1ZICA

Crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFAATSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zicA00
3AFIA 4UBOA 4AN1A 1CUYA 1JI3A 2QUBA 4X00A 1C4XA 4X6YA 5HF6A 1DT5A 3LLCA 2WHQA 5ALMA 2J3QA 4A23A 4CCWA 5HF5A 1SCIA 3GELA 2JGIA 4H7HA 5IH7A 3ANSA 1CUCA 1YAJA 1N5MA 2WFMA 5LZ8A 1TKRA 2XI4A 3EIOA 4X6XA 4TPKA 4G4JA 4C89A 4DYHA 2XUOA 1P0QA 3UUEA 2WLSA 4DNOA 2H7CA 4U2FA 1UKBA 3BWXA 4AXBA 4BE4A 4DMFA 3C70A 3HYSA 4WFIA 1A8UA 4WY5A 4Y2YA 2XMDA 1U65A 1YS2X 5CW2A 2PL5A 2Z3ZA 2I3ZA 3UUFA 1JU4A 5ALRA 5AK3A 4M0MA 3FVRA 5K5EA 2PX6A 2QR5A 4KACA 2PM8A 2WG2A 4Z49A 5JATA 3GZJA 1ODCA 1IMJA 4M0FA 5A7HA 2I03A 2OLEA 5JALA 1XLUA 1QGED 4AX4A 5CT8A 2PUHA 4B84A 3ICVA 1U4NA 4YK7A 2HA2A 1LBTA 1BN6A 4EHBA 4KE7A 5EIAA 2B20A 3CN9A 3B5EA 2AJLI 3YASA 4BAGA 1MT3A 3ILSA 5LP1A 3V1MA 3HC7A 4YPVA 1LPSA 3K6KA 4C4ZA 4ZV7A 5AOCA 4ZXFA 5EIEA 4PQEA 2J4FA 2JGFA 3H18A 5F4ZA 4OSEA 1DX6A 2B61A 3QPDA 2WIDA 1QIGA 1MTZA 2DHEA 3N0TA 3G9XA 4WDRA 2QJRA 1O6GA 1C7JA 3C45A 2XUFA 3BF8A 2OAGA 5AKZA 4J0IA 1XKTA 3DD5A 3WYNA 4FNMA 1TQHA 5CTAA 4CIAA 2ZVDA 1UK9A 3KWJA 3R41A 3DYIA 2JGJA 4KAJA 1RP1A 3B12A 3FYUB 5AP9A 1VXOA 3DEAA 3K9BA 2HA0A 1RWQA 2OQIA 2O7VA 1FSSA 2OCLA 3S2ZA 2ZYRA 3WA6A 3D4LA 4XIIA 1LZLA 4EY7A 3PI6A 2HL6A 4UBMA 3FLEA 3E4DA 3G8YA 4U2EA 3STVA 1EH5A 2HIHA 5AOAA 1L7RA 5EI5A 1AURA 1VZ2A 5YASA 3AINA 4X92A 4Y2VA 1ZJ5A 1CUUA 3PFBA 3H2IA 1CUGA 4ZI5A 3VJLA 2H9YA 4ROTA 1GT6A 2Y6VA 4QA9A 1ZGCA 4WDQA 4GI1A 1FFBA 5DNWA 2JBWA 4FKBA 1CLEA 4FLMA 5A7GA 4G4IA 4W1RA 1BCRA 1XROA 4DGQA 5JAHA 1SC9A 2Y2VA 2B4KA 4B7ZA 1ZI8A 1U2EA 2AJ8A 4UHCA 3A2NA 4UBJA 5LZ9A 1XZFA 4V2IA 2JIDA 5AI6A 3DNMA 4G9EA 5C8ZA 1CUJA 4QDTA 3VJKA 5C8VA 1F6WA 5AH0A 3FSGD 4UHFA 3D2AA 4H0CA 1CEXA 4OU5A 5D7BA 3RARA 5A6VA 5JD6A 3F97A 1E5TA 2XUJA 5HKAA 5AO9A 2CMFA 3OURA 4PF1A 5JASA 3FLAA 4CG3A 3TRDA 3FNBA 3T4UA 4N5HX 4GDMA 4TVKA 1H22A 3DOHA 3G0DA 2PU7A 2JGMA 1MPXA 2D0DA 4JEIA 5DLPA 3H1BA 1MJ5A 4LXHA 5JYCA 4GXNA 4FDMA 5ALPA 4JH0A 5KWIA 1VZ3A 3VDXA 3FBWA 1IUNA 1LLFA 1PV1A 2XUGA 1C7IA 4J3JA 4UBIA 3G9ZA 2XMRA 3QMMA 4LIPD 3IVMA 4TGLA 4ETWA 4N8EA 4PV7A 2BGNA 3HI4A 1JT2A 5FV4A 5JZSA 3H1AA 4Q05A 2HDWA 3AIKA 3SX4A 3O4HA 4DTCA 1Y7IA 2WJ4A 3M82A 1TIBA 4Y2SA 3RK4A 5LIPA 1WPXA 1ORVA 3WL8A 1L7QA 3G0GA 2Z5GA 1AX9A 4KRYA 3A6ZA 1E89A 2PKYX 1GPNA 5HQ3B 3PICA 2FJPA 4J0KA 4Y2TA 1T4MA 3HSSA 1TRHA 1YASA 1XRPA 3HRHA 3BE8A 2WHRA 4UBNA 1DINA 1N8SA 2PBLA 4X97A 5CH3A 1A7UA 3CN7A 1QZ3A 1YSCA 3W06A 3UMJA 1DX4A 1LNSA 2BUAA 1ZI6A 5HZGA 1LZKA 3VJMA 1W6RA 2XQKA 1AQLA 1CR6A 2R8BA 5D6OA 4OB7A 1RYYA 1CV2A 3GFFA 3KD2A 1ODSA 4UFNA 4PW0A 5FOQA 2VJAA 1CUHA 2H7XA 2O2HA 3O4GA 4FTWA 5AHXA 5AKGA 1JJIA 1TCBA 2PSFA 1R1DA 5ISMA 4MWSA 4H35A 3WWDA 3P2MA 4BDTA 4ARAA 5T4EA 3ZPXA 1QOZA 5CH8A 2HFJA 1FFCA 3F9CA 3ESCA 3IURA 5I9IA 5EHZA 3M81A 2HHAA 1HLGA 5K3FB 1WM1A 3R40A 2G5TA 3W9UA 3BDIA 3IIIA 4BTVA 1AUOA 1QE3A 1MU0A 4Q1VA 5AI9A 5ALXA 3PF8A 4XWGA 2VJBA 3HABA 5BV7A 1E3QA 1LPOA 1LPAB 4J0JA 1GGVA 1MAHA 5JZ9A 4QNNA 4UBKA 1QONA 1ZIXA 1CUDA 2Z8XA 5AIAA 2X5XA 3WK4A 3HACA 1UWCA 3QYJA 4OU4A 3DYVA 4J0DA 2EDCA 3B3QA 3OM8A 1BEEA 3R3ZA 3FCYA 3NOXA 2OQVA 1JJBA 4G9GA 1R9NA 3FAKA 1WOMA 2IIVA 1QO7A 4G8CA 4EB0A 1CPYA 3H0CA 1ZD4A 1VE6A 5BOVA 2OG1A 4M0EA 4HZGA 4J03A 1ZGBA 5IVIA 4WCVA 1UT6A 2WILA 4LKOA 4H7IA 1CUIA 5E2IA 1XLWA 1HDEA 2RHWA 4EZIA 2WG1A 3EQ9A 4CI9A 4GW3A 1H2YA 2RI6A 4FHZA 4EY6A 3WWPA 5DTJA 1W52X 1ISPA 1QTIA 1UFOA 1HQDA 1CRLA 3V9AA 2EEPA 3JW8A 1QTRA 5ALTA 3QM1A 3IUNA 4UUQA 4AO8A 1GPKA 2Z8ZA 4MJ3A 4Y9SA 5DNVA 1ZI9A 2BGRA 1W75A 4BVLA 5AM0A 4F0JA 5K3DA 3WL5A 1B6GA 4X6UA 1VJ5A 3O4IA 1J07A 5A71A 2FJ0A 1CUZA 1Q83A 5HF8A 3LS2A 4BP8A 2I78A 4HS9A 2V97A 2K2QB 4W1QA 1I6WA 2ORYA 3M3DA 2QM0A 1CUVA 2CEKA 3BJMA 4JUIA 1CUFA 3WK5A 1DWOA 3AZOA 3WLAA 2XLCA 2WIFA 2XUQA 4QLOA 1UK8A 3ED1A 1WB4A 5A2GA 1UOOA 2O7RA 1YS1X 4BCCA 4QLAA 2QUAA 4AB1A 5LZ7A 4RE5A 3O95A 1CUAA 3H19A 3GROA 2AJCA 4C87A 1F0NA 5FXMA 1UKAA 4D9JA 2CKMA 2LIPA 4XVCA 4L9AA 3H04A 5EHNA 1IZ8A 4HRXA 1Y37A 5SYNA 5HFAA 1CUSA 1W1IA 4BATA 1A8SA 3G9TA 5K3CA 2BJHA 1EHYA 3QH4A 4KE9A 1MN6A 3HZOA 5ALJA 3AIOA 5I7UA 1DU4A 2XB6A 4FFVA 3V48A 4UFPA 2JGLA 2ROQA 1J06A 3L1JA 3FVTA 1YA8A 1XZKA 5ALFA 3KXPA 5ALOA 4ZREA 2WTMA 4BE9A 1QJ4A 4IH9A 3QMWA 2QXUA 2VATA 1P0IA 4FLFA 1PJAA 4AO6A 3E3AA 5HCUA 3C6YA 1OXMA 2FUKA 4B6GA 2OGSA 3WZMA 4KAAA 4B85A 4AZ3A 2H7YA 3NWOA 1BE0A 1BRTA 2XMBA 4OCZA 2HU7A 4S0XA 1X2EA 3G0BA 4GLBA 4Y2JA 1CQZA 2GBIA 4ITVA 4QDZA 5AKIA 3I2IA 5JZBA 2WG0A 5AM3A 1CVLA 3WKDA 4H7DA 1W76A 4GBGA 3F98A 1UXOA 4U2DA 2V98A 1XLVA 3U0VA 3IDAA 5EGNA 1ETHA 1GQSA 2WU3A 4G4GA 4H7EA 2GYWA 3QZUA 2CB9A 2CJPA 5ESRA 4BP9A 2J4CA 3I2JA 4P08A 3O9MA 2QJWA 3C6XA 1EDDA 3STWA 5DNUA 5ALEA 3A2LA 5AKXA 4C4YA 5IVHA 3O0DA 3PDCA 4HTAA 5AK6A 3CCBA 1P0PA 1LGYA 3FSGA 1WB6A 3NGMA 5DWDA 5KBYA 1QO9A 1IZ7A 2O2IA 1JJFA 3BDVA 3U1TA 3WK9A 4OYLA 4X91A 4EBBA 4KAFA 2HA7A 5HK9A 4LYEA 4HXGA 3SK0A 2GBFA 5EFZA 5ALHA 2UZ0A 4DM7A 4PSCA 4W1PA 5AKYA 5CURA 4AMZA 2J3DA 3FLBA 3WKCA 1UK6A 2V96A 2C5FA 3IA2A 1F0PA 4HXFB 2OXEA 1DT3A 4BZWA 4C88A 3G7NA 3WJ1A 4F21A 2BUCA 1VA5A 5K3EA 5LYYA 2BCEA 3C8DA 3NUZA 4W63A 3WJ2A 1SCQA 3IULA 5ALQA 1XFDA 2XLBA 4K6GA 4BCBA 5LZ4A 3EQ8A 3HXKA 2PU5A 4G1FA 4NS4A 4IHAA 5BWBA 3ESBA 2O2GA 5ALKA 2VQ6A 1TCAA 4BCDA 5DTIA 3RLIA 4OD0A 2C0PA 4P92A 5AK5A 4ARBA 1R9MA 1MNQA 2X8BA 5CXUA 4FMPA 4Q34A 4FLEA 2OCKA 3OG9A 3ZLVA 1L7AA 3DCNA 5ALIA 3OPMA 2VSQA 5DYTA 5C7YA 2XUAA 4L72A 4G8DA 1MX5A 2HRRA 5JARA 1WCYA 2PSDA 5E4YA 5E4JA 3C5WP 2ACKA 2C7BA 4F5ZA 4X71A 1YB7A 4IO0A 3IUMA 4BVKA 2XMQA 4CCYB 2B9VA 1Q84A 2R11A 3WWEA 1JU3A 4X85A 3OC0A 5T4HA 2RONA 4H77A 3Q8WA 2C4HA 4U2GA 2GZSA 1WHTA 5CT6A 2V9ZA 2W22A 3AUKA 4MXDA 3AZPA 3DOIA 2HFKA 1QIJA 3I2HA 3CXUA 3ZWQA 4B0PA 2XUPA 4MEBA 3E0XA 1EK2A 3LCRA 3GUUA 4BBZA 2XDWA 3FCXA 2WQZA 1K8QA 4KE6A 2QZPA 1NU6A 2D5LA 4Y2PA 4DMHA 3H2KA 3OTQA 4BDSA 2YYSA 1XZLA 2NW6A 3FYTA 5C8XA 4QZVA 1Q0ZA 2P8SA 4RGYA 4OUKX 1FFAA 4YASA 5AICA 7YASA 4XX1A 4QE3A 3DL4A 3QPAA 1TAHA 3Q0TA 3STUA 4A16A 2JF0A 1EA5A 2VT6A 2OGZA 2HA5A 1JMKC 2Q0XA 1QIKA 2WIJA 2GBGA 4HXEB 3I1YA 4C6HA 2HADA 1GKKA 4N8DA 1FFEA 1E8MA 1HPLA 2GZRA 3IB3A 1UZAA 3WZLA 2PUJA 4OB8A 4ZWNA 2XQIA 3E1GA 4KRXA 4AZ0A 1YCDA 2H1IA 3LIPA 4I3FA 4B0OA 5AM2A 5JD4A 2XE4A 5FP0A 4KYVA 5CMLA 3I6ZA 2YXPX 2CBGA 5EHQA 1CQWA 1VE7A 4BC0A 3G9UA 4I19A 3T52A 2PSHA 4JYMA 4PSDA 2HA4A 4B83A 5AKHA 3F96A 3QITA 1EB8A 2DQZA 4E14A 5CT4A 1BS9A 4QDXA 1K6EA 4O08A 1WHSA 3W05A 2ONCA 2HRQA 4Y7DA 1MX9A 4J7AA 4J0HA 3V1LA 3I6YA 4W1SA 5T4BA 5AKJA 1KU0A 4X93A 2WU4A 5CRIA 3IBTA 1ZOIA 4BRSA 1THGA 1PFQA 3BIXA 1R50A 1EVQA 5CH5A 4OPMA 3EQ7A 2JGEA 4IQ4A 4LXIA 5LKRA 5AKKA 2ECFA 1HBJA 4KEAA 5BWCA 4Q3LA 4LHEA 1THTA 2DHDA 4ZV9A 3C43A 2VF2A 2WTNA 1EB9A 3D3NA 3STXA 2YH2A 1QIIA 1M33A 3I28A 1DTEA 1R88A 2BUBA 3EF3A 4UHBA 3WL6A 1QIFA 2OAEA 1HL7A 1AMNA 1F8UA 1VOTA 2BAGA 2WUEA 1JMYA 3A2MA 4IH4A 2Y6UA 4QDOA 2WKWA 1JKMA 2DSNA 2WUFA 4PSUA 4Q3KA 3GBSA 3JYHA 3IUJA 3F67A 2PSEA 3C6ZA 1LPBB 1QFSA 2QTBA 2AJBA 1XZAA 5AOBA 5AM4A 4CG1A 2CUTA 4U2CA 5IVDA 2VEOA 3WWCA 1A88A 1OCEA 1MX1A 4BAZA 1USWA 2VAXA 2PVSA 2XT0A 4WY8A 1X70A 5DYYA 4J0CA 1E66A 2WFLA 2AJDA 5FLKA 3RM3A 1CUWA 3MGAA 2WUDA 3QBJA 1H2XA 1ZD3A 2VTVA 3ESAA 1MNAA 1BEZA 4PNZA 5IKXA 5IVKA 3AILA 3M83A 4K6HA 4K2AA 4DIUA 2IX9A 1BCSA 3PUIA 5CT5A 1P0MA 1K63A 5ALWA 5ALSA 4DSAA 2VJCA 4UBLA 2XMCA 3L1IA 4FNGA 3ESDA 5AK4A 4G5XA 4G8BA 4X7BA 1UKCA 2ZYSA 2GBCA 3DKRA 3DLTA 3R3WA 5KWJA 5JANA 5FRDA 3KWFA 4UFOA 4P93A 4X3CA 2ZJ6A 2XMGA 5ALVA 5C81A 1XZMA 3A70A 1XZEA 2QS9A 4LYDA 5EHXA 1MAAA 3PUHA 4HAIA 4L0CA 1B41A 3N2ZB 2XQGA 1FJ2A 2W6CX 2OGTA 3R0VA 3D2BA 1VXRA 4P9NA 2WHPA 4DNQA 2G4LA 1KU6A 1QIEA 2VJDA 4U2BA 3H2GA 5A62A 2ZYHA 2AXEA 4CFSA 4BYMA 1XQWA 2XUHA 4E46A 5AM1A 3ZV7A 3LP5A 3W2TA 2YASA 1IVYA 3H2HA 3R3XA 2VA9A 4H7JA 1G4HA 3ZLTA 3GA7A 5E4TA 1ZD2P 3VXKA 2ZSIA 5LKAA 4QDUA 3PFCA 4RE6A 3WIBA 5JIBA 1SFRA 1EI9A 4B9AA 1ODTC 3WA7A 4FBLA 4CG2A 3C6BA 2FX5A 2ZYIA 4BZZA 1G66A 5D3KA 3C5VA 3I2GA 3D5EA 3WKEA 4N8SA 5AI5A 1XRMA 5DYWA 1HKHA 3DS8A 3HEAA 2JGKA 4BVJA 1TCCA 4Y2UA 4WJLA 1ORWA 3VKFA 5LZ5A 3G0IA 3WMRA 2QMQA 4ZRDA 1QIMA 2C5GA 4EY8A 1O6FA 3BF7A 3DDUA 3VISA 4MYSA 2RGUA 1QFMA 1EK1A 4J0GA 1YAHA 1DWQA 1XRRA 2JEZA 3WK7A 1XRNA 1MO2A 3D0KA 5ALZA 4H18A 3BIWA 2ES4A 1J2EA 4E15A 2XUKA 4INZA 5FPPA 1SOMA 2ZJ7A 2Y2UA 4FFWA 3AIMA 1J1IA 3DQZA 1KEZA 5HKBA 1IUPA 2WIKA 1XQVA 2Y1KA 4E11A 1ACLA 1AKNA 2JEYA 2WSLA 3VVMA 4BRZA 2OPHA 1GPLA 3SWWA 1XRQA 3S8YA 5ALNA 4GECA 3KSRA 2E3JA 2HU8A 3SC2A 4NMWA 5K3BA 2C0QA 1A8QA 1XZIA 3D2CA 3STYA 1EINA 3TEJA 3I6MA 1ZIYA 2XQFA 4UHDA 4RNCA 1UK7A 1XZHA 4A5SA 1EVEA 4C4XA 3I2FA 5ALYA 5FKJA 1OILA 4K6KA 4Q82A 3O9VA 1LPNA 2VT7A 4FOLA 1S8OA 1H23A 3R3UA 3DL7A 1EX9A 1H2WA 1QLWA 5FPQA 1Z68A 3H17A 4DNFA 3FWHA 5ALDA 3V1NA 5KREA 3O4JA 2RAUA 1K5PA 3X3HA 3CCCA 4GWLA 1D07A 6YASA 1WB5A 2WFZA 4JNCA 1E8DA 2QT9A 4MWTA 5JAOA 5CXXA 2G63A 5JD5A 4AO7A 4B82A 1DQYA 1N5RA 1E8NA 4MEAA 3DJYA 4EY4A 3BJRA 5H3HA 4MQMA 5JADA 5CT9A 4FBMA 1G5FA 2DHCA 2XUIA 2XMZA 1CUBA 3MVEA 1ZICA 4MYDA 5LZ2A 2HA6A 4Y2QA 4B9EA 4KE8A 1GKLA 3I1IA 3I2KA 4HRYA 1R4ZA 5T4FA 2C58A 1JFRA 3FYUA 4Q3OA 2DR0A 1XZGA 1AC5A 1CUEA 1X2BA 5DJ5A 1T2NA 4ZGBA 1XZCA 4WFJA 1LBSA 3WKBA 4EUSA 1WPRA 3ANTA 3KOOA 1Y7HA 4I4CA 3MUNA 3WL7A 1VA4A 1ACJA 3G02A 4MQLA 1BN7A 2QVBA 4BTLA 3VVLA 4OYYA 4BB0A 3PF9A 2BKLA 3FYUC 2Z3WA 5J3JA 1BROA 1ZJ4A 2WUGA 3HLKA 4WFKA 4FWBA 1XZJA 2G5PA 5A7FA 3D7RA 5ALGA 2IITA 4F60A 3AJAA 4DNPA 5D3ZA 4DMKA 4IH1A 3TGLA 3AZQA 1XQXA 3V1KA 1N1MA 1YB6A 3QVMA 3STTA 3K2IA 4DSZA 1VKHA 3G0CA 2WIGA 5FUMA 4CIBA 4QWWA 2HA3A 3MUOA 4Y2XA 1U8EA 3QPCA 3WWOA 1UOPA 4B80A 2I3DA 5JAPA 2HU5A 1LPMA 3WKAA 1XZBA 3ZI7A 2QOEA 1GXSA 1XQYA 5HFNA 4GHWA 4K5QA 3LIIA 1NU8A 3ZLUA 5CBKA 3WIOA 2PPLA 5FDFA 4CCYA 4PO3X 4HVTA 4XJVA 4NZZA 1Q0RA 2WFLB 2VAVA 1BU8A 1CFJA 5ALLA 4BAUA 4X95A 4B81A 1GZ7A 4KJXA 1R3DA 5AI4A 3W04A 2XMSA 3QMVA 3RKSA 5AI8A 4YX9A 2GYUA 1XZDA 4LXGA 1FFDA 3WK8A 2QKYA 3BL8A 4H7FA 2XQJA 1CUXA 2WM2A 2HM7A 3HJUA 5HQ3A 3C8HA 2QRUA 1AGYA 3R3YA 4H7KA 2ACEA 1EDEA 3WK6A 3L1HA 3JWEA 5JAUA 4N5IX 3KDAA 2OCGA 1XKLA 2XUDA 2OCIA 1QIHA 2GYVA 1XRLA 1EXWA 5AKEA 4C01A 5I8PA 5AJHA 5SYMA 5LLSA 2WJ3A 2WHPB 1TK3A 1UOQA 2BFNA 1G42A 4NVRA 3BXPA 3D59A 3H2JA 4KR0A 1SCKA 3IUQA 4RPCA 4QEKA 1DWPA 2PSJA 2QXTA 3EBLA 1VLQA 3OOSA 4DMCA 2ZSHA 1IUOA 1EDBA 2DCMA 4AN0A 3WI7A 4AQDA 3DKKA 4BC1A 2DQYA 5AKLA 2ZJFA 4JYPA 5AM5A 1YR2A 5HF9A 5EIHA 2CZQA 4DLNA 4QWMA 1AZWA 4W9RA 1ZD5A 2EDAA 4X90A 4L3WA 2DFPA 5K3FA 3PE6A 3WQHA 4AMYA 1H2ZA 4X94A 4GEGA 3W9BA 4Y2RA 4EA6A 4EY5A 4OB6A 1YA4A 3F8SA 3WYDA 1QIDA 1NX9A 3FOBA 3ICWA 5HK8A 5K3AA 2RHTA 1W4LA 5ALUA 3TJMA 1GQRA 1DQZA 1K4YA 4UHEA 2RIPA 1CIJA 5AIBA 2X76A 2WJ6A 4UHHA 3C87A 3R3VA 4UPDA 1LPPA 5AI0A
chains in the Genus database with same CATH superfamily
2VDUE 3UKOA 1YWGO 1UBJS 4FGUA 4RANA 3DBVO 5JZVA 2OXFA 1CUYA 4R41A 3P9KA 1JI3A 1LJ8A 4X6YA 2Z8YM 1T3HA 4K81B 4NAHA 4X3PA 4ZAZA 2QGNA 3AF6A 1A3CA 1P9LA 1D2EA 2GLXA 4AG5A 2VG8A 1KOJA 4JEMA 2JCBA 4LWQA 4O2BA 5DOVA 4U9UA 3NH9A 2J3QA 4G85A 1TEVA 3H4VA 4WW0A 1HG1A 4CCWA 4WNAA 1UXGA 2AC2A 2D2XA 4KQEA 2ET6A 2B4YA 4NQRA 5E3HA 1WXIA 4X65B 2QN1A 1SCIA 2OP0A 5D3MA 4A03A 2GM4A 2WKSA 2JGIA 3HYLA 4D97A 1MGOA 4F4HA 3E3MA 2G04A 5K4GA 3ANSA 1YAJA 3EZLA 5EZSA 1N5MA 5J5CA 1TKRA 5GJWC 4RSHA 1M1ZA 2OHJA 1AIPA 3EIOA 2J0VA 2JLQA 3NM5A 1GAEO 3GLVA 2AGVA 4Q4HA 2FWJA 4D79A 2JKYA 2SBTA 3EQ6A 1N2IA 1Y8RA 4GR4A 5B3AA 1T8TA 2XB8A 1NNLA 4BXOB 1KO1A 1VP9A 1P0QA 2JIZD 4GDFA 4G3XA 1C80A 1U9CA 4A2QA 4GKJB 4DNOA 1X0XA 5KYUA 3TDMA 1HDCA 1JPNA 1NKSA 2EIXA 2H7CA 3V2HA 1SRQA 2N42A 4YMWA 4F2WA 3K71B 1XZNA 1AXGA 1NQ5A 3GRPA 4P34A 1RPZA 3VZQA 3NVAA 4MQ6A 5A3JA 1RQGA 3JD1A 4BMXA 4BWGA 1VC2A 1TUIA 3HFSA 4YRBA 5BSWA 1FXUA 1P2GA 2CNKA 2H18A 3JQBA 2BFDB 3MNFA 4BE4A 3SM3A 4JBGA 4DMFA 5BR1A 4L2IB 1YFLA 4K86A 4HO1X 5B7QA 4KFRA 1RWVA 3L7IA 1A8UA 1OX4A 4ZAGA 3SC2B 2Z2XA 4EHKA 5CG2A 1K2VN 2OZLA 2JH8A 5DTEA 4DPMA 1NX6A 1G9TA 1E2LA 1U65A 1YS2X 3NTVA 4JVNA 3VNSA 3AR5A 4CM7A 4B34A 5I7VA 3UUFA 3ZZUA 2WP0A 4C2AA 4NARA 2P2CA 5AUPB 3VPHA 4RTLA 2QG4A 1TEHA 4RPHA 4M0MA 4DV2B 3H1GA 3A14A 1VG0B 2ZAOA 3FVRA 1NBME 3OCWA 4PO8A 3ZG6A 2VTEA 1HETA 2PM8A 4BE7B 4KQJA 1ATZA 3LQFA 4MS3A 1Q6YA 2Q1SA 1ODCA 1DC7A 3OIFA 1ZLXA 3L8HA 3NTOA 4DSTA 3OWHA 4FR0A 5ADHA 4K87A 1AKQA 1Z33A 4P4SB 3MJTA 2ZTUA 1XLUA 3U4CA 3BGOS 2LKCA 1MBZA 2RK3A 1F51E 3LXMA 4B3BA 3DMHA 4D8UA 1GEEA 1F2UB 3E82A 4J1TA 1JS1X 3PR1A 4AX4A 4CMGA 2QLTA 3W5JA 1EZZA 5LA6A 3WIDA 1A82A 2FOLA 2PUHA 4DMMA 1WV0A 1YB1A 1U4NA 2IZ5A 3SF8A 3W1VA 2JLYA 3IQHX 4LOAA 1U1CA 1H6DA 4NZ9A 1BDJA 4IEFB 4C3UA 1TUGA 2HA2A 3TOXA 3UK0A 3BORA 3QJGA 3GNSA 1RZRA 5EIAA 3ICCA 4TZ6A 1BNCA 1D9ZA 5F3DA 1DIHA 4QKQA 1X80A 1D04A 3HGMA 1XK7A 3CB4A 2P2YA 1QBKC 3AKCA 1XMPA 3NP9A 3SC6A 2IU4A 4E08A 5KSPA 3THRA 1I3NA 421PA 1HT3A 2ACVA 3KTFA 4EPTA 1MT3A 2P1RA 4WASA 2C5AA 2NZ2A 4C21A 4WZBB 3ELWA 3OCYA 2GEFA 2BBWA 3BA1A 5FNVA 1F0YA 3OESA 4AM8A 4W5NA 1X42A 1JBKA 1T29A 2IHYA 2VYFA 3HC7A 3TZCA 3OC6A 1K3TA 4HMPA 1DBVO 5CEJA 1LPSA 2ATEA 4NCBA 2GX6A 1Z6QA 5IUKC 4KGZA 3JVVA 4ZV7A 3L4JA 4ZXFA 5EIEA 5I7AA 2NTVA 1T8YA 2BGGA 1PL8A 4KTVE 4R1PA 7ABPA 3AJ9A 2JGFA 3DXZA 3H18A 3ZZMA 3BWMA 1RRCA 2GMWA 2P6UA 3K09A 3VC2A 1P4GA 5ITWA 1IUKA 4OSEA 2XXAB 4HV4A 2ZR8A 1IG3A 4JZKA 3B89A 3U9TA 4YR9A 4YCSA 1XMSA 3N0TA 4XVUA 5I5EA 3GJ4A 1KMCA 2I3GA 5C7OO 3G9XA 3X1WA 1K6MA 1WXEA 2CJYA 5HKLA 2QJRA 3SQDA 4CEIB 2LNDA 3TNLA 1XNHA 2I4OA 3D43A 5HS6A 3W3AH 4MITA 4BV3A 4OHMA 1FXWA 2A6PA 4LV8B 2J0UB 1Z37A 1VHQA 1V26A 2ID9A 3GIWA 5AKZA 4TTQA 1Y3FE 4S1OA 1V96A 1OGYA 1A5ZA 2SECE 3P26A 2OWEA 1PX0A 5T6MA 2GK7A 1LLCA 1YE3A 3IDQA 1OXTA 3ZXSA 8OHMA 4FEYA 4FE4A 3KKNA 3KQNA 1JW9B 4YAEA 2GK6A 4C0AC 1EGHA 1UK9A 3UT5B 3KWJA 3WSWA 4YRIA 5H8WA 2C2GA 1JNYA 1R6TA 1VG9B 1RP1A 1FRQA 3B12A 3K3PA 3FWKA 4NONA 2XD4A 2QRVA 1RYNA 2HA0A 2E4AA 3BWCA 3BULA 2O7VA 1FSSA 3JYPA 4LEIA 2OCLA 3VOSA 2IF0A 2Q5FA 2ZSFA 1Z6ZA 2OC4A 3SR3A 4C4TA 2FRDA 3WA6A 4NP6A 1T4BA 3D1LA 4B74A 3FUVA 1KVRA 4IRUB 5I9BA 4EKYA 1F20A 2BKVA 2Q99A 4BNTA 1U3VA 4XIIA 4EARA 4LMAA 2VPIA 4EYEA 2IUEA 5DI9A 1UFRA 4TL7A 4PINA 4EY7A 5EIBC 4OXRA 4E5YA 1SQ5A 3WAKA 4EP1A 2OM2A 1WCWA 4DMLA 1LLDA 3IP6A 1AMOA 3FLEA 3KJXA 1QTNA 2IZZA 5LP1A 4CCYB 3ZE9A 5JAZA 2ST1A 3ZCSA 4MGKR 1NUAA 5EI5A 3WX0A 4PPYA 1I51A 1KVSA 1M9NA 4LCJA 2O3QA 1HDXA 2BJWA 2O1EA 4G6ZA 2KYRA 1VI5A 3AINA 1E3LA 2X0IA 2C2OA 3KWMA 1J4AA 3P0JA 4Y2VA 5DB4A 1M76A 3UG7A 1PSDA 4RK4A 3GRKA 3QY0A 2P0AA 4J1NA 1YR3A 3RHZA 5L4LA 1X7ZB 4AP5A 1JEYA 4L8YA 1I0ZA 1RYDA 1I2AA 4NJEA 4DMRA 3LQ2A 4FN4A 4GI1A 4BGVA 4G0NA 4DG5A 4GI7A 1CLEA 4D74A 1KRXA 4GG1A 4ROSA 1IPEA 4YJ3F 4R9UC 5EN4A 5BWNA 1Y3CE 3QPVA 4RKEA 4NOKA 3W5IA 1BCRA 1A2BA 3EJ6A 4OBWA 3TBFA 2BMVA 3ZYZA 5FPSA 4DGQA 5JAHA 1SC9A 3CPJB 1ZM9A 4DRYA 4QSHA 2R5WA 1LNZA 2A9FA 2BKEA 4GOMD 2AZXA 2QL6A 1IM2A 3A2NA 3NRJA 1F2DA 4LOHA 4RHCA 5KEIA 4V2IA 2IXDA 5AI6A 1NW8A 3A6LA 3DNMA 2NLOA 3OUZA 1K89A 1SUCA 1YCFA 4OXIA 4MROA 3AETA 5C4GB 4G0YA 2UZ4A 3DONA 4TWAA 2Y0BA 1MOZA 4DC1A 1UBSB 5AUNB 3VYTB 1WABA 4H6WA 1O3YA 3VJKA 4CIYA 4EO9A 2DY0A 3FSEA 2VRWA 4JELA 4MR9A 2O8EB 3U62A 3PXGA 4PM4A 4JK3A 5EIBD 3E35A 4TT8A 3OQVA 1I4TD 2Z57A 1GZVA 1Z2EA 3CKMA 3D2AA 4OU5A 3EJWA 5A6VA 3S1LA 5K2MA 1KNQA 1T35A 5TT0A 1EEHA 3FMFA 4JLDA 5F9MA 5CB4B 4PC3A 2NV6A 8MHTA 4Q1FA 3BCUA 2OWDA 2CMFA 3OURA 1KDRA 1TLLA 1ES9A 2GYYA 3UC5A 1OTHA 2SCUA 3A9SA 3EHEA 3ELBA 2BI8A 3CC8A 3KL4A 3L04A 4L5JA 4FYPA 3DHYA 4L7QA 1RI5A 3FNBA 3DPIA 4N82A 2WU8A 4GDMA 4OHZA 1H22A 2G17A 1OAAA 2C4WA 2VHEA 3BK7A 1O9BA 1Z5UA 3B9RA 3EVFA 1II9A 1ZAYA 3TNDA 1XBTA 1MEOA 2J41A 4KU4A 1ZYUA 1EFUA 1Z4PX 3STHA 3HFGA 1OWOA 1U3CA 2JAUA 1OIXA 2ZI5A 3BTOA 1A5SB 1MPXA 2D0DA 1ABFA 3KB1A 1JDNA 4JEIA 2Q2QA 3E3OA 5FHQA 1XMIA 2ZW9A 2IC5A 4LXHA 4D3YA 1U8FO 2AN3A 1RAFA 4GXNA 2AH5A 3CVJA 4UUMA 5ALPA 4G1UC 1TZJA 3JQGA 2IXTA 3T94A 3ED5A 4LYHA 3NYIA 4XTCS 3R8CA 3MWLA 3LDUA 4RAQA 2X0NA 1C7IA 4M8IA 2XMRA 1H9AA 4LIPD 1U3UA 2PKQO 3SDSA 2PUFA 1Z29A 3HL4A 1LFAA 3ENVA 3VKHA 1R0SA 4TGLA 2BIFA 2XXBA 2JHCA 3TDKA 1N4DA 1XLTA 2CJWB 2FSUA 3ORFA 5C8YF 2B36A 4E51A 5JZSA 4RZXA 4FT2A 4QYTA 1E4OA 1Y5NA 4ZAFA 4E1AA 2Q45A 5E8JA 2QU8A 2QD3A 5CNJA 4ZAWA 3V1YA 5IJAA 1XDSA 3SX4A 3O3OB 3SKVA 4DWWA 2HCJB 2I4LA 7MDHA 2ZCVA 1DB3A 5BMOA 2YY6A 2Q0QA 4FC6A 1QP7A 1GT91 1PG5A 3P8ZA 1PJCA 3Q3CA 4HDMB 5L4NA 5J43A 2XWQA 4L5YA 5E1DA 3ZX5A 1M10A 1ORVA 4IRXA 4Y0NA 4CODB 1ZG3A 2CUKA 2Z5LA 1P7VA 4DIDA 4DCMA 4RTKA 1DG9A 3PNYA 4BECA 2Z5GA 1AX9A 1RD4A 3LGSA 3FPKA 3UK6A 2WA1A 3TQFA 5HJ5A 3DZ8A 3DMTC 4XLTA 1C9NA 3NWBA 1HRKA 3R7WA 2Y76A 4KRYA 2YIDA 3H1EA 3MWEA 5EESA 4Q24A 5TJ9A 4BNLA 1N3IA 1X14A 5AXCA 2EFDB 1MF7A 1E89A 5AVXA 4R5MA 3R9XB 4XSVA 1P61B 4N0PA 3DDOA 3BG5A 3Q7EA 2FJPA 4LJ6A 4XCXA 1JEOA 2RB5A 4J0KA 4Y2TA 5K6AA 3HSSA 1TRHA 1WZCA 4RUKA 4AIRA 4F4DA 1YASA 4M7PA 2PVPA 3MMZA 2QLMA 4UBNA 2A7XA 4X63A 3A11A 5E6RB 1RNLA 3LK6A 4O02B 5IK2A 4Z8YA 2WYVA 4U63A 4WNYA 4D3XA 2RGCA 5CH3A 1KO4A 5T41A 4D9EA 4GGMX 1A7UA 1V4NA 3KDSE 2ICAA 1BA3A 4CM3A 5LFAA 4UATA 1ZCBA 4DR7B 3UMJA 1JB1A 4NXMB 2ZRPA 3ROXA 2O1SA 1I9CA 3ESXA 4ITRC 4WERA 2BUAA 1ZI6A 3GP5A 5CD9A 3TTTA 4J94A 2QD1A 2EATA 2GFIA 2CL7X 2PD3A 2X2PA 3O9ZA 4KVFA 4PCLA 3WGLA 4JKYA 3GLFA 3A2KA 3GHYA 1JRLA 3RVSA 5A5GA 1HFJA 1SD1A 4N9WA 4H0FA 1S4MA 5LYJA 5B1HA 3GEHA 1IHDA 4CIXA 1LSJA 3OA0A 2YNMD 4G97A 2FX3A 1DARA 1PGJA 3LNTA 5ECWA 3HXPA 5EZ5A 2X77A 5HYVA 3GFFA 2QLJA 2C2YA 1W48A 2IU6A 4NECA 1SVMA 2ZIGA 4RK7A 2F6RA 3NATA 3THOA 3THXA 2YY7A 1H42A 1GNVA 1L5ZA 5JCOC 5G0UA 5A0TA 4X8MA 4ZI7A 1P8AA 1F8XA 1JVSA 3OTGA 3U40A 1TU4A 2FWPA 3IIKA 4PXSA 4QUKA 3TLKA 2H7XA 2Z1DA 3DL2A 4LXTA 2A88A 4QTTB 1RI1A 4U2KA 5HM6A 3KQTA 1Y1LA 3ADCA 2JHFA 2PQ0A 2PSFA 1NUUA 4HDKB 1V25A 2WSIA 3ZVLA 4F9GA 1MB4A 5ISMA 1E9AA 2W48A 4MWSA 1DAIA 2WWWA 4DZTA 4WKNA 4YXWA 4BDTA 2O2XA 3PFWO 1ESZA 4RHEA 4YMSA 1I5RA 3ZPXA 2FVXA 3OZGA 2I2BA 1WKBA 5ICFA 1XL1A 1RBZA 5DBEX 3PRYA 4XDYA 5A5VA 4KX3A 2X1LA 2HFJA 5CHEA 3KJFA 3AO0B 5E2BA 4DGSA 2X19A 2OHFA 4F9FA 1ZMXA 2NYUA 4V3BA 2EF0A 1NW7A 1YOVA 4RADA 3ESCA 3OZTA 1CY8A 3IURA 3ZBUA 3MHPA 1JFLA 1HK7A 4PYNA 5DIFA 1YDWA 5EHZA 5IVPA 3CH5A 4HMQA 4UJ3A 5JYBA 2HHAA 3FFAA 3QPWA 3F3KA 3V7NA 3VU8A 2Q1XA 3VR2A 2HPZA 4G26A 2NU7B 3LY7A 5FI5A 1U4OA 3BHMA 1XELA 1TIPA 4FGJA 1M1NB 5JZOA 2G5TA 4D4JA 2UUCB 4FDTA 3PRKE 1DMSA 2H00A 3NT2A 3BDIA 1K8ZB 4BKQA 4LF6B 4BTVA 1VG1A 1UXHA 3ID6C 2A3NA 3K5HA 2VYCA 5EZYA 4NCHA 4Q1VA 5E3JA 2AG1A 2NZYA 5AI9A 4BO3A 1FFSA 4BO2A 2X3FA 3JQ9A 1RJFA 3QFHA 1YJCA 4HEA6 4XWGA 2VJBA 4JT9A 4N9QA 4X54A 3TZBA 5BV7A 3L9XA 4D8VA 3HM2A 1SUWA 1O03A 5KWSA 1XTUA 2R97A 1PR1A 4I4TA 5AXDA 1FQOA 3ZWDA 1LPOA 1LPAB 4OYRA 4TLBA 4J0JA 1XZQA 1UMDA 3EEIA 1RSZA 2C7GA 3AF2A 1OLSA 2P41A 9MHTA 5DXAA 4MW2A 1MAHA 3V4VB 4NDNE 4QNNA 1ZWKA 2CXTA 4UMFA 4XD7D 3IAXA 3WGZA 3G59A 3L1UA 2VF8A 3PNBA 2ODAA 4ZJUA 2FPIA 5AIAA 1RIIA 1ZMTA 2X5XA 4X1IA 5IDWA 1YZ3A 4OU4A 1OYVA 4H27A 1QGUB 4O3FA 4ZOLF 3SY8A 2EDCA 4QFDA 4PZ9A 1SXGA 4K9KA 4JBXA 4OREX 3OM8A 4DADA 3C85A 2O0MA 1R18A 1BEEA 3IR7A 4ZDIA 3R3ZA 4TTRA 5I47A 2J0EA 1TAGA 1FK8A 3ZDFA 1QBGA 2PA3A 2A8YA 4Q16A 2J67A 2ZI9A 3DYBA 4GMXA 2EZTA 2QN9A 1KY4A 3NOXA 2CLSA 1Z45A 3CRMA 3LKDA 1EYZA 3DT9A 3QGMA 5IPFA 4D4LA 3IEMA 2FPMA 2O3TA 3PQEA 2FQXA 4MVJP 1EWTA 2ZSEA 4KIJA 2CLCX 4Q7QA 5ED4A 5CX4A 4NU6A 3EPHA 1QO7A 3LYLA 1R74A 5J2TA 4HH0A 2IY8A 2JCVA 3D8RA 2APJA 1TW2A 3GGPA 3P7MA 4IDHA 4O2BB 3V1TC 5F35A 1IC6A 4HWKA 1NQUA 2H2WA 3FWNA 4M46A 1IN5A 4WZAA 1P3JA 4EB0A 3R5JA 5D3MB 1GSOA 5F7ZA 3TFWA 3KLOA 1UJ2A 2H9AA 4FCCA 1P19A 2PYZA 1QYXA 1WXGA 3KKOA 4LJKA 5A9TA 3W7AA 2ZCJA 2EG5A 2F1KA 1LF5A 4UQPA 1NYRA 1S2GA 1JIQA 1YUNA 4J03A 4Q4HB 1COWA 1XT6A 4I4NA 4KXXA 3PXDA 1JDSA 1Y8RB 3EXG1 5IVIA 3RYHA 3BSSA 3HV0A 3ND5A 1JAHA 4EI2A 3Q41A 3ZNOA 1B0UA 3V3TA 1Z2DA 1GY8A 5KYUB 1JQEA 1PFGA 5E2IA 1GSHA 4JA2A 4QJIA 3GDWA 2GERA 2PUAA 5IEJA 4DV1B 1NAHA 1HDEA 1E1QD 3BGDA 2V7BA 1JLKA 3IBCA 2KW5A 1VPVA 4FYJA 1MQ8B 4EUNA 3K1YA 4EZIA 2WG1A 3KHUA 5BT9A 2O0HA 2Z08A 5IANA 5CA1A 3EQ9A 3HCWA 3Q7TA 1OX4B 4J49A 4RA9B 4GW3A 3P0HA 1U7WA 3RU9A 3KB8A 1RAIA 1P73A 5D7NA 4F4FA 1TU0A 2OZLB 4BGUA 3I04M 2QTWB 4RABA 3GEMA 1GHTA 1N5OX 4DWVA 1CRZA 3RANA 3KJGA 2FW6A 3GLGA 1QTIA 5LD2B 2YJ3A 4PU0A 3UMFA 1UFOA 1BTOA 3HR4A 2JIZA 3MRXA 2VVTA 1BX0A 3IEPA 3RIEA 3V7UA 3SXJA 2Y0EA 3E9NA 3IO5A 4MA0A 5B58T 1SKMA 3IEVA 3MAJA 4MS3B 4D6YA 3KELA 4XGRA 2D1FA 2GH1A 3WY9A 4D9NA 1DXOA 3B1XA 4H2DA 3L0ZA 1JFVA 4AO8A 2FPUA 2JNWA 4MJ3A 5LMZA 3UHJA 1KZ6A 2BGTA 4EB8A 1E6KA 3NQ41 2XTMA 5C1PA 1IOZA 1NATA 4D6XA 5K0EA 1YF3A 2HQSA 1AUPA 1NWCA 1UQRA 1YZGA 3JPWA 4H60A 3SU8A 4PZCA 3W90A 5LA6B 1BO6A 1TJ5A 1JX6A 2DFTA 5AM0A 3R5KA 2XIQA 1T2AA 4F0JA 2ENWA 2QQGA 3SF8B 5C34B 2WKPA 4TVSA 3IS3A 3QF4A 4WFQA 3OFNA 1TUBA 4YQFA 3ZHVA 3PC2A 4WPGA 2OZEA 4RMHA 2O4CA 2BSXA 2G8NA 3H97A 1LRLA 1X80B 1JHPA 4QPJC 3VKWA 4LQDA 1T34A 2DH6A 2EFCB 2VK1A 4MV8A 4WZ6A 5BSVA 4BNVA 1DAMA 4D8TA 4DLSA 2I2FA 2WU0A 3ABRB 4IIFA 1BHJA 3KLPX 4LA4A 4QNRA 4JV5B 3O83A 4XW2A 5TPWA 2AG0A 2AK3A 5K8CA 5FNVB 1Q74A 3WLAA 2XLCA 2XJ4A 2JIMA 3WGJA 1OHHD 3N2YA 3V6MA 3T8YA 2ISCA 2C84A 1BWQA 4Y6PA 3M6IA 4RAOA 2G7ZA 2Y4OA 1Z9BA 1U0TA 1YA6A 4DDHA 1XNGA 3BH0A 3GEDA 5GQSA 3UXEA 5BSFA 1VJ1A 2PXAA 1UT5A 1P81A 3LSYA 1X8KA 4W8HA 3UWPA 4BLOA 4CETA 4BCCA 3O38A 4ZGGA 4J4HA 1ZNZA 4MWDA 5DNDA 5DV9A 4AB1A 3AQ4A 3DMGA 1Y6QA 3W8NA 2W2XA 3ND8A 3NKFA 4RE5A 1GRCA 4B3DA 2HEGA 2FMXA 2ZPAA 1NASA 3UPUA 1G19A 1UC4B 4WLVA 5G3YA 1YRHA 3EYAA 4LJRA 4C87A 1F0NA 2GPWA 3DLHA 1T4CB 4M88A 2ZRQA 4YIKA 1WZEA 2ONYA 5FXMA 2MDTA 4NQZA 4D9JA 4A6PA 1CJVC 2YHUA 2H8GA 4LTNA 5FWDA 4RL4A 2PE5A 2PAAA 1V16A 1RM0A 4HRXA 1N0IA 2ACWA 4FC7A 4HRVA 1CUSA 5DKFA 1YQTA 1V8BA 4HUQA 3TCNA 1N1GA 3G13A 3B48A 4AKEA 3D5QA 3LL4A 3IJ5A 2QTTA 3G9TA 2BJHA 5K0LA 2F8TA 5JDIA 4B4WA 2G7MC 1EHYA 4KE9A 1YQEA 2J9FA 4IS2A 4R40A 1MN6A 5KO2A 2EX4A 3G1WA 3LC0A 3HZOA 1X39A 4DJ5X 2ZXEA 3KJIA 5ALJA 3AIOA 4RIHA 4BLVA 3U4MA 1C81A 4EGCB 4GZ6A 2BOVA 2A9VA 3S1AA 4LXYA 4Y2GA 2ROQA 1EFDN 5CLJA 4RW0A 2VP2A 3WDKA 1KK1A 1XQ9A 1YA8A 2FWIA 2R8XA 2XF8A 5TVGA 1PJ8A 2XRZA 1TO1E 1JI0A 3C7TA 1YH3A 4M1YA 5CYOA 2F8MA 4CV2A 1A2KC 3L6EA 4BJHB 2PKQP 4ZREA 1B3RA 3U4IA 3R09A 2WTMA 1A98A 1ESMA 1U6JA 2AN1A 3D8UA 4BE9A 4D7AA 3ZHQA 4D96A 2BFAA 4GC5A 5LXTF 1QJ4A 4EFDA 3RQSA 2ZOSA 3KOZA 3GO4A 1H9BA 3BMQA 1RRVA 4X7PA 3UCEA 1RI3A 1SVWA 5LOVF 2D5AA 4GBMA 1P0IA 2CXOA 5LQRA 5CB8A 4AWXA 4AO6A 1JEYB 3I5UA 1FJGB 1M54A 2I6TA 2F8LA 5DHQA 2O06A 4N47A 4HLQB 4PC7A 4NJEB 3VO2A 2OGWA 1R2QA 3DFKA 4W7IA 4B6GA 2H2IA 3CTMA 5DK6A 2HNBA 2Z98A 2HSEA 3VSBA 4AZWA 1X94A 2JIOA 3A8TA 3Q9UA 1JF8A 4EFMA 2PIDA 3NWOA 4TMXA 1ZY2A 4LUCA 1BCRB 2IU3A 3I4FA 1XVLA 2HU7A 2NVOA 3P9CA 4S0XA 1X2EA 3CRZA 5U4XA 3BX1A 1WBDA 3E15A 1BHSA 4GO1A 4QX6A 3N86A 1ZRMA 5LLTA 3UUWA 4MV9A 1SEPA 4BFVA 1SQ6A 1KHHA 5JZBA 3AETB 4QASA 3ZTTA 3SM9A 3CZMA 3EBOA 2ZIWB 1CVLA 3RUHA 1WZ2A 2J3KA 2PEZA 1RTKA 3HDGA 3NETA 4JYCA 3GAMA 4S2EA 2QLFA 4MR9B 1LNQA 3FFBA 1XLVA 4HQKA 2BHSA 1IY2A 4HGOA 4XJXA 1SWWA 3AX6A 1TECE 3HDQA 2PUGA 4JLNA 5CBPA 3GLFE 1TW3A 3QSYA 1GQSA 4H7EA 1GRVA 4OMCA 5DGTA 3LHIA 2QHXA 1SWVA 4TL6A 5EJAA 4PYJA 2CJPA 2VXCA 1FP2A 5ESRA 1R4AA 1RT9A 4LHSA 4N54A 4WOCA 2DX7A 2FCAA 2V5AA 4FUQA 2QJWA 1JIKA 3TRHA 5KX5A 1IFXA 3STWA 1PNRA 3UICA 3PUKA 3RK0A 4AECA 3H4MA 3NNSA 2XZDA 2G72A 3J81A 1KOLA 2OHGA 4QNMA 1E0SA 3HB5X 2SCUB 3DCJA 5DSXA 4A91A 4AP9A 5IFLA 5JBIA 3KKMA 1OT5A 4WKOA 4DG9A 3NC0C 4IDCA 1VJRA 5CA0A 1SBCA 2AOXA 4HVAA 4I8DA 1K75A 1CVIA 5FJJA 4F1JA 2Y92A 1R8JA 2YCLA 1Y48E 4KX5A 3NC4A 3CH6A 1SHTX 4KPFC 3URKA 5AK6A 4AG3A 4PLGA 3X2FA 3WGIA 1FZTA 3LBAA 4GVLA 3ML1A 1YZQA 1QFYA 1PT8A 5EIWA 1EXDA 4GS5A 3U4GA 2JB9A 1QLJA 4JJEA 1P0PA 5BVHB 4QGGA 5I8WA 4P86A 1JEAA 1WB6A 4X45A 4ECEA 1T1IA 3JQ7A 4NK5A 5DWDA 1Z6XA 1WCIA 1QO9A 5B4UA 4LBWA 2VH1A 3JQGB 1L5OA 1EAMA 1M6VA 2AOUA 4A9AA 1ECJA 1JJFA 3BDVA 4P3OA 4XUGB 4C2TA 3RC2A 2WAMA 2GXUA 4UMDA 1S3FA 2B30A 3R6WA 4MUBA 2QJOA 4KAFA 1SURA 4QOGA 1IK6A 4AJHA 5C8DA 1EK0A 3NHBA 4C78A 1T1EA 621PA 1MUUA 2GZAA 3NBYC 4QULA 1HDOA 1Q57A 5BRNA 1WW3A 3AJDA 3DV2A 4S1TA 4W7SA 5EZQA 3OF3A 5EFZA 2B2XA 3U3XA 3VMFA 4B2YA 1N57A 2KJQA 1XCLA 3ZQJA 2UZ0A 4JHXA 3U2QA 1G7CA 3VH2A 1G2IA 4W1PA 3W78A 5AKYA 2O5VA 5J63A 4OK5A 2R4TA 1SQ0A 1U0LA 3JASA 2B1QA 5CURA 3H9JA 4MW1A 4CE6A 4NKRA 1UK6A 4HS4A 4IQGA 5TY0A 3IUYA 2H1LA 2V96A 1VPTA 3CLSD 3E4CA 4S12A 3U48A 3CV3A 4I5IA 2OR3A 2VRCD 1G8PA 4IFIA 4UD2A 5I7HA 1AKVA 4D0LB 1ZU5A 2JZOA 1K6XA 2VZ0A 3UGKA 1TQ8A 3M0EA 1F5SA 4UTOA 3HE3A 1TCUA 1NBEA 1ZJ6A 1MC4A 1LTKA 2R1UA 2XADA 4KO3S 5TV2A 1DOAA 2CZGA 2W6OA 1O54A 3L77A 2SKCA 3WBBA 1Y63A 4A0HA 1RZUA 4ZO4A 3R7WB 4LE0A 5AOVA 3IMEA 5BV0A 1VA5A 1ZC4A 1SHLA 2Q8QA 3B9PA 3OVMA 4YWJA 3UBTA 4TLAA 2P77A 2YQ4A 3QLTA 3PWZA 3NIBA 1I7SB 2TRSB 121PA 4P32A 4HN9A 4IOLA 3QV1A 1C3EA 1NWHA 5EKSA 5C5DA 2X5OA 1PR4A 1TZKA 4UM9B 1F17A 3PV0A 4XGIA 3S2IA 2C83A 5FA5A 3N7TA 1NXQA 1KGDA 4HH3C 2VWPA 3REFA 3EARA 1HNNA 5EKUA 4ER7A 3LDHA 4R8LA 4XUCA 4YCJA 3ESBA 3OPYB 3U7RA 1YU9A 3SHVA 2FFJA 2ERYA 1TCAA 2Q0SA 3IPCA 3MWJA 4RD3A 4XQ0A 5DTIA 2JLUA 3TIFA 2C0PA 1MQ9A 2RHGB 3LCMA 2VH2A 3ETCA 5K05A 2PS1A 4AJOA 3GLFB 3FZNA 3OZDA 5BQPA 2VIIA 1R9MA 2O9JA 5I4BA 3MAAC 2RGYA 4GR5A 3WTBA 5LYJB 1N0HA 4EJMA 2G25A 1Y9DA 3MTIA 4FUTA 4LDAA 3JD2A 4WZAE 1N4AA 3DXFA 3G8DA 2ZUBA 5FBRB 1HTBA 1K9VF 1NXTA 3VAYA 3W5VA 4FMPA 3TLJA 1FU4A 4FLEA 3INRA 3PEVA 2DJ5A 2OCKA 4MUIA 3VH3A 1DQNA 4DPKA 1SCAA 4HDAA 2VPQA 1EUZA 4GD3Q 4BNFA 3DCNA 4ZI7B 1ORHA 7REQA 4PG6A 4JI5B 3CG0A 3ZNNA 1WMAA 2W2TA 2VSQA 2V03A 1ABEA 1PEDA 1U2ZA 2I2DA 4ZI2A 4I50A 3RRXA 5JLJA 4N01A 4B48A 3LCVB 3VRHA 3UG6A 1NT2A 2ZWOA 3T0GA 1VMDA 3DHEA 3EK2A 2B8TA 3LC2O 3QKIA 5J5VA 1SVIA 3CTPA 4OMUA 2HRRA 3V7YA 3LX8A 1TKBA 4M9CA 3ZDRA 2YQZA 4UUNA 5KZMB 3ROGA 1QF6A 5E4YA 4JXZA 1KS2A 5E4JA 5ADVA 3P0FA 1EG2A 4TL8A 2IHUA 3HU5A 5B1IA 3TQCA 2YNMA 1HYBA 2PUCA 4BO8A 5F5XA 3AUYA 1G5RA 4OL0A 5FI1B 2G08A 3KQVA 7GPBA 2XR1A 4EPYA 4X71A 4ZJPA 2YVKA 1KBOA 2NXWA 1XDZA 2NAPA 2PXCA 3C3MA 1XYGA 3IUMA 3LOPA 3ZWMA 2J6HA 4WK2B 2NV0A 4MPJA 4WNIA 4XPZA 1MO3A 1NVTA 2GZ1A 2M9MA 2OHOA 2R11A 1IXRC 3I8XA 1YOVB 3P0RA 2OBBA 3OJ0A 5B1DA 3AM4A 3VBCA 3GLGE 2HCBA 4YMGA 3TYXA 1A4XA 3I8OA 3N6VA 4H16A 3OC0A 4BU1A 3SXUA 4N7BA 1A27A 2RONA 4H77A 1BHQ1 3OMXA 4MMYB 3S0JA 2W4IA 2YN2A 5AW2A 1P45A 3DTTA 4EHNA 2XRYA 4RTJA 2W2LD 1OLUA 1M67A 4R84A 5IU6A 2NADA 1VCIA 2JEOA 4IIUA 3UT0A 2BFFA 1LK0A 1DKMA 1HE2A 4C0KA 4KCGA 4ZCIA 1KH2A 2YS7A 2HX1A 5L7WA 2NT4A 4A8JC 3QUSA 4K7JA 5EZYB 3ZJYA 4D2IA 1WXDA 1ZL2A 3ABIA 3N0VA 3M5PA 4IOMA 4EENA 3TMAA 4Q7MB 3H1TA 4N48A 1CEYA 3A1FA 3KQHA 4BMSA 3E9DA 1QORA 2PD4A 4O2AF 3WLMA 2P2SA 4I4TB 3GNLA 1NXSA 3WGTA 4R8MA 2VOEA 3N6XA 1QF7A 1UMDB 1I3MA 1Y34E 2JFPA 2QUZA 1OLSB 4K9LA 1DLIA 2DFVA 2NQ8A 2O6HA 1J24A 2AW5A 2GN2A 3U09A 3K0CA 3QVJA 3PGLA 4PO1A 2PV7A 1QG6A 3TAXA 3RSGA 3ZWBA 5HPYB 2QQEA 5HVNA 1IXKA 2FPIB 4G5HA 1BDHA 3NM6B 1E64A 1UDWA 4KDRA 1JPUA 2R6GA 4Q3DA 4BNXA 2CV0A 1E20A 3FSRA 4WHMA 4PYRA 3KKQA 4IJ6A 5FYQA 5BPHA 3AB8A 4Q1AA 5CK5A 3FCAA 3FCXA 1BA2A 1FS5A 4MW0A 3BQ9A 1K8QA 1JKXA 2I3AA 4V2UA 521PA 5IZCA 1U7DA 4EA9A 1XJWA 2D5IA 2J9YB 3UJ9A 3TQHA 1W44A 4GPEA 5MDHA 4HNVA 3OMLA 3SIWA 3SSOA 4OM7A 1O4WA 2Q4BA 3T5AA 5EPUA 1D4AA 3M4NA 3FF4A 4ZODA 1FS6A 1P1CA 3NIWA 3DUFA 4B6FA 2J07A 2Q5HA 5J2TB 1GILA 1Q2UA 3AMVA 4N6GA 1OQAA 1ZOSA 1UFQA 3FYTA 3JSAA 4Q7LA 4XD7A 4IUBS 3UF0A 1UDRA 4BVHA 1CCWA 1V4VA 4D8YA 3E9MA 1DELA 4RLHA 2JJ1D 3MAGA 4NAUA 1DUIA 1P44A 2Q49A 2OCYC 1I10A 4WZAB 3FOFC 2D2EA 3GK3A 3VO9A 1KOFA 1ZBQA 2DH5A 4QYMA 2G3YA 5EG5A 4UEQA 4ALKA 4MEJA 1KBQA 4TWZA 4J16A 5F1KA 1VKRA 4QE3A 4A3SA 3U19A 1P4HA 3LZ6A 4BNMA 1Q3KA 4XX0A 5HJ2A 3LUKA 3BXEA 3QOWA 2J3EA 4GPIB 2XYRA 2BFOA 5K3SA 2C7VA 3I23A 5D3QA 5KHAA 3RYHB 1AKRA 1GZ4A 3MTEA 3BIFA 4R1TA 2H16A 1NONA 1WKVA 1JHUA 2WB4A 2R8ZA 2OGZA 1JSXA 2HA5A 1Q16A 2E4XA 5HE8A 3SZGA 3PRJA 4M0PA 3HBNA 2GLTA 2R6HA 3NAZA 3T1HB 4RCZA 1H2HA 2GBGA 2PKEA 3BXXA 1E2IA 1UBKS 4HXEB 4QT0A 2PWPA 1NIPA 3EODA 1QQTA 3I1YA 3G2OA 4BNUA 3KKLA 1GKKA 1T43A 1ZLYA 4N8DA 4RD0A 5CA1B 3U60B 1ST2A 3C1AA 2PPVA 5G4LA 3SE7A 3K9GA 4BYGA 2C2HA 3BGVA 4N6OA 2ENUA 1HPLA 2GZRA 4N3GA 4PC6A 5T8KC 4EKEA 2E4ZA 1EIWA 3WZLA 3A58B 3IOYA 1Z18A 4NYJQ 4OMDA 5AJWA 4CL3A 1DDGA 4QSMA 2UYOA 1ID8A 3MTBA 1X1TA 1K7YA 6REQA 3GLGB 1GM5A 3A3NA 4UDNA 4NZYA 2X86A 2HUNA 4AZ0A 1SIBE 3E2MA 3UJ7A 3LIPA 1AUVA 2IA5A 1TTTA 1L8OA 4I3FA 1PYOA 1POXA 3PEWA 2P5SA 1NVGA 4R81A 3A26A 4JGGA 1FQWA 5DXJA 5JD4A 1E1QA 3BK1A 5FP0A 5JAMA 5LUBA 4MARA 5DNAA 3NBAA 4ZU6X 2JJYA 4M1KA 5A9RA 4KFCA 5ER6A 1ZQ9A 1ENPA 2MOKA 3PUWA 4BC0A 2WYIA 2H0RA 3OE1A 5DHUA 3S7TA 1QQAA 2J48A 2R7LA 1XPRA 1UJBA 4IIVA 1A4RA 3T52A 3T61A 5DI3A 2AG8A 5JBNA 3VZBA 3OOWA 2EJTA 3IODA 1J2YA 3BREA 4LQCA 4DUGD 1PWHA 2Q8PA 2XRFA 5JPCA 3UMMA 1BS2A 3QF4B 3SZOA 2COEA 3ZLBA 4EA7A 2HCTA 2J9ZB 4CEHA 5AKHA 1P5FA 1JDPA 4I1SA 5JLAA 4B71A 4FYKA 1E3WA 1W4ZA 4MA5A 3AJRA 2BVNA 3BFXA 3M34A 1TMKA 5AK0A 3SE0A 1Y6GA 4QJ5A 3C3EA 3HWSA 4QDXA 2VXBA 4CCAA 4QYIA 2FEKA 3CT4A 2IV3A 3W05A 5KAMA 1D1SA 1Y89A 1YXMA 2XCIA 3GRVA 2ONCA 3PS9A 4HRAA 2CUNA 4J76A 3X43A 1KK0A 3WRYA 1MX9A 4KHPB 2VUTA 4GIBA 4J0HA 2B8JA 5TPWB 1W93A 5CXQA 2CVFA 1WE2A 2LDBA 4NOMA 1Z75A 3E0QA 3I09A 5K51A 3RVQA 3ZU5A 1M83A 4RVCA 3OJXA 1XXHA 2QTGA 1HE5A 2Q5CA 2RE8A 5LB2A 1R6DA 2IEGA 1YOBA 2WU4A 1AA9A 2HUPA 1CHNA 4RFSA 2UYQA 5KQMA 5CJJA 5EP1A 5FJIA 3TXYA 4BB5A 1THGA 1XCGB 2GEJA 1VDZA 3OLCX 3RC8A 4MVJG 2IWRA 5JI2E 2IOFA 2AI3A 5E4FA 1EVQA 4OPMA 5CH5A 4FOPA 2OLJA 4DIFA 2V6MA 2YFHA 1TLFA 3D8NA 4JLUA 3VH1A 3I4CA 1XEFA 3JXEA 4HDCA 4TZKA 4Z8XA 3W2IA 3O4FA 1DEHA 1N2OA 1YJXA 4FYMA 5AKKA 4DJDC 4KEAA 1D1PA 4XJSA 2IHBA 4ZYYA 4RH0A 2F48A 4RKRA 3VAAA 5KQSA 1THTA 3ONWA 1XAJA 1OHHA 2DHDA 4ZV9A 3TM5A 2DEUA 4YT2A 3HJAA 3NHYA 2VF2A 3EE6A 4NHEA 1IBRA 1XVVA 5KQPA 4J7XA 5DK4A 5DIZA 3NBXX 3N76A 4K40A 1VRWA 1IEQA 2A3RA 2YH2A 3KU1A 4EJSC 3E61A 2O54A 4HUQB 1PZMA 3S2SA 4P0TA 3RVKA 3O5AA 2Y1EA 1KYXA 2ZFUA 1UWVA 2X9VA 1MAUA 4U7GA 2XTZA 3BTVA 4DDTA 2HDNB 2J9FB 1DBPA 1T10A 3WL6A 5K8TA 1QIFA 4TM8A 3VUEA 1RJEA 2PGXA 1SU7A 1FP7A 3GEBA 4YJKA 3S70A 5CIWA 2QRKA 1TYZA 2VDWB 3S1AB 1A5AB 1XP8A 2X4IA 1SUPA 1ODKA 5C80A 4WKPA 3AQIA 5G1OA 1UZUA 2ZSBA 3NAQA 2P4SA 2QE6A 1GPMA 3AEXA 3EWAA 3ZV3A 3B5JA 2Y6UA 3MCVA 4BO7A 3UGTA 4YT8A 4BNGA 3EY9A 1AK9A 4QDOA 1JKMA 3MGCA 1W73A 4G65A 3NTQA 4EMBA 3OJCA 2FPGA 2PZMA 3REGA 2WUFA 4PSUA 3JYHA 1YJQA 2WM3A 4GP7A 3DE6X 3TLAA 3QJYA 1QFSA 5JNRA 1OA0A 1P1KA 1XGKA 3JD3A 1QK4A 4UVIA 2C3MA 3BMQB 4YP1A 1NUTA 2C94A 4MK4A 3GAAA 1FYVA 1ZCAA 2PJUA 3GG9A 3LP6A 5AM4A 2AQHA 3VOBA 4I1IA 2CUTA 3ORSA 2P9JA 5IVDA 3TIIA 3WFIA 2OBFA 4H6VA 1APBA 1DUSA 4E5MA 3MUEA 1GA6A 3VTAA 1FFWA 3OCUA 2X8WA 3BSWA 1JBEA 1L3CA 5KHLB 5TE9A 4NE2A 1GUYA 3QYAA 4XH9B 4OQFA 5ELMA 4WY8A 4XXHA 2C4MA 2HN9A 4CF4A 5B6IA 4JR0A 1VE3A 2AZTA 2GVNA 1F8FA 1FEZA 1WWKA 3B3AA 5DYYA 5AW5A 4J0CA 4CM4A 3K8YA 1GV1A 1YQ9A 3L84A 2HMSA 4L8GA 3SYTA 2K5UA 3AHJA 3HO6A 3PQ7A 4R1SA 2WUDA 2CDRA 5F1YA 2O5EA 1H2XA 3GFBA 3TEFA 1VTKA 1SU8A 1S2IA 4HNGA 2VTVA 2EG9A 4YRNA 1V9CA 3AKEA 4RVDA 4DR1B 2FUG1 4PNZA 5GAJA 5B4TA 5TIIA 4K9PA 3ADDA 4Y9TA 1J97A 1NLUA 3M83A 5DLYA 2C7OA 5BR8B 1WULS 2R8OA 3PHGA 3L6BA 1LVGA 2FFHA 4Q39A 2IX9A 4XR9A 4FFDA 3ZV5A 4ALMA 5CBPB 3ELDA 1IONA 2OORC 2ZJ3A 3N7UA 3O1IC 3PUIA 4RKWA 5DULA 1RRFA 1WETA 3IE1A 1ZEJA 3OSUA 4G67A 3L7LA 4KPEC 5G1PA 1E9VA 2FGKA 2IW1A 1R00A 1I7PA 2QVZX 4GP6A 2KPOA 5D1HA 4DSAA 5BSHA 3LV8A 5TXGA 2VJCA 1N3LA 2IS1A 3QBVA 2HD4A 1W25A 4HF7A 2NO4A 5DHAA 1N34B 1QP8A 1ECPA 3BRCA 3CF4G 3ESDA 4PG7A 5DBHX 5CA0B 4P22A 1GQFA 3FUCA 5AK4A 2FJUA 1RLIA 1WSBA 4G8BA 4L7VA 4X7BA 1UKCA 2GBCA 5H82A 4A15A 3DLTA 3CVYA 2JBAA 1KSJA 1W8IA 2Q3MA 5KTSA 5JANA 5FRDA 3K8QA 4MCAA 5HBRA 3GJ7A 1K5GA 1FE8A 2D2VA 2PLWA 5B2FA 3BHNA 5CLLA 3JWIA 3ENNA 3BWVA 3AR8A 1W5SA 4GYYA 4JJAA 3LQ1A 3JQ7B 3WIVA 1XN1A 1WCIB 1EGAA 1CJBA 1KL7A 1L4UA 2H17A 2O7NA 1M6VB 3QYPA 1ANKA 5K8LA 5KQLA 2QN2A 3A9CA 2YJ4A 3LLSA 3O2QB 5D87A 4PN3A 3A70A 2CV1A 1WDLA 1YI0A 4NBNA 5DPMA 1IK4A 2X40A 4H3KB 3T9CA 4GYWA 4LYDA 1CP2A 2BMFA 3CO5A 5KNCH 4P82A 2ZWAA 3L7MA 3MLBA 1TVMA 4OK6A 1RYHA 3FWYA 1D8TA 4KB5A 1QG0A 2VXYA 3UMVA 4DJTA 3N2ZB 5TF4A 3RABA 1W19A 3GN2A 4JBYA 4POAA 3ZGNA 2AV6A 1E3MA 1FJ2A 1YHYA 3JY6A 4EG7A 2VHVA 2IYUA 1V95A 1L7EA 2AYXA 1FZQA 4L9SA 1B2LA 2YC4C 1VIVA 3AL2A 3JASB 2AB0A 2A0UA 1VL2A 2QTFA 2JLBA 3FNQA 1VXRA 4P9NA 4UZSA 1D9XA 4DNQA 4EB6A 1B42A 2REXB 3IO3A 3DPSA 3KIPA 5DX8A 2YWDA 5F23A 5F2OA 2VAPA 1QIEA 4KBGA 2VJDA 2LD4A 4D57A 1V8OA 1XEWX 3ON5A 2XCUA 2ZYHA 4NEHB 1M2EA 4CFSA 2MWMA 4C3OB 4L8VA 3DEHA 1VHWA 3ZU3A 4YRKA 1TE2A 2FY8A 2CLIB 2XA2A 2GPSA 2AL7A 3G2JA 2PSSA 2NTJA 5IKEA 3TJZA 1AXRA 2XWBF 5T57A 4Q1CA 5L3SA 2CY0A 3G2MA 2IYPA 3C41J 3CSSA 5EQFA 5TQ0A 2X3UA 1THMA 1QGOA 4BQOA 3R3XA 3SX2A 2VA9A 3PEFA 3PCRB 3ZLTA 3P71T 3L92A 4FWIB 4Y67A 2PGJA 3F73A 1TD9A 2PRSA 5LKAA 2R66A 1SXJD 1HC7A 3D7LA 4L74A 3D31A 4ARSA 3F6EX 3ZE2B 2P9QA 4ODIA 3WNZA 3SCZA 2WVHA 3BAFA 4GNRA 2DFNA 3KWLA 5JIBA 3MXTA 3FNEA 1OBCA 4ER0A 3RC7A 1XCJA 3OCZA 1U0RA 5KQGA 2WWFA 4B9AA 1KAQA 1E4VA 3DP9A 1TJPB 1YB2A 2ZJYA 4FBLA 3LHFA 3PYLA 3N70A 4FQ5A 4HWRA 4P3NA 5E1OA 4C03A 5TGDA 5I7WA 1I7LA 4X6LA 2PD6A 3M6LA 5B58C 5D86A 3C5VA 1O94C 2ZI7A 3W9SA 1C1YA 1GZSA 5L6MB 1WDMA 4R3WA 1HFKA 1F3OA 3WSVA 4ZEVA 5AD1A 1E92A 2RMKA 1E61A 3I2GA 3QHPA 1D0VA 3F7TA 3RYIA 1KRHA 3HLTA 2B4QA 4TN1A 3HCAA 4O63O 3Q9SA 4Q93A 3M7IA 4IMRA 4JOSA 4TQGA 3WGUA 1A96A 3CH4B 3DKPA 1KQFA 3GLTA 3IQGX 1WUYA 2Z6VA 3TLZA 1NVUQ 3FFWA 1BE8A 3UYKA 4TLMB 2JK1A 1FVXA 2PO7A 4BVJA 1G3RA 1H5QA 1X7DA 4Y2UA 1JYEA 3KEGA 1YVEI 3HCPA 1J25A 3IGFA 3HCNA 2B37A 2Y1GA 1N7IA 1PJ3A 2QMQA 3WMRA 5BXQC 2VCYA 4I50B 4GR9A 3CRNA 4UU0A 5THXA 4ER5A 4JQSA 1G7RA 2DCUA 4M0CA 5KJEA 4U7TB 4ZYUA 3BB3A 1E9RA 3HCCA 1QIMA 3FX2A 3K0FA 4RA6A 1E3IA 2NYAA 2C2MA 4NI5A 5ILQA 5KNDH 2W7TA 2BWJA 5JDCA 1CDZA 1QFMA 1EK1A 2ZUEA 4J0GA 1N2ZA 2B6NA 3GRYA 1DWQA 4LZJA 1QHYA 5CYFA 2PMKA 1GNLA 1XRRA 1G6Q1 1YK0A 1ZNXA 4DLAA 1GD1O 2F9FA 1AZLA 2YJZA 3ZY6A 1LDMA 2FV8A 4GKAA 3VPDA 1R9JA 3ETNA 3FHCB 4UZEA 3E7PA 3JQRA 1EWVA 2OCXA 2X5KO 3OPYI 4QXMA 3EF1A 3R5TA 5JC1A 2P2NA 3A0RB 3SZLA 3CEMA 3L8YA 1KI9A 1OLXB 3BXZA 5BSRA 3MYYA 1VBKA 3HQ4O 4E15A 2V9PA 3B2NA 4E4RA 2J9XB 1OLUB 1L8AA 2XUKA 5I7SA 1GUAA 4LVOA 1ESCA 5FPPA 4E70A 5DO9A 2BFFB 3CB2A 1SOMA 1O9GA 2YRWA 3IUBA 4UU8A 3VR4H 3IKMB 2W6NA 4M1WA 4RPKA 5CFZA 3IIJA 2AF3C 2GUGA 3PXXA 4NFLA 4P5EA 3CKKA 1IUPA 3GXOA 3QTTA 4W82A 2WIKA 4DSUA 3AFHA 3FPGA 1E77A 3JRNA 5EE3A 1EKXA 1E7QA 1NGSA 1SOVA 3INGA 4DANA 1JL3A 4IIJF 1FX1A 1AKNA 2WSLA 2DWQA 1F14A 2Q7XA 2IDJA 1BD4A 3MQ4A 1FYDA 1VE1A 2ZU0C 2Y3IA 1GPLA 4DSNA 2GO7A 3DZDA 2JFYA 3CEAA 1V71A 3RIMA 2HJHA 1PK8A 3HGTA 2QXYA 4PLTA 1TVCA 4QYWA 1V48A 3LY9A 1NF2A 3WWZA 1Z22A 4XWOA 1KEPA 1VIYA 4E2FA 2C0QA 3DB1A 1A8QA 3OOEA 4LGMA 3RYCA 1HMYA 3AVVA 3LPLA 3STYA 5KSZA 3GLKA 3V8QA 5AQEA 1B6SA 4TQUS 3ZVRA 3DZCA 4TYNA 2XQFA 4GXTA 3AWDA 1Y9ZA 2I7TA 1RACA 4UHDA 5KNLA 2GK3A 1DC5A 1XZHA 2TSYB 3M70A 2MJLA 4IGKA 2ILTA 2FG6C 3DUFB 4C4XA 2G1AA 2IVZA 3GLIA 2WSSD 4CRWB 4RTMA 2O2YA 5ALYA 3HEBA 3N58A 1CY2A 4R54A 1OILA 3M33A 5C1DA 4KKXB 3PKZA 4HQOA 4Q82A 4CN8A 1PL0A 2WD7A 1EXMA 1LVUA 4GOJA 3GNQA 4FHGA 3BL5A 3DPUA 4CLDA 1JZTA 4URWR 3FIUA 5HCNA 3GJQA 4PTLA 4N3CA 2CD9A 2ZWMA 4A82A 1H23A 2PZEA 2ZYUX 4DJEC 2B2NA 2IYOA 5GZ6A 4XX0B 1E2QA 2UZ3A 4O4JF 2HXSA 3EFHA 4MHTA 3WNCA 1X8JA 4M9XA 4BX0A 1SCBA 4KRFA 4Z7QB 1A77A 2VI5A 3H17A 5TR9A 2LE0A 2I33A 4DNFA 2QYHA 1OAOC 3T7RA 1YZYA 2OILA 4CTJA 1P8JA 5FTLA 1UL1X 3RVNA 2PH1A 3CONA 2G9UA 1C3XA 1GPUA 3D2LA 3X3HA 2WDZA 1OGIA 2VLBA 3CCCA 4GAEA 5GOZA 3WSTA 2FZLA 4KYUA 4TS9A 3KNZA 3DFUA 1QVVA 5DW0A 2VPXA 3FNHA 4QFCA 1G8KA 3LKZA 3WLIA 1AKTA 1S96A 2JJ1A 3V4LA 5KPJA 2AFVA 4FCVA 1ZRNA 3K0KA 5JAOA 2FUNB 2G63A 2GBLA 1GPJA 4YTEA 1H93A 3IVAA 1WF6A 4NL4H 3EOZA 4KNVA 3QNUA 3DM5A 4S1PA 1Z62A 1S89A 3KPYA 2GAFA 4NZOA 1BVUA 1W87A 3LLVA 4BNIA 2VDKB 2BKAA 4NDAA 1GRQA 4DYVA 4YY3B 2C2WA 3E9CA 1PHRA 2R3SA 3KM0A 2N0SA 1T9KA 4FT4A 1X3LA 4EY4A 1DIAA 5H3HA 2IP1A 4GBED 3I62A 4KSCA 4BMNA 1JH9A 4JEUA 4ESVA 1K4MA 2NMVA 1F2TB 1U9IC 1NW9B 2XKAA 2JFXA 2UZAA 5JSKA 2GAOA 1G5FA 1DIRA 1H0KA 4KW7A 4CIDA 2ODNA 2B7CA 1E3SA 2IVFA 1UZNA 1Z2AA 3LT4A 4JVMA 3GZTB 1EJBA 4NPAA 5IC6A 3RV4A 1JFTA 2WZBA 1CS0A 5IC4A 4LJ5A 4LZLA 2ARKA 3OF5A 1V3TA 2ZRFA 1Z74A 1MJHA 2D0IA 4YAWA 2R00A 3AY0A 5EE5B 5DI3B 1CUBA 3HXMA 1U2DC 3MVEA 3VO1A 1HORA 4A36A 3RVJA 1ZICA 4MAMA 1OU0A 2I8AA 4YT4A 5LZ2A 4QOHA 3VKGA 2QTVA 4MB2A 4CTKA 2VF5X 5A04A 1JN0A 3HI6A 2C3OA 3VC1A 4JP3A 1S1MA 1SC3A 1SPBS 1YULA 3OHMA 1WB9A 4CEHB 2A92A 1C14A 1R4ZA 1TKCA 1XA4A 3BM5A 1IM8A 1JFRA 4E5KA 1E3WB 4FFMA 4A6DA 4M0UA 1AB6A 2XE7A 1AS0A 1CUEA 3WV5A 5F1OA 3ZWCA 2GA8A 3PNSA 2YZMA 5DJ5A 3DMPA 3A1NA 1U0BB 1T2NA 4UQOA 1AO3A 3U49A 4QYIB 3WLFA 4AY3A 1NRWA 3I76A 5J4KA 3D1VA 2HF9A 2RK6A 4QTUB 1XJ5A 3NEAA 3PIIA 1T2FA 1YS9A 3P9PA 2O7SA 3WKBA 3W4IA 3KCQA 2QTMA 3N28A 4EUSA 3TECE 3KOOA 4PNEA 1ZUIA 4MI9A 2EC5A 4TTJA 4LY6A 1RYMA 3EW9A 1N3YA 4CJXA 1XXHB 1OREA 1VA4A 1NZJA 3UVEA 4D42A 4Y98A 4DUGA 2W6ID 2ERXA 2WM9B 3LF1A 3MRSA 3T7EA 2E37A 3QNMA 4RFSB 4YRGA 3LX4A 4M9QA 5KKNB 4IZ6A 1Y6FA 5BY2A 2G9ZA 4HAVA 1T25A 2Q3FA 4BB0A 4DR3B 1A8PA 3FYUC 2IZOA 4AYWA 4KUHA 1W46A 4NG5A 2X0EA 4CF7A 3EA4A 5H3CA 2AC7A 4TV8B 4NABA 2XZTA 4A6EA 1PWEA 1EIZA 3QLEA 1WDKA 1YBVA 3EA5A 3NU1A 4MS1A 2WF8A 5FBQB 4E4TA 4AKIA 5A7FA 3VSDA 3K0SA 2A86A 2IITA 4Q9KA 3RYFA 3TNFA 4IWNA 1UH5A 3SYKA 3WNVA 1Z38A 5EFOA 3SJAA 1QHNA 3BN3A 4F60A 2MIIA 3E1KA 1QRUA 2JLCA 4ND5A 3PT5A 1L6RA 2RC5A 4IH1A 2IH5A 5FF9A 1C7EA 2BEVA 4ES6A 3WYBA 2B2CA 4MKFA 3ZQKA 1N5IA 3BMXA 4Q5IA 3V1KA 4DSOA 3I12A 5SY4A 3WLHA 5L51A 5LNK6 2FK8A 1T91A 4LV6A 3STTA 4E4YA 4LJYA 4EPRA 3LZDA 5F5LA 1PS8A 4DSZA 1L3IA 4EX6A 4G89A 4EGAA 3HKCA 1DV2A 1WP9A 3HSYA 4LFCB 1QYWA 1WAMA 4CIWA 3TTXA 2JFHA 3TXXA 5ITVA 3W8EA 4YV2A 1MXHA 5JSHA 1RWMA 1GG5A 3K96A 3BKWA 2KLHA 2O3RA 2OBLA 4H1HA 3R7LA 3TL6A 3C3YA 3BE5A 2Q6VA 3K20A 1ZVMA 1KC1A 3B78A 3GVXA 3WISA 2FPGB 1IAQA 1IH8A 4ZCRA 2QVLA 4U3JA 2AWNA 4FU0A 2FI1A 1XVIA 1RKUA 2P3QA 2QVXX 4IDDA 3W7BA 5AVSA 2QRNA 1Q1QA 2V6IA 4LZZA 3FRHA 5GZ1A 1JHRA 2HU5A 3HUDA 5J1TB 3DZHA 1P72A 1GG2A 2VXOA 2I1QA 3T1TA 1LPMA 5EMHA 3OQHA 3WKAA 4R98A 2D54A 4JU8A 5F77A 1LLUA 1W47A 5CFQA 2DWOA 2IW3A 1XZBA 1CJMA 4TKLA 1CRQA 4XIGS 4XLZA 3EISA 1GXSA 3RDPA 3EGEA 3TSWA 4GHWA 1FP6A 4F9EA 3V5NA 4ZI3A 4YRMA 4PZAA 2XB2A 2C8VA 4ZVVA 1G64A 5CBKA 5D85A 1YZTA 1YCHA 3RGGA 5B1EA 5GJBA 1IQUA 3GU3A 3OQIA 4IDPA 4ZOLA 4CMAA 5B6PA 5K0ZA 1Q0RA 4S04A 4HAUA 2WPNA 1UJMA 3SFVA 4CM4B 3HSKA 3UXMA 1QE5A 2V7UA 3HV2A 1MPTA 2IEAA 2YZ2A 2P0EA 2YVUA 4AUEA 1BU8A 2BFEA 4KVAA 1DJPA 1GZ7A 1WW2A 1SPXA 1YR1A 2IP2A 3AOEA 5CYPA 1T3ZA 5K1ZA 3QIAA 2NV2B 1R3DA 3U44A 1H0SA 3CEPB 1YR8A 3A3OA 1A2OA 2I1VB 3O47A 3RASA 1B1AA 3EZ2A 4FZRA 3M6VA 1CZHA 3FPLA 3FJYA 3RS3A 4KODA 4JYAB 1GFWA 2GHTA 4A7PA 3GFVA 3RFTA 4EPVA 2HWYA 1CHDA 5ILGA 4LFAB 1T1RA 2F3UA 1HE4A 1HNZB 2D0PB 4B6PA 2H5EA 3TZKA 2WZQA 5BT8A 5BW4A 3QWIA 2WFAA 4MO9A 1HDRA 4YX9A 1BXKA 3C4QA 4NNPA 1WVGA 4BQNA 1FDUA 1WD5A 2PFSA 3GH3A 4NU5A 4NYIQ 4DT1A 4KGDA 1SCDA 3PC8A 1L5GB 1X77A 1V5IA 1LXCA 1FFDA 3EY4A 1CB7A 2OA0A 4AUKA 4Y30A 3K4QA 1M2VA 3EMKA 3ZD7A 2HLPA 4JLVA 5LBIA 5TMDA 3T9FA 1KS9A 3DT8A 5COAA 1S2LA 2FXVA 1W2WB 2J6CA 2WNHA 3BL8A 3OF2A 3PNVA 1KYWA 3HN2A 5C5EA 2QX9A 2WM2A 5KUTA 3OUUA 1VLVA 2JBAB 4IZHA 2Q3BA 3FB4A 5HQ3A 4KFSA 1M2KA 5B3KA 3C15C 4NU8X 4UDYX 4HFMA 2F2TA 3U7GA 1HRDA 2QSZA 4K8RB 1DC3A 5H70A 4JC5A 1FDRA 1N0UA 4IS3A 1HGXA 4C1BA 3WP1B 2ACEA 4ZJZA 1FPMA 1E2HA 3VHLB 3KPUA 3MQFA 3G2LA 1NP7A 3KC2A 2FFRA 5F4BA 4F86A 4UTVA 3IQFA 3S2FA 3A9UA 4R5HA 2AJTA 3E2IA 3JWEA 4MINA 3REOA 3AOGA 1MVLA 3C6QA 2MMGA 4X44A 4E2XA 2DR3A 1X7WA 1QRAA 2HR1A 4ABYA 2D4HA 5F3WB 1EK6A 1KI3A 1A0OA 2HJ9A 3DWGA 3WMXA 1NY6A 5HKKD 5AKEA 2BZSA 3HCDA 1N0WA 1RXSA 3F47A 5FOXA 1RFLA 1PV4A 5K09A 3ZGLA 5K8IA 3CY6A 2GJ8A 5ULLA 2VL7A 1E7RA 4JLOA 4C1NA 4CCSA 1J0BA 1KYIA 4IICA 4QBHA 3ROPA 4PQGA 3ZWPA 3TLGA 1EUQA 3DLBA 1T2CA 1XPJA 5K03A 5SYAA 4EB6B 1G42A 5JSUA 1QGAA 2I8LA 1R5JA 2RHLA 4GZ5A 3BAZA 1XTTA 2XPCA 1SCKA 3TSAA 3KRTA 3EXHC 4RIIA 3Q3JB 1FP4A 5DASA 3GFQA 4QELA 2QZ9A 4RPCA 4V0QA 1QMPA 4QEKA 1BQ3A 4GGPA 5ERYA 4B17A 1JDZA 1JALA 2XE8A 3RUFA 3G0HA 1DWPA 3I9LA 2NSLA 1UIRA 1ZCJA 3JVUA 3CE6A 2QXTA 4L4SA 1AV7A 2OD7A 3OOSA 5JSQA 2HBYA 1IUOA 1EDBA 4AN0A 4Z86A 4CF6A 4DA0A 4YJ2A 4EABA 5BWOA 3BFJA 5L3SB 4AQDA 5CD1A 3DKKA 2C3PA 3D6JA 2J0QA 4FZ5A 4ANFA 2GCPA 2OV3A 3M6XA 3FIJA 5TQ0B 4U7DA 1NNEA 3M5WA 1YR2A 13PKA 2BZ1A 3O0TA 3C3AA 4DLNA 2JHPA 3RIYA 3PPIA 2DTXA 4FZ3A 4URHA 4DLRA 1FMJA 3A4NA 1XNQB 4RD6A 4BEBA 3RG8A 4AMBA 1Q7RA 2ODWA 4U7PB 2DVMA 4DRZA 1FMFA 3N39C 1D7OA