1ZIXA

Crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIHYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSDYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
molecule tags Hydrolase
source organism Pseudomonas putida
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
total genus 83
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zixA00
4YPVA 1XRLA 2I78A 4G1FA 4ETWA 3HEAA 4QWMA 1GPNA 1H2YA 4DNQA 3FLEA 4DMFA 1QIEA 2WKWA 4UFNA 1T2NA 3WZMA 4S0XA 4UBKA 2OGTA 3WWCA 2WJ6A 1DX6A 3RLIA 5ALXA 4MEAA 4MWTA 4B83A 2B4KA 4WDQA 3EIOA 1G5FA 2BAGA 4IHAA 5ALEA 3M81A 1E8DA 3R3ZA 2BUCA 2VJCA 3FLBA 2JGMA 4BCDA 1JMKC 4KAFA 2HRQA 4LYDA 3V1MA 3EBLA 1X70A 3S8YA 5EIHA 3B5EA 3LLCA 2AJBA 5C8ZA 1B41A 2PKYX 4B80A 1TIBA 2W6CX 2XMGA 4Y2PA 4BAUA 1XQWA 2XUFA 2AJCA 4MYDA 1C7IA 1ZIXA 4OU5A 4U2GA 3STWA 2R11A 1VXOA 1YB6A 2WHPA 2WM2A 4H7JA 4N5HX 5I7UA 1WHSA 1E66A 1CUAA 2BGRA 2XQFA 4NMWA 2G5PA 5JASA 3UUEA 4YK7A 2B61A 5JANA 3PFBA 1TQHA 1RYYA 3U0VA 4A5SA 2G4LA 1DWOA 4H0CA 1S8OA 1TAHA 4WCVA 3WKBA 1ORVA 4AN0A 1N5MA 5E4YA 3OOSA 4CIBA 3GELA 1SOMA 2DR0A 4QDOA 1XKTA 3G9XA 4PW0A 2H9YA 1NU8A 3E1GA 1DWQA 2BJHA 5LYYA 4C89A 4BTLA 2XI4A 3LP5A 2HFJA 1TK3A 4JYPA 2I3ZA 2ECFA 3SK0A 3FLAA 1GQSA 1QIFA 1MAHA 4EB0A 4HVTA 4QZVA 1CV2A 4CCYA 5T4BA 1BCRA 2QJRA 2CB9A 4DGQA 5FP0A 1R9NA 3O4JA 5ISMA 2QUAA 1CRLA 2XMBA 4K6HA 4UPDA 1LPNA 3PF9A 2QVBA 1ZD3A 2XUJA 1A88A 3A70A 1GT6A 2PM8A 2O7RA 5ALJA 2J4CA 1U65A 2PUJA 3I2JA 3JYHA 2O2IA 3A2LA 1F6WA 1CUGA 1J2EA 1BCSA 1E89A 5AOBA 2VATA 3UMJA 5KBYA 2XUOA 4ROTA 4ZV7A 3QMWA 5K3DA 3HABA 2XMZA 1K5PA 2HFKA 5AKJA 1VA5A 5FRDA 3O4GA 3DOIA 5T4EA 2HDWA 4AO8A 3F98A 4DNFA 1N5RA 3G9TA 2JF0A 5K3EA 4UHFA 2VT6A 2YYSA 1EINA 3AFIA 2QMQA 1WCYA 4DNOA 4IH1A 4KR0A 1O6GA 4Q1VA 1QIHA 5DNWA 3R3XA 5AM1A 1DX4A 2VA9A 1SCQA 2I3DA 4J0HA 1ORWA 1VJ5A 1HDEA 1WPXA 1MX1A 5JD4A 3I2IA 4C4YA 2LIPA 2RIPA 3FSGA 1IZ7A 1UOPA 3A2MA 3WMRA 4FBLA 4XVCA 1R9MA 5D3ZA 5CXUA 1AURA 2FX5A 2FJPA 4WJLA 3OC0A 4JH0A 4RGYA 3KXPA 2UZ0A 1MT3A 1EB8A 3ZLUA 3K6KA 4PSCA 1W4LA 4KE6A 5HF5A 5AO9A 1WOMA 4AZ0A 5ALLA 4AXBA 3WWOA 5J3JA 1K8QA 3ZV7A 3N2ZB 1H2WA 1U4NA 3C8DA 3PUIA 2WG0A 4A23A 3NWOA 2V98A 3DD5A 2JEZA 4BRSA 1USWA 5I8PA 2RI6A 3OM8A 3IDAA 2D5LA 2OLEA 5HCUA 1YA4A 2XUPA 1Q84A 5ALNA 1XZHA 1J1IA 1PJAA 4IH4A 5KWJA 4W1QA 4HS9A 3NGMA 2OGZA 4UBOA 3FCYA 3D2BA 3AIMA 3WA7A 1G42A 4BAZA 3W2TA 3C6BA 1CEXA 4G9GA 1XZMA 1QOZA 2WFZA 3P2MA 2QJWA 1R3DA 3M83A 4G8BA 4XJVA 5EHNA 3WK7A 2HA2A 1XZDA 1GQRA 3K2IA 2ONCA 5LP1A 1WB4A 3DYVA 5AI5A 1X2BA 5JAHA 5HK9A 3ED1A 3WKAA 2CMFA 4PSUA 2WUFA 3EQ7A 4DLNA 1Y37A 1QONA 2J3DA 5AKXA 1XZAA 4HZGA 3C5WP 2GZSA 4W1RA 3I6ZA 3DKKA 3C6XA 1R88A 4UHDA 5CBKA 1CQWA 4X90A 3WWDA 5AIAA 4ZREA 3OG9A 3WK6A 4RPCA 4ZI5A 5JAOA 1KU6A 2H7YA 4K6KA 2O2HA 1E5TA 4AMYA 1DWPA 2JEYA 2HU8A 2OXEA 2WTMA 4N5IX 2WILA 3IUQA 2WTNA 4EY6A 1P0IA 5JARA 1JFRA 1K63A 2Z3ZA 4IH9A 4W1SA 2CJPA 3DLTA 2BCEA 3STYA 3HLKA 5A7GA 5ALIA 1EDDA 1ETHA 2OG1A 1LPAB 5DTIA 5JZBA 1XRQA 4MJ3A 4E14A 1VA4A 4N8EA 3FVTA 3O0DA 1OXMA 1SCKA 4J0JA 3AILA 4AQDA 5ALYA 1RP1A 3QMMA 4KE7A 2GYUA 3D2AA 3TGLA 2C58A 1CUBA 3EF3A 5K3BA 3KWJA 2XMCA 4DNPA 3DL4A 1G66A 1XQXA 3O95A 5ALGA 1CUSA 1CUWA 3L1HA 1ZICA 2ZYRA 1JMYA 3BJRA 3DJYA 5AKKA 5HQ3A 3VVMA 3C5VA 5IVIA 1HKHA 1UK6A 4ZGBA 5T4FA 1HQDA 5AHXA 4BBZA 1N1MA 3ESDA 4HRXA 2XQKA 3O4HA 1MNAA 1AZWA 5DLPA 3H1BA 4BYMA 3N0TA 4Y2QA 5H3HA 3H04A 1H2XA 4MXDA 3F97A 4L0CA 1LPOA 4J0IA 3FVRA 5ALRA 2AJLI 1IMJA 2Z8XA 1YCDA 5ALQA 3U1TA 4UHBA 4NS4A 3VKFA 1EDBA 1DQYA 4L3WA 2OCKA 2HA5A 5AK5A 1E3QA 3FWHA 1FFAA 4IO0A 2VT7A 1XZBA 4MQMA 1NX9A 4GLBA 4I19A 2YXPX 2V9ZA 2J3QA 3PF8A 1GZ7A 1XKLA 2CZQA 1HLGA 2RHTA 1CLEA 2VSQA 2WHPB 1KEZA 2JGJA 3QPAA 1O6FA 3AIKA 2WUDA 4OSEA 1A8QA 3DYIA 2WQZA 5CW2A 3T52A 1FJ2A 1YS1X 5C8VA 1M33A 5K3FA 4BATA 3S2ZA 2BFNA 1QIKA 5D6OA 3TRDA 3IB3A 2HU5A 3GZJA 1K4YA 5FDFA 3K9BA 4GECA 3BDIA 2ES4A 2WUEA 3D4LA 3H2HA 4FDMA 4WDRA 4UFOA 3KDAA 2WIGA 3QMVA 5JZSA 1MX5A 5HKBA 3WL7A 5AICA 1DU4A 1PV1A 1UXOA 1MX9A 5JIBA 4CCWA 2ACKA 4HXGA 4PSDA 3WJ1A 4BCCA 4G4JA 5EI5A 5HZGA 4UHEA 2JGFA 4KRXA 4AMZA 4FFVA 5FLKA 5AK6A 1ZIYA 5IVDA 2HM7A 3H17A 1UT6A 1MO2A 2PSEA 2QT9A 3BWXA 1LPBB 3AJAA 4DIUA 2VAVA 3RKSA 1X2EA 1IUOA 1GKKA 3JW8A 1MU0A 4Z49A 5CXXA 4G4GA 2EEPA 1MPXA 4OB6A 4P08A 4XWGA 1YA8A 4RNCA 3G8YA 2VEOA 5DYYA 4JYMA 5LZ8A 2BUAA 3B12A 1ZJ4A 2JBWA 1Y7HA 3WK9A 2XMSA 1BEEA 4PO3X 2IX9A 5ALPA 4PV7A 1CUVA 2E3JA 2PSFA 2Y2UA 3G02A 3C6ZA 4AZ3A 3I2FA 4N8DA 4INZA 3DOHA 3EQ8A 3ZLVA 5DTJA 3EQ9A 4ZV9A 3DKRA 3QITA 1B6GA 1JKMA 3BF7A 4AX4A 4WFKA 4MWSA 1ODSA 1EB9A 1AX9A 4FWBA 5AKHA 4P92A 2B20A 5AKIA 1BS9A 4EY7A 4LXGA 1XZJA 4X71A 5ALWA 2Z8ZA 4BC0A 5T4HA 3C43A 3R3UA 4GWLA 5CRIA 3M3DA 1MJ5A 4DMCA 5A7FA 4C4ZA 4Q82A 2WU3A 3ZWQA 1XRPA 3I28A 2OCGA 3G0BA 2OCIA 2QM0A 4H7KA 1R1DA 4HXEB 1R4ZA 5KWIA 2I03A 3CN7A 1U8EA 5BWBA 4X6UA 3DQZA 3RK4A 5A71A 4X92A 2Y2VA 4FHZA 4GXNA 4XIIA 1Z68A 3R41A 5C7YA 3H2JA 5D7BA 4P93A 1IUNA 1SC9A 2XLCA 4JEIA 3OURA 1VE6A 3MGAA 1QTIA 1TRHA 1UOQA 4QNNA 3G0CA 2CBGA 5AH0A 4M0FA 2WJ3A 4Y2SA 4KAJA 3I2HA 4KRYA 5JALA 1T4MA 5DNVA 1WHTA 4W1PA 2O2GA 5HQ3B 4KE8A 3CCBA 3MUNA 5LZ5A 5AP9A 3X3HA 2HU7A 1ZD5A 4WFIA 1RWQA 1XQYA 1QIJA 2HA0A 3PE6A 5CT5A 1EK1A 2XQGA 5HFAA 3OPMA 2CKMA 1XFDA 2AXEA 3BL8A 4F0JA 2ORYA 1XLUA 5LKAA 1WM1A 3CN9A 1EVQA 1XZLA 2RHWA 1QGED 3WIOA 1QFSA 1ACJA 4Q3LA 1AMNA 1DT3A 2ZJ7A 1IUPA 4FLEA 4KJXA 3V1LA 4FFWA 3VDXA 2D0DA 4XX1A 3RM3A 5AM0A 4KAAA 3I6MA 1I6WA 1ODCA 5JZ9A 2DSNA 3FNBA 5LIPA 3WK4A 4OD0A 4I3FA 3HC7A 2BUBA 2OGSA 3GROA 2WIDA 3PDCA 4DM7A 1N8SA 2WLSA 4ZRDA 1MAAA 4W63A 1AKNA 1AC5A 1HPLA 1ODTC 4FLFA 2ACEA 2PUHA 2XT0A 3WI7A 4QA9A 4UUQA 2ZYIA 2WIJA 2R8BA 3FSGD 1UOOA 3VISA 1TCAA 2JGEA 1Q0RA 3ESAA 4BDSA 1EI9A 5LZ2A 3V9AA 1GKLA 2X5XA 5AI9A 4U2DA 5K5EA 4DMKA 4OYYA 2XDWA 1ACLA 3IUMA 4BE9A 5ALDA 2IITA 1LBSA 5AKYA 3ICWA 5ALUA 2WFLA 3I2KA 5ALVA 1Y7IA 4D9JA 1QE3A 4AO7A 4QDUA 1QFMA 2XUQA 5AKGA 3BF8A 4BE4A 1THTA 4FLMA 4GW3A 4LHEA 2WIKA 6YASA 1IZ8A 1TCBA 4EA6A 4BP8A 1CFJA 1VZ2A 3I1IA 2C4HA 2QOEA 1C7JA 3WKDA 1EDEA 2QTBA 2PX6A 1CUFA 4UHHA 2XUHA 4G8DA 3H1AA 1DQZA 3Q0TA 5DNUA 1W52X 5HKAA 4K2AA 1VLQA 2BKLA 4B0PA 1JU4A 4GEGA 4LXIA 3DEAA 5DYTA 2WHRA 2VJBA 1CIJA 1H23A 4X7BA 4J03A 1XLVA 2XUIA 4OUKX 4A16A 3H19A 4GDMA 3ICVA 3IUNA 1BEZA 4UBLA 4QWWA 2X76A 2Y6UA 5EGNA 1AQLA 2Y6VA 1VE7A 2DHEA 3I1YA 1JJIA 3IURA 4QLAA 1XZKA 3B3QA 3C87A 2GYWA 1W6RA 2HA3A 2VF2A 2WJ4A 2QUBA 1P0MA 1CUIA 3C70A 1VXRA 3R3VA 1QJ4A 1J06A 2IIVA 4E15A 4C88A 5I9IA 1MTZA 4WY8A 4UFPA 3IIIA 4KACA 1KU0A 4DTCA 4PF1A 3OTQA 2HA7A 2CEKA 2FUKA 5AOCA 4PQEA 2WU4A 5HFNA 3E3AA 3CXUA 2QS9A 5HK8A 1CUJA 1F0PA 3V1NA 2ZVDA 2H1IA 2XUDA 3HACA 4DYHA 1W1IA 5AKZA 3DS8A 2JGKA 5HF8A 3IA2A 1JI3A 5A2GA 4J0CA 3W06A 4EY8A 5BOVA 3DCNA 3YASA 2GBFA 3A6ZA 2WSLA 3WZLA 5K3CA 1UK9A 3GUUA 1JT2A 4O08A 5AI6A 5JAPA 4X6YA 2VAXA 3O4IA 1YB7A 2K2QB 5EHXA 5FKJA 3WQHA 1XROA 4J0KA 4BB0A 3G0IA 4X97A 3ZLTA 5AI8A 5CMLA 4OYLA 1XLWA 4FTWA 1YSCA 1UK7A 4U2EA 2XUKA 4FOLA 4X6XA 3W9BA 5AOAA 2GYVA 3D59A 1EVEA 2XQJA 4QLOA 1DT5A 3D7RA 3LIPA 5BV7A 3PFCA 5AM4A 2HADA 3QBJA 3KWFA 1Q83A 3AZPA 2XUGA 2XE4A 3QVMA 1L7AA 4EBBA 4TGLA 4EZIA 1WPRA 4CIAA 3F96A 4QEKA 4H77A 1GPLA 1A8UA 2Q0XA 5KREA 5CT6A 1XRMA 3PICA 3HYSA 4X91A 3JWEA 4OCZA 1L7QA 1ZI8A 2W22A 3AZOA 3R3YA 3FBWA 5EHQA 4BVLA 3BIXA 1PFQA 3VVLA 3F8SA 3QH4A 4NZZA 4Y2VA 5CH3A 5SYMA 4CG2A 4FKBA 1QO7A 5E2IA 1C4XA 5LLSA 2XMDA 3VXKA 5CT8A 3WL8A 3ANSA 1QZ3A 2ROQA 5AM5A 2DQZA 3M82A 2PSJA 2HIHA 3FYUB 3DNMA 5ESRA 2HHAA 2CUTA 4CG3A 3BE8A 3QPCA 5E4TA 4X00A 1BRTA 2JGIA 4TPKA 4NVRA 1VKHA 5AK4A 1CUUA 2WUGA 4EHBA 4FNGA 5ALKA 1UZAA 4Y2JA 4Y2YA 4FBMA 3H18A 3W04A 4B82A 4X94A 4X3CA 4RE5A 4K5QA 3WIBA 3BJMA 1FFDA 3HXKA 4QDZA 2G63A 1QO9A 2YH2A 4W9RA 4BCBA 1CUHA 4ARBA 3GFFA 2GBGA 1EX9A 3ESCA 2G5TA 1XZCA 5LZ4A 5ALZA 2OAEA 3WK5A 1YAJA 2DHDA 3G0GA 1TKRA 3R3WA 4LXHA 5ALFA 1JU3A 5JD5A 4C6HA 3HSSA 5FUMA 3AIOA 4HRYA 4H7FA 3BIWA 3D5EA 5HF9A 3A2NA 4B9EA 2ZJFA 3STXA 3PI6A 1YS2X 2HA6A 5CT4A 3PUHA 1F0NA 1XRRA 4YASA 3H2KA 4GBGA 1MNQA 5A7HA 1P0PA 1UKAA 5ALTA 3L1JA 3QM1A 1F8UA 4H7HA 1BE0A 4HAIA 1AGYA 1UKCA 3C6YA 3GBSA 5IVHA 1XQVA 3WWPA 3BDVA 1JJBA 2JIDA 2XQIA 1XZFA 3ESBA 1ZGBA 5IVKA 2GBCA 2QXTA 4BRZA 2PU5A 1K6EA 3D0KA 4B7ZA 1ZOIA 1H22A 1ZI6A 2WG2A 1YASA 3TEJA 5CTAA 2GBIA 4J3JA 4FMPA 3IULA 5AI4A 2FJ0A 4M0EA 4MQLA 1EK2A 7YASA 3WYDA 5AKLA 1CUEA 1CUDA 4UBMA 5JAUA 4YX9A 1GPKA 1CUYA 3O9MA 4CCYB 3L1IA 3R40A 1GXSA 3GA7A 5E4JA 1W75A 1QIDA 1U2EA 5FV4A 1P0QA 1UWCA 5EHZA 3WYNA 2PBLA 1QIMA 5FXMA 1CVLA 4BVJA 3HI4A 3G9ZA 1LPMA 1LBTA 2GZRA 4JNCA 1BN7A 4Q3KA 4PNZA 2DQYA 4U2FA 4OU4A 1CPYA 1D07A 1XZGA 4GHWA 3C8HA 1TCCA 1ZGCA 3LCRA 4OB7A 2H7CA 4BDTA 1ISPA 2WHQA 1A7UA 3G0DA 3FYUA 4QE3A 1VZ3A 3ZI7A 1CUCA 5FOQA 4WFJA 3SWWA 5CH5A 1EXWA 5C8XA 4JUIA 3V1KA 5F4ZA 5IKXA 1LZLA 1SFRA 2V97A 1DTEA 3H0CA 2VTVA 4Q3OA 5A62A 2BGNA 1J07A 2PU7A 4CI9A 4G9EA 1E8NA 2X8BA 3KD2A 3DDUA 1MN6A 4P9NA 1WB5A 2PVSA 2ZSIA 3MVEA 3LS2A 2C7BA 2WG1A 1LPSA 5CT9A 2C0QA 2VJDA 3WJ2A 5AM3A 5YASA 1Q0ZA 3QZUA 3DL7A 3AUKA 4EY5A 4BZWA 4U2BA 1LNSA 1YAHA 4Y9SA 5EFZA 4DSAA 3I2GA 4C01A 5JD6A 1BROA 3I6YA 2VQ6A 4X95A 4C4XA 3KSRA 4G4IA 3ANTA 5DJ5A 1EHYA 2PL5A 1H2ZA 5AI0A 3NUZA 2RGUA 5CURA 4L72A 3ILSA 1G4HA 3D2CA 4B81A 3FYUC 2RAUA 3TJMA 2WFLB 4BP9A 5FPQA 1FFCA 1QIGA 3Q8WA 4UBIA 1YR2A 1XZEA 4B85A 1L7RA 5LZ7A 5HF6A 2J4FA 4Y2TA 2C5GA 5BWCA 4UBNA 2NW6A 4X93A 2PSHA 5AM2A 3IBTA 2PSDA 2O7VA 1QIIA 1THGA 5FPPA 1CUXA 4L9AA 2DHCA 2QZPA 4ITVA 2HL6A 1CQZA 4WY5A 4TVKA 3FCXA 4HXFB 2PPLA 2WFMA 3KOOA 3STVA 4LYEA 1EA5A 4OB8A 4BZZA 3AINA 2JGLA 2H7XA 4H7IA 4MYSA 1ZJ5A 5JADA 4OPMA 3FAKA 3RARA 4DSZA 1LGYA 1W76A 2AJDA 3WWEA 1QTRA 1WB6A 4B9AA 2Z5GA 2HRRA 4BC1A 1AUOA 2AJ8A 4C87A 3IVMA 5ALHA 4N8SA 3C45A 5K3FB 2ZJ6A 5JYCA 4G5XA 3HZOA 3T4UA 3E0XA 3D3NA 2QRUA 5LZ9A 1OILA 3UUFA 4EUSA 2DFPA 4KE9A 4UHCA 4F60A 1NU6A 4QDXA 4DMHA 4F21A 1HL7A 3AZQA 1XZIA 4J0DA 4B84A 4LIPD 2XMQA 4BAGA 1GGVA 4H35A 4AO6A 1A8SA 5CH8A 3VJMA 4ARAA 5AK3A 4ZXFA 2V96A 1ZD4A 2OQVA 3H2IA 2XLBA 3HRHA 5C81A 4UBJA 4B6GA 1HBJA 3CCCA 3O9VA 2YASA 5AJHA 4CG1A 3WK8A 3BXPA 3W9UA 1IVYA 2OPHA 1OCEA 2HA4A 4E11A 1FSSA 2ZYSA 1FFEA 4F5ZA 3IUJA 4MEBA 5EIAA 3E4DA 3STUA 2OQIA 2OCLA 2OAGA 3QYJA 1JJFA 3WKEA 2QXUA 4GI1A 3ZPXA 4BTVA 3F9CA 3SX4A 2P8SA 4K6GA 4Q05A 3VJKA 1LLFA 2EDCA 4HTAA 5SYNA 1EH5A 2XMRA 5AIBA 1CR6A 1SCIA 3HJUA 4IQ4A 5K3AA 4KEAA 3MUOA 5LKRA 1ZD2P 1R50A 1FFBA 1BU8A 3WKCA 1VOTA 4H7DA 3VJLA 2Z3WA 3F67A 2RONA 4FNMA 5DYWA 5EIEA 1LPPA 3FOBA 4V2IA 2XUAA 2EDAA 5IH7A 3G7NA 2QR5A 3WLAA 3WL6A 3FYTA 1QLWA 4ZWNA 4LKOA 1LZKA 3SC2A 3WL5A 2WIFA 4E46A 2Y1KA 4G8CA 4AN1A 4I4CA 2VJAA 4U2CA 4Y7DA 4J7AA 5ALOA 4RE6A 1UFOA 2QKYA 4M0MA 4QDTA 3QPDA 2XB6A 3LIIA 1UK8A 4KYVA 4Y2RA 3WA6A 2C0PA 5AKEA 3H2GA 4Y2UA 2C5FA 1DINA 4B0OA 1ZI9A 3V48A 4H7EA 4EY4A 4J0GA 3R0VA 5JATA 1CUZA 2DCMA 2ZYHA 4CFSA 1E8MA 1UKBA 5ALSA 5ALMA 5DWDA 2ZSHA 4AB1A 4BVKA 4Y2XA 4H18A 5D3KA 4Q34A 3W05A 3STTA 2B9VA 4X85A 1XRNA 3G9UA 3NOXA 5A6VA 1BN6A
chains in the Genus database with same CATH superfamily
1N5IA 2BDEA 5IBQA 4GOMD 2I78A 3ROKA 3QF4A 4MW2A 2IUEA 4ZZ1A 1AS3A 5KUTA 2XZOA 2HEGA 2VBGA 4YCDA 4J76A 4NXMB 4MPDA 3LX8A 4Q6WA 5DGHA 5ES3A 3VC3A 2OVFA 4YV7A 1NVUQ 2CFOA 1KHTA 3HEAA 4IXTA 3TIFA 1FQOA 3OTOB 1GPNA 1DFGA 4MQ6A 3EN0A 4MZDA 4E21A 1H2YA 4TWRA 1KEKA 2BF7A 4DNQA 5L3SB 1XG5A 2J09A 4TT8A 1TQDA 2WKWA 4UFNA 5AVJA 3OOHA 3LPNA 1Z83A 5F76A 2ZPUA 4UBKA 4NATA 3VX3A 2B2CA 1VCIA 4TV9A 4EJSB 1F60A 2HIAA 5FOSA 5T41A 5TC4A 1TI7A 2AOVA 2X0DA 1JR6A 2NIPA 4NF2A 2J6BA 2WJ6A 2POQX 2ZE7A 1H0KA 1L5FA 1XJ0A 5GOZA 5ALXA 3MUFA 3THRA 2FMTA 1P2VA 2DT5A 1NURA 3TLBA 4F1KA 4TXNA 5A4DA 3AXSA 2WFAA 2OV6A 4JMPA 1RM5A 5IC6A 3V7UA 4MRAA 1DADA 1E2JA 4DBLC 3VOBA 3DE6X 4DLXA 3M81A 3UWKA 4URXR 1KOGA 1Z0ZA 3O75A 3A6GA 2O8CA 3ZCVA 3NONA 1EUDB 3QLTA 4RIIA 3SBEA 4CMIA 3R3ZA 2CDNA 2VJCA 3X1ZA 1D2GA 3EFOB 2C4MA 2X8JB 4ZT7A 5FD8A 4BCDA 1EVJA 1JMKC 2F3QA 2V0GA 4LXUA 1ZAYA 4BFXA 3S55A 4EHFA 5KC8A 1VLZA 4LYDA 4MROA 3Q9NA 3O8DA 3V1MA 2KYRA 1IRIA 2WNIA 4HQ6A 4E4TA 4UTXA 4MX8A 3PD0A 2VPWA 1T0PA 1X70A 4JBXA 2QVGA 2FLWA 2J0VA 4FINA 4EVIA 2A0KA 2DTEA 1GJRA 1RT9A 3B5EA 4BASA 1SM4A 2A8YA 2WYIA 5I7RA 3EGDA 3ZZ0A 2FR1A 1JAXA 3VQTA 1JPUA 2Z2KA 5KX5F 1LSUA 3GDFA 2NSDA 1KJQA 2A35A 4X66B 1F2VA 4IOLA 3CE9A 1AQJA 1L5OA 2NV6A 2XMGA 2AJCA 3CZPA 3QXSA 2JAWA 2K5UA 4IDAA 5JG7A 3VDRA 3A6EA 4US1R 4IJKA 3R7WA 1C7IA 3TECE 4L16A 5IM5A 2I8LA 3MTJA 1KQ3A 3H11A 4D43A 5BV1A 1T0JB 4KN5A 1OKKA 1PZXA 1Z18A 3LTEA 1Y4AE 2R2GA 2WM2A 2P6RA 1BA3A 1ZWLA 2ESRA 2QYHA 3WGMA 1ZCJA 3IDSA 2V7VA 1IN1A 4R2XA 1WHSA 4O0MA 2ZG6A 2G5PA 5JASA 1SXJA 1WTCA 3QLUC 4YK7A 2H9IA 3JQ6A 3PFBA 4ZVRA 4RAOA 3IOBA 3U0VA 4BWVA 4PAGA 1O77A 2B69A 2RHBA 3A06A 1QHHB 4IF6A 2IYSA 4FGLA 4NZPA 1C0IA 4LY3A 5DH9A 2PHZA 2YL2A 2G4LA 3UKJA 4H0CA 2R9VA 1I51A 2R6CA 3PQ2A 2OY0A 4Q4JB 5BW5A 1UMKA 1UZMA 2VHJA 2QLTA 1QQ6A 2H7VA 1LS1A 4MVXA 1YDHA 3WKBA 2CGEA 3QG5A 3LHDA 3DC2A 5E4YA 4AN0A 5KX5A 4W5NA 4R5HA 1XZQA 2I6GA 4E4YA 1Y9JA 3F7NA 4OHRA 2GJ8A 2J6IA 4D81A 4CIBA 2NSLA 2A5DA 1L5WA 3GELA 3PKIA 1FS4A 2VJMB 4MLCA 4QULA 5SY9A 4XQGA 1L8OA 1P5ZB 2WYOA 4WKOA 3G9XA 4G8JA 1A3CA 4FYJA 1W9MA 2X19A 3C8ZA 2XYRA 3M0EA 2O19A 2EIHA 4YJFB 1RTKA 3PPYA 1WSAA 3L40A 5AW8A 1XPUA 2F90A 2FPLA 2BJHA 4DV2B 3NHUA 1KQOA 2O7SA 2QD2A 2VSYA 4XWYA 1DIAA 1PT6A 4BTLA 3GAFA 4NLLA 4RK4A 3ZW8A 1TC2A 2OYRA 4ABYA 2Y0PA 3LUFA 2R7LA 1B1CA 2FV8A 4JFRA 2HFJA 5DI3A 2OHHA 4M8LA 3PKJA 2VSFA 3AUAA 4JP1A 5EZYF 3RAJA 4YIHA 2XB2A 1QE5A 2I3ZA 3SK0A 1W6UA 4GXRA 1MH9A 4KHZA 4YCNA 4BNKA 3FR7A 3VFDA 3V1UA 1LLCA 1AJEA 3M6FA 1RRKA 2WWHA 3H86A 3ZDDA 2DE0X 3PZBA 2RK3A 4U02A 4XGNA 1M2JA 5BVGA 1BCRA 2B21A 3PD7A 1PSZA 1HURA 2QJRA 1MW9X 3VKUA 3NBYC 2BTQA 3IAS1 3QV1A 6PFKA 1YR1A 4DGQA 4FZRA 5SYAA 5L3QA 5FP0A 1R9NA 4BX3A 1P2GA 2QLNA 1ZK4A 1UMBB 1YVUA 3TX2A 4Y6RA 4CW7A 1W47A 3BMOB 4KX5A 3AHDA 2MINA 1LPNA 4KQEA 3HNOA 1WG8A 1TUGA 2VBCA 3EXFB 1M8KA 1N2OA 3N59A 3NUGA 4U0JA 4PG7A 4HX5A 4ECEA 4HD8A 1T8SA 2DKNA 2PM8A 4U9HS 3RSFA 1JHXA 2WV7A 3SM3A 4FCCA 1U65A 3BK7A 3KEOA 4F4UA 2GQ0A 2PUJA 2HMVA 3LF2A 4N65A 4KH0A 5GIPE 5HCNA 5LQRA 1HEYA 2W2TA 3UV6A 1W29A 4GSLA 4HLNA 3I0NA 3ICPA 2OB1A 4NNPA 4NZNA 2QV0A 4YT5A 3ZY3A 4MV6A 2FEXA 3H11B 4U39A 4R2KA 1PEDA 1ZNWA 2GASA 3QLEA 2ODBA 2E1RA 4H6PA 1JFLA 4PLPA 2CLOB 3TE7A 1Z7YA 3TLMA 1N7JA 3UGJA 3E9CA 3TR0A 1KI2A 3R7NA 4L9SA 2VATA 3A1UA 1VB3A 3VU0A 1SCUA 3W6OA 3JAMA 4CEJB 5KBYA 1M6NA 2XUOA 4HC4A 3Q85A 4BQFA 3O21A 4Q48A 4NNOA 3VBCA 2XMZA 1K5PA 2V4ZA 4UM5A 2DY1A 5E3JA 3HPQA 4J0FA 2UZ1A 5KYVA 2HFKA 3VU3A 1VE1A 3Q9SA 5FRDA 5EIBC 3RU7A 1TAQA 2YMPA 3O4GA 3TLGB 1RCTE 3PK0A 2Y1OA 3DOIA 3MIZA 2F48A 5DMHA 4C0XA 3FTEA 2R85A 5FNVA 3ZGYA 5HJ5A 1PJZA 4AO8A 4C2AA 5U9CA 5J4VA 1E4YA 2G0NA 4G3XA 4GE0A 4BFZA 2JK0A 2EZ4A 4BKPA 2H5EA 3H87A 1N5RA 2Q27A 2YFHA 2FP3A 4N3GA 1Y98A 5FBKA 3SDBA 1ZSYA 2IEYA 2YY5A 3A6LA 5ARCA 2OENG 2PJRA 5SY6A 3I04M 1C9MA 4KFRA 4II3A 2IH4A 4ZCTA 4N76A 3GAMA 1IFXA 1GGHA 2YYSA 3FFXA 4MGYR 3I83A 4DB4A 4NBKA 3AFIA 4OQQA 1QHXA 5AVVA 3NV7A 3R6DA 3UNXA 1KYTA 3NWBA 2JAXA 1YF3A 3UCFA 4KR6A 1ZOSA 2PT6A 3T94A 1TM2A 1WEKA 1WCYA 4DNOA 4F06A 5LWQA 3KR2A 2B7BA 1QCCA 2X9VA 5GVSA 5LA6A 3BK2A 3L9XA 1QU2A 1C9KA 1R5BA 2CLDX 5ENZA 3N75A 2VJNA 4JS0A 5FPHA 4ZCSA 1CTQA 3AC0A 4CL8A 4ISBA 2NAFA 3UN1A 2L69A 5EESA 4ZZ2A 4DXAA 4CPDA 2I3DA 4J0HA 4S12A 3D1LA 1SD5A 1GKIA 1HDEA 5EP2A 1HT1E 1Q44A 3EFHA 1ZP6A 1JMVA 4EB8A 1EBFA 3LL7A 3NWPA 4CM5A 1N2SA 4Z1MD 4XDHA 4KLAA 3UJHA 4FFLA 3I2IA 4JJAA 4C4YA 2ISCA 5CX1B 3E8SA 4LGYA 2EJTA 1NPYA 4DG8A 1IZ7A 3I72A 1YJAA 5A06A 1OLUB 1DEKA 2OQRA 3PWSA 1YZQA 3MRXA 4JIMA 3GFGA 4R1NA 3RTGA 2WAYA 1IOZA 3DEHA 4C14A 2TMGA 3IYLW 5G4KB 4DMLA 3Q3EA 2HR1A 5LU8A 3S27A 3OOYA 1PN3A 2GI4A 3UJ6A 1R9JA 1H2AS 4OHMA 4TZ0A 5CXUA 1AURA 4ZCMA 2AZXA 1WCV1 2ID9A 2MJLA 3RF7A 1SPXA 2C2BA 3R7BA 1Z56C 2IZ7A 4UDOA 2VZLA 1GSHA 3SXUB 3OEHA 1ZR4A 4HYEA 2ZAGA 2PZMA 4R2HA 1ZHOA 2UUCB 1UQUA 3HFGA 4CFZA 1WETA 4ND8B 3B51X 3HCBA 1UXGA 3L7OA 2D5CA 1L3IA 5L95A 1H5QA 3QXCA 2X15A 3O31A 1EBUA 2SKEA 4TLAA 3U7QA 1GVHA 3EGIA 1QGOA 4P35A 5ALLA 1HOTA 1J7KA 1Q0HA 2J3KA 2V74B 2VH5R 4P36A 4REQA 4XLTA 2PMEA 3WWOA 2ZIAA 3TXYA 3EPJA 1VLHA 5J3JA 1SQ6A 3MN1A 4IM7A 5LBTA 3N2ZB 4GMHA 4L5YA 3C8DA 4KVAA 2QTCA 3PUIA 3GIWA 3EEFA 3ZBUA 1WY7A 1Q14A 3HCCA 2R7KA 1PVDA 2G08A 4UPEA 2VSXA 1KDYA 1OX6A 4FSHA 1VPLA 4XPZA 3QRWA 3C85A 4DA9A 1Z08A 4ZQGA 3NAMA 4GP7A 4WBNB 3RRNA 2HI0A 3MLBA 2G71A 2P3LA 4G63A 1GA6A 2MU1A 5DI3B 2HDOA 3UVEA 2GT1A 4LBYA 3V9PA 5AHKA 4B17A 3OM8A 1F8GA 3IDAA 3SR3A 4DF3A 3DE1X 2Z0MA 1UWVA 1YA4A 4MUFA 4DANA 2XUPA 3D3WB 4MULA 5F1OA 3QWFA 3QVUA 3KQVA 1CQIA 1EQ2A 2XRMA 3RUAA 3ZVNA 3U4MA 4LJKA 4R1MA 5ALNA 1J1IA 2IUYA 3C39A 1Z6QA 1PJAA 1VB5A 3DPSA 3I4FA 4PHHA 4QBGB 2GK6A 2NV2B 3GFTA 4PHCA 2EVWX 2MR5A 3K8OE 2A9OA 4Y6GB 4GE3A 3AIMA 2KMLA 3WIUA 3KOYA 3O5AA 3UXMA 5CEJA 1DIBA 2VJLA 3UWMA 3OX3A 4ZK2A 1FJHA 3KJIA 1GPJA 5TQJA 5TDHA 4DZRA 5AVTA 1CEXA 4KV7A 5DASA 1H1LA 4H60A 4GZ5A 4CT0A 2D8AA 3JVVA 1XCOA 3NTVA 1ID8A 3RREA 1QOZA 3WXMA 1C0LA 4Q9DA 3AJDA 3U0BA 1B42A 1NKSA 3L8CA 4Q4AB 4WXMA 4MRNA 5PNTA 3RVNA 1Q6ZA 2QJWA 4ZO9A 1TPYA 4CMJA 5FTNA 3M83A 5L53A 5IFKA 1W30A 2V4MA 2OSBA 1ZNZA 4L85A 5B3JC 2IOHA 4A10A 3KQMA 2AOUB 1Y7LA 3ONNA 4MA0A 3LGXA 3P4XA 4R8LA 5AJXA 1TKCA 4JEUA 4E0BA 4RO0A 2JH8A 1BKDR 2WKRA 4PAMA 3W5DA 1D8TA 4ER6A 3USCS 4BJ6A 5BWNA 1HE1C 3A4NA 5D1HA 4PAWA 5JS1A 4BPBA 3O83A 1SEVA 5IEBA 3UWDA 1CZOA 3SQWA 2JCBA 4XB6B 1NRJB 3QELB 4LHSA 2J3DA 3DBRA 1EE1A 4B7CA 5C51B 4HDCA 2BBTA 1BGWA 1NQWA 2C97A 5IC5A 4IYJA 1IG3A 3T7IA 5K09A 3DO8A 4LDZA 2YFQA 3OTWA 3PSAA 2FR8C 1M2OA 1P72A 3DKKA 3BCSA 3I6ZA 1YZ3A 1R88A 1M1YA 1X1CA 4UHDA 1A4UA 4OAQA 1IQPA 4C76A 4PCAA 4CLHA 5BORA 5C5IA 1NUPA 2NO1A 3V8VA 4ZDKA 3UWSA 2PXAA 4Y1RB 1Q15A 2BEUB 1YQXA 1N2CE 4R2IA 1JYFA 4OFXA 1I4OA 2IYLD 3ZE0B 2BMFA 3MWLA 2ZPAA 3BBLA 3CM0A 1OZGA 2NTVA 4KSCA 5GJCA 2O5EA 1YS4A 1VE3A 5I9NA 1D5WA 4G5HA 3GOHA 3N0WA 2H7YA 2R6ZA 4OQFA 4BFCA 2ONJA 4F56A 1V5GA 1B15A 5JJ5A 2WW8A 2OESA 5I7VA 3PHIA 3CW9A 5J43A 2ZDQA 1DWPA 2WJVA 4B1FA 3UM9A 1CSEE 2WF6A 1E1RD 1MOQA 2OXEA 2P2YA 2AQHA 2Z1DA 3GEIA 3K72B 2F9LA 2WILA 4XOUA 4ZAZA 5K1ZA 1A1SA 3W5VA 5LYJA 3L6EA 2WTNA 1WLYA 2G1KA 1P0IA 4GQAA 4O2AB 1ZD1A 2XOXA 2O2YA 4TTIA 1T91A 3K8ZA 4BKRA 1Z8FA 3KUXA 6NULA 2ORED 1K63A 3FOAA 1F4PA 3D8UA 3DT8A 1SR8A 4L8VA 3ZKAA 3WYCA 2FK8A 1KVSA 3SJAA 1ML4A 1GSOA 3DZHA 1N4AA 4ADSG 2H85A 1H2BA 2PRJA 2ZAIA 4YLEA 1P1KA 1GN9A 3FG9A 2E7ZA 1GTVA 4Y8VA 5FWYA 1CJMA 3L3BA 2NZ2A 3OOEA 4JP5A 4BNLA 1OBVA 1KQNA 4DR4B 1JF8A 3UOWA 3TEFA 4WLFA 5ALIA 1EDDA 4YIKA 1LPAB 2DUJA 2P9EA 3H97A 4YA6A 1K88A 3QEMA 1GADO 2B4RO 1VMIA 3DVAB 3LXXA 2UYHA 1AZLA 5JMPA 2JGDA 3ECCA 3K9HA 1VA4A 3FVTA 3IA7A 3IEVA 4YP7A 5JH7F 2XDQB 3AR4A 5T64A 1E9SA 1PJRA 3EXG2 3U09A 1DC6A 1QAOA 1P8AA 4TQ9A 3HKBA 4J0JA 1EVZA 2YJ6A 2DBRA 3HO8A 1JFFA 3KDSE 5D5QA 4C04A 1SC6A 3WYEA 3LU1A 4EKIA 2DWQA 3D2AA 4EX7A 3TGLA 2C58A 1CUBA 3EF3A 5IAJA 1CP3A 4Q12A 3HKEA 4JR2A 3R3JA 5A0FA 2B1GA 1TQ4A 1Z0DA 1G66A 1ZGHA 2BSAA 2YMMA 3LY7A 3ADOA 3O95A 3Q10A 4QREA 5ALGA 3A0UA 3V97A 2FPPB 1X80B 2YVAA 1JXQA 4A0HA 1O96B 2VPIA 1B2RA 2PWPA 4X9XA 5LP6B 1HOXA 4BVHA 4NESA 4RETA 4K26A 3VPAA 1WDLA 4DGSA 1NJ5A 2GH1A 1QP4A 3CVWA 4OFWA 2BGLA 1NW7A 4A8HA 1RWKA 4Q7JB 4ZT3A 2AZDA 2IZZA 5IVIA 1GG5A 3QTBA 3RW9A 3A8TA 5EXXA 1TZCA 2NNWB 3I9OA 1WULS 1HKHA 1UK6A 3L8DA 3NBFA 4B74A 3OX1A 3PIRA 5G53C 3EDMA 5AHXA 4BX9A 3ZLJA 2C4KA 2XE6A 1N1MA 3NH9A 1IJKA 1EUCB 2ZYAA 4HRXA 5A9SB 2XQKA 5A9RA 1U9YA 2J07A 3O4HA 2VK8A 3V4SA 4D0LB 1XNHA 2GJSA 3B9BA 1OH7A 1DG3A 1MNAA 2GAOA 2VTBA 4IGEA 3N7AA 3GT7A 3AP3A 4BYMA 1H3FA 4JVLA 2AZTA 4Y2QA 3UHOA 4AI6A 2Z09A 3F5QA 3WP0A 5LQAA 4JOSA 2J8ZA 4JI1B 4AP9A 3EIWA 4KV9A 3G2OA 3RQIA 1WMEA 3SVLA 2PGAA 2YZMA 2JCVA 1OXTA 1P6QA 3A6FA 3FJYA 3OIDA 1AY0A 2B99A 3Q1KA 3F49S 4P4GA 5E9AA 4AQ7A 5AUQA 2BKAA 4C0AC 3BM5A 1XYYA 2WYWA 1R27A 1PK9A 3F97A 2H2DA 1FP1D 1M7BA 3BUSA 3PP8A 3DZGA 1EWYA 1LPOA 4KMSA 4ZVKA 1NZFA 1VJ1A 3OCXA 3RF6A 2QN3A 8ATCA 3FVRA 1NNEA 3BC1A 1QDEA 4L2IB 5JZOA 5CB4F 5CHYA 3BXFA 5KTKA 4IHJB 1IMJA 3UXHA 2WP0A 2NACA 4LECA 5ITZA 1GAEO 2GVNA 1AKUA 4GYYA 4UHBA 3ZLBA 5KOHB 1E7MA 2YXLA 3KXDA 4MPRA 2DM6A 1BH6A 2C95A 1U11A 1ZUIA 1NBOA 1TUBA 2WF5A 4RK6A 2L18A 5KYGA 3FOEC 3LWDA 1EDBA 2XCIA 1DQYA 1TVCA 4BIIA 1YQTA 2ZUDA 4DXHA 3E5RA 5DSXA 1GYPA 4ZT5A 5CLJA 4MUXA 2IYWA 1ZBDA 2RHHA 4CKWB 1EXMA 4AROA 1E3QA 3FWHA 3OJOA 4ZVOA 4GT1A 1C7QA 4QGFA 1YFJA 3D6FA 2W2KA 1P3DA 3NWJA 3F5SA 2X0IA 1H5NA 3ABRB 1X7WB 3KQQA 1J49A 5K3OA 1XZBA 4W9NC 4EG5A 3GHHA 1FRVA 1YD7A 2ZWVA 4Z0TA 3M2TA 1GA4A 1R6AA 4BZQA 1RXVA 1NDHA 1VL8A 1BYUA 1C5KA 3EB9A 3NI2A 2VP9A 2HK8A 4P53A 2IWRA 3W7BA 2HTEA 2PV7A 2V9ZA 3P26A 2YJTD 2ONYA 3PPVA 2J3QA 1GZ7A 5CM8B 1GQFA 4D82A 3DAGA 4OI0A 5FTJA 1Y3AA 1B16A 4OK3A 2Q7OE 3E1SA 1GOTA 3ZE6A 2GX6A 2BP7A 3RTAA 1CLEA 1JKFA 1TW3A 1T25A 2VSQA 3NT4A 4HL6A 2WHPB 3JQAD 1YRAA 2FZGA 3AETA 3EUAA 4HB3A 5F4BA 1D04A 2L42A 1QX3A 2V6BA 4IOJA 1O6FA 4UNIA 2R48A 1GUFA 1ODFA 4ZVPA 4OSEA 1A8QA 1RJGA 2FW1A 1H85A 1FDSA 1I4EB 2H18A 2HCFA 1PLJA 4QO7A 4RV9A 3WLRA 1HZJA 5FNZA 2XD4A 5JO0A 1QR6A 1F2UA 2ZULA 3CUVA 4PNEA 7GPBA 3VNVA 4OHZA 1EZ1A 3WIEA 9GPBA 5AJWA 4JLVA 2V7XA 3IB3A 2WJAA 1ZXBA 4CKEA 1O5TA 2VPXA 1ZU4A 4FCTA 4PLHA 2A5FA 4GSKA 4I9UA 1TYBE 3KJQA 4TV9B 3GLRA 3BDIA 2V7QD 5EFOA 1MAUA 3PGXA 1CR0A 3Q6IA 2WUEA 1FNSA 3ANMA 2EWMA 2ZKLA 1DZ3A 2D00A 3MOGA 3RR2A 2DPYA 4ZJYA 1XTKA 2HYIC 3M5CA 3ENVA 4UFOA 2JFPA 4CEIA 3OCVA 1KMQA 3QMVA 5JSKA 1YZGA 3FRIA 3TOSA 1G5IA 3AQ4A 4ESEA 2O8NA 4O5AA 4TKMA 5BMVB 4MWBA 3JS5A 4MUHA 3EDOA 5E6UA 4PYOA 1BXGA 1WZ2A 4YHHB 1S3GA 5HKBA 2BFWA 2C4WA 3LT4A 1LQTA 1NP7A 1ZGZA 2GEJA 3K4PA 3NVAA 2JFNA 5AICA 1DU4A 3IEMA 3IOEA 2QY9A 4K1XA 4WCFB 3HNPA 1O97D 1V7PC 1PV1A 2W2NA 2X7XA 1RWNA 1TJPB 3BIJA 3FSEA 4FGZA 4ND4A 1H4VB 1KDZA 1APBA 5A04A 1UXOA 2PKCA 4IDCA 2FCRA 3O2QB 4EATA 2K2WA 4NARA 5A5DA 3M6LA 1N6RA 2IELA 5DBIA 3ND8A 4IMPA 1BJRE 3D7KA 2BEWB 4ZQHA 3T3DA 4A15A 1CYEA 3WJ1A 4F5DA 1P2UA 1VSBA 3TNDA 3THXB 1SELA 3VKHA 4IP0A 4D1YA 3OQPA 4QXAA 1G19A 4UD2A 4DCSA 3JPWA 8ABPA 1R6VA 5FUQA 3L92A 1VCNA 1GDDA 3HYRA 2IP2A 2JKYA 3PBKA 4KRXA 1N36B 3KZNA 2OOSA 3CX7A 3DZJA 4QYIB 4X8OA 1JILA 3JD1A 1HLFA 1YZTA 2C3PA 1OX4B 3QUQA 4FFVA 4MVJD 1ZIYA 1UBMS 2P9FA 2X9QA 1K7CA 1U7UA 2XKBA 3OIYA 4PR3A 2HM7A 3H17A 3MIIA 4R68A 1KPHA 2OD9A 1MO2A 2PSEA 4PSKA 2VK4A 3E2MA 4D3YA 1QO0D 2IVFA 4GL4A 4ZYXA 4DCGA 1KXJA 3ZW7A 3LO5A 4E03A 1NG9A 4DIUA 1FLVA 4O1IA 3IUEA 4E7PA 1M0EA 2QP9X 4EJ2A 2JBAA 5ADHA 3HVJA 3B6MA 1MU0A 1OTYA 4JLUA 3EGWA 1RLJA 3LV8A 3IBFA 4E09A 2CJWB 3D6AA 2FSHA 4S1VA 5CXXA 4N3BA 3UZUA 1M6YA 2EEPA 1MPXA 2JATA 3OX2A 1OXUA 4WZBA 4OB6A 2ZE6A 3K16A 1UDRA 3H5RA 1VKRA 4AMBA 2Q5IA 4PC7A 5F35A 2ECKA 1KOFA 2X5KO 5FOWA 3K0CA 4DZZA 4NX2A 5PGMA 2VEOA 5IUJC 2HQRA 1Z73A 1AMOA 4TVBA 3K15A 3OFKA 3TBFA 4I66A 1EM6A 5JBNA 5JNSA 5COBA 1ZJ4A 4QGBA 4AJ9A 1SBCA 2W6PA 1GUAA 2YIVX 3WK9A 4D4IA 5IAOA 2XMSA 2YWJA 1BEEA 4TTSA 4C9BA 1QKJA 3QVVA 4JCCA 1L5SA 5ALPA 1G5HA 2E3JA 4J29A 1VPTA 5DNEA 2Y1XA 2HEIA 4JOCA 4QELA 3RVBA 3C7DB 1NT2A 1ZUWA 4JASB 4CBVA 4UDXX 4HEJA 4O4LF 1X42A 2I1VB 4INZA 2WV9A 4ZO8A 2CEAA 2Z9CA 3K5WA 1QE0A 3OD1A 1NF3A 1Y8QA 2P67A 4URHA 5F2EA 2DBZA 1ZESA 2W2OA 1TCVA 3H65A 3OO1A 3OZFA 1A9SA 4YI3A 1D6MA 3ZLVA 1FF9A 2C7QA 1G8FA 3CXRA 4XDZA 2JAHA 5JECA 5REQA 4ZV9A 3KKEA 1TKAA 3DKRA 3QITA 2O8DA 2IXEA 2WBLC 4ZPXA 2FOLA 3MJVA 4NBNA 1S0UA 5EMNA 4RIEA 4ZI3A 1ZO8A 2FWAA 3BF7A 3ESXA 1V96A 3RABA 1PR2A 3CGWA 2Y1DA 1P5HA 3CUSA 4WFKA 2D59A 1M5RA 2CY0A 1BRMA 1FFGA 3QVGB 1BWSA 3K5HA 3RWOA 3DXYA 4H27A 4B2LA 1EB9A 1KDPA 1Q17A 2VRCA 1KNXA 4FBGA 4FWBA 4P92A 3UY4A 1RYZA 4A2QA 5KQLA 2B20A 2FTKE 1ID1A 5AYVA 2AI3A 3LQRA 4EY7A 2PX0A 4LXGA 3B6JA 2P75A 4C6TA 5JWOA 2I2AA 2UUOA 3AP1A 3IT0A 4ZD6A 5HDQA 1IOWA 3L84A 4YNBA 4RY0A 4GWLA 3GYBA 4DMCA 3PNMA 3HGTA 3SQDA 5KNBD 2J9RA 1GA1A 4Q82A 1KAQA 1QRAA 1RNLA 2WPDD 2QGZA 2WU3A 2KPOA 1FYWA 1XRPA 4MMZB 5F98A 1GFWA 2JBAB 4ES6A 1Q50A 2OCGA 3G0BA 4OQ4A 1E9AA 4H7KA 3JVUA 1R1DA 5KDDA 2HWYA 1GZSA 4HGZA 1R4ZA 1E0DA 2PT5A 3KOMA 4PX2A 3HXPA 1J5PA 4ND1A 3CN7A 1OVGA 4LCEA 4P5EA 4P5DA 3KJZA 5A71A 4X92A 3DCIA 5LCXA 1Y1SA 2IJGX 4FYKA 3N2LA 4CL2A 1N0UA 5CDUA 1ADFA 2BCJQ 1CQJA 5BXYA 4UVIA 4UEJA 3R41A 4GI7A 1IY2A 3LPAA 3P2OA 3IBSA 5AW5A 1ZKDA 3RRZA 2XNKA 2KSQA 5B3LA 4DRYA 1IUNA 2YICA 1U8YA 3FY4A 5FQNA 2YY7A 4XJTA 2I55A 3B85A 5TT1A 2Y0EA 3QOXA 3TCKA 2I6UA 1CQPA 2D7JA 5AUNB 1ECPA 3OURA 2ZBEA 1VE6A 1W5TA 1Z5GA 3DE3X 2R60A 4A5OA 3GVCA 2IWHA 3U44A 1Y89A 3ZHRA 4CYMA 2DOKA 2N3ZA 3KTAA 3UIEA 5JOQA 2D74A 4JLNA 5ETJA 4M7PA 5AH0A 4YQEA 2WJJA 5B1EA 4RJIA 2V7BA 1OFVA 4X8HA 1ZVMA 3M1LA 2V7QA 4N0PA 3BCHA 4UM9B 1I2DA 1F2TA 1K8YB 2R6AA 1NJ1A 3I2HA 3S81A 1M2FA 2AMLA 4Q1BA 1SXJD 4AAYA 2JFBA 5AW0A 1T4MA 3W5BA 4W1PA 2FI1A 4Q0MA 5DXAA 5AXAA 1XB2A 1QYVA 5HJ2A 5H9WA 4KE8A 1FUYB 1N8KA 1XVUA 1WP9A 4XASA 3H0EA 1ILWA 4EB3A 2W4QA 5CB4A 4Z4QA 1P62B 3FHLA 5AP9A 2JCXA 1HYBA 2O8DB 4HADA 1N3YA 1NBIA 1UBEA 3UJNA 3U62A 1XA0A 3ZV5A 1JTVA 2XIJA 3I6BA 3OLZA 1RWQA 3ZGVA 5FO0A 3DEIA 3CTPA 4ZVVA 2H2GA 1T2DA 2PPVA 4DDUA 3FN4A 4ZVMA 2FG7C 3I30X 3PE6A 3ZXYA 3TI7A 4EWLA 3DOCA 3EEIA 4NBUA 1IDOA 3VVBA 3PFNA 5TB5A 1DQSA 3T7DA 4D2IA 3Q6MA 4V0NA 2ZQZA 3TG8A 4ZTZB 3EZGA 2ZATA 5HFAA 4EA8A 3HO1A 2CKMA 1NPDA 3BAFA 2AXEA 3N3BC 4F0JA 1JDPA 1MDFA 2ORYA 3C6MA 1NYRA 3L0CA 1N9ZA 1XLUA 1YZFA 2CJXA 2JFWA 3CN9A 4IGKA 4C7MA 1EVQA 2YQ4A 5CDGA 3TEMA 3WRYC 5IJZA 3AP2A 4LYJA 2BDUA 2FE4A 1DTWA 5FUYA 1KEPA 2GKOA 4D56A 1P39A 4HN9A 1K89A 1A8IA 2GUGA 1ACJA 3O1LA 2B5OA 4IMRA 5JDCA 1AMNA 2O52A 4GKBA 1JVNA 5DTMA 3CLTD 4HGQA 4J3FA 2A1IA 3GJ0A 1J23A 1JR3D 4R2LA 4YP1A 3SZ3A 2DKFA 1NQAO 4C5AA 4FEYA 4MV1A 1K27A 2X4IA 2X0KA 5FBLB 4BMPB 5KYXA 2D0DA 4I55F 2DULA 3C5EA 3CH7A 3EGXA 3KZXA 3O2NA 2X2FA 3VOTA 4HQLA 1I6WA 1U3FA 3AL2A 3GA5A 4WGFA 4I50B 4ZEMA 3PE3A 3LKBA 2J7KA 3P7MA 1UDXA 1GWNA 5JZ9A 3SZMA 1EX1A 3TKLA 1K2WA 2VJPA 4P6VF 1A72A 4JB2A 4R0VA 2PRZA 3VHQA 1C7EA 1FDWA 2AMYA 3HC7A 4YP9A 4FIZA 3RFTA 3L6DA 2OGSA 4PX9A 1NBME 3KC2A 2W2LA 5JCXA 2FKAA 2RGGA 4CWAA 4MTCA 4XFDA 1DPGA 3NEYA 3LI2A 1G9SA 1QGUA 4ZRDA 3BMNA 3AR8A 1PZGA 4FX2A 1NBAA 2A94A 3T3NA 2EL9A 2G8NA 4MYTA 4CKXA 3LX4A 4I9NA 3NJRA 2OXIA 4ZYYA 1WRBA 2HNKA 1WMAA 4PWYA 2IHUA 4QHYA 2IOFK 3SNHA 4OKNA 3FHOA 3T5PA 1V0JA 4YB8A 3CWZA 1U1EA 4KI0A 3KT6A 5TEVA 1XDSA 2YWEA 1KJ8A 2R62A 1XMSA 1U6IA 4NDNE 5DPMA 2X6QA 3VISA 3MA0A 1RWVA 1GZVA 4O0LA 3AGPA 3IAEA 3QE3A 4TLBA 5B3JA 1U2DA 2BC9A 3H8SA 5JCJD 3TW8B 3V42A 4GPZA 3OQOA 1A9QA 3W0LB 3JWHA 2AC7A 5FUWA 3ESAA 2E4XA 1EI9A 1VL5A 2OORA 2RCYA 2YV1A 3IOYA 5LZ2A 1O97C 3ZJUA 3TZCA 1NZDA 5CPFA 4U2DA 5K5EA 3B9PA 1C8VB 2B6HA 1SBNE 4NV0A 4DMKA 4W5RA 1YVRA 4X6LA 4LHWA 5E8JA 3DB2A 1JVSA 1KDVA 3T3PB 1NJ8A 3RJMA 3DONA 3C7KA 1T6XA 4PLGA 3EPRA 3Q5DA 3FR8A 3N8IA 3Q7IA 1SCAA 4GYKA 4PZUA 5AKYA 3HP4A 4DS3A 1U0BB 3RUHA 4G4SP 3NX4A 3UG6A 1V71A 1LU9A 1IY8A 2BM9A 1I0LA 1HFEL 5AUPB 4HATA 1GQYA 3T7KA 3SLKA 3L2OB 1GP2A 3I0MA 5CLFA 2PXHA 3SVTA 4WE3A 4BB6A 5JSUA 4QRIA 5KYXB 4QDUA 5KJEA 3ZCXA 2RI0A 2PDAA 3A9SA 2Q3DA 2ZRFA 2X4GA 2O9JA 2WM3A 2BF4A 4JXKA 3P96A 3W04A 3SN6A 4A0FA 5CD9A 3WNDA 4ZVUA 4LHEA 4MW0A 1CZRA 1ZH2A 1WB9A 1IZ8A 2XODA 4J1SA 1H05A 2AWOA 4B31A 1ATIA 5IT5A 2G9NA 2GERA 3BE4A 1FY2A 2IPNA 3CRVA 1VZ2A 3I1IA 3I8SA 5EZYB 1JAYA 1TA4A 1SUPA 3U7FB 1B8NA 3RTCA 2I9PA 2NZUG 3ZWKA 1CEEA 3ABZA 1G21B 1QRRA 3CPSA 3I92A 3ROPA 2QTBA 2YUTA 1CUFA 3B1WA 3KVVA 2Z2IA 2D8MA 3CLRD 1NVTA 1U02A 1W0KA 3THYB 3L7JA 1QVVA 2PYZA 4G8DA 3H1AA 5C1DA 1KI7A 1KVTA 2C3YA 4DT1A 4DR7B 2PX8A 1KP2A 1U8FO 3A36A 4J2OA 1P44A 1W52X 2QPTA 3OQIA 3ESYA 3PEVA 4ZCIA 1VBKA 3U3XA 4FEGA 5HKAA 4RKWA 1FYDA 2ORWA 1N2XA 3AHGA 4H4EA 2FUG6 4NABA 4GLLA 1WU8A 3UHPA 5F23A 2QMZA 1FXUA 1JU4A 3JQFA 1V8ZA 1E4OA 2L19A 1N1EA 3FRJA 4A92A 2NN3C 1FYXA 2C3MA 4TSFA 2QP4A 5DT9A 1YVDA 2EKZA 1COWA 3VTKA 4LXTA 2FX3A 4ALIA 2V7EA 3OA0A 1X80A 4LJAA 1CIJA 1MZVA 3ONVA 2QQ0A 3KO8A 4YAJA 3PLRA 3JRNA 4TZTA 3LUGA 3OU6A 3R0XA 2PO5A 4GC5A 4OUKX 4A16A 2WE7A 1Z0FA 2KLHA 1KJ9A 4GDMA 4F5YA 1WXGA 4YT4A 2E1PA 4AWXA 1WCIA 2IZ6A 4QX6A 3D3EA 4EW6A 1OAOA 1LQ2A 1MT0A 2X76A 1DIGA 1RCFA 4MGEA 1YBHA 4PSAA 5K51A 5HOQA 1XMQB 1FZQA 3SQNA 2R66A 4BMSA 3H4MA 4HAZA 1AQLA 1YTUA 1LF5A 1M54A 2FWIA 2JAOA 3OHSX 5BNZA 1JWLA 3KB8A 1GR1A 4E5KA 3A9CA 1VE7A 2EFHB 4Q9LA 3I1YA 1JJIA 3H9CA 2EC5A 1UM9A 3A14A 1BE6A 3RHFA 1QORA 1ULHA 4K03A 1C29B 1TCUA 5BSKA 5BSTA 4OGGA 1PR3A 3AEZA 2IGTA 3G2NA 2JKZA 3VR3D 1NNLA 2I1LA 4QLAA 2ZREA 2C4TA 1TLFA 3KEFA 2P9YA 3AKDA 5B64A 4RVUA 4G0MA 2A59A 2OG2A 1ONBA 4RY8A 1NASA 2IODA 5DN6D 1JL3A 2XF2A 4TUYB 5DB4A 3CSSA 2DH6A 2VYVA 1ZUHA 1YBFA 2C2ZA 2HHLA 2VI5A 4FFBB 3EXHC 4OF4A 4Z9FA 1L5HB 4FGSA 4XQ0A 2DUMA 3REOA 2HBZA 4YUWA 2WJ4A 1T5IA 2BR5A 3EXIB 3OJXA 3HL4A 5I9LA 4P7JA 1TM4E 1DBSA 1CEQA 2O2DA 2W58A 3ET4A 1KMHA 2LE0A 4UNPA 3DEFA 1F6DA 2QL5A 1ZMTA 2E6KA 3UH0A 3SI7A 4FJ2A 4BFSA 4GRAA 3ZDYB 3I9V6 4UMDA 3P9NA 5B58T 1MTZA 3CNEA 1CJKC 2O3JA 2R6FA 4JQSA 3KPWA 4K6FA 4O4HF 4WY8A 4ZT4A 4AJNA 4EUEA 5BR8B 3VO2A 4I2NA 1X86B 5G0SA 5EZ5A 5BURA 5WRFA 3ZGZA 3OTQA 1A27A 3R4VA 1OLOA 1DBPA 2BM8A 5AOCA 4JELA 1U8AA 2NSJA 2W98A 4DRXB 1QZXA 1V7ZA 1VYHA 1TMOA 1LDGA 4HWOA 2P2NA 1J0EA 3DMYA 1NC3A 1KZ1A 1E5QA 1QPGA 3RYIB 2QS9A 4RJLA 3OI7A 5FBVB 3NU1A 5A05A 2B8WA 1PDWA 2H1IA 1A9YA 2F2TA 2XUDA 2ZVDA 3BICA 3NR2A 3PA6A 4RADA 2ZTSA 4UD6A 4F6CA 4LRUA 1XTIA 1GNSA 2H1LA 1YL5A 1NJ2A 4GGPA 3CNNA 3IA2A 3GJ3A 3JZMA 4AUMA 4E5VA 3AOEC 4EMTA 5A9SA 1P91A 1URPA 2A5GA 3L01A 3JR7A 1SVMA 1Z4MA 4H1UA 4O3FA 4I81A 5EHIA 1ZLXA 2YMQA 2QGFA 4ETIA 2B1QA 2VHYA 3MWJA 2BGTA 4GU5A 3GLFE 4EKNB 4LXXA 1TM5E 4KDEA 2XZPA 3UMRA 3ZVRA 1OV4A 3YASA 5CK4A 1D6SA 1AKRA 2PZKA 3P0HA 2X0EA 4Z1OA 1MC8A 4UCXA 2C2WA 1Z06A 3GVIA 3A3YA 3JCZA 4LNUB 5F7OA 1NI5A 4KR9A 4S2EA 5IM4F 3AVPA 3R6LA 1QZTA 3IAS6 4HLQB 3RTBA 1YR3A 4PNHA 3IE1A 4REMA 3REFA 1JT2A 3F78A 4A8JB 4O08A 1GL7A 5AI6A 5L6LB 4TV8B 4X6YA 4ZN6A 2GN0A 2GF0A 3OQVA 2KM1A 5LB4A 2J4DA 1YS6A 3UWOA 3F9IA 1Z28A 5FA8A 3U5ZB 3QVJA 4E6EA 5KOIA 3VYSB 2RKWA 4MA5A 3R7FA 1F51E 4OBBA 4RGBA 3V7FA 3PQ4A 2FCAA 1RXEA 1XTZA 2Y66A 1NULA 3K35A 5J5VA 2X8AA 2P41A 3QEKA 5D86A 5HGJA 3WGLA 1EGQA 1J9GA 2JARA 4GLFA 5CA0F 3TNYA 4FK8A 5E3HA 5KOJA 3CX4A 4KQXA 1ZY2A 2ZRKA 1H6AA 1FVOA 3QV2A 4OYLA 3T3GA 1WV1A 3B78A 1TO2E 1UK7A 1PV4A 1H3NA 1EWRA 2XUKA 4BUCA 4RZHA 1GGNA 1BVUA 1GU1A 1ZR2A 2ANBA 4JJ7A 2COEA 1IWBB 3I8OA 4WLVA 5IAAA 3FPSA 2XGMA 3BFVA 3EAGA 3RUCA 2OA0A 1MCZA 3HYTA 3DF9A 1KSHA 3UB2A 4DLYA 2J08A 5L7WA 1NP6A 3KYCB 1DKUA 4ZAVA 2HADA 2H3EA 3RNOA 1KSJA 5F7XA 1J5XA 3CZQA 3RK1A 1RPTA 1SK8A 1T4CA 2CBZA 1ZOPA 2EP5A 2PJDA 3OAAA 5C8YF 2XUGA 2JVIA 3SAJA 5BMVA 2XE4A 4YJDA 2J9FB 4UEWA 4JLWA 4MQBA 2P2CA 3QVMA 1BOFA 1L7AA 1XDGA 1YO6A 3GN1A 4WBNA 4QASA 3WGOA 4CM6A 2GJKA 4EZIA 1IZ9A 1WPRA 2WKPA 1K6IA 5JU6A 2QN9A 1DC7A 3VZQA 1DMSA 4LBZA 3F96A 1HG0A 1I5OA 1KAHA 2UUPA 1GPLA 4QEKA 4QPJC 3F6SA 1MIOA 3H7IA 3RV3A 2DC1A 1J0DA 1X1TA 2Y67A 2YOGA 3KT8A 1A5TA 2YXBA 4BFLA 3BK1A 3WSVA 5LMCA 1I32A 4MQ5A 4OKSA 1HDOA 2GPNA 2FR8A 3PUZA 4JLKA 4X91A 5LMUB 1NXQA 3EMKA 2B34A 3PQCA 4KVGA 3G7UA 2QQEA 4UZFA 4NPHA 4PYIA 2PCLA 3T12A 3ZE1B 4DHEA 1ZNXA 2GEDA 3BSFA 3FYCA 4FQ5A 4RFVA 5F3WB 2RJNA 3R3YA 4LX0A 2XYVA 4WNAB 3CWCA 2HSWA 1IIRA 3FBWA 5EHQA 4A0QA 1NV9A 3JQ8B 1PFVA 2P9GA 3LCCA 4W7HA 3LBHA 1KJIA 3OPXA 4M0KA 4K6MA 5KNDA 4Y0AA 2UXDB 2Q49A 1KZ4A 3F8SA 1OC4A 1SMKA 2VYFA 2JVKA 2RDMA 1KIFA 2QK4A 3ORYA 1I9CA 4P22A 5SZKB 4WOCA 1S2NA 2ZIZA 1NSTA 3QNWA 5DDIP 1AO0A 2J85A 1DEHA 4O2BB 1Z6TA 5BQ3A 3AW8A 1UODA 3HQ4O 2OYCA 3U4AA 2HT1A 1H66A 4QYSA 5JCZA 1IXZA 1ULTA 4J07A 5KDOA 5AVOA 2ZUUA 4G36A 3C3DA 2PGJA 2HKIA 3B1VA 2PUCA 1SUDA 3FDIA 3I9KA 5LPNA 4D44A 1LFDB 1S96A 1QLHA 2WMNB 4COOA 3PRKE 3GL9A 1I6MA 4C3ZA 3HBFA 3M82A 4AVYA 4LF7B 3ZNOA 4GAEA 5J40A 5LOVF 3AJRA 3FYUB 5I3CA 3JAKA 5ESRA 3DMHA 2Y1LA 2CUTA 4QPZA 2GXSA 4RV5A 4B3HA 1YGYA 3L06A 4NU0A 5JNVA 1SCUB 3CF4G 4GGMX 3V2UA 3C1AA 4FYXA 2YIDA 5ED0A 4JR1A 3HU3A 3HDJA 2JGIA 5ESWA 1TJ4A 3ZHTA 6REQA 2CUNA 3H3JA 2AZ4A 2H2WA 1QRTA 2P27A 1U3DA 1QXSA 1Z36A 2H6EA 4RW0A 4H08A 3ZJVA 3UO8B 2VP6A 4WGGA 3V8MA 3HDVA 3ORRA 4KXWA 5E3IA 5EJ8A 1W4RA 1OZ0A 5AK4A 3RBZA 1CUUA 4BMDA 2WUGA 3LDFA 3OLQA 5DRTA 2PE5A 4EHBA 5CNJA 4DNXA 4FNGA 2GJ4A 3E35A 5T6MA 5DGXA 4RXTA 1JXAA 4C0LA 5C1IA 1E1MA 1WZCA 4Y2YA 4NH4A 1I4WA 1YBVA 3JX9A 1E2PA 1C9NA 1KJZA 5D87A 3ZQ4A 5HZHA 4YREA 3CLUC 4GQBA 5K0BA 5FPTA 4YO8A 1MABB 1V3VA 3DWGA 2NU9A 3QYPA 4ND7A 1F06A 1E3DA 1NY6A 2O2CA 1NTOA 3PYMA 1UBGA 4X5OA 4ZJPA 3PVSA 2NXCA 3S2UA 2HJGA 4K5QA 4PLVA 3WIBA 4HMQA 2M1XA 1UJCA 4LE2A 4KYTA 4UATA 2R65A 5CDTA 2ZOSA 1GKYA 4A9AA 4DJJA 5L4NA 1TYCA 4ZYTA 5JRZA 4J7XA 3CPEA 2GFQA 4JN6B 2VAPA 2GR9A 2QA5A 1E5LA 3JR3A 4Q7EA 1UJBA 4AZ0B 1UIRA 1I3MA 4MV0A 4C30A 5MN5A 4OHWA 2WYUA 3WBJA 3E18A 4G1UC 5ALZA 5EG5A 1IRXA 4HDAA 4DREA 1KK3A 3S2YA 2P2ZA 5K2OA 4FFRA 3AGQA 2IA5A 2PD4A 1QH1B 3CKYA 2Z6AA 3CRMA 3QJYA 4ND8A 1Z6GA 1U7HA 1BDMA 1OE0A 3E8MA 1I7NA 1U9IA 5IJWA 1CE8A 4LXHA 3RRFA 1PJCA 3GGCA 1B76A 2D1YA 1E18A 4P81A 2VRBA 3SSAA 4C6HA 4YCJA 2V1XA 5FYDA 3AIOA 3NMUF 1UXKA 3QIVA 3RGGA 4WKGA 2GN9A 1D4ZA 2QTVA 5H68A 5EQTA 2QAGB 4EG3A 1Z8DA 4L4YA 2ICAA 3KPJA 3B7PA 3H3XA 4LJ4A 3UKDA 2ZJFA 2G9RA 3RSGA 4ZMSA 3U6BA 3ZKWB 3RS3A 2WZDA 4M86A 1NBEA 3OE1A 3PUHA 1ETUA 4WAUA 3KUDA 1R4AA 1JA1A 1TJ3A 3GEHA 3H2KA 4G0YA 3VU9A 3OPVA 4V0KA 5H9VA 1C7FA 5LD2C 1MNQA 1RHJA 2QD4A 5A7HA 4GM0A 3NIFB 2VJKA 4F2GA 5FIUA 5ALTA 4RTKA 2LTAA 1SEPA 3QM1A 4NEQA 3KAKA 1AGYA 4KC0A 4G5QA 1M6EX 2QX8A 2HN9A 2QUIA 2YYAA 3JPYA 2W0MA 3WRXC 1H6BA 2P0AA 3KG2A 2M1ZA 1CRWG 2Z56A 3VR4H 4OQXA 4CM4B 5IVHA 3F74A 1Z37A 5KSPA 3PB3A 3LWZA 4BNIA 2RIRA 3W9SA 3HG7A 2J33A 4NR0A 3QE2A 3CRQA 4HG2A 1DG1G 1OREA 1ZGBA 4JWTA 3LHKA 3AHEA 1L1RA 3PGVA 3I9FA 3WFIA 4R0MA 3EGOA 1JLSA 1NVXQ 4PINA 4BO1A 1YQWA 4P0PB 1A8HA 1ZK1A 3ZS9A 2Y76A 1PGJA 2EZTA 4PYMA 4RFSB 4E12A 1P0CA 1UEXC 2H1RA 4IQGA 3IAUA 4RM2A 3F1KA 1ZEMA 3NTRA 3FFTA 2IKSA 1H22A 4NENB 2XTZA 2JGDB 4O2AA 1XV5A 4QUEA 4F97A 1W2HA 4G86A 4C3OB 3FZGA 1JAIA 1CZKA 3N53A 1KMIY 2JANA 4F4CA 4I1PA 1JFSA 1JBKA 4I9FA 3IBYA 4OFZA 2QMYA 4NC9A 5FI0B 4CDMA 1D2EA 2FWNA 1S4MA 2GARA 3ASUA 3B3JA 4QOIA 1V7CA 3EFBA 3FMFA 3TQIA 1Q0QA 2W0SA 5AI4A 2BTQB 4PQYA 2X22A 4Q18A 1ISMA 5JPIA 5HM8A 2FJ0A 2F8MA 2D2VA 1XVTA 2AG8A 5F9FA 1QHIA 3M6AA 2OXFA 1CNEA 5JCOA 5BWOA 1OU0A 5BVGB 1C30B 3PYXA 3ZYCA 1M2KA 1KYZA 1KDTA 1CUEA 1CUDA 1IH8A 2XECA 3E53A 2NXJA 3RT9A 4XSGA 3AFNA 3RSLA 5IBPA 5IYZF 4GR9A 2ZRDA 2BLNA 3GT3A 3L1IA 3EIUA 1NMXA 4MVJG 3GYGA 1XU9A 2GXQA 2Y05A 1TEVA 3ZHOA 1GXSA 1JV2B 4UDYX 1ADYA 1UMDA 2NOAA 2ZYUX 3SY8A 4IDFA 3FPKA 4F3CA 5FV4A 1C14A 3M7IA 5G41A 3WYNA 4NH0A 2PN1A 3MELA 1FFWA 4FJ0A 2ISQA 3OESA 5AW9A 3PE4A 5TPZD 4X94A 3HI4A 1YNOA 4Y1GA 3RIEA 4WPGA 3JALA 1SUIA 3AVOA 1ZH4A 3QXJA 4BQPA 3QK7A 1WUHS 1P75A 2GZRA 5JQGA 1FPMA 1XAGA 2RH9B 4RD6A 5KJCA 1AO3A 4U6SA 1TMYA 3E70C 4X44A 5JHHB 1N57A 2E0IA 2BFDA 4RDXA 1BN7A 2OZLA 4N82A 4YLGA 2XBLA 3VUFA 3KZOA 2IZ0A 4CLOB 1BWRA 2O3TA 4Y1RA 4D8UA 3MAAC 3O3MB 2CYBA 1K6XA 3OCYA 2EWWA 1EZZA 1D07A 4KBGA 4M1ZA 1M5UA 2BMAA 1JFFB 1DJLA 2C5BA 2ZRMA 3C8HA 1BVRA 3L0ZA 1TCCA 3C3BA 3DE2X 3U56A 2H7CA 4PWZA 1DUVG 3LQQA 4QE3A 4H9GA 3JD0A 1VZ3A 1JG7A 3F6PA 1CUCA 3COZA 2LD4A 4G5OA 4G84A 4LE0A 4WFJA 5CIWA 5EMKA 5FOQA 1NQ5A 2GSDA 1K7YA 1KPIA 4FONA 4PYRA 1JQ3A 3CH6A 1MXFA 4JUIA 5DO9A 1XTTA 4NKRA 5C8XA 4NJMB 1SFRA 4KTVE 1DTEA 3TZKA 1V1JA 4CKZA 1JKIA 3COYA 1T6ZA 2VTVA 1EFKA 3C3EA 1V43A 1D1TA 1JZTA 2II6A 1J07A 1ESEA 3H9BA 1QQ5A 2R84A 4Q9HA 2L2QA 4CI9A 5F52A 2AOTB 1ENZA 2X8BA 3KD2A 4NZ9A 1J22A 3HCPA 2RGRA 3VKGA 3INNA 3MJ4A 2AEFA 3Q9LA 4LC9A 3UMFA 2NXNA 2J59A 4G2TA 4N40A 3IPRA 1G64A 4ZI7A 2DQSA 4EHJA 2ENWA 2EHJA 4G0OA 2EKPA 1SJ9A 2D5AA 2MT9A 3RD5A 5L3ZA 1DVRA 3LS2A 1N1DA 2C7BA 2QSJA 3HB7A 2XDQA 1Z16A 5ESXA 5CT9A 3N07A 3ZWVA 1NRWA 4TSRA 4Q4LA 1U3TA 4QPPA 5JAQA 2DP4E 3NETA 1DKMA 4IEIA 3VSEA 2NVUB 4B35A 4TKVB 1IN5A 2AI1A 2OC9A 2PA3A 1Q0ZA 4PZPA 2PUAA 1L7NA 3DL7A 3WB0A 1ZGAA 2OV1A 1T8RA 3P9XA 1G21A 2PX4A 2EBHX 2H4ZA 1PSDA 3K0EA 4P0TA 4XSVA 3WGHA 4BGDA 1XEFA 1ORTA 2J48A 4Q9JA 4LNHA 1KAOA 3AG5A 4IDPA 2UVPA 4ZODA 4B2IA 4M6WB 3HN7A 3U48A 5KTTA 3EY9A 4DJTA 2Q1XA 4LV8B 3SHVA 5EJMA 1QF9A 3SIPA 3I2GA 5EJEA 1S9HA 4XD7D 2X5OA 3RJZA 4C01A 4NXNB 3AW9A 1CY8A 3KFVA 4PG4A 5LXTA 3AL0C 3A1SA 3MC1A 2HDNB 1O58A 2JIQA 2J7PD 3T5MA 4F2HA 4JOQA 3ZW9A 3RYFB 3R8FA 2Q3JA 3KSRA 2I66A 2YWBA 3FZQA 4K87A 1B0UA 1GNVA 3ANTA 3KEQA 3R76A 3I6QA 3NCTA 3RVJA 4D9GA 2UYQA 3EG9A 3Q5EA 4EPVA 5BPFA 1WBDA 3VU1A 2PL5A 1VL1A 3HP1A 2RGUA 4UQOA 2EFDB 4D9NA 4XQEA 5JROA 4L72A 3GLHB 1G8HA 1HT0A 3B53X 4FKZA 4LJLA 3MTQA 3RKUA 1JQLB 4OLAA 1RPNA 1TTQB 1PT9A 3TTUA 2AEEA 3D2CA 3W8NA 4Q5IA 1O96A 5BSHA 1FLNA 1QGYA 1FXWA 1BS1A 1C9EA 1JG6A 1I3NA 3DHNA 3QG1A 4RH0A 3TJMA 1JEYA 3RFVA 3LRTA 5HPYB 4FX5A 1FFCA 5HKLA 2I6XA 1LBIA 1KO7A 1PQUA 1QIGA 2JJMA 1MB3A 4GPAA 4H4DA 4NJMA 1VCMA 1LA2A 2VCEA 1MC1A 1JLLB 1YDWA 3OO0A 5LOVB 1TZKA 3D3QA 5TXGA 5KNLA 1BHQ1 2AXNA 4TYPA 2P9ZA 3QFHA 3O03A 4G6ZA 3S1AB 5D3QA 1Z0IA 1QP7A 1KXZA 3A10A 3CFYA 4NCAA 2OO3A 2J4FA 4QDKA 3I53A 4EEXA 1C1HA 4Y2TA 4CTMA 2XZLA 3W6UA 2CXTA 1RXIA 4ZQIA 1QTNA 4Q47A 3EG5A 3HCWA 2FUNB 3B2NA 4DC0A 4GG1A 4NYJR 4QFDA 5CYFA 1G5TA 4O4LA 2YZNA 4FR2A 2E49A 2VAWA 3O8RA 3TO5A 2HQ1A 1Z74A 3IALA 4JP3A 4BO4A 5FPPA 3BE5A 1CUXA 2EWVA 3FWYA 1HX7A 4KKXB 1XTBA 2DGDA 2FF5A 3IJ5A 4L9AA 2ZBUA 2YXNA 5HUJA 2AW3A 2QZPA 4HFRA 4ITVA 2DBYA 2NU6A 1Z2AA 2C94A 3W2EA 1L8QA 2ZJ8A 1DMRA 4LZWA 1CQZA 1V11B 3DT9A 2I4MA 3GO4A 3W2IA 2O0JA 1SHJA 2V65A 3CLSC 3NIDB 2C1XA 1Y63A 2VPZA 1ODJA 3EODA 4RPIA 3PITA 2C9OA 4LF8B 5KCZA 1UMDB 4POAA 1YRLA 5DN6A 1IHXA 4PTYA 2COUA 2BSXA 4OB8A 1QH0A 3ETNA 3EX7C 1BOOA 4UULA 1J7JA 2DFKB 2YJGA 4XD7A 1CJSA 3GFVA 3IUPA 3R9XA 2H7XA 2FZLA 2AMJA 3I3OA 2VC2B 3L1VA 4WERA 4MYSA 4XFJA 4D9HA 1J70A 1ZJ5A 4M9SA 1R4NA 4IW3B 1YE8A 3GLGA 3D8NA 5JE8A 5CITA 3ZKWA 2AN1A 1O9HA 2PTHA 4MO2A 4OPMA 3FAKA 2Y9PB 2W8BA 3GZNA 2PX5A 3X1MA 4GZMA 4DMMA 5BNFA 1USVA 3AF4A 2EYQA 1WUTA 2WWWA 5AUOB 1SG9A 2ETVA 3VI4B 1JSZA 2GDJA 3LQ4A 4B7XA 1Z2DA 4Q7QA 1PD0A 3WLFA 2AJDA 3M6XA 3WLKX 3GNQA 3ZHXA 4DBZA 4H3KB 5CA1A 2CHQA 3ZXSA 3Q15C 3QJGA 1GPYA 3L8MA 1BJTA 4TTVA 4DSTA 4RWZA 4PYNA 1SXJE 3O47A 4F8JA 4DV6B 1PQWA 4FYYA 3CLKA 1NVEA 1AUOA 1XCLA 2BEUA 1J09A 2AJ8A 2Q50A 2PFKA 2XNHA 1G63A 3KB6A 4RQAA 3B52X 3SF0A 1JZQA 3SYRA 5IC4A 2FLVA 3C45A 3W7AA 4JMLA 1NVGA 5BUQA 2BGWA 1ULZA 1Z0JA 5JYCA 4GZ6A 1N5KA 3OZUA 4G5XA 4NCXA 4QT0A 1VHWA 5HP4A 1J2UA 3HR4A 3L5OA 1Y3DE 2QRUA 5FBQB 2QQFA 3L4KA 4Q15A 1XJWA 5BN5A 2GF9A 4ER7A 4NK4A 4BFWA 3OLCX 4KE9A 2YN0A 5G0UA 4TV8A 3U1BA 3RAGA 2D4HA 2AWNA 4JJ4A 1T5LA 4L3VA 5AW4A 2H1SA 2FP4B 1G41A 2IQ5A 2RG1A 2VPQA 3AYXB 4DMHA 1TXGA 3LC7O 1KY2A 4G9BA 3UJ3X 1Z88A 2A9PA 4L95C 1TA9A 3ZJ4A 4O8ZA 3WFJA 3EDCA 4LPKA 1JQ5A 4M6WA 4YRZA 3GJ7A 1UPAA 4G1MB 5EYPB 2FPIB 5FOVA 4HHEA 1R8QA 4BVAA 2C2YA 4CGZA 1JHQA 2Q4EA 2N46A 2ON6A 2X0RA 4BQRA 3SHWA 2VDNB 4LIPD 3KE9A 2N42A 3I39X 3EEYA 3DZFA 4M76B 4EKDA 1LI5A 1T3LA 1GGVA 4LE1A 4AO6A 1M8GA 5EAIA 2QT1A 4WMLA 4G5SA 1OXVA 1W2WB 1KFCB 3C7TA 1L5QA 4RZ3A 3N70A 1E3SA 1Z9BA 5AXDA 4WK0B 1SG6A 2GN2A 4LCJA 4QJ5A 4XVHA 4C4AA 2V96A 2A1UA 2R7NA 3FB4A 3MAGA 4RV4A 2FPGB 5C81A 2ZUBA 2MR6A 1I6LA 5KTPA 1HBJA 2CVZA 2ADMA 3ER9A 1ZVJA 2C2XA 2NT3A 3BFJA 2GF2A 1YU9A 1JLRA 1KC3A 2AR9A 1M1ZA 1NUSA 1VIAA 5DWVA 5EWMB 2Z4TA 2QRGA 1WVMA 1VSTA 3CRNA 4MLDA 4WFQA 4WLOA 1AK1A 4BO9A 3CT4A 1YRQA 2C88A 4LAFA 1K75A 1R8SA 3PEEA 1MV8A 2DQ4A 2OPHA 1S9DA 2VXYA 4HDRA 1Z4QA 4XCQA 1OCEA 3IMKA 4W8HA 3GJSA 3LKDA 2HA4A 3O8LA 4Q19A 5DCLA 3TWOA 2ZYSA 1NDUA 1UJ6A 4CMBA 1RAGA 1UANA 4F5ZA 3THXA 4RL4A 4MEBA 5P21A 3V6LA 5EIAA 4BQQA 3KU1A 1K97A 3E4DA 3STUA 2B83A 1E1RA 2OM2A 5A03A 1XYVA 2QAGC 2EERA 1U99A 2GO1A 4GI1A 3UC9A 1WVGA 2MMGA 2V6GA 3F9CA 3MCVA 4BTVA 1R2QA 3BA6A 4K6GA 3BXXA 4NL4H 1NVKA 3A2KA 1D1PA 1Q20A 3B9QA 2XA9A 4FOTA 3T9EA 4E5SA 3JRXA 2WNSA 5H8WA 3VJKA 1M8PA 1XMOB 4QFMA 4WV3A 1SQSA 3I73A 4X3OA 4NYMR 5C4IA 4LTNA 5FHRA 2LCQA 2I2FA 3TIXB 2UYYA 2NPFA 1V5IA 2VYND 1EH5A 4H7PA 3HDTA 3L0BA 3PI7A 3QIAA 1XJQA 3UYLA 4J6FA 3VVCA 1XA3A 3LDAA 3BSWA 1CR6A 1DEOA 5DLDA 2Y0CA 4ZCLA 4EF6A 4IQ4A 2C8JA 1M83A 5IDYA 5K3AA 5GJBA 1H2HA 3HN2A 1Y5NA 3SIXA 1R50A 3F2IA 2IUFA 4BLOA 1VOTA 3VM6A 3MFYA 3GEDA 4QRDA 2CV1A 3F67A 4FILA 3HXOA 2RONA 4FNMA 3FAZA 5JVDB 5KWEA 2Y4NA 4LFAB 1LX7A 2EAUA 4YC7A 3I45A 5SZIA 3UCEA 2QTTA 1OH8A 5KTYA 5CFQA 1C0KA 3OQJA 4RJ2A 3DH0A 2FPXA 3UMVA 2C1EA 3E03A 1Z0SA 1EGVB 2CMDA 4E5MA 4KUEA 4FN4A 2QZSA 3PJDA 2PD3A 4G0NA 3RFUA 3DLHA 1RKBA 2BVNA 4TLDA 1YZHA 5GADl 1AXRA 2ST1A 1AHNA 2CVPA 1QLWA 3G82C 3MXTA 4JLPA 4ZWNA 4R1PA 2J5RA 3SYLA 3LGSA 2QX4A 3KETA 2ORIA 1QFZA 2CLKB 2PLWA 4HPWA 3DZKA 3WNCA 3D6NB 3N6RA 1P18A 5BVHB 5C2JB 4P86A 1WXQA 2WIBA 3ROZA 4D9MA 2VDJA 1JH9A 4FMBB 1X7ZA 3TAXA 4J7AA 3I3SR 2XRZA 4IVPA 3BN3A 4M0MA 2C5SA 4PRZA 3D8RA 1T2UA 3QPDA 1PS9A 4PYKA 2BYTA