBTA 4BDSA 4ND2A 4JLDA 3UJAA 4GR9A 3ROEA 1M0TA 2I6UA 5IXSA 1WMDA 1Z68A 2YWJA 2X9GA 4PZYA 1TZJA 5MGNA 4YP5A 1XNRB 1Q0TA 1K5HA 3UCEA 2ZYRA 4OJTA 2JBAA 4POAA 2WNIA 3CW9A 4LN1A 4YMWA 2EJTA 3U3OA 4ABYA 1NKVA 5L6MB 4P32A 1J97A 1P0CA 1CR0A 1OWMA 1YDHA 1ZD9A 5B7GA 4L74A 4CLOA 1Q0QA 5G1OA 2OHGA 2IZOA 2WW8A 3N7AA 3DFFA 4Q05A 3W9YA 4YRKA 3PRKE 4O4LA 3WLJA 2C9YA 3I4CA 1CZUA 1ZM2A 1TYEB 4RTLA 4DV3B 1SCJA 3W90A 4DLKA 3HM9A 2G9VA 3OZIA 1NPDA 2WZDA 1H2ZA 4R16A 1MVNA 1A4XA 4PLGA 3COJA 2WIKA 3MM4A 4I2VA 5BN3A 4ASUA 4URYR 4HRAA 2BGGA 4PG6A 2HA2A 2Y1KA 2FPUA 1KSFX 3JS5A 4P7GA 2R1TB 3U26A 5JCZA 4YUZA 2H7CA 1JE0A 3TTVA 5A9SA 1S2OA 4PLHA 2D54A 2A2ZA 5D86A 1G66A 1Z4MA 1S7GA 2ASVA 3BWXA 3LCVB 4K6FA 4REMA 1EVJA 1C29B 4XB1A 4CEHB 1I4TD 5JEDA 1EFAA 5CBPA 2CL5A 4NYIR 3LLUA 4NBKA 5TQ0A 3JD1A 3TX2A 1DBQA 5C32A 3W2HA 1YI8A 4C6RA 1E2PA 5KYWA 3PC6A 5AUQA 3ND5A 2GK7A 1ZVJA 1RVV1 3H7AA 1K7XB 3PEFA 4UCXA 4ZCPA 4RDIA 1EA5A 2HA5A 4D79A 3LBNA 4K87A 3OFKA 4J90A 3OPYA 3MWDB 4PAQA 3DOJA 4TTSA 4X3CA 4FFBA 1F0YA 3P4XA 3GJ6A 2JJQA 1JL3A 3AIOA 1Z6ZA 3RF6A 1X1AA 1DEXA 2G1AA 3TJRA 2RAFA 1J20A 2VTVA 1A9PA 4JBXA 2DPMA 3F71A 2W2PA 4QOHA 3QYPA 2EW8A 2G4VA 1A0OA 3AP2A 4O4IA 3WZ2A 5ILOA 1DQSA 1MQ8B 1TZBA 1VPLA 2EX1A 3GFSA 1OIWA 1OYWA 4AW9A 4E5DA 5DWVA 4F4JA 1H6CA 5ADVA 2B69A 4F84A 1CVIA 4GXQA 1BDHA 5KSWB 2CB0A 1P6UA 2ZE6A 4MNTA 4J3NA 4CKZA 1S3GA 1KH3A 4FLMA 4X9XA 1GN9A 1XSEA 3KOWA 3BOSA 4YHBA 4YMGA 3AWIA 3F5SA 4KAJA 1TMGE 1FQOA 1HRKA 1ZJJA 4EHHA 2KHZA 1A82A 1GLVA 4UUQA 2ZBRA 3ENQA 3BMCB 2HX1A 3T3HA 1GQQA 1P2FA 1S2DA 2A9KA 5H70A 3ROTA 3ROQA 3W05A 3IXMA 2HJWA 1VGQA 3KDPA 1TTTA 1Y82A 1XFDA 1U8AA 1XLTA 2BFPA 2D2IA 3G1TA 3OKCA 1GYQA 3SHTA 4D57A 2C95A 3LH5A 4U7TB 1Z15A 2OZKA 3GNLA 3KZCA 4HVCA 4NCAA 4OSOA 4W8GA 2I6SA 3RADC 4CPDA 5CR9A 3QX8A 2VNIA 3OJOA 4L4RA 5F9MA 3LT0A 2QAGB 1U0RA 4U7GA 4BNGA 1BCRB 2AJTA 3BRWA 3D6MA 4QYMA 2E4UA 3P1JA 3PICA 4R6XA 5IMSA 4QODA 1ZUIA 5FBWB 3FXAA 2G71A 4RFSA 3U31A 1H8HD 1R6VA 3THRA 1MJHA 1CUGA 3I6IA 3M4XA 2IUTA 1XK7A 2A7QA 2R48A 3HJBA 1ADGA 1W581 3WL8A 3DF7A 1RXSA 4UVEA 1T0PA 3T7IA 2FHPA 2H1IA 4RM3A 4OLBA 4M46A 4LBWA 2TSYB 1RMQA 3H1AA 2Q3MA 2F9FA 2I4NA 2XZOA 1UPAA 5BY2A 1DDIA 3DW3X 5C3UA 3JALA 2R84A 3Q87B 4JJIA 4L4YA 4PY2A 2PS9A 1RXVA 5F7OA 1TM2A 3WBBA 4LOJA 1ZICA 1K5GA 2NUPA 3AVUA 3C3DA 3PX7A 2PLFA 2PWYA 4FNGA 1O58A 4PG5A 4D26A 2FWBA 4YH1A 2NU6B 4WBNF 1NXQA 4L28A 5IFKA 4F4HA 2AI1A 4S0ZA 4OK3A 2DFNA 3FCOA 4QXMA 4RHFA 1RPZA 3N6VA 1L4LA 2ET6A 4FFSA 4D99A 1MOQA 2VCEA 1GWNA 3RU2A 4A27A 2D0PB 1LRJA 2IUFA 3K1AB 3OPQA 3T7SA 4C6TA 5C18A 4U6QA 1P29A 3TRIA 2F55A 1YCHA 3AVXA 1BJRE 2RONA 5GOTA 5K3AA 4DADA 5ADWA 4C78A 4LA4A 2J3KA 5TNXA 1DMRA 2FZVA 2PSHA 2VPQA 4AB1A 1RLIA 1LFAA 2H54A 3BC1A 4IIYA 4EYEA 4XDYA 2QDKA 3R7SA 1XZMA 1KQFA 3OM8A 3CSUA 4MGYR 2Q45A 4NV0A 4ZCMA 2FF5A 3MT8A 3VOTA 5KMGA 2AD5A 2M6KA 4P92A 4MDYA 4HGRA 3ORFA 5DNEA 3WK5A 2P67A 3Q72A 2Q3BA 3LXUX 2OPHA 3HQ4O 4KE8A 2P9FA 4QASA 5CB0A 3HNOA 1JGTA 2XWBF 2GBLA 3HDYA 1DNPA 2OVBA 1BS2A 2O05A 4AUNA 4F45A 2XB2A 1SOMA 4I55F 4F3NA 1A88A 3KQSA 4PC7A 1N7GA 1Z5PA 2FZGA 5DBFA 1N8TA 2BWJA 4BO3A 3AKYA 3C6YA 2EEZA 2Z58A 1MIOA 1XEAA 2DFVA 3EIQA 2RKBA 2X1LA 1FQKA 2BF7A 1I0LA 4J4TA 3ILSA 3HBJA 1O2DA 3ZWOA 3OJEA 1U3VA 1OZGA 3IUNA 4JLOA 5KVQA 4E5YA 1QCCA 2C2MA 1PZNA 1UDXA 5ITSA 4JYZA 4MVJH 3PD7A 4EKGA 3DAGA 1EGVB 4QM7A 2O1SA 2IYYA 2J5QA 1ZIDA 3C87A 3IPCA 3PXEA 4QT0A 1FP6A 2H3HA 2J1LA 2YOHA 4E2FA 2I71A 3HABA 2IE8A 3PC8A 2XCRB 5AI0A 3VI4B 2ZLBA 1UOEA 4LHYA 4LVUA 4RIHA 4RLFA 3OCWA 3DO6A 1KDYA 3F5DA 3RSSA 2V6MA 3A1DA 1M8JA 3QYAA 4QDJA 1RI5A 4JT2A 2ISCA 2MYNA 2XMPA 3L1KA 3N74A 4KV9A 2PKCA 3HKEA 5HSGA 4N5DA 3NDIA 5IVKA 3AFMA 3MJ4A 2Q9UA 4ZT7A 3UWDA 1IHPA 1W19A 2IY9A 3FTQA 4RWEA 3F6EX 5ICSA 1V5GA 3K9NA 1SC4A 3NHZA 4NG5A 1W76A 2ARKA 2JEYA 2ZJYA 3NBZC 2W6OA 4QVGA 5LCXA 1Y3CE 1GKLA 3ZHVA 2HMWA 3RQSA 4CCAA 4YT8A 1GCAA 1SIWA 6ADHA 1QS0B 3GLGA 2YQ4A 4B3TB 4EHJA 1J7JA 1O97C 3UT0A 3I0ZA 1KDTA 2K6GA 2PT9A 4HMPA 2YUIA 1Q7TA 2E89A 4A0GA 3CF2A 3NJ4A 2RB5A 3HUEA 3KEMA 2JIOA 2JATA 1MFPA 1NXTA 1SPXA 2N0SA 2LXNA 3BCSA 4NE2A 4IDHA 1ZD3A 2WKQA 2XNSA 1RJDA 4NJEA 5EHGA 4WTOA 4Z4QA 3INRA 1U2EA 4LSGA 3PUYA 4W5QA 4KPGA 1ICEA 4WLFA 2CKDA 1DAEA 3ZBQA 2IYEA 5F64A 4PC1A 5EN4A 4FT2A 2X0DA 3WK6A 5M5BA 2PUAA 5D1HA 2ZJFA 3BIWA 4S1VA 2OAQ1 5H8WA 3A14A 5K5EA 2J9RA 2V59A 1PT5A 1ESZA 3DKPA 1A9XA 1DIBA 1QRSA 4KPUA 1TE2A 2ATVA 3DM9B 4R1SA 5CNKA 5B1DA 1JU9A 2F4VB 3HJFA 1EBUA 4BO5A 1CQJA 5F3DA 5FORA 3P4YA 1Z8HA 2BFCB 2MYUA 3S1LA 3NORA 1OWNA 2O4UX 3D6TB 4N65A 4MW7A 4OGGA 5COAA 4BRZA 2ZIEA 1E9VA 2XD4A 3D7RA 3R9XB 1D9XA 3ICCA 1P7PA 3C1TA 3HA7A 3G8DA 1TIPA 2DP4E 3GUVA 3CN7A 2WQ6A 1G6Q1 1U2GA 4HEQA 3M9WA 5M7EA 4JU9A 4M7PA 1KHHA 1VLHA 2WF7A 1U7UA 1NWHA 1V1RA 2HNAA 3BTUA 4WADA 3ZDRA 2B3DA 2XUZA 3K2BA 5D01A 3ASVA 4ME6A 3C48A 4CCYB 4QREA 5LP6B 1Z2EA 3U37A 1N8NA 3E7DA 3EH2A 4DKJA 4YRJA 3WIVA 2VPZA 2EJWA 3QVSA 5BXYA 1YQUA 3B12A 4GAEA 5EHXA 1CY2A 2Z57A 3IUMA 1W5AA 2QGNA 4AJJA 1QFSA 2IEZA 1N77A 1J4AA 1DEOA 3PI6A 4PYQA 1QHGA 2UV8A 5DCLA 4B2PA 1I2ZA 1U0LA 3TXAA 3UMJA 1PEKE 5KYYB 1U4SA 4J03A 4KBFA 1BX1A 4ZK6A 2I6XA 5LA6A 3TLGB 2X76A 3TLAA 3UJ3X 1EAMA 1X2EA 5IHXA 1US8A 2W90A 2XKBA 2DFDA 1MTZA 2FGKA 2YOGA 2QQ5A 4OQEA 3ZEAA 1R37A 1ZYUA 1GG8A 5EZQA 2WZBA 5CVDA 4ZZ1A 4TRNA 3FPEA 3UPDA 3NM6B 3PCRB 3W79A 3ZG6A 4M1EA 3SIRA 3E8SA 2AZDA 2Z08A 3FBTA 3N53A 4BN0A 3IPLA 5EQDA 3OE4A 3O2JA 1WPXA 3WNQA 2IC5A 2QYOA 1H65A 3W6PA 4ENSA 2QRUA 3DOEA 1MRSA 5CXXA 3GHHA 3P20A 2IVZA 5BN5B 2YJGA 2Z04A 2JZNA 1J8YF 3OJ0A 3GLHA 2YVQA 4II3A 4HD8A 2ZI3A 3WO0A 3FSEA 3OQJA 5CIQA 3AB8A 1D07A 2IYOA 3OZCA 4UXJA 2RGXA 4D5EA 4C7OA 2QTFA 1QC5B 3A6EA 3NV7A 1T5DX 1EFKA 5TE9A 3W2IA 1KMHB 2NO5A 4DA7A 1XALA 5JAHA 4KX5A 4TKZA 3ILVA 5EWJA 4ZT2A 2YOFA 3DQPA 3PC4A 3HEBA 1SQFA 1PL7A 4E5KA 3Q8WA 4KUHA 2VN8A 1M7HA 1T8SA 3A70A 1AUOA 1JFLA 4J16C 4O63O 3C14C 1H2XA 1SBIA 1OKKA 1UFOA 2E37A 1RJGA 4WLUA 1L5SA 3KPYA 1M2WA 1E20A 1W49A 3X1ZA 4UBOA 4M8LA 3PENA 2W4IA 1OIVA 3S5UA 4FX5A 4S1PA 2H2FA 4Q9NA 2KS6A 3CT6A 1BE6A 1XZGA 2YQ5A 2EFEB 3IJPA 4QLBA 3CUKA 1I7LA 4N49A 5AW7A 1ZH8A 5AM5A 4D3YA 1U7OA 5IN5A 1VCMA 1W1UA 5CDHA 3SR4A 1IOWA 4D8TA 4G5SA 4JUBA 1XDZA 2M32A 2R1VB 1XPUA 4MW2A 1ODFA 1D1PA 1I6KA 3WJ7A 4EG3A 3RFCA 3MCWA 4F8YA 4D9CA 4CUKA 2BFWA 3CLRD 2C5BA 1W36D 3VA7A 1PFGA 1JVSA 2ZCUA 3OLWA 4X7BA 5KWVA 3OJCA 1NNEA 4QWWA 2WF5A 3B5IA 3G2IA 2QXTA 3G5UA 3TDMA 4LMPA 3ZWWA 1MO3A 1S96A 5JWOA 5EUQB 5BOSA 1TW2A 4DZTA 5JS7A 4MWDA 3RSLA 2AL7A 2PD3A 3ZGVA 1K8RA 1ZIOA 3BD8A 3OAAA 3NANA 1J7KA 4MWSA 1MX1A 4FYPA 1ONSA 1XDBA 4OREX 2BJVA 2VTEA 4R3WA 2F3QA 3E5MA 1CDZA 4IIBA 3U49A 2K7FA 4PG7A 1K88A 3LYUA 4IV8A 1QX4A 4W6QA 1O5TA 4YJ3A 4C3OB 2CFTA 3UC9A 1BYIA 3ZVMA 5HFAA 3DZJA 1BDJA 2BM1A 2IPXA 3MTIA 2H63A 3M4NA 4HWTA 4MGIR 3V1MA 2ZM6B 5DJ5A 1VHQA 2B4KA 4JP1A 1B3BA 2HHJA 4UD6A 5K8VA 3HFGA 2ATEA 4F7WA 1GZUA 3QENA 3PT9A 2GPAA 1L0BA 4D74A 3OQIA 3AXTA 1BWPA 5I48A 2JARA 2YWXA 3HY3A 2J30A 4Y2QA 5FTWA 1FVXA 5KNDH 5L95A 2QTHA 2O7NA 2VWHA 4IXDA 4CYMA 2C29D 2QM8A 2NQTA 2BF4A 2K7ZA 3CZ5A 3K8QA 2RBGA 3KDSE 1PNOA 3L2OB 3LM8A 4X61A 1ESMA 1JR3E 3P19A 4RSMA 2QUIA 1UOQA 3BEDA 5E7MA 5K0LA 1Q0LA 4Q9JA 2BMJA 2ZYWX 1OYYA 2WHPB 4N9QA 5H1YA 1ONNA 1F17A 4FYYA 1JKMA 4L85A 1NN5A 1GY8A 3U80A 4N7JA 3U39A 3UK1A 3LPDA 5JCXA 5JVDF 3U56A 2NU9A 4X93A 1MOZA 4PFJA 1U7TA 3BH0A 1P0PA 4EKEA 1GG2A 4WJLA 3NTOA 1V6AA 2QTLA 1N2GA 1GDTA 5K0FA 1AGYA 4JX8A 3EVZA 4EHDA 1OLOA 5C8YB 2GBLC 2HRQA 3EA0A 1EFTA 3JQEA 2LP4Y 3WRXA 5C5CA 2Q0QA 2G4LA 1RS0A 3HLKA 4EQZA 4NENA 4C43A 2BSQA 2AYZA 4B43A 4TRRA 3UQYS 1K63A 2GJAA 1LV8A 1X39A 1M10A 1T4BA 1E89A 3ULKA 4E31A 1VJ0A 3C6QA 5AIAA 9MHTA 1CKEA 1EINA 1PYGA 2J0EA 1ZONA 3L7YA 2HU5A 2XMQA 4LY3A 4PO3X 5DLQC 3WRYC 5A7FA 3DO5A 3CWZA 1Z0UA 1IEQA 3HN7A 2NU7A 4U9IS 3VR5A 4YUXA 1WUJS 3P9KA 4NPAA 1EIWA 1ULTA 2R8BA 3JVVA 1AC5A 4GLOA 1R4ZA 3VYTB 4JSRA 3TLKA 4LFCB 4GGMX 1YR8A 3QLVC 4LXXA 1KBQA 2Q6LA 4R1PA 1PX0A 1MV5A 3PD1A 3I6ZA 1PT9A 2IHBA 4U02A 4RMNA 5TDHA 4HUQA 4BMOB 1UH5A 2OCAA 3ZD6A 3HCFA 2X1VA 1AF4A 2AFIB 3WK8A 2PBLA 2W6CX 3Q2OA 2P2NA 4MB2A 1S9HA 1WCIA 2NTVA 4UMVA 5ER9A 2Z6AA 1U7XA 4OATA 2ZWVA 3ETCA 3GP3A 4CLEA 2DUMA 4BWFB 4QTYA 4AJNA 1WMAA 2X3YA 3FHLA 1H9BA 4HWRA 4U8GA 4H77A 3TZQA 2GZSA 4EBFA 1A76A 1NVVR 3QJGA 3FSRA 3GJSA 3TSOA 1PNVA 4H4CA 2Q7XA 4IQFA 1NHGA 1Z5VA 2WVHA 3CV3A 3K1YA 3QBVA 1VJCA 3PX3A 4PYMA 3S70A 3HU3A 1JA9A 4EVSA 4ZJYA 4IO0A 2OO5C 3B8EA 3RFFA 1VBKA 1OGJA 4JEMA 3HR8A 2A94A 4R0MA 4CG2A 5HKBA 3UHPA 1LV7A 2QMHA 3G0CA 2QU8A 1LQ2A 3ZTWA 4KVZA 3ZWQA 2Y9PB 3GJ4A 1NVUQ 2DWPA 4L22A 3T5TA 2AOTB 2V7BA 3BHJA 1NKTA 1O89A 1ZRMA 4XQCA 3SY8A 4BWVA 4IGAA 4AMZA 1M1YA 1U0FA 4CV3A 3SYTA 5CXUA 1R3DA 3FNQA 1TMKA 3PNSA 2HA6A 3MWYW 4ITVA 5KJEA 3RYIA 3VX4A 4HGZA 4OD0A 1P7ZA 1IEWA 1RWVA 2B35A 3ANLA 5IEBA 1MG0A 3RS9A 2WF9A 4F96A 1ZW6A 4ZDKA 3VKFA 1DRUA 2NZWA 3ISTA 5MN4A 1L5GB 2ZANA 4A0FA 4A8PA 4M4SA 3HLYA 3UT6A 3QFRA 4EUEA 5D00A 1KRXA 3TW8B 3LGXA 1HLFA 1X1RA 3E1KA 4B5LA 2P75A 4BFSA 1BVHA 2V9ZA 4EKIA 2O23A 4ETMA 1M6VA 2MJLA 2IZ1A 2O06A 4X62B 1Z22A 4W63A 3MC1A 1M1NB 1T25A 1RKVA 4EGAA 2CV1A 4HYEA 1P45A 1U2ZA 2XQFA 3A7DA 3QJYA 3KSDO 4RYDA 1BGXT 1O0SA 2QORA 1C9EA 1Y80A 2WPDA 4R8LA 4URZR 1YS1X 3QKSB 5GQSA 3ZD8A 2A84A 1UC9A 3HZZA 1WKBA 3UCXA 4FR0A 3Q8KA 2I54A 2IU0A 3FE2A 1Q6ZA 2E4YA 4IUBS 5IS2A 2WVAA 4KYTA 5CYOA 1E3MA 1CDEA 3QPAA 1VPWA 4M0UA 5EGNA 3NKLA 4D4JA 2GQ0A 3TUIC 4WPGA 2OGTA 4ILEA 1GDDA 5CLFA 4K3VA 4C1BA 2PUCA 1FA9A 3AW8A 4Z7QB 5F98A 3ZHBA 1RQPA 1UKYA 2LIPA 4FYIA 2YZGA 3U3ZA 3VU0A 3A4LA 4UHHA 4F91B 4F5ZA 4GWKA 3H1PA 1EGHA 2HDOA 5IXJA 2Q99A 4X1OA 1YQ9A 4DY6A 3SZMA 1QGUA 3DLCA 4BO6A 5FWXA 2EKLA 1VM6A 4KGDA 3UOWA 2ISQA 3DOIA 4BNUA 2FWPA 4C89A 2ZAMA 3P0JA 3NWOA 4QECA 2V97A 1SD2A 2ZDHA 3E3LA 2Z1MA 1LDGA 4CG1A 1TTQB 3M81A 2REXB 1NG9A 1ZMTA 4MYUA 3NBMA 2O8DB 1P60A 3ON5A 2BTOA 2HW8A 1P0FA 1UC8A 1R9NA 3T5MA 1B16A 4DQXA 1CE8A 3M2PA 3GOQA 3JR7A 4RVGA 4LJ8A 1B7GO 1NW5A 2BEKA 3F96A 4FMDF 4P34A 4F04A 2QOEA 4HDRA 5AHXA 3UMRA 3ZGXA 2C5SA 1P31A 1JNXX 1GQSA 1QP4A 4TMKA 4AIRA 3L7DA 2ZYIA 1WF3A 3TIXB 1XVTA 3FJ1A 3WLOA 3EQ6A 3DB1A 4PO8A 2C82A 1ZGGA 4M1WA 4WBNB 4HNVA 3BMOB 4DLZA 1L5HA 3DL4A 3EXG1 4WT7A 4UPEA 1KZ7B 1GPWB 3HU1A 4TVOA 5B37A 3LZDA 3KT6A 4J0IA 4IEFB 2D1TA 5ILGA 1GZ4A 1Z0AA 2BEUA 1OGYA 1A8QA 3C3WA 4M9CA 2FEOA 2F17A 4DJDC 3FUWA 2O8NA 2WF8A 4L72A 5EZ5A 4OXQA 1QSGA 2E3JA 2Q0SA 2RBKA 3TD9A 1XQ1A 1C2TA 2BZ0A 3QWFA 1JMYA 1VL8A 4KN8A 4CMGA 5KCZA 4URFA 4MYRA 1HFJA 4XYLA 4HWGA 1JF8A 4CIBA 5IF3A 1A95A 5ALLA 5K0GA 3ICQB 2IYRA 3EDOA 3QFSA 1JMKC 3RU3A 4CL3A 4ERXA 4ZO6A 4GMKA 2FVYA 5L40A 3IE2A 5JEEA 3PG5A 1G7CA 2AMYA 1D6SA 4NDNE 4AJ9A 2J9XB 3CLUD 4N7RA 4DCVA 4F5DA 4XFKA 1KPGA 2JBWA 3KWFA 3AR6A 1C9MA 3BK1A 4FBGA 4QPDA 4OIFA 4GR5A 1RT9A 1Y8RA 2CFSA 4TS4A 4B40A 2NN3C 1R8XA 3U0BA 4FEEA 3T15A 1Z9BA 5KNBH 4I55B 4YJ2A 3CEHA 5LFAA 1Z4QA 3FKSA 2KI5A 1O94D 3ZDFA 4BNMA 4ZVNA 1TJ5A 1E2DA 3MMXA 5AJHA 5T64A 4DSZA 3A6GA 4CT4B 1KU0A 3U7QB 5KREA 3A58B 2OPBA 5IM4F 1HKHA 2HTEA 1XLUA 3WGYA 1W4ZA 4Y1FA 3BXHA 1P4AA 2ADOA 3TNDA 4M1QA 2WOJA 3REGA 3LECA 2D62A 3OM0A 4HDMB 3ITEA 5DI3B 2P4EA 4EG7A 4P4TA 2YRXA 4BQFA 3ADBA 1KZYC 1Z33A 2QTAA 1RZUA 3G23A 4LJKA 4WDRA 5DIZA 1W30A 3AW9A 3PHLA 4URVR 1CRPA 1KE2A 3VO1A 2IXGA 3CH6A 3QLUA 4R7ZA 4WGGA 1GTRA 5A0VA 1ZIXA 5HM8A 2ZRQA 3SDBA 4GDMA 4B6QA 2H4HA 2LKCA 4M0KA 2H18A 2EFDB 3U19A 3QF7A 1LK0A 3DTYA 4OXNA 5DNDA 4LZAA 2NAPA 1ULZA 5JCOA 4D9JA 4Z0PA 3AERA 1ODKA 1RE1A 1KP3A 2FI1A 3H4TA 4FOSA 4CT5A 4BQNA 1ULUA 2IS2A 1U5BA 1VLJA 1UR5A 4RPIA 2AZ4A 3DW1X 1NI5A 5AJWA 2FV8A 3WDSA 4GNRA 4R8SA 1A5BB 1GL3A 1TT5B 2FWNA 3L6RA 2IKSA 5AW5A 4LDZA 1F2TA 1AZTA 1I36A 2OBYA 2WYOA 5DZSA 3UMSA 4E94A 2FDRA 3FCYA 4LPSA 3KAJA 5ICEA 3GN2A 4RNDB 1EWQA 5K8TA 3UYKA 1BXRB 3NETA 5IUNC 4TV9F 2OYRA 3V7NA 4DEXA 3MB5A 2VAPA 2QIPA 4KPYA 3HYTA 3UUWA 1DPGA 4RMGA 1G1AA 1GIAA 2Q0HA 2Q3EA 3IJRA 3OJFA 4COKA 3DZFA 4CTKA 3QUAA 4D3DA 5J4KA 2E1RA 1SOWA 3BB4A 4JNKA 1L7XA 4GLFA 5ALSA 1RFLA 1UJ6A 3LT1A 4NONA 4E13A 4FONA 5DVZA 4G01B 3A9CA 1UIMA 4V2UA 1HH4A 3ORYA 3CEMA 4DVGA 2RGNA 1KI6B 1J21A 1F2UB 2MIIA 3AEUB 3CGWA 2HMVA 3TUJC 3H5VA 4G3XA 1A8SA 3R76A 1KTVA 3GT3A 4W5HA 2DHQA 3E05A 3Q3VA 1RXIA 4OJYA 4CI0B 3T35A 5CFRA 3E81A 4OHPA 1GUAA 4ZKEA 2H7YA 1JHOA 3G0BA 1LRKA 3LUDA 4Y6SA 1VE3A 3VH3A 3L1HA 3ROPA 3WLEA 5LZ2A 3LLVA 3VYVA 1AMNA 1WZIA 2PYIA 2IBMA 2V0GA 1YDFA 3LY5A 1NI4A 4NBSA 1UBKS 2PUTA 4PZ9A 2JLXA 5BSEA 5BV1A 3AHJA 3H6HA 4QAJA 4MQEA 4QJBA 1I10A 4IZ6A 1I7NA 1X3SA 4NEHB 4Q3LA 4QNNA 2WTXA 3KYCA 3ZHYA 3SYMA 5K45A 2X0NA 4PPNA 3H9JA 3RYFA 3IL2A 2G5TA 1DQZA 1HPLA 4B35A 2X0KA 3AKCA 4BNXA 2WUEA 5LNK6 3FVQA 4HJRA 2XHZA 2BGKA 3AEQA 2IIPA 4WCDA 5I9IA 2CDCA 2OLEA 2WWXA 2WM2A 3KB2A 4WK0B 2BOVA 3GLQA 3EGOA 5KIAA 1ZHOA 3WKCA 1UM9A 2QZSA 4PAMA 3WGIA 4PRLA 2ZBFA 1SU4A 2J0QA 1C4KA 4ITRC 4J6EA 2GK6A 3TKLA 1F9EA 1NTRA 2GXUA 2A9OA 1YZGA 3GUYA 3HL0A 3AFNA 4Q1AA 5DO9A 1YASA 5JWRA 3G9XA 3CVXA 4WE3A 3FH0A 2CL0X 2ZBQA 1KEVA 2ZB3A 3H87A 3ZNQA 3IR6A 1PQYA 1UJ5A 4F7DA 2YZ7A 1NLZA 4HSEA 2OKCA 4QRHA 4C0BA 3U4DA 1SEVA 5BR4A 2QVYX 3AZPA 1X15A 1B1CA 2UVDA 1DIOB 3C5VA 2PYZA 4QTUB 5HF6A 3RRNA 3M5DA 1DC3A 3PU6A 2Z5VA 1AKUA 4TVSA 3KDAA 1W1WA 3KZMA 2V7QD 4JUAA 2WD7A 4WKOA 4OMFG 4DM4A 2YN4A 4MP8A 4E0BA 3E15A 3TGPA 4KREA 1P19A 2IEBA 3OZ7A 1M75A 3QLJA 5E7JA 5JFGA 1F1BA 2Z3ZA 3FCAA 1VLLA 1V1MA 1J8QA 4PZCA 4HX9A 2GZ1A 3IMCA 1Q7RA 4DCTA 4A3SA 4J0CA 3KPWA 2BKLA 3L0PA 3ADCA 3D5QA 4KCGA 1UPUA 4E5VA 3SG0A 2WUVA 1QVAA 4B4DA 3OZSA 1N32B 3VJKA 3DBHB 2V3CC 1BROA 1RYMA 1U28C 4EJ6A 3O4RA 2VH1A 2IV7A 1R8JA 3QVLA 2PRZA 3LD9A 4OQXA 4HK4A 2SNIE 1CNMA 4X6UA 2HMYB 5T4BA 2QP9X 2GEUA 2FW9A 5AP9A 2W6ZA 5JROA 3R8CA 4LX8A 3NCTA 1GJRA 2Q7OE 4BVFA 1U1CA 2H4JA 1T36B 1TL7C 1EX6A 2ZATA 2NYUA 3O1HB 4LW8A 1QANA 1AE1A 2V3VA 4J1QA 2G08A 1XGKA 3B9PA 1IMOA 2X6RA 3NJRA 3PHGA 3R5FA 4Z0NA 3V8MA 1K6IA 4P81A 4PZZA 5ITZA 3SVLA 5FLXA 2FDCA 5FLYA 4XDZA 3TYXA 3B9QA 5ITVA 3EPHA 3CB2A 4RF4A 3T95A 3BMNA 1T2AA 3GFVA 3KYBA 1GLGA 3FPKA 1U6JA 4RIIA 4AZWA 1TYAE 2ZKLA 3N0VA 2Q1SA 1NR5A 2OQIA 2QTTA 1W7AA 4DLPA 3E18A 2G06A 2CLFB 2VHCA 3CX4A 2WJJA 3JAKB 4UUNA 4IHJF 4B31A 4D56A 3DDNA 3LP8A 3PC7A 4TYMA 1QH8B 1I7SB 2X40A 1GGKA 2PKRA 3PUJA 4H0FA 3K6SA 2O8VA 2GXSA 3IALA 3GPBA 1E7QA 1DBSA 1ZKDA 4MCIA 3ZWKA 4IOJA 5A04A 3NKFA 4KQ9A 5DLEA 5C34B 3OLXA 4GXRA 2ZTVA 3KXLA 4MVJA 3WGLA 3IO3A 5AKJA 4FDMA 2ENUA 3GW8A 2YFKA 4RTSA 1T0BA 5K6TA 2WA2A 2VS1A 5JH7A 3C43A 1E7WA 3CRNA 1Z6QA 3GT4A 3SFZA 3UV7A 2GNOA 5C80A 5GOZA 3DVLA 1QCDA 1XTSA 2O2JA 2W43A 1O77A 4MLPA 4HDNB 4U7JA 521PA 3RV4A 3ZV6A 3ER9A 1CEYA 2E4VA 2C99A 2FWRA 4UFOA 4AN1A 3GMDA 2A0FA 4D0LB 3KVYA 1KFBB 4HNAB 5SZJA 5BQ3A 1N2ZA 2JFQA 1KYWA 1RWOA 1J0AA 3QE4A 4MYTA 2VAWA 2IYTA 4MYDA 1J8VA 1GRCA 5JVDB 1R4NB 3K2EA 1FFWA 5HJEA 4NU8X 3FBGA 3G9QA 4RADA 3O93A 3WWYA 4EB0A 3LNCA 3ZU2A 5CCEA 4UARA 1QF9A 2XWJI 2R8EA 2YYYA 2OUIA 3B38A 4K0RA 2OFFA 1ZJZA 4AK9A 2GO1A 2PKWA 4OFBA 3C4QA 1ZIYA 2PS3A 3GCDA 1YS9A 4X90A 1O9BA 3LGSA 5LQKA 4TVBA 4OH7A 4IDEA 4YYZA 1CY4A 2WAAA 4MVYA 3KQWA 1FB5A 3NM5A 5AI8A 2GCEA 3G0IA 2O54A 2VT3A 4PGFA 1O57A 3DTVB 4J2HA 4WERA 1BIFA 3VNAA 2VYND 1CB0A 4AJIA 4BE7B 5IYZF 3QHPA 5IVDA 1U7PA 1JFRA 2ISSD 1I5EA 5IMBA 3VSCA 1NQOA 4GZ3A 3K30A 4GVXA 4H60A 5KQRA 3Q5GA 4R8KA 2AKYA 1UWLA 5FOXA 4LRYA 4EGFA 1XKTA 3DHWC 2FP4A 4GG1A 5JJBA 2I8LA 1W46A 2JRLA 4Q0MA 1DLIA 2MCFA 3GEBA 3V48A 3DPSA 1QIMA 2CZCA 2X9VA 4R8RA 1K7YA 2AH5A 2X1HA 3QUBA 2E85A 1DEAA 3NUQA 1PVDA 1KEKA 3T8YA 3E0QA 1Y3AA 1P61B 1V4VA 3IERA 4FFOA 4MX8A 1V11A 4WKPA 1Y1QA 3BIFA 3H42B 4GGOA 1P91A 4N01A 1TM7E 1LRLA 1W85A 3V3TA 4QSMA 3JVEA 2YMLA 3EVDA 4XJVA 1NASA 4AU1A 4LBZA 4P4GA 1WO8A 2VSXA 5CLJA 1S1MA 2P3QA 3VV3A 4NPHA 5CTJA 2X23A 1DAMA 1G18A 3C39A 5DYIA 4JDPA 1GCGA 1B2LA 2QRVA 3OSUA 4GPIB 2OA0A 1T3LA 3JQ7A 3P9IA 4GPTA 3UFXB 1PR3A 1X8XA 2EXXA 4W4TA 5LIRA 4Q48A 1FL9A 2Z8YM 3H0EA 5KHAA 1Y4SA 3RIYA 1QJ4A 2IL1A 2PGOA 4GFDA 3IDOA 1SC3A 1E0KA 3G5MA 2IUUA 5JPDA 1AM4D 1CIJA 1EG7A 2XCSB 1QPBA 1E2KA 1T2UA 3ASYA 3UT5B 4K9LA 5KVAA 4AI6A 4KACA 5HZGA 2V1UA 1OFIA 2ZU6A 4BAGA 3SXUB 1XCGB 3WJ1A 4AY5A 3SMVA 3VXKA 3IESA 4WW0A 2ZJ7A 3KWMA 4JQCA 1DG3A 4BFWA 2I7TA 1VFPA 3WQRA 1A2BA 2AK3A 3QEOA 4K3UA 4MS1A 1VP9A 1WNFA 3TB6A 2QVZX 3WKAA 3WZMA 3AC0A 1FTQA 4R9NA 5FYQA 1JAYA 4YRQA 5T41A 1M34A 4DNFA 2WVGA 2XDQB 2J9YB 4P3YA 1BOFA 1DFGA 2PCJA 4RA9B 3TTUA 4L27A 2QE7D 5FPKA 3NX4A 3VHQA 1EESA 4IGEA 5AJTA 1VZ2A 1GITA 3PEEA 3JZIA 5IWCA 3KUCA 3DUWA 4J0JA 4XIFA 5DYWA 3HR7A 4TX1A 1KPIA 1E92A 1YDMA 3ZJVA 5A62A 1AK9A 1CUJA 4KHZA 1E58A 2B34A 3O4GA 3ZI4A 1U7DA 1YRAA 2VEDA 3AJRA 5H9VA 4DL9A 1DC4A 3ONEA 4HNUA 4L51A 5C1DA 3ZNPA 5EIEA 4OQNA 1MZPA 2PMBA 3LY7A 5DE3A 5FUXA 1GD1O 3NP9A 4AECA 5JSZB 1BO6A 3X3HA 1LWOA 5KTMA 3WBFA 4R54A 4RA6A 3ITKA 2CMDA 5F5NA 2VZ0A 3B1FA 2C3MA 3GT0A 4ZVVA 5TF4A 1JHUA 1Y5IA 5JRJA 2ZDGA 3LIIA 1NR1A 2GYYA 1WXQA 2VRBA 3FOAA 4NYMR 5ALJA 1CDOA 2OHHA 2Q3HA 3FFWA 3HA3A 1RYYA 3B6EA 3MILA 2ODQA 4Q16A 4W7HA 3QKRA 4PNZA 4W7IA 3ZE9A 2ZYVX 1PFKA 4JJEA 4Y1RB 1W93A 4AIIA 1F9AA 3ZQJA 2X6TA 4EB6B 2REQA 4M9QA 5K4HA 2P6RA 4EFLA 3FCXA 1GV0A 3PUVA 5DHTA 4BDTA 3QE9Y 3LC1O 1U8ZA 2ZIFA 2YV1A 5CNJA 3USCS 4QEKA 3OBBA 1U0JA 3I23A 4K9DA 1TVEA 4M86A 4KAFA 2EP7A 2X15A 1GPJA 1UZLA 2CHVA 2IY8A 2JDID 2JAWA 2YNMD 1IEXA 1NI3A 2GD1O 4PLFA 2PS1A 5FI1B 3B9BA 4I4TF 4J49A 1QVRA 2MR6A 3ZX4A 2ZRGA 1M0SA 2H7XA 1TECE 2Z2XA 3X1JA 1N5JA 1L8OA 2QVLA 3ETGA 4IL5A 3W3AH 4K6OA 1RBQA 1KY3A 2EQBA 3KTAB 3C4JA 1JDVA 2KM1A 4E4YA 2GBIA 3AUSA 4EOGA 4PQGA 4NQZA 3SM3A 4FMDB 5JD6A 4S12A 2F9LA 4L76A 1W0CA 2Z5LA 4HXGA 4CKXA 2XDYA 3NTXA 2JLZA 4X41A 4ED9A 1L5ZA 1ZXBA 1GQOA 2ZJOA 3EXIA 1QH9A 4FC6A 4JJ7A 5C2JB 5CEJA 4J0DA 4M0EA 2I3GA 3EF0A 1KZ1A 3K09A 2CHFA 3OZGA 4RL6A 1XTVA 4EL0A 2A0KA 4YUYA 3EIXA 1HDIA 1U4NA 3EPPA 3CZQA 5KZMB 1DQRA 1D4FA 3LC7O 2KB0A 4PYOA 4PX5A 4CETA 2O2CA 2PT5A 4P3PA 2QTMA 3PUWA 3P5BA 3QV1A 4KOEC 1CUDA 3E9CA 5EE3A 2P2LA 1QVVA 5I4CA 5KNDA 1ONBA 4MYSA 5ALGA 2OCXA 4LV8B 1R5JA 4R69A 3NFYA 3K16A 3LWZA 4PCLA 4C7BA 2R8ZA 1F48A 3VOBA 4D4HA 3DDUA 2ZJ3A 3KYJB 3N2KA 2Z56A 1W0KA 1NN1A 1QHYA 1WAMA 4BNYA 1OASA 3I01M 1GADO 4L7QA 1D3AA 2VAMA 4OAQA 2B82A 2F3RA 1HYHA 2AVDA 4PSKA 2JCVA 2CLCX 5DM0A 1OROA 4O08A 4WCFB 3FPBA 3V8RA 4C01A 4DDHA 4L8GA 1TVKA 3QXJA 1CRWG 4H1VA 1PG2A 3AF1A 3TR0A 1EUZA 4DB2A 5C7IO 1FP1D 3D0OA 4H35A 3O4FA 4TLCA 4OGFA 2I22A 1BRTA 1R4MB 1DHTA 5ICFA 4ARZB 3HXLA 3UAZA 4MS4A 1TJNA 2WD9A 4ZAZA 2UZ4A 1NXXA 1NUAA 2IBTA 1RLTA 5A1TA 3PKIA 2PHZA 2Q2OA 2O7SA 2Y1FA 2YW9A 3LLCA 4FQ5A 4N8DA 4L3OA 4LYHA 2OZLB 3MNFA 3FNFA 3ZWDA 2HXGA 3CNLA 2HDHA 1P3JA 3NH9A 4WACA 5PGMA 2QT0A 5JSKA 3SVTA 1SHLA 1RJ9B 2GNAA 3RFXA 4CMBA 3G8AA 4FNMA 3C24A 1Z3IX 2IXDA 2X58A 1JDPA 2GAIA 1U2PA 4WESB 1ZO8A 1ZD1A 3CKLA 1JE1A 2OB2A 4Q02A 3SD7A 4JC8A 5IRCD 1S7CA 2Q6TA 3CTMA 1RCUA 3UBTA 3NVKI 1MN6A 3BWDD 1NJ8A 1UT5A 1GPAA 2A5YB 2PX4A 3FI9A 3N87A 5B6JA 4MRVA 3LRTA 1CUUA 4O1HA 4UD2A 1IRXA 3SYNA 4EIWA 5BQFA 2I7CA 4HAOA 4JLJA 3RU9A 1EFPB 3GRYA 4D98A 5K3EA 3IYLW 2M6SA 1V2HE 5FI5A 5A4JA 3OZEA 1ULBA 3IT1A 3JQDA 4RH3A 4NZNA 4YK7A 3DOCA 1EDDA 5LOVF 4C3ZA 3EFOA 2WTNA 1G3RA 3T0IA 3LQRA 4CL0A 2HWWA 1I4OA 1EK6A 3R7DA 1XZCA 4C87A 1C0LA 3EMBA 2JAXA 3C8HA 2PSDA 4Q3AA 3E9MA 1Y1TA 2JVIA 3SEAA 2GKGA 4WN9A 4JP5A 3U3JA 1BU5A 1WMEA 1SXGA 1K7SN 2PWBA 3LFTA 1N9GA 4O4JF 4TV9B 3VPFA 3WYDA 4AWAA 2C59A 2Y67A 2DKOA 3H1EA 4DDMA 3WOHA 2XRZA 1KJ9A 2A8YA 1NW9B 3BF8A 4DLAA 3L0OA 3GG9A 1Y6GA 4WQMA 3O5AA 2R11A 2GHRA 3FDZB 3U62A 1H1DA 4HSGA 2IHJA 3BTOA 3ZZTA 4LNUA 4BO4A 1Y81A 1P5JA 1VJRA 5KC9A 1NJ1A 1L4UA 2CXTA 2YR0A 4WNYA 1D2EA 1J1ZA 1DTSA 2BFEA 1A9RA 3LPLA 2NUAA 3GUZA 3QRWA 1P2BA 4CF6A 2UVQA 3AO0B 3MCAA 4YP9A 4OKIA 2FSFA 1QMPA 2ZSAA 3IT0A 2WG0A 4EPTA 2I91A 1JPVA 1EPUA 1TQDA 1X2BA 2G5PA 1FNBA 2GXQA 2OWDA 3EVAA 3TNJA 1RCTE 1YDEA 3KQOA 3AESB 1CTQA 1SK8A 3KZ1E 3RH0A 5EJ4A 1L7OA 4A91A 1TMOA 2GZRA 4AZSA 2INGX 3QI2A 1IXRC 1BN6A 1J49A 2FN3A 2A35A 4CKCA 2HCBA 1GAXA 5A3SA 5ALMA 5BWOA 3IQEA 3RAGA 3SCZA 4NOKA 5CYGA 4OFZA 1UADA 3KOMA 5D85A 2JD2A 4Q1EA 5IC5A 4C7VA 1ZKMA 3LCJA 5CG2A 3UGTA 4X8MA 1JBEA 1LX7A 1YUBA 4BY9E 1OR8A 1NM5A 3R0QA 4U7HA 4YUWA 5DW0A 2VBCA 3VJLA 5HBGA 2QQEA 3V97A 4KXVA 4BE4A 4D02A 4QOGA 4FT4A 2F1HA 5J4LA 2ORED 1RHQA 3BXXA 3N2ZB 4KQ2A 3SSAA 3MCTA 4K1LA 4ND5A 2WOOA 1WDTA 1HI9A 1PN3A 1ESEA 2X3FA 1MC1A 3CLRC 5KTOA 1M2VA 8AT1A 4LJRA 4HGYA 3N3BC 1RWNA 2SCUA 3IX7A 2FRXA 4CM4A 4R68A 4WMLA 3ICWA 2HT6A 2QL9A 1PGNA 3M1LA 5LZ9A 2O1EA 3TPZA 4XJXA 4BZXA 3FNEA 1FUEA 2R4TA 3O3CA 4OK6A 4B6RA 3DKIA 2FVXA 4CE6A 3D4PA 3JASA 3MWJA 3RSQA 4BX3A 1YR1A 3NNSA 3SS8A 5DBGA 3SX2A 1REQA 3ZVKA 2C84A 3HNRA 5A3QA 1Q1QA 3K92A 5ER6A 2ANBA 4LY6A 1SXJD 3ZLVA 4AN0A 1QM5A 1G20B 1LLDA 1TAHA 3WQBA 3H04A 4ATNA 3H0KA 4CQMD 2QLJA 1QH0A 5BR7A 4B3CA 1AMUA 1GU7A 2JFUA 1MXFA 3ZE8A 2D5LA 3WK7A 4Z5XA 3OT5A 3IKTA 1MLDA 3UIEA 4N3NA 1YRHA 1HDZA 3RVQA 4A5OA 3F49S 3EW9A 4Y0AA 5HZKA 5EJFA 2GN1A 3ZLJA 3AETA 1IHOA 3QW2A 1JHRA 1V35A 3FX2A 3GCGA 2O3RA 2ZE7A 4JL6A 1PIWA 2C7GA 3OQMA 1HG1A 1R1DA 5P21A 3M4JA 4Z53A 2XKAA 2CFRA 4JS0A 2NO4A 4MB6A 1PJBA 3OJXA 4OL0A 3SE0A 1G4HA 1RLMA 2VQ6A 1USUA 2GPWA 3WMXA 1JRLA 3CZAA 3PWSA 4EMBA 5K3OA 2X6QA 5H9WA 3CBQA 2M9MA 2ZREA 3RRMA 4XEUA 1E6MA 1Q91A 1IVNA 1E6UA 2H4YA 1A9SA 2B1RA 3EMVA 3HB0A 4U00A 4UE6A 5FTLA 1KFJB 1M6YA 1NE7A 3WDLA 1DCFA 3HTXA 2Q41A 1ZPDA 4UMFA 2GXAA 5EC8A 1SUEA 3HY6A 3GMIA 1B2RA 3PXGA 1MT0A 2A67A 3SPXA 5FWNA 5JHGB 2J09A 3G68A 3HP1A 4EHFA 2O57A 4P83A 3H3XA 5EE1A 4BV2A 5EE0A 3VPCA 1XN4A 2R6ZA 1NMZA 3FUXA 4S1NA 1TCAA 5CPFA 2AKEA 1AHHA 2QM7A 4KDEA 5JNTA 4ADSG 4MULA 1YL5A 1GP2A 4ZT6A 2NNWB 1V16B 4Q9LA 4U39A 3LKZA 1KO5A 1ZG3A 5GONA 4LFBB 2WHQA 3D0QA 4TLBA 4E1VA 4HNTA 5KNBA 4ZV7A 4QATA 2J41A 3V2HA 5FP0A 1HORA 2VXYA 3R0JA 4P86A 4JBHA 1H0RA 3OHPA 3AL0C 4QPZA 4CEJB 5E3HA 3BTVA 1DT5A 2VJYA 4CIWA 5DNVA 4IHJB 4BVEA 3L9WA 2DH5A 3GNQA 3GQBA 3FCUB 1XWWA 3LVQE 4PHFA 5DN9A 5KPDA 3B8HA 5CDYA 2OXRA 4Z99A 5IUKC 4HHEA 3RSHA 1NJ6A 4CUZA 2H1CA 4Y2XA 3E84A 2XDAA 4LGYA 1Y5LA 2EHJA 3A4TA 3VU1A 3E2PA 3KKNA 5E6UA 4ZVRA 3HM2A 3DEAA 3VHXB 1H3FA 3K09C 1UDRA 3EK2A 3QPBA 1XD2B 4MUJA 3FR7A 1RQRA 3Q6MA 1ZC4A 2OK8A 2C9CA 2ZJ0A 3CXRA 5C8XA 4NU6A 3GGJA 1PNQA 3YASA 4DLBA 3BGDA 1LVHA 1XP8A 3O83A 2MSWA 4CQLB 1WXGA 3WS7A 2ZAGA 4LFAB 1W5BA 2C31A 2FEAA 2FTKE 2JCBA 3MN1A 3OX2A 4OQ4A 1TO2E 4HAUA 1CF2O 3F47A 2JKZA 3RT7A 2QL7A 3HDJA 2FPRA 4LWPA 3WKEA 5G0VA 1KI4A 2XJ4A 2F00A 1C3OA 1WMBA 4FDUA 4YJFA 4MKZA 2FQYA 1KAEA 1QRAA 2DFLA 4QBKA 1BA2A 4Q4AA 2YFYA 2B8NA 1USGA 2VDKB 4JEIA 4MTCA 3U7FB 4BO7A 4YUAA 3P52A 3W1WA 1LZLA 1M2JA 2VJOA 4N9WA 3REOA 2YV3A 3BBLA 1R00A 1QWSA 4XB2A 5E7IA 1YHYA 5FO1A 4MCJA 4MTLA 1SIOA 1RHKA 1WVIA 2Y68A 2G1UA 3A11A 4RSGA 2VYFA 4Y2JA 3R8XA 1C1HA 3V46A 5I7HA 1I7QB 4JZYA 3VR4H 1IJBA 1V0JA 2XPCA 2ZYTX 3CEJA 3ZNOA 3IPRA 1ZMXA 4BOYA 5JTTA 1XE3A 1YRWA 2EZUA 1T4CA 4DQUA 1QYXA 3NPMA 1YZKA 4DC0A 4V1CA 5IYZB 3AHIA 2JFFA 2OR3A 3FLEA 4RGQA 4MEBA 1ZOLA 2HJRA 3NT5A 5U4XA 4GI5A 4YMTA 4H31A 2AD1A 4L4ZA 2RH4A 1NRWA 1SBZA 2IK8A 2FPIA 4MQMA 4KIJA 3ZIAA 2FRDA 1SXHA 4ZOCA 3I30X 1VHTA 2VUIB 3G2QA 1B76A 2XQIA 1FFDA 3MTJA 4GO1A 1QGDA 4TVKA 5EKUA 1CP3A 3EZ2A 5GGXA 3SSNA 2GD6A 3V5NA 5F2NA 3ESZA 3W5JA 4G6ZA 3IMEA 1DP4A 1IB0A 2QLFA 1UBOS 1EP9A 4UBNA 1UOPA 2CLHB 3ZY5A 2VI5A 3IELA 4OHKA 3VU9A 1E3DA 3MFQA 1I33A 3I45A 4DV6B 4Y9SA 4PYRA 4F2DA 2ZJ1A 3B3QA 3G8CA 2CN1A 3JYNA 6YASA 3FGZA 1V3UA 3IP6A 1CQIB 2QZ4A 3BXGA 1YHZA 3HZRA 3CUWA 2VPWA 1Q17A 3G2MA 4KFUA 3RBZA 3PDCA 2BJWA 1PWZA 1VIYA 5IKPA 2VVTA 4KDFA 4YNBA 5KYVA 1O6FA 4M0DA 2IS4A 2XW6A 2AEJA 1ENOA 2BCJQ 3PEVA 1L1FA 3I42A 3ST7A 4BQOA