1ZICA

Crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFAATSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zicA00
4L9AA 4BCDA 3A2MA 1GPKA 2RGUA 1YB7A 1ZOIA 4NZZA 4AQDA 1CUCA 1SOMA 3BIXA 3LP5A 4KYVA 5D6OA 3C70A 1YS1X 2XUHA 4CFSA 4H7JA 4IO0A 4S0XA 1XZKA 5CT8A 3DKRA 5T4EA 1P0QA 4OB7A 2QKYA 4X6XA 4H7FA 3FBWA 1XRNA 3KXPA 4RE5A 2O2GA 5AKEA 5AJHA 4LHEA 2ZVDA 5HF6A 4NS4A 1H2ZA 1XQVA 3CXUA 2B9VA 4AMZA 3F96A 5C8VA 4ARBA 2WUEA 1H22A 4G8DA 1UXOA 3AZQA 1YSCA 3ESCA 5JARA 4BP9A 5DYTA 5SYNA 3ZLUA 2DSNA 3EQ7A 4UBKA 3F8SA 3G9ZA 5E2IA 4QNNA 3FAKA 1R50A 2H9YA 3ANTA 4DNFA 1AMNA 3IUJA 2XUGA 4FFWA 1VE7A 4Q1VA 3D7RA 4U2GA 3A2LA 4PNZA 5F4ZA 5CXUA 1BN7A 1CUGA 1N5MA 1GXSA 3FNBA 5JALA 1JJIA 4BDSA 3IUMA 2B4KA 4B7ZA 4L0CA 5K3CA 5IKXA 1EDDA 1XZDA 4AMYA 2BAGA 4ZWNA 4FLEA 1F6WA 2PSEA 4FOLA 2EEPA 3VJKA 5K3EA 2WFMA 4KAJA 3DKKA 3HI4A 1K8QA 4LXGA 4BC0A 4X7BA 2FJ0A 4L3WA 5FPQA 5AKXA 5EIHA 4QDXA 1YS2X 4JEIA 3M83A 2LIPA 4JYPA 4HTAA 3D0KA 1QFSA 4G5XA 1OXMA 2XMCA 2XUKA 2C5FA 1FFBA 3GBSA 5JAOA 2RIPA 5ALNA 5LZ8A 1TKRA 3DL7A 4DTCA 2G63A 2WU3A 4MQMA 3ED1A 3RM3A 4H7IA 1XRPA 3TJMA 4KRYA 1VZ3A 2PM8A 2JEYA 4EA6A 4Y7DA 5ALLA 3C43A 2JBWA 4YPVA 1XRMA 3CN9A 1N8SA 2BUAA 2VJBA 5ALGA 3MVEA 4DNOA 1JU4A 4Y2UA 2ACEA 2WHPA 2ONCA 5T4FA 5ALTA 3AILA 4GI1A 1UK8A 1E66A 2HU7A 5AKHA 4UHFA 5DNUA 4C01A 1O6GA 1YCDA 4DMFA 2HM7A 2PU5A 5AI5A 3H04A 3P2MA 1MAAA 2VSQA 1SCQA 1ORVA 5DYWA 1XZEA 4JYMA 4D9JA 3BJMA 3JW8A 3AINA 5CT4A 1BN6A 5T4BA 3SX4A 4XVCA 2ACKA 4MYDA 4W1SA 2WIFA 3DLTA 1G42A 4X00A 1CVLA 3DS8A 3EQ9A 3ICVA 4ITVA 3QZUA 4OB6A 2FUKA 3VVMA 5HF9A 3O4JA 4ZV7A 4E15A 4KE9A 3F67A 4FLMA 1CEXA 4FNGA 1GPLA 1HL7A 1X2BA 2QRUA 2BKLA 3KOOA 5AM0A 3WYDA 4I19A 4NVRA 1TCBA 1VKHA 1G5FA 2XMBA 3I2IA 2WHPB 2C4HA 4UPDA 5ALQA 1XZFA 2G5PA 2QMQA 1UFOA 1G4HA 2O2IA 3MUOA 3O4IA 1XQXA 4LKOA 5ALRA 2ZYSA 1QIGA 4P92A 1Q83A 1U2EA 4QA9A 1UK7A 2PSHA 3BE8A 1IZ8A 2YASA 4V2IA 5CBKA 5E4JA 1GGVA 2XQGA 1CUEA 3WK9A 5AOBA 1JI3A 2H7XA 4KEAA 1CUYA 4LIPD 3WYNA 5EHZA 3FVRA 1DT3A 3DYIA 3QM1A 1QJ4A 2BUCA 1QO9A 3NGMA 5A71A 2Z3ZA 1DT5A 2XMDA 1WHSA 1YA4A 4CCWA 1TRHA 3QBJA 5JADA 1QIMA 2XUIA 2WLSA 2HA4A 1JU3A 5CT9A 1WB5A 1ACJA 3G9TA 4QDZA 3ZLTA 1QIFA 3OC0A 3WL7A 5LIPA 1YAHA 4KE6A 1WOMA 3WKDA 4Q3LA 1NU6A 5E4TA 3DDUA 4MEBA 1E5TA 3WK6A 1ZD4A 3H2GA 5AKLA 4XIIA 4DGQA 1FFAA 1JMYA 4AXBA 5CH3A 3E4DA 2HDWA 3WKEA 3HXKA 4HXGA 1WPRA 1VLQA 1PJAA 4WDQA 2BGRA 4Y2VA 2HA6A 1SCIA 3K2IA 5AKYA 1EVQA 1M33A 3F98A 1LPNA 3O9MA 4FBLA 5HQ3A 4AB1A 1BU8A 5ALFA 3GUUA 2WIDA 3BL8A 5H3HA 2G5TA 4EY7A 3JYHA 4W1RA 1DQYA 2XMRA 2Z8XA 4OB8A 1PFQA 2PSFA 1EXWA 4BC1A 4K2AA 3C6BA 1AQLA 3FYUC 3O0DA 3H2IA 3PICA 2JGMA 1UT6A 5AI0A 2XI4A 2PUHA 4N5HX 3WWDA 5LKAA 1J06A 2OCIA 5CT5A 4DNQA 1XLUA 2AXEA 4BBZA 2VJAA 4BZZA 3BJRA 3H0CA 3PFBA 5A62A 2FX5A 5CRIA 1E3QA 3C6XA 1USWA 2Q0XA 1Z68A 4IQ4A 4UBLA 4BTLA 1XZGA 1A8SA 1EDEA 3PF8A 1XRLA 2VJCA 1EI9A 4W9RA 3I6ZA 5AM4A 2WG1A 4GLBA 3E3AA 3WL8A 1L7QA 5EHNA 1F0NA 1TCCA 4BB0A 3CCBA 3GZJA 1LLFA 4UFOA 1ZD2P 4XJVA 1QLWA 5AHXA 4XX1A 1X2EA 1ODSA 2QZPA 1DINA 1WHTA 5AI9A 1E89A 1K63A 3PI6A 5JD4A 3D3NA 4GXNA 3UUEA 3BDVA 3ZI7A 5HZGA 5AICA 3KWFA 4X91A 1IVYA 2Y6UA 4KAAA 3L1IA 2I78A 1DWOA 2O7VA 3STUA 1BEEA 1K6EA 3BDIA 2ZJFA 1DX4A 5A7GA 1MU0A 3CN7A 3DEAA 2WFZA 2HA0A 3A2NA 4G8CA 4Y9SA 3WQHA 1YASA 1XZMA 3IBTA 3M82A 1JJBA 1S8OA 2OGSA 1AGYA 1HPLA 5DWDA 4DSAA 5EIEA 2AJBA 4H7KA 2XLCA 2OCLA 3QMVA 3AIMA 4ZRDA 4QZVA 4QDTA 3V1NA 4MJ3A 1A8QA 4IH9A 1EA5A 5ALDA 2GYWA 3R3UA 2QT9A 5JD6A 1K5PA 1IUNA 3NWOA 4BZWA 4C87A 4X92A 4CIBA 5AK3A 2QXTA 5FXMA 4QE3A 1CUAA 4DIUA 2I03A 1T2NA 4Y2TA 2HA2A 5DLPA 4Y2YA 4RNCA 4N8SA 1UKBA 2JGKA 3DD5A 2WSLA 3WA6A 1UZAA 3DCNA 3ZWQA 4G8BA 1N5RA 3DYVA 1JJFA 3W05A 1G66A 1TIBA 4Z49A 2WU4A 3PE6A 4KE7A 3G0DA 2XUOA 4AO7A 2HA3A 2PKYX 2BJHA 4Q05A 1XZBA 1N1MA 4QWWA 3LS2A 1JT2A 4J0KA 2GBIA 5KWJA 5AKZA 2WUDA 1R3DA 5D7BA 1H2XA 1CUVA 3SC2A 2ZSIA 4FWBA 2JEZA 5AM1A 4MQLA 1VXOA 4N5IX 1VA4A 2JGLA 3VXKA 2DCMA 3T52A 1B6GA 4BCBA 4CIAA 4PSDA 2WHRA 4X6YA 1XKTA 4FHZA 4DMCA 4GECA 1XROA 1YR2A 2ECFA 5FPPA 4BAGA 5IVKA 5LZ2A 1XRQA 1TQHA 2RONA 1SCKA 3DNMA 3WWEA 2AJCA 1WPXA 2BGNA 4A16A 3QH4A 1THGA 1MX5A 4UBMA 3HEAA 1H2YA 1CLEA 4PSCA 3FLBA 4F0JA 1HLGA 1JKMA 5IH7A 2OCKA 3IURA 5K3DA 1SC9A 2I3ZA 4B9AA 4CCYA 4HRYA 2WUFA 2CBGA 2XUAA 2CJPA 2IX9A 3D2AA 3C8DA 5E4YA 5CURA 3H1AA 5LZ9A 5JATA 4FNMA 3C87A 2GYVA 4GWLA 2QM0A 3D4LA 5EGNA 5C8XA 1W4LA 1XRRA 4X85A 1VA5A 5BOVA 1ZD5A 2C7BA 4N8EA 5K3FA 3R3ZA 4G4IA 3FSGD 1WB4A 1EVEA 3W9UA 1BS9A 2XUQA 5T4HA 1ZI8A 4DSZA 4H0CA 2HU8A 1HDEA 3OTQA 3R41A 1RP1A 1XFDA 4MWSA 1BROA 1QZ3A 3V9AA 1R88A 1XZHA 4H7DA 4CCYB 1DWQA 1W52X 1LZKA 3HSSA 2GZRA 5FOQA 5AKJA 3PFCA 3LCRA 1AX9A 1WCYA 1LGYA 1R1DA 1CIJA 5AK5A 4K5QA 4G1FA 2JGEA 3BF8A 4OYYA 2ES4A 1C4XA 1CUBA 2JGFA 2J4CA 3LIPA 4ZXFA 3WKAA 4HXFB 1CUIA 3NOXA 2E3JA 4AN1A 4X71A 5AO9A 5K3FB 4FTWA 5ALHA 3G0CA 1L7RA 3AZOA 4HRXA 5DNWA 2WKWA 1VOTA 1BRTA 4H7HA 3B3QA 4RE6A 2RHTA 5CH8A 3H1BA 2H7YA 4UHHA 2VATA 4EY6A 1QTRA 3DJYA 3BIWA 3TGLA 2XQFA 5K5EA 4BE9A 1EB9A 5FUMA 3H17A 3QYJA 4BCCA 4EBBA 3IVMA 2OXEA 1CUSA 4LYDA 4BTVA 5IVHA 4Y2QA 4Y2RA 1HBJA 4PSUA 2RI6A 4BVKA 1MNAA 4EY5A 3FLAA 5C7YA 2JIDA 4J0DA 1DWPA 1EK1A 5ALXA 1XZLA 1ZI6A 1RWQA 4IHAA 5AIAA 3FVTA 4AZ3A 4AO6A 2I3DA 1FJ2A 2QUAA 3QMWA 5J3JA 4GBGA 4C6HA 1A88A 1P0MA 4ZI5A 2HFJA 3U1TA 1U65A 5FDFA 2OCGA 2WJ3A 2ZYHA 3C6YA 3O4HA 5LZ5A 5CMLA 3TEJA 4U2DA 2VAXA 2HFKA 3QVMA 3FOBA 4YK7A 3RKSA 1UOPA 1ZI9A 1CUDA 1UOOA 2JGJA 2QVBA 5FP0A 4BDTA 1X70A 3G7NA 3WKBA 5JASA 4WY5A 5AI6A 3G8YA 1NU8A 3GA7A 1YB6A 3LLCA 4ROTA 3DOHA 2CUTA 3QPDA 5AM2A 1GQRA 1AURA 3WKCA 4CI9A 3V1KA 2XE4A 5BWBA 4X3CA 2XLBA 1QE3A 6YASA 5HFAA 1GT6A 5C8ZA 4ZV9A 2J3QA 3HRHA 2WQZA 4PW0A 1MJ5A 4U2CA 4IH4A 5C81A 5I7UA 4N8DA 4Q3KA 5AKIA 4X90A 3AFIA 4B85A 5AM5A 1U4NA 2QOEA 3N0TA 1VZ2A 1O6FA 3FLEA 1DTEA 1A7UA 2VF2A 4FBMA 4OCZA 1GZ7A 4E14A 1ETHA 4K6KA 3F97A 2C0QA 2XUFA 1LBSA 1DU4A 3C6ZA 3B12A 2OAEA 3AZPA 4U2BA 3UUFA 1K4YA 3RK4A 2DR0A 2PSDA 4FKBA 1LPBB 4QLAA 1DQZA 3SWWA 3A6ZA 4DLNA 4C89A 3O95A 5ALWA 3ESDA 3KDAA 5HFNA 2DFPA 3CCCA 4I4CA 1YAJA 4EB0A 3X3HA 4WJLA 2ZYIA 2WUGA 3WI7A 2XMZA 5JYCA 1LPSA 4F21A 1B41A 2ZSHA 3V1MA 4DMKA 3I6YA 4B83A 4X95A 4G4JA 5DJ5A 5AOAA 3WIBA 4ETWA 4KJXA 3WA7A 3KSRA 2YXPX 1WM1A 1QIDA 3N2ZB 2OQIA 5AKGA 4BAZA 3VDXA 4OYLA 2WILA 2QXUA 4PV7A 1XQWA 2JGIA 3MGAA 1J2EA 5ALUA 2XUJA 1EB8A 2WJ4A 2VAVA 3STTA 1XQYA 1ZICA 3H18A 5AI8A 1Q0ZA 5DYYA 4HS9A 4HAIA 1F0PA 1VE6A 4XWGA 4J0HA 1C7JA 1Q0RA 1UK6A 5ALKA 2XMSA 1CQWA 5KREA 1AZWA 1NX9A 5DTJA 3MUNA 5CXXA 3EBLA 5A7HA 5A6VA 2P8SA 3R3XA 1ISPA 3STYA 4GEGA 2AJLI 1A8UA 1CR6A 1LPAB 5ALVA 3S8YA 1MTZA 2XT0A 4EUSA 1TAHA 2ZYRA 4QDOA 5IVIA 2WIGA 2Y2VA 2IITA 3FCYA 3VVLA 4NMWA 3OURA 2DHDA 3BXPA 4BATA 3OM8A 1MT3A 5LKRA 1SFRA 1H2WA 3AUKA 3I2HA 7YASA 3JWEA 5D3ZA 5K3BA 2OGTA 1LNSA 2R11A 4Q82A 4J0IA 1QONA 4I3FA 4MWTA 4A23A 3B5EA 1ZJ4A 4FDMA 5JAUA 4JUIA 2FJPA 5JANA 2PSJA 3RARA 1HQDA 2YH2A 4UBOA 3WJ1A 2B20A 2J3DA 2J4FA 4H77A 5A7FA 4W1QA 3KWJA 3HACA 4FLFA 5KBYA 1RYYA 3I6MA 3QPAA 5FKJA 5JZ9A 1MN6A 1CUZA 3H2JA 3W06A 3WWCA 2VEOA 1H23A 3ZLVA 2X76A 4F60A 3HJUA 2D0DA 4C4ZA 3IDAA 4B84A 3HZOA 4OU4A 4UHDA 3A70A 1XZIA 4U2EA 1QO7A 1GKKA 2Y6VA 1C7IA 3STWA 3M81A 2O7RA 2RAUA 5JD5A 5D3KA 2HHAA 3WL5A 5EI5A 4WFKA 1QOZA 1PV1A 4WFJA 2AJDA 1W6RA 3H2KA 1EK2A 2O2HA 4OU5A 4K6GA 4C4XA 4H35A 5JAHA 1UWCA 1MPXA 3S2ZA 1AKNA 3KD2A 4CG2A 4Q3OA 5ALZA 4P93A 4A5SA 5FV4A 3R0VA 1HKHA 5ALOA 3WWOA 4LXIA 3U0VA 4DMHA 5ALJA 3D2BA 4Q34A 1CRLA 4INZA 2PBLA 3BF7A 4HVTA 1BCRA 3WZLA 4UHEA 3IIIA 3OOSA 1ZGCA 5KWIA 3PUIA 4BAUA 2HU5A 1CUWA 1CUXA 4MXDA 2NW6A 2BFNA 3RLIA 2WFLB 1LZLA 3HYSA 2IIVA 2XQJA 1ZIYA 2QJWA 2XUPA 1E8NA 5ALEA 1E8DA 4X94A 1I6WA 3I2FA 4E11A 4TPKA 1Q84A 4DM7A 5I8PA 5ALSA 1QFMA 4PQEA 3O9VA 3YASA 5ESRA 3V48A 4AZ0A 2C0PA 2OPHA 1Y37A 1BCSA 2QUBA 5EIAA 4Y2PA 5AOCA 1JMKC 2Z5GA 3C5WP 4H18A 4WFIA 3IA2A 3STXA 1UK9A 1EHYA 2EDAA 5ALIA 2WJ6A 5AP9A 3PF9A 3I2KA 2H1IA 2XB6A 1ZIXA 3R40A 1CFJA 4J0JA 4GW3A 4EZIA 3M3DA 4EY4A 1TK3A 3ZPXA 5HKAA 1FFCA 3VKFA 1W1IA 3D5EA 5ALMA 3EF3A 3GROA 1ZJ5A 2C5GA 2GBGA 2AJ8A 2RHWA 2XUDA 4AO8A 5BWCA 2K2QB 2OG1A 1ZGBA 3WK8A 2WTMA 3Q0TA 2H7CA 4G9GA 4M0EA 3UMJA 5EFZA 5ISMA 2DHCA 5ALPA 5AIBA 3C5VA 2BUBA 5BV7A 3IUQA 2G4LA 5FRDA 3AIKA 3K9BA 2VQ6A 5LP1A 1OILA 3IULA 4TGLA 2JF0A 3Q8WA 1DX6A 4KRXA 1CUFA 1XZCA 2DQZA 5A2GA 1U8EA 5JZBA 2Y2UA 3FYUA 1CV2A 4G4GA 1W75A 1IMJA 1D07A 1XKLA 3K6KA 3I1IA 3W04A 5JIBA 3TRDA 3C45A 2V9ZA 3L1JA 1Y7IA 2ROQA 3FSGA 3SK0A 2XMGA 1T4MA 1UKCA 4KE8A 1EINA 1IZ7A 2V96A 4B9EA 1P0IA 2WM2A 3OPMA 4DNPA 3W9BA 4UFPA 1GKLA 4EHBA 1AC5A 5LZ4A 1LPMA 3OG9A 3G0IA 2PPLA 4HXEB 2OAGA 4X97A 4FMPA 1BEZA 4IH1A 2ORYA 4B6GA 2X8BA 3E0XA 2Z8ZA 1CQZA 3G02A 4OPMA 1ZD3A 5CH5A 2Z3WA 3V1LA 1ACLA 3ESBA 1AUOA 1J1IA 5AM3A 4Y2JA 1W76A 3G9XA 4M0MA 1XZJA 5I9IA 3FYUB 5DTIA 4O08A 3D59A 1KU0A 1TCAA 2Y1KA 1GQSA 2W22A 5AK6A 3WK4A 1R9MA 3WK5A 1QGED 1VJ5A 4P9NA 1MX1A 4GDMA 3IUNA 2DHEA 2HA5A 3H2HA 2PU7A 2WHQA 4LYEA 2VT7A 4QDUA 2PVSA 1R9NA 4YASA 4GHWA 3I28A 4ZGBA 2GBCA 2OGZA 2GZSA 4M0FA 3ICWA 3HC7A 1R4ZA 2QTBA 4B82A 4KR0A 3I1YA 2CB9A 4B0PA 2B61A 2PL5A 4UHBA 1WB6A 4UBNA 2EDCA 4H7EA 2HRQA 1FFDA 3QPCA 1JFRA 3DL4A 2VJDA 5CT6A 3EQ8A 5AK4A 1CUUA 2WG2A 3DOIA 5EHQA 4YX9A 3D2CA 4RGYA 1VXRA 5DNVA 3VJMA 2D5LA 4JH0A 5HCUA 1FSSA 2WIJA 3O4GA 1LPPA 5HK8A 3QMMA 4UHCA 5AH0A 3NUZA 2OLEA 3E1GA 4J0CA 2R8BA 4BP8A 1ODCA 5JZSA 1QIKA 2V98A 2PUJA 3C8HA 5SYMA 1J07A 4BE4A 3VISA 3LIIA 5CTAA 4UFNA 2GYUA 3WMRA 3BWXA 4X93A 1P0PA 4J3JA 5LYYA 2XQKA 2ZJ7A 4BVJA 4U2FA 4WY8A 1CPYA 1QIEA 2WTNA 4HZGA 1Y7HA 1IUPA 2VT6A 1XZAA 2CKMA 1E8MA 3T4UA 1FFEA 2GBFA 4RPCA 3STVA 1QIHA 1YA8A 4J03A 2PX6A 4OSEA 4OD0A 4CG3A 2CEKA 1CUHA 4KACA 2UZ0A 5FLKA 3FYTA 3WL6A 1EX9A 2OQVA 4PF1A 4K6HA 5IVDA 1THTA 3I2GA 1BE0A 4BYMA 4J7AA 1CUJA 3G9UA 1MNQA 3DQZA 1LBTA 3L1HA 2HL6A 4FFVA 4AX4A 1EDBA 3AIOA 1GPNA 3WK7A 4B81A 1KEZA 5YASA 4G9EA 2VTVA 4E46A 4W63A 3G0BA 1UKAA 2HADA 5AI4A 4JNCA 1KU6A 1QIIA 3R3WA 4PO3X 4L72A 4ARAA 1L7AA 5ALYA 3PDCA 3ESAA 2VA9A 2YYSA 3ZV7A 5LZ7A 5HQ3B 3W2TA 2CZQA 3QITA 3GELA 4F5ZA 3R3YA 2QS9A 1ODTC 4B0OA 1OCEA 2C58A 1LPOA 2ZJ6A 1ORWA 3H19A 3R3VA 2XMQA 1F8UA 3I2JA 5HF5A 4P08A 2WIKA 3IB3A 2W6CX 2CMFA 3ANSA 1EH5A 3WWPA 4AN0A 2HIHA 4QEKA 4BRZA 1IUOA 3FWHA 5LLSA 2XDWA 2DQYA 4UUQA 3FCXA 4Y2SA 5CW2A 4MYSA 3WLAA 4BRSA 4LXHA 3ILSA 4CG1A 2X5XA 2V97A 4WDRA 4Y2XA 5HKBA 2HA7A 4C4YA 4UBIA 5HK9A 1XLVA 3WJ2A 4X6UA 1MX9A 5AKKA 3HLKA 4MEAA 5K3AA 4EY8A 4OUKX 2HRRA 3HABA 5JAPA 1MAHA 2WFLA 4TVKA 2QJRA 3WIOA 4B80A 3AJAA 4QLOA 1QTIA 4C88A 3EIOA 3VJLA 4W1PA 3GFFA 1QIJA 4J0GA 4WCVA 1UOQA 2BCEA 4ZREA 4UBJA 2QR5A 4BVLA 5HF8A 1MO2A 4DYHA 2XQIA 1XLWA 4QWMA 3F9CA 4KAFA 2WG0A 3PUHA 3G0GA 3WZMA 5EHXA
chains in the Genus database with same CATH superfamily
3EZFA 4S1NA 1A9XB 1GPKA 2FVXA 4XWWA 4G5QA 3T0IA 4D57A 4RJIA 2CLOB 3G0OA 5EMLA 2OB1A 2GEUA 2C3UA 5F7JA 3BIXA 2I1VB 2ZQYA 4I9GA 1KORA 4X6LA 4KYUA 4QXMA 3PPWA 1JVNA 3C70A 3SHQA 5TVKA 2ORVA 5BSVA 1YS1X 2XUHA 3BG5A 1ZLXA 3OFKA 4TSFD 4A6PA 4CFSA 3U4QB 1WVGA 4H7JA 1MC5A 3I8XA 5BQPA 4S0XA 1XZKA 3V1YA 4MUFA 5CT8A 2I3AA 2VWQA 2X8AA 1OU4A 4US2R 2O4CA 4DCMA 4V0KA 1JR2A 1P0QA 4YJ2B 3BWDD 1SB8A 1Z3CA 4MDHA 3OQPA 3KAJA 3FBWA 1XRNA 3EDOA 4OBWA 5AYVA 4Q4JB 3SJUA 4IGIA 3LWBA 4YJ2F 3UWSA 2DLNA 1T29A 1A4UA 2R1VB 2AF3C 1QB7A 2H4FA 1KVUA 2A5DA 2QRZA 3GZNB 4JR0A 2H1FA 3FMOB 3I01A 5AKEA 1YWGO 4C5CA 4ZYLA 3BICA 5JEEA 4YRIA 4ZIRA 2PS0A 3N05A 3X1MA 3U7IA 4ER7A 3IVRA 4JYBA 4NS4A 4Q3DA 1KH1A 3LF1A 5MGBA 4L0DA 1JQLB 3QG5A 4QPJC 1ENOA 4GU5A 4KNVA 2PJUA 3GX1A 4DCVA 5LOVB 3SJCA 3P5BA 2GM9A 3IMGA 1RFGE 2D4HA 4URFA 1PRYA 2PH3A 3Q9LA 4NBSA 4KX3A 5ICGA 5MDHA 5TLSA 5CU7A 5LOVF 2YMQA 1O8CA 4BKOA 4DWJA 1C1YA 2OUKA 3WBKA 2B25A 4AK9A 4AS1A 4ZT6A 1DBSA 4XARA 3PFFA 3BAZA 2X0RA 2V5AA 4C6RA 1ZM4A 4L5JA 2WZBA 2VHEA 3QOFA 4LJ5A 4P81A 1YRBA 4M1SA 1CRQA 3BGIA 4PTLA 1IM2A 4X5OA 2BR4A 1QS0A 1YSCA 2AHOA 2Y27A 3PXDA 4NDAA 5FWDA 3WIEA 3W7AA 4BP9A 5FWNA 2X2FA 3H2YA 3LQ1A 5B55A 3ZLUA 5LDHA 3KYDA 4K81B 3KQUA 1RBZA 3EQ7A 2Q5HA 1SBQA 3O8BA 5KQLA 4ESVA 1PP4A 1JI0A 1J0XO 1N8NA 3GT4A 4QNNA 3TX6A 3SQDA 4C20A 2BSAA 5IXYA 1XPRA 4PG8A 1UJ4A 2H9YA 4GDFA 1RLTA 3AM5A 3Q88A 4MWZA 3AVWA 1XNJA 4RJ2A 4KIGA 2V55B 1VE7A 3SYMA 2Q1WA 3T1NA 1ISRA 3D7RA 2WSBA 4U2GA 1JEOA 2QZJA 4AY4A 4MMZB 3WBFA 3JRNA 1N5MA 3EXHC 4LBVA 4RDHA 2Q5FA 3T94A 1W7AA 1RKXA 3RS3A 4UUBA 3TIGA 4BDSA 1M6EX 3QW2A 2HQOA 3IPCA 2BE7A 5EGSA 4B7ZA 5HGJA 4L0CA 5IVPA 1DQRA 4WA8A 2OO3A 3HCFA 4Z54A 3SZOA 2YFQA 3OFND 3C98A 3W8DA 4B4KA 3NJRA 2BGWA 2QQEA 4JC4A 1Y9AA 1XZDA 3AHFA 2BAGA 3O8NA 2YJ4A 1OAAA 4UW9A 4RPGA 5IANA 1GYQA 4ZWNA 1QK5A 2C96A 2PSEA 4O4HA 1FBTA 4RD6A 3SIRA 4R8RA 3VPCA 7ADHA 4CMEA 1RYFA 4WT7A 2WFMA 4QJ3A 3DKKA 1VPTA 4FN5A 1XJ5A 5KAPA 4R69A 3GEHA 3ZKAA 9LDBA 4YRTA 5E1MA 3FNIA 5AKXA 5EIHA 2F3SA 3WB0A 3WP1B 1G5HA 1E9RA 2BHSA 3GFPA 4FVTA 3QUAA 4GC5A 3Q3CA 1OFGA 3HWRA 1YS9A 4GMXA 4JDPA 4LTMA 5K0LA 5BQOA 2ZE5A 3BGDA 1O1YA 5IT5A 1L4UA 2RMKA 1PJCA 1NLFA 2IPOA 2ZCJA 4Q1DA 1M1YB 3TRIA 1PK9A 3CLUC 4TRNA 3LUJA 4CQMA 4Q1BA 3J7AC 4FJ0A 3NIWA 1ENYA 3RUPA 3BCRA 4OGGA 1KOFA 3T5MA 2C5FA 2BSXA 4IGFA 4O6VA 3GBSA 3GEMA 4DM4A 2QUJA 2ZE8A 3H6HA 4JROA 4U6SA 5ALNA 2RKWA 4DPKA 4G89A 3BILA 5FULA 2AG0A 3WHPA 2WMNB 4QXQA 3E3MA 3I0MA 4MZXA 2IYWA 3MAGA 3OLYA 3DL7A 1ULTA 4DTCA 4HRAA 4F72A 3QNWA 2GZ1A 2OO5A 3SM3A 1AKMA 4MCIA 4MP6A 4ZJUA 1XN1A 3M6LA 1I13A 2G71A 3ZZNA 4J7CA 4R16A 5F21A 1PJTA 3RYFA 1QOPB 4YQFA 1JP7A 5TQ0A 4ZV4A 3RBAA 4J29A 3EVNA 3RM3A 2J9FA 1S02A 2FN7A 2FR1A 4O2BB 4H7IA 3EH1A 3JVUA 3TZ6A 4XB6B 1RD4A 1SOWA 4KRYA 4O2BF 4EPXA 1FNBA 1D9ZA 1M8GA 2PM8A 1O5IA 4B5LA 2GHTA 1FPMA 1RI4A 3F8WA 4KQ1A 1LCIA 1WXFA 2D1SA 3VNQA 1EFHA 3EDYA 4G07A 5E3HA 5BWMA 1XK6A 5FOTA 1ONOA 2EGUA 4C4PA 4PGFA 1TJ4A 3SI7A 3DE0X 3LPCA 3MWDB 3DM5A 4YRJA 3FTFA 3TG2A 2YWEA 3BK7A 1ESNA 4QXPA 2ACEA 2HNKA 3NV7A 2Z30A 1X3SA 2ECQA 3LTEA 4NOMA 4B8YA 4AY5A 1RJGA 3TIVA 4PSKA 1U3UA 1YFKA 4AMVA 2CE2X 2HEGA 1XK7A 2JA2A 3V1UA 1XI2A 3SQXA 4RPJA 1PN3A 2E82A 1RAHA 2FGKA 2EC5A 3F7MA 2CDBA 4G85A 4QGAA 1JSLA 1L7DA 4C01A 3ROQA 5ITSA 3OJLA 4ETIA 4MGIR 1UP6A 2PSSA 2QUZA 2FP4A 2BRUC 1CR0A 4WK2B 4DMFA 4FYPA 4WSOA 2QP3A 3R6TA 3SXUB 2QRVB 2YZGA 1KNXA 1GAXA 2BHLA 3KUCA 4KI0A 3E7XA 4L6AA 3B1WA 5CM8B 3FOFC 2H17A 3P2MA 1RRFA 5EINA 3NBMA 3H9BA 2OFOA 3BVPA 3KT0A 3VZPA 4A5OA 5BN5A 4IIYA 1XXHA 3P9RA 3Q3IA 1SVSA 4R0MA 1NMYA 3W5CA 3GO4A 4D9JA 5DEOA 3T7CA 3KB1A 4F3RA 3SAJA 4W99A 3QVXA 1UZLA 5T4BA 1J0AA 3O6VA 1XEWX 2YR0A 1KJZA 1AA9A 1BVRA 3BH6A 3IOEA 2DKOA 4GWKA 4HWPA 8ATCA 3SX4A 4XVCA 1YONA 3DUWA 5JI2E 3A4YA 4NFSA 2GK3A 1GFIA 4YP7A 2QLFA 2VXBA 4LHVA 5CD9A 5DF1A 1Q77A 1ZQ1A 4OJNA 4MRRA 3WJ7A 2JIOA 3PX3A 3K8YA 1NRIA 2CNWA 3VTZA 1U5BB 4J0FA 2X6RA 3NP9A 3DS8A 3KJFA 5F5XA 1WDWB 3EQ9A 1CZUA 3K0FB 1A0OA 4JT2A 5I4IA 1RQGA 3IAS1 3EVCA 4PFKA 1O57A 1AF7A 2D7DA 3I9V1 4EI9A 3ORFA 3OE1A 3UHOA 4E15A 3HUDA 4Z4CA 5E4FA 1NVTA 2FYTA 3H2BA 1CEXA 1YA6A 2XVYA 1L1QA 4QT0A 2XCQA 1WW2A 4F8YA 1R74A 1U2RA 3O7WA 4I46A 4FCWA 4KV9A 4YJHA 1T2FA 1VTKA 3G82C 1C7QA 1NMQA 2A9FA 3V4RA 3UPUA 1IPFA 2BKLA 3R8FA 3KOOA 4HHEA 3C24A 4YUZA 4NVRA 4HQKA 3MPUA 4HGRA 5JWHA 3HKBB 1FTGA 3EG9A 1UFRA 1G5FA 3L6CA 3CLTD 3M6WA 2XMBA 1KI4A 4PCVA 4CIWA 3ID6C 2GJ8A 2VWHA 3D8SA 3JTEA 5ALQA 4A1OA 5AVYA 1W48A 5JT1A 1QDUA 4UTOA 2QMQA 4ZOAA 3V6MA 1ORTA 4IF6A 5F35A 2QMUA 2WD7A 2ZZMA 5DYIA 4R8KA 5KYGA 8AT1A 3WIVA 2ZWOA 4LKOA 1K2WA 3QBEA 4EFMA 5IC5A 1Q1AA 2D2IA 2QTWB 2G0AA 4LY3A 1Y3AA 5ALRA 5ES4B 5KNLA 3EZ9A 3OQIB 1IBLB 2II6A 4JZYA 4OYHA 1Q83A 4O02B 3G2QA 4PLWA 1IQRA 4HDNA 4WBXC 5TT0A 1H93A 1K1EA 3RK1A 1C50A 3C5HA 1RMQA 4KQFA 2PSHA 5KU7A 3BDAA 4M38A 1K75A 4ZJYA 2AF4C 4JLNA 4JHXA 1RDFA 2O1WA 1NW9B 3RI3A 4V2IA 5KTKA 3OO1A 4ZQGA 3U4AA 2ZSEA 4KXVA 2XQGA 3H6KA 5C52B 2GAIA 3ULKA 2PS9A 5CLHA 3VO9A 3OLVA 4LYFA 3PDJA 1HEYA 2I99A 3IGFA 4IWYA 1Z73A 1M6VB 4PWYA 5EHZA 5KHLB 3K9FC 3K71B 1DAFA 1DIOB 4HNQA 3ZDEA 3DYIA 3QM1A 3WGLA 4ZQEA 3DFFA 4RHUA 1DKQA 3LBHA 5ETJA 2BGGA 1P1KA 2V6FA 1TVMA 3NGMA 5AW2A 1AXEA 2B4TO 3KV3O 5A71A 4RCYA 4C0WA 1A7JA 4DV1B 3I9FA 1FX0A 4MW1A 4YMWA 4EKDA 4RY2A 1LK7A 5JFGA 5JRJA 4MUYA 4PYRA 3UOWA 3M7IA 4Q12A 1QH8A 1X1DA 2Q4OA 3E9RA 3H5LA 2JAUA 3DV0A 5JADA 3RVBA 2SKCA 2NT4A 3PRYA 4CDNA 1MB0A 2GCIA 2OY0A 4C30A 4Z1MD 3IT3A 2DOKA 4J75A 2JIMA 4M1ZA 4OHVA 2HA4A 5DIFA 1FVHA 1JU3A 2I54A 4FKMA 2C29D 1ZNXA 4HAZA 4LRQA 5CT9A 4AKTA 3JQGB 4NARA 2E4XA 3LE8A 1X38A 3G9TA 3WDLA 2GKOA 1CQPA 3RABA 3QKSB 4D0NA 2CYCA 2IS2A 3IO5A 3PDIB 1L7XA 4QBHA 2QN1A 4JVNA 1JILA 2X4LA 4BO8A 2I34A 1V43A 4XDHA 1UJMA 3T99A 3RFCA 3WKDA 4R6XA 1FZQA 2J3KA 2Z4SA 5B30A 1J6UA 3DDUA 1IIRA 1ULSA 5LUBA 1C80A 2G36A 3GJ4A 4GM0A 4KZKA 2AXQA 3SYLA 4KXLA 1PWXA 1ZR2A 2VO1A 3DE6X 2A9QA 5EOVA 1KK3A 4PEVA 4BV3A 3BSWA 4S1OA 2DJ5A 1OH6A 3H2GA 5AKLA 4XIIA 3R7FA 3VZDA 4HCJA 4LECA 3TVYA 2XAAA 3FLMA 2ADOA 4EL5A 1NJ2A 4UXIA 3D1JA 5E7MA 2YVLA 4BJHB 1WPQA 1XTJA 4CMEC 1WF3A 5BYKA 3N2EA 3B36A 3OJ0A 1ZOOA 3MQ2A 4PO9A 4AXBA 1FXWF 2EFGA 1ZNQO 3E4DA 4MGKR 3R76A 1NW8A 4BEWA 4K9KA 5JWOA 1QXSA 5FUVA 3BEOA 1MB3A 4QRHA 4NKRA 1U0FA 1VIAA 1VLQA 2B1GA 2OT3B 3OLCX 4RFSB 4P54A 2ZWVA 2FN8A 3K0HA 1LC0A 2KW5A 3HB1A 1CIVA 3O82A 4WDQA 3WNQA 2AMVA 4JQSA 2CCGA 1GDTA 3MXOA 5HZKA 1W9MA 3CYFA 1ADYA 4QQNA 4KGZA 4D9HA 5KNCH 1RM0A 4RF3A 3F4BA 5DYNA 1Q15A 1LPNA 2X0NA 1WS6A 3IKMB 3ZY2A 2HRCA 1AGNA 3DAYA 3M49A 4LZAA 4Y9TA 4TL7A 1JEQB 1QE5A 1ELOA 1ARZA 4OAOA 4WUVA 2YHIA 4GR9A 5HQ3A 4FGKA 2HUPA 4GMFA 3IUBA 2OO5C 1ZU4A 3CLUD 2RBGA 4LQLA 4AC9A 5CVEA 4D3DA 3F3KA 4MVJF 3ZY5A 3CNOA 4RD3A 4GNRA 2IYZA 1P1JA 1EM8A 5L4SA 1BO6A 1MMFB 3E5HA 4D4LA 1OGJA 5H3HA 4BX3A 2G5TA 4IOKA 4EY7A 4DCGA 3JYHA 2PMEA 2X0IA 4G24A 3RVPA 1A97A 2F67A 3K8ZA 1DAPA 2AJTA 4FQ5A 3EGEA 5AW8A 3O8RA 1S2GA 4OB8A 2IL1A 3DTVA 2CV1A 1PFQA 5ADHA 2PSFA 1T8WA 2P75A 4YJFB 1E2MA 1IM5A 3JASA 3HWSA 4IJQA 2IEAA 1P5ZB 2Q3CA 2C59A 1Z8DA 1Z4QA 4K87A 3FYUC 4JV5B 3MS2A 2K5UA 3ENZA 2A5LA 2BMDA 2EP8A 2GMWA 1UT6A 4EVQA 1NN1A 2J3LA 1KI3A 4TLCA 3OE4A 5AI0A 5IWCA 2B4RO 2FEWB 5LNK1 3OZAA 4RMIA 3IVCA 3WWDA 4BJ6A 2WV9A 3W90A 3IXLA 1J06A 3BIOA 2OXFA 1PJLA 4L57A 4NH4A 3GWGA 3CH4B 1KQ3A 2AXEA 2JHCA 1ZHFA 3E2PA 2BL4A 2FA9A 3K0CA 3QEKA 5EQTA 4F8EA 4JN6B 3V5NA 3NWJA 5CLQA 3LQKA 3M1LA 5HKKA 5JI3E 2O7NA 1TDJA 3JQ8B 2C4TA 5L3ZA 2ZB4A 2GF2A 3H3FA 3WG9A 1E5DA 3PFBA 1RXSA 1RSZA 2B82A 2O3RA 2XHEA 5CRIA 4EG7A 1E3QA 2ZS9A 3VNRA 2COKA 1RAAA 2J3IA 4QUDA 3G8CA 3MCUA 1LDEA 3IPRA 3KYBA 4HYYA 4WACA 1QP7A 1U0LA 1ZUHA 1MJGM 3EGVA 1DO2A 2ADFA 3RYHA 4OXIA 4ZOEA 4HDMA 1E96A 1JGTA 2VYVD 4WK6A 4Y1EA 1BOOA 3T34A 4BFUA 2VHTA 1XRLA 3KB8A 2VUSA 3PJFA 4BFLA 2G06A 4N0PA 2Q8PA 1SZJG 3DLIA 1Z4LA 3UGKA 4DMUB 1T3HA 4HT3B 2FTKE 4YIHA 4R2KA 3OCXA 5IDWA 1UZNA 2W93A 3EFOB 3B6EA 4GLBA 1MXHA 1N3BA 2CL6X 4Z8XA 1YR9A 5CA0A 5DTMA 2DPGA 1EXNA 1KHTA 3S55A 3KR1A 5FPHA 1P61B 1T3LA 2XRMA 2HHHB 1P91A 4CM6A 3GLFA 1RYMA 4CKWA 3T1TA 1XL0A 2QRLA 5IT9A 3MTAA 1MA3A 1ZK4A 2OP0A 1SVKA 3MJVA 4LUCA 5KYNA 4BFSA 3JWIA 1KYTA 4TMXA 3QELB 1X2EA 1YVDA 4XX1A 1QTNA 4M36A 4AJ4A 2QW1A 5BMVA 2GRUA 3A6HA 5AI9A 1DKRA 2J0VA 3DMHA 1E89A 4AKSA 1VG8A 2ZT5A 3V42A 4C0QC 4C9BA 5K03A 3E3LA 1GITA 2WU8A 2CN1A 4XSGA 1KEPA 4D46A 1W5TA 1VKRA 1K68A 3PDWA 2YFKA 3KSZO 3REFA 3FSEA 4P34A 2HUNA 1UMCA 2Q1TA 4ZO9A 4K6CA 1CY6A 2XBLA 3FOEC 3IR7A 5H68A 2DG2A 3UWPA 1IL0A 2OXRA 1J56A 1HT2E 1MHPA 2E5WA 2RHBA 3G2NA 4ZCTA 1IBSA 1FJGB 2JFZA 3DCJA 3SYRA 3VAAA 2OV1A 4DREA 1K3FA 3HU3A 2EOAA 4PPQA 1PZFA 2EWMA 2HGSA 1WW8A 2HK8A 4C0KA 4EEZA 1SXJA 1W1UA 2FHPA 4D81A 3JPYA 3L1IA 2EX0A 2I78A 3STHA 2GN6A 2XCLA 3BERA 3OECA 1CVRA 1DWOA 2GPJA 3T7KA 5K05A 2YWXA 5G02A 1QMPA 3AL0C 1NGSA 5HMMA 4LJ7A 1CJSA 1U7WA 1KK0A 4Z99A 3ZGLA 4PLFA 4NCAA 1OJ7A 1XCJA 3ZHYA 3MLAA 3FCUB 2ZP1A 5C1OA 3I5MA 2CLEB 2X7XA 5H83A 5A7GA 4MVCA 1E9AA 2Q29A 1PAUA 1JX6A 1UXHA 1QJCA 2I6GA 1QAMA 1YE8A 3A2NA 4AKIA 2G80A 3HY4A 3QOWA 4F9TA 3WQHA 4JU9A 4TX1A 5E9AA 5SZHB 4MZDA 4LF9B 3BMXA 3IQIX 3EYWA 1ZO8A 3IBTA 4EG6A 4GLJA 1JJBA 4GSKA 1G8MA 1J0BA 1S8OA 4A6EA 3RF6A 2DHQA 1R4MA 1A04A 2YIMA 5JCOC 1AGYA 4M0DA 3O4VA 3PGLA 4F6CA 2PWBA 1P7VA 3SFVA 2O2CA 2XLCA 3JZAA 4MVJP 3ZR4B 4DA7A 1AGRA 2G1JA 4JKOA 1TU3A 1C14A 2R6JA 2AG6A 3VO1A 1KQFA 1KJYA 5LXTA 1SELA 5L9AA 3JRWA 5GV8A 4OI2A 5E8JA 2RSLA 4LI0A 4D9MA 3CZPA 1ZAYA 1WZEA 4YJDA 3EWNA 3TS1A 3VFDA 1W29A 3LDGA 3ND6A 4DUPA 3IE2A 1MF7A 3G6KA 4CEHB 3F49S 2O8BB 1AXRA 3HA7A 3K0AA 4X92A 4ZCIA 2IODA 3FB1A 1V2GA 4RKRA 5CAEA 3F73A 5DW3A 4B6EA 5AW5A 1NR7A 4UNIA 1XNHA 3CLKA 1LKZA 4DBLC 3K9QO 4MUJA 1JZTA 1Q74A 1T2NA 4X8MA 1SM4A 4DQLA 3IHKA 2JLSA 3MT9A 4GVPA 1WOYA 4DPLA 1CC1S 2L82A 2HA2A 3GJ3A 5DLPA 3SKXA 4BX2A 2OBXA 1ZISA 1VL1A 3F6EX 2G1PA 3OU7A 4QDKA 4Q4AB 1DQSA 1R5JA 4W9NA 2VK2A 2J3HA 1TUIA 2PH7A 5FO1A 4XR4A 1UZAA 3VPHA 3T3DA 3WA6A 3DCNA 4XIJA 1AV7A 4RY0A 2WMYA 3Q72A 1ZUNB 1TMGE 3IOBA 4MW9A 3ZWQA 13PKA 3NJ4A 1FTNA 4PYKA 3ZC3A 3MJFA 4TWBA 2XUZA 2P1DA 4DC1A 1FSFA 1G66A 3SSMA 3TSAA 1JAXA 3PR1A 2CVQA 2LNDA 2WU4A 1ND6A 4PSAA 3PE6A 2PGXA 3KJZA 5AXAA 3G0DA 3EAGA 2JEOA 4UDOA 3ER9A 2FVYA 1Y63A 4KVGA 1P18A 4S1PA 5F3RA 3ZU5A 1IK4A 3R5KA 1YZYA 4E1VA 1ZN7A 2N42A 4G37A 1V16A 3R0IA 4XJTA 4OLAA 1WKCA 1E6KA 3ABSB 3H1GA 3KPYA 1JLKA 3GY0A 3HB4X 5JVDA 4L5BA 3REQA 3KPVA 1SZDA 2C3MA 2WPDD 2ZUVA 3KQQA 4JT8A 4KXWA 2PDAA 3ZI4A 3MRSA 4YUVA 2VDPB 2ZIWB 3QU7A 2WYUA 3SR0A 1H2EA 1G3IA 1JT2A 1NKSA 2GBIA 4F93B 5IF9A 3ACBA 3VC7A 3DBOB 1TW2A 4EM6A 3OY2A 2R84A 5L95A 3R7WB 2NVWA 2Q3MA 1H4SA 3EEBA 2ZJBA 3D2LA 1Y4AE 4JOQA 3WOVA 3ZHUA 1AQ6A 3PFGA 2ZUWA 2D0PB 1XTPA 5FCDA 4NXMB 3TXAA 1ZGZA 1T34A 2IZOA 4B46A 1NASA 3RC8A 4BCBA 1PJ8A 3F9IA 1VGRA 2DKNA 2RI1A 4U8HA 2OAQ1 2A5GA 3EISA 5LFAA 2VSFA 3KQTA 4HSGA 3ESZA 1RZRA 5JZOA 3ZTTA 3G88A 1OREA 4R2LA 1N6KA 5J23A 2HB6A 4MHTA 4UDNA 5B58T 3VX3A 3QWBA 3OKPA 3P2JA 5BW8A 1F2UB 1U9JA 4GPZA 3G1WA 2CFRA 4KIFA 2Q2WA 1XRQA 3NYQA 4MQFA 6REQA 4B7CA 1KMCA 2RONA 2DPXA 2JPDA 2Y1XA 4R1TA 4AW9A 3GLGB 2R00C 4EF6A 1IH8A 2NPOA 3V2GA 4G09A 4RF2A 1YBMA 1CJBA 1B76A 1Q3HA 1TZBA 2BGNA 4OQNA 4KQHA 4RA6B 4F91B 5F1KA 1MX5A 1OX5A 2ZSAA 4P4SA 2HD4A 1H2YA 4ZVPA 1ZRMA 1CLEA 4PSCA 1A2KC 2WAMA 3W9YA 1HLGA 2G67A 3JCZA 4G0YA 2CUKA 4FS8A 1BAPA 1PF7E 2ZPUA 4MIOA 4FB4A 1Q3KA 1LX6A 1SC9A 1OVMA 1A76A 3OZDA 1I4DD 3ZDYB 3AF3A 1H2AS 2Z04A 4KO1S 3SZLA 5TMPA 2WF6A 1MFPA 1MVOA 1PT9A 2WAAA 3OT1A 4UNQA 3ISTA 5H4HA 2B2NA 4TN1A 4YNBA 1KMNA 3O8QB 2J0SA 2IX9A 2XKAA 3ZDCA 3KZVA 3IE1A 4PYJA 2Z9DA 3AF2A 3D2AA 4C4SA 3IEIA 4UQOA 5J9FA 5KX5A 1T10A 1G7SA 3NDPA 1W93A 1WMAA 3P4XA 5E4YA 1SD5A 3B53X 5CURA 3RTEA 4F3KA 2QGNA 1V8DA 2B36A 2YWBA 2Z8YM 5LZ9A 3CF0A 1ZPDA 1ZA2A 2GKSA 2V7GA 3MXTA 3DE7X 4GKVA 4BBJA 3PEEA 4LX0A 1VCNA 2QRHA 2O2ZA 4QYIB 1UPFA 1MDFA 4B71A 2H51A 1BW9A 4GWLA 4GGOA 2WR8A 2X1VA 1UEXC 1INLA 3KHTA 3NORA 5EGNA 1XRRA 3ANYB 1GSIA 1HXHA 3AERB 4ZOLA 4C0BA 4Y0VA 3IUYA 5K3FA 4CM7A 1B42A 3TJZA 1W0CA 2AOWA 3AP1A 4PPYA 1DG3A 3ZHCA 3OO0A 1CS4C 1HRDA 1EBBA 1WMEA 3D9QX 3TDMA 4JUAA 3ZY4A 2ET6A 5EUBA 1JS1X 3MG9A 2YY5A 1WG8A 4DW8A 2C7OA 2P4HX 4LVUA 3AUUA 3KXLA 1PQ4A 1CKEA 3JQAB 1IN4A 4OG2A 5DBIA 1H8ED 3DBLB 4HQRA 1ZI8A 2EKBA 3HB5X 1Q0LA 2YIDA 4MARA 1JE0A 7REQA 3K0SA 2X2PA 1CF9A 1MT0A 3IBCA 3MWEB 3QV1A 5C5DA 1VPDA 2OXCA 4JT4A 1T1IA 2I9PA 2X86A 1T2EA 2HK9A 3COVA 4CCSA 3U16A 4M1EA 3X44A 4V0MA 4DR3B 2Z0MA 2CFIA 4GYKA 3T3OA 3B89A 4KPFC 1EWRA 4MWSA 2FPPA 3QXSA 3KZKA 2I22A 5E6UB 4IS2A 5AR1A 2A0KA 4QPNA 3ASVA 1BROA 3C4QA 5L3SA 1UANA 2CNBA 4WGFA 3AI3A 2XZDA 3ZBUA 2HIGA 3QWAA 4D8YA 3OZBA 3OE5A 1U2PA 3VBCA 4ENVA 5ERGB 1W52X 2Y0BA 3RANA 3A32A 1ZW1A 2BKAA 2YIVX 3PX2A 4KQKA 1AN9A 2GPYA 3ABQB 4YEDA 5TNXA 2X9LA 4YCSA 4D42A 3ETCA 1QG4A 1BS2A 5DK4A 5KJEA 4M0CA 1CX9B 1R37A 3OEED 3K9LA 1WCXA 1OWNA 2BGLA 3MELA 4HEA6 3A6JA 5L45A 1NF2A 1Q7TA 4FP9A 1GAEO 3L84A 1KOLA 2JJQA 3LI2A 1IJKA 2GH1A 4DQDA 5CDYA 3RIEA 4OLBA 1GGEA 3D7NA 4XDGA 1E0JA 4K5QA 3A37A 4ESOA 2J5BA 2Z4RA 2JGEA 2P4QA 3L4BA 3Q7PA 4TYMA 4ZVRA 1XYGA 3NHJA 4OYYA 2ES4A 3A10A 3MTJA 4JIMA 5FA8A 3EBPA 4F04A 5C37A 3HNOA 2JGFA 3ZE8A 1F0KA 2P7IA 2V5VA 2X19A 3BHNA 5CDGA 5DN9A 3MCVA 5CLGA 1JQKA 3QUQA 4ZXFA 3T1HB 1CUIA 1FB5A 3IAXA 1YTUA 1TM2A 1KY4A 2F64A 1OTYA 1WR8A 1ZKDA 3FR8A 3NOXA 3U6KA 3NTUA 3EIEA 4G5GA 3B9BA 4TQAA 5EUQB 5TEVA 3OEYA 4OYRA 3VSAA 3TX2A 4BFWA 1B7GO 1D2AA 3I92A 4JY7A 1UMBA 4R98A 2JANA 2IU6A 2JD1A 4D74A 3JQ7A 5DNWA 3NUGA 3LC7O 3TD6A 5K0BA 4JMLA 1GFSA 4QT4A 1TA0A 4WUTA 4BLSA 1X87A 2FDRA 3A9RA 4L8GA 3MNFA 4Y7CA 3TF5A 2EJVA 3MTQA 1FRFS 3WLTA 4DOMA 2O8DB 2VDUE 1GSOA 1MIOA 2H48A 2H7YA 5A5VA 1K89A 2PYDA 2IDJA 1NLUA 2C03A 2QZSA 4NCIA 4W5QA 1TZMA 3SP1A 5JMOA 1F60A 2I2FA 4GLLA 4YJGB 2XQFA 2E7ZA 3O93A 4B74A 3F0TA 1Z0ZA 2WAXA 1E9BA 3I09A 5CVDA 2EAUA 4WL0A 4QFMA 4BLRA 1NJ6A 2N47A 4K9SA 2Y68A 1O5OA 5DFAA 1Q7RA 1U8CB 4N6GA 3RYIA 1IHYA 2H1OA 2H1LA 4KR2A 1FSZA 2A7QA 1G21E 2XGOA 5HBGA 1QHHA 3TL2A 4AJ1A 2Y4OA 4JLSA 4WCFB 5FFNA 5LQUA 1ZS9A 2Q1XA 3KKMA 3QIVA 4BTVA 3PRJA 1G3QA 2G09A 3IJ5A 4Y2RA 1XWWA 1MRZA 1HBJA 1XZQA 4J8PA 1ICIA 4BVKA 3EGDB 4YP0A 4FONA 2FG7C 5K0FA 3K9GA 3MC1A 4BNYA 5C7YA 1N0VC 2JIDA 1T0PA 3VOAA 1HZZA 4JK3A 1Q0QA 1XZLA 4W9NC 3SS7X 4CKCA 4ZCRA 5I8WA 5LMZA 2CUNA 1AHHA 2HU2A 821PA 4QGHA 1OPRA 1TKCA 3U44B 4BRUA 4EZBA 3EVZA 4I1OA 1XWFA 2PGLA 1FJ2A 3QVVA 2QUAA 3QMWA 2I66A 2IHTA 3OTIA 5J3JA 2XKKA 1P0MA 1DJOA 3A25A 3AR8A 1B8NA 3CMMA 1YMQA 1LDNA 4HDKA 1GWNA 2BEKA 2BMVA 2C1ZA 1U65A 2GARA 2HFJA 4QUEA 3U1TA 1EXVA 1STOA 3GUHA 2H5EA 4HH0A 4XGIA 2WJ3A 3GJRA 1XPOA 3DLBA 3N2LA 1JUDA 5IMSA 5HZHA 1L5HB 1YVUA 3FPHA 1W88A 1NJGA 2FFBA 4XYMA 5B4TA 6PFKA 3RKRA 2HFKA 4KIJA 3DDHA 4N18A 4AZTA 1QM5A 1Z26A 5HJ7A 3FOBA 2IBTA 2CXSA 5I9BA 4HFNA 5EAIA 2WFAA 4NE9A 2OBYA 2YYAA 3CH5A 2WYWA 3ONNA 3Q2KA 2R7KA 4M6WA 5DX1A 5C4MA 2YJ6A 1QHGA 4JL6A 4MQEA 2FPGA 1ZUWA 2JGJA 2PWZA 3MWKA 3PENA 3FTDA 1QLHA 2P5TB 1P7CA 2ASEA 2FFRA 2GZHA 3C7DB 5KKAA 3FUXA 5CBPB 1LU9A 1HK7A 5LQDA 5JASA 5B64A 2XBMA 2PD6A 3FUUA 1M73E 4MS4A 3V7WA 2H18A 4Q21A 1R0BA 4REQA 4KXFB 4TM8A 4UC0A 4XDYA 5HZMA 3HN6A 4EPVA 4MDEA 1NUAA 4KAXA 5CYPA 4IOMA 1EFPB 1BMQA 3UJ9A 1PQUA 3CEPB 3FIUA 4M9CA 4LTDA 1HDCA 1EZZA 5AM2A 5FNVA 2ZAOA 2EKLA 3S1AA 2I5PO 1WB9A 2HMTA 2I6UA 1K92A 1TOAA 3FTQA 4I1SA 4MKGA 3V1KA 1FFSA 2LUOA 4X3CA 5EIWA 5FUXA 4UTVA 3RIHA 3R0QA 3WIDA 2X4IA 3L9WA 2VJMB 3VR2D 2FKAA 4Q3EA 3A3YA 4NU0A 4ZU6X 3R9XA 3HRIA 4ZV9A 1S2MA 1ZH8A 2SBTA 2J3QA 10MHA 3SYNA 4P53A 4IMRA 1EDZA 3I6QA 4ND2A 1QDLB 4QICA 3LGAA 1GM5A 1MJ5A 2R1UA 1SQ5A 1KAMA 3ZW8A 1U0RA 3MZ0A 1RAIA 5C81A 4HP8A 2JA1A 3I5YA 1TZJA 4WKGA 2PX4A 4ZVUA 4Q3KA 1QC5B 1UIMA 1QWSA 2JHAA 3N74A 1Q1BA 3OUUA 3SNKA 3C6MA 4LJAA 1NLZA 4XM2A 1GDHA 2VI5A 1VZ2A 1WY7A 2FEMA 1I01A 1R4NB 4MV8A 1XE3A 5A9RA 2MINA 2NSYA 2ZRQA 4DEYA 1A7UA 4FBMA 1Z6ZA 1DBIA 4MUXA 3H8VA 1KDPA 2I2WA 2YYZA 2F1JA 2GJ4A 3AQIA 1J2TA 2OBLA 4DUGA 5C3MA 2OGWA 1E9CA 1ETHA 4RKWA 1WVIA 3NLLA 2ZM5A 2QIOA 1FA9A 4XRGA 4ZALA 1LLQA 3A1FA 3C6ZA 1KMMA 3BREA 1GIAA 3G5LA 2I2BA 2QLBA 4MS1A 5HTOA 1Y3HA 2IXTA 4OUDB 2CJYA 1Z4OA 1FRZA 2X41A 3AHCA 4RORA 3ZV6A 1QAOA 2O5VA 3OQMA 2DZDA 3PUVA 3K3PA 3H9UA 4PC7A 2VPPA 3U4IA 5LP6C 4C0HA 1WUJS 2HQ1A 2PTGA 3N0RA 3Q87B 4UCWA 8ABPA 2I8AA 3A6ZA 4PZCA 4GZLA 4ZYYA 3AY6A 1JIIA 2SECE 1MQ8B 3EFBA 4FYYA 1ZW6A 4HQFA 1QGUA 2G40A 4K9RA 4WZZA 4BFZA 3HRKA 3RS4A 5AHKA 2VRNA 2P9FA 4NBRA 121PA 4BO7A 3ZOZA 3W4KA 5TGDA 3WI7A 1QGZA 5P8WA 2UZ3A 4AG3A 4F21A 5K4HA 3RNLA 2ZSHA 3LAWA 3RVOA 1M2NA 3LZCA 4DMKA 3UK2A 1L4BA 5LSAA 3QIAA 3GEGA 3QF7A 1IHXA 2NNLD 4X95A 1H3FA 4G4JA 4LWQA 2Q2OA 5LYJB 3G89A 2JBAA 1QWOA 2DLCX 5M29A 4O33A 5AOAA 2YBEA 4W8GA 2FOXA 5LYJF 4K9DA 1JG3A 4ETWA 4IIHA 5KSYA 3EJ6A 2PK3A 2PWYA 4KJXA 4OAPA 3NBZC 4ZA2A 4LGCA 4A8TA 4FNAA 4BY9E 3Q1LA 2B8NA 4DLPA 4YCDA 3S2FA 3U31A 4MJXA 1QIDA 3UXMA 1WNTA 3CT6A 3D5TA 4FT2A 2HYDA 3ZHVA 2G9UA 4QIHA 4TXLA 3VDXA 1UBHS 2W0MA 3RF7A 4NYMR 3H9GA 2CLDX 5JNWA 1HYHA 2DR2A 1VB5A 3X43A 2ZRCA 3DDZX 5I7AA 4IEEA 2ZUTA 3OOWA 2I76A 5JEDA 3HR7A 5K0GA 1ZJWA 1KE2A 3U3MA 4CL3A 3NT5A 3OZWA 1NW7A 4LVOA 4PPNA 2Z2IA 4L8FA 4QGSA 1BA2A 2QRMA 1PVVA 1VIYA 3JAMA 2GF0A 5JHHB 4NJMB 3BXXA 2HC9A 1OD6A 1EZ1A 7MDHA 3H18A 5KYVA 3PHBE 2FMHA 3VUFA 1RJ9B 2GAAA 3PQ8A 4TTSA 2WJIA 4GSLA 1O0CA 1GG9A 4HQOA 4QOJA 2O0LA 5IW8A 3UUGA 3DMGA 3OLWA 1CRZA 4MO2A 4RSGA 3VOBA 5G4KA 5FOXA 1CY7A 3CPHA 3FPEA 1VI5A 4GOOD 1IDN1 2X1LA 5AVQA 4UKDA 1LFAA 1NQWA 3T7EA 3ZXYA 1C7JA 3WLIA 2JHFA 1Q0RA 5ALKA 4IDEA 4LOHA 1UUFA 5B6IA 2CNDA 1F8FA 3BMQB 3QBVA 3UKJA 1T4DA 3QP9A 4RZSA 4E4RA 1Z34A 1CQWA 2GEFA 3ZVMA 3TIIA 4ZQCB 4BLQA 3OZCA 4Y98A 3G2PA 1G5RA 1NX9A 2LBPA 3FA2A 3A7DA 4WLNA 1E1NA 2QR2A 2V45A 8OHMA 2P6UA 1RQ7A 1DO8A 4RPIA 5DM1A 3VNBA 4Q4CA 4CVNA 3EQ6A 2I71A 4K6MA 4TQUS 5A7HA 3FCSB 1EK5A 3DXFA 2JH8A 4MYCA 2P8SA 3F78A 3PHJA 3CCFA 1GYRA 5JJKA 1UQUA 2QL5A 3QFFA 4ZEWA 4TYNA 4GEGA 3ZS8A 4C2TA 2BH2A 4MR8A 3DCIA 1LPAB 4XWTA 3LUKA 3WL4A 3MFQA 1FNNA 3N2GB 4Y9RA 3S8YA 4K2HA 1R0ZA 2BVNA 5AT1A 5CG2A 3U7GA 1DBWA 1DOHA 2XT0A 4Y0NA 5DNEA 4IMIB 4DLXA 2GCNA 2ZYRA 4Q3CA 5AJYA 1I7QB 2XGSA 3DNFA 3NFRA 4P33A 2WIGA 5EWLB 1LSJA 2DQSA 5KYKA 2Y2VA 1EGVB 1NR5A 2X6QA 2IT1A 2PWPA 4Q37A 3TRJA 5HHTA 5A02A 1ZSVA 3NBUA 1PZGA 3UXYA 2G9QA 5FX2A 1M74A 3QU4A 2C84A 3KM0A 4NMWA 3C7KA 3TQHA 5KOHA 5DTRA 2DHDA 1GKIA 3PCXA 4BO3A 1V95A 4OQDA 3MINA 3OM8A 1ID1A 3SHWA 1MT3A 1E9FA 1QDEA 1QZTA 2J9ZB 1MBZA 2ZBPA 2RGNA 4TVBA 1TT7A 2RKBA 2Y66A 4LJLA 4EGQA 1KYIA 2QPOA 2DLDA 5IZCA 2O5EA 3D6MA 5D3ZA 2YNMA 1NUTA 1UBTS 3JQ9A 4LQDA 3U7RA 5GZ1A 5JBQA 1UKVY 2JKVA 4HWRA 2OGTA 2YZNA 3EN0A 3RU7A 3HU2A 4JOBA 5EQJB 4YMGA 1N3LA 2C7PA 1P44A 3A4VA 3HP7A 3KQPA 2CNNA 2GVZC 4FEYA 5AVKA 1ZZGA 3WRVA 3AL2A 5AQ1A 2CYAA 4F4CA 4I3FA 5COAA 4A23A 2V5UA 3QTTA 5BQ3A 2C4KA 3HA3A 1WBDA 2J6CA 5JAUA 3B70A 1OBVA 4LSZA 2JI7A 2O50A 3W5IA 4LGYA 2R8PA 1ZOLA 3EXHB 3IAS6 4H27A 3LT4A 3I9V6 1TTHA 1HOTA 2D1RA 4OKSA 3PWSA 2YH2A 1L4LA 3WJ1A 5CX4A 2J3DA 2J4FA 5KYXB 5GGXA 5BN4A 4H77A 5F1OA 3NEYA 3UWKA 5K8TA 3KWJA 3TVDA 1SAYA 3UH1A 3QVGB 4ZZ0A 2CLCX 2VF7A 1Q5PA 2FFJA 4BKRA 1U9CA 4JXXA 4BUJA 4FLFA 5KBYA 1RYYA 3E5MA 1UBJS 2H1HA 5KOYA 3V34A 4YT4A 3QPAA 4RHCA 1BTOA 2IBMA 1T2UA 3DQPA 2WTXA 2NZ2A 3A05A 1JXAA 3DE5X 3DFZA 1JLLB 3O75A 4N3AA 3RU9A 3UT0A 3WSTA 4CQLB 3C3KA 1E92A 1O6ZA 1QV9A 2PLAA 1IAQA 1XCLA 2MYUA 3MMSA 4ERXA 2PUAA 1AO0A 1T1EA 3QU2A 4RKEA 2QE7D 2XITA 2C98A 2WNIA 4X7PA 3ZDZB 1KZGB 1R0KA 4CFZA 2VEOA 1WMBA 1HSZA 1OYVA 3AVQA 3W7VA 3IEMA 3NXKA 2AZXA 4AY2A 1UINA 2X76A 3P0RA 4WY2A 3VV3A 2PUDA 3NVKI 3UA3A 5JJ5A 2A1UB 3RVRA 5HVNA 4HUQB 3HXQA 4G86A 2YOHA 4OU4A 3ECSA 4TKUB 5IARA 1ONNA 3ZGNA 4C1NA 1U7DA 2B69A 2Z9CA 3KQYA 4QRDA 4NL4H 1B93A 5KOJB 4UEKA 3ZHSA 4BXOB 3EW9A 5CB4A 1Z5OA 2EP7A 2OLJA 1GKKA 1ZXXA 4X44A 4YLGA 3SZ3A 2FAXA 1J42A 5EJIA 3KBBA 1C7IA 1PGQA 3Q40A 1YZ3A 2CVFA 4LHWA 2WF8A 1IUKA 2O7RA 3OCYA 4LVCA 5LBUA 3FCCA 4QAQA 4N4AA 2YJTD 3KVVA 3Q3GE 4XWYA 2F59A 2HHAA 5ICEA 4LE1A 4TYYA 5AFSA 1FRQA 3FW1A 5JS6A 1BQ3A 2PLNA 4R5MA 5IBPA 5KTMA 1RZRD 1Z75A 1W87A 1X7XA 4QXOA 1VI6A 5B3LA 4H4CA 5M04A 1GV0A 4HNVA 3DOFA 1TJYA 1IMOA 2AYYA 3EPKA 1VL8A 3HN7A 5CFMA 3UW3A 2CZCA 4MPDA 1EK2A 2GHIA 5HJ2A 4EKEA 1S4QA 1KE1A 3OZUA 2R4QA 1Q11A 5BWOA 1XD8A 5TMDA 3T12A 2WSSA 2CHGA 3GGSA 1JECA 2QX6A 2KLBA 2OD2A 5AJTA 4ZTBA 3QPWA 5CYFA 1DARA 4I1VA 5DNDA 5BSRA 2WU1A 2RC5A 3SBOA 5J2TB 2QQFA 1TEHA 1YZGA 1UWCA 3NIDB 4DGSA 4FE4A 4ZO4A 5J2TF 1PSWA 3GBVA 4GPEA 4CG2A 1YK1A 1WCWA 1ORIA 2G70A 1OXXK 4OX9B 3NV9A 4GO1A 4D8WA 3V32A 4PCAA 4EO7A 1X6VA 3LLVA 1UF9A 2HPHA 1XF1A 2OP1A 1L5WA 2V7QA 3DULA 3DVAB 5AUNB 3VR3A 1NKTA 1YVEI 3U49A 3FUWA 3TUJC 4LF5B 3G0HA 1QCDA 4L3VA 4BE7B 2OKCA 4CF6A 1RRKA 1YZHA 2CL5A 3F2VA 4OY3A 2RHOA 5EUCA 4HK4A 3JQQA 4MVWA 5EJFA 4UJ3A 3UK6A 3PYXA 1D09A 4MPRA 3Q9SA 5HA5A 1QZXA 2PBLA 4UM5A 2O3TA 3WYFA 4EQ6B 2QVZX 2F4VB 3VR6H 1GD1O 2NU8B 4ZK2A 1RWPA 4N03A 3FVQA 4I1YA 4X8LA 1T26A 4DIKA 2VYFA 1I9CA 1WXIA 1Q20A 2B9EA 3HJGA 3R5HA 1BCRA 5THXA 5H9VA 1PVDA 3THYA 3IIIA 3M6AA 1L4EA 1ZGCA 2YC4C 5KWIA 3PD1A 2R8OA 3I12A 4BAUA 3IAEA 1BX3A 2WRZA 4NQRA 3RAGA 3O3MB 1NA5A 1AB6A 4X3OA 3RLIA 1OAKA 1Z4PX 1KC3A 1OF1A 2JIQA 2UV8A 3FTCA 3H8SA 1YRAA 2FFQA 3KU1A 4R0VA 2QMZA 4ZI3A 5K45A 4DA4A 4PHHA 4Y8VA 2W43A 1SUSA 2R4TA 5GJWC 2F9LA 4B2IA 3KQHA 1F12A 1UPAA 3VR1A 5IX8A 2Z9BA 4NCHA 2QJWA 3CR8A 1DTWB 1E8NA 1Z8NA 5ALEA 4NU5A 4BBAA 1I6WA 3Q3VA 4M7PA 3CG0A 5FT9A 1C3XA 1N33B 2Z2JA 4TPKA 4HZUB 5IJAA 4TT3A 1YR1A 1WDKA 3KP1A 4ZZ1A 1RT9A 1EVZA 1FXUA 1QFMA 4PQEA 3O9VA 5BXQC 1Y48E 4LQCA 5KOIA 3GMTA 5JDIA 5L40A 1M83A 3UT5B 3D8NA 4OI0A 1GRQA 4AZ0A 1TYDE 2GD0A 2F00A 1N7JA 3NBAA 5HBRA 3QF4A 1BHO1 5SZKB 2YV2A 2QUBA 5E8RA 5EIAA 4KR9A 1NDUA 5AOCA 4CM4B 1JMKC 4GT1A 3AF1A 5BN4B 2XMPA 3R6LA 2P5SA 4MLCA 3IA2A 2ZZNA 1NW3A 1CCWA 1V8OA 1P1FA 3SJ7A 4ZAZA 4HGQA 5CJJA 1EX1A 2WHXA 3DO5A 2BHNA 1XVLA 2ZUCA 5C4IA 3MGKA 4GQIA 2NU6A 3CURA 4RSRA 4AUKA 2OM6A 4DILA 2H1IA 3T9CA 1PGPA 5JQGF 1I7SB 2VK1A 3GV0A 6ADHA 3R40A 3D1LA 3W3AA 4YQYA 5EERA 4TTAA 4FJ2A 1FQWA 1P39A 4EZIA 2RGYA 2H4ZA 2ZRGA 1A50B 3CSUA 4EMSA 5CCBA 4X45A 1DVRA 3UTDA 4NZ9A 2I55A 1IEWA 2GBLA 5K8LA 2C7QA 5KNDH 1CBUA 3LPMA 1SBHA 2FCAA 2PUGA 1TK3A 3A6PC 3AONB 5C51B 1WMDA 4DE5A 3C5CA 3WGZA 3D5EA 3IVGA 2E4VA 1P74A 2X40A 4XUDA 4R8LA 1YZKA 1R8XA 4MITA 2LD4A 1F8YA 1R15A 3F6RA 3WDKA 3GROA 1KMQA 4UARA 3BE5A 4ZIRB 2OBBA 2VHVA 4N76A 3ZJVA 3N28A 4DZTA 4L07A 1HA3A 1LJLA 4IXMA 5JH7B 2XD4A 3HP1A 4N3GA 2XNSA 1XDBA 4G9GA 4E3ZA 5EFZA 3BSYA 1FTQA 1MFZA 3Q8MA 1BDIA 4JX9A 1UBNA 5JH7F 2HXGA 3MBOA 2QI9F 4Y6GB 2CF6A 4MRNA 3NKVA 3DC2A 1IWBB 1VHLA 5AIBA 2OILA 1JIKA 3JAWA 4FOOA 1OU0A 3UKDA 2QUKA 3EVDA 2GD2A 2O1EA 3DDWA 4I0WB 5IKPA 1H4TA 2CF5A 3NJ8A 4HLUC 2D5AA 3L1UA 5GOTA 3NHBA 3ROXA 4E33A 3EXAA 1KZYC 4NHOA 1WETA 3MAAC 1VE3A 2EJBA 3K9BA 3X1KA 3LP8A 2QTNA 2YNMC 4FD3A 3JQ9C 1EVLA 1XAHA 5EIFA 1OILA 4IVPA 4WNAB 3UUWA 4P3OA 3OOEA 5EPUA 1Z6GA 2C3OA 3Q8WA 2HLNA 1TVCA 1XU7A 2J5RA 4OM7A 3FJ1A 3TR6A 4QYTA 1T3SA 3RVJA 2VHJA 1OTXA 1LRLA 1WWKA 3JYOA 3E3NA 3RC3A 3ZWPA 4HH4A 4CKBA 3H5OA 4KGDA 2X2OA 4POAA 2J6BA 5F1YA 3GPLA 4NF2A 1EJ0A 3EZ7A 1KJJA 3KTFA 1ZVVA 1TVEA 3LCMA 4ALKA 3ADPA 3HCWA 4HQ0A 3AL3A 5J59A 5A6SB 1W75A 2FE1A 2L0XA 2PNJA 1OX4A 4IZOA 4QULA 3OHSX 3F1KA 1KJ8A 3ESQA 3I1IA 3W04A 1QKJA 3RFXA 2HMUA 1UM8A 2PL3A 3H9EO 3TGWA 3I32A 4NDZA 4A0QA 6LDHA 1T5SA 3B8HA 4O4HB 1Y7IA 3FSGA 4CTKA 4O2AB 1U0NA 2XMGA 2CMGA 5JOQA 3NTQA 2XHZA 1F2TB 4ZYVA 4PICA 3CTMA 3DCYA 4O4HF 4TXHA 3TOSA 1RHMA 2GPAA 3R5JA 4O2AF 3RJTA 4BV2A 2XRZA 5A06A 1MGOA 1T4MA 1L4MA 1IZ7A 1BXRA 1GU1A 1RXCA 2R66A 2WVGA 5B3AA 2Q3HA 3HMKA 3I39X 1ECJA 5C32A 1EVIA 1Y1KE 4O25A 1QVAA 4ASUA 5JAIA 3FX2A 4HAVA 4LOAA 1Y8QB 4UFPA 4E5VA 2A5JA 4HJRA 2IDZA 2WAOA 1YJ5A 3QUTA 1VJGA 5BNTA 5LZ4A 1JEAA 1JAIA 1Q2UA 1SU8A 2B5OA 2VF5X 2EBFX 4HB0A 4BUCA 3LRTA 3M1YA 4I4IA 4XD7D 2OAGA 1FMTA 4G5YA 5FOWA 3KL4A 4ZU1X 3EOZA 5A1TA 1PNVA 2ORYA 4B6GA 3KETA 5A3QA 4Q9JA 1PK7A 1YMUA 3RSOA 3KDPA 2VHZA 2BWJA 3VR5H 3LT5A 1HNZB 1P3Y1 2B1JA 3Q11A 5JFTA 2GHRA 2Z8ZA 4XIYA 3GDFA 4FXOA 4S24A 1O96B 1P75A 5CXSA 3RTAA 1XQ6A 1ZGHA 1PBTA 1ZDMA 2EGGA 3DKPA 3E35A 3HBAA 1PT8A 3CR7A 3G02A 3PBKA 3RYFB 1TYBE 5FWXB 3ZUGA 1P9LA 3D81A 4OJTA 4PZ0A 5I6DA 1W5EA 3AI1A 3KQKA 1LFDB 4I5IA 3OA0A 1E2BA 1S9DA 4NZOA 2HSDA 3L18A 4YECA 1KMIY 3DMYA 4KSBA 3KKLA 4JA2A 3OCUA 2HSGA 4BNWA 2FEPA 1W76A 1BEUB 3FF1A 1E5XA 1G1MA 2JJYA 1KZ9A 1WNFA 2ZR0A 4H17A 4M0MA 1TUBB 3LBIA 2DFDA 3WYGA 3DLHA 1WUHS 1RI1A 3FYUB 3L7JA 3VYRB 1I5RA 2J0UB 2VWPA 2VHWA 2GK7A 3D59A 4EFKA 2WQ7A 3DP9A 4EKIA 5CIQA 1GQSA 2VXOA 3T3NA 1CQXA 3PP8A 3VA7A 3P71T 3NS7A 4DXAA 3WK4A 1H0KA 1BX1A 3WK5A 4KREA 2VNSA 3W79A 1MX1A 3IUNA 3PXBA 2HA5A 1HX7A 3H6GA 1NSTA 5DM4A 4YRPA 1DZIA 2PU7A 1PYOA 2HSWA 2PH1A 2XOKD 3AWIA 3K0KA 3O74A 1MOZA 2J5KA 2QN3A 4H1UA 4W7HA 3WLNA 2C9MA 4B3BA 4AJKA 4B76A 2BPOA 4IGKA 4BP3A 4CN8A 4DLKA 2CV2A 5K20A 1Y1PA 4G41A 1Y5MA 1XTKA 3ELUA 4KQXA 1E5QA 3RAPR 2YZ2A 3GRVA 2A0YA 4R1LA 4AWAA 3ICWA 2QHXA 1R4ZA 1EKXA 4BQPA 3PQFA 4OH1A 1KXZA 3DAHA 1PNQA 2IE0A 2W71A 3RT1A 2Y0CA 2F6RA 2BOVA 4HWSA 1KH3A 3C0KA 3EMVA 1R4AA 3QOXA 3TYXA 4F4JA 2DT8A 2Y1GA 4UHBA 1RAEA 1XXHB 4XASA 3OD5A 5H1YA 4JFAA 5BN5B 4A8HA 3I04M 2OCBA 4MRAA 3ZWAA 4DYVA 3VM6A 4RW0A 4L4SA 2YV4A 3JTMA 2G88A 3TTSA 3OQBA 1YJCA 3IAM1 3O8CA 1Q7CA 2HI0A 4X7MA 1V5GA 2CWWA 1S3GA 1SVIA 2NX2A 2ZWPA 4JJZA 4YI5A 3SD7A 5AK4A 1PEYA 2H5JA 1IQUA 1U9YA 2D0OB 3M33A 3NAGA 3PGMA 5KUTA 4J16A 2DR3A 4OJKA 5JZVA 5BN3A 4R9RA 5EHQA 1SA0A 4M9SA 3QKIA 3UANA 1MCZA 4Z86A 3D2CA 1NXWA 5I01A 3O1JC 1AXGA 1VSTA 1A7AA 4CEJA 3I2YX 3GDHA 3CF4G 3GF4A 3RCBA 2YFHA 1PTJC 1UAGA 3N8NA 4LF6B 2YKGA 1FSSA 2QM7A 4CKEA 1JVSA 3R9WA 3FD8A 4OBEA 4LXTA 1RWNA 3WRYA 2QEQA 4QBFA 3EZYA 2PCJA 4XX0A 4V02A 5KHOC 3BT7A 3NUZA 4YJHB 2P4EA 4HQNA 2W42A 1UCFA 2HWYA 1NZJA 2PQMA 4JXKA 3H97A 3PT9A 1MOQA 3OU2A 4MP3A 4PZPA 4U7TB 5TGTA 1Y1QA 5JZSA 4DKXA 2V98A 1KP2A 1MAVA 1TW3A 3EG9B 3S2UA 3LGXA 4L5YA 3OBBA 5EZSA 1JIXA 4NCNA 2PUJA 1KKLA 5JXWA 2CEAA 2BFEB 2IYSA 2J5QA 5SYMA 5CDUA 1YJQA 3DL2A 1E59A 5ANRB 4BE4A 1SVWA 3GRYA 4ZARA 3O2QB 5D87A 4V03A 5F1PA 2QD4A 3LIIA 4IDCA 4UFNA 5G0WA 4LOIA 4LY9A 1NUHA 4IVQA 3KKPA 3BWCA 4TWJA 3ZHZA 4L95C 4D2IA 3WL3A 5KWVA 2XIJA 2V54A 1E0SA 1N2OA 2OR3A 3K2QA 1D7OA 3TTXA 4ZOQI 1M0SA 3KFXA 3QU9A 2ID9A 4JS0A 5FAKA 2ZJ7A 2QP9X 1USGA 3KPJA 1FRNA 1CE8A 1T3GA 2YXNA 4RPHA 3DM9B 1J24A 2P2CA 5BRNA 2AW3A 5CR9A 3GR6A 1SOAA 4A8PA 3T15A 3FN4A 3RUDA 2GBLC 3I6IA 1HE2A 2J9GA 1UXIA 5K6AC 2XEDA 2Q2VA 3LWZA 3WBJA 1VKOA 1D1SA 5FQOA 4H6VA 4G36A 1JEYA 5CLIA 1SC4A 2XCIA 3I6BA 3MWGA 4MP8A 3IDFA 3JVIA 4YO7A 1Y7HA 5T8KA 3OE7A 2LDXA 2VT6A 1YS6A 1JHAA 1P1HA 2CKMA 3TNDA 4WQMA 3V80A 3Q8LA 4HGOA 5AOVA 2GKGA 4IIJB 4L4ZA 1Y3FE 2F1RA 1USIA 3HCBA 3T4UA 3SVTA 3RYCA 3QY9A 3A1VA 1CW2B 3NHUA 1WSWA 2ZBDA 3Q7IA 4IIJF 3WLEA 1H5QA 2I7XA 1SCUA 2WKQA 3FFTA 3PEUA 5JDCA 1QPZA 1NUUA 3UAVA 4QHSA 1U99A 1V1RB 4WXMA 5JW6A 1YUMA 1XFAA 3ASYA 5HGXA 2VDQB 3AUAA 3P0JA 1FX0B 1I9GA 2VL7A 5EJ9A 2KPOA 2VJNA 1K9SA 1XO1A 4J49A 2PMFA 4PANA 4M99A 1I24A 1SC3A 1XDSA 1N0UA 2PX6A 1U0OC 3LW7A 3VTKA 1G16A 1IEVA 1M2WA 1ECPA 1YR7A 3AHDA 2OK7A 3CNHA 4DQUA 4JWKA 2XNDD 5DMXA 2P2GA 4C4TA 4CG3A 1E1KA 2CEKA 4G1UC 1DIRA 5IUJC 1XD2B 3PUXA 4WZAE 2Y76A 2O8CA 5FLKA 1RLMA 5LVAA 4MWOA 2EJWA 3VJRA 4D6PA 1NRJB 5C5EA 4C7OB 2GF9A 3LPAA 1ZVQA 3AJRA 1ZWKA 4J2HA 1HFWA 2FSVA 4URHA 2ENWA 3IEUA 1V45E 3K05A 3WTCA 2FUNB 5CEJA 2H57A 1SKYB 3O31A 3PDHA 1THTA 2VBFA 5DHSA 1RZUA 1DHTA 4AP5A 2AQKA 2APJA 3KJHA 3O73A 5DP1A 2QM8A 3PNOA 3CVYA 4J7AA 4QQKA 1K98A 2Z2YA 1B8OA 4JXZA 1MNQA 1PK8A 2ZT6A 3DQZA 1FDUA 3RSZA 2HL6A 5BRAA 1DCTA 2W6PA 1T6XA 3M6UA 1M1NA 3QVKA 4WKBA 4AX4A 2YCLA 1KVTA 2VS1A 1KF0A 4NNOA 2FNAA 2YWRA 4R1QA 1CJUC 1EDBA 3L7DA 4JITA 5DBGA 4EUKA 4ENPA 4CV2A 4YRMA 4LEIA 1DIBA 3ZNNA 4XR9A 1F1JA 4WK4B 2Q5EA 3FOZA 4DC9A 1KEZA 4M1QA 3ZIDA 2WBLC 1RRCA 2ESRA 3BRSA 2ICAA 5JBNA 1L5OA 3KRTA 4Q03A 4QPPA 3PWZA 5A5DA 3E15A 2ACWA 5FF9A 2OKGA 5A3JA 2OESA 3O03A 1MP0A 5EY5B 3G0BA 2NADA 2HADA 4MYRA 4HGPA 5IHXA 2GUGA 4D96A 4B43A 2VCYA 3GW8A 4JNCA 5KVVA 2PT6A 4E09A 5AVZA 2NSDA 4QPCA 4TT8A 3R75A 4PO3X 3D6AA 5DEIA 5EP2A 4AXXA 3NBFA 3WIUA 3C4JA 4CV0A 3GYBA 1OZ0A 4L72A 4ZVOA 4GIBA 4LDPA 3TI9A 4YCAA 4YGYA 1IVNA 1JAHA 3BWMA 4HQLA 3ESAA 3JZFA 4H4EA 2CFTA 2AFVA 2OPBA 4FHGA 3IBGA 3CSDA 4E88A 3HJHA 4LTNA 1YB1A 2YHIB 5HQ3B 3JYPA 1B2RA 2CZQA 3A14A 3OT5A 3W2TA 2DBQA 1FP4B 2HV9A 2GRAA 3I0NA 1PFUA 3N39C 4HLDA 3EFEA 3GELA 5EVCA 2ZPTX 4ZU3A 3W77A 2IOFA 5LQMA 1SHKA 5E7IA 4MMYB 4BQFA 3GMIA 1G2QA 4B17A 4RKYA 2OHOA 3I5XA 4U63A 1NHGA 3EYAA 1Q0PA 2IS4A 3O1LA 4ATNA 3IQXA 3VNUA 5IG2A 1ADGA 1EGAA 4C05A 1J1ZA 4PS0A 5F33A 1AQNA 1UT8A 4I2NA 2CL7X 1K8YB 2VF8A 3OMLA 4QUAA 3FNQA 4BJ3A 3JASB 4ZRNA 3PZBA 1M7GA 5HF5A 3FUCA 4WN9B 1WEKA 1B43A 1NVDA 2J09A 2WIKA 3V7NA 2A78A 5FI5A 2C9BA 1SKUA 2B21A 3AVYA 1DTSA 4G1MB 4ER5A 1A9XA 1JBKA 4AY6A 3D0RA 3WWPA 4IKOA 1SG6A 2NVOA 5UKDA 3FWHA 3I58A 1X94A 2JD0A 2RGXA 2EYUA 3KX2A 4LS3A 4YCBA 5LLSA 6AT1A 1DGQA 1NWCA 2XDWA 2DQYA 3T06B 1XMSA 2IYUA 1TQ4A 2AFHE 2GM5A 2R79A 3EAFA 1NI3A 3FNGA 3HKDA 4WZBB 4Y2SA 2BW0A 1JPVA 4BJ1A 1HDGO 3SR3A 4CXMA 1Q7GA 4LXHA 5D5HA 4DAOA 5E6SA 4EWLA 4OMCA 3P9IA 4RIGA 4UMDA 3ZXUB 4CG1A 1N1GA 4ALJA 3IYLW 5CG1A 4WDRA 4KR6A 4CLRA 3JQ6A 1D3AA 2I87A 2AD1A 2A59A 3O8DA 2ID7A 5ABPA 2W83A 2HA7A 4IIFA 4RKQA 4UBIA 2IHBA 3A4IA 1E1YA 3B3FA 5TY0A 1UJ2A 4YJ2A 3CVVA 3N8IA 1O94A 3AESB 3BK2A 3IMFA 4Q4JA 2XCOA 3EB9A 1EMDA 5AKKA 1JMVA 5JO0A 1RPZA 1JDZA 5DIZA 5DPMA 4LJRA 4U7GA 1MRNA 2R1VA 1DAHA 3FNHA 3I83A 1FFXB 1VSBA 5AW7A 3GZNA 3LNCA 3RC1A 1QV6A 1V9CA 2VP2A 3EFHA 3V4SA 4EI8A 4B4VA 1WZIA 3AW9A 4BVBA 2ATVA 3DHEA 2NXWA 5KTNA 4EKNB 1RVV1 1M1UA 1XSEA 1KZ1A 2HDNB 4XXHA 2R6GA 2WFLA 1KJ9A 2AHRA 3ONFA 1W49A 4AJHA 3FJOA 3HL4A 3WIOA 1TM5E 5LOVA 5H4GA 1S7CA