1ZI6A

Crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 81
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi6A00
1CUEA 2O2GA 4BE4A 3CN9A 3E1GA 1GZ7A 2QTBA 1VXRA 4KRYA 2XMZA 4QA9A 4EY4A 1LPNA 3FLBA 3IDAA 3AIOA 5FPPA 3FSGD 4U2GA 4DNPA 4HXFB 2ZJFA 2XT0A 1DX6A 4Q1VA 2CKMA 4J0KA 1IZ7A 1VKHA 1IUOA 7YASA 1XRQA 3M81A 1ZD2P 4YK7A 5CT9A 5C7YA 2K2QB 1XLWA 4UHBA 5EHXA 2VJDA 3IULA 2ACKA 4HRYA 1QLWA 1BN7A 5SYNA 2LIPA 1XQVA 3PE6A 3QMMA 5K3DA 3KOOA 3P2MA 3MUOA 4HS9A 2GBCA 5LKAA 2JGLA 2H9YA 3ESCA 1W76A 4WFJA 1NU8A 1EDBA 3WWPA 2XUFA 3D0KA 4PF1A 4AO7A 3D7RA 3A2MA 1MNAA 5CXXA 1JJBA 1QE3A 2QZPA 3KWFA 3HI4A 4UPDA 1BEZA 5AKLA 3BJRA 3N2ZB 3VISA 4ZI5A 1H2XA 1QIGA 4P93A 3W05A 4BYMA 4MQMA 5D3KA 4X6YA 2X8BA 5AKEA 5HFAA 1YS2X 1R9NA 1U65A 3IBTA 1MNQA 3PFCA 1ZD5A 5DYWA 4AB1A 4U2BA 3O4HA 1HQDA 4N8EA 3WK6A 1CUUA 4IH1A 1AC5A 1YB6A 1LPBB 2ONCA 3C6ZA 2O2HA 3DYVA 1EHYA 4Y2JA 4IQ4A 4B81A 4BB0A 3NWOA 4B82A 4KE6A 1FFDA 2B9VA 2J4CA 2FUKA 1XLVA 2H7XA 4AMZA 4QLAA 2WLSA 1GKLA 2HL6A 3OM8A 3VJLA 4H7JA 4Y2TA 3O9VA 4L9AA 5ALVA 2PKYX 2CMFA 2I3DA 2W6CX 1VA5A 4X93A 5EFZA 4L72A 4UHFA 4DMHA 2XUKA 3QBJA 4CG1A 2AJLI 4M0FA 1R3DA 2WJ6A 2AXEA 4NZZA 5K5EA 4FFVA 2JGMA 3I28A 5JAPA 1UK8A 3H2HA 5E2IA 4EA6A 2DR0A 4Y2PA 5ALYA 2C0QA 4FLFA 1MJ5A 4B80A 4KEAA 4GHWA 4C6HA 4Q3OA 3WYNA 3PUHA 5LZ4A 1XZDA 2QUAA 4KR0A 3I2GA 4OU4A 4H7DA 2WFLB 1CV2A 2VJCA 3T52A 4U2FA 3OURA 1HKHA 1WOMA 4E11A 4EY5A 1WHSA 2BAGA 3AJAA 3QMWA 3WA7A 1XRNA 2WIDA 4GLBA 1FFCA 5C8XA 3C45A 1SC9A 1KU6A 4NS4A 5ALJA 4MYDA 4PQEA 1FFEA 5ALSA 5DTIA 1AZWA 4BCBA 3QM1A 2EDCA 1MO2A 3WKAA 3STWA 3WIOA 1IZ8A 4HRXA 5IVHA 4BBZA 4H7IA 3HXKA 4G4GA 4INZA 3I6MA 2WFLA 5JASA 2CZQA 4ZXFA 4OYLA 1NU6A 5JANA 2XMRA 1G66A 3BJMA 4BTVA 2BGNA 2RI6A 4QDUA 5AK3A 1FJ2A 1Q84A 3G8YA 5HF9A 3FYTA 5AOCA 3WJ1A 4UHDA 3W9BA 5ALRA 5LP1A 2RIPA 4WDRA 2BUCA 4KYVA 5CTAA 3S2ZA 2DSNA 5A2GA 4BC0A 3NGMA 2OLEA 4FLEA 2ACEA 2WUFA 4Z49A 2WSLA 3CN7A 1XZAA 5CT5A 2C0PA 2WM2A 4B85A 4UBKA 4BAZA 2VAVA 1VA4A 4DMFA 4BDTA 3TGLA 3FYUA 3EIOA 1LPSA 1BRTA 2XQIA 2WJ3A 2Z5GA 3RLIA 2IX9A 4OPMA 2RHWA 2WTNA 4UBJA 3WL8A 2HADA 2WIJA 5AK4A 3DEAA 4NMWA 3QPCA 1H22A 4DSZA 2PSHA 3R3XA 4K6GA 1UKBA 3UUFA 5CBKA 4EBBA 2HRQA 5ALTA 4AX4A 1QZ3A 4YASA 1ODSA 1IUNA 2JEZA 1A88A 3R3VA 4X3CA 3MVEA 2EDAA 3PF8A 1QIJA 4AN1A 3DNMA 1CQWA 3G0GA 4MXDA 4EY8A 3M3DA 2WG2A 3WLAA 3QZUA 1SOMA 1JU3A 2HDWA 2Y1KA 3LIIA 4P08A 2GBFA 5JYCA 4B6GA 2HU7A 2XQJA 2WHRA 2VEOA 1TCAA 2PSJA 1ETHA 2PUJA 3GROA 3IUNA 5K3AA 3BDVA 4RE6A 1AURA 2XUOA 5I9IA 3H1AA 4PSCA 5ALLA 5JZ9A 4UFNA 1BE0A 1HLGA 4DNOA 4Y2RA 4ARBA 1ACLA 3H2GA 4JYPA 5I7UA 3L1IA 4H18A 4RGYA 1WPRA 1WB5A 1ZIXA 3BL8A 1GKKA 3IUMA 4MWSA 5LLSA 4WDQA 2HFKA 3O9MA 3SC2A 3KXPA 5AI4A 1W75A 2D0DA 4W63A 5YASA 3R3YA 4JNCA 1XZKA 2OCKA 3ZV7A 3AZQA 4BVLA 1LZLA 2XMCA 3FLEA 5FOQA 4QDZA 5JD6A 1Q0RA 4OB6A 5K3CA 1PJAA 3ZLVA 1OILA 3QYJA 3G0DA 1RWQA 5T4EA 4CG3A 2XMSA 1W1IA 5K3FA 3I6YA 4UBIA 1QOZA 2E3JA 3OTQA 1THTA 2YXPX 5ALKA 3YASA 3D3NA 3B3QA 1DU4A 4GWLA 4L0CA 1QFMA 4MQLA 5DNUA 4FDMA 5EIEA 1ZI8A 5AKKA 1VE7A 2WG0A 3WWCA 2OCLA 2CB9A 5AM3A 1SCIA 2HA0A 1UKCA 3WI7A 4RNCA 5ALXA 5SYMA 3NOXA 3G0CA 4IH9A 1UK7A 1N8SA 5ALNA 2J3QA 1LBSA 1BCSA 3CXUA 4J7AA 1UK9A 3ED1A 1XLUA 1ORVA 2XMQA 1AX9A 4ZRDA 2UZ0A 4BATA 4BCDA 2GZSA 3VVMA 1BROA 3DJYA 1DINA 2WU4A 2HHAA 5IVDA 4K5QA 5AH0A 1ODTC 4GI1A 3W06A 2QT9A 3ZLUA 1EK2A 1WPXA 2HM7A 4N8DA 4J0HA 4Q82A 2PUHA 5H3HA 4UBOA 5A6VA 1CVLA 1YA4A 2VJBA 2Z3ZA 2WU3A 2WFZA 5FV4A 1EI9A 4Y9SA 3HZOA 4B83A 4GBGA 1BN6A 3I2HA 2ECFA 4W1PA 1EDEA 4WJLA 1GPKA 4RPCA 3NUZA 3V1NA 4H7HA 1C4XA 2I03A 3F8SA 5CH8A 1EH5A 2G63A 3WK5A 3KDAA 3D2AA 1MU0A 4BDSA 3AIKA 5BWCA 4M0MA 4I3FA 3FVRA 5AKJA 5JD4A 4LKOA 3TJMA 1VXOA 3ZLTA 4B0PA 3DOHA 1DT3A 1UOQA 1LGYA 2BCEA 5ALEA 4WY8A 1Z68A 1CRLA 4D9JA 1UXOA 1P0MA 3F96A 3FOBA 2XUAA 2QJRA 4CG2A 5BOVA 4HXGA 5FLKA 4QDTA 1EVQA 3ZI7A 4W1QA 1QIHA 3WKCA 1H23A 1L7RA 2V97A 1CUFA 4PO3X 4BE9A 2ZYIA 1LPOA 1EVEA 2CJPA 4F5ZA 3I1IA 1JT2A 3BIXA 4IHAA 2PL5A 2VSQA 4CCWA 3LS2A 4FWBA 4AMYA 1LBTA 4FBMA 5AKZA 3E4DA 3R0VA 1ZIYA 1RYYA 4X91A 1QIMA 1CUHA 5CT4A 5ALGA 2OG1A 3G9UA 2Z8ZA 2VATA 1FFBA 2ZYHA 3E0XA 1EA5A 2PBLA 2G5PA 2VA9A 4MEAA 1G42A 4DYHA 4AN0A 4PSDA 3STVA 1CUYA 3G9TA 4C4YA 3DL4A 1CUZA 5ALPA 3PFBA 1O6FA 1YB7A 1XZGA 3BIWA 3H18A 3D2CA 1QJ4A 5LKRA 4BVKA 2Y6UA 4FNGA 5CXUA 3OOSA 5AKIA 4BRSA 1TAHA 2PSDA 5AOBA 5ALDA 5ALWA 3C8HA 2ZSIA 1DTEA 4EZIA 4BCCA 1ZD3A 2Y6VA 1ORWA 3STTA 1AQLA 1E8DA 3H17A 1L7AA 5DJ5A 5DNWA 4N5HX 3S8YA 2B4KA 2VTVA 3D2BA 3D59A 5AM1A 3F98A 4C87A 4H7EA 2OGTA 1JMKC 2PM8A 3WKEA 4ROTA 1UOOA 1A8SA 3WL7A 4F0JA 1ZOIA 3N0TA 3DS8A 3QMVA 4FKBA 4C88A 5AHXA 3ESDA 4XX1A 5ISMA 2QKYA 3H2KA 5IKXA 1E89A 4MEBA 3PI6A 5FP0A 2GZRA 3H19A 4GXNA 2GYVA 3FVTA 2FJ0A 1PV1A 3G02A 5JALA 2XQFA 1OXMA 1E3QA 5AKXA 1WB4A 4B9AA 2NW6A 3IIIA 5JADA 3G0IA 4S0XA 2AJCA 3ESBA 4KAJA 2PSEA 3WWOA 1QTRA 2YH2A 3UMJA 4FTWA 3DL7A 4L3WA 1XQXA 1BEEA 1GQRA 4E46A 2I78A 1LPAB 5CMLA 3AIMA 4AXBA 2DQYA 3WYDA 1FFAA 5FXMA 4WFIA 1GPLA 4QWMA 2OPHA 1HDEA 2XLCA 3IUJA 3F97A 3GBSA 2XUDA 4DSAA 4KJXA 3O95A 1IVYA 1EINA 1E8MA 5JARA 1W4LA 2O7RA 1E8NA 1SFRA 3FNBA 4X71A 3HJUA 3GA7A 1R9MA 3EF3A 1C7IA 5CT6A 1VJ5A 4LIPD 3PDCA 4X94A 3ANTA 4HXEB 3FWHA 2OAGA 3KWJA 3OC0A 4J3JA 1CUJA 1XZMA 5ALIA 3L1JA 4QE3A 3C5VA 5K3BA 1CUCA 2Y2UA 4J0JA 2XUPA 5LZ9A 2QXTA 3DKRA 3RKSA 2ORYA 5AO9A 4OUKX 4J0DA 3O4GA 4JEIA 3GFFA 4ZV9A 1YAHA 1ZI9A 4DNQA 2QR5A 3G0BA 5HF8A 4I19A 2ZJ7A 3IA2A 4KACA 4V2IA 4C89A 4BTLA 2WTMA 4FBLA 1WHTA 2ZVDA 3IURA 1B6GA 2IITA 2XE4A 4Q3KA 4DMKA 2QS9A 1R1DA 1ZI6A 4UHEA 5A71A 1J06A 4X6XA 4B0OA 1EB8A 5BWBA 1QIKA 4AZ0A 2GBGA 5ESRA 5DYYA 4BC1A 2VT6A 4Y7DA 1CUAA 4EY6A 1Y37A 2PX6A 2WUDA 1A8UA 4X6UA 2RGUA 1LPMA 4BZZA 3SX4A 4QWWA 3I2JA 3ZWQA 1CUWA 6YASA 4U2DA 4ZWNA 3DDUA 2JEYA 1U4NA 4FFWA 1IUPA 2XMGA 1TCCA 1NX9A 5D3ZA 4E15A 4BP8A 3X3HA 2OQIA 1R50A 3EQ7A 3FCYA 4Y2YA 3OG9A 1X70A 4MYSA 5ALOA 4UBMA 3WZLA 3C6BA 2ZYSA 2ES4A 4OB7A 1W6RA 3HRHA 5AKHA 1I6WA 2XUIA 2H7CA 2I3ZA 3I6ZA 4I4CA 2WG1A 2DFPA 3WL5A 3PICA 1XFDA 4H7KA 2WUGA 1DWPA 4X85A 3K6KA 1G4HA 4CIAA 5LZ2A 3M83A 4KE7A 4MJ3A 4TVKA 3B5EA 3AFIA 4G9GA 2DHCA 1CUIA 3R41A 4B7ZA 3AILA 1JU4A 5KWJA 4CI9A 4QZVA 1QTIA 4Y2QA 1XRRA 1WB6A 2BFNA 5CH5A 2GBIA 3C6XA 1CQZA 3OPMA 3QVMA 3F9CA 4HAIA 3A2NA 1JJIA 1JKMA 2QMQA 5EI5A 5LZ8A 4W9RA 1XKTA 1XZFA 2JBWA 5T4HA 1GQSA 4YPVA 1J2EA 3D5EA 4H7FA 1CUDA 4C4ZA 2AJ8A 3Q0TA 2ZYRA 4B84A 4XWGA 4G8BA 4O08A 1S8OA 5CURA 4Q34A 3KD2A 5LYYA 1PFQA 1CUVA 2QJWA 3H2JA 3MUNA 2BKLA 4Y2UA 1FSSA 3AINA 4E14A 1CIJA 5AM2A 4F21A 3LLCA 1CFJA 3V48A 3U0VA 1QGED 3R40A 3LIPA 2JGJA 1XZJA 2O2IA 1THGA 5JD5A 1CPYA 1K6EA 4FHZA 2XUJA 1DT5A 2C4HA 1GGVA 2WIKA 2B20A 3DKKA 1AGYA 1A8QA 4ZREA 3G9XA 3VXKA 2QRUA 3AZPA 2JGKA 3WK7A 3VVLA 2ZSHA 5HZGA 1QIDA 1MAAA 1EX9A 3DOIA 4LXGA 4OCZA 2JGFA 3GUUA 4AO6A 1QO9A 3ZPXA 2WHQA 4TPKA 1YASA 3WWDA 1KU0A 5ALHA 3R3UA 4IO0A 3B12A 1K5PA 4BZWA 5HQ3B 1P0PA 3ICWA 1K63A 5AKGA 2HA2A 4G1FA 1JFRA 2HU5A 2QOEA 1E5TA 3JYHA 3FAKA 4LHEA 3WZMA 4W1RA 2PVSA 1XZCA 1UT6A 2OAEA 3CCCA 3WK9A 4J0IA 3C8DA 2YYSA 2OQVA 5C8VA 2RONA 4ZV7A 2XDWA 1UFOA 4JYMA 1N1MA 3WWEA 3A70A 3AZOA 5JZSA 2VAXA 3WJ2A 1QIIA 2XUQA 4H35A 2XUGA 4LYDA 5HF6A 1CR6A 4UFOA 4Y2XA 4WCVA 5EGNA 2XQGA 2BUAA 3EQ8A 5FDFA 5KWIA 2W22A 1XZHA 3I1YA 3I2KA 3KSRA 2V9ZA 2V98A 4U2EA 5DYTA 5AP9A 4QDOA 2H7YA 3RARA 3K2IA 5EIHA 1EDDA 1JI3A 2Q0XA 4QNNA 1QIFA 4UBNA 3PF9A 5E4JA 4PSUA 4TGLA 5ALUA 1N5RA 2O7VA 1BS9A 1T2NA 3WMRA 2RHTA 4BAGA 3SWWA 4UFPA 4DIUA 5IH7A 1UWCA 3U1TA 5JAOA 1ACJA 3R3WA 3H1BA 4CCYB 5JZBA 1P0QA 2WFMA 2VF2A 4K6KA 5HFNA 4X90A 2XMBA 2X76A 4ITVA 1C7JA 2R11A 1GT6A 3EQ9A 4A5SA 3FYUC 2WKWA 4OYYA 1O6GA 2FJPA 1TQHA 1YA8A 1QONA 3G7NA 2J4FA 4P92A 4UBLA 5HF5A 2QXUA 5LZ7A 3WK4A 3R3ZA 1VZ3A 2XMDA 1X2EA 5ALMA 3HC7A 2YASA 1EK1A 1CUXA 3DYIA 1MX5A 1OCEA 5AICA 4U2CA 5J3JA 5DWDA 1UKAA 3PUIA 3SK0A 5I8PA 1ZICA 2XUHA 1LLFA 5EHQA 1HPLA 3LP5A 3IUQA 1R88A 4H77A 3ILSA 5K3FB 3DCNA 1R4ZA 3E3AA 5AJHA 3BXPA 1VOTA 1HL7A 4AO8A 1ZGBA 4CCYA 5DTJA 4BP9A 3A6ZA 1Q0ZA 4XVCA 1F0PA 1UOPA 1X2BA 3JW8A 4DM7A 1MX9A 4KRXA 2JGIA 1KEZA 2GYUA 1USWA 2C7BA 1ZD4A 3G9ZA 4MWTA 2QUBA 3I2FA 2QM0A 4A23A 5CT8A 2OGSA 3QPDA 5ALFA 4YX9A 5JAUA 3RK4A 1K4YA 5BV7A 4G8DA 3VJMA 3I2IA 5AKYA 4N5IX 1BCRA 5CRIA 5E4TA 1YSCA 5AIAA 1JMYA 4LXHA 3EBLA 5EIAA 1YR2A 2OXEA 3CCBA 2HRRA 2CBGA 4FMPA 4A16A 1ISPA 4EB0A 1XQYA 1VE6A 4LYEA 5E4YA 1DWQA 4Y2VA 2XI4A 1DQZA 5T4BA 3H0CA 4GW3A 2PSFA 1XQWA 2V96A 4EUSA 5AI0A 2WHPA 2WQZA 3GZJA 3MGAA 1DQYA 5C81A 3JWEA 5HCUA 1RP1A 2H1IA 5AI8A 5JATA 4KAAA 4X7BA 5AM4A 3VKFA 4GEGA 3FSGA 1MPXA 4BRZA 5HKAA 3TRDA 1YS1X 1ZJ4A 4G5XA 3HLKA 3STUA 4RE5A 4OB8A 2WJ4A 1UK6A 1LPPA 1H2ZA 1M33A 4OSEA 4Q3LA 4P9NA 1CUSA 2PU7A 2Y2VA 2DHEA 3C6YA 3BF8A 4J0GA 3FBWA 1VZ2A 1U2EA 4PV7A 3LCRA 2ROQA 1Q83A 1MN6A 2CEKA 2HA6A 5A7GA 1H2YA 2XQKA 1U8EA 3O4IA 1DX4A 3STXA 3QITA 3Q8WA 1H2WA 5FUMA 1XKLA 1CLEA 1A7UA 4GECA 1AUOA 2Z3WA 3V9AA 5AIBA 5AOAA 3FLAA 1XZIA 2J3DA 4ARAA 2GYWA 4K2AA 1J07A 3W9UA 3QH4A 1SCKA 2VJAA 4KE8A 4AQDA 1JJFA 5LIPA 4QLOA 5A62A 5F4ZA 2AJDA 2RAUA 3HYSA 4UHHA 3W2TA 4KAFA 4C01A 1ODCA 1Y7HA 4B9EA 2HIHA 4HZGA 1MX1A 1AKNA 3HACA 1D07A 4DNFA 4G8CA 5FPQA 1GPNA 1AMNA 4DMCA 5KREA 5AM0A 3C87A 2G5TA 4J0CA 4X95A 5LZ5A 4BVJA 5KBYA 5JIBA 4IH4A 2IIVA 4EHBA 3BWXA 3H2IA 5HK9A 1WM1A 4W1SA 3V1KA 2AJBA 1MTZA 3BF7A 4OU5A 4XIIA 5AM5A 3GELA 2BGRA 4ZGBA 3WA6A 1E66A 4X92A 4CIBA 1YCDA 3WL6A 5EHZA 3HABA 3A2LA 1XZEA 4UHCA 3HSSA 4JH0A 1P0IA 5AI6A 4EY7A 5EHNA 1TIBA 1XRPA 3D4LA 1LNSA 4GDMA 1CEXA 2Z8XA 3WKBA 4CFSA 5A7FA 4ETWA 2D5LA 1G5FA 1QO7A 2XB6A 2HA3A 4AZ3A 3WK8A 2BJHA 4X00A 3DD5A 3BE8A 1W52X 2BUBA 5ALZA 1TCBA 1EB9A 2WIFA 2CUTA 4PNZA 4F60A 1BU8A 2EEPA 4Q05A 3RM3A 2PPLA 1TRHA 4FNMA 2WIGA 1F6WA 5T4FA 2X5XA 2OGZA 3HEAA 1ZJ5A 2B61A 3ESAA 5FRDA 4BAUA 3O0DA 1J1IA 2JGEA 5DNVA 2WUEA 5D6OA 5AI5A 5CW2A 3V1LA 3WIBA 3BDIA 3WQHA 3DLTA 1L7QA 4QDXA 3C5WP 3L1HA 1SCQA 4DLNA 1VLQA 2HA4A 3AUKA 4FLMA 1K8QA 1XRLA 5JAHA 5HKBA 5AK5A 3VDXA 3FCXA 3IVMA 2DQZA 1QIEA 1YAJA 1EXWA 1N5MA 4G4JA 2WHPB 1QFSA 3VJKA 5C8ZA 4LXIA 1WCYA 4HTAA 3TEJA 2HU8A 2VQ6A 1GXSA 5D7BA 3C70A 3QPAA 3IB3A 4WY5A 2QVBA 2XLBA 2C58A 3T4UA 4FOLA 1XZBA 1T4MA 3STYA 3H04A 1B41A 4HVTA 5K3EA 4K6HA 3O4JA 5CH3A 5HK8A 1MT3A 2OCIA 5IVIA 4G4IA 3F67A 1XROA 4UUQA 3ANSA 5FKJA 2JF0A 2HFJA 4X97A 2WILA 5IVKA 5AI9A 5ALQA 2C5FA 4OD0A 2DHDA 1HBJA 3K9BA 2R8BA 4JUIA 1MAHA 3C43A 5HQ3A 1CUBA 1TK3A 1TKRA 3WKDA 3FYUB 4QEKA 4N8SA 3M82A 1XZLA 3W04A 2HA5A 2VT7A 1ZGCA 2HA7A 1DWOA 1CUGA 4NVRA 2G4LA 5AK6A 4DTCA 4M0EA 5DLPA 3V1MA 5A7HA 3UUEA 2PU5A 1UZAA 4C4XA 3ICVA 4XJVA 4KE9A 1Y7IA 2OCGA 1IMJA 4WFKA 2DCMA 4DGQA 1F0NA 4H0CA 2ZJ6A 2FX5A 2P8SA 4PW0A 1XRMA 2C5GA 4Y2SA 1LZKA 2JIDA 3DQZA 4J03A 1F8UA 4G9EA
chains in the Genus database with same CATH superfamily
3G1WA 1HT0A 4IDNA 3UJ8A 3SE0A 2CLCX 2NUPA 3H6GA 1YS9A 1VHDA 1Z63A 2FE1A 4L6CA 1ZC3A 4OXXA 2GD2A 3MIIA 3ZQ6A 1Z08A 2ZZKA 3UGJA 2QTBA 3C3WA 2PWYA 4K6CA 4BEJA 4KRYA 3T7RA 4MGEA 4B4VA 2W4IA 3PJEA 3ENWA 3ZCSA 1SVOA 4EY4A 5FWYA 1FMLA 1HTTA 1LPNA 3IDAA 4P5PA 4JLOA 2ZP1A 3OD5A 4JI8B 1OBVA 1XSEA 3ONNA 4LI0A 1YZHA 3FSGD 2FCRA 4TROA 3RVDA 3HCAA 3UOWA 3QFCA 1USVA 4AJJA 4C1NA 2AVDA 1OTHA 2RKOA 3IUSA 2G0NA 5DIZA 3WB2A 4QBFA 2QLBA 1DTWB 1QH9A 4R2HA 2VHVA 3NIWA 4NOJA 4LXXA 3D02A 1SCDA 4LXTA 4J0KA 4RCVA 4U6SA 3RUEA 3X2EA 2UXDB 1M8FA 2A9VA 3TDKA 3ZWWA 1IZ7A 2NYUA 3VV3A 3KTAB 3IR5A 1WUTA 1CQXA 1IUOA 3SS9X 3T3HA 2DWQA 2HJHA 1LC3A 1PQPA 2NQ8A 7YASA 1XRQA 4EYKA 4YK7A 5CT9A 4ZN6A 2NZ8A 1QB7A 2PQ2A 3TE7A 4URWR 3K0AA 2W6ID 3A1VA 3MQFA 2VJDA 3MCZA 5KX5A 1NJSA 2YV4A 5J4KA 1SMKA 3KVNA 3L79A 3FR8A 4DEXA 2ACKA 3JSAA 5KSYA 2F3SA 3VR6H 2EKZA 2RHCA 3VQTA 4F38A 4ZTUB 3PP8A 5JTTA 4ZYUA 1BN7A 4KG7A 3H0EA 2V45A 1NASA 2VNHA 2J67A 3E3OA 4YYZA 1MZVA 1WU8A 1WVGA 4RFVA 2OK8A 3P9NA 5C53B 4JVSB 4BV8A 2XA2A 1KF0A 1XQVA 2PR2A 3RS0A 1U2QA 5LA6F 4PLWA 4Y1RA 3DGFC 1SZPA 3GA0A 5JXIA 3KOYA 2A2ZA 1S4MA 1A7JA 3MUOA 4HS9A 2W6JA 4TL8A 2D62A 2GUWA 5LKAA 1Y9EA 1S2OA 1ZCBA 1OJLA 3A3KA 3CNEA 2RHLA 3L1VA 4O4HB 3S2FA 1MA3A 4IEEA 1KEEB 3D8BA 3ESCA 4O29A 1XEWY 1DFGA 2V7GA 2C3UA 2ZE8A 4GZMA 2C54A 1E98A 4MZDA 5IMBA 4AU1A 1ULHA 4EPXA 5BXQC 4Y9RA 1QGOA 4H6PA 4UAJA 1V37A 1TM7E 4X66B 5MHTA 2AEMA 2WJHA 2ZUEA 4CEIB 2B8JA 2Z09A 4EFDA 2XJ4A 2OK7A 3KZOA 1YUMA 4DILA 4QOHA 1YC5A 2BGTA 3AYXB 3ZNOA 3ZKAA 1OUMA 4HSEA 2FFAA 3A2MA 4RJTA 4TTTS 1RABA 2RGEA 1RU3A 1VJDA 2H4FA 2R8EA 3G2HA 3IC5A 3PITA 2ERYA 4JFAA 1MNAA 4ZAVA 2F48A 1JJBA 1QE3A 4M0PA 5EINA 5HMMA 3CG0A 2F1RA 2IK8A 3UHPA 4AURA 1BG6A 2HD4A 5FTKA 4GEKA 4NOKA 4OL0A 4EUHA 3ZHZA 1CE8A 2QRVA 4CQMA 1R27A 4MA4A 4YAIA 3BZWA 3KWFA 3W1VA 4ZK6A 1GTMA 4ITUA 2RB4A 3ESRA 5AW7A 1JI0A 1BEZA 3EW7A 4Z2YA 4IUDS 3BDAA 2PH7A 2VXBA 1SA0A 3BJRA 3N2ZB 5E9QA 4BVBA 1P2GA 3DPUA 4ZI5A 4HB0A 2VXCA 3B3GA 3ITNA 5KOHB 1C3OB 1QRRA 4CKWA 2KHZA 1NRWA 5ABPA 3H0KA 2AD5A 1B0AA 3DT8A 3ABSB 4GR4A 4DMLA 4MQMA 4J1SA 1SZCA 1X1QA 2J31A 2O7NA 3FX2A 2CLIB 2YDXA 3CGWA 5KUTA 1EEXB 1PZNA 4ZT6A 2EZTA 1GP2A 3KP1A 7ABPA 1R9NA 2JLWA 4ZU1X 1D0VA 1U65A 4CM4B 2YL2A 4CU2A 2Y92A 1WB9A 2AE1A 1N5LA 1MV5A 2XOKD 4JAVC 2A86A 3SBOA 5LXTF 1K66A 4ND5A 4P2BA 1VHWA 1JJVA 3PIRA 1Z88A 1WLSA 3QBEA 3IMGA 4ZV4A 2GB4A 1B42A 2QT1A 2LNDA 3I0MA 3OZBA 4JLWA 2LPMA 4GX5A 4N8EA 3UFBA 5KYXA 2YIDA 3ESQA 4ND2A 1WPQA 3CTMA 2I65A 1P6XA 3OPXA 4PZEA 3EDCA 2PX2A 3OTHA 1AK9A 2BC9A 2NQ2C 3RAPR 2Q45A 2YC4C 4E3WA 2X3FA 1EHYA 2HO4A 4R1MA 5EP2A 3ETEA 4KE6A 3AI7A 4WEOA 2B9VA 4HEJA 4MJLA 4KI7A 5JQGB 3M89A 1XLVA 1K8XB 2IZ1A 5JNRA 2R8ZA 1CW2B 1UPUA 4I9UA 4UC0A 1A1SA 2VDVE 3CNLA 4QBHA 2J08A 1OHHA 1S8NA 2Z56A 4M1ZA 4MIKA 2AC7A 1T2VA 2IHVA 5KTYA 3MUEA 3CLKA 1VKNA 4CV2A 2C04A 3LQRA 4X1YA 3MHPA 1KQ3A 4G89A 5H81A 1RACA 1DAFA 3GRPA 1A77A 2OCDA 2PT6A 4H7JA 3W0LB 2BOVA 1YMVA 3O9VA 5A04A 4BZPA 4MARA 4Q12A 3TS1A 4RTQA 3V1YA 3U4GA 1N7IA 1QQ5A 2ZCUA 1QO0A 4DQLA 4DJAA 5BV2P 2UUBB 2AOWA 4LFCB 3BJEA 4LZOA 1VA5A 2WWYA 4LZLA 3SXUA 3GDWA 4F4UA 2VHYA 2RSLA 4KL8S 1T4GA 3HH8A 1JTFA 1RVDA 4RZ3A 3O83A 3OSUA 2A88A 5L40A 1NQAO 3S27A 1DKNA 5M04A 2HXSA 3WICA 3WLSA 4CG1A 4M1QA 4EA7A 3T61A 5JS7A 2AJLI 2SNIE 2UYQA 3HKEA 4OBBA 2CV0A 1U1CA 1E4EA 5FNVA 2WJ6A 2QGNA 2AXEA 3K96A 5FBZA 5HS4A 1NVMB 3LY9A 4WA8A 1N8KA 5K5EA 3DMYA 4QQKA 2G5CA 3VX3A 3SJZA 3NTUA 4ZZ0A 4BMOB 2JH9A 5B64A 3HI6A 1A9ZA 3DFKA 3E7FA 3EW9A 1UK8A 4ZT7A 3WL3A 5IUNC 1QKJA 1SUIA 5E2IA 1UFKA 1M0TA 2DR0A 4EA6A 4QPNA 4YJKA 5ALYA 3V1UA 3IEMA 2P75A 4HAYA 4YROA 4B80A 1KA9H 4QPPA 4EJ2A 2AFVA 5KU7A 1QUEA 1XAGA 4EKDA 1I2ZA 5ECYA 2YWXA 4OLJA 3WAGA 3T6KA 4RETA 2OUKA 2VT3A 3UWMA 5K8IA 2AC4A 2A3NA 2EAUA 1HMPA 1TXGA 4AQYB 5A05A 3ZCTA 1CB0A 3MELA 1KHTA 2V54A 4R3UC 4RJLA 4V38A 2ZZMA 3LBYA 3UUWA 3RRNA 3W5VA 3BILA 1PR6A 1RBQA 2QUAA 2FQYA 4QBTA 3QE9Y 3MB8A 4KR0A 4PLHA 4OU4A 2NU9B 4B3SB 1NE7A 1QVWA 2ZI4A 3MJTA 1ZAYA 2WFLB 2C2OA 4QPDA 1ZU5A 3FZEA 4QUBA 3I01A 4W1QA 4BO7A 3EF0A 1BQEA 1ECJA 1HKHA 4CN8A 4JX9A 4F5YA 4RQTA 4E11A 4ZANA 3K6SB 2HHJA 1NNEA 2C4TA 2VDWB 3ZY3A 1WHSA 3A26A 1ZM7A 1A9QA 3DWFA 3QMWA 2NU6A 4GAEA 4Z9BA 3WA7A 4JI4B 2IOHA 4ODIA 2VP0A 4LZNA 4KPUA 2WIDA 2ZRCA 5DI9A 5BWLA 1F2TB 1QVRA 4P32A 3C45A 2W98A 3PVCA 3L0PA 4JLVA 4NS4A 4A2CA 2DPMA 2JLQA 4O0LA 3TSYA 4D8WA 3IHLA 3FPFA 4YAUA 1FSFA 2AK2A 2FW0A 5ALSA 1Q20A 5BR4A 4NXNB 1O0SA 3RUAA 2DPLA 2ZYAA 3KTFA 1AZWA 3Q9UA 1ZUNA 1F2DA 4N3AA 3EDQA 3H8VA 3ZU2A 4BCBA 4YJGB 1E5VA 4KQEA 3ZWYA 1KO7A 1MO2A 3FOFC 1RTKA 3AJDA 3ZY5A 5LBTA 3WKAA 4R1SA 1P7PA 5LIRA 2ZI7A 4FSHA 5FWYB 2EXXA 3KLNA 2G76A 2O0JA 4GRIA 4NMLA 5DLDA 4JJ8A 4GYYA 1KSFX 3IB6A 4HS4A 3L7IA 3OPNA 3LUHA 5EZYA 1GARA 5IVHA 3FPKA 2Z57A 3H75A 4LRUA 2X7XA 2IQ5A 1QQ7A 3MEQA 3R9KA 3N07A 3NYIA 3IP1A 3HXKA 4I9NA 1I0IA 3EE6A 1N6KA 3ZGLA 1A5SB 4KX5A 4MTCA 3QVSA 4BU0A 2PS0A 2FH5B 2JIBA 4TZKA 4AS3A 2WNSA 4HY3A 5H0IA 1T0UA 1P7WA 1SRRA 4ZXFA 1N2XA 4US0R 1ENPA 1SCBA 1FBNA 2XGSA 4G0YA 2Z4RA 4YDSA 3BZBA 1PJ4A 2J9ZB 3NDJA 2R1TA 2PUCA 2XMRA 2P4HX 3F90A 4D80A 4XQCA 1APBA 2C9DA 3W3AH 3FWPA 4ZAZA 3TTSA 1Q0QA 2BGNA 4UD2A 1E7RA 1O08A 3FPHA 3VR5D 5C5CA 7AT1A 2X3YA 3HJNA 1QX4A 3A37A 3CUTA 1FJ2A 1Q84A 3AVTA 4YQFA 4FS8A 3GLFB 4DA7A 2JD1A 5TQ0A 1GU0A 3C8UA 2JHFA 5ALRA 4HGRA 3DB1A 2C9CA 3CRMA 4ENRA 1ZX1A 1NBOA 3L6OO 2A0YA 5A9SB 1GNVA 1VPEA 4BC0A 3KB8A 3DTNA 1T9GR 4FLEA 4KQ2A 2A94A 1O94C 1GR1A 2CHUA 3JALB 1PLJA 3GJXC 1LV8A 3HDQA 4HG2A 1D6NA 4KO3S 4ND8A 4O5AA 2WUFA 3FIUA 4LISA 3CN7A 4KBGA 2OL4A 1XZAA 3RNOA 2C0PA 3DWIA 2WM2A 4I3HA 1YK0A 4N54A 1K3TA 1VE3A 4PZ9A 1MABA 1TEZA 4BNGA 2XEXA 4BDTA 5JO9A 1DDOA 4FFDA 2EZUA 4I2VA 5A5GA 3VR1A 4HWGA 5EXPA 2HLNA 4EGAA 2QENA 2XQIA 3NVAA 2BRUC 2W4QA 4RKEA 1GKIA 4Q9AA 4B8YA 2VCHA 2WWHA 3MJDA 3RHZA 3W5BA 3FOZA 3O8NA 2JCBA 2NACA 2POCA 4ZVLA 1U80A 3RLIA 3U7RA 5LA6B 1P7VA 1EBFA 3LY5A 4XYEA 5EVCA 3A9UA 1KOFA 1M8GA 1BJKA 5L3ZA 2ODAA 4BNZA 4TXLA 3RFXA 3PIDA 2R79A 1PZHA 4GBED 3GUYA 4WN3A 3EGWA 3DEKA 4RQUA 4MYCA 3WNQA 1P4HA 3KHTA 2SHKA 4QPJC 2PGIA 1PEAA 4IDGA 3PHCA 1XZ8A 3GJ3A 1GUFA 4I4TA 3R3XA 4QQNA 2OHHA 4PE5B 3M6AA 3R76A 1TLFA 1ZO8A 5B7NA 2EFJA 1JFVA 2QTVB 3M6FA 3NWBA 2R5NA 4YRJA 2V7UA 1Z5OA 1YR1A 1P9OA 4AX4A 1IN6A 2CCKA 2CLHB 3GUZA 1K8RA 4EARA 4F4CA 3JVUA 3GN2A 4ZT2A 3R3VA 2BTEA 2GJ9A 1CVRA 2A5YB 2EDAA 1KY2A 3OICA 3P9RA 5JCOC 1KO1A 3FWZA 4AN1A 4FGLA 3DNMA 5CD1A 4R1UA 4F4FA 3CX3A 3TOVA 1M66A 3FTCA 1I7PA 4DCOA 3M3DA 1GQYA 3HJBA 3U16A 4CV0A 3L0YA 1DELA 2WG2A 1EWYA 4WK2B 4ENTA 1X1TA 1D6SA 5TQJA 2QUZA 3H05A 3ZLJA 1EP1B 1RI1A 4J7XA 1F9AA 2QVLA 4XH9B 5IX8A 1X7WA 1A4XA 4NS1A 2XTJA 2AFIA 1R5OA 2GK4A 2Y1KA 4P08A 3VDQA 3ZWMA 2EHJA 2EV9A 2HU7A 3T7CA 3VH4A 1ZCZA 3ETLA 4FEAA 4B40A 4NBKA 4W5QA 4P34A 3L4JA 3SMQA 2GLTA 1H3FA 2BFDA 4IGFA 5I45A 3QUQA 4YACA 2PSJA 1ETHA 4FR2A 4ENVA 3IUNA 5KSZA 3B6MA 4X24A 3A4VA 2P6NA 2H59A 1JQDA 2XIQA 4OH7A 5CP8A 4HLDA 1P77A 4WLOA 3QLVA 3TZCA 4PSCA 4Y6LA 5JCOA 4BQPA 10MHA 5C80A 5JYDA 2CVOA 2X7HA 3RKUA 2FMHA 3FG9A 4IDAA 2J85A 4XJTA 4QRIA 3RTEA 1U0GA 1ZRSA 3NHYA 4KK3A 2IV3A 3UHAA 3AL0C 5AFSA 1GN8A 2NPOA 4INJA 4BP1A 4E32A 4UFNA 2BSAA 5JZ9A 3W5AA 1BE0A 1MIHA 4H7PA 1L7MA 3NOQA 5LP6F 1ACLA 1CY4A 3DC2A 1YTUA 4JYPA 1JLLA 3VZSA 3BUSA 3J7TA 2CNDA 1YB1A 3L1IA 1LQUA 2ATXA 1N9GA 3FY4A 5B53A 1H2BA 4L4ZA 4WK6A 3TG2A 1WB5A 4U9IS 3GRUA 2PDAA 3Q3HA 4DMRA 1DXYA 3AUYA 3N53A 5K4GA 4RIHA 3UMBA 4MYTA 1O94D 2PD6A 4WKBA 3WOVA 2IKSA 1N4DA 4TXJA 3DMTA 4U3JB 3INYA 3IHKA 4IYRA 5U9CA 4FT4A 3OX2A 3PC7A 4N3GA 4YLGA 1GA1A 5AI4A 3W3AD 3O3OB 1M6VB 2D0DA 3E9CA 4Q3NA 1FU4A 5FV7A 4ND8B 2VG8A 4OKIA 1FXUA 4G65A 4V0QA 4TVOA 3GK3A 2D1TA 4WLFA 3QWBA 1SVLA 1CRPA 1MVLA 4TSFA 3SYNA 3B78A 2ZR8A 4UEOA 4P3NA 1LZLA 1PHRA 3ZZUA 3D0QA 4RHCA 2XNKA 5AOVA 3AUTA 4HUTA 2FEMA 3DMPA 4OB6A 4R1NA 3UGKA 4ALKA 4TQGA 2PR7A 4Q3AA 2RMKA 3VNQA 3G0DA 4U8GA 5T4EA 4CG3A 5LM3A 2XMSA 5F23A 4NU6A 3T15A 2SKEA 2IKQA 1L3CA 3I6YA 2YWRA 1QOZA 3COZA 3T41A 3LQFA 4RSMA 4TN1A 2OXIA 3RADC 4JBNA 3OTQA 4MVWA 1BIFA 1THTA 5ALKA 2C3PA 3B3QA 4L0CA 4GWLA 3DBOB 3D6NB 4WCFA 1L7OA 2WY2D 3JALA 4A1OA 1XWIA 3EXHB 4CGYA 5JH7B 4K03A 1UBKS 3LP6A 4PO9A 3UTDA 2O1EA 5DNUA 3RNLA 1Q14A 4L8FA 3H5RA 2F9FA 3IAFA 1PWHA 1MOQA 1O96B 2OCLA 5KNDA 2FPGA 2X7JA 4G86A 3W6PA 4FDVA 4BNDB 4N49A 2Z95A 4ASUA 2Z83A 3K05A 1DV2A 3QW4B 1AQUA 3A3PA 3IR6A 3REQA 4F5WA 3WI7A 3RR2A 4N18A 4RNCA 1CIVA 2GQ0A 1PFYA 9LDTA 4O4IB 3W34A 2KMLA 1N8SA 1NIJA 3P9ZA 2Q3BA 5FEUA 4KO2S 4N6NA 1ZGHA 5IAAA 3FJ1A 4R69A 4OTZA 1F9EA 5I48A 1Z73A 2EW1A 1Z12A 2J3QA 4K26A 1KI7A 2ZYTX 4BUZA 1YHNA 1VIVA 2WJAA 1QZXA 3PNOA 4J7AA 4EP1A 2UUPA 2YHAA 1P5ZB 3OH8A 5ADUS 1JEYB 4H1UA 5AVJA 1X14A 4N0DA 3BE5A 5JY1A 1FTGA 2OFOA 3H42B 4HN9A 1X1EA 4Y2HA 3WO1A 4BNFA 2XWJI 1TZMA 4CI0B 3VPXA 4ZRDA 2B99A 3DKPA 2BISA 2PPVA 4E31A 4GLOA 2VHUA 2G1AA 4PTYA 2YTZA 5EKTA 4GQAA 3I6BA 3RGWS 2HO5A 4QD3A 1RAAA 4E94A 2N1BA 2RB5A 3N6RA 4C5AA 5ECDA 1SHTX 1JBKA 1NG9A 1Y1QA 2DBQA 1ODTC 5CVUA 4CN9A 4OYHA 5CLIA 5AUQA 3UKJA 4MVCA 4DA4A 1WSBA 4GL2A 3ZLUA 3RVSA 1PWXA 1SC6A 3OZVA 3E9NA 4N8DA 1Y3AA 3EVFA 1W5FA 4HL6A 3DE3X 4J0HA 5KB3A 3HS3A 1YKGA 3NXKA 4MLPA 4Y1FA 4FW8A 1OVMA 1PDOA 1U8XX 1C80A 2VAWA 3LKVA 3U44B 4IDFA 1SWVA 1UJBA 1W5AA 3P9KA 3PNMA 4BV9A 3ETHA 1W88B 4CTJA 2YUTA 1QP8A 5KYTA 2ODWA 5MFZA 4OQEA 3H97A 4L9SA 5F3RA 5FJJA 1VKZA 3Q2OA 4MUEA 3BXEA 3UJ6A 1GZSA 3FNHA 3HXTA 1ISIA 1DIGA 1JG2A 2C4MA 4FZ5A 3WG9A 4MUGA 4G1EB 1YHZA 1DIRA 2I1QA 1NXOA 3MAAC 2BM0A 2EQBA 4GSYA 4MP6A 4WJKB 1JP7A 5IWCA 2GN9A 2FHSA 4RZIA 3A1DA 1FLVA 1NR5A 4GBGA 1RFGE 1BN6A 4UCXA 5JS2A 3ZWCA 4LNUB 3SBDA 3W2GA 5LU8A 1D09A 2J0UA 3M6VA 4WESB 2BVNA 1OSNA 3EEBA 1MVNA 5HQTA 1VBNA 1HTWA 1EDEA 2VP4A 1ORRA 1JH8A 1L4EA 2A30A 4PGGA 3KQUA 3BRWA 1Q7CA 3IMCA 3MWJA 4MR9A 4R8SA 1DXHA 3KKEA 1D1TA 3NHJA 4K86A 1ZEJA 3TFWA 3NUZA 1O97C 3TRHA 3FPCA 4XLTA 5E6UB 1H2EA 3JV7A 2CLFB 2I03A 4JR2A 2O19A 2V4UA 3ND8A 1VLZA 3AMVA 3GEMA 5CH8A 4RM2A 1ZW1A 4GZ6A 2IIPA 2ILTA 4WXPA 4X8OA 3CVOA 3KJQA 4BLRA 3MTGA 3CH4B 3E5RA 3ELBA 1MU0A 3CKKA 5KAMA 3SEQA 2W2MA 1J24A 1RWPA 1HQYE 1TYZA 3KPVA 1IIRA 3NKVA 2HSWA 4I3FA 3FVRA 1LJLA 3WB9A 1VB5A 4D3FA 1CWUA 3LHFA 4YUXA 1RXVA 2BGWA 1E9BA 1PQ4A 2YMMA 4LKOA 2UXBB 4EUKA 2C7RA 4NMMA 3F7TA 2Q5OA 3U31A 1W2HA 1DIAA 5EZSA 1RYDA 1HE4A 2BCEA 1ACMA 2WT8A 4EZEA 1XZPA 4K9RA 1ZKDA 5ICFA 1JG3A 1S8AA 3PG5A 2HUNA 2R3SA 4FYXA 2QTAA 3H87A 2Q2OA 1Z68A 3I09A 3INGA 2OTCA 5SZKB 4D9JA 4DJEC 5L3VA 2IIQA 4IP0A 4KUGA 1LEHA 2GDJA 2XUAA 1I2CA 1TMOA 4CG2A 1Z0JA 4ALJA 1PL0A 1DBVO 5KOJB 1JQKA 2D3WA 3LVRE 1XAJA 1AV7A 3WOHA 4C78A 2EERA 3FHTA 4IMPA 3KB6A 1E9SA 3UO8B 3KVRA 4AVYA 2PUDA 2ORVA 5F73A 5JFOA 3ZZ1A 1EVQA 1TLLA 3JZIA 3N5KA 4TWIA 4W8GA 5LQMA 3U3MA 3BT7A 5I47A 2LCQA 5E6RA 4NXMB 1MB9A 2R96A 4IFEA 2R5FA 4KXFB 3HJTA 1R8QA 4OHPA 4PICA 2P9HA 3TMKA 1CUFA 1KC1A 4GMXA 2XRFA 1D8AA 1PNTA 3L6DA 3PUJA 4FS3A 4FX2A 3SHTA 1D3AA 1HURA 4BE9A 3W2HA 1J70A 1ID8A 1NI3A 2ZYIA 2VR1A 3OF5A 1RQ2A 1ZH8A 4QO8A 3HXOA 2N1MA 3PJFA 3NLLA 2H9AA 3LA6A 2BM8A 3OKPA 4BNVA 1I36A 2PANA 3EH2A 4RJKA 4QG7A 2M32A 3KB1A 4RORA 3CR3C 4AJKA 3ZE0B 3O2SB 1YRLA 3M6LA 2DFLA 1XB2A 2E6KA 2DUNA 2X9GA 5AKZA 4BBPA 2BBOA 2ZVQX 4S1NA 1WXGA 4ZCMA 5T8KA 1UT8A 1RYYA 2GKGA 4X91A 3IQFA 3CRZA 4UULA 2HRDA 4ZZIA 2B92A 2AH5A 1KJNA 4WOKA 5EEHA 2IYFA 2P62A 3NQ41 5CT4A 3M6IA 1ZOOA 2JGNA 2QX8A 4XRRA 1YF3A 3WYCA 4B3GA 2QAGC 5EEGA 1AS2A 2OZEA 3K9NA 4A0QA 4DQ0A 1ESMA 3DE5X 2JASA 2M1ZA 4YP0A 2JDID 4MV8A 2QB5A 3JQ8B 1T2FA 2YN2A 1IN8A 2NTNA 3A1SA 5A1JA 1DBSA 3H9BA 4X7MA 1G42A 1IY2A 2XGOA 4XIGS 2Q1TA 3WBBA 4XGIA 4BLUA 3BXXA 2IUSA 4HAXA 3PC6A 5D01A 2QTZA 4Q9IA 1CE8B 1ZXXA 3QLUC 1CUYA 3CZMA 5EVJA 5FEMA 3STVA 4C4YA 3WLJA 4FBGA 3WX0A 1KWGA 5ALPA 1LRLA 2VOJA 4LJ4A 4YQZA 3TR6A 3GC6A 1U02A 3VC3A 1WUHS 3QA3E 4YTEA 2GLUA 1RJEA 2EBFX 3KZMA 4HNRA 4KIUA 3RODA 1FNMA 1JIJA 1N57A 1WS6A 1XZGA 3BIWA 1L5HA 5LP6A 1F6DA 1YB2A 1OFVA 4TX1A 4TZTA 5DGXA 1K5DA 3D2CA 3WRXC 1XCOA 4F2HA 4XVUA 4MITA 1P9WA 4TTAA 5MN6A 3GGCA 1V5FA 1CJUC 4KPFC 4DLXA 5TVKA 3JYOA 2IOYA 5AKIA 5GONF 1TAHA 4MRAA 2WZBA 1IPHA 1QV6A 5EMLA 2DKNA 4AZTA 1G3QA 2BPOA 3CX6A 1AHNA 3OLQA 4GQBA 3VR2A 4Q16A 4XDYA 4EAQA 4EYGA 5BNWA 1GJRA 3D4NA 2MCFA 4PO8A 4ZYLA 4MI6A 1O5OA 1WCV1 3K20A 4WZBE 1UZLA 2CZCA 3L4EA 1ZZEA 2ZBVA 3EZGA 4JUFA 4NULA 4HDMA 4NNJA 1X39A 5ALWA 4QKQA 3C8HA 2ZSIA 3UV6A 3BIFA 3EXG1 3KG2A 1W88A 1Q7TA 2ATVA 4I5DA 3W6NA 1XTKA 4EZIA 2JVKA 3IOMA 3UK1A 2PY6A 2MSDB 1C4OA 2PZFA 4BCCA 3DTYA 1ZD3A 4YPOA 4JVLA 1FK8A 1JQEA 3O82A 5GZ1A 3KYCA 3NAMA 2YFYA 1LVGA 2PWZA 4GRDA 1KSHA 4G4SP 1UC5B 4NYMR 1GT91 4OJQA 2IY7A 3QELB 4GMKA 4KW7A 2EX1A 4XARA 1Y8QA 3ZOKA 4BZXA 5LMNB 1WP9A 1L7AA 1YA6A 1P5HA 1G7CA 2GK7A 2C9MA 1W19A 2JFXA 2VTVA 3WRVA 3HGMA 4GO1A 1P9NA 4FQ7A 4OQXA 4D8YA 2FMKA 4Y9TA 3F98A 3M2PA 5D86A 4KWIA 4H7EA 2OGTA 3KO8A 1Y5NA 2I2CA 1F8GA 4FOPA 2VRCD 5H3LA 5L3QA 4ZYTA 2E7ZA 4ROTA 4UM8B 2A1UA 3G2LA 3P9CA 3X0DA 2I6TA 3N0TA 4WI1A 2OXTA 3RSGA 5KWVA 1RPZA 2D2IA 5KVVA 4HF7A 4V0ME 1U3TA 3DS8A 3QMVA 3OIGA 5JAZA 2VCYA 3GLIE 5C4GB 1DUVG 5T7BA 2AXQA 3PC8C 3C39A 2NXWA 1CP3A 1E2JA 2QKYA 3PFWO 1UC8A 4EHNA 4FB4A 1S9DA 4KGZA 1U81A 3B9PA 4KWEA 5FQNA 3HZZA 4GNKA 5DM60 3JQCA 4DLAA 3Q98A 3P0RA 4HDRA 2W93A 4MEBA 4FZ3A 5FP0A 1C3VA 2CXSA 2R4QA 2QZZA 4LWOA 2WPDD 1GZUA 2BFFB 2GYVA 2XR1A 3WLTA 4YO8A 2TECE 1Z8HA 1XE3A 1GDDA 2BP7A 2FJ0A 2P9ZA 3G02A 4EHFA 2C2HA 2XQFA 1E3QA 2B69A 3KM0A 1T2CA 3DDWA 3PGA1 4IJ5A 3WDSA 4Z9XA 5FOVA 1NOJA 1WULS 3GI1A 4OAPA 4X61A 1K7XB 4Q9KA 3RTBA 1ZC4A 2P6MA 2OZKA 3WBKA 5JADA 1WZ2A 1SXPA 4BVEA 2FETA 1Z33A 1E0JA 2V74B 3GRZA 3EXHA 1VKJA 3IELA 3NTQA 1XD8A 3WWOA 5CBPA 4ALIA 1WPGA 1CSEE 1FFXA 1SQ5A 3EA0A 2HRBA 3IQZA 5IWAB 5E7JA 1XDDA 5DLYA 3I1FA 3O8QB 4LHSA 2C1XA 1MIOB 1M6NA 1PK8A 2BTOA 5F35A 5HSGA 1Z45A 2I78A 1LPAB 2VLIA 2BHRA 2EFCB 4N5LA 5EMHA 3B85A 2GM5A 1ZJWA 2IU6A 1SURA 2ZRBA 2XHZA 4AS1A 1I01A 1V16A 4NV3A 2DQYA 1CBUA 1OLUB 1RLJA 2GFHA 1WZNA 3IALA 4NEQA 1L4BA 5FA6A 2ZJAA 5FR2A 1YBAA 1O6CA 2ADOA 2KB0A 5C5EA 2GEJA 1GPLA 3CS3A 2QQEA 5KVSA 2DR2A 2HDOA 4N1AA 4HH0A 3B7GA 3QKWA 3GRFA 1U8AA 3GT3A 4BN0A 1J0EA 1HDEA 1OYYA 1I10A 2ZT8A 4A0FA 1XKQA 2GPWA 1AZSC 1IDN1 2HREA 1USKA 5JWHA 3ADBA 2J6CA 4BNTA 5J43A 1BX0A 2XX3A 1DAKA 3GBSA 1C0IA 1B0ZA 1NKVA 3PKJA 5TS3A 4W9NC 1KZHA 3TTWA 1ZR2A 1DO2A 1TQ4A 4KJXA 3SZUA 3ZH9B 3PKIA 4PLYA 3TWOA 2NZWA 5J1TB 1BW9A 1IVYA 1TTPB 1NRJB 2Z58A 2CFCA 2PFGA 2I87A 2CLSA 2XWQA 4Z6KA 1I7LA 4XDHA 4KMSA 1N0IA 1IY8A 2I2FA 3CT4A 1RQNA 3WTCA 2DLCX 2AKAB 3W3AA 4FYIA 4CV1A 2ANCA 1UZUA 1W4LA 2O7RA 1E8NA 1Z35A 2OO3A 3UMRA 1A5ZA 1BSVA 1SFRA 4R0NA 4ZYVA 4ILKA 4Q5IA 5IABA 2JLXA 2R97A 1T4BA 4LGMA 1R9MA 3TN7A 2GN8A 1ZOPA 3LNTA 4QOSA 1G7SA 1RFLA 5E1BA 4EPRA 3QMPA 3JQGB 3EF1A 1UPXA 2Q9BA 3N2NA 2FRVA 4KTTE 2C31A 2PWPA 4ETMA 3DE6X 5FPHA 5CEEA 5TNXA 1D4ZA 3DAYA 4D4HA 2W2KA 1CUJA 1Z5UA 2J6BA 2FW1A 2AWOA 3EA5A 3BB1A 2CD7A 1ORTA 1WBJB 4G63A 1OT3A 1SUBA 1U0EA 2VPIA 2GOYA 1IN1A 4QE3A 4ZVNA 3ZS8A 1TM3E 1OI3A 3ICCA 3C5VA 4M8NE 5GQSA 3B3JA 5JNUA 3U4QB 2Y2UA 2C61A 1XF1A 3LLMA 2X22A 1HH4A 3C15C 5D1HA 1HMYA 3A9CA 3D3WA 3S81A 5HP4A 5F4BA 4BBJA 5B7PA 3CZAA 1SUPA 2PKEA 1BZYA 2YWFA 3UAZA 3B6KA 4AJLA 2IS6A 1N9ZA 3HVHA 4V03A 2Q7OE 4XWOA 1WZEA 4AKTA 4OUKX 1LWNA 2RHMA 4YMGA 5CA0B 4H17A 5G02A 3U3OA 3GLIB 2JBHA 4JEIA 4EG1A 1OAOA 2IHNA 5FPKA 1DUIA 4ZV9A 4AUMA 3NDPA 5LWQA 4CIYA 5HIAA 1L4KA 2YWCA 4OHCA 5ECWA 4R51A 4TL6A 2CXPA 5K8UA 4DSNA 5H83A 1BDMA 2V6FA 4HQFA 3UYLA 1VCNA 4YCCA 1VPWA 1V8FA 4I19A 2K87A 1PL8A 1EFVB 5BQPA 2XH8A 4C89A 4LVOA 4BFZA 3BMQA 4JC5A 4PZDA 3GYBA 1YRWA 1LC0A 4O4IF 2VYVA 2X5JO 5JDIC 1JDJA 4E1AA 3V8QA 2P77A 2JLZA 2JLSA 3GNQA 4E22A 4FHGA 1N7GA 1N5IA 2X41A 2XE4A 4MYRA 4CUJA 4ERXA 4Q3KA 3HBFA 2G8LA 1NJ2A 1XD9A 4R54A 3NKFA 4XWTA 4ZARA 4UHEA 4ZJZA 4BGDA 1NE2A 4BKQA 4NOLA 2ZIAA 1PGNA 4B0OA 2ONYA 1EB8A 1MG0A 2NVUA 4LTMA 4QJ5A 4KQKA 1XYYA 5LDDC 4HI0E 3VDMA 1KWKA 1LCIA 2AHRA 2H2WA 3A6LA 5LDHA 2WA1A 1M34E 1QORA 3UATA 1OY1A 3U37A 1ZGJA 1R9JA 3CLSC 1L4NA 2AFHE 2VT6A 2WK1A 3KE8A 3OLZA 2Y1LA 3PQ8A 4XOIA 2FSPA 2JFGA 4Y7DA 3WC4A 1PP4A 4EY6A 2NP6A 2BDUA 4DMMA 2CYBA 4E2WA 1E2EA 1NBWB 1PI3A 3QYFA 4JJEA 4JYCA 3ZZMA 1ZU4A 2A1TS 2DP4E 3ITEA 3DFZA 4BZZA 4PYIA 3RPEA 1Q15A 1AF4A 6YASA 2FFBA 3DC7A 2VN8A 4U2DA 3FHCB 3MJFA 4ZWNA 2BELA 4C07A 3RJZA 2Y8EA 4GYWA 4H0FA 4D3DA 2I8LA 2HJ9A 2QV0A 4CTMA 5BT8A 1GCOA 1IHOA 1IUPA 1ZMXA 1SBYA 1ZJYA 2JGAA 4M22A 2QRJA 4YGXB 1T1GA 2XMGA 3GAAA 1F48A 1SGWA 3MS4A 3V2UA 1ILWA 1NX9A 4Q01A 5DCUA 4IIXA 3PYXA 5TE9A 3AU8A 2OQIA 4QTYA 4NZYA 2O50A 3F5MA 4L8WB 5BUZA 5ADVA 2GXSA 8ADHA 2VP3A 3TH5A 4Y2YA 2YHUA 4ZVUA 3HK2A 3HCDA 5C8YA 2IH5A 4L5IA 1E32A 3SKXA 2HJWA 1GTRA 3TCNA 4UBMA 1DADA 2X19A 3DEFA 1SU7A 3B53X 3IKJA 4GUAA 2Q5FA 3C6BA 5ARDA 2JLBA 3OZGA 1CP2A 2ZYSA 1N32B 4OJKA 1ZUD1 2G07A 2FZWA 3DOCA 1DARA 2G0TA 3DMFA 1W6RA 2ZRKA 3CWQA 4XGKA 1J0XO 2HBYA 5AKHA 3I34X 1CF2O 2G1JA 1I6WA 3FNEA 3NALA 3UQYS 3OUTA 3USCS 4CMIA 1Q95A 4DLWA 3TGPA 3PT9A 4WN9B 2E1PA 3NBUA 2E5LB 3TFOA 2PEYA 1TC1A 4KFRA 2H0QA 2VZ9A 3QY9A 4DWWA 4I4CA 3JD0A 2PMBA 3HCCA 4RXMA 3P4XA 3THYA 4M53A 3HCPA 3U1BA 1QPGA 2SBTA 3H6KA 1VL0A 3SD7A 2IXGA 1ZL0A 4CLDA 2OR3A 3FFXA 5JXWA 1TFRA 3WMEA 5BR8B 5GVSA 2AL7A 1WVMA 4YCSA 1GL9B 4F11A 5AVXA 1C41A 2BP7B 1I5EA 2D5AA 3NWJA 3PICA 2I99A 4OSPA 3WL5A 3TUIC 1WV0A 3WP0A 3ZZTA 1A97A 1DWPA 4CVNA 3K6KA 2O4CA 2FSVA 3CMCO 3M83A 4KE7A 5CX4A 4FDLA 4GR5A 3RVRA 3AFIA 3VGPA 3KBOA 4OP1A 3PZRA 4IOMA 1N3LA 2XB2A 1V5GA 1GTSA 4QRDA 4G09A 2WI8A 4JQYA 3R41A 4NE7A 3BAZA 3U2QA 1JU4A 1GGNA 2HQSA 3CBQA 4I4LA 1STOA 1Z4QA 1KSGA 4G2TA 5KWJA 3VDNB 2IE0A 1DS6A 1GTJ1 4Y8VA 4QZVA 1C7EA 3ERCA 3PWSA 2O1XA 4R9NA 2XD4A 1OXXK 4TTPA 1FDTA 5FOXA 1KQPA 3IUYA 1J9ZA 2BDTA 2VDWA 2XDQB 3VJRA 2RCYA 4W7IA 3CF0A 2CUKA 1RS0A 2NZJA 3MPOA 2GBIA 4CKEB 3C6XA 2I4LA 3JPWA 4GMHA 2XXAA 3GL9A 4A8TA 3PRYA 2CVPA 4B43A 2B1GA 4BTEA 4KZKA 1VGRA 4YMSA 4LPKA 4Q4DA 5AHKA 1H9AA 2FX2A 2ZCJA 4RNDB 1E1QA 5LZ8A 1XKTA 1OGYA 3LL7A 1BA3A 1LJUA 1NQOA 1NVAA 1T0IA 4W9RA 2JBWA 4ZO8A 3SEZA 3ZWBA 4EM6A 1IJBA 1U8TA 4JT8A 3O1HB 4H7FA 3SLGA 3MTJA 5EG5A 3N3BC 4EITA 2I8AA 2IPAB 4C4ZA 1II8A 3CZRA 3NBKA 4Z0PA 4OUDB 4OK3A 3Q0TA 2P9YA 1IEXA 3QX9A 4FE3A 4B84A 3IV9A 3AT1A 1S1MA 2B6NA 2ZWMA 3LHIA 4IVNA 4N39A 2FSIA 3NRBA 3FTPA 5GJCA 3G85A 4C4AA 1RRPA 1T8PA 2VDPB 4YT4A 2AFHB 4O08A 4ZI7B 2K5UA 1H5UA 3SLRA 1S8OA 1TGVA 1PJLA 2P0AA 3CLTD 2ZUBA 3KD2A 1EXNA 2OESA 5REQA 9ATCA 4IMRA 2W8BB 3AK4A 4LNHA 1PFQA 2LWIA 1CUVA 2X42A 4JLAA 4LY9A 2FPLA 1UJNA 4U6QA 3ZTWA 1DOZA 3LM8A 3UW3A 5L7WA 1N2CA 4ZI7F 5E0KB 5K45A 1XZNA 5DISB 4Q93A 4PPQA 1JRLA 3ZV3A 2LP4Y 3GDFA 3LUJA 3TW0A 3AINA 1DI0A 3BYZA 4BEWA 1KZ4A 4E14A 1EZ4A 1CTQA 2B94A 5COBA 4Z9AA 4NIMA 5AW8A 4RANA 3SF8A 1EIZA 1CRWG 1SHKA 3VBEA 3THYB 1DKPA 1T36B 1CIJA 3PCXA 3MCWA 1T8UA 1ISJA 1NW5A 5AM2A 1Y8ZA 2EZ8A 5A3QA 4TV8F 3NUGA 5U1PA 3KFXA 4X8MA 4C0LA 2X4GA 3IQIX 1T6YA 4QBKA 3ZDEA 4GXTA 4KWHA 1QGED 3REFA 3U0VA 3H86A 3K8QA 2E4ZA 1P7YA 3DOFA 3OM0A 7REQA 3LC1O 1XZJA 2W5UA 2O2IA 4AD8A 2JFPA 3FIJA 3CSDA 4LE0A 3VTFA 2MSWA 3U4DA 5D5PA 4TZ0A 5DHRA 3HO8A 2G9ZA 1X7ZA 2R4TA 1CC1S 3EBPA 3LZCA 2W2XA 4NRDA 5EQDA 3FHJA 1WVIA 2Y1CA 5E3IA 2B20A 4GKKB 1AGYA 2VZLA 3TKYA 3KCQA 3O94A 4K88A 1CDEA 1DAIA 4W5JA 4HSGA 4NYJQ 3OI7A 2PKRA 2RK4A 5BQOA 3G5MA 1ZAKA 5E9WA 5HEKA 3ZW9A 2DPGA 2DY1A 1FMTA 1A8PA 1YKFA 4AQ7A 4OJMX 2VO1A 1JJ7A 3QU5A 3JD1A 5HVNA 5CGQB 2FMFA 2GA9A 1RT9A 4K1LA 4P54A 1MAAA 2CCGA 3RBXA 1FLNA 3HB0A 1QWSA 4V0KA 3HBJA 3C3CA 3BM5A 1SVKA 1GR0A 2PN1A 4E07A 1FY2A 3A4LA 3PPWA 4YP5A 4ON9A 2AFIE 1OWNA 2JFQA 1KU0A 5TQ2B 2FPRA 4MUYA 4R7GA 3R20A 1L4UA 4J1TA 3LLUA 3R3UA 3O0TA 4ER5A 1JL3A 4E5YA 2WAXA 1WMSA 3G89A 3A1NA 3R8CA 5CG2A 5JISA 4MV9A 2QDKA 4BZWA 1L9XA 1IU9A 3GCGA 3O74A 3ETNA 4M8LA 3LX5A 2HMYB 4FN4A 4BNWA 1P0PA 1HEUA 1AKVA 5I3ZA 1XN1A 3GDOA 4I99A 1UWKA 3F1LA 1L7BA 1K63A 4XM0A 5IAJA 2ID8A 1PS8A 2REBA 3ZNQA 5CNIA 1KJYA 3PHJA 3WLIA 4QATA 3SGLA 4CQLA 4AYWA 3AC0A 3HA3A 4ZICA 4B3RB 4ACBA 3KCNA 3PLNA 5HBRA 4H60A 2NU8A 4FFSA 2E6UX 2HU5A 2JANA 3CIOA 5LLTA 3M70A 3GLKA 3P9SA 4R83A 5DBOA 4PGAA 4EOGA 2ARKA 2PKCA 4JT4A 5LZ9A 4MPDA 3C1AA 2QV7A 1T9HA 1F1BA 2OKGA 5LWHA 1VLHA 3TEFA 1K0FA 1YACA 1YFKA 2ORED 1RWMA 4IJMA 3TECE 1OZ0A 4PS1A 3ZHBA 4F8YA 1K27A 3WZMA 4OHKA 3ZX4A 2OAEA 4WBXC 3NHAA 4YP6A 1W4CA 1S9HA 5CIYA 3WK9A 3B38A 1RLMA 2W6MA 4JOQA 3IAAA 2GZ3A 1N5JA 2GN1A 1VGVA 1Z7WA 5IDWA 1X7WB 3D8TA 2C1EA 2OQVA 1Q1AA 2Q7DA 1IAVA 1NURA 1NXQA 1AA9A 2CJWA 2VDQB 3FOCA 3MD9A 3PQ5A 1EX6A 4YP1A 4F2WA 1PF7E 4L5BA 4C0QC 2IZ0A 3CG4A 1EVZA 1GA4A 4DWVA 3ONVA 3AZOA 3SKYA 3T5PA 1HEIA 5DMHA 4ZOLF 5KDLA 5JZSA 1ZLXA 4HNHA 1ODJA 4Z53A 1GZHB 1IHYA 3LWDA 2C4VA 1BMDA 1G20B 2XYRA 2C4WA 3GT0A 3NNDA 1MPTA 2XUGA 4IG4A 4JKYA 1U94A 2H1FA 1O03A 3O1JC 5HF6A 4RWZA 1CR6A 4G41A 4K0RA 4RACA 5JNSA 3DMRA 2O6LA 2DY0A 1XVIA 2CSUA 3MNFA 4S1OA 5H4HA 4WCVA 5FOWA 2XQGA 3K4QA 1Z2NX 1WD7A 3W90A 3R5KA 1LBEA 3Q9SA 1RJ9A 3LRTA 3Q3VA 3SJBA 2FRDC 4JY7A 2MIIA 3L8ZA 1XVAA 2EFYA 1W36B 5E1MA 2V98A 4NV0A 2GZHA 3PYLA 2P4EA 2DLNA 3H9UA 5DULA 1I80A 5KPJA 2Y1DA 5HGXA 5ETJA 3I5YA 1A4UA 4S1WA 1C8KA 4G0PA 1Z0FA 4UOZA 4E7OA 3EFOA 3LQKA 2NPFA 5CDFE 4S24A 1E94E 2IW3A 3BXZA 2H7YA 1KIAA 5D1NA 4O2AB 4H6WA 2VZ8A 2GAIA 3EG9A 1UMCA 2PV0A 4LOLA 5K20A 4E2FA 3I5XA 1EGQA 1E58A 1VMIA 3DBRA 2J5RA 4JOBA 3SAJA 1K3FA 1I3LA 1TA0A 2ZQ5A 1E3EA 1JI3A 1YONA 2Q0XA 2QMZA 3AUFA 3LT0A 3CPSA 3QVGA 4FWIB 4QNNA 5C37A 3N7UA 1ML4A 4O2AF 3MIZA 4Z0NA 1IBLB 1HZZA 1I5RA 1RCUA 5JLAA 1M6WA 3TL3A 4AICA 1P81A 2B1JA 1FFWA 2M98A 2O4UX 1E3DA 3R5TA 3TO5A 4BMSA 3I4FA 2P3LA 4E2XA 1XVTA 4TYPA 3DVLA 1HL3A 1Z5VA 3EC7A 4UU8A 1JT9A 1VECA 1BS9A 4PPFA 1T2NA 1Y8RB 2NUTB 3DLIA 2WYIA 1DTWA 1N3YA 2ZDGA 4BAGA 1VPLA 4YRBA 2R00A 4KUEA 1CU1A 4DIUA 3S3TA 3IAM1 4IV0A 1Q7RA 4R6WA 1TQDA 1RQ7A 5IH7A 4A0RA 2JFVA 3E7PA 3QE2A 4RS3A 4WW0A 3WV5A 3OHMA 3BTUA 2J59A 4A0GA 5JI3E 4CCYB 5JZBA 3SVTA 1Q0PA 1SB9A 3BN3A 5C1IA 4LX8A 3WWZA 4AKGA 4NICA 1YIDA 2ECOA 5HFNA 1JIVA 3T7SA 3NHWA 4F6CA 1HRDA 3JR7A 3IEKA 4ZEMA 1Z4KA 3ZGYA 1OI7A 3EQ9A 3DVQX 3O8QA 2WKWA 4OYYA 1IB0A 5D84A 3FN4A 4JI0B 1TQ6A 3PX2A 1CY1A 1OZHA 2OP1A 3G7UA 2V0GA 3NBYC 4GLFA 1IOZA 3DL0A 3G7NA 3AP1A 1YKSA 3AKZA 4RH0A 4BFLA 3COVA 4YNBA 4TS3A 3MS2A 2J4FA 3OSZA 2AQHA 3PDUA 4PIMA 1Q1BA 2BR3A 2QXUA 5BURA 3D0RA 3THWB 3KXDA 2P8JA 3QVXA 2RHOA 4IICA 3OMWA 4L9WA 2CXNA 3E4CA 4IIJA 2O8BA 3O8LA 4KZPA 1U2DC 1VZ3A 2YV2A 1JDSA 4ATNA 3WFJA 3WSTA 1HRKA 4L2IA 3HC7A 4Y7CA 2YASA 3FNIA 5CHYA 4PYLA 3ND9A 1OH6A 4B3MB 1FQKA 4IIJB 1IATA 5AICA 1EFPA 3FSRA 3DXFA 2XT6A 3I9NA 4JOSA 3KKLA 1BA2A 4Z3OA 5EP3A 4WZAA 3SK0A 1UXKA 3A4TA 1W47A 3Q9NA 2HQBA 1H8EA 4JWTA 2R7LA 4R7TA 4UDXX 4O25A 4ARSA 4EDHA 5JV5A 3WNZA 1JN0A 4WNAA 3JZMA 2Q0HA 4PYMA 1JSLA 2MT9A 1UT5A 2RD2A 1OXVA 4D6PA 2PS9A 4TXHA 1PJTA 1E6WA 1PT8A 3SVZA 2NIPA 1RKXA 2Y68A 3TUZC 3ILSA 2Y67A 2BEVA 4DTIA 5B55A 2PKQP 2Y66A 3PFHA 4MI3A 4CYMA 1XRJA 5AJHA 4MWOA 4LBWA 4V2UA 3BXPA 2YC2C 3KEGA 3X44A 1ADYA 4TXNA 3BICA 5DTJA 3SR3A 3V4SA 1JG1A 1ZUNB 5A4AA 1QVZA 4EBFA 3A6ZA 2WMNB 3UGQA 1H9CA 5HJ7A 1ZD8A 3PHIA 2VPWA 1T34A 1CR2A 3MJEA 3FNGA 2VQDA 4DAOA 4E51A 2JGIA 4IXMA 4RC9A 2EU8A 3CUWA 2C7BA 2RI0A 1UC4B 1TJ5A 4NU8X 1V7ZA 1T5BA 1M7HA 1T0PA 2H5JA 1K88A 1GILA 3LFHA 3VNVA 1YZUA 2JJMA 4QXAA 4D41A 2ZROA 2H48A 4BWVA 2FFJA 3VNSA 3L0DA 1SUWA 1IQ0A 1K4YA 3CSUA 4NYIR 4YUZA 1XU4A 2R25B 4G8DA 3VJMA 1A8IA 3I2IA 1LBHA 3LVFO 1TRKA 2W4MA 4KWCA 1YSCA 2FR1A 3OESA 4MKIA 1KZ9A 2NO7A 3QUBA 3U3RA 3O3CA 3U6BA 1J90A 2WF7A 3P0IA 3PVZA 4BMXA 4GM4A 2X5NA 4UAGA 2B4QA 5BN4A 4MAAA 5K8LA 3PE3A 4I4TF 1CJVC 4F1JA 1YR2A 4HMOA 1N0UA 2ZGVA 4MWBA 2QTHA 3NMUF 3T9CA 1M0WA 1WD5A 5K2OA 5C31A 4EKYA 1N7HA 2VUUA 3SYLA 2P9FA 4RMHA 4N6OA 4KLCA 4O4JB 2GARA 3L8YA 2J0VA 1P31A 3S29A 5LP6B 1RCTE 4NBTA 3IVCA 5E4YA 3AF2A 4W9MC 4B5LA 1RHQA 1UQRA 3I5AA 3GF4A 4HJXA 3UV3A 1DQZA 1G8AA 1SY7A 3DDSA 4IKOA 4R6XA 5T4BA 2FZGA 1PGJA 1QFZA 4QTZA 3Q9LA 2CLLB 2WHEA 1XTZA 4AF8A 3OLYA 1YH3A 4XJXA 4EG3A 4TV9B 3K70D 1FX1A 3RQIA 3A6KA 2WQZA 3GZJA 1J2TA 4IDCA 1D0IA 4MLZA 1BDHA 3VVBA 2IDJA 1WUYA 4ESVA 1U8FO 5KVCA 3FMVA 1KZ1A 5AI8A 5JATA 2NZYA 2Q2QA 5LMZA 4KAAA 2N9UA 3CH7A 3QG1A 1UDCA 4BGVA 4FK8A 1R0LA 1SVMA 5AM4A 1QZTA 2E4XA 2KM1A 2R6GA 4BN5A 3A2KA 2WOJA 2YN0A 3DPSA 1NXPA 2NXCA 4TV8B 1KOGA 4NENA 3VA7A 5ICCA 4DIMA 4XCVA 1RBYA 1X9IA 1Y3BE 1W96A 5TPWB 1KDTA 1ZNWA 2QVGA 2TSYB 3U9SA 4YT8A 4DABA 1XPRA 1ZJ4A 1D2HA 1PD1A 4JLNA 3CVXA 3ORHA 5KCZA 4TXMA 1T5HX 2ZRDA 3STUA 2HMSA 3DQPA 4M99A 4CF4A 1GCAA 4OB8A 4A36A 1PEDA 2VZEA 2CHVA 1GG2A 3WLNA 1DP4A 2QTTA 2H1VA 1RRKA 3AOEA 3TL2A 3CSSA 2AYYA 1PTJC 1SNYA 4CDRA 3R3HA 4MQUA 1I2MA 2M6LA 1PFGA 4NY1A 3AB3A 2HMVA 1X87A 3A04A 4ROSA 3VPGA 4P9NA 2PT9A 4BLSA 4M89A 1HT1E 4F84A 2AI1A 5JJIA 4YRLA 1KXZA 3GNSA 1X1DA 3ONFA 1S6YA 3KKZA 1YVEI 3FBWA 3M5CA 1CXZA 3E8SA 5JQGA 2QRKA 1PE0A 1W59A 3M6XA 1Q83A 2Q0SA 1KFCB 1ESZA 2ISCA 3OT5A 1V8PA 4A91A 4NECA 3ROTA 1YD7A 4YMVA 4FFNA 1PK7A 3E22A 2G06A 1E6KA 5L3SA 1WCIB 2O3TA 5FOUA 2OKCA 2HK7A 1U8EA 2P5TB 3N8IA 4YCBA 1UPTA 1TT5A 1TADA 3O4IA 4NCIA 1R66A 2WNHA 3D7NA 4KQJA 3QITA 1XXHA 4V02A 4JLKA 1YDHA 1TZKA 4OOFA 3IPAA 4FZJA 1PL7A 1ADGA 2A5GA 3GGJA 1TZJA 1IH8A 5PGMA 5IEBA 5DHTA 4HVCA 2OV4A 1CLEA 1TE2A 4TM8A 4WNIA 4GECA 4ARUA 4D6YA 1KAHA 3V3TA 1M8JA 4H3HB 2QYOA 1KI3A 3OEEA 2MYUA 5CPFA 4IHKA 4KR2A 3FLAA 2QQGA 3JQ7A 3MJHA 4F1WA 1BNCA 2O0MA 1K4KA 4RV4A 2QW0X 3RH0A 1ZHHA 4ARAA 1KKUA 4YHBA 1O0BA 4Y6SA 2PH1A 3DE2X 1ODLA 2CNOA 1Z6ZA 4B47A 1X7ZB 2V3WA 3R5JA 4MKHA 1EX1A 4HDOB 2AUMA 2OOKA 4KE8A 4R01A 1CLUA 1G7TA 3TOSA 1RIFA 3HU3A 2BEVB 4KLAA 1PWZA 3RI3A 1DRJA 3HZHA 3SJ7A 2WJGA 1ZL2A 1PQUA 3I6QA 4C01A 2WWVD 4G26A 4WNAB 2J7KA 2ZG6A 4XGQA 4HCJA 2ALJA 1VM6A 2V7PA 4LJKA 3COWA 4ZCPA 3EXIA 3D2LA 2FA9A 3OZ7A 4FFOA 4CUKA 2WTEA 3MINB 4L4SA 1U9CA 3M6MD 4OQQA 4PXSA 1EXMA 3SOPA 5K7SA 1WBDA 2UYOA 4B4WA 4CFYA 1S2IA 1R0CA 3ZGNA 3M3HA 4GKVA 3SJCA 4DNFA 4AECA 3BTOA 3K94A 2X0FA 4EW6A 3CNOA 5LYJF 3KYIB 1QUFA 1KZGB 4KQ1A 2GXQA 2I76A 4DMCA 3CVYA 4MHTA 1OFUA 2Z9DA 4MI9A 5AM0A 3PK0A 3FBTA 1HDYA 2B83A 2G5TA 3HA5A 4YT5A 4X95A 5ECGC 1W49A 1Q0SA 3QXHA 3LW7A 5ER9A 1KEEA 1U3GA 2ZBPA 4O4HA 4X62B 4MCHA 1QRDA 4A1FA 4G1BA 1ZGGA 1T2EA 1NA5A 2E55A 1H2AS 2JIPA 5IAEA 3VTAA 4KK4A 2PE5A 1NNLA 3L6UA 2E1RA 3BWXA 4W1SA 3D81A 2ICAA 1P1FA 3N75A 1ZVJA 2YCBA 1YBMA 4URVR 5JJLA 4RSHA 5SV2A 2KPOA 1EWRA 1TB4A 3FZGA 3M5WA 2RGAA 1VPVA 3AUUA 3DD1A 4MSUA 3EWIA 1YCGA 4OU5A 4EHKA 3QI7A 4G1MB 1QLHA 4N48A 3QWIA 2FE4A 2AVNA 1DG1G 2HIGA 2NYVA 2RHDA 4QICA 2ZJ0A 3M4NA 1XTQA 1OPXA 3GZNA 1PSDA 3W8NA 4CIBA 3KETA 3EULA 1T3TA 2HWYA 4MS4B 4QOJA 4BEBA 5EHZA 1L8OA 1N6NA 2L17A 3B3AA 1U9IC 2WUVA 2CDRA 3TQRA 2MYNA 2Q5CA 3M5PA 1Z6YA 1ABFA 1Y4AE 5CGZA 4B3FX 3ID6C 3VR0A 1ZQ9A 4ZEWA 5FBKA 3WV4A 3QFFA 3L05A 2Q41A 3NATA 4R2KA 4DADA 3RRFA 2J07A 3OZCA 2R8XA 5BNZA 2EX4A 2QSYA 2EF1A 4MVJF 3AWIA 3T95A 1U3FA 1T9GS 5DTRA 3PPIA 5I7VA 1XDSA 1JWAB 1M2OB 4EJ0A 3KAJA 4HWSA 1LNSA 5FTWA 4GDMA 4D9CA 1WAMA 4UNRA 4CFSA 4EI7A 2OAP1 1C9YA 2PZGA 1X6VA 4XIFA 4ARZB 5BORA 2ZWAA 2QRMA 5B3AA 2OO5A 3T94A 1QYDA 3P96A 4BXOB 5HMLA 1YIOA 3PNBA 3IJEB 2Z6VA 5DTQA 5JJCA 1KGDA 2Q3JA 2GXUA 1PR2A 5ERGB 4KV7A 1E99A 2ZJ8A 3UFXB 3ISJA 1L9KA 2XKKA 1E1YA 1UBJS 4JJZA 3BE8A 1HSZA 3IQXA 1KDVA 1M1YE 3TI9A 2TS1A 5KSWB 3UK0A 1WSAA 5KTRA 5L95A 1G55A 1XTBA 2XCIA 1NUHA 1PG2A 2QHXA 3AEYA 1GGJA 3HWWA 1HWYA 1KE2A 2X0DA 3RWBA 1GAEO 4MWZA 1KO5A 4NZMA 3VZRA 4AY6A 1BU8A 1WDLA 3H6HA 2UAGA 1UBTS 5LQAA 2C5BA 2NT3A 5J2TB 1TRHA 2B8NA 4NL4H 3JAMA 3CX7A 3HBNA 3AEUA 2NTYC 4KXWA 1J4AA 5DBIA 3BPSA 4I1IA 3ER6A 4RD2A 4MQFB 1QXSA 3AJRA 1N33B 4GZ3A 5T4FA 2X5XA 2HMAA 2VHEA 3F49S 2F8LA 3K0HA 2I1VB 3QVWA 4OHZA 1JXOA 1KVQA 3ESAA 3IMFA 3GIDA 3ZBPA 2C5LA 4IV8A 1OBHA 4PY2A 2FR0A 3X1KA 5CB8A 1FRNA 1LLDA 4HUQA 4QJIA 4FWTA 2ZIXA 1AU9A 1W5EA 2JGEA 4DY4A 3A9RA 1NFRA 4GPIB 5DNVA 1Q2UA 3UMGA 3VZQA 2VL7A 3AI1A 1H94A 1XHEA 3T3OA 4YQEA 1ULBA 4C0KA 2Q6KA 3T1NA 4W82A 3AI2A 3OTWA 2QX6A 3SNHA 1R6UA 3R0XA 3UWOA 3LPDA 3WQHA 3P97A 1JHXA 1L7QA 2FOIA 3BORA 4L7QA 3C5WP 3L1HA 3I4LA 3I72A 1NW7A 3HP4A 3MC1A 3ONDA 4RAQA 3ZWPA 4LXQA 4BU1A 3H9QA 3V5NA 2BI4A 2PKXA 4R31A 1ZINA 2H9IA 3IUBA 3HYCA 4QC2A 5AT1A 1G18A 2UUOA 1E1NA 3RC8A 5IYZF 4URFA 3RYFB 1IEVA 3X1DA 4DV1B 2WHXA 3OPYB 5ARCA 3BS4A 4FGKA 3MMNA 2P1RA 2UYCA 5CDSA 3TLAA 2GPTA 2MR6A 2VYCA 2W71A 3PHBE 5DGCA 3WLRA 3INNA 3CUSA 1QFSA 3O91A 1KAEA 4TSRA 1DWUA 1DHTA 2XCOA 3GZTB 1PZXA 4YRTA 5AXAA 2V4ZA 1I4OA 1M54A 3V8EA 4DE5A 4W5OA 4QEZA 3TEJA 2E82A 5FAKA 2LE0A 2XTZA 3WP1B 2YZGA 4N0EA 2R00C 4NLLA 3NONA 1VTKA 2ASVA 3OEWA 4XQGA 3VNAA 1P91A 4KDFA 2BJWA 2Q2WA 4R9SA 3R7WA 3LNCA 5D7BA 4Q1DA 4KMRA 2DR3A 4EI8A 3NEYA 3QPAA 1KYIA 3ZDAA 2XBLA 1NY5A 4F3TA 3LQ4A 1SVUA 1XC7A 4B6EA 4LYJA 3D1LA 2QK4A 3HNRA 3UOAB 5G1OA 1USIA 3T4UA 1XZBA 1RYEA 4KXXA 4PTLA 4JT9A 3U0BA 2PRYA 5KQRA 1TZCA 4M54A 5HGJA 1B41A 1XTPA 4HVTA 2RI1A 3JYLA 5K3EA 2G3YA 5FJIA 4CF3A 2RG7A 1LW7A 3NBXX 3RSOA 5A03A 1C9EA 5CH3A 5B37A 4MUFA 2FQWA 3BFJA 1JA9A 1JYFA 1V8ZA 4L3VA 4NARA 4AWAA 2X0JA 2VUIB 2P5YA 3NS7A 1G3MA 4LQ4A 4C4PA 4RIIA 2KX7A 1CYEA 3ZK8A 1ZOSA 2FWMX 4LDZA 4RF2A 2PMFA 4B6OA 2E0IA 1NL3A 4AUNA 2IY9A 3WGJA 2W6ZA 4G4IA 4MDHA 1FP2A 1KEVA 2BTQB 4M9ZA 2QPTA 2QF7A 4Q7MB 4KIWA 4DBZA 1XROA 1OU4A 1UBMS 3FI0A 3LTEA 4B6RA 1MO5A 5IDQA 1MFZA 5FKJA 1B43A 1JUDA 5IBCA 2ZYUX 4AJOA 3HJGA 1QPZA 5JBQA 1XNQB 3Q2IA 3HB4X 1XZQA 2JCYA 4RCYA 4OD0A 1Q0HA 2DHDA 3GFBA 7GPBA 2V1XA 2XB8A 1GAXA 2OY0A 3A8TA 3EEYA 2IPNA 2R8BA 3GWGA 1Q3HA 1SVSA 3K9BA 4JUIA 4MRVA 5FTJA 4LDJA 5HDBB 2CXQA 4GC5A 3VSDA 4MQFA 5IKPA 4PC2A 1X1CA 1XDUA 2CEAA 2PZEA 4PYRA 4REQB 4CIWA 1T4DA 1AXGA 5KSOA 4JLBA 2O48X 1L2TA 4P1ZA 3W78A 2R62A 2NNWB 4ERNA 4YRRA 3BOSA 4V1CB 3DR5A 3H65A 2YVUA 4JJGA 3ZDQA 4U7PB 1BXRB 1MO4A 3GPBA 1AKEA 2CHEA 4TMWA 1Z9BA 3RYIB 3SF8B 1O8BA 1NBIA 3CONA 1KZ7B 5TS2A 1QHHA 1VCHA 1ZRMA 3TZBA 3TTUA 2V65A 1X1BA </