1ZI6A

Crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 81
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi6A00
1JKMA 1VXRA 5JAHA 1CUDA 5FKJA 3WK9A 2XMQA 5ALGA 3PE6A 4OYYA 4PV7A 1F8UA 2O2IA 4UHEA 4U2FA 4MQMA 4J0HA 2HRQA 1UZAA 3KWJA 4WDQA 2JGFA 4K6GA 1JU4A 1YA4A 3FCXA 2ROQA 4EY4A 1K63A 5HZGA 2RHWA 5AK4A 1S8OA 4M0MA 4P08A 5AKLA 2ZJ6A 4A16A 3STXA 1XZKA 3DJYA 4WJLA 3STVA 3JW8A 4AZ0A 1XRNA 4QEKA 1E89A 5FRDA 4UUQA 2C4HA 4GHWA 1UFOA 3WJ1A 4BDTA 5AM4A 1EI9A 3IULA 5ALPA 2CEKA 4HTAA 5JAUA 1MX5A 2PSDA 5HQ3A 5ESRA 5AI6A 2HA0A 5BWBA 1GGVA 1ACLA 2GBFA 3H18A 5FXMA 4FNGA 1G42A 1H2XA 1QIGA 2I3DA 1BRTA 5HF6A 2QRUA 4J0CA 1UOQA 3HACA 5DNVA 2JEYA 1EXWA 3M81A 5LZ8A 5ALNA 4I3FA 1C7JA 4B6GA 2QVBA 4N8EA 4X93A 2CMFA 1JFRA 2W22A 4EY6A 5EIAA 3WKDA 5JARA 4J0DA 4NVRA 3VISA 3IBTA 1EVEA 2CBGA 5ALDA 1QIKA 5CMLA 1R50A 3DCNA 1LPSA 5C8XA 1FSSA 3WI7A 1JMYA 1ZI9A 3IA2A 4C4YA 4BYMA 2XMCA 2QR5A 3H2JA 3BDIA 4O08A 3D0KA 2CKMA 4C4ZA 3PF9A 4YPVA 4RPCA 2VT7A 3DYIA 4OB7A 1W52X 4YASA 2XQJA 3A70A 3H19A 5ALLA 3VKFA 3DS8A 3HSSA 2Y6VA 1ZI6A 4LYDA 4AX4A 1JT2A 3U0VA 2HFKA 1HQDA 4KRXA 1MAHA 3O4GA 3GFFA 4AN1A 4P92A 4C87A 1DWPA 3LCRA 4KAJA 3D5EA 4FOLA 2HA5A 1MN6A 3VXKA 5FP0A 4B0PA 4UBNA 1WPRA 4BZWA 4BBZA 5BWCA 1LZKA 2HHAA 3V48A 3IIIA 3G0DA 1TCAA 5ALMA 1AC5A 5AHXA 5I7UA 4EUSA 3C43A 3QM1A 1UXOA 2IITA 4Y2PA 2GBIA 4DYHA 5LKAA 5HF9A 3DQZA 2GYWA 3M3DA 1ZIXA 2PU5A 5DWDA 3G9UA 4W1RA 4U2DA 2HA7A 3W04A 3JYHA 5AICA 2VJBA 1U4NA 3O4HA 1H23A 2WLSA 3G9TA 1EK2A 1DT5A 3T52A 2JGKA 4HS9A 4AXBA 2JGMA 4E14A 1XRQA 5AK6A 5AIBA 4ZI5A 3CN7A 5ALFA 4I4CA 3AFIA 3F97A 5IVIA 4HRYA 4JEIA 4V2IA 2LIPA 2AJBA 4C01A 4EZIA 4G9GA 5E2IA 3Q0TA 1ISPA 1YB6A 3BWXA 1MT3A 5CXUA 4H7IA 1DQYA 3AIOA 4RGYA 1CEXA 1PJAA 4DIUA 4FBMA 2QTBA 1XKTA 2XUAA 3WA7A 3BDVA 3DEAA 3FLAA 1UT6A 2GBCA 3G0IA 3TRDA 3FBWA 3V1MA 1QO7A 1AMNA 3OPMA 4OB6A 3WK7A 2XUGA 4LXGA 1KEZA 2D0DA 3KOOA 5JZ9A 1SOMA 3FYUB 3OM8A 1Q83A 1CVLA 3G9XA 1WOMA 4HVTA 4BC0A 2C0PA 4EA6A 4BCBA 3F96A 4DTCA 1BN6A 4AO7A 1A8QA 4N8SA 2XUIA 1XRRA 4BAZA 3LLCA 3C45A 1YB7A 3UUFA 4XVCA 2HU7A 3D3NA 5DYTA 4GECA 5AO9A 3S2ZA 2C58A 1ORWA 4UFOA 4PSDA 2BCEA 3QPCA 3AZQA 2GZSA 4CG3A 2RI6A 4HAIA 4KJXA 1A8SA 3ESBA 4H77A 2Z3WA 5CT5A 2RAUA 1CLEA 1K6EA 4CIBA 4HXEB 5AKKA 2VSQA 3WZMA 1HL7A 2ORYA 5ALWA 5AJHA 4FLEA 4N8DA 2RGUA 3LS2A 4FFWA 3ICVA 1UK8A 4J03A 4H7EA 1N1MA 4F0JA 3HRHA 3ESDA 1JU3A 3G02A 5AOBA 5EFZA 2WTMA 1ZIYA 1CIJA 3E0XA 1FFDA 4ZREA 4Q3LA 2DCMA 1VZ3A 3N0TA 4MWTA 3EQ7A 2JGEA 3FWHA 1QTRA 2B20A 5AKIA 4J7AA 4HXFB 3I1YA 1R4ZA 3M82A 4TVKA 3VVMA 5DLPA 3FOBA 4J3JA 4H35A 4S0XA 3NUZA 3D2CA 1XZBA 1VZ2A 4Q3OA 5BV7A 5FLKA 1XRMA 1XZCA 3FYUA 1ZGBA 4N5HX 2G63A 2FX5A 5AM5A 3G0CA 4BVJA 3WKBA 2R8BA 1DQZA 3V1NA 2Z5GA 3R3ZA 3WIBA 4PNZA 1W6RA 3WWPA 4CI9A 3H2HA 1CUEA 4KEAA 2WKWA 3W2TA 4WFKA 1X70A 1EB9A 5HK8A 5AOAA 5AKGA 1VE7A 2WG2A 1AUOA 3I6ZA 2VJAA 2HADA 3I2GA 2CJPA 5IVKA 4XX1A 4WFIA 3A2MA 4QA9A 3UUEA 1YAHA 5SYNA 1R88A 1NU6A 1XZGA 3TJMA 2ZYRA 1HLGA 5EI5A 2XMRA 4QE3A 3ZV7A 2WJ6A 4UHDA 4M0FA 1QIJA 2YXPX 3WWEA 5EGNA 2O7VA 4ARAA 3QMWA 4DMCA 4H18A 1YCDA 1YASA 3H2KA 5FUMA 2ZSIA 4NMWA 5JADA 1LBSA 2HA3A 3BJRA 4H7DA 2UZ0A 3YASA 4ZGBA 5ALVA 3EBLA 1CPYA 5EHZA 2ONCA 1CRLA 3PICA 5IH7A 4A5SA 2IIVA 4PQEA 2QJRA 3ZLVA 1Q84A 2PX6A 3K6KA 2XQIA 3DKKA 4QDUA 2X8BA 2QT9A 2WTNA 3N2ZB 3NOXA 4BP9A 1XZJA 2HA4A 4JUIA 3FNBA 1DX4A 3FSGD 1J06A 4KYVA 5AKEA 4W1PA 2O2GA 3F67A 3AINA 3R40A 3OC0A 5T4HA 1XZLA 3ZLTA 5ISMA 3UMJA 2ACKA 4KE7A 4CG1A 1UOPA 4Y9SA 4UBLA 1EDBA 1BROA 2OCLA 4ZWNA 5JIBA 4B0OA 2XLCA 4OUKX 4CIAA 4DMFA 4OYLA 2BUBA 3DOIA 5AIAA 3WL8A 3BIXA 2PPLA 2ZYHA 4LXIA 2XE4A 1Y7HA 4L72A 3IUQA 4UBJA 4MXDA 5A7FA 4FHZA 1Z68A 1W76A 4Y7DA 1UKBA 1SCKA 1JMKC 4G4GA 1MPXA 2GZRA 3H04A 3QPDA 3T4UA 4F60A 3G9ZA 5CW2A 1CUGA 1CUAA 2PSHA 1KU6A 3PDCA 4RNCA 3ESAA 4B9AA 5HF8A 5ALUA 1ZD3A 2XUQA 3O9MA 5SYMA 1DT3A 1CR6A 2XB6A 3HEAA 3ESCA 3ED1A 1VKHA 4H7FA 1A7UA 3V9AA 3C70A 4INZA 4NS4A 2FJPA 1GQSA 4GEGA 1DWQA 1XROA 1L7QA 3H17A 1VOTA 3B12A 3SX4A 1IUPA 4DGQA 3WKEA 2OGSA 3EQ9A 4X94A 3D59A 4P93A 1U2EA 1LBTA 2CB9A 3PI6A 1ACJA 2H1IA 1LPNA 4YK7A 3QMMA 1XLUA 3WL6A 3ZI7A 1QJ4A 1QFMA 1JJFA 4IO0A 3FCYA 1UK9A 5K3CA 1VA5A 3GZJA 1U65A 4BAUA 1PFQA 2WJ3A 4BATA 2JBWA 3DL4A 3HLKA 2RIPA 4B82A 2O7RA 1RYYA 3WK8A 1ZGCA 2J4FA 1IZ8A 4Q34A 4Y2RA 5DNUA 4Z49A 3FLEA 1QO9A 3SK0A 3ANSA 2B4KA 3RM3A 1VE6A 3H0CA 4BRZA 3F98A 2X5XA 1GT6A 4Y2XA 4W9RA 3H1AA 3K2IA 4N5IX 2ZSHA 5HFAA 1XQXA 5A7HA 5K3FA 1CFJA 2XUOA 4BE4A 4QWWA 4X91A 4BVKA 4KE9A 1J1IA 3RKSA 3M83A 3A2LA 1R1DA 2GBGA 1QGED 4E11A 5ALJA 5JD4A 2OPHA 3SC2A 4K6HA 4EY8A 4GW3A 3MUOA 1MNAA 1YAJA 4FWBA 5C7YA 1X2BA 4QDXA 2XMDA 1B41A 1CUBA 4DSAA 3BE8A 1TQHA 2NW6A 3KD2A 1CQWA 2XI4A 4TPKA 3KSRA 1Q0RA 1BN7A 4AB1A 5ALOA 1P0QA 5LP1A 2V98A 5K3EA 1EDDA 2VF2A 1OILA 5AI9A 1XQWA 3U1TA 2AJLI 5F4ZA 3F9CA 5D6OA 5AP9A 1UOOA 1WM1A 4MWSA 4A23A 2XDWA 1T2NA 3W9UA 2VAVA 1CV2A 2ZYIA 2Y1KA 5J3JA 2OCIA 4MYDA 2H7YA 4LXHA 1TK3A 2WFLB 3R3VA 1XZIA 4OD0A 5ALEA 1CUJA 2XUJA 2JEZA 2Z8XA 1HBJA 2QJWA 3IUMA 4MEBA 5K5EA 2HIHA 3R41A 4EBBA 5HCUA 2PM8A 2DHDA 3HYSA 1ODTC 1MU0A 4UHFA 1XZMA 5DTJA 4GDMA 3GBSA 2V97A 2ZJ7A 3W05A 1CUYA 1ZJ5A 4F5ZA 3WL5A 2HFJA 4DNQA 2OCKA 4E46A 4FFVA 4H7JA 1XZAA 5FPPA 4JNCA 1W75A 1CUWA 2JGIA 3H2IA 1QIMA 4OU4A 1LPAB 1UK6A 4YX9A 3S8YA 4PW0A 5AKYA 1G66A 4X97A 1AURA 5AKZA 3GELA 4GBGA 5HQ3B 2WSLA 1YR2A 4AQDA 3ICWA 3CN9A 2BJHA 3TEJA 4X00A 1CUZA 3FVTA 3HC7A 4EY5A 4WFJA 2PKYX 5C8ZA 4FDMA 3G0GA 1DINA 5A2GA 5CT6A 4G5XA 3STUA 5CRIA 4NZZA 2VJDA 1XRPA 2C0QA 4OPMA 1XZEA 1AGYA 5AKHA 2WG1A 2QXTA 5JYCA 3FYUC 1NU8A 1QE3A 1LGYA 1W1IA 4IH1A 5CH3A 4DNOA 3D7RA 3DD5A 5ALYA 3E3AA 1AZWA 3GA7A 4BTLA 5HK9A 2O2HA 1L7RA 1XQVA 2Z8ZA 3E1GA 5AI0A 4DLNA 2CZQA 1EK1A 3G7NA 3AILA 4EY7A 5A71A 5HKBA 1GZ7A 2WILA 1F0PA 2ECFA 4UPDA 4KE6A 4Y2JA 4WY8A 2PU7A 4B7ZA 4U2GA 5DNWA 1X2EA 4XWGA 4K5QA 5CXXA 4DNPA 3C6YA 1EX9A 2OAGA 1E8DA 3R3XA 1OCEA 4UBMA 2OGTA 1HKHA 3C6XA 2I3ZA 4GLBA 3VDXA 3TGLA 1MX1A 4U2BA 4AMZA 3STWA 3WK6A 5DTIA 4BDSA 1O6GA 2V9ZA 4BB0A 1QIIA 2ES4A 3BJMA 1MX9A 1QTIA 1QIEA 2XQKA 1LPMA 4DNFA 2DQYA 2B61A 5ALHA 4Q82A 4PSUA 1VJ5A 4BP8A 3QVMA 4L0CA 3O0DA 3VJLA 5D7BA 1E8NA 1TKRA 3HI4A 4BC1A 5FPQA 5IVHA 4GI1A 3F8SA 5A62A 1MNQA 2WM2A 2HM7A 2VTVA 2E3JA 4F21A 2EDCA 2RONA 1A88A 5LLSA 2WFMA 2WIJA 3HABA 2HL6A 2Y2UA 1H22A 2WHRA 4WDRA 4MJ3A 3X3HA 1E66A 5JZBA 5EHQA 3IB3A 2XMBA 4IH4A 1H2ZA 5CBKA 2QUBA 4PO3X 3WWDA 4H0CA 4B9EA 4OB8A 3ANTA 4X71A 4MQLA 2HRRA 2DFPA 5ALZA 1H2YA 3HJUA 4BVLA 1QZ3A 5LYYA 5LZ7A 5AOCA 5JAOA 1ORVA 3VVLA 1CUFA 1ZOIA 1AQLA 2AXEA 5EIEA 1BS9A 5CT4A 1IMJA 1SCQA 2VA9A 1TAHA 2I03A 4Y2TA 4FBLA 2XQFA 5DYYA 1WHTA 2XQGA 1W4LA 3H2GA 3D2BA 3IURA 4BCCA 5HFNA 3GROA 1FFEA 4W1SA 4AO8A 1CUSA 2YYSA 3G8YA 5JATA 2XMSA 5IKXA 2Q0XA 3V1LA 3QH4A 2PL5A 3D2AA 4X6YA 4KE8A 3P2MA 2OXEA 1GPLA 4FNMA 4KAAA 2GYVA 4U2CA 5AK5A 3ZPXA 5HKAA 3Q8WA 5LIPA 1RWQA 1LPBB 4QDZA 1WPXA 4RE6A 4BTVA 4X92A 4J0GA 5CH8A 2AJ8A 4G1FA 1GKLA 3IUNA 3AUKA 1TIBA 3PF8A 3AJAA 2BKLA 3FAKA 3WL7A 1SCIA 5D3ZA 1QLWA 3KDAA 2VT6A 5K3AA 5BOVA 1B6GA 1SFRA 2WIKA 2D5LA 3RLIA 4LKOA 3SWWA 4Q1VA 1JJBA 1GXSA 2VEOA 1FFCA 3I2JA 3C5VA 4MEAA 5LZ9A 3ILSA 2YASA 4TGLA 2XUFA 3WMRA 5FDFA 4B85A 4KRYA 4G4JA 5AKJA 5T4EA 1FFBA 3MUNA 2QUAA 1XFDA 5JZSA 4J0KA 1Y37A 5JD5A 1A8UA 2EDAA 3VJMA 2VJCA 2FJ0A 4BZZA 5ALQA 1F6WA 4H7KA 3LIIA 1THGA 2EEPA 3PFCA 4L9AA 3LP5A 1BU8A 3BL8A 5DYWA 4ITVA 1N8SA 2B9VA 5K3BA 3STYA 1XZDA 5ALKA 1P0PA 3NWOA 3GUUA 4K6KA 1CUHA 4C88A 5E4YA 2WUFA 2HA2A 4AMYA 7YASA 1U8EA 5JAPA 4Q05A 4XIIA 3DYVA 2WUEA 2H7XA 5CTAA 1PV1A 5CT9A 5AI5A 3O9VA 3DNMA 3I2FA 4D9JA 4ZRDA 3QMVA 1EHYA 1F0NA 4HXGA 4IQ4A 1FFAA 2WJ4A 2YH2A 5KWIA 4Y2VA 1BE0A 4DM7A 5ALSA 4X85A 4U2EA 5EHNA 4PF1A 3WKAA 3A6ZA 2BGRA 2BUCA 1P0MA 1K5PA 3HXKA 5AM0A 1ETHA 3NGMA 1C4XA 1UKCA 1JI3A 5K3FB 2OQIA 1IUOA 1MO2A 4UHCA 1XZFA 5LKRA 5JD6A 5H3HA 2WQZA 4IHAA 1G4HA 3QZUA 4FLFA 2W6CX 4QWMA 4KR0A 4P9NA 5T4FA 2PUJA 4LIPD 1VLQA 2QXUA 3IDAA 1QIDA 2HU8A 4G8CA 3WKCA 4QNNA 2PUHA 3C6ZA 3WIOA 4DMKA 1HPLA 2BFNA 4IH9A 1T4MA 3O4IA 4K2AA 1EDEA 3B5EA 3HZOA 4X90A 3H1BA 2JF0A 1MTZA 2G5PA 4UFNA 3C8HA 3KWFA 1ZD4A 1TRHA 3EIOA 3BXPA 1OXMA 2X76A 1C7IA 3BIWA 3R0VA 5EHXA 2WFZA 5IVDA 4X95A 3W06A 3OOSA 4ZXFA 5KWJA 2QMQA 3WZLA 2OQVA 2H9YA 2XLBA 1WB4A 1CUUA 5DJ5A 1M33A 2HU5A 1CUVA 4DMHA 2AJDA 1ZJ4A 5LZ5A 1NX9A 1E3QA 4RE5A 1L7AA 4FLMA 2VQ6A 1YS1X 5T4BA 4G4IA 2XUDA 2K2QB 2C5GA 2FUKA 1QFSA 5LZ2A 2J4CA 4DSZA 1XZHA 4MYSA 2OGZA 1LPPA 4BAGA 2WUGA 3I6MA 4QZVA 3CCBA 3KXPA 2IX9A 4G9EA 4UBKA 4BRSA 3BF7A 4EHBA 5C8VA 2DQZA 1D07A 2Y6UA 1EVQA 1DU4A 2G4LA 2QZPA 3RK4A 4UHBA 4QLOA 4ZV9A 2DR0A 3I1IA 5ALIA 1G5FA 2C7BA 3OTQA 5CURA 2OCGA 3OURA 4QDOA 2JGLA 1BEZA 1RP1A 4OU5A 4I19A 2BUAA 1LPOA 4QLAA 4KACA 1J2EA 4WY5A 3WLAA 4C89A 6YASA 3WYDA 2Y2VA 2ZJFA 3C5WP 4GWLA 3CXUA 1AX9A 1QIHA 1ODSA 5D3KA 3DKRA 4KAFA 4CCYB 1I6WA 4UHHA 1CUIA 3I2IA 3BF8A 4AZ3A 5KBYA 4PSCA 1QONA 3PUHA 1AKNA 1CQZA 1IZ7A 2WU4A 3D4LA 3A2NA 2PBLA 2WFLA 1DTEA 2H7CA 1UWCA 1N5RA 4C6HA 1XLVA 3MGAA 3IUJA 1LLFA 5JALA 3WJ2A 3WWOA 2XUPA 5E4JA 3VJKA 2XUHA 1CUCA 4X6XA 4X6UA 1GKKA 2PSEA 1TCCA 2JGJA 4X7BA 1R9NA 4HRXA 2HDWA 3G0BA 1O6FA 2CUTA 1UKAA 4EB0A 1GPNA 1USWA 3ZWQA 5C81A 1DWOA 2WHQA 4B83A 3AIKA 3RARA 2HA6A 3JWEA 2RHTA 1IVYA 3AZPA 4AN0A 1BCRA 1XQYA 4Y2UA 4C4XA 2OLEA 2V96A 4Y2YA 3EF3A 4ZV7A 3I6YA 5AK3A 1Q0ZA 1K4YA 1TCBA 2ACEA 2WG0A 5AI8A 4UBOA 1YSCA 2DHCA 2P8SA 3WQHA 2Z3ZA 4M0EA 1BEEA 4CFSA 4BCDA 5AKXA 1XKLA 1IUNA 4UBIA 3E4DA 2JIDA 3WA6A 4ETWA 3I2KA 1P0IA 1ZD5A 4CCYA 1LZLA 1MJ5A 2DHEA 1E5TA 4JH0A 1EB8A 3FVRA 4FMPA 1R9MA 2XMZA 1LNSA 3I28A 4ARBA 1EA5A 1ZICA 1KU0A 3C6BA 3WYNA 2WHPA 2OG1A 1XRLA 5E4TA 3AZOA 4AO6A 3B3QA 5KREA 3QYJA 3IVMA 1K8QA 3L1HA 5LZ4A 1WB6A 1HDEA 3LIPA 4OSEA 2AJCA 2I78A 3V1KA 4BE9A 1EH5A 2GYUA 4QDTA 4Y2SA 2WIGA 1VA4A 1H2WA 3L1IA 1ZD2P 4L3WA 5ALXA 1EINA 4W63A 5AI4A 3DDUA 4X3CA 5I9IA 2QOEA 1ZI8A 3PUIA 4B80A 2BAGA 4E15A 3DLTA 3O95A 5K3DA 1THTA 4UFPA 4B84A 4JYMA 5FOQA 5I8PA 5YASA 3R3YA 3C87A 5AH0A 3O4JA 1YA8A 3STTA 3W9BA 2WUDA 2VAXA 4G8DA 1Y7IA 3I2HA 5HF5A 2WIDA 4J0IA 5JANA 3PFBA 5JASA 4HZGA 3DL7A 5ALTA 2G5TA 3FLBA 1QIFA 1VXOA 1YS2X 1N5MA 1DX6A 4W1QA 2XT0A 4XJVA 3K9BA 3EQ8A 5CH5A 2PSJA 4CCWA 4J0JA 2XMGA 4WCVA 4LHEA 3WK5A 3FSGA 4FTWA 2OAEA 1J07A 1SC9A 1XLWA 5AM1A 4B81A 2BGNA 4ROTA 3ZLUA 2DSNA 4G8BA 2R11A 3CCCA 5EIHA 3QBJA 3R3UA 2QS9A 2J3DA 4OCZA 2QKYA 3FYTA 1QOZA 4LYEA 5A7GA 2C5FA 4FKBA 1WCYA 2WU3A 1GQRA 2PSFA 1FJ2A 2WIFA 1E8MA 2WHPB 3QPAA 2J3QA 5AM2A 4JYPA 1R3DA 3DOHA 4CG2A 1WB5A 2VATA 5ALRA 1MAAA 2ZYSA 3QITA 3L1JA 1BCSA 4H7HA 3OG9A 1ODCA 4GXNA 5AM3A 3WWCA 2XUKA 3WK4A 4Y2QA 5A6VA 4Q3KA 3R3WA 1JJIA 1UK7A 3MVEA 2QM0A 2PVSA 1GPKA 5FV4A 5CT8A 1WHSA 2ZVDA 1CUXA 3C8DA 3AIMA
chains in the Genus database with same CATH superfamily
3FUWA 2M1XA 4IFBA 2BKEA 1JKMA 3VC7A 3PUZA 2YUTA 3INNA 1NYRA 3DAGA 4Q0MA 1CUDA 3NKLA 5A4AA 2NTNA 3HCPA 3JQBC 5EPOA 5FKJA 1GFIA 1PV4A 4CM4A 5DLEA 2R8OA 5DXJA 2Q2WA 3PE6A 5EEGA 2LVBA 5FR1A 4RZHA 4YGXB 1KQPA 2I3GA 1X1SA 3QTBA 1F8UA 5H68A 4OMUA 5KIAA 5EWMB 4DCPA 4U2FA 3OSUA 2IDMA 5BUZA 4AMVA 1Z7EA 5IK2D 1IXKA 1UZAA 2EWVA 3A3KA 3GLRA 1KJNA 4ABYA 3VAYA 3UWKA 1RYFA 4K6GA 3CWQA 5K8IA 3AU8A 3JX9A 3KAQA 3F5DA 3SP1A 2X7JA 2ZTSA 1Y80A 4UU8A 2PX3A 1MQ8B 4NCJA 2X8JA 1C8LA 3CSSA 4RDIA 2RHWA 3UH0A 1NLYA 3V34A 4AKIA 2JD1A 1VMIA 2Y99A 5TVKA 1NJFA 3BXHA 4EI7A 1Z35A 4AX8A 1Y1LA 5KDOA 2ZI7A 4DV2B 4OJKA 1TZ2A 4JSRA 1ZU5A 3QU9A 2EBUA 2FSFA 3OFJA 4DLPA 1X7ZB 3H83A 5AKLA 3IOCA 1NUHA 3GQBA 2YX1A 4QL3A 2O8EA 2PZFA 5LQDA 2HYDA 4Z3OA 3C14C 4K88A 1Y1QA 3STXA 5I4BA 4OGWA 3I64A 2BFDA 2QD4A 1O5TA 3HU3A 3SE7A 3AYXB 3LDAA 4YAWA 1SVMA 1W44A 2DKFA 3KNZA 1U28C 1RI2A 2BHNA 1SVKA 4HH0A 4R2HA 1AZSC 2GBLC 3PLAE 2GO7A 5BQXA 2OFOA 2FPPA 2VOEA 2O05A 3KJXA 4R1QA 2IS1A 4JGIA 1HXHA 2HF2A 2R2GA 4EM6A 3VX3A 3NT5A 1ZCAA 5FUBA 3SC4A 1FP6A 1QP8A 2ZATA 2C4HA 4GHWA 3WSTA 4CMIB 2M98A 2EWMA 4Z3DA 2WSSA 4LKRA 4D5EA 2FCAA 2G77B 3C15C 3CNHA 2C5EA 1EI9A 4H31A 4PE5B 3DMHA 3GLGB 5IX8A 5IJXA 2FVXA 2XEDA 2CDBA 1U8TA 4P4LA 2DFLA 1TVKB 4LJRA 1CJUC 5BWBA 1GGVA 2DJ5A 3C39A 4UM9B 1LCIA 4ZVUA 1E5XA 3OIVA 1IY1A 5FXMA 2H0QA 3WQBA 2QNRA 4KPUB 1ODFA 3ONEA 1Q3TA 1FP2A 5C4GB 1G42A 4XVRA 1NVEA 4TTQA 3ADPA 3UMFA 1BRTA 1W88A 2W0MA 3ROEA 3VR5A 1QHIA 4L0DA 3H11A 3U49A 4D8WA 4UM5A 3FTNA 4FZJA 5D5HA 4D4HA 2IHTA 4G5GA 1Z4QA 3B9PA 4HPWA 2LCQA 2IK8A 2EAUA 3ITNA 1EXWA 4XLLA 4XTRA 5AW8A 1GUDA 4ID3A 3FROA 4ACBA 3R44A 3HVUA 2KLBA 2A6PA 3F6RA 1MEJA 3WG9A 3FBTA 4YRLA 1XWFA 4IIFA 1ND5A 4L5CA 4N8EA 3H0KA 2WHXA 3NKVA 3NV7A 1JFRA 1VPEA 2H7VA 2REQB 4X61A 3UMCA 3V5NA 2Q9UA 4U7HA 3KPWA 4FGSA 5EIAA 3WVNA 1ORTA 1VMEA 3JAKB 3GJZA 3MIZA 4A6EA 2WA1A 1YZLA 4JQOA 4L4ZA 3KJFA 5C5CA 3OEED 4NVRA 3J80A 4M21A 3COWA 3QPUA 3JZFA 1ISJA 1JKFA 2I3BA 3ZQ6A 1KZ7B 1EVEA 2FSIA 3IKMB 1IDOA 1HE8B 2CBGA 2VNAA 2AD1A 4FYMA 1DKOA 1MB3A 2OR3A 5D7NA 1OJLA 1R50A 1Z4PX 1JQLB 2EW1A 4M7OA 3TSAA 3USES 2F8TA 3JRXA 3QKRA 1QFJA 1NGSA 2FYTA 1LPSA 4YJGB 4A36A 3LBYA 2FN7A 3PFKA 3Q9LA 3FVWA 3L46A 5C8XA 3WI7A 5KNCD 1EUYA 2P2GA 2Q49A 4AZ3B 2NXEA 2JZNA 4LCEA 2VLIA 1UBMS 3CF0A 2O2ZA 3E7PA 1I4OA 2H6EA 2ZPAA 1MAWA 3NWEA 5FTWA 3IQEA 3IAEA 1RPTA 1OW3B 1RQGA 3ZXUB 2XADA 3KUCA 1G16A 2QI9F 1A97A 1PTJC 1AHNA 1Y1TA 3NCTA 4OQMA 4A0FA 4XTCS 4RIHA 5K4GA 5I8ZA 1K9VF 5AJVB 1AV6A 4LW8A 3E3OA 2VT7A 1E2DA 3BSFA 4OB7A 1IB0A 3NGXA 4EO9A 3OLWA 2H4HA 3D3EA 1KKLA 1ZBQA 4G0XA 3WRVA 3UK7A 3PPWA 3B3JA 4NZMA 3L04A 2XJ4A 2O3JA 1I51A 3HSSA 3MF4A 4HUQA 3FNGA 1XWWA 1Z3IX 2B4AA 2GTIA 2I1WA 2NTVA 3UK2A 3MZ0A 3GJRA 2AR0A 3L5OA 3P4XA 1A69A 2HFKA 1HQDA 4DXHA 1PJRA 4ZVRA 4KXUA 1DSSG 3SYRA 4POAA 3NCHA 1Y8RA 1Z38A 3UATA 2ZUFA 1T25A 3A1VA 1NYQA 1MQAA 4C87A 1DWPA 3LCRA 4O4JA 3T1OA 2CD7A 3A04A 3ADOA 3I5MA 3NVMB 2HF7A 2R9VA 5HOQA 2HA5A 4PCLA 1MN6A 4L6IA 4ADSG 4ALKA 4EMUA 2QMEA 3PNQA 1ZISA 1U0HC 1HSOA 1OXTA 2XR1A 3BMQB 4MVJD 5I8WA 2IYNA 5CYFA 2JHFA 3FGOA 1ZH0A 3AKEA 4UBNA 2Q7DA 2LRHA 3T0IA 3LPLA 3O1HB 4XVUA 1USVA 2HHAA 1MH1A 4R8RA 3DGFC 1PBNA 3IIIA 2WFAA 1JFVA 1KAGA 1QVWA 4J6EA 4OM8A 3DZJA 5FCDA 2YY5A 3SYNA 4F8EA 1PT5A 2DLDA 3G23A 1FQJA 3RUFA 3LTNC 3IQXA 5JLJA 1P8AA 4HRVA 1L8LA 2IITA 3TE6A 2V74B 4EGCB 3E7WA 4MAMA 5LKAA 2PVCA 4O2BF 5FPYA 3CO0S 3EAFA 2HMWA 3U09A 1FDSA 3ZY5A 1CY7A 1QH8B 1E3MA 1T91A 2IYUA 3DQZA 5I7VA 3ACDA 3DVRX 1XXLA 3AEUB 4G37A 4MUJA 3TB4A 1ZIXA 5DWDA 4Z51A 4EHKA 1XCPA 1QK3A 4M98A 4OBBA 3FFXA 1S0UA 4CM6A 3AEXA 1Z75A 2HA7A 5F7ZA 4BQIA 1OC4A 5DV9A 2PRYA 4G56A 5AHKA 1XK7A 2AKEA 1BVHA 2O2YA 1KYWA 1YZHA 2GBLA 2V59A 121PA 4UZFA 1X7DA 2CJFA 2D8MA 3T5MA 4KPYA 1KMNA 1Y9JA 1E0SA 2RGDA 1YUNA 3G9TA 3LQRA 3O4HA 3VR6A 2FXIA 2WPNA 1YUBA 1UPXA 5EMLA 4QPDA 1WSWA 4HS9A 2PS9A 2IOYA 1W88B 2BMWA 1MC1A 2HI0A 4TSFA 4LTMA 2ZSAA 1KTVA 4CKYA 3GRPA 4ES6A 5JBIA 1PK7A 5KNLA 2HSJA 1JIIA 3T7RA 4EPYA 1BS1A 2C9BA 1XRQA 2EX0A 4JELA 5AK6A 1N77A 2UXBB 1MV5A 4X66B 4R0VA 5HKKD 3C4JA 5ALFA 4GXTA 3C3EA 3AFIA 1U8XX 3BQMB 4YAIA 3K71B 2PMKA 4YJ2F 3AB3A 3VSAA 1XD2A 3KHUA 1PEYA 4AZTA 4EP1A 1C3EA 1XXHE 1KOFA 3OECA 2PZLA 2XKKA 2VNIA 2G08A 1QFZA 3FUCA 4R9NA 4XVQA 4WTOA 3RV4A 5A6SB 3ER8A 4MICA 4FZ5A 4EZIA 3L02A 1YQGA 2A4KA 1ISPA 3BH0A 3BWXA 3Q0TA 3M6LA 2QRJA 3BCUA 5K51A 3RVDA 1C7FA 4QEZA 1EFRA 5CXUA 4BGVA 2JJYA 1M74A 5IJWA 3H97A 2FPGA 3QXHA 1NT2A 5KYWA 3MS2A 1KMQA 1KJQA 3E84A 1G5PA 1O0BA 2PGJA 3MQ4A 2ZRJA 3VO8A 4DIUA 2AIRA 4X0EA 5EQTA 3TKAA 2XUAA 1IG0A 1C41A 1IRIA 2X23A 4CDGA 3DFKA 4D74A 3BDVA 3BCSA 1K7XB 3RUIA 4ACAA 4FEYA 1F8XA 2PUWA 2YWRA 4DLSA 4I9NA 5LM3A 4FN4A 4NYMQ 2CHEA 4NFHA 1EXNA 1PLLA 1EEXB 2C3YA 3AC0A 3EGEA 3DE2X 1L5LA 3VTKA 2DT8A 5CDFE 5KPDA 5EQDA 2ZJ0A 2H9IA 2JW5A 4J76A 3A1EA 4OREX 1XTVA 5DTEA 4OBWA 2GDZA 3ZLBA 1KEZA 3KOOA 2VF5X 4RLFA 5JZ9A 1NYLA 4GPD1 3QOYA 4KFRA 4V0MA 5EP2A 2VLBA 3FGPA 3R77A 2CNKA 2VUHB 5KOJB 3OM8A 1MG5A 4G1EB 1CRZA 1N0VC 1Q83A 1E2MA 3OZSA 4NBRA 5HE9A 4Z9FA 4CF4A 1CVLA 1H4VB 3DPSA 4QFBA 4MJXA 1QRDA 4HVTA 3DMTA 1F06A 4UUPA 1KP9A 3C3CA 1EHIA 1S4QA 2P90A 3RC9A 3WYCA 3ZXIA 4BCBA 2L17A 5C32A 1BN6A 2QSYA 2YWBA 1AQIA 1PSWA 4N8SA 4KN6A 5B7PA 2K6GA 3UYLA 1G38A 1TPYA 1DIGA 2DGDA 4QQNA 1L9XA 4QU9A 5DBHX 1FYEA 4RMJA 4COOA 1F2TB 5KNDD 3KV1A 13PKA 2EFYA 1F2TA 2HU7A 3PQ2A 1RLJA 3L92A 2ZI4A 4UJ5A 5BT9A 4EUKA 1QGAA 5DYTA 1E1CA 4YRKA 4D5GA 2J0UA 2Z2XA 4OHCA 1SBCA 1NJ2A 3B9QA 3ELUA 3BRWD 3QVGB 4NHOA 5J5CA 3V46A 3VU0A 1N36B 2YV2A 1F0KA 1N75A 1PR3A 2XF2A 5EP3A 1Z9BA 2IYSA 4LYAA 4PSDA 3L8ZA 3U7GA 3ABIA 3AZQA 4OI2A 2FSPA 1LDMA 2ZQZA 3ABOB 1U7HA 4FSDA 4CG3A 4LDNA 3QK7A 3UK1A 1ZA1A 4XDHA 1XJCA 3U62A 4GF5A 3VH2A 2K5UA 2Z09A 3LPCA 1GZDA 5HA5A 4ZAXA 5TPZD 2RHMA 3DUFA 2P4EA 1XMXA 2IKQA 4A8JB 1GDTA 1N5OX 3KQPA 4O4LF 4OI1A 4Y9TA 1SY7A 1IFXA 4RZUA 3UJDA 3L5KA 1IXZA 4PHCA 2I67A 4FCTA 5DGXA 4CPDA 4CIBA 4HXEB 1QH8A 2IS4A 1SC1A 4GLJA 1KK2A 5AKKA 2B0JA 1PNVA 1C7QA 1HL7A 5EIXA 1VBKA 3B2EA 4N0QA 2E4YA 1BKSB 1CNFA 1UBGA 3U7QB 1Q19A 2HCTA 3ZWMA 4DMGA 4LF9B 1L5RA 4G1UC 3GWZA 4XASA 3EDQA 3N2NA 4KDRA 1NR1A 4INPA 1YU9A 4YWHA 1Z07A 1XKXA 3LS2A 3EQ6A 5H81A 1KZYC 2ZUCA 1O4VA 2QRQA 1Y9DA 1U90A 4H9GA 5AW5A 4C43A 1UK8A 5B1EA 1JHMA 4I50F 3DE4X 3QELB 4I81A 4NWIA 5IM5A 3K5IA 2A9FA 4LFCB 3KQVA 4UNPA 1IZ9A 1T1JA 2FJUA 2Q6TA 4F0JA 2BSAA 3HRHA 2H92A 3MERA 5B7QA 3SQOA 5AOBA 3TLYA 4CN8A 4Q3CA 1UPTA 1GSAA 2WTMA 3PRHA 4ILEA 4MVJG 4BNHA 4CT5A 4DZTA 2OXFA 2XVYA 5SV2A 3CLUC 4DILA 3EEFA 3LO5A 4QBIA 4CKZA 4GKVA 1OROA 1OX4B 3BK7A 1CIJA 4HEA6 3ILHA 3M1IA 4RIIA 3W5JA 2AQIA 2FZ5A 4ISBA 5INTA 3J81k 1CT9A 1P5FA 1TEHA 4WZBB 4KREA 3DT8A 4YAJA 3DXZA 2RKBA 1JJ7A 4U5QA 2HJSA 3EWNA 5KWEA 4LCJA 4AJ9A 1IXRC 1DKUA 1J6UA 2YHSA 3CU5A 3SY8A 1E9BA 1OLSA 2IDKA 4P81A 3NAMA 4PIVA 2GZ1A 1D03A 1GRQA 2RAPA 1NPYA 3ZK7A 4ZVVA 4WUTA 4CL2A 4FYJA 4PSAA 4CM8A 1YMVA 2BTOA 4CM8B 1JHAA 1PZHA 2XECA 3LX8A 2WRZA 1DAFA 1ULSA 1KDRA 2B20A 2BTQA 2HW8A 1PZEA 1JSZA 2DUJA 2OFPA 3M82A 3MTBA 4HXFB 1ULAA 4UUOA 3VVMA 8GPBA 4X1KB 3RYCA 2V3CC 4NCAA 1EM8A 4H35A 4RKQA 3G3EA 2R6FA 2CLDX 3KYCB 4RA6A 4PSVA 4S0XA 4C3VA 4HGZA 4IDHA 1BW9A 1UXKA 5ILGA 1AN0A 3VC3A 4OFZA 3ZDDA 4ZEOA 8ABPA 4Q3OA 5TGTA 5FLKA 1NAIA 1O95D 5BV7A 5REQA 1XZCA 3D3WB 2O0MA 4UQLA 3OBBA 5JISA 2EFDB 2CLEB 1L4FA 1WP9A 1YHYA 4FZRA 3WMGA 3GD7A 3FPEA 1QGZA 1C3OB 4PVDA 5EHIA 1L7MA 3JQGA 5TQ2B 5LN1A 4BQOA 1IK6A 1HNWB 2VRNA 3JQGB 2MSWA 5HSGA 5AM5A 3G0CA 4BVJA 2R8BA 5D3QA 2WAAA 2KHZA 4JOBA 4TMXA 5A4FS 3WWPA 2IY9A 4GNKA 4CI9A 1EFPA 2N9UA 3FSJX 4J3NA 4HB3A 2PVPA 4TM8A 3MPOA 1T1IA 5HXAA 4QXAA 2PDAA 4WFKA 5HBRA 2G9VA 1V5IA 4Z86A 1WSDA 3W79A 2C5LA 4J4HA 1XTUA 4AJHA 4BB9A 2BT4A 4UATA 5BSGA 4EI8A 5AOAA 4ZU6X 2QVZX 2QF7A 4F3YA 3ZVMA 2O8FB 2P2CA 3VYTB 3NETA 1JA1A 3DWEX 5FHRA 1Q1QA 2Q3BA 3RJMA 5ENDA 3MBIA 3I2GA 5EYPB 1BVRA 4MW0A 4F12A 1BXKA 4URUR 2WMNB 1OH7A 4F6LA 1YDWA 1OJ7A 1UWLA 2IIQA 3OQBA 4X54A 1E6UA 1YAHA 4FS3A 4S1WA 2ENWA 2HEGA 2I66A 1T36B 1Z62A 4YRPA 4CIXA 1AE1A 1GNSA 5TGZA 2OY0A 1FB5A 3I8XA 1Y9EA 3E53A 4YJ2A 1P0FA 3FYHA 4TTRA 1GZHB 1HLGA 2LCIA 4JI2B 2ZB3A 2LW7A 2OHJA 2ODEA 4LZZA 3TKYA 1Y5NA 3DAHA 3DMGA 1OKKD 2WJ6A 4G1VA 2FUG1 3BD9A 2YXPX 4HDCA 3TD9A 2VTBA 4ARAA 3QMWA 1K8YB 1Q7TA 2Z2ZA 2F1KA 1SD2A 3O92A 4S04A 1M8JA 3SIRA 4D42A 2JFNA 4L7VA 1B15A 1HQCA 5FUXA 1VJ0A 2LR0A 5E6UA 1U3CA 3B89A 3UMVA 2Z5LA 3WISA 2COEA 2BI8A 4KXYA 1KEEB 1UJBA 3YASA 3LY5A 4ZGBA 2FFJA 2CKDA 4L28A 1CPYA 4NMLA 3WYFA 1Z73A 1L4GA 1CRLA 4Q1DA 3EXG2 3ZHXA 2GYYA 2WJVA 2IIVA 2ZP1A 3MAGA 1WZCA 5IXJA 1EQUA 2VZLA 4Z7NB 1QV9A 5HUQA 2YN4A 4MKHA 1OLXB 2QJRA 4IPTA 4KTVE 3D31A 3L6RA 1Q84A 2PX6A 3K6KA 2XQIA 3DKKA 5B3KA 5ADVA 4OJTA 1NTOA 2IHBA 3PQ5A 3AH8A 4K86A 3LV8A 1T5TA 5ECDA 4BP9A 4DPLA 1G98A 4YUZA 2RAVA 3E5NA 4MW6A 1XEXB 2ALJA 2WJIA 3LZDA 2CNDA 3LE8A 3BXXA 2VPXA 3EC1A 1BQ4A 1LSJA 4WAUA 3TLCA 4KYVA 1M6NA 5DWQA 2WJPA 4IYJA 1JAIA 1WUHS 4BB6A 4JVOA 4UASA 2ZJ3A 3KQNA 3B6MA 5FNVA 4EQ6B 4X8OA 2A84A 5SZHB 1I32A 4A8TA 2CD9A 3F6BX 2CE7A 1V11B 3RVBA 3R40A 3IAM6 4JA2A 4C3OB 3NJRA 4RA6B 2JFOA 4DZZA 1YZFA 1MDFA 1I7NA 3UMJA 4JI6B 2ZRGA 3DXXA 2OVFA 4FM9A 3GVPA 3FBGA 2CF5A 4AJ1A 4CLEA 1YJ8A 4DCVA 1ZKMA 1V2GA 2OV3A 2JC3A 1WVGA 4ZWNA 1KEVA 4TVBA 2EKBA 2OZEA 1H6AA 2P1DA 3RSHA 5JMPA 5AVZA 1XD8A 2ZKLA 4S1VA 1NMYA 2HHLA 1DKQA 4OYLA 1ONOA 4PSKA 4ZQEA 2CZCA 4LZAA 5K0EA 1OVGA 4OVKA 3QOWA 5AIAA 4BB5A 2PD6A 4QUKA 3BE6A 1COWD 1ZRMA 3RK1A 3PGA1 4LVOA 5FJIA 4AYWA 3BIXA 1O0CA 3FSRA 3A6EA 1TNDA 9GPBA 4E5DA 4DJTA 1UEJA 5KKCA 3N6XA 3OIWA 4ECAA 1K98A 2GPTA 2GSDA 1E1RD 4S12A 1Z6YA 1RZ3A 1SOAA 1NBME 3EXHC 3BM5A 1OBVA 2PGLA 1CIVA 1HUQA 1JQ3A 1PDOA 3OE1A 4TSRA 5J59A 5A7FA 1XMQB 1WR8A 4HDQB 5K05A 1D5WA 2EIXA 4RZSA 4PX5A 1U0SY 2XY4A 1J0DA 1V6AA 2X5JO 1GZSA 4JBGA 1SHTX 3KPJA 2SBTA 1EJBA 1RMQA 2BR5A 3D6HA 4OYHA 2X7HA 3A7EA 2OBBA 4OLJA 3QVUA 2OBYA 1WX1A 4Y7DA 3WSVA 4ZT6A 3PFIA 1WKVA 1SCKA 1HETA 1CJBA 1C9KA 1RXYA 2R7KA 1PD0A 3JQCA 4JVSB 1ODLA 2GZRA 1KY3A 4MRMB 4HNAB 2JIBA 4PBRA 1VPVA 4EAAA 1UMBA 4GSKA 4HEA1 4IRXA 4UZEA 4B3BA 3N7TA 1NJ5A 3T4UA 2EU8A 4R81A 3UXYA 1YQDA 1JAZA 1PJCA 3RYFA 2B7LA 4EDFA 4B8YA 3G9ZA 2IYPA 3U3DA 4C5AA 1RWVA 3GIDA 1CS4C 1YBAA 2C2HA 2AC2A 3FFWA 2YZKA 3FUVA 2RJ3A 3ZW7A 4GGMX 5AW7A 5DHUA 4BO0A 5HF8A 2VFAA 2YRWA 2YNMD 1GZ6A 2XUQA 5F2OA 4Q93A 4KAXA 1QP4A 4OMDA 5JDIC 5EJ9A 4QTTB 3SD7A 1KFJB 3ESCA 1C9JA 3BZWA 3ED1A 4H7FA 2UYOA 4HAVA 4M7PA 3WB9A 1K2VN 2ECOA 2IW1A 3ILYA 4JBWA 3O2JA 1GQSA 2I6XA 4ER3A 5JJKA 1XROA 2J3IA 4XB6B 3H17A 1KMIY 1K3UB 3F6SA 1L4EA 1KR5A 1NI4A 3A9CA 3B12A 3FD8A 4PZYA 2FAXA 3SX4A 4BLQA 3PD1A 1IUPA 1TPZA 3WKEA 1Y4ZA 1RFLA 1HRKA 4DBLC 4YR7A 3E15A 1AA6A 1SHLA 3EQ9A 4WGFA 2ODPA 2H2AA 1E79D 4MVXA 2V1XA 3RUPA 3AEUA 3ONVA 1SUPA 1TM5E 4OQ4A 3TOCA 2ZUWA 3E18A 3D59A 1Z4MA 3OPYB 1P9OA 4P93A 4D4IA 3GDHA 1K5HA 3ZQKA 4UTNA 1LBTA 1DIBA 4O1MA 2GEDA 3PI6A 3NHKA 2YN0A 4O25A 3ZU4A 4YMGA 4Z4QA 3GK3A 2O8EB 4B4UA 1VC2A 2KJQA 5FTJA 3BKXA 5THXA 4WOJA 1M6HA 2Q0HA 1Q15A 1F1BA 2IEIA 3DE0X 1FTSA 1VM6A 1G8JA 3PHBE 4FGZA 4FS8A 4GYYA 1JJFA 2AS0A 4RY0A 2ZIXA 2HWUA 2Z9CA 5TJ9A 4ZJYA 2UXCB 3KG2A 1WXQA 5ULLA 1V3VA 3QFFA 4BKPA 2YWDA 1PIWA 3BWMA 1J9GA 1UK9A 1VA5A 2EW8A 2F43B 1NXXA 1UBFA 2V6BA 2VDRB 3CRRA 5K3CA 5CA1B 2F43A 4Q6BA 3AGQA 4DV6B 1A8PA 5L3RA 1YVPA 4AUNA 1YKFA 1LEHA 1M67A 1XD2B 2AZ4A 2NU9A 3KELA 3PG5A 1F5NA 4PZLA 1RABA 1PFQA 2JFZA 3DOUA 3OEYA 2IDZA 3P2IA 2KBEA 4B4KA 4B6JA 5MFPA 3QQ5A 2ZB8A 5AVQA 1U81A 2ZXFA 3FPSA 1ZRSA 3GLHA 5CDYA 2A7QA 2F1JA 3TTTA 2HAEA 3IV9A 4BGIA 4ZC8A 1UMCA 3NRBA 4WL0A 5JRJA 4B82A 4W6ZA 3DZKA 4KBFA 5CFOA 1DJMA 4WOBA 3RSCA 1EXMA 3C4QA 5LUBA 2P0AA 1IBCA 3VYWA 5I7OA 3ORQA 3S6JA 4EK9A 1VFNA 2JIQA 1T24A 4NICA 1DC5A 2P0EA 4ZT7A 4QUIA 2JRLA 5DXAA 3GP8A 5LQJA 3L7KA 3OX3A 4LEIA 1SHJA 4Q34A 3VZSA 1MJHA 1QLJA 3PSAA 2EF0A 3PPXA 4IUCS 4AK9A 5IHXA 3B9RA 5GJVC 3FLEA 4MKGA 4QXOA 3GPIA 3L7YA 4JEUA 5EUCA 2DEUA 1MA3A 3ANSA 2B4KA 2X6RA 3H2BA 1JFFA 3I9MA 4XM1A 5LYYA 3TW8B 3PL1A 2P9ZA 4ZCIA 5GP1A 4MQEA 1EHCA 3H0CA 3W90A 3WTBA 2H2WA 4R2XA 2X5KO 4BRZA 3LCJA 2EARA 4DA8A 2G83A 5JZOA 4DJJA 4N5IX 3OU7A 2QPTA 2ZSHA 3AJ8A 3NKFA 3BOSA 4I3HA 4OHOA 2QTHA 3V7FA 3PYMA 1UKVY 3OD5A 3RHFA 5JDCA 4IFTA 2CK3D 4P0QB 1VSUA 1GRCA 1T2DA 3E27A 3D5TA 5JMOA 1EE2A 1XTIA 4IMIB 4BE4A 4DV0B 4ZI7A 1T3GA 2AMLA 3TUZC 4S24A 3RT1A 1U2SA 2J6BA 3Q5DA 1FW6A 1NI3A 2Q5HA 2CNBA 4HH3C 4JQCA 5H59A 3TZBA 4JXKA 4BJ3A 3ECCA 1ZJWA 1P4HA 4KC0A 1J1IA 5I3ZA 3OJ0A 1E92A 4EPTA 1OBOA 5FNVF 4PCAA 3RKSA 3OJOA 4OOFA 4DVJA 1KIAA 3HYTA 3W8DA 2G82A 4DLLA 4FQ8A 1VJCA 4WN9A 3DBHA 1DNPA 1TA9A 3ECSA 2X0FA 2HLNA 4DHWA 2GBGA 1E1CB 1WRBA 3ZHYA 5ALJA 3CH7A 1ISRA 1PR5A 5D51S 5JD4A 4K9MA 4LXUA 4M7RA 4MIYA 5GMOA 5I3CA 3IP9A 1NX6A 2ONKA 2Q0SA 3RB8A 1EVYA 2FR0A 2J4DA 4Z4CA 4NLLA 4K6HA 5IDWA 1F51E 1QF9A 1QMPA 1XU4A 2C88A 2EWWA 3ZIDA 1U6KA 1UQUA 4GLFA 3UANA 3DLAA 3ZZ1A 5EJ5A 3MUOA 3RSOA 4RLHA 2CYAA 2VDNB 4M0UA 3D4NA 4UU7A 3HGMA 1G8HA 3PUYA 3WAGA 3E4CA 3EUFA 3UW1A 3R7NA 3P9KA 4LYJA 2C9MA 3DB2A 3NHFA 2BMDA 5EGSA 4LWZA 1I5EA 1CUBA 1XDDA 3NQ41 4G4SO 1TQHA 3WLJA 2Q6IA 3E2MA 3VU9B 3LZ6A 2NW6A 3HKCA 4OHKA 1JFLA 3KD2A 1RZRA 4C6TB 2YZ2A 2PZ8A 3EVZA 2FG6C 1E2BA 4NU0A 4TPKA 1U0OC 2P4QA 3DR3A 3AEZA 3E8MA 4A1FA 4ESHA 3I1FA 1N6LA 1P1KA 2UZIR 4ARUA 1I7QB 1RQ7A 5DP2A 1Q0RA 4I1PA 2JGDB 1IEWA 1ZC3A 1ZMTA 4K1LA 3ND6A 4HNTA 2BLLA 4HDAA 5AW1A 1NG9A 1BYIA 2XT9A 1R5BA 2APJA 1FSZA 2KWIA 5K3EA 3RTCA 3E23A 1LJUA 4AF7A 1ULTA 2Z5FA 4NZNA 4OQEA 5DHFA 3RJTA 3UJ7A 4RK4A 1V45E 4H3KB 1XQWA 1Q7RA 1O6CA 3U1TA 4PNHA 5F4ZA 4HD8A 2QL6A 1CR1A 1JSCA 1NW8A 3UJ8A 2DU8A 4IDGA 2IP2A 1GZUA 1N0WA 2QP3A 5DSZA 5FWYB 1X80A 4O1HA 1LH0A 3FE2A 4MWSA 1VECA 1ZA2A 1XP8A 2ZZNA 4ITRC 1JR3E 3ZWKA 1HDRA 1KAMA 1T2NA 5DHTA 3W9UA 1B43A 1COWA 5IAJA 3TLBA 3CX7A 1K8XB 3D3QA 5BYKA 3C7DB 2IVZA 4DEXA 3ENVA 4LJ8A 2XVAA 3G6KA 4RFLA 3S2SA 3UMGA 4F9EA 2OV4A 4JR1A 3PSHA 3OIFA 1N1DA 2H7YA 4HDRB 3BEOA 1SNYA 5KKAA 3AUUA 1BOFA 3R3VA 1OLUA 1XZIA 2D4AA 4PG6A 3NIBA 3S1AA 3WHLA 2EHDA 4EG8A 4MAAA 1IBKB 3M5CA 4GSLA 3WOVA 1E63A 2GT1A 1DO8A 1HDCA 4NH4A 4Y0NA 3RAFC 3MUFA 1Q16A 4AY4A 3EXIB 4LXXA 1NVBA 2XUJA 2JEZA 4P3OA 3DD1A 4KZPA 2FR8C 1WW3A 4F04A 2CUZA 1HFEL 1Q0QA 2JL1A 3GX1A 3IT2A 4HSEA 2PKQP 5COQA 2M6LA 3HO1A 4OXRA 2BEUA 2Q6LA 3CX4A 1E4EA 3R41A 1YB2A 3TCXB 2XUZA 3O90A 2OP1A 1M2JA 3OT5A 5FUWA 1A9XA 2DHDA 2VTEA 3HYSA 3TQHA 4HGOA 1MU0A 1B8PA 1UBLS 2GESA 2VDVE 1NQ5A 2VDWA 1J56A 2V7QD 3OZXA 5KS2A 4LSMA 2QPAA 1N7HA 2FOXA 4FW9A 3EVFA 3GBSA 3UFXA 1D2GA 3HB1A 2O07A 3M3HA 4IKPA 4CMEC 3QX7A 4EAQA 1N3LA 1RKVA 3P4YA 4Q39A 5B37A 4H4CA 3I9V1 5CK4A 4EPXA 1NPDA 2OCKA 1TCVA 2AF4C 4FHGA 1OB2A 1Q1ZA 2DBQA 4DKXA 5FPPA 2I54A 3BWEA 1SU7A 3D6NB 4FE4A 4JNCA 5LU9A 3A6KA 4J3FA 4BQPA 3EPKA 3F6YA 2JLZA 1CUWA 4CVNA 1C30A 1NZFA 2D1YA 4L3OA 5CEJA 4G65A 4PLGA 4KDCA 3H2IA 3GGPA 1CLUA 1TZBA 2P9BA 4C1BA 1QAQA 1XDUA 3PVZA 4WPGA 1TKBA 2JFFA 5EE3A 4CQLB 1KTIA 4RMHA 2YV4A 1W2HA 1GPBA 5IUJC 4CU5A 1HZJA 3PWSA 1L7OA 4OXQA 2R6JA 3CJRA 4DA7A 5AKZA 1T9GS 2YHBA 1VG1A 2ZRKA 1DV1A 1LW6E 3HCOA 3HBJA 1HI9A 3GELA 4IY1A 1FMFA 2W2OA 1W59A 3O2QB 5HQ3B 2JARA 1FE8A 2WSLA 1RHUA 4H59A 2NTJA 1YR2A 1TVKA 4R1SA 1X7XB 2AFIE 3EWAA 2I5PO 2Z43A 5HG0A 3M1YA 1J2UA 1VL6A 3TEJA 4R3NA 3STHA 5KQRA 3I09A 3U6KA 2AE1A 3G7SA 2WDPA 3FVTA 3I5UA 2RI1A 4AUMA 5HHTA 3VAAA 5J58A 3F5SA 2AOWA 5K0JA 2XITA 5JYBA 4NOLA 5FTLA 4C0SA 3EZ2A 1C9EA 2H8KA 4TLCA 1EUCB 5A06A 4BEBA 4B73A 2QUIA 3VKWA 5B30A 2ATCA 1E96A 1NDQA 3IPCA 1XPOA 3JQ8A 5CRIA 4FMDB 5BY2A 3A9UA 2WUVA 5J47A 4RPKA 2R2AA 1GV1A 1T2FA 3BN3A 4M4SA 1AKTA 1XZEA 4JVLA 3RIHA 1QS0A 2DUMA 1RP7A 1NVMB 2PZEA 2OYRA 1IZZA 2QXTA 3NT4A 7MDHA 2OKGA 4P36A 1ZUD1 2XWQA 5HIJA 3W5SA 5JYCA 2HTFA 2P6UA 3ERCA 1ZM9A 3CZCA 1RIIA 2P41A 2D5CA 3BTVA 2Z0MA 3V8BA 4Z0HO 4OXIA 1W1IA 2YINC 3IMKA 4IH1A 5KDLA 4UDOA 3D7RA 1CWUA 3J81A 1Q92A 2PT6A 2VCEA 2H1FA 3UK0A 4EGQA 2PBZA 1Z34A 4DEYA 2XT6A 4LN1A 5JNSA 3QEMB 4R3WA 4W5TA 4F71A 5DBOA 2WTUA 2NV0A 3DZ8A 3N3BC 5FWXA 4I55F 3FHTA 3IELA 3U3ZA 1BJTA 2D0OB 4BTLA 4K9PA 2O2HA 1PL6A 2DKNA 2ZUUA 3S5JA 2C84A 4B47A 5BXQC 5AVKA 2XGJA 1NJ6A 1BFDA 3WJ7A 4Q47A 4C2UA 3PWZA 2Z8ZA 4CR7A 3GGSA 1A7AA 3RADC 1MDBA 3HJRA 1EK1A 5ER6A 3MXOA 3I3OA 4IF4A 3TLEA 3FDZB 4PYMA 1XL0A 4XD2A 4ZO4A 5DNYB 1GGMA 1L7PA 1FBTA 1NOKA 3UK6A 1F38A 4WY8A 3K4QA 3KBBA 2PU7A 3RVQA 3S44A 3DWFA 4U2GA 1Q77A 3DVAA 2ZIVB 5HVNA 3CF6R 4DQVA 5CGQB 1ANKA 1YZGA 3GR6A 2H1SA 1E8DA 3BVPA 4OFWA 3UVEA 1A7JA 4UBMA 2OGTA 5E7IA 3U7JA 3C6XA 4LDQA 2D1FA 2W6JD 1FRFS 2YWGA 1J8QA 3VDXA 1KOLA 2PL9A 3WQRA 1IB6A 1IQ0A 2FXVA 4HG2A 2BFEA 4JLOA 4AMZA 1CZUA 2XZLA 1BHO1 1RYMA 4RGBA 5F1KA 3KVNA 4X8HA 3TLKA 3EUWA 3TECE 2HRDA 1XZNA 2V7XA 4M53A 4KXQA 1QC5A 1QIIA 1QVVA 2GUGA 1ONBA 5CLIA 3CVUA 1XPJA 2ZSUA 3DEKA 1G41A 1NXSA 1U02A 1IQUA 2CLCX 2C04A 2ES4A 1SXJD 2HRBA 2J0UB 2V8OA 3BJMA 4DJFC 4F9GA 2G80A 2X0NA 1A5ZA 4IV0A 4BLTA 4MK4A 4ZI3A 4KQ2A 1ZNWA 3VNSA 2VYND 3T54A 4EJMA 1T8PA 3L79A 3OP1A 1VG0B 4U4AA 3HY6A 4TT3D 2DQYA 3EVTA 5ALHA 2PWPA 3JWJA 1EMDA 1T0JB 3EFHA 4LX8A 4BP8A 2IXDA 3LUAA 4BO9A 2XEXA 1NNEA 2CL7X 3U13A 2VSOA 1KIFA 3RUHA 3W3ZB 3VJLA 4V24A 4HF7A 3HNPA 1TKRA 4FFRA 4QM7A 1OPRA 3NUGA 1GTZA 1CY2A 3LU1A 4BC1A 3BWVA 4MQUA 5C3MA 1OOEA 1VYVA 4MX8A 3FFAA 4GI1A 3TIGA 3ENNA 1DUIA 2OC4A 1E9DA 3OZIA 1LXCA 5A62A 2X2FA 3JD4A 3OOWA 3ZGOA 5FL7A 3ZE7A 2ZAGA 3IO5A 3PC8A 5C1OA 4RKWA 3EK2A 1G5TA 1ZSYA 1ZJZA 2LCFA 4NNJA 3REQB 2UUAB 2ACWA 3UENA 5EN4A 6PFKA 1VCIA 1XQ1A 2QUHA 4YCBA 2A0FA 1ICEA 2E3JA 3IB6A 1HORA 1P1CA 2J33A 3MSXA 4U3JB 1UDBA 5ERYA 4FYXA 2QQGA 4BVGA 3PX3A 1TJ4A 4MPDA 3FZQA 2P6RA 4Q66C 4A2QA 1GR1A 1TFRA 2Q1YA 1Z06A 4GEKA 2C0CA 3DW3X 1Z0DA 2A9PA 4HK4A 4BNXA 2GCIA 4Y6SA 1GTL1 5JPIA 1M0EA 3U4MA 2H5EA 4GS5A 3CURA 5AVUA 2V7QA 1E66A 3FOWA 3CZMA 5AJTA 2GN9A 3WYGA 4D7AA 2XCOA 4YCLA 1F17A 1DXYA 1BGWA 1K0FA 3LK6A 5EHQA 5PGMA 5CBKA 5DYIA 4NYJR 1YFKA 3SU8A 1DKMA 5EXEA 1KP3A 2SKEA 2X0IA 3WWDA 5BVGB 4DBZA 1OWLA 1GAEO 4H0CA 4DCOA 4PG4A 2CLSA 3TS1A 2DUUA 1J0BA 1W9MA 2QX6A 3OOYA 4MQLA 4L78A 5CHEA 4L74A 3A37A 2P27A 3LFHA 3RE1A 3JU3A 3HJUA 1UT8A 3NHUA 3ZW9A 2H0AA 3PP8A 4D0GA 4D3YA 3H1GA 3GLIA 1KJYA 2VHEA 4Z1MD 5AOCA 3CSDA 1ORVA 3VM6A 3VVLA 3NI2A 5JS6A 1YBMA 3U9LA 1UIMA 3BREA 3EOAI 1G3IA 3L2OB 3W7BA 3SYLA 4CUJA 1EE1A 5BNWA 3CUSA 3AVVA 3E81A 5CFPA 3W5BA 3IQHX 2X4LA 4G24A 1EXDA 4LF5B 3A1SA 3VHXA 5CLGA 4QODA 3O4FA 4R2JA 1DHRA 2ILTA 3K8OE 4OQDA 1SA0A 2HJGA 4ALMA 4EG4A 1W25A 1EFAA 4MVJP 1W4LA 4UJ3A 3QKIA 2IU0A 2M6RA 3PNVA 4PAGA 5IYZF 4QNMA 1AZTA 1E1NA 2L69A 1E2LA 4RIEA 1Q20A 1FTYA 4GPIB 4W1SA 1FX1A 1FVFA 2WKRA 1GG5A 1DOHA 3O26A 2P6MA 4AO8A 1YQUA 4BX3A 1J09A 1EBFA 3G8YA 2VTDA 4DR5B 1THMA 3CE6A 4R51A 1BW9B 4F2GA 5J4LA 3OTWA 4DV5B 1ZNZA 1TCUA 2L19A 2WSMA 1QYIA 1X8KA 2XMSA 2X9VA 3O2SB 3PXEA 5C34B 3EIHA 4JP2A 4XFJA 4FSXA 1H0SA 5D85A 3WFZA 5TIIA 5MDHA 1BE8A 3QH4A 2AN5A 4AG5A 3K92A 4EB6B 1SG6A 1BFKA 2IUSA 3I92A 4X6YA 4LDJA 3P2MA 2QMUA 3RWMB 3VSCA 1CZKA 2IPXA 3RTAA 1OUMA 1B14A 4KAAA 4U0KA 4MA4A 4X7RA 2EZ8A 5LDHA 4A2PA 4MLDA 1T36A 4P2BA 2X13A 4C0HA 4ZVLA 3GT7A 1Y7PA 1GGNA 1U3GA 2WOJA 3B3AA 3PHGA 4XQ9A 4B8WA 1Z7GA 3R5FA 1LPBB 1EZ1A 2ZIEA 4QDZA 3VKUA 3OTIA 5IZ4A 4RE6A 3VPSA 1I4WA 2J5RA 4EPRA 3QTTA 5K3SA 4EHLA 1K6MA 2QTRA 3R5TA 4C03A 2XGOA 2HCJB 2AJ8A 1E3SA 3IUNA 3LLVA 1JH8A 1Q2XA 3WHPA 1G9TA 3ZE8A 4H6XA 2C5SA 2H2DA 3IVGA 2C83A 1U80A 3AM3A 2IV3A 3ON5A 4TV9B 2J3KA 1GARA 2CZGA 3P7MA 1QLWA 4MPTA 2Y66A 5AVRA 3T34A 2C5BA 2EGGA 1RJ9A 3NVDA 3UT5B 3MAAC 5K3AA 2O5EA 1T8RA 4JJAA 3VBCA 4I8DA 1B6GA 1I80A 2HMTA 4PHGA 2WIKA 3DDZX 1MABB 2JLYA 3C7CB 2MU1A 1OXVA 1PZFA 3ANXA 3Q8XB 1V3UA 3MJ4A 4DV4B 1NJ1A 1N2SA 1Z88A 4G0ZA 1SQ6A 4YN3A 5DM70 1KYQA 3JQBA 4YMUA 2RHDA 4RYLA 1FFCA 2O0JA 3T7DA 4GR9A 1YB4A 3ILSA 2FKNA 3ADKA 1EZZA 4U9UA 5FDFA 1MQ9A 5EJ7A 4KRYA 3ZLJA 4K6OA 3UA3A 4EG7A 4PPYA 4WFQA 4JXXA 4HPXB 1M6WA 2ZSKA 1XFDA 2EP8A 3S2YA 2FP3A 4E1BA 3WC4A 4YYEA 4MARA 1O87A 3OTHA 4LTDA 3RIYA 3FRHA 5TLSA 1BE6A 3G1WA 3VJMA 5ALQA 4WXMA 1NQAO 4M9UA 4XE5A 5JVDB 3TRJA 4LUCA 3FUUA 2O8NA 2NXWA 2I29A 2NV6A 1L4MA 3CNOA 4OLFA 1VG8A 5B53A 3COJA 4XQEA 5ITZB 2FLWA 4ZANA 3GXBA 4C0KA 1DAMA 3JZIA 2J8ZA 2O48X 3UAWA 4C6TA 1D6JA 1L5ZA 3LP5A 1BU8A 2GD6A 1WPGA 2NO0A 4L02A 3KQWA 4II2A 2WYVA 4OQZA 3JYLA 4EKDA 3F71A 5DYWA 1U1IA 2PJRA 2BL4A 4X3OA 1RM0A 2YVAA 1GFZA 3AFMA 1TUEA 1JU9A 1QO0A 3EZNA 1G20E 1HTTA 1N5KA 2RGYA 3H75A 1CUHA 4B43A 2VIIA 3T4EA 1JKJB 2PJZA 2ZITA 4ZMSA 1IN6A 4G8JA 1OAOA 1DEKA 4Q05A 4XIIA 1AN9A 3FYDA 3RFVA 3SSOA 4JBHA 4RWZA 5FEUA 2R62A 3JYOA 5CLJA 1BTOA 3BFJA 3PQEA 4NMXB 1QF7A 3ROQA 2GAAA 2I22A 3M5DA 3QVVA 2FUNB 1ILWA 4KOAA 2Q5QA 4Q3NA 1WHSB 4D1YA 4NZYA 3F78A 3F5MA 5G53C 3KQSA 3I1JA 5REQB 2F3SA 4ISCA 1JXQA 5K03A 4N6GA 3LLMA 1LBEA 1PV1A 4C0QC 4D98A 1W4CA 2AX4A 3DNMA 2FEKA 5FA5A 1AXRA 3DV9A 5C53B 1VMDA 1Z2CA 2DE0X 2GXAA 5TQ2A 1LSSA 2FRDC 3SQLA 1PEDA 3KP1A 5BSVA 1DC4A 1E94E 3RRYA 1IQPA 3HCCA 2GCGA 3MLBA 1SQSA 2ZUDA 4BUZA 1R0LA 2WJ4A 3S2GA 2CFOA 2KI5A 3ETJA 3MXTA 3RS9A 4G09A 1T4GA 4JOCA 4QBKA 1E2KA 2W7TA 3IPXA 1V8ZA 3GZNB 4RD6A 4M8KA 3VTAA 4ETMA 1YC5A 3H9GA 4XR4A 4BS9A 3SSNA 2IXTA 4B09A 1S02A 1PWXA 2V6FA 3GUHA 1KR2A 5KTYA 1ULZA 2DH6A 5JC8A 2CXUA 1KHHA 1X1TA 1KBQA 3AU9A 5AM0A 4ENWA 5CB8A 5LA6F 3NGMA 1V48A 5FYDA 3RBZA 2RGNA 3OZRA 2Q2NA 4M36A 4PLPA 3ROXA 1EGQA 2PFSA 1DUSA 1I3LA 1MBZA 1FFXA 1NOJA 3N8DA 4FYKA 1N2IA 3T3IA 2ATIA 1HWYA 5CVCA 1E64A 1DAKA 3B3GA 4J4TA 4KU4A 4IVPA 1Z0UA 2PR2A 5K3FB 2WYOA 4UHCA 3DMYA 1Z15A 1Z4IA 4XIFA 4CF3A 2QVGA 1FS4A 2DYKA 1X3LA 2PZAA 1UC9A 1QQ6A 2OBMA 1KJWA 4IHAA 2I34A 4J6FA 5FNZA 4C0BA 3CH6A 4FLFA 2W6CX 3IDQA 1MAVA 1YR3A 4A7PA 4FMCF 4P9NA 1EUDB 3OHMA 1SOWA 4UTPA 1G18A 1U9IA 2PTHA 3FUTA 2XNSA 3K09C 1MGOA 1KPGA 4CQMB 4EWLA 5DB4A 1ST3A 3BC1A 3M5PA 5DDIP 1M0SA 1P9WA 5CDSA 2IZ7A 2W4QA 5FAKA 1DG1G 1XLTA 3GDWA 2PUHA 3OE7D 3ELYA 1QX4A 1R7RA 4RSMA 1SU4A 2EG9A 1NXOA 1GFWA 1ZSVA 3JVVA 3BSSA 3EE6A 4JN6B 5FBHA 3T8YA 4IH9A 5DNDA 1M1YA 1Y63A 1XYYA 3C7AA 4Q9KA 4N18A 3O4IA 1JQEA 2BKAA 3L8GA 1YZVA 4R5HA 1DP4A 1LI7A 2IEGA 5BO5A 3LKZA 2NP6A 1E9VA 3SZGA 2Y67A 1OI7A 1BD3A 1SIOA 2VR1A 3ABZA 4NOKA 2O52A 2GK4A 3KEFA 3IBCA 4NXMB 3HZOA 3GNSA 3EGIA 2V4UA 4PC2A 1I0LA 2ICAA 4DWVA 1UBEA 2EVWX 3E2IA 3PCRB 2P1ZA 5F52A 1S2OA 1MTZA 1PGJA 2G5PA 3RVNA 3GGJA 1K75A 3C8HA 3T9DA 4YRCA 5K0FA 1OAAA 2BIFA 1H8EA 3QSGA 5AVOA 1U2PA 3BAZA 5GTDA 1AMOA 3ICOA 3PWTA 4HAXA 3I6BA 3Q87B 1TD9A 2X3UA 3I5AA 2AD5A 4FT4A 2WZBA 3R7SA 1DTWB 1GTJ1 2REQA 4B74A 4QBFA 4FPXA 1UZNA 2OB2A 1CYEA 2OV1A 4XARA 1DXQA 3A10A 5I9BA 1S2MA 1I33A 3I62A 2QTFA 5EE5B 3K0AA 5IVDA 4X95A 2X5OA 3GLKA 3GJSA 2GN6A 1RKUA 2VAWA 3K0FA 3W06A 1R6VA 2I8LA 521PA 2GVDC 2BZ0A 3IUPA 4PIPA 3WY9A 1CY0A 2Z95A 2XV1A 3KPVA 3R6TA 2GHIA 4PS0A 2OQVA 3C24A 2H9YA 3W0LB 1UAYA 4U6SA 3FDXA 1PJZA 1E2GA 2XRYA 4KMRA 1M75A 2IYTA 1NW7A 2XZTA 4Q4AA 3RU7A 2H1CA 1SC3A 1CUUA 5DJ5A 1M33A 2MINB 3S2UA 4IGEA 1VB3A 2QTNA 1WPQA 3L8YA 3UB2A 3MM4A 1NV8A 5LXTF 2ZTMA 4J2HA 4DC1A 4EFDA 1H2AS 5FHQA 3K1JA 4PC1A 4NG4A 1ZJ4A 2C42A 2QDKA 3CTMA 4OMFG 4GMHA 5LZ5A 4BO7A 2V5AA 4DA0A 1NP3A 3UN1A 2CXTA 4DCCA 3VZRA 4QJ3A 3JTMA 5BV0A 4J94A 3LPDA 4FDAA 1AKMA 4Q9HA 4MKFA 3E9RA 4TWBA 1C1HA 3THYB 3GCZA 1ZD8A 3G68A 2G70A 4UU0A 4FBGA 3D6VA 1Y5IA 1JT9A 2QROA 2KMLA 4GOXA 4E51A 4JUAA 3T7SA 1WW2A 2HLDD 2QZSA 3D54D 3HADA 4N01A 3NTVA 5KJEA 2ZBRA 1WDKA 1FY2A 5B12A 1JAYA 1PYGA 1ZC4A 3ASVA 1GTMA 2AC4A 3LRPA 4NYMR 3MC1A 3CRW1 1RRFA 2J4CA 4KVFA 1T5LA 1ZKDA 3MEQA 4IHJA 3ZNNA 2O8BB 1FDRA 1VYHA 3Q6IA 1XZHA 2OO3A 3EHEA 3LFUA 4TS4A 2O0HA 5BOSB 4DM4A 1L5HA 2GNOA 3BFKA 3LMKA 1PS0A 1L5HB 5GVRA 5HUJA 3VMMA 4ZDJA 3LW8A 5E6SB 2WDZA 2YYYA 4F96A 5HZHA 1P33A 1UFQA 2P2LA 2PWBA 1AJEA 1DDIA 5GWXA 3BH7A 2IX9A 4DUYB 5KNBH 3K9FC 3ENQA 1OB5A 4EW6A 4MKZA 3GLSA 2ZBPA 3NOOA 1J97A 3M3PA 4Q15A 4UVHA 3K0HA 1KS9A 4Y0AA 5C8VA 1Q12A 2HZ7A 3PJFA 1T4CB 4KSBA 3FOEC 4AIRA 3GYBA 1ZVKA 1D07A 3IRVA 3KDSE 2I62A 2MWMA 4PIMA 2W2QA 3ONFA 4RVGA 3DGEC 3BJZA 2SECE 2BBSA 2QP4A 3DBHB 3U3OA 3ENKA 5EZQA 4HH1A 2BKVA 1ZUWA 1DC3A 2AWNA 3ETDA 3LAWA 1YFZA 1WZ2A 3I1IA 3AEKB 3F1KA 1F2VA 2O2EA 3JY6A 2E1RA 5ALIA 4CQMA 1N2OA 4MR9B 4ZVMA 3T5GA 3CMMA 4BASA 4BNUA 2YWHA 1BXRB 1YRAA 3E7XA 3PX7A 2QM3A 1G5FA 1XJ0A 3SLRA 1H0KA 2P75A 2HQ1A 3A4NA 2C7BA 3WLOA 2AC7A 2ONZA 3E3NA 5CIQA 5CURA 3JPWA 1E4YA 1M34A 3EGXB 4U7PB 4QDOA 4ZOEA 4EEXA 4OU5A 2XUIA 3JRNA 2GASA 3F8TA 4D96A 1HDXA 3AOEA 5G02A 2CXNA 1P9RA 1Q0LA 2PYDA 3NH9A 2OO5C 4WECA 2BUAA 4HWRA 4I55A 2NUTA 3V4ZA 3AVUA 3N8NA 4N0EA 1P6XA 4Z4GA 2QR2A 1MJNA 2PUBA 1QGUA 2DPLA 2ZUVA 3II6X 1ZL0A 3A3PA 1ZO8A 1IVNA 4C89A 3HDHA 2AFHB 3NVKI 4DY6A 1B0UA 2E1PA 4LJAA 7ABPA 1DJPA 2FG7C 4K2HA 3TL6A 2AOTA 3ZN2A 5HYVA 1OFUA 1GA1A 1QXSA 3M70A 3EA5A 1PR6A 2H00A 3BGVA 1OXBB 3BKWA 2JD2A 3F7NA 1JAXA 1PQYA 4TVOA 2AL7A 5IP5A 4ZVQA 2YCLA 3VI4B 4P82A 2GLXA 5EIWA 5I01A 1QIHA 1UKYA 2ZUBA 4GQBA 4MYTA 4PGFA 4RDXA 2XCTB 3RHSA 4D0LB 4KAFA 5JJLA 2AYYA 3VPBA 4CCYB 3DEIA 4JLVA 1KFCB 2YJ4A 1PR0A 4FXOA 3RWBA 5BN3B 1G5IA 1VG9B 1NP7A 3B36A 4JI5B 1Z6TA 3FHJA 4KVZA 3G49A 2BFFA 2QL7A 3BF8A 3WGMA 1XPUA 1JR4A 5A5FA 4G5HA 1Z29A 1ZNXA 2H18A 2AUMA 3LYUA 1TQ2A 3ASUA 1TGYA 3EPPA 3W4IA 4IWNA 4PSCA 4GL2A 1QONA 2IEDA 2ZUSA 4YIKA 1CNMA 3QU7A 3SJZA 5K8VA 1AKNA 5KMGB 4YJDA 4K3VA 5C5DA 1J2TA 1I36A 1MG0A 2JJQA 1YS6A 3X1XA 1JFTA 1CC1S 1LI5A 4OY3A 3FPBA 3J7AC 2NVBA 2WU4A 3KYCA 1RBZA 4A73A 3A2NA 1FTGA 1Y81A 3I0NA 5FV7A 3BDAA 4N54A 2WFLA 2RG7A 3N8KA 5CYPA 4DNXA 2GN0A 3MCTA 1DCMA 4LMPA 2AKAB 2Q41A 4HBZA 1YIDA 3JQEA 5D6NA 4FDVA 4IXMA 5EJFA 3W2GA 3T94A 2SCUA 1KZ9A 4PC6A 2GA9A 3LQ2A 2H59A 1JRLA 3MGAA 5CG2A 2RE8A 4AY2A 1AM4D 1B73A 2EYUA 3GLVA 3C3KA 4LS3A 5JALA 1GPDG 1W7AA 4HLUC 1KMCA 2QZJA 3CF4G 3HFRA 5H8WA 4MMYB 5GGYA 2FLVA 1NC1A 3OWHA 5E4JA 5F9MA 4DW8A 5JSZB 1DQNA 2XUHA 2E9SA 2R8RA 2ZIFA 1RHJA 3DLCA 1J49A 1ZWLA 4X6XA 4BBJA 2VNSA 3SNHA 3LKVA 2PSEA 4BO4A 4A3SA 1TCCA 1X1CA 2JGJA 3KOZA 5EESA 4JUCA 5L3ZA 4CGZA 4K28A 2D1RA 3K70B 5CA0B 5KO2A 4EOGA 1ULBA 3I4LA 4HAYA 4Z1OA 3VA7A 2V0GA 3FZEA 4IIVA 4KR3A 1SCJA 2Z2YA 1FLDA 2ZJYA 3RABA 4EB0A 1USWA 3CX6A 1ZRHA 4UEWA 1DWOA 2WHQA 1AV7A 1DEHA 2HN9A 2PMBA 3OPYI 4MULA 4LA4A 4F9FA 1M6VB 1G60A 2JK1A 4URFA 3OAAD 1IVYA 4H3SA 4WA8A 3VR2A 2GERA 4R2MA 4S1PA 2XNJA 4MA0A 3V1TC 4KXLA 1N7JA 3OETA 2X77A 1D2CA 1MXHA 3GRAA 3OKAA 1Z3CA 3QSYA 4HNAA 4AP5A 1NA5A 4LRXA 2WV7A 2OLEA 4QGHA 4RF5A 4NHEA 4V03A 4C4XA 1RRPA 3FH0A 4CMIA 4Y2YA 4ZV7A 3NNDA 3RWOA 3GQVA 1CSEE 3PPVA 5AK3A 1K4YA 1IWPB 1OXXK 1TCBA 2AOVA 3DUFB 1XWIA 2NZYA 2WG0A 3UJAA 4F97A 5D1NA 3TH5A 1BA3A 2GF2A 1YSCA 1ZM2A 3IAXA 4W8OA 3CIOA 1KRHA 3PDJA 2A0YA 1RD4A 2RH8A 1EFRD 5K0ZA 1IIRA 1NBHA 4HHEA 4UPVA 4EFNA 2WTEA 3BD6A 3E5MA 3FTPA 2AX3A 2HT6A 2XB9A 1T5BA 3IODA 4GE0A 4MYUA 4QPCA 4DV3B 1I2CA 2FWMX 3JZAA 3PNBA 2PX8A 1MEEA 2W00A 1KQNA 2CVHA 2JGDA 2P4UA 3GLFE 1DMRA 5I7FA 3JWPA 3O8DA 1J20A 1YDGA 5DCWA 4DR2B 2V54A 1D1PA 5D3MA 2GZHA 3FNHA 4X62B 1R74A 1P0IA 2Q6OA 1Z0SA 3NB0A 2ZU6A 2FW7A 2DFDA 1D04A 3AR6A 2EQ5A 4R41A 2OG2A 4E3ZA 2N1MA 2ZROA 1CQJB 2PT9A 5G1NA 2FY8A 3E1KA 3FNEA 4BVEA 1HG1A 2FMUA 3BBPA 4JH0A 4LOKA 4QQKA 2FH5B 3FVRA 4HMQA 3WRXC 1MMFB 2XMZA 3ZIAD 2WF6A 3P52A 4MYCA 2O5VA 1PT7A 2X2OA 3L1VA 2PMEA 3WGVA 5K45A 1H3EA 4FHEA 4E4RA 1ORDA 4L76A 4D9EA 1WXDA 1QRTA 5IVPA 4F9TA 3QYFA 1DCTA 1RJFA 3C5HA 3RYIB 2FPGB 3TQFA 1UC4B 1PNRA 1C7EA 3MJFA 4CF6A 1UDRA 3HXLA 1GPJA 4E32A 4HN2A 4HDRA 5BSMA 3OQVA 3EBPA 4CYMA 4ZOLB 5JFTA 5K0CA 5FLYA 3B3QA 3HP7A 3N6RA 3RBXA 2H48A 3B6ZA 1L5GB 1U7ZA 1FXWF 2HF8A 1OI4A 1WB6A 2YV1A 3LNCA 1E0DA 2AJCA 1ZGGA 2JDID 1FX0B 3UJHA 4RELA 2WWTA 4I08A 4XIYA 1BXGA 4QDTA 3C3AA 3H5OA 1A9SA 1DARA 4KMOA 4P58A 2UUCB 3AW9A 2ET6A 4UMDA 5AXDA 1C3LA 1NJSA 2FW6A 1VA4A 4H6PA 4KNYA 4KPFC 2GEFA 4HQLA 4NV1A 3SIWA 4LBVA 5LL6P 4LYGA 1KERA 2AN4A 2PA3A 3DR5A 3HDQA 4L3WA 4JJZA 4W63A 5AI4A 1ARZA 2QAJA 5P8WA 5I9IA 1AS3A 1KWGA 5LD2C 1JIUA 4HNVA 4C06A 2DTEA 4MA5A 5BMVA 4QOIA 3D0OA 4NFYA 3QUCA 1X8JA 4Q3DA 1W49A 3HPQA 2OA0A 1ENZA 1C8BA 5DH9A 3TN7A 2NZ8A 3PZRA 4JIGA 3VR6H 4UM7A 4XWWA 4YDSA 4H0FA 3MMPA 4HWKA 4LJSA 4D9GA 3O95A 4HH4A 4E15A 3CEHA 3PQDA 4FOOA 1AU9A 4J16A 4UFPA 5JNTA 3ZHBA 4ONEA 3JAWA 4JYMA 3AOEC 4ZEXA 1U0RA 3IIEA 3HCEA 4FUQA 4L07A 4EBFA 5I8PA 5AVYA 5B2EA 5JSZA 1AO3A 2B69A 3GFQA 1YZ3A 1Z4KA 3C87A 4TYWA 1YA8A 3MBOA 3L8DA 3MLAA 4M6WA 4RH1A 1W35A 2B82A 4JB2A 4MUKA 3U31A 3UEOA 3EGDB 1NY6A 1GPH1 2DBRA 1AK1A 1IYZA 1Z28A 1Z56C 2F9MA 1XKQA 2WIDA 2WP8J 2YWCA 2YWJA 3GMTA 4BE7B 2EERA 1BVYF 3ZI4A 1XBTA 5C46F 4L9RA 2X4GA 1TO6A 1TYAE 2XPCA 5EINA 1DX6A 3TOZA 2KB0A 4J29A 3O03A 4Q01A 4U3JA 5G0TA 4RCVA 3OTGA 4EENA 1ISSA 3MCWA 3KOWA 5BWNA 3QU5A 2CBXA 5FEMA 4E5UA 1E3IA 4CLHA 4BP3A 3CRMA 5L7YA 3S28A 5MGBA 1M6VA 1NBEA 2FTKE 3LYLA 2PSJA 4I3GA 1Z8HA 1BXZA 2EZ9A 4J0JA 4KFTA 4PZZA 3SEFA 1LQUA 4LJ6A 4WCVA 3DOOA 3SICE 1L5OA 1HT1E 1W85B 4FTWA 1IN1A 4MGKR 1J07A 4URXR 4PEVA 3VUEA 1C1YA 1L9KA 3COPA 4YQZA 5GAJA 1K7FB 5IMBA 3GC6A 4CT4B 2H31A 2BGNA 2EEZA 4K05A 3RC8A 4LGYA 4G8BA 3CCCA 5EIHA 3M1AA 4L8LA 4BNIA 3Q3CA 4JYAB 2HREA 3WDKA 1I3KA 2JFUA 2QS9A 3CW8X 4MTCA 1AQ6A 4JKYA 4W99A 1CJCA 2N3ZA 4L5AA 5L95A 2O8CA 2ZRBA 3K9CA 3FYTA 1NVTA 3NDIA 1XN4A 4LOLA 3SHQA 2QM7A 2L2QA 4Q3EA 4FKBA 3SQDA 5CBPB 2ZE5A 5FJJA 1SU6A 3GCDA 4ID9A 4JBYA 2W6ZA 3UPDA 2PSFA 1XVVA 2BDUA 4F4IA 1Q50A 1SBNE 3CLSC 2ZK7A 3L7JA 1FSGA 1B1AA 1Q6YA 5BRNA 3W2IA 5IDQA 4P54A 4CM5A 4NE2A 1ECFA 1HE5A 5I9TA 1FJ2A 4BNWA 4F72A 2ZEJA 1X1AA 3VC1A 1F12A 4WCFC 5A2QA 4ZQFA 4ZOCA 5HE8A 3HL0A 4HB4A 4IINA 5HPYB 1W87A 4XGIA 2N1BA 3ETEA 1VIMA 2QX8A 3I45A 2QDXA 3WDMA 5F33A 1QZZA 4BX9A 2H2FA 1SELA 4N3BA 1CKEA 1DIRA 1UFKA 1YL7A 5EWLA 4B32A 4B2YA 4EMSA 4U00A 4S2UA 2HPAA 5EJ8A 2J9RA 2P7HA 2Q4BA 1DDOA 3QITA 4AZSA 3W2HA 2YFYA 1BCSA 4PZPA 1EBUA 1P72A 1W0JD 4F3CA 1WSAA 1I1NA 2C3MA 3G1TA 1GNVA 4GXNA 5HCIA 3ETCA 3LX6A 2BGGA 5HJ2A 5AM3A 3PFWO 1MC4A 3KC2A 3VKVA 1Y3DE 2R6HA 1HF3A 1ZQ9A 2WYWA </