1ZIWA

Human toll-like receptor 3 extracellular domain structure
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
635
structure length
629
Chain Sequence
VSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 3
publication title Crystal structure of human toll-like receptor 3 (TLR3) ectodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 221
structure length 629
sequence length 635
ec nomenclature
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1ziwA00
4GT6A 5IYXC 4CNMA 3WPBA 2OMXA 4FCGA 4QXEA 3JB9j 2ELLA 4R5DA 3OGKB 3FXIA 4RCAB 4Z8GA 4RCWA 3E2JA 5GMGA 4V2EA 2Z66A 2WFHA 3RJ0A 1P8VA 4LI1A 2Z65A 3UL8A 4U7LA 2IFGA 3WPIA 3UL9A 1FS2A 3RGZA 1JL5A 3UN9A 5FTTB 2JE0A 5GMHA 4CC4A 3W3NA 1XCDA 3W3LA 3C6OB 1KOOA 3ULVA 3O53A 4P91A 1OOKG 5IJBA 4H09A 2JQDA 5AWBA 5B0TA 5AWCA 4K17A 4U09A 3O6NA 4LXRA 4V2CA 4GLPA 2Z63A 5A5CA 2OMUA 2JE1A 4WYKA 3ZYIA 4KXFB 4XSQA 1A4YA 3M19A 3OGMB 4OQTA 4R5CA 2P1MB 4CP6A 4LSCA 4Q3GA 4KT1A 4XGOA 1M0ZA 4Z61C 1U0ND 2Z7XA 3VQ1A 3ULUA 3WN4A 4Z64C 3CVRA 4ARNA 4Y61B 4R6FA 3RW6A 3RW7A 4LSAA 3G06A 2A0ZA 2ID5A 4IM6A 3A79B 5B4PA 2XOTA 1IO0A 2BNHA 4XOSA 1A9NA 4Q3IA 3OJAB 5GS2B 1LTXA 4R6GA 3P72A 2FT3A 3RFJA 3W3KA 4MQWX 2Y5QA 4PSJA 4LI2A 4J0MA 4FDWA 2OMTA 3ZYOA 3WPDA 2Z82A 4EZGA 1ZIWA 4FHOA 4LSXC 3CIYA 4QBZA 4WP6A 1M10B 3W3JA 5CMPA 5AWAA 1O6TA 4FMZA 3WPFA 1XECA 3REZA 3RIZA 1OZNA 3M18A 2OMZA 4ARRA 1FT8A 2RA8A 2P1PB 2UZXA 4ECNA 5LFNA 4C2BB 3ZYJA 1M9LA 4J4LA 5GMFA 1DS9A 4R58A 1PGVA 5CMNA 1DFJI 3C6PB 3PMHG 4PEQB 4KNGA 1QYYA 4Q62A 4QC0A 3OGLB 3CIGA 4L3AA 4M7EC 4I6JB 1YRGA 2Z62A 4Z94G 4R09A 3BZ5A 3RFSA 2O6SA 4RWTC 3RGXA 3KJ4A 3G3AA 5HDHA 1O6SA 3TSRE 2Z81A 4G8AA 1M9SA 4BSUA 1DCEA 1D0BA 1OTOA 1G9UA 1OGQA 4HQ1A 4BSSA 2R9UA 1OTNA 3C6NB 4L3FA 3VQ2A 2ASTB 4FD0A 4UFRA 4MN8B 2Q4GW 4LSXA 3WPHA 3OJAA 2BEXA 2RR6A 2WQWA 3E6JA 4PQ8A 1K5DC 2O6QA 2V9TB 4U06A 3G3BA 3RFEA 2WQVA 2OMVA 4NKGA 1K5GC 3UL7A 2V70A 1W8AA 4YEBB 4NKHA 4R0AA 1H6UA 4R6JA 2CA6A 2O6RA 3W3MA 4AW4A 3DZEA 1O6VA 5D3IA 1Z7XW 1P9AG 2Z64A 2UZYA 1XWDC 4M7EA 1XEUA 3E3ZA 5HZLB 4BSRA 5AWDA 5GQRK 2P1QB 2OMYA 1H6TA 4R08A 1GWBA 3WPGA 4BV4R 2V9SA 3G39A 4U08A 5GS0A 4LXSA 5AZ5A 5B0NA 2P1NB 4B8CD 3WPEA 3GOZA 4CILA 1FQVA 5IJDA 1P8TA 3WPCA 5IJCA 1SQ0B 2XWTC 4AY9X 4TZHA 4CC4C 4V2DA 4PKIG 1KOHA 3W3GA 3G04C 4CNCA 2WQXA 4FS7A 4R07A 2ASSB 2WQUA 4P8SA 2P1OB 1OTMA 3ZYNA 2OMWA 3ULAA 4Z79A 1XKUA 2Z7XB 4ECOA 4C2AB 4PERA 1WWLA 3E4GA 4R6AA 1FO1A 3SB4A
chains in the Genus database with same CATH superfamily
4GT6A 4NZTM 5IYXC 4CNMA 3WPBA 2OMXA 4FCGA 4QXEA 3JB9j 2ELLA 4R5DA 3OGKB 3FXIA 4RCAB 4Z8GA 4RCWA 3E2JA 5GMGA 4V2EA 2Z66A 2WFHA 3RJ0A 1P8VA 4LI1A 2Z65A 3UL8A 4U7LA 2IFGA 3WPIA 3UL9A 1FS2A 3RGZA 1JL5A 3UN9A 5FTTB 2JE0A 5GMHA 4CC4A 3W3NA 1XCDA 3W3LA 3C6OB 1KOOA 3ULVA 3O53A 4P91A 1OOKG 5IJBA 4H09A 2JQDA 5AWBA 5B0TA 5AWCA 4K17A 4U09A 3O6NA 4LXRA 4V2CA 4GLPA 2Z63A 5A5CA 2OMUA 2JE1A 4WYKA 3ZYIA 4KXFB 4XSQA 1A4YA 3M19A 3OGMB 4OQTA 4R5CA 2P1MB 4CP6A 4LSCA 4Q3GA 4KT1A 4XGOA 1M0ZA 4Z61C 1U0ND 2Z7XA 3VQ1A 3ULUA 3WN4A 4Z64C 3CVRA 4ARNA 4Y61B 4R6FA 3RW6A 3RW7A 4LSAA 3G06A 2A0ZA 2ID5A 4IM6A 3A79B 5B4PA 2XOTA 1IO0A 2BNHA 4XOSA 1A9NA 4Q3IA 3OJAB 5GS2B 1LTXA 4R6GA 3P72A 2FT3A 3RFJA 3W3KA 4MQWX 2Y5QA 4PSJA 4LI2A 4J0MA 4FDWA 2OMTA 3ZYOA 3WPDA 2Z82A 4EZGA 1ZIWA 4FHOA 4LSXC 3CIYA 4QBZA 4WP6A 1M10B 3W3JA 5CMPA 5AWAA 1O6TA 4FMZA 3WPFA 1XECA 3REZA 3RIZA 1OZNA 3M18A 2OMZA 4ARRA 1FT8A 2RA8A 2P1PB 2UZXA 4ECNA 5LFNA 4C2BB 3ZYJA 1M9LA 4J4LA 5GMFA 1DS9A 4R58A 1PGVA 5CMNA 1DFJI 3C6PB 3PMHG 4PEQB 4KNGA 1QYYA 4Q62A 4QC0A 3OGLB 3CIGA 4L3AA 4M7EC 4I6JB 1YRGA 2Z62A 4Z94G 4R09A 3BZ5A 3RFSA 2O6SA 4RWTC 3RGXA 3KJ4A 3G3AA 5HDHA 1O6SA 3TSRE 2Z81A 4G8AA 1M9SA 4BSUA 1DCEA 1D0BA 1OTOA 1G9UA 1OGQA 4HQ1A 4BSSA 2R9UA 1OTNA 3C6NB 4L3FA 3VQ2A 2ASTB 4FD0A 4UFRA 4MN8B 2Q4GW 4NZRM 4LSXA 3WPHA 3OJAA 2BEXA 2RR6A 2WQWA 3E6JA 4PQ8A 1K5DC 2O6QA 2V9TB 4U06A 3G3BA 3RFEA 2WQVA 2OMVA 4NKGA 1K5GC 3UL7A 2V70A 1W8AA 4YEBB 4NKHA 4R0AA 1H6UA 4R6JA 2CA6A 2O6RA 3W3MA 4AW4A 3DZEA 1O6VA 5D3IA 1Z7XW 1P9AG 2Z64A 2UZYA 1XWDC 4M7EA 1XEUA 3E3ZA 5HZLB 4BSRA 5AWDA 5GQRK 2P1QB 2OMYA 1H6TA 4R08A 1GWBA 3WPGA 4BV4R 2V9SA 3G39A 4U08A 5GS0A 4LXSA 5AZ5A 5B0NA 2P1NB 4B8CD 3WPEA 3GOZA 4CILA 1FQVA 5IJDA 1P8TA 3WPCA 5IJCA 1SQ0B 2XWTC 4AY9X 4TZHA 4CC4C 4V2DA 4PKIG 1KOHA 3W3GA 3G04C 4CNCA 2WQXA 4FS7A 4R07A 2ASSB 2WQUA 4P8SA 2P1OB 1OTMA 3ZYNA 2OMWA 3ULAA 4Z79A 1XKUA 2Z7XB 4ECOA 4C2AB 4PERA 1WWLA 3E4GA 4R6AA 1FO1A 3SB4A
chains in the Genus database with same CATH topology
4GT6A 5IYXC 4CNMA 3WPBA 2OMXA 4FCGA 4QXEA 3JB9j 2ELLA 4R5DA 3OGKB 3FXIA 4RCAB 4Z8GA 4RCWA 3E2JA 5GMGA 4V2EA 2Z66A 2WFHA 3RJ0A 1P8VA 4LI1A 2Z65A 3UL8A 4U7LA 2IFGA 3WPIA 3UL9A 1FS2A 3RGZA 1JL5A 3UN9A 5FTTB 2JE0A 5GMHA 4CC4A 3W3NA 1XCDA 3W3LA 3C6OB 1KOOA 3ULVA 3O53A 4P91A 1OOKG 5IJBA 4H09A 2JQDA 5AWBA 5B0TA 5AWCA 4K17A 4U09A 3O6NA 4LXRA 4V2CA 4GLPA 2Z63A 5A5CA 2OMUA 2JE1A 4WYKA 3ZYIA 4KXFB 4XSQA 1A4YA 3M19A 3OGMB 4OQTA 4R5CA 2P1MB 4CP6A 4LSCA 4Q3GA 4KT1A 4XGOA 1M0ZA 4Z61C 1U0ND 2Z7XA 3VQ1A 3ULUA 3WN4A 4Z64C 3CVRA 4ARNA 4Y61B 4R6FA 3RW6A 3RW7A 4LSAA 3G06A 2A0ZA 2ID5A 4IM6A 3A79B 5B4PA 2XOTA 1IO0A 2BNHA 4XOSA 1A9NA 4Q3IA 3OJAB 5GS2B 1LTXA 4R6GA 3P72A 2FT3A 3RFJA 3W3KA 4MQWX 2Y5QA 4PSJA 4LI2A 4J0MA 4FDWA 2OMTA 3ZYOA 3WPDA 2Z82A 4EZGA 1ZIWA 4FHOA 4LSXC 3CIYA 4QBZA 4WP6A 1M10B 3W3JA 5CMPA 5AWAA 1O6TA 4FMZA 3WPFA 1XECA 3REZA 3RIZA 1OZNA 3M18A 2OMZA 4ARRA 1FT8A 2RA8A 2P1PB 2UZXA 4ECNA 5LFNA 4C2BB 3ZYJA 1M9LA 4J4LA 5GMFA 1DS9A 4R58A 1PGVA 5CMNA 1DFJI 3C6PB 3PMHG 4PEQB 4KNGA 1QYYA 4Q62A 4QC0A 3OGLB 3CIGA 4L3AA 4M7EC 4I6JB 1YRGA 2Z62A 4Z94G 4R09A 3BZ5A 3RFSA 2O6SA 4RWTC 3RGXA 3KJ4A 3G3AA 5HDHA 1O6SA 3TSRE 2Z81A 4G8AA 1M9SA 4BSUA 1DCEA 1D0BA 1OTOA 1G9UA 1OGQA 4HQ1A 4BSSA 2R9UA 1OTNA 3C6NB 4L3FA 3VQ2A 2ASTB 4FD0A 4UFRA 4MN8B 2Q4GW 4LSXA 3WPHA 3OJAA 2BEXA 2RR6A 2WQWA 3E6JA 4PQ8A 1K5DC 2O6QA 2V9TB 4U06A 3G3BA 3RFEA 2WQVA 2OMVA 4NKGA 1K5GC 3UL7A 2V70A 1W8AA 4YEBB 4NKHA 4R0AA 1H6UA 4R6JA 2CA6A 2O6RA 3W3MA 4AW4A 3DZEA 1O6VA 5D3IA 1Z7XW 1P9AG 2Z64A 2UZYA 1XWDC 4M7EA 1XEUA 3E3ZA 5HZLB 4BSRA 5AWDA 5GQRK 2P1QB 2OMYA 1H6TA 4R08A 1GWBA 3WPGA 4BV4R 2V9SA 3G39A 4U08A 5GS0A 4LXSA 5AZ5A 5B0NA 2P1NB 4B8CD 3WPEA 3GOZA 4CILA 1FQVA 5IJDA 1P8TA 3WPCA 5IJCA 1SQ0B 2XWTC 4AY9X 4TZHA 4CC4C 4V2DA 4PKIG 1KOHA 3W3GA 3G04C 4CNCA 2WQXA 4FS7A 4R07A 2ASSB 2WQUA 4P8SA 2P1OB 1OTMA 3ZYNA 2OMWA 3ULAA 4Z79A 1XKUA 2Z7XB 4ECOA 4C2AB 4PERA 1WWLA 3E4GA 4R6AA 1FO1A 3SB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT6 A;  5IYX C;  4CNM A;  3WPB A;  2OMX A;  4FCG A;  4QXE A;  3JB9 j;  2ELL A;  4R5D A;  3OGK B;  3FXI A;  4RCA B;  4Z8G A;  4RCW A;  3E2J A;  5GMG A;  4V2E A;  2Z66 A;  2WFH A;  3RJ0 A;  1P8V A;  4LI1 A;  2Z65 A;  3UL8 A;  4U7L A;  2IFG A;  3WPI A;  3UL9 A;  1FS2 A;  3RGZ A;  1JL5 A;  3UN9 A;  5FTT B;  2JE0 A;  5GMH A;  4CC4 A;  3W3N A;  1XCD A;  3W3L A;  3C6O B;  1KOO A;  3ULV A;  3O53 A;  4P91 A;  1OOK G;  5IJB A;  4H09 A;  2JQD A;  5AWB A;  5B0T A;  5AWC A;  4K17 A;  4U09 A;  3O6N A;  4LXR A;  4V2C A;  4GLP A;  2Z63 A;  5A5C A;  2OMU A;  2JE1 A;  4WYK A;  3ZYI A;  4KXF B;  4XSQ A;  1A4Y A;  3M19 A;  3OGM B;  4OQT A;  4R5C A;  2P1M B;  4CP6 A;  4LSC A;  4Q3G A;  4KT1 A;  4XGO A;  1M0Z A;  4Z61 C;  1U0N D;  2Z7X A;  3VQ1 A;  3ULU A;  3WN4 A;  4Z64 C;  3CVR A;  4ARN A;  4Y61 B;  4R6F A;  3RW6 A;  3RW7 A;  4LSA A;  3G06 A;  2A0Z A;  2ID5 A;  4IM6 A;  3A79 B;  5B4P A;  2XOT A;  1IO0 A;  2BNH A;  4XOS A;  1A9N A;  4Q3I A;  3OJA B;  5GS2 B;  1LTX A;  4R6G A;  3P72 A;  2FT3 A;  3RFJ A;  3W3K A;  4MQW X;  2Y5Q A;  4PSJ A;  4LI2 A;  4J0M A;  4FDW A;  2OMT A;  3ZYO A;  3WPD A;  2Z82 A;  4EZG A;  1ZIW A;  4FHO A;  4LSX C;  3CIY A;  4QBZ A;  4WP6 A;  1M10 B;  3W3J A;  5CMP A;  5AWA A;  1O6T A;  4FMZ A;  3WPF A;  1XEC A;  3REZ A;  3RIZ A;  1OZN A;  3M18 A;  2OMZ A;  4ARR A;  1FT8 A;  2RA8 A;  2P1P B;  2UZX A;  4ECN A;  5LFN A;  4C2B B;  3ZYJ A;  1M9L A;  4J4L A;  5GMF A;  1DS9 A;  4R58 A;  1PGV A;  5CMN A;  1DFJ I;  3C6P B;  3PMH G;  4PEQ B;  4KNG A;  1QYY A;  4Q62 A;  4QC0 A;  3OGL B;  3CIG A;  4L3A A;  4M7E C;  4I6J B;  1YRG A;  2Z62 A;  4Z94 G;  4R09 A;  3BZ5 A;  3RFS A;  2O6S A;  4RWT C;  3RGX A;  3KJ4 A;  3G3A A;  5HDH A;  1O6S A;  3TSR E;  2Z81 A;  4G8A A;  1M9S A;  4BSU A;  1DCE A;  1D0B A;  1OTO A;  1G9U A;  1OGQ A;  4HQ1 A;  4BSS A;  2R9U A;  1OTN A;  3C6N B;  4L3F A;  3VQ2 A;  2AST B;  4FD0 A;  4UFR A;  4MN8 B;  2Q4G W;  4LSX A;  3WPH A;  3OJA A;  2BEX A;  2RR6 A;  2WQW A;  3E6J A;  4PQ8 A;  1K5D C;  2O6Q A;  2V9T B;  4U06 A;  3G3B A;  3RFE A;  2WQV A;  2OMV A;  4NKG A;  1K5G C;  3UL7 A;  2V70 A;  1W8A A;  4YEB B;  4NKH A;  4R0A A;  1H6U A;  4R6J A;  2CA6 A;  2O6R A;  3W3M A;  4AW4 A;  3DZE A;  1O6V A;  5D3I A;  1Z7X W;  1P9A G;  2Z64 A;  2UZY A;  1XWD C;  4M7E A;  1XEU A;  3E3Z A;  5HZL B;  4BSR A;  5AWD A;  5GQR K;  2P1Q B;  2OMY A;  1H6T A;  4R08 A;  1GWB A;  3WPG A;  4BV4 R;  2V9S A;  3G39 A;  4U08 A;  5GS0 A;  4LXS A;  5AZ5 A;  5B0N A;  2P1N B;  4B8C D;  3WPE A;  3GOZ A;  4CIL A;  1FQV A;  5IJD A;  1P8T A;  3WPC A;  5IJC A;  1SQ0 B;  2XWT C;  4AY9 X;  4TZH A;  4CC4 C;  4V2D A;  4PKI G;  1KOH A;  3W3G A;  3G04 C;  4CNC A;  2WQX A;  4FS7 A;  4R07 A;  2ASS B;  2WQU A;  4P8S A;  2P1O B;  1OTM A;  3ZYN A;  2OMW A;  3ULA A;  4Z79 A;  1XKU A;  2Z7X B;  4ECO A;  4C2A B;  4PER A;  1WWL A;  3E4G A;  4R6A A;  1FO1 A;  3SB4 A; 
#chains in the Genus database with same CATH topology
 4GT6 A;  4NZT M;  5IYX C;  4CNM A;  3WPB A;  2OMX A;  4FCG A;  4QXE A;  3JB9 j;  2ELL A;  4R5D A;  3OGK B;  3FXI A;  4RCA B;  4Z8G A;  4RCW A;  3E2J A;  5GMG A;  4V2E A;  2Z66 A;  2WFH A;  3RJ0 A;  1P8V A;  4LI1 A;  2Z65 A;  3UL8 A;  4U7L A;  2IFG A;  3WPI A;  3UL9 A;  1FS2 A;  3RGZ A;  1JL5 A;  3UN9 A;  5FTT B;  2JE0 A;  5GMH A;  4CC4 A;  3W3N A;  1XCD A;  3W3L A;  3C6O B;  1KOO A;  3ULV A;  3O53 A;  4P91 A;  1OOK G;  5IJB A;  4H09 A;  2JQD A;  5AWB A;  5B0T A;  5AWC A;  4K17 A;  4U09 A;  3O6N A;  4LXR A;  4V2C A;  4GLP A;  2Z63 A;  5A5C A;  2OMU A;  2JE1 A;  4WYK A;  3ZYI A;  4KXF B;  4XSQ A;  1A4Y A;  3M19 A;  3OGM B;  4OQT A;  4R5C A;  2P1M B;  4CP6 A;  4LSC A;  4Q3G A;  4KT1 A;  4XGO A;  1M0Z A;  4Z61 C;  1U0N D;  2Z7X A;  3VQ1 A;  3ULU A;  3WN4 A;  4Z64 C;  3CVR A;  4ARN A;  4Y61 B;  4R6F A;  3RW6 A;  3RW7 A;  4LSA A;  3G06 A;  2A0Z A;  2ID5 A;  4IM6 A;  3A79 B;  5B4P A;  2XOT A;  1IO0 A;  2BNH A;  4XOS A;  1A9N A;  4Q3I A;  3OJA B;  5GS2 B;  1LTX A;  4R6G A;  3P72 A;  2FT3 A;  3RFJ A;  3W3K A;  4MQW X;  2Y5Q A;  4PSJ A;  4LI2 A;  4J0M A;  4FDW A;  2OMT A;  3ZYO A;  3WPD A;  2Z82 A;  4EZG A;  1ZIW A;  4FHO A;  4LSX C;  3CIY A;  4QBZ A;  4WP6 A;  1M10 B;  3W3J A;  5CMP A;  5AWA A;  1O6T A;  4FMZ A;  3WPF A;  1XEC A;  3REZ A;  3RIZ A;  1OZN A;  3M18 A;  2OMZ A;  4ARR A;  1FT8 A;  2RA8 A;  2P1P B;  2UZX A;  4ECN A;  5LFN A;  4C2B B;  3ZYJ A;  1M9L A;  4J4L A;  5GMF A;  1DS9 A;  4R58 A;  1PGV A;  5CMN A;  1DFJ I;  3C6P B;  3PMH G;  4PEQ B;  4KNG A;  1QYY A;  4Q62 A;  4QC0 A;  3OGL B;  3CIG A;  4L3A A;  4M7E C;  4I6J B;  1YRG A;  2Z62 A;  4Z94 G;  4R09 A;  3BZ5 A;  3RFS A;  2O6S A;  4RWT C;  3RGX A;  3KJ4 A;  3G3A A;  5HDH A;  1O6S A;  3TSR E;  2Z81 A;  4G8A A;  1M9S A;  4BSU A;  1DCE A;  1D0B A;  1OTO A;  1G9U A;  1OGQ A;  4HQ1 A;  4BSS A;  2R9U A;  1OTN A;  3C6N B;  4L3F A;  3VQ2 A;  2AST B;  4FD0 A;  4UFR A;  4MN8 B;  2Q4G W;  4NZR M;  4LSX A;  3WPH A;  3OJA A;  2BEX A;  2RR6 A;  2WQW A;  3E6J A;  4PQ8 A;  1K5D C;  2O6Q A;  2V9T B;  4U06 A;  3G3B A;  3RFE A;  2WQV A;  2OMV A;  4NKG A;  1K5G C;  3UL7 A;  2V70 A;  1W8A A;  4YEB B;  4NKH A;  4R0A A;  1H6U A;  4R6J A;  2CA6 A;  2O6R A;  3W3M A;  4AW4 A;  3DZE A;  1O6V A;  5D3I A;  1Z7X W;  1P9A G;  2Z64 A;  2UZY A;  1XWD C;  4M7E A;  1XEU A;  3E3Z A;  5HZL B;  4BSR A;  5AWD A;  5GQR K;  2P1Q B;  2OMY A;  1H6T A;  4R08 A;  1GWB A;  3WPG A;  4BV4 R;  2V9S A;  3G39 A;  4U08 A;  5GS0 A;  4LXS A;  5AZ5 A;  5B0N A;  2P1N B;  4B8C D;  3WPE A;  3GOZ A;  4CIL A;  1FQV A;  5IJD A;  1P8T A;  3WPC A;  5IJC A;  1SQ0 B;  2XWT C;  4AY9 X;  4TZH A;  4CC4 C;  4V2D A;  4PKI G;  1KOH A;  3W3G A;  3G04 C;  4CNC A;  2WQX A;  4FS7 A;  4R07 A;  2ASS B;  2WQU A;  4P8S A;  2P1O B;  1OTM A;  3ZYN A;  2OMW A;  3ULA A;  4Z79 A;  1XKU A;  2Z7X B;  4ECO A;  4C2A B;  4PER A;  1WWL A;  3E4G A;  4R6A A;  1FO1 A;  3SB4 A; 
#chains in the Genus database with same CATH homology
 4GT6 A;  5IYX C;  4CNM A;  3WPB A;  2OMX A;  4FCG A;  4QXE A;  3JB9 j;  2ELL A;  4R5D A;  3OGK B;  3FXI A;  4RCA B;  4Z8G A;  4RCW A;  3E2J A;  5GMG A;  4V2E A;  2Z66 A;  2WFH A;  3RJ0 A;  1P8V A;  4LI1 A;  2Z65 A;  3UL8 A;  4U7L A;  2IFG A;  3WPI A;  3UL9 A;  1FS2 A;  3RGZ A;  1JL5 A;  3UN9 A;  5FTT B;  2JE0 A;  5GMH A;  4CC4 A;  3W3N A;  1XCD A;  3W3L A;  3C6O B;  1KOO A;  3ULV A;  3O53 A;  4P91 A;  1OOK G;  5IJB A;  4H09 A;  2JQD A;  5AWB A;  5B0T A;  5AWC A;  4K17 A;  4U09 A;  3O6N A;  4LXR A;  4V2C A;  4GLP A;  2Z63 A;  5A5C A;  2OMU A;  2JE1 A;  4WYK A;  3ZYI A;  4KXF B;  4XSQ A;  1A4Y A;  3M19 A;  3OGM B;  4OQT A;  4R5C A;  2P1M B;  4CP6 A;  4LSC A;  4Q3G A;  4KT1 A;  4XGO A;  1M0Z A;  4Z61 C;  1U0N D;  2Z7X A;  3VQ1 A;  3ULU A;  3WN4 A;  4Z64 C;  3CVR A;  4ARN A;  4Y61 B;  4R6F A;  3RW6 A;  3RW7 A;  4LSA A;  3G06 A;  2A0Z A;  2ID5 A;  4IM6 A;  3A79 B;  5B4P A;  2XOT A;  1IO0 A;  2BNH A;  4XOS A;  1A9N A;  4Q3I A;  3OJA B;  5GS2 B;  1LTX A;  4R6G A;  3P72 A;  2FT3 A;  3RFJ A;  3W3K A;  4MQW X;  2Y5Q A;  4PSJ A;  4LI2 A;  4J0M A;  4FDW A;  2OMT A;  3ZYO A;  3WPD A;  2Z82 A;  4EZG A;  1ZIW A;  4FHO A;  4LSX C;  3CIY A;  4QBZ A;  4WP6 A;  1M10 B;  3W3J A;  5CMP A;  5AWA A;  1O6T A;  4FMZ A;  3WPF A;  1XEC A;  3REZ A;  3RIZ A;  1OZN A;  3M18 A;  2OMZ A;  4ARR A;  1FT8 A;  2RA8 A;  2P1P B;  2UZX A;  4ECN A;  5LFN A;  4C2B B;  3ZYJ A;  1M9L A;  4J4L A;  5GMF A;  1DS9 A;  4R58 A;  1PGV A;  5CMN A;  1DFJ I;  3C6P B;  3PMH G;  4PEQ B;  4KNG A;  1QYY A;  4Q62 A;  4QC0 A;  3OGL B;  3CIG A;  4L3A A;  4M7E C;  4I6J B;  1YRG A;  2Z62 A;  4Z94 G;  4R09 A;  3BZ5 A;  3RFS A;  2O6S A;  4RWT C;  3RGX A;  3KJ4 A;  3G3A A;  5HDH A;  1O6S A;  3TSR E;  2Z81 A;  4G8A A;  1M9S A;  4BSU A;  1DCE A;  1D0B A;  1OTO A;  1G9U A;  1OGQ A;  4HQ1 A;  4BSS A;  2R9U A;  1OTN A;  3C6N B;  4L3F A;  3VQ2 A;  2AST B;  4FD0 A;  4UFR A;  4MN8 B;  2Q4G W;  4LSX A;  3WPH A;  3OJA A;  2BEX A;  2RR6 A;  2WQW A;  3E6J A;  4PQ8 A;  1K5D C;  2O6Q A;  2V9T B;  4U06 A;  3G3B A;  3RFE A;  2WQV A;  2OMV A;  4NKG A;  1K5G C;  3UL7 A;  2V70 A;  1W8A A;  4YEB B;  4NKH A;  4R0A A;  1H6U A;  4R6J A;  2CA6 A;  2O6R A;  3W3M A;  4AW4 A;  3DZE A;  1O6V A;  5D3I A;  1Z7X W;  1P9A G;  2Z64 A;  2UZY A;  1XWD C;  4M7E A;  1XEU A;  3E3Z A;  5HZL B;  4BSR A;  5AWD A;  5GQR K;  2P1Q B;  2OMY A;  1H6T A;  4R08 A;  1GWB A;  3WPG A;  4BV4 R;  2V9S A;  3G39 A;  4U08 A;  5GS0 A;  4LXS A;  5AZ5 A;  5B0N A;  2P1N B;  4B8C D;  3WPE A;  3GOZ A;  4CIL A;  1FQV A;  5IJD A;  1P8T A;  3WPC A;  5IJC A;  1SQ0 B;  2XWT C;  4AY9 X;  4TZH A;  4CC4 C;  4V2D A;  4PKI G;  1KOH A;  3W3G A;  3G04 C;  4CNC A;  2WQX A;  4FS7 A;  4R07 A;  2ASS B;  2WQU A;  4P8S A;  2P1O B;  1OTM A;  3ZYN A;  2OMW A;  3ULA A;  4Z79 A;  1XKU A;  2Z7X B;  4ECO A;  4C2A B;  4PER A;  1WWL A;  3E4G A;  4R6A A;  1FO1 A;  3SB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...