1ZI6A

Crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 81
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi6A00
2I3ZA 1X2EA 4C6HA 4N5IX 1CUUA 3AZOA 2IITA 3C6BA 4OCZA 1DTEA 1DQYA 4MYDA 2XQJA 4MYSA 5CH3A 2WHPA 1G5FA 4U2EA 2G5TA 3F9CA 3I6ZA 1HQDA 4B0OA 5JALA 2Z3WA 3WJ1A 5D3ZA 1YAHA 1E66A 4D9JA 5CT4A 2G5PA 3E1GA 4UFPA 4EY5A 4X6YA 5AI6A 3D0KA 2AJLI 4J0CA 3WL5A 1QFSA 4KE9A 4MWSA 1AX9A 1AGYA 1VA5A 4Q34A 2H7YA 1VOTA 1JMYA 4RNCA 2ZVDA 3UUFA 4LXHA 4B80A 1WB5A 2GZRA 2NW6A 3L1IA 5BWCA 4I4CA 4H7KA 2YH2A 3WQHA 4QLAA 4H7FA 4L9AA 3DOHA 2O7VA 1E8NA 1CFJA 3HLKA 5D3KA 2WHPB 3HXKA 2ZJ6A 5AKIA 2OQVA 1EXWA 1GKLA 1MX1A 4GWLA 2XMSA 3WKCA 3C87A 4H35A 1IMJA 5AH0A 2V97A 4H0CA 1FFEA 3H2IA 1DWQA 1QIEA 1W6RA 1UOQA 2OGTA 2HA6A 4FTWA 3D5EA 1PJAA 1EK2A 4QDXA 4G4GA 1Y37A 1JJBA 3YASA 2E3JA 3DYIA 5A7GA 2V96A 4A16A 3WA7A 3QH4A 1Y7IA 1ZIYA 5ALVA 4BE9A 5BWBA 3CXUA 3O4IA 2XMQA 2D5LA 3VISA 2HL6A 1QTIA 4LHEA 1QIMA 3D2BA 3ZI7A 3D3NA 2ZJFA 5AI8A 1KEZA 2R11A 2WIFA 3NGMA 4LYEA 2WKWA 1CIJA 4HZGA 4J0IA 4Y2PA 2K2QB 3LP5A 5AM1A 3FLAA 1E89A 2CKMA 3R3ZA 3STWA 2OCGA 3STVA 2YASA 2HA3A 2XUHA 3AUKA 3WK6A 1LNSA 2O2GA 1QIFA 5EIHA 1UKBA 4UBIA 3L1HA 2Y2VA 1MNAA 3C8HA 1QIIA 3T52A 1VZ2A 2HFKA 2XMRA 5CT6A 1M33A 1P0QA 3EQ7A 3G02A 3FYUC 4FKBA 4Y2UA 3ILSA 2XUKA 4Y2YA 5LZ9A 5LYYA 2J4CA 4XX1A 3C6YA 4ZXFA 3WKAA 2XUIA 3WI7A 4AX4A 3G9XA 5AM5A 1YS1X 1GQRA 5ALXA 5AO9A 4J03A 5F4ZA 2VJDA 1JFRA 3QMMA 2XUGA 1B41A 4AZ3A 2WUDA 4AN0A 3F98A 4AN1A 4PSDA 2O7RA 3DDUA 3EQ9A 1J1IA 3C43A 3GROA 4JYMA 4B84A 2XLBA 2CEKA 1ACJA 3DQZA 4L0CA 3DEAA 4BVJA 1JU4A 3R3VA 3FSGA 2WUFA 3DOIA 4J0JA 1MAHA 4UHBA 2J4FA 3W05A 5ALJA 3O9VA 2PUJA 5FRDA 5AM2A 4BRZA 2C4HA 4G9EA 4IH1A 2DFPA 1H2ZA 4ROTA 3WK9A 4U2BA 4W1RA 3VKFA 4ZRDA 4NMWA 5A7HA 2HRRA 5LP1A 5CMLA 3PFBA 4L72A 4Q05A 1EHYA 3O0DA 4A23A 1ZI8A 1CUSA 1UWCA 3ZV7A 1QFMA 3GFFA 1CUAA 1XZGA 4MQMA 3WZLA 3K6KA 5KREA 1UFOA 1A8UA 3D7RA 3AFIA 5FDFA 1THTA 3WKDA 2DHEA 3EIOA 4JNCA 3QITA 1HPLA 3WA6A 3WWDA 4MWTA 4UPDA 2R8BA 3JW8A 2QZPA 3HI4A 5LZ7A 3WYNA 2XUQA 4J0KA 2QXUA 2WFZA 3SWWA 1DT5A 1ETHA 3ESCA 4WY5A 1XZIA 4QWWA 5ALRA 5JIBA 2VJCA 3IUQA 3PE6A 3GELA 5ALZA 5CH8A 4F60A 4X94A 4P08A 3MGAA 3WJ2A 2DQYA 2WU4A 5IVKA 3CCBA 4AB1A 4FOLA 5EHZA 1EDBA 2C7BA 3S2ZA 5CTAA 4XIIA 3H2GA 4BVKA 1LPPA 2ZJ7A 3B3QA 4G8DA 2YXPX 4EBBA 1CUJA 2AJDA 1L7QA 1MT3A 3DYVA 1U8EA 5CBKA 1E5TA 1MO2A 3NWOA 1XZMA 2GBGA 2HA7A 4FBMA 1K6EA 2WTNA 3KSRA 3H2JA 1ZJ4A 4UBKA 2OLEA 2XE4A 1NU6A 1WB6A 5JD4A 1WHTA 4Q3KA 4CG2A 4C01A 2ORYA 1P0MA 3WWOA 4F5ZA 4HXGA 2H7CA 4TVKA 1G4HA 3DL4A 3IB3A 3H1AA 3WLAA 4BC1A 2QUAA 2G4LA 5J3JA 1SCIA 3WK5A 4FBLA 4DNPA 4UUQA 1OILA 3H04A 4X91A 1CUFA 4Q3OA 4K6GA 1CQZA 1T2NA 3R41A 1DWOA 3PDCA 4AMZA 1CUIA 1VKHA 1U2EA 4NVRA 1MX5A 3E0XA 4M0MA 3FVTA 1W75A 2X5XA 1Q84A 3FYUA 3Q8WA 1GPNA 3HC7A 1FFBA 3G0GA 4UBJA 2VJBA 1ORWA 3FNBA 5JZBA 5DYYA 3BIXA 3V1NA 2WUEA 1RYYA 4KACA 1U65A 2CZQA 2FUKA 1W76A 5AI9A 3WL6A 2PSHA 4Z49A 2EDCA 3IIIA 1ZGCA 4G4JA 5ALHA 3HRHA 1L7AA 1SC9A 2XUPA 5BV7A 2PU7A 5HF9A 2OCIA 2B9VA 3PUIA 3IULA 2HA2A 1CUXA 1DT3A 5ISMA 2D0DA 2QM0A 4OB6A 1CUYA 4UHFA 3FAKA 2XMZA 4K2AA 4KAAA 2PPLA 5I9IA 2GBFA 4INZA 2H7XA 1ODTC 2XUJA 2XQGA 3GA7A 1HDEA 2DHDA 4BAGA 2DHCA 3FLBA 1LPAB 4FLFA 5JAHA 2JF0A 3H17A 4J0GA 4JUIA 3HZOA 5EI5A 4EHBA 4IHAA 4KRYA 5ALFA 5CT8A 1H2YA 3D2AA 4Y2JA 3F67A 1A88A 2QUBA 1KU0A 1WPXA 3I2JA 2WFLB 1QIGA 5HKBA 4WFKA 5EHNA 3BDVA 4L3WA 1UZAA 5LZ4A 4Y9SA 4AO8A 1RP1A 1CEXA 1AC5A 3RM3A 5AM3A 1UKCA 2BUAA 1XRMA 1XZFA 2VF2A 3EF3A 1BEEA 4GECA 2WIDA 4EB0A 3IUNA 4QDOA 1AQLA 1JKMA 3PICA 2PX6A 2XT0A 2XMCA 5FXMA 4LXIA 4IQ4A 3DKKA 5CT9A 3I2FA 1QE3A 5ALTA 2BFNA 2X76A 3ZLUA 5AI4A 1HL7A 3ESAA 3R3WA 5AKJA 4TPKA 5C8ZA 3FOBA 2BGRA 4Y2VA 1CUEA 4Y2TA 5ALDA 5DNWA 3BXPA 1EA5A 2WFLA 3A2LA 3EBLA 1JI3A 1UOOA 3STTA 3C6XA 2J3QA 4BCBA 3QZUA 5AK3A 2WM2A 3I2HA 2XQIA 3H0CA 3N0TA 1MN6A 5FV4A 4MEAA 2OCKA 1EVEA 2OGZA 2JBWA 2HIHA 4XVCA 5EGNA 3CN7A 3G8YA 4PF1A 3M81A 3KDAA 2XB6A 2I03A 3JWEA 1EINA 4BDTA 1BS9A 1EH5A 1R4ZA 2GZSA 2CMFA 2AJCA 3QYJA 2QJWA 1J06A 1Q83A 4B85A 2QR5A 4MQLA 1CVLA 1MPXA 3C5VA 5ALOA 2HA0A 4OB8A 5HQ3A 1YR2A 5HK9A 3G0IA 5JADA 1EI9A 2WJ3A 2LIPA 4E14A 1CUZA 5CH5A 4TGLA 1GQSA 4Y2XA 1UOPA 3C8DA 1AKNA 3W9UA 1Y7HA 1G66A 1QTRA 4PW0A 4J0HA 5DJ5A 4F0JA 5AI5A 2C58A 1IZ8A 4OD0A 3G0CA 1SCQA 2QVBA 3SX4A 3FLEA 3SK0A 6YASA 3MVEA 2XUFA 3GZJA 4QNNA 1R9NA 1CUCA 4KRXA 3SC2A 4E11A 1ZICA 4PV7A 3K9BA 4B81A 4BATA 3BDIA 3PF9A 4JYPA 3BWXA 3HABA 1XZDA 4W1QA 2FJ0A 3K2IA 1A7UA 2QXTA 3V9AA 1U4NA 1BRTA 1W4LA 4GW3A 4ZV7A 3VDXA 3KOOA 2Q0XA 5K3FB 2JGJA 4YASA 1GPKA 2C0PA 1XLWA 2Y6VA 3KWFA 4H7IA 1TCCA 4FDMA 2OG1A 2QTBA 3QPCA 5JAPA 3G0DA 4CI9A 1BU8A 4BRSA 1UK6A 4KEAA 5T4FA 5ALUA 1LZLA 3FCYA 4AO7A 2XUOA 1H2XA 4OSEA 5A71A 4G8BA 4CIAA 4XWGA 2IX9A 4W63A 4DNOA 5CURA 5JD5A 1CUVA 4BAZA 4C4YA 1XZJA 5ALEA 4RPCA 2VT7A 3BF8A 1MTZA 2OAEA 1WM1A 4QDUA 5AHXA 1ZD4A 3DNMA 2DR0A 4NS4A 1F0NA 3QPAA 4KE7A 2ZYSA 1YCDA 5HFAA 4QDZA 5K3CA 4ITVA 3I2IA 2V9ZA 4QA9A 5JD6A 3KXPA 5CT5A 4BB0A 2PSEA 5ALGA 3OC0A 4PSUA 1R1DA 4HVTA 1XZHA 3WK8A 3RKSA 4DLNA 5FPQA 1J2EA 4EZIA 3X3HA 1AMNA 3ESDA 5BOVA 3GBSA 3EQ8A 4X7BA 2BAGA 2DQZA 3QMVA 3AZQA 3D59A 2Y1KA 2QRUA 5AKHA 4HXEB 4CG1A 4WDRA 2WG2A 1HKHA 2JEYA 5LZ5A 2JGIA 4ZV9A 1E8MA 3A70A 1SFRA 3B5EA 5FPPA 3LIIA 1XRPA 4KAJA 3LIPA 3WIBA 4UHDA 2HRQA 3G9ZA 3FBWA 4I3FA 4BP9A 3DJYA 3G9TA 3WL7A 1PV1A 3QM1A 5K5EA 4BC0A 1B6GA 1BCSA 3WMRA 1NU8A 4FLMA 1TK3A 3QPDA 4A5SA 2ZYIA 4DIUA 4C88A 3D4LA 5CXUA 1QONA 2VA9A 1RWQA 2XDWA 1ZI9A 1Q0ZA 2WUGA 3LCRA 4U2CA 4Y2SA 2OQIA 4UHEA 5C81A 4WFIA 4DYHA 1ZI6A 4EY4A 4IO0A 4E15A 2QOEA 4BTLA 4DNQA 1N5RA 1C7JA 3CCCA 3KWJA 1JU3A 1S8OA 2GYWA 1BROA 4H7EA 2DCMA 3H18A 5I7UA 2HDWA 3W04A 1QLWA 3V1LA 4WCVA 3F96A 1SOMA 5IVDA 5T4BA 4P92A 4QE3A 2RHWA 2XLCA 4UHCA 5ALKA 4UBNA 2PSJA 4HRYA 5HFNA 3FVRA 1T4MA 3BIWA 4B7ZA 3FYUB 5JANA 5AICA 2XUAA 5D6OA 1IVYA 5EIAA 3PF8A 4X95A 4WDQA 1JT2A 2Z8ZA 5AKYA 2WFMA 4Y2RA 1H22A 2ECFA 2ZYHA 1MAAA 4NZZA 4BZWA 3FSGD 3LLCA 2VSQA 2JGKA 1H23A 4DMFA 2OXEA 5JARA 1LZKA 2OAGA 5A62A 4KAFA 1EX9A 1UT6A 2UZ0A 4H7HA 4QZVA 1CRLA 1BEZA 4UBOA 4DMCA 1LBSA 1QO9A 2B61A 3RARA 4QDTA 3V1MA 4CFSA 1CUDA 3Q0TA 4GLBA 5KWIA 3WIOA 4QWMA 3M83A 1EDEA 2PKYX 5AI0A 3DL7A 2GBIA 3IDAA 5DLPA 1QIJA 1GPLA 4J0DA 4DTCA 2ONCA 2I78A 1XZCA 1MNQA 4FHZA 4OPMA 1F0PA 3R3UA 4EUSA 2OCLA 1R50A 2ZSIA 3DD5A 4FNGA 5HKAA 4FFWA 4CIBA 2CUTA 2YYSA 2ROQA 4M0EA 3CN9A 3ESBA 3BE8A 1Q0RA 4AQDA 5AK4A 2QKYA 5HCUA 3IA2A 5AKGA 4BCCA 5SYNA 1WHSA 5ALQA 5FLKA 2QJRA 4BP8A 2RIPA 4CCWA 5HQ3B 3AZPA 1WPRA 2WILA 4X92A 3OPMA 1R9MA 1YA8A 1THGA 5E4YA 2PVSA 4YK7A 1TAHA 3O4HA 3M3DA 3AIMA 3VXKA 4UHHA 4FMPA 5JAUA 1DX6A 4KE8A 1CQWA 3U0VA 2WHRA 1I6WA 4PQEA 4GDMA 2IIVA 1FJ2A 1ISPA 3ANTA 3NUZA 3BJMA 5AOBA 2QS9A 2WTMA 5AKLA 3IUJA 3A2NA 2BCEA 5JAOA 3I28A 1K4YA 2PM8A 1QOZA 1A8SA 1TCAA 3WZMA 5FOQA 4DNFA 3VVLA 1GGVA 5IVHA 1FSSA 1LPBB 4AXBA 3HJUA 3ZLVA 1CR6A 5FUMA 5T4HA 3GUUA 1MJ5A 1LLFA 1XLVA 4EY8A 1K8QA 4CCYA 1F8UA 3O4JA 5CW2A 5DYWA 3WWCA 5ALIA 3I1IA 1LPSA 4E46A 2WLSA 4X00A 2HFJA 1IUOA 1EB8A 4U2FA 5DNUA 1DX4A 4N8SA 4Y7DA 4X71A 2HA4A 1ODSA 4RE6A 1ZD3A 3FWHA 5ALPA 4N8EA 5AKKA 4OYYA 4HRXA 1XZLA 3WWPA 2XQFA 3HSSA 5ALMA 2XMGA 3AJAA 5DYTA 1QIDA 3BF7A 5AIBA 3PUHA 1F6WA 5C8XA 2Z5GA 3I1YA 4LXGA 2WQZA 5AOCA 3MUOA 4FFVA 3VVMA 3RK4A 3LS2A 4ZGBA 1P0IA 1FFAA 1QIKA 2H9YA 4X3CA 4BVLA 5D7BA 2XMBA 3HACA 1CLEA 4Q1VA 3ICWA 3NOXA 3R3YA 2BUCA 1FFCA 1LBTA 4G9GA 4OU4A 1E8DA 3STYA 1GT6A 3H2KA 5AKXA 4AMYA 1XLUA 2VQ6A 1CUBA 4BDSA 3G9UA 1C4XA 4N8DA 3OM8A 1R88A 3WL8A 1CV2A 4K6HA 4LKOA 1DQZA 2B4KA 2QMQA 4EA6A 1NX9A 1K5PA 5E2IA 3TEJA 1XZBA 4YX9A 1AZWA 1DWPA 4W1SA 1YSCA 2ACEA 4X85A 2JGEA 1BCRA 4DSZA 1SCKA 5DTJA 3H1BA 1ZIXA 3U1TA 3DLTA 5IH7A 3V48A 5E4JA 5KWJA 5IKXA 3WKEA 3C6ZA 3IUMA 1TCBA 3ZPXA 1YB6A 2WSLA 4UBMA 2VT6A 1ZJ5A 5ALWA 2JGFA 4Y2QA 4X90A 5ESRA 3KD2A 2AJBA 3E4DA 4DSAA 2BGNA 4AO6A 3F97A 4BE4A 1G42A 3C5WP 4B82A 1XRNA 3C45A 1CUGA 2BKLA 3W9BA 3DCNA 1OXMA 1QO7A 5C8VA 4S0XA 2PSFA 3OTQA 3VJLA 2GBCA 3T4UA 4EY6A 3AIOA 1O6GA 4XJVA 1QZ3A 4G1FA 4C89A 4U2DA 1ZOIA 5SYMA 5IVIA 2BJHA 3I2KA 4FWBA 1O6FA 1VXOA 5AM0A 1JJIA 1VE7A 4N5HX 1DU4A 1MU0A 3ZLTA 5ALLA 1IUNA 4GXNA 2RAUA 2ZYRA 3HEAA 1ORVA 4OUKX 3WWEA 5HF5A 1USWA 1KU6A 4LIPD 3F8SA 1N8SA 2PUHA 4CG3A 1TIBA 1J07A 3O4GA 2O2IA 1PFQA 2GYVA 1XKTA 1UK8A 4WY8A 1TQHA 1XKLA 5FKJA 1XZKA 2EDAA 5C7YA 4IH9A 4HXFB 4F21A 3R0VA 2FX5A 2XMDA 1JJFA 3D2CA 5I8PA 1A8QA 1YB7A 4P93A 3S8YA 5T4EA 4ETWA 3W2TA 2ACKA 4UFOA 2ZSHA 3E3AA 1QJ4A 1OCEA 3QMWA 3WKBA 4O08A 4BTVA 1LPOA 1EB9A 4QEKA 1UK9A 4V2IA 1MX9A 1CUWA 5LZ2A 4CCYB 4G8CA 2PL5A 1IZ7A 5AIAA 2QT9A 5CXXA 2RGUA 1EDDA 2AXEA 4M0FA 3OOSA 4B6GA 1CUHA 3ANSA 3G0BA 1R3DA 4QLOA 4X97A 1XZEA 3V1KA 1HBJA 5LLSA 1QIHA 1UK7A 1XRRA 1W52X 2JEZA 5JZSA 1XQVA 1IUPA 3H2HA 3P2MA 1C7IA 5EHXA 5A7FA 3M82A 4KR0A 4GBGA 1ODCA 5EFZA 3W06A 4B83A 2X8BA 3AINA 4BBZA 4B0PA 4ZI5A 2J3DA 5K3EA 3RLIA 1YS2X 1GXSA 4K6KA 1N5MA 3L1JA 4IH4A 1XQWA 1YAJA 2Z3ZA 5ALYA 4C4ZA 4EY7A 1WB4A 4KJXA 4WJLA 2WJ4A 5AJHA 3ED1A 1Z68A 2P8SA 4RE5A 5KBYA 5HK8A 2HM7A 1D07A 2OGSA 1GZ7A 4PO3X 1WOMA 3MUNA 3IVMA 4MXDA 2RONA 2AJ8A 3DKRA 4KYVA 4LYDA 5LKAA 3PI6A 3AILA 4B9AA 4C4XA 1W1IA 3AIKA 5FP0A 5JASA 5LZ8A 5DWDA 2WHQA 4K5QA 4H7DA 4U2GA 1XZAA 1K63A 4W1PA 4BZZA 1GKKA 2XI4A 2RHTA 1TRHA 3A2MA 5K3DA 3I6YA 1BN6A 7YASA 2PBLA 2JGMA 4DM7A 1XFDA 2HU5A 3UUEA 3IBTA 1FFDA 2Z8XA 4GHWA 1VJ5A 2EEPA 3C70A 5AK6A 2JGLA 2VTVA 3UMJA 4BYMA 5AKZA 3FYTA 4HS9A 3VJKA 4YPVA 4GEGA 3QVMA 2WJ6A 2BUBA 1UKAA 3ICVA 4B9EA 5HF6A 1QGED 4HAIA 4H7JA 5JZ9A 1EK1A 2VEOA 1LPNA 3BL8A 4I19A 2W6CX 3R40A 1DINA 3TRDA 1JMKC 3I6MA 5DNVA 2DSNA 5K3BA 5JYCA 5A2GA 3R3XA 2FJPA 2VJAA 3JYHA 3TGLA 2RI6A 5CRIA 4DMHA 4W9RA 4KE6A 2WG1A 5AP9A 4ZWNA 3WYDA 1YASA 5AKEA 4PNZA 4RGYA 1LGYA 4G5XA 3VJMA 1CPYA 4GI1A 1XRQA 2C0QA 1P0PA 2WU3A 3PFCA 5AOAA 3STXA 3N2ZB 4WFJA 4DGQA 4OB7A 4P9NA 2C5FA 4PSCA 4UFNA 3O95A 3IURA 2WIJA 3FCXA 5YASA 1N1MA 1ACLA 2H1IA 2I3DA 4MEBA 5ALSA 4JEIA 4MJ3A 4UBLA 4OU5A 5EHQA 5LIPA 5H3HA 1ZGBA 1H2WA 2GYUA 1E3QA 1XQYA 3O9MA 4AZ0A 3TJMA 4C87A 2HU7A 1XQXA 1BE0A 2B20A 3WK4A 1BN7A 4G4IA 3G7NA 2XUDA 3HYSA 4DMKA 5HZGA 3WK7A 1ZD5A 5JATA 5ALNA 2HU8A 1VA4A 1XROA 2ES4A 4J7AA 2VAXA 2WIKA 4J3JA 5E4TA 1TKRA 2CBGA 2VAVA 2PSDA 1EVQA 3STUA 1VLQA 1VXRA 2CB9A 1VE6A 1HLGA 2HA5A 2PU5A 1UXOA 1AUOA 4Q82A 5LKRA 4X6XA 4FLEA 1YA4A 4OYLA 3ZWQA 2XQKA 2W22A 1AURA 4JH0A 4FNMA 5HF8A 2HADA 1X2BA 4X6UA 1ZD2P 3A6ZA 2WG0A 3BJRA 3OG9A 2OPHA 1L7RA 2HHAA 5K3FA 4BCDA 3I2GA 4H77A 5K3AA 4X93A 5A6VA 3H19A 2JIDA 2O2HA 3DS8A 4BAUA 1WCYA 5EIEA 4ARBA 3OURA 1X70A 2G63A 5AM4A 4ARAA 2CJPA 2V98A 3B12A 1VZ3A 3QBJA 5AK5A 2Y2UA 4Q3LA 2C5GA 5DTIA 1XRLA 2VATA 2WIGA 4HTAA 4ZREA 2Y6UA 4H18A 1LPMA
chains in the Genus database with same CATH superfamily
1E2EA 2I1VB 2IPLA 2QSZA 4L4XA 4K9MA 3V8QA 1RJEA 3BEOA 3FCOA 1UODA 3IVGA 2HHHB 2IITA 2Q5LA 3I3SR 2ADFA 4PC3A 1KAEA 2LNDA 3OT5A 1H3NA 2QUJA 2XCIA 3Q3EA 1JHOA 1PW7A 2OZVA 1A9SA 3LUDA 1PZFA 2NXEA 2VUIB 2XQJA 2YX1A 1JV2B 2X3YA 2ZQ5A 4QTZA 1GP2A 4Q3CA 5CH3A 2Q3BA 2V7GA 4MIYA 4F91B 2JIZA 4U2EA 1E6EA 4MIEA 2VUUA 2G5TA 1ZMBA 4MI1A 4AW9A 3EY9A 3I6ZA 1TJ5A 4UEOA 1JZQA 1Y3FE 4LK3A 2A14A 2Z3WA 2B36A 4QPNA 3OUTA 3RUHA 3WJ1A 2WU0A 4QUGA 5DE3A 1YAHA 1J8QA 2JI6A 5JQWA 3HNOA 3KE8A 1JDUA 4ND8B 1WW2A 2Y05A 4YUZA 5BN1A 2ZITA 3SXJA 2VKQA 4E1VA 1MA3A 5BQFA 1VCNA 5JS8A 1T3TA 1OAKA 4Q9DA 4QVIA 1X14A 2X1MA 1F4VA 2G5PA 4LZZA 2C4NA 1G18A 5CEFA 3JQ6A 3QE2A 2AJLI 4HLCA 3AEXA 2GEDA 2HXSA 4ZQIA 1UP4A 2VDLB 5DLEA 1E1CA 1DV1A 3HCOA 4EA7A 2JLZA 2O8DA 3WGYA 3DXFA 2I65A 1SIBE 4WW0A 1P9WA 4W8HA 1E4EA 2B1GA 4XM2A 1N7HA 4Q34A 1PIWA 4RNCA 3FDFA 3VVCA 4E2XA 1FFWA 3T5MA 2AL7A 4MVYA 3U4DA 4K8RB 3VGPA 4B80A 2JLYA 4XJTA 3U7FB 1HX7A 3ZDEA 4HEA6 5TGZA 2CSXA 1XTKA 2Q2NA 4Y6QA 4ZVOA 1JKJA 3FSEA 1RYNA 5E1OA 1E6KA 5FV7A 3ISTA 4F5WA 2IY8A 3NHKA 4JQZA 2GD6A 2IF2A 4M8KA 1JKXA 4MWOA 4I4CA 2VJQA 4GGOA 2QN6A 2GUGA 1UJNA 2GA9A 4NYIR 4H7FA 2RJNA 4QLAA 5E9AA 3C3CA 4OP3A 2AF4C 3DOHA 1P1CA 2W83A 3GJZA 5FAKA 2F43B 2Z1MA 1ZCAA 3OU2A 1WULS 1A5TA 4WY2A 5L6LB 2ZB2A 1RQNA 1WUHS 3B20A 2OK7A 2WHPB 4F3CA 4R98A 1GSAA 3LC2O 3M1YA 4RF4A 4JEHA 6REQA 1A77A 2MDTA 2YV3A 1D04A 1GKLA 3C4VA 1MX1A 4IIXA 1HEYA 2AI3A 1L5FA 1V9CA 4B34A 1Y6GA 2XMSA 3MYRA 1G7CA 3C87A 3U40A 3D6NB 3JARB 2WYUA 3TOXA 4E08A 1IMJA 1JXQA 4WK4B 2O2CA 4R9VA 2D6FA 3VH3A 4DC1A 3A25A 2RG7A 2Z2JA 3H2IA 3V4VB 1DWQA 5A1JA 1HRKA 4GOKA 2DQ4A 2J09A 3IUYA 1T24A 4PS0A 1QIEA 1W6RA 3O38A 5AW7A 1MX3A 2QJOA 5JYDA 3IQIX 4TL8A 5T8KA 2HA6A 3JASA 1AS3A 3AVUA 4YP5A 3D5EA 1RZRA 5DK6A 2UVPB 4GM1A 4RIHA 3TRHA 2P1RA 1PDOA 1USUA 3MXTA 1T35A 3O2JA 5L53A 1Y37A 1KR5A 1BX1A 1O4VA 1QDUA 2PXXA 3BMNA 4C0SA 1XXLA 4K7JA 2HZBA 3FFTA 5COAA 1Y8RB 4P4GA 3BB3A 2JFHA 5FBZA 3T5BA 3TQOA 2Q1WA 5U9CA 2B5OA 1ZZEA 3CEMA 3DYIA 4HYTA 2VK2A 3LZ6A 5DHUA 3DMGA 3SAJA 4E5NA 3M4NA 5LQKA 3UO8B 4JC4A 5LN1A 3A11A 4P4UA 1STOA 1TJNA 4Y1RA 5H59A 3WLHA 3IEXA 3UFXA 2FWNA 1VHTA 5ALVA 1M6WA 4A26A 5JFTA 4KXMA 1B74A 3CXUA 3O4IA 4KN6A 2XCTB 2D5LA 5GMOA 4LHEA 1UKZA 1ZESA 2HNKA 3S5JA 1C3OA 4PYMA 4ZKDA 1APBA 2C3OA 1SZPA 3H11A 1SXJC 2ATVA 4JBGA 5JBIA 2VI5A 3LH5A 3ZI7A 1U9JA 1EFLA 4YAUA 2DUNA 2ZJFA 4O33A 13PKA 2BCGY 1KKLA 3D6JA 1TEXA 2WKWA 2X5NA 3P71T 3E9YA 3FD8A 4J0IA 4RTJA 4M55A 3TTWA 1KSJA 3AFHA 3BVPA 3IHLA 4XVHA 1SUAA 2DFLA 3LP5A 4I1VA 4J2HA 1J42A 1KARA 1EXVA 3FLAA 1D09A 2YDYA 1E4OA 5EHIA 4OGLA 3QYFA 3RCBA 1BMFD 4A4DA 3BERA 4OYHA 4JVMA 2OCGA 4YMIA 4Q18A 3STWA 4DA9A 1YBVA 1YFJA 2XUHA 1NVAA 3A9SA 4WZAA 1RW4A 5EIHA 4MHOA 1X39A 2JHCA 4GI5A 1VL0A 4CIDA 3NHBA 4P5EA 1QO0A 3F1KA 4IX9A 1PT9A 1ZG3A 4Z4FA 2GEUA 1OFUX 2BEWB 3L1HA 3CJTA 4NKRA 5HBRA 4GE0A 3TNJA 4K1LA 4LOHA 4MIOA 5FTNA 3JQPA 5TQ2B 4YHHB 2XMRA 1DFIA 2VS1A 4H08A 4IWNA 3UM9A 1HDZA 3DNPA 3NC1C 4BPRA 4NJEB 5JJIA 2FYTA 3R6TA 1NUSA 3SEQA 5EE9A 2WVJA 4J7XA 1UF9A 5BN5A 3RVOA 2DULA 4IRXA 4RA6A 3AMVA 5JD3A 2F1IA 3QOFA 3D31A 1T1EA 5B55A 4WOPA 2DWCA 2NV6A 2HBRA 3ZZUA 4Z53A 1PZNA 1WG8A 4IOLA 4LF5B 3C6YA 1R4MA 2XAUA 1SK9A 4JK3A 4HEQA 3T7JA 3TUJC 3MTQA 3P4YA 5CIWA 3WI7A 5KYUA 6ABPA 1H4QA 4P33A 3G9XA 4PZZA 4TRMA 5CFLA 4ER7A 3MT8A 4E31A 4K9LA 2R84A 2HD4A 3OZRA 2CLEB 3W4KA 1MO3A 1ZXBA 3JALA 4LMPA 4AWAA 4DDVA 5JCOC 5K4GA 3MRSA 3AR5A 1T0HB 2IYVA 4HDMA 1QVZA 1E3EA 1GFIA 2CUNA 3BEDA 4FYMA 1JFRA 3H83A 3ZWMA 2DX7A 4A6PA 1VL2A 2N46A 3KUCA 5KTOA 3PQ6A 2OFFA 3V3KA 2G1JA 1F1JA 2JGNA 1MB9A 1VKZA 3OPVA 1I3LA 4OFXA 1WOYA 2CLOB 2A5JA 4R2LA 3BTUA 2PX2A 3EASA 5LOVA 4MRRA 1FFXA 1PGNA 1U1GA 1Y34E 1Y82A 2XTNA 4ZHQA 4E94A 4EJSB 3DDUA 3EW9A 4DMLA 3R20A 4XSHA 3UJAA 4FE4A 3ZW7A 3HWX1 2UXDB 4JQYA 4RZUA 4ASUA 4N54A 3OWXA 5EKXA 4JYMA 2WF9A 4KXQA 1PR1A 3L7LA 2IU4A 2OV3A 1SXIA 4M8LA 4CU2A 3GK3A 3PNLA 2OSBA 2GN6A 5KMGB 1BQ3A 1E6WA 1X7YA 2X1HA 2WUFA 3FWNA 5DGTA 3GL9A 4DQVA 5IXSA 3PE4A 2GRJA 2RHMA 2DT5A 1QKIA 5HTOA 3ZV5A 3ITEA 2DOKA 4R7TA 1U0HC 4BNTA 1M6VA 4UHBA 1XXHE 2AN3A 3GRRA 3OJOA 1K7YA 1MVOA 4AF8A 2W11A 3GBPA 3TQRA 5GADl 5ALJA 2YFHA 3HWRA 4IMJB 1DJOA 5IAAA 1E1DA 4PFSA 5CJ2A 1TLTA 1SIWA 3HA5A 3L79A 4E2ZA 3DDCA 3A31A 5EXPA 2HC9A 3C8ZA 5FBRB 1M76A 3C7DB 2ZGVA 3T1OA 1A7KA 4G9EA 4IH1A 5CW1A 3TOVA 4DB4A 2ZI9A 2CL6X 4EJSC 3AO0B 4HFMA 4ROTA 3RW9A 4M7PA 2ZSFA 4MCHA 3CUWA 2A0FA 4IY1A 5EZYB 1TDJA 4W1RA 5B64A 3NBAA 3HO8A 4JV5B 1DELA 2EJCA 3N2YA 3IR5A 4A0FA 2BMEA 4G36A 2OHOA 1LK0A 1I8TA 2A33A 1QKJA 2B1IA 2FWPA 3BX1A 3EWAA 3PC4A 3UJ6A 5KMGA 1VLVA 2FZCA 4OOEA 3GJ0A 3HB1A 1EHYA 4RKFA 4YS6A 4ZPJA 5TPWB 3TIIA 2NO4A 4QM7A 2ZRJA 1WNTA 2D4HA 2ID9A 2VHJA 2AVDA 2YCLA 4DXHA 1Z13A 3OY2A 4DJEC 1AHPA 5KTMA 1WXQA 2VTBA 4K0KB 2ZT5A 1QLHA 1NC3A 1A8UA 1AZSC 1TJ4A 1ZITA 3ZDYB 4JXJA 4K26A 1UBHS 3L0YA 3WL4A 2I62A 2AEJA 2YWRA 3GAMA 3TLGB 4AJEA 4M99A 1V41E 4CEIA 1W581 1TMKA 3WKDA 3DBIA 4KXNA 3SHOA 2A88A 1QR6A 2H63A 3M3PA 5LFAA 5FT9A 1MEOA 2HCBA 5EZSA 1DO2A 4MP3A 3SFZA 2FWMX 1N2CA 1U9IC 1KQ3A 2B5WA 3INTA 3KKZA 3KZMA 1WTCA 3QITA 1C9EA 5FLYA 5TQJA 3CC8A 3K73O 3P2JA 4LHSA 1G7TA 1U2SA 4IIHA 4MWTA 2JLBA 4OHCA 3SZUA 5FPYA 3H2ZA 4BNVA 4NE7A 1KKUA 5LNK1 3Q12A 3JATB 1SVWA 3QFSA 3EIEA 3HBJA 5IC6A 5THXA 2GZDA 2Q8NA 3DOJA 4RJ2A 1IQRA 2BFEA 5JIBA 3RC2A 1CZRA 2KYRA 4JBHA 3GELA 5ALZA 3G7SA 2BV3A 1SKYE 4JLSA 3H5AA 4Z7JA 1JHMA 1T6XA 1N2ZA 1XYGA 4Y1EA 3A2KA 5EHGA 3KJQA 1XTUA 3NAQA 3HJRA 2V58A 1X7ZA 4KDRA 1G63A 2IK8A 4N0MA 4WWHA 1V4VA 4HQLA 2WU4A 2D1QA 1M6HA 1M9NA 1EFHA 3CCBA 3OF5A 2B4QA 2PUEA 3SFVA 1XTPA 5EHZA 4J7UA 2IWRA 3C2QA 3DBRA 3ELUA 2C7BA 5EL0A 3GLSA 4TYPA 3P9CA 4W82A 3S2ZA 4JA2A 4XM0A 4IX1A 2PPVA 4W5HA 2FDXA 5E0OA 3FSRA 1FDUA 5D6NA 3IBSA 4LA4A 3VZRA 2V59A 1II9A 5DSZA 3A4MA 2G25A 5E3HA 2FZKA 4JMPA 2F9FA 3HFGA 1HURA 4G8DA 4AUEA 4EBBA 3A6JA 1BD4A 1R0BA 1Y48E 2EWMA 4GZ3A 4OXXA 3T7AA 1BAPA 3GAFA 4RBNA 3VOTA 2D2EA 1U8EA 3DYVA 1E5TA 4PR3A 5EZ5A 3FTDA 4C76A 1T2FA 2YTZA 1YFLA 4ZICA 2ISSD 3ISVA 1L7OA 2GNOA 3DEYX 4TWAA 4FBMA 4I0WB 3ZH2A 1QRSA 1MB0A 4LOLA 4C3ZA 1SIOA 3KSRA 3LM8A 5GJVC 3H2JA 4B43A 3CPEA 4BFYA 1RZ3A 5M2QA 1DRVA 4OP2A 4YUVA 2IUYA 3DZDA 4ZAZA 5INTA 2J9RA 4FX2A 2IYQA 1WB6A 3ASVA 2O07A 1AB5A 2XVMA 3HJAA 4X1KA 8LDHA 1ZXXA 1WHTA 2GK6A 4Q3KA 4GPBA 4C01A 1H9BA 3ESYA 1R3UA 1V3UA 1P0MA 2VCYA 3B53X 1QO0D 5HHTA 1JQKA 3EZXA 3UMYA 2DUUA 1J8MF 1D7AA 1E1QA 2GDZA 1L7PA 2WBLC 2IOYA 4CM6A 1WWKA 1SWVA 2W2TA 4TVKA 1I2BA 3WNDA 5AVYA 3S70A 5H9WA 5HG0A 3DL4A 2OBNA 1ZGHA 3IB3A 1ECGA 3H1AA 4QQRA 4YPFA 4C7OA 3WLAA 5EKSA 2G4LA 1Z6XA 4V1CB 5HIAA 5J3JA 1E3JA 1MIHA 2WAMA 4PE5B 4DNPA 3D6FA 5IDWA 1L4NA 1XR3A 4O3MA 2H1LA 3PUJA 1HI9A 4KVFA 4YRDA 2PLWA 3GJTA 4GUDA 3JZDA 4TMTA 4ZAGA 5BPHA 1SOVA 3OQPA 2XW6A 3T7DA 1KR2A 4RGQA 4OUDB 4K6GA 4EYQA 4C6HA 1U3DA 1PR5A 4L0DA 2Z1NA 4DJ5X 3ZK7A 3PDCA 1PYGA 3R7FA 3UT0A 1CUIA 3WTBA 1VKHA 1FRZA 4RZXA 3I0MA 1GQOA 3T38A 1QOQB 3O8QA 4ZYVA 3QE0A 4E51A 4HNUA 1YRHA 1JU9A 2O2SA 2FMXA 2YYAA 1E0SA 3MWEB 3U26A 3ACBA 4D7AA 1PDWA 3D3WA 1Z6GA 3PDIA 5ITZB 2FDCA 5DYIA 1GRQA 2QPOA 2FMUA 1D6MA 3CO5A 4RVHA 4UJ3A 5KJ6A 1YOVA 4M0MA 3V7UA 2Q7OE 3T3MB 2FSHA 3HPRA 1GLNA 3CLTC 2XKBA 1ENOA 4Q21A 5KCZA 2H4JA 1Q84A 4JT4A 4DLUA 4ACBA 3Q8WA 3AONB 3SDBA 2PWAA 2W5UA 5TVKA 2ZUFA 1FFBA 1Z4IA 3FBGA 3G0GA 2J9YB 2VJBA 4MDYA 3DHYA 3RTGA 3FNBA 1MRSA 3I0ZA 3WB2A 5JZBA 1NRWA 2VBIA 3F3SA 1SQ5A 3L49A 5JMWA 4TOIA 3A6LA 3O9ZA 1WXHA 1X80A 4EB6B 3BXOA 5JVDB 4RNDB 2WWIA 2EKBA 3HP4A 2ZBFA 4O2LA 3N74A 4XQ0A 1A8HA 1CIPA 4MAFA 1GKYA 3JZAA 3KR0A 4LSGA 2JFZA 2EHDA 1N6LA 1CS0B 1U65A 4I6JA 5KNBD 3WMXA 4CEJB 3WL6A 1W0JD 1ZPDA 2BFEB 4Z49A 1RE1A 3Q2IA 1FFHA 1PW5A 5CDUA 1UT5A 2VR1A 4KP7A 3IIIA 1ZGCA 4G4JA 2IL1A 3C8MA 1PHPA 3DZHA 3HRHA 4GI3A 4LZAA 1SC9A 5F2KA 5G1NA 5TGDA 3SQLA 4NL4H 1BFDA 5A5VA 5KPJA 1M5UA 1OASA 4B2PA 1AQUA 1D2HA 1G21E 3QBDA 4FGLA 5GGYA 3AEQA 1XMOB 2JGAA 2JCBA 1JAIA 2REQB 2R2AA 5CFPA 1I3OA 2B9VA 3TI7A 5L4NA 4EG8A 2O8FB 3K2EA 3PUIA 4QU8A 5GV8A 3W9YA 4TQAA 4PU0A 2OYCA 3T3NA 4YRBA 4P4LA 4PSKA 3PDHA 5ILOA 1ODFA 3B48A 4RVCA 2Q0QA 5TS3A 1NW7A 3UAOA 4C1NA 3HUTA 4POAA 4URWR 5HTKA 2D0DA 2QM0A 3ETDA 4OB6A 4OIMA 3MTJA 1XEAA 1E77A 5EPOA 2POQX 1UQUA 3UFXB 4MYTA 1FZTA 1JVNA 3ZCUA 1KIMA 4ND1A 4YT8A 3FAKA 3A9CA 2XT6A 1KEEA 2XMZA 1P7ZA 1D6NA 5J63A 1N8NA 1G7RA 1YK0A 3ANLA 3O90A 4AMUA 1HFKA 5FI0B 4W5RA 2Z2XA 3TOSA 2QR3A 5JPCA 3HR8A 5KWEA 3PNBA 8MHTA 1GUAA 5JVDF 4LGYA 1KNXA 2HSEA 5CU7A 1LJUA 4ZOBA 1B6TA 1EP1B 1WSBA 1KQOA 1AK1A 4KR2A 2IH5A 3S0JA 4O0LA 3RF6A 4RA6B 1HORA 3F9RA 2C99A 5C31A 4KXUA 1EZ1A 1RR6A 3EVNA 3IPCA 1GGHA 2JF0A 1UUFA 4YLYA 4LDZA 3JTEA 1MQAA 3KT3A 3HZOA 4CLXA 5C37A 4D26A 2RHBA 4M9CA 2VN8A 4BNYA 4Z9AA 1GM5A 3VPAA 1UH5A 5A4MS 3EXIA 4KRYA 5ALFA 2EG9A 2Z95A 1H2YA 4KB5A 4YCAA 2XCRB 4BFZA 3W4IA 4Y2JA 3OT1B 2HRZA 3AFOA 4COKA 2PTHA 1I01A 2QUBA 1S5PA 2Z4RA 5FI5A 3G2HA 1NR1A 2Q6LA 4HWRA 1AO0A 3RUAA 1WPXA 3I2JA 5DM4A 4F4JA 3NOOA 3RRYA 4IG4A 3B6ZA 4D6XA 4IRUB 2CVZA 4E7OA 5JH7B 1SVNA 5I9LA 4F3YA 3OOJA 1UZAA 5LZ4A 5G0TA 5HCIA 3FFWA 4AO8A 5D5PA 5CAEA 3UW1A 4GD3Q 3PFIA 1P60A 3PQDA 4GI2A 1NOIA 2FPMA 2RKBA 3HKBA 4ER0A 2IW1A 1E6UA 5I51A 4QREA 3FHCB 2WI8A 4CL3A 4F06A 4GZ6A 5J4VA 1MV5A 3UATA 3W2GA 3AUAA 3TD9A 1XRMA 1XZFA 2VF2A 2WSYB 3EF3A 2LCQA 1UP6A 1SBQA 1OWPA 3KEOA 2IZ6A 2WIDA 4EB0A 5BNZA 4CM4A 4QDOA 3KFVA 4MWDA 5AYVA 2HO4A 4O2BF 4PIPA 1RJDA 4AICA 3UV7A 4E6EA 2WB2A 2XT0A 3S29A 3H05A 2QSYA 4AG6A 1ZW1A 5L45A 4MW5A 1SQSA 1Y6QA 2XOXA 3DKKA 4XEUA 4I5FA 1FTQA 2VJMB 1F20A 2BFNA 3VR5A 4DHWA 3D02A 1P61B 3PPWA 3GDFA 4HT3B 1ODLA 1R9JA 3ESAA 1Q1BA 1G38A 1NW8A 5C8ZA 1V7PC 1KMHB 5HJEA 5F9FA 4I5EA 4C0XA 2J59A 1KJNA 5F77A 1CIVA 3S55A 5D7NA 4E3ZA 3DHNA 1JDBC 1I51A 1EA5A 4OHXA 1Z35A 2C0CA 3PC8C 4JC5A 4K9DA 5JLJA 3QENA 3W2FA 2PJDA 1YQUA 3HDVA 5CM9C 3UAXA 5TF0A 4YV2A 3AESA 1FUKA 2JI7A 4WNAA 3E3MA 4QQKA 4RJTA 3MHPA 3STTA 3U4MA 3GEEA 5JRDS 1GRNA 5FF9A 1YZQA 1QG4A 3BMOB 2B8JA 4E6PA 3OJLA 4KO4S 3K71B 5LXTF 3KQUA 4G1CA 1GNVA 5AK3A 3I2HA 2AC4A 1M2HA 1ZSVA 3AEZA 1RQPA 2CHQA 1I9CA 4Z86A 3WYEA 4WBNA 4OI2A 1G1MA 4OMUA 1O2DA 3LSTA 4QU0A 1Y4ZA 1N92A 2OGZA 3DTVD 3HCDA 1MAVA 5DB4A 5K3SA 3VHLB 4V1CA 3NALA 3CN7A 1DE0A 2BFMA 2INGX 4PF1A 1H2HA 3CEPB 4R31A 2Z56A 3KDAA 3M81A 5TJ9A 2V0NA 4F5DA 2OVFA 1DAPA 2Y4OA 1MF7A 2O7SA 3EXEB 5CA1F 1U99A 1RYDA 1ZGGA 2D5BA 3FDIA 1GLVA 4LWPA 3IT3A 4QRHA 3A1CA 3DLPX 4RLHA 4XWKA 5LQRA 4WKPA 1SQFA 3BGOS 3ZCTA 4R9RA 1DSSG 3M5CA 3IOYA 3KPWA 3H84A 5B37A 4RLQA 4PAQA 2H1CA 5L8VA 4DR5B 2QL5A 1GL3A 1RFLA 3F2IA 3F5QA 4B85A 2QR5A 3SJ7A 4FC7A 1U6KA 4ZODA 3ACCA 1XPOA 2JIOA 1CVLA 3KDSE 1BVHA 5K4HA 3K4HA 3OMWA 2XE8A 2YOFA 1W29A 2C9CA 3S2IA 4BO9A 3FNRA 4EVRA 2MTBA 2UVQA 5KYKA 5BW6B 5IX8A 3AUTA 4MR7A 3RGGA 3WB0A 3ISJA 4B4KA 1MW8X 1SUSA 2ZWOA 3JD0A 4CV1A 3D4PA 3WWYA 4R84A 4AYTA 3ZWDA 4WA7A 3R5JA 4KMSA 1HV8A 5KAMA 5LB4A 5AJWA 3RC9A 3SOZA 4BBPA 4EF4A 1GG9A 1QDLB 4FBGA 1NAIA 1NBMA 2C2ZA 1JFFA 2O6LA 3B1WA 1HYEA 3NHRA 4NICA 1UC9A 4XUGB 2DVMA 2HHJA 2XVXA 4KNWA 3I37X 5F12A 3SC6A 4MKXA 3MNFA 2CMGA 1ZRHA 3QQPA 4PZUA 1T5IA 1DV2A 3GJXC 2BP7A 5JADA 4RS3A 3ZW9A 3CMMA 3BD9A 3UXHA 2OL4A 3BCRA 2O5VA 3A9RA 4AY2A 1EFTA 1D0IA 2PMKA 5CX1B 3REQB 3U49A 3ZDQA 3SBEA 1QHYA 1YOVB 1X8LA 4R16A 5MGBA 1RPNA 2P27A 4L0MA 1NYQA 2G82A 2L17A 1ISRA 6AT1A 1UBMS 3DE5X 3E27A 5GONA 2FPIA 1U8XX 1AKNA 4FGSA 3I9MA 1Y7HA 4JZKA 3NORA 4L02A 4L8GA 1QTRA 1Z06A 3FNIA 4J0HA 5DJ5A 3QXXA 2FUCA 1NQTA 1Q2XA 1WMBA 2OZEA 3KQTA 4L6AA 5TSDA 4DPKA 5F23A 3F49S 1VL8A 2JLAA 2C58A 2KBFA 4QRDA 4F2HA 3FPGA 1V9SA 4HDSB 4AWXA 2YWXA 4MW0A 3SIXA 4M0LA 5SICE 2M6LA 3HRKA 3EZNA 5EZQA 3FLEA 3SX4A 1I33A 3TW8A 1I4EB 4X8HA 4UREA 6YASA 4RZ2A 4NCKA 2XBMA 4DR6B 1JFLA 1X1QA 3NBZC 1XJWA 1UMBB 1ZNZA 1MDFA 2YFKA 3L01A 4P3OA 4C0JA 3P32A 4AF6A 2EX0A 3MJEA 1HE5A 1WDWB 4ZTZB 2B8NA 1BRMA 2EZUA 4QNNA 1OC4A 3NEJA 3U6BA 3SC2A 1QWSA 1KZ4A 1ZICA 1NTRA 1JLLB 3B3JA 4BATA 1WP4A 2HMAA 5I4KA 3H99A 3LFUA 4B48A 1QCCA 3HUEA 2FRVA 1J0BA 2YMLA 1IBCA 3L04A 4YPOA 4HRAA 4GP6A 1XZDA 1W36B 4RTPA 2AFVA 2ZR9A 3ROGA 4XWYA 2QG6A 3WFZA 1OU0A 2CXNA 1TVCA 4ZO7A 1GUZA 2JHPA 2Y1OA 4DVGA 4ED9A 3RC8A 1GTL1 2BFCA 4WERA 4IGEA 3FUVA 4KR7A 3F5FA 1CY7A 4FFNA 2EJBA 3ITKA 4GW3A 4L75A 5E1BA 4ZV7A 1M34E 5BN3B 5L40A 1L1EA 2IRWA 2Q0XA 4GAEA 3T3GA 3ZXIA 1NW4A 5KQRA 4NBWA 2JGJA 1ULTA 2C0PA 2Y6VA 4HQ0A 4NABA 4B6EA 4CTJA 2XB2A 4ENUA 1PT6A 1BNCA 1JWAB 2B1QA 1NSTA 3ZVMA 2F8SA 3ZK9A 1XMJA 3GJ7A 3OPYI 3WHLA 4KTVE 3PHGA 5JPIA 1X9HA 4UM9B 3U4IA 3NHPA 3TL3A 4ZU3A 1US8A 2WJVA 4JLDA 4O0MA 4FZRA 4IQ0A 3AP2A 3G0DA 4RFSA 1OI3A 1W5BA 1M2VA 1RHJA 1Q17A 2CNWD 2QMZA 2DY1A 2FEOA 2R00A 3HGQA 5I01A 2ZJ1A 2OO5A 1NJ5A 2H1FA 3H9EO 3WGHA 3LHIA 4MS4A 3WQRA 2WPDD 4MZXA 1RRFA 2JIZD 2TMDA 5PGMA 1H2XA 3NDJA 4IP0A 1RLTA 2IELA 1N1GA 4AMBA 2WKQA 2JZOA 1AUPA 2NUAA 3QE3A 5IC5A 2QY9A 5A71A 4CIAA 3EPJA 3VU1A 3D8HA 1TFRA 2FPUA 4XWGA 2IX9A 4W63A 2X0KA 5CURA 2X14A 2GPTA 4BAZA 4D3FA 1IN4A 2PT7A 1ZU5A 5ALEA 1N9ZA 4KPGA 4N7JA 2VT7A 2J67A 4M86A 1JPVA 1U9YA 2VDMB 1NRXA 4LYGA 2OPBA 2WJIA 4KQ9A 4H1TA 2FZLA 5MFZA 3U7GA 1ZH6A 2ZJ4A 2OUKA 4BNDB 4L85A 2F3QA 1J0AA 3SS7X 3DGFC 1MAWA 4RHXA 4AUKA 8AT1A 4TYWA 1B23P 2A86A 5K4AA 2AR7A 2BHRA 4GBMA 2HPZA 4RSMA 3LUCA 3COPA 3TD2A 4DCCA 2NU9A 2OXRA 2WKPA 3W79A 3CRQA 4HNHA 2QQEA 4RVDA 4XM1A 2ZR7A 5EJ7A 3CNNA 3EQ2A 2ZYSA 4HLQB 4KE7A 2VPYA 2PHZA 4MB6A 1E79D 4NZ9A 1J2YA 1O5OA 3WGVA 4ETNA 1SJ9A 3KLOA 5HILA 1J20A 5GAJA 2UZIR 4LTMA 2J9FB 2FW0A 1FMFA 2GPJA 2IXGA 4PYRA 2P9YA 3I2IA 3MCUA 2V9ZA 3UC9A 3BIJA 1M3SA 2QENA 5CDGA 2A8YA 1I3KA 3C6KA 3LGXA 2PSEA 4R9UC 3WSTA 3LCVB 3AJDA 2DWUA 3PHHA 4EYEA 3IP1A 1U8YA 1DXHA 2O06A 4JASB 3ZXXA 1CETA 2IS4A 5BVHA 3H5NA 3OE7A 2F1RA 1VGVA 3OZVA 3WS7A 4PZLA 2JHFA 4KFCA 1JQAA 4KQJA 3KL4A 3LBFA 2K2WA 1QDEA 3S2GA 3WRXA 1KA9H 1ELOA 1OYYA 2YW2A 3DAHA 3TBKA 4YY3B 4IZ6A 4KO3S 1VTKA 5U4QA 3L18A 1ZGJA 2ETVA 3KAJA 1I6MA 2RC6A 4MOWA 3BB4A 2NTNA 3HFSA 4YWHA 5H5JA 4YDQA 4E4RA 1TYBE 3QPBA 5T6BA 5K05A 1T4DA 3KK0A 4FVTA 1GDHA 2FH5B 5CBPB 5K01A 1I7DA 1Y98A 3B9QA 5DXAA 2QLTA 1PZMA 2BAGA 2PL3A 2QHXA 5G2OA 3QMVA 1P5FA 2Y1KA 3IP3A 2HCTA 1G6KA 1DRKA 2HRDA 3TNLA 4JI4B 4EL0A 4HGZA 5FTWA 3F73A 3WB1A 3LSYA 2NVUB 2MSEB 2A4MA 2FOXA 4KI0A 4QATA 3WIUA 2AX4A 2XT9A 1I5RA 2JEYA 1LCIA 2YZMA 1OXVA 3NTUA 3V4SA 4AULA 5JJCA 5IAGA 2PKWA 3AB3A 1R0KA 2FX2A 3G3EA 3GLRA 1UJMA 2FPGA 4FHCA 5I6DA 4ZCQA 2W0MA 3J81k 5EOVA 1IOZA 1HO3A 5EP3A 4CQLB 3RTEA 4A3SA 2Q8QA 4UTRA 1G1AA 2YQ5A 3CZ5A 3M7IA 4BU0A 3RS9A 5FLEX 2AEFA 3GN1A 4Z0PA 4AX8A 4P3NA 2C5SA 4JBNA 1PWXA 3KQQA 3CURA 4LHVA 3NC4A 2BFAA 4RPGA 1RM5A 2JAQA 3E9EA 1GL9B 3ELBA 4YBRA 3MINB 4M2LA 1VGQA 2A9VA 2EBUA 2VWGA 2A94A 1MPTA 3FBWA 3NB0A 4DCMA 4PO8A 1YB4A 5KX5B 5ELLA 2QRPA 3DJYA 4QC2A 3G9TA 2HV8A 2LCIA 3OOWA 1IRIA 3K2BA 1N77A 1JTVA 4CUKA 5HOEA 4B75A 3F4LA 3IH5A 5FUYA 3H1GA 3S2SA 5JO9A 2VXYA 3N8KA 1POWA 1G2OA 1F0YA 4A5SA 5LQMA 3PQ2A 1HE2A 2OHJA 3HJFA 3TR0A 3VKGA 1A82A 3GV0A 1A9TA 5EXTA 2P9JA 2VP9A 3EDYA 4LW8A 4NZYA 1NJSA 1JRLA 3MLBA 2PY6A 2WUGA 5EERA 1ZUIA 4BU1A 4BLRA 8ADHA 3OJFA 1NW9B 4M9QA 5I5EA 2XDQA 4OXQA 4DYHA 1ZI6A 2ERCA 3KR9A 1K4MA 4PLFA 3DXXA 3HB4X 4JLMA 4E15A 2XNDA 2J5BA 1AH2A 5IBRA 1U0JA 3L6OO 4ABTA 3N0XA 4BTLA 3H8SA 4HWKA 5IBQA 1JJAA 2PBRA 3IODA 1WLSA 4XE5A 8ABPA 3A6DA 3CCCA 1KYQA 3FH0A 3KWJA 3UTDA 3AJEA 3O8CA 2IZ5A 1XFAA 2XGGA 2C4UA 3I8SA 5BQOA 2O19A 1QGYA 3KYIB 2V6MA 3PDJA 2HWWA 1FTYA 3F5MA 4H7EA 1YB1A 4KLAA 5LD2B 3IUSA 1DJPA 2CJYA 2GRAA 3SYLA 2N42A 3FZYA 3VI3B 4JOCA 7REQB 3CVYA 1H4VB 2QW8A 2HDWA 1H8ED 2R4QA 3FY4A 4D42A 4M8NE 3LHFA 1QLWA 2IOFK 1NDQA 1RBMA 4JJKA 1IJEA 3HBMA 4WCVA 3F96A 3RVMA 1NUHA 2ADMA 1JLSA 2IGTA 4J6FA 4BNDA 4YRJA 3O3NB 4FE7A 1TT7A 3ZHOA 4RZSA 3COJA 1K5HA 1R5NA 5IVDA 5T4BA 2XTJA 4XB6B 4YRIA 4D99A 4P92A 4UUBA 1NR7A 2P3OA 4AKHA 5DNCA 2VTDA 3E18A 3DHEA 3LL4A 1YBMA 3PKJA 1DMSA 1YOBA 4HRYA 1L9KA 1C1YA 5IDYA 1DKRA 3FZGA 5HFNA 2QZ4A 5CGQB 1WXIA 3F1LA 5KAPA 2GN1A 5G3ZA 3WOVA 1T4MA 5GV7A 4TMVA 3RS0A 4CLOA 1VMAA 5M34A 1RMTA 4G85A 16PKA 1RHQA 1RIFA 3PRJA 3ZZNA 3PUXA 1ZSNA 1E3DA 3KC2A 1IE3A 2WSIA 1Y1SA 3PGJA 1RI5A 4LJKA 5T6MA 2YN2A 3K31A 5HKOA 4H15A 3WZ2A 1M2OA 4QOJA 1MXFA 4FDUA 4X95A 3A0RB 1IHPA 4GYYA 5JNUA 3DM9B 3CPJB 1JFSA 2CNBA 1U0OC 1WKCA 3QVWA 1JT2A 1NQAO 1DWUA 3LBNA 5FFNA 1UFQA 2FKAA 2Q8PA 5AKYA 3F2VA 3RAGA 2V65A 1M73E 3KYJB 1QG0A 2GHIA 2EP7A 3H2BA 4P81A 4R81A 4CKWB 3SVLA 2OCDA 2R6ZA 1JR3D 4D44A 4JGGA 2ZYHA 1A8PA 4MRPA 4NZZA 2QBYA 3JYOA 1T9ZA 3LLCA 2VSQA 3B5JA 4LBWA 1GAWA 1YU9A 3H7AA 4OXYA 1W1UA 4LI3X 4I4TB 4PWZA 4YAEA 4A0RA 4DMFA 4OQ4A 4KNVA 3O8OA 3DWGA 2HWYA 3AV3A 3V7NA 3JQBA 2PS9A 1E4EB 1SZDA 2FZ4A 1ZH8A 2BDUA 1NBEA 1ECJA 2HZ7A 5K0SA 1AMNA 1W34A 4M3NA 4OAOA 5ADVA 1L5QA 2H85A 1H93A 1RWBA 3LPLA 2VPWA 3H1PA 3RQSA 5LYJF 1K7XB 2Y0EA 1GGNA 3INGA 5BWMA 1F3OA 5IZCC 2BKAA 4HFJA 4E5KA 1YQTA 1ZP6A 3HJTA 4FR2A 4IBOA 4EVSA 5JZMA 2GZ3A 1CRLA 4G23A 3U9TA 1MGPA 5C80A 1RCFA 2YIJA 3FGPA 5HKKA 3K9WA 1R6VA 4NPAA 4PYOA 4JLKA 2J3LA 3R7DA 5HS4A 3H9CA 2B61A 1L9XA 4LY9A 2AQHA 3JY6A 4WN9A 1SA0A 1V4NA 1J24A 2NN3C 5DVZA 5EA2A 3RARA 1Y8QB 1Z0AA 1FU7A 1GSIA 1Y89A 1O57A 2B2CA 3QNWA 4ZCTA 1WXXA 5C1BA 3WGMA 2J0VA 5KWIA 1C9MA 1YJXA 4KFTA 1U3TA 3BZBA 3C3AA 3I5MA 4V3BA 4UNQA 2B4AA 1GITA 5BRAA 1BE6A 5BUSA 5G1PA 3DL7A 3NWEA 5IZCA 3SS8A 1CQIB 1P7CA 3BRCA 5FWXB 1YE5A 2J33A 1HYGA 4QPZA 1JPUA 2GBIA 1M72A 1T4GA 1DL5A 3UXEA 5B4TA 2V8BA 2VQEB 1FZQA 4DLAA 2DPLA 1ZJZA 1GGJA 1P1KA 1QIJA 2XIQA 3MQFA 4KX3A 3RYFA 5DP2A 5JSHA 4J0DA 2VDWA 3GQBA 3FGNA 4KMRA 5A06A 5ITSA 1NG9A 5A02A 5F7ZA 2I78A 3E82A 1NOKA 4QJ5A 3U4HA 1MNQA 3D5TA 1UPUA 4OPMA 3WGJA 4HDSA 2H4WA 1HDIA 5TXGA 3WLKX 1GZ4A 4RHTA 1Z7WA 4XR9A 2OV2A 1LBQA 3DD5A 3FF4A 1E3LA 3W5AA 4FNGA 3NTQA 1W59A 4KQXA 5JAZA 5MFPA 3WLSA 1EX6A 4CIBA 3I61A 2F2TA 5HKLA 2CE7A 2YYSA 1KYWA 5IPFA 4EB8A 2E5WA 2B2NA 3G1UA 1JDTA 3GP5A 3CN9A 1XA0A 4HUJA 4MVJF 4PM4A 2C00A 2O23A 3N39C 1UZNA 3A36A 3AJ8A 1Z3CA 4H4DA 2OXCA 4GXQA 2OFWA 1NBHA 2SHKA 3FI9A 3PKIA 4AQDA 3BSWA 1JH8A 4TM8A 2PWYA 2Q1TA 1HFEL 3DUWA 1EP3B 3W7VA 4BYGA 1QU3A 1KF0A 3IA2A 4K0RA 1KETA 5SYNA 3VNBA 4BCCA 4CM1A 3KKLA 2FK7A 2QJRA 1LI5A 4TMWA 5L6MB 3K3PA 3IOEA 4RY0A 1LDGA 4OP1A 4UDXX 5JROA 3TQFA 1FVOA 2VF8A 2H5EA 2FZ5A 3BFVA 3UNXA 1ZVKA 2W6IA 5IJXA 5BO5A 3U62A 3W8DA 2QI9C 1O8BA 4UOZA 1W4AA 1J33A 2QMUA 1GEGA 4X92A 4BTEA 4PBSA 4MQBA 3EMVA 3F3YA 1BFKA 1I2CA 2F1KA 1RHRA 3AF1A 4JJ8A 4DDTA 4P6VF 4FOTA 3VX4A 1THGA 1JQLB 2I29A 4GH5A 5K8JB 2IXDA 4K9SA 4EHNA 4FMPA 4UHHA 3A32A 4KE8A 1DLIA 1CQWA 4YQYA 1G4AE 3VYTB 2I4MA 3WDKA 3DMPA 3IC5A 2KX7A 3QX3A 1E1KA 4B2IA 1UPTA 3H4IA 3WXBA 1I6WA 2IEIA 3K1ZA 4Q9KA 3CRNA 4GDMA 1SULA 2YUTA 1P44A 4CYMA 1MR3F 3BRSA 3OCJA 3O3CA 1J5EB 2XWQA 4TL9A 2YWFA 2QUHA 3VPXA 1AKQA 1HG0A 4TXLA 1KYVA 5AOBA 4G0XA 2BR5A 4CHTA 5ICSA 1RBZA 2AFHA 4HC4A 3IUJA 2JLRA 1SCBA 2N0SA 1V11B 2NSHA 2YV5A 3BGVA 4XTCS 3IILA 3OKCA 2XYQA 5JAOA 5C5IA 2PM8A 2GEJA 4I14A 3CA8A 3DVAA 2CYBA 3QNUA 3MYYA 2YS7A 2QMOA 4GR9A 2ODBA 2I6FA 2VF5X 2MSLA 1RMYA 1YIAA 5E0KB 1CX9B 4D0NA 2DBQA 2ZR0A 4JVLA 4HB0A 5FOQA 3H5IA 3A1VA 5L3RA 3EIQA 1UBRS 2C4WA 2Z2KA 3KEQA 3P94A 1X8JA 1L4MA 1TCUA 2G76A 2GM9A 3AVQA 1LPBB 4AXBA 1Z9BA 4Y0NA 3ZLVA 2OP0A 2RMKA 1NQUA 3PD1A 1M7GA 2NUAB 4A82A 3IMFA 4RFSB 4LOIA 4MVWA 5DW3A 3E1KA 5DRTA 1AF7A 2Q29A 3GRVA 1K8QA 1THZA 1NTOA 3FVWA 5IUKC 1PLKA 4ZO6A 4DSTA 2AG1A 1QK4A 4GNRA 3V1TC 4BVFA 4D9GA 3O4JA 3UGKA 4E5YA 4V0OA 4GKAA 1ZMXA 2WMDA 3BG5A 4V0KA 5F5XA 5CG2A 2Y77A 1CQJB 1RMQA 2P79A 4ENWA 1LPSA 5J1TB 1JHYA 3OD5A 3ZYZA 3U81A 1OGYA 3B1JA 3KS9A 3O8BA 4P3XA 1Z0FA 2ORED 4R2XA 4B3JA 4ZQBA 2UZ1B 3HXLA 4U2FA 3L8GA 4LY3A 1RAAA 3G8BA 4Z0NA 3SY8A 1AQIA 1F2TA 3E7PA 2HA4A 4Q1DA 4X71A 5CP8A 3ROFA 1ODSA 2BI4A 3VGJA 5E1DA 5CLJA 2Q3LA 1NF3A 3UV3A 4MB2A 2QU7A 4RE6A 1R7RA 3FTCA 1ODKA 5E4FA 4ZAWA 4F56A 4NMXB 3D8TA 2WWXA 3TRJA 5ALPA 1NVUQ 4CLEA 2AFIA 4KQ6A 5AKKA 3REOA 2YZGA 3NIDB 5KYWA 4KXXA 4AURA 4TT8A 3KE9A 1C1DA 3LX6A 1W5EA 4DIOA 4FWTA 3DMNA 2HO5A 2YR0A 4TQUS 3T3HA 3WLTA 4ETMA 3ON5A 4N49A 1N6OA 3HSSA 4I08A 4U3JB 2R6R1 2XMGA 2W70A 1LTKA 2DTXA 2RGRA 1QIDA 3BF7A 5AIBA 3K5PA 1O6CA 1F6WA 4IGFA 3ORFA 4P0PB 4EUKA 4LXGA 1M2EA 5IULC 3MUOA 1JHUA 1L3BA 4DV6B 2HLDD 3SJUA 2IV3A 1SQGA 4FEGA 2HMYB 4HJRA 4MW2A 5DHTA 1IEVA 1L4EA 4YB8A 1TL7C 5K0TA 2B34A 4G9BA 5CXSA 3MJHA 4LWZA 4LSZA 5F78A 3QWBA 4MCJA 2GARA 4UAGA 4U1RA 4UARA 4C0AC 2Q99A 3HA2A 3IMKA 4Q4DA 4FOSA 4X3CA 1N2SA 5D7BA 1ISHA 1N7IA 1P1RA 1O97C 3HACA 2R8ZA 3NHSA 1H3FA 3SLGA 3OE5A 2XE7A 1FTSA 3WYCA 2A5YB 5DGIA 3C3JA 3O3OB 4H27A 3UIEA 1V48A 3RUDA 4EOGA 1FW8A 2FMKA 3ICWA 4AP6A 5HWSA 1ZUHA 4N6OA 3DFKA 3B9PA 3TQSA 4MGIR 2N75A 1GR1A 1G8PA 3QHQA 1Q1GA 4LRSB 4CKBB 3N7TA 1XTBA 3EODA 4M6WA 3GOHA 6NULA 4OGFA 3OPNA 2QD2A 3R3YA 4KO8A 2PDAA 3UJBA 4NPCA 3W6UA 2IUFA 2FLKA 4XLTA 4G1MB 3G5TA 4G9GA 3CH5A 4REQB 4YJ3A 2ZS8A 4OU4A 4C5BA 5JNTA 1JR2A 5LA6A 3WHPA 1TJYA 5AKXA 1LK7A 1XLUA 4AMYA 1KMCA 3E2IA 4FU0A 1JDZA 4ZJPA 1LRKA 5C8YF 4MR7B 1PYDA 3T3PB 1BDIA 4N8DA 3OM8A 1R6BX 4QPDA 4Q4HB 1GPH1 1D1TA 1U7TA 2BC9A 5FL3A 1DARA 1E1QD 3AFNA 1ULAA 3GX1A 5JWRA 1Z6TA 5KVQA 3QX8A 5JJBA 1DZIA 3TMYA 1P6XA 2B4KA 4BQOA 2NTVA 4W7SA 1MOPA 2Q3FA 3B13B 5BY2A 2WNHA 4TT3A 3NAGA 4JI6B 3IIJA 3AHEA 4UZSA 3BD6A 1N2CE 4I8IA 5BXQC 5HPYB 1K5PA 1HSOA 3MFQA 5E2IA 5D86A 5FBVB 1AZWA 1LFAA 3URKA 2DQKA 1I2MA 1DKPA 2GJSA 1VPLA 3IVCA 2H11A 1YSCA 1Z4PX 2ACEA 2VNAA 4IFTA 4HI0E 2I7CA 1HMYA 1HYBA 2Y1XA 3LWZA 3RROA 2OB1A 2G07A 2DH6A 5EWMA 3FM9A 1JQBA 1FUEA 3GT0A 4DSZA 3FAZA 2XF8A 3CF0A 3NCHA 4BMNA 5KWJA 2QTVB 1Z82A 2FWJA 4BJ5A 5DP1A 3WKEA 2VK8A 3FXAA 2R44A 4YUAA 2JZCA 3PS9A 1WXDA 2CL7X 1KL7A 2BMWA 1XF1A 4ZU1X 1J09A 2VT6A 3AR7A 4DAEA 2QTRA 3TDNA 1TA0A 4XI9A 1E60A 1C30A 3HP1A 3VNSA 5KKAA 5G0WA 1DC3A 2WZCA 4UXIA 1OXTA 4GT1A 1NVDA 4UXJA 1LRLA 2V5UA 3C7CB 4A92A 1DFGA 3E4DA 1SOAA 3N0RA 4V03A 2G1UA 4B76A 4A36A 1RXCA 4MW7A 1P8AA 1N8TA 2LKCA 1PJQA 1FEZA 2G08A 2Q7XA 4AN4A 4DYVA 3EFEA 3ID6C 1QUFA 2GEFA 5DYNA 3DMFA 1USKA 2QLNA 4J2OA 5JT1A 3U60B 1E98A 5B3AA 4BE4A 5JYBA 3U56A 1E2FA 1T2AA 1UL1X 4NARA 5CFZA 2UZ1A 2PXAA 1Z0UA 2WDPA 1CFZA 2VHYA 3C45A 5JDIA 3U3RA 2OV6A 2R97A 3CVWA 3NIFB 3KZ1E 4R69A 2F1HA 3LUJA 4RTKA 1DKNA 3DCYA 3KQNA 3EEBA 1OXMA 1PUJA 4IKOA 5IC4A 1UOEA 1BCRB 4XWAA 2FPWA 4PSAA 4ZI7B 3AETB 5C8DA 4X8OA 4FSXA 4AXXA 4DMGA 2PSFA 2BZ1A 2EVWX 3LW8A 5KYWB 1YZNA 5FD8A 4ESEA 1A3CA 1AE1A 1U0RA 5CCBA 4FR5A 2GBCA 3LECA 4G56A 1X8XA 4WKBA 4I36A 5H81A 3LLUA 1SO8A 2XITA 4P2BA 4XJVA 1T9CA 3Q5EA 5LOVB 2MYPA 3GHHA 4G41A 4G1FA 5KU7A 3EPKA 1VI5A 1T5DX 1GAXA 2G5GX 4AQYB 4AZ3B 3INNA 2VP4A 3GC6A 1Z4LA 2ZRKA 3F7NA 2WAXA 4FGJA 4YTEA 4RMHA 3VV3A 4CMGA 3QU5A 3LDUA 3R74A 1PX0A 3EFBA 3W5BA 1GQQA 4TWJA 1FRVA 1QVRA 2BJHA 3L05A 3IL2A 1NURA 3DOUA 3O94A 3QVLA 4XEHA 5AM0A 3AL2A 4AZSA 4DIBA 1EQAA 4C4SA 5A3JA 5DCLA 3LNCA 3L7DA 1N6IA 4Q1AA 4N5HX 3ZE8A 1DU4A 3PXAA 3E22A 1WD7A 4HN4B 2GK7A 4FS8A 3TD6A 4DV1B 5FWAA 3GJRA 4Y0VA 4JBLA 3ZLTA 4MW6A 3ZHYA 1Q21A 3SF8A 4DVJA 2QSUA 3K8OE 1YQEA 1QPBA 3CWZA 3VMFA 4YAWA 4WCFB 5KTNA 5KQMA 4G3XA 4DCGA 3DXYA 4LIPD 3TQTA 3ZW8A 4G0VA 5HZHA 1LBEA 4Q9LA 1UJ5A 1U94A 1BHJA 1Q1EA 4ZEOA 4HK4A 5JTTA 2OOSA 4D3SA 3VSAA 2BBTA 1JIVA 2PUHA 4V0MA 5E3JA 3WP0A 3P0EA 2XB8A 1W9HA 4PLYA 1LQUA 1QGOA 2ZB4A 4XYLA 1A2OA 1Z56C 3ILYA 4NAHA 1UK8A 2BBOA 1PJ8A 1HM5A 4QXPA 1TQHA 1XKLA 2XD4A 3OIYA 2EDAA 4NNPA 4WESA 3LY8A 4WY8A 4B8ZA 3S7TA 1MEEA 1WCXA 2HV9A 4QHTA 4DIDA 4Z51A 2QTVA 5H68A 3VOAA 2J85A 2JFUA 3W5IA 3AKYA 2QR2A 3JVDA 4GMFA 4XDZA 1H5NA 4D41A 2PZJA 3FVQA 2C7GA 2R1ZA 1Z36A 1U3FA 3QFRA 4HTFA 4IXTA 4J90A 5SYAA 3ZXUB 3K70C 2FX5A 1V1MB 2XYVA 1D6SA 2PEZA 3GWGA 4C7JA 1T15A 4O2RA 1Y3CE 2M6KA 1A8QA 1ISMA 4MITA 4P93A 4IOJA 3UJPA 1D9ZA 1PEAA 2ODPA 3L1KA 2ZSHA 5D3QA 3HQ4O 4D0LB 4F97A 1GFWA 4HG2A 5DCUA 5JXWA 5B1IA 1ZVVA 2TS1A 4N48A 3H8VA 4F86A 4XJXA 1TMGE 5FTMA 3OZWA 3G0HA 4DMRA 3EXG2 4AJPA 1XMSA 4EG0A 3UG7A 4RXUA 4RL4A 5LMCA 2PA0A 2IE8A 1AK9A 1GZVA 1LNZA 1SHTX 3KQVA 4BTVA 1LPOA 1IQUA 1EB9A 3OO1A 4LYHA 4QEKA 1KY2A 3CUYA 4LKRA 2VHEA 3L4BC 2VSYA 1P2GA 1UK9A 2OP1A 3FA2A 1UEXC 4O29A 5H3CA 3TJZA 3VZBA 2OILA 3IKJA 1H5UA 1CUWA 2IHTA 5LZ2A 1CG6A 2VRCD 2QVLA 3PITA 5DI3B 1BD3A 3NFRA 5B7NA 2UUPA 1G5IA 1ZNQO 3OIGA 3EYAA 3PHCA 3PX2A 3TTVA 4EF5A 1CRZA 4RIFA 4TLLB 3RAPR 3PIRA 1HDGO 4TVBA 4MQ5A 3KEGA 5AIAA 5CA0B 2QT9A 3CLKA 5I47A 2B83A 4YONB 2DPXA 4ZP1A 2MOKA 4BS9A 3NUQA 1VIYA 4FOOA 1WBBA 2X22A 3PUKA 5D87A 4D4KA 2CUKA 2R1VB 3JR7A 3OH8A 4W6QA 4B6GA 4KHPB 3GLGB 1LS6A 1KDRA 4QLOA 2RJOA 3PPVA 4CR6A 3UVEA 3OMXA 4IJKA 4W9MC 4IHKA 2YVLA 1IHXA 5D5HA 4JSTA 4WNIA 5B1EA 4G5RA 3KVOA 1OY1A 2JH3A 2WD7B 1OZAA 5A3VA 3OU6A 4QUDA 1YR9A 1JFVA 5K20A 2C8VA 3PTLA 4WCFC 4BJ3A 2I4RA 4GWGA 2QUZA 5EIFA 1W52X 5CFNA 2WV7A 1H8HA 3E9CA 3HEMA 4RYLA 4D9EA 4R0MA 2I6UA 3I3OA 3UGJA 4DKJA 3C4JA 3C1TA 1J23A 5H70A 4WADA 1S3SA 2HF7A 1BGXT 1IUPA 1PEDA 2O2DA 3H2HA 3O92A 3PXCX 4O4LF 2ZK7A 3FCAA 4NBTA 3KKOA 3PRHA 2QRMA 4XSVA 1IK6A 5AUQA 5IT4A 10MHA 2O8BB 4KHZA 1TM7E 2W2MA 2WAYA 1ODCA 3DQQA 4YQZA 5CYGA 3AINA 3E23A 2PGXA 1A9XB 1OI2A 5K3EA 2ZWPA 4N7MA 1E7QA 1PBNA 3DQPA 4FYYA 4MV5A 1L5YA 2IZ1A 4R0VA 4EPXA 5AVJA 4WOJA 3U31A 3MILA 1N5MA 3I9NA 4FFLA 4RLFA 3WLRA 1I4LD 1A69A 2J5KA 4RU1A 2IHBA 3GLFA 1DLJA 1ZBQA 4JP2A 3U4CA 1KH3A 4IH4A 4B6OA 5F2NA 2X4IA 3OO0A 2HK7A 3EF0A 3C39A 4IZIA 2R60A 3HVIA 4JEUA 4BFTA 4HQOA 3Q7TA 4YR7A 1JL3A 3GRYA 1BWRA 4C4ZA 5FUWA 4CL8A 4H6WA 4EY7A 1WB4A 1YS4A 3PPIA 4OHOA 3SDSA 1J0CA 3FR7A 1F06A 2XEXA 2WJ4A 1Z2DA 2EZ9A 3RT7A 3L2OB 3KWLA 5JC1A 2M1XA 5AJHA 1Z68A 2GVNA 2W93A 3ACDA 4FEYA 5TX7A 3QG5A 2P8SA 3RRBA 3BMQB 4GQBA 1CF2O 5FPTA 3UJ7A 5HK8A 3T95A 3C24A 5AVUA 2HM7A 4FMBB 4F92B 1D07A 1JFTA 3PEYA 4QO8A 1OBFO 1XKQA 4GUAA 2QLJA 4LE0A 1V16B 3MUNA 4WGFA 1NNEA 1QC5A 4XRGA 1CY4A 2RONA 3AR8A 3DKRA 3VH1A 4HSEA 4AMGA 2EP5A 3AHJA 3H1FA 5JHHB 2O8VA 4US2R 2JGDB 1U1FA 3AILA 2HF9A 4P80A 5DNYB 1QRTA 3ZJTA 5KYNA 3L4EA 3DPSA 1EIZA 2MINA 1W1IA 5FP0A 2FQWA 3JYNA 4K9RA 4TV9B 1AUXA 2W00A 3OCCA 1I6LA 2WHQA 2X15A 2XIJA 3CTMA 1QTNA 3AERB 3IR6A 4K88A 4TVOA 3SJZA 5KJ1A 4I2VA 4U2GA 1NP6A 2UVDA 2XOKD 3I9JA 3QW2A 4B6FA 4BQIA 1D2GA 5FEMA 2OSVA 2C2YA 2NU6A 4GMHA 1U7OA 1FVHA 2KBEA 4XIGS 4UM5A 3JVUA 2QLLA 3K9LA 5IUNC 3GEHA 4MRSA 1S3IA 1DKOA 5E6UA 3DLAA 3FOAA 1R0WA 3RTBA 5L3VA 1I30A 3I73A 5SZKB 3WYAA 5DI9A 4PYJA 4BZZA 4O4HB 3EZ2A 4G63A 5EJAA 1JSRA 3QP9A 3RRJA 3R4VA 4PINA 2XI4A 2WJPA 2RHTA 3FFBA 1TLLA 2KJQA 3P4UA 2ZT6A 4OJMX 4D3YA 4ZI3A 1QG2A 3EZFA 1P7WA 4C4OA 1KMHA 3T1TA 4EIWA 3A2MA 2BF4A 3SYRA 4BN5A 1BN6A 1G0NA 1GG2A 1RT9A 1XU4A 1YKSA 7YASA 621PA 4LXXA 4N3BA 4Z4HA 2JGMA 4QXOA 1JIUA 4QUIA 4DM7A 3GFRA 3ZD7A 1K66A 1IVNA 1VG9B 4GR5A 2QWXA 2LXNA 4HWTA 1DBRA 3PR3A 4YAOA 1TM3E 2WEKA 2D0IA 2EFDB 2RAPA 5A4FS 3RU2A 2CCJA 3JWJA 1F2DA 3KAKA 1VJ5A 2CHFA 3C70A 2JGLA 5GJBA 3L7YA 3FYTA 4HS9A 3USCS 4NXMB 5HMLA 4HLUC 1OAOC 1G5QA 2QX9A 4CGZA 3Q10A 1CBUA 3NAMA 3R5XA 4B9EA 4HAIA 3KPUA 5JZ9A 2CHVA 2JEOA 1XOIA 3VR3D 5M5BA 1LSSA 5TQ0B 4MKGA 4LY6A 4WJKB 5CBPA 1O6ZA 1ZK2A 3MJCA 3Q3JB 4J4BA 4YRAA 5IJ9A 3NW9A 2WSSD 4IJ6A 2W6CX 1FX0B 3EG9A 3R40A 3QRWA 2HH9A 3IX7A 3F7MA 1KDYA 1PFUA 5HRUA 5JYCA 4HVLA 3Q88A 2V9CA 2QLFA 4B6JA 3DVSX 4I4TF 1VJ0A 3R3XA 4WIAA 3VAZA 3WTCA 4BKRA 1AUVA 2XTZA 2VTEA 2O50A 4HDRB 1YZ3A 2HI0A 3FR8A 3NVDA 2RI6A 3M6WA 3H1EA 4F3KA 1MBZA 4DMHA 1WL8A 3OZGA 3TTSA 5IS2A 2A59A 4KE6A 2E5LB 2BGGA 5DPMA 1U2GA 3G5UA 3EN0A 5AP9A 4JI3B 5AESA 2WWWA 4LZJA 4H31A 5DTEA 2Z04A 5IYZA 3IAAA 2HQOA 4X8LA 5T3YA 3PGLA 2EC5A 3ZXSA 3WYDA 2V3CC 3KQWA 3GLKA 1E9VA 2OCPA 4PNZA 4U00A 1C14A 5LP6F 5LNK6 2IYFA 1DNPA 3EDQA 1VBFA 3HSKA 2W2OA 4B3GA 1U5AA 3HDGA 3IE2A 3L84A 3UY4A 3EIWA 1CPYA 3MGGA 3IAEA 2K4MA 4GI1A 5FQNA 3AVWA 1YWGO 2R66A 2C0QA 3HB9A 2Q6VA 3V55A 1ZHOA 2WU3A 3W9SA 4AUMA 4OOFA 1CLUA 2ZRMA 3PFCA 3N2ZB 4MWZA 4DSUA 5K0CA 1QFJA 2VWQA 2WIBA 4YUXA 2PUBA 4KSCA 5IW8A 2P69A 3HJBA 5HBGA 3W1VA 4DGQA 4BWGA 1XMIA 3B1KA 3M6LA 4RWEA 1IEXA 1CJVC 2JA2A 1ZM4A 2Q9CA 3PTZA 4JUBA 4F4CA 2QNBA 3CNOA 3UK0A 4HUQA 3IAM1 3OKFA 2NSLA 4INJA 5DLQC 3THXB 1BDMA 2PJUA 2Y1EA 1CR1A 2PX8A 4MA5A 4XSGA 3V6MA 1DTWA 1XBTA 3GCZA 2MINB 4ZCLA 3V4ZA 4KWIA 1QX4A 3S7ZA 3X2SA 3A14A 3UMBA 4X1OA 3KWMA 2ZUBA 2R7NA 4DR7B 1VBKA 2E48A 1CB7A 2GZ1A 1ZN7A 4R1TA 5ALSA 1ND6A 2ZJBA 4MJ3A 4N6NA 1AO3A 1E0DA 1SNYA 4UBLA 4PXYA 5EHQA 1II0A 3AB7A 3OJ0A 2C7OA 1MQ9A 1RLOA 1MABA 4MVXA 4TS4A 1P62B 1ZGBA 1PQYA 3OZUA 2FV8A 4MDHA 1Z63A 3FUCA 4RVSA 3O9MA 1NM5C 2WTEA 3KSUA 4YJKA 3HCNA 4KJZA 3RNOA 1EWTA 5CXQA 1NASA 5G1OA 1B73A 4GOND 3AJ9A 4G4IA 4XD2A 1KSGA 3A7DA 4RHEA 4YQFA 3C3PA 2ERXA 4CTOA 1MFPA 4LK2A 1WUTA 4DMKA 2OM2A 3JSAA 3TSZA 1E6MA 4C6TA 2BM1A 1YFZA 4QXQA 2RBEA 3R1IA 3ROEA 5JATA 1DFHA 1QS0A 2AWOA 5EUQB 4GQAA 3TGPA 3MRXA 2BWJA 2QTAA 3OA0A 2BSXA 2ZVJA 5EJ6A 1FJXA 3ZXYA 1R8XA 1FP7A 5CLFA 5KYYA 4J7AA 3V7FA 2WIKA 4PAWA 3TRIA 4KGZA 3T3IA 2DEUA 5EUBA 1W0JA 2FR0A 3BKWA 4WASA 1DKUA 4PQYA 3V7WA 2NTJA 1R8JA 1EA7A 1V8DA 2J0EA 2Q0HA 1UQRA 1N2JA 4NESA 5IH3A 4B8YA 3LQ1A 4IWYA 4XWWA 3OP1A 1TKRA 2OBBA 1M2OB 3AXTA 3QI2A 4OHYA 2W4MA 1EK0A 3VYVA 1GADO 3NT4A 1TTPB 5KKCA 2FI1A 2Q4BA 4TS1A 2WD7A 2Z2ZA 4P86A 1W2HA 3HKEA 2FMIA 4GPTA 4IL5A 4DARA 2PO7A 3UA4A 5JMTA 1O89A 1XQ9A 2H54A 1P77A 2ZTVA 5ANRB 4BNMA 4KWCA 1TU4A 4PAGA 1N5DA 1VXRA 4GLOA 1F8GA 1JHRA 3GRZA 3HNRA 5FA5A 2HA5A 3VV2A 2FSGA 2G28A 2OCBA 2Q3JA 2FSPA 4M37A 1K6XA 3T3OA 2UUOA 2IYYA 4Q24A 1XC7A 1VMKA 1ITZA 3VZSA 4CDGA 2YXLA 2CLMB 1CHNA 1JAXA 3TVDA 2YIMA 4FLEA 5EJ2A 3G2LA 4BE7B 5JFOA 2AMJA 1Y1LA 1BQ4A 5HIMA 3ZEAA 4DC0A 5KKNB 2CDNA 5AW0A 3HM9A 3PGXA 1DDGA 2XOKA 4LPKA 4AJJA 4MWEA 3P0FA 3ZWQA 4RMJA 3EG9B 2EX4A 3PNQA 2DBVO 2XQKA 2B9EA 4F1JA 1IAQA 3GF4A 1YDMA 2WUVA 4M0PA 4UMDA 4D9CA 1RBYA 1L7XA 1Z16A 4IJVA 4L9SA 3MT0A 4Q7KA 4YMUA 2VJKA 4MQEA 1IN8A 3MAGA 1NRIA 3D6HA 3I64A 4MRAA 3F4BA 2Z98A 3KVVA 3D4BA 3GO4A 3MGBA 3ZIAD 2V7BA 4BFXA 3C8UA 4MDFA 3OA2A 1Z0JA 1IG0A 2EL9A 1ZAKA </