1ZJ4A

Crystal structure analysis of the dienelactone hydrolase mutant (e36d, c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.7 a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 78
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zj4A00
2WHQA 5ALWA 4K6HA 3G9ZA 3WIOA 5I8PA 2WILA 1BCSA 4WDRA 3ILSA 1I6WA 1DT5A 5FRDA 4AXBA 2WIKA 3AILA 3FBWA 3H2GA 1AMNA 3ZLUA 2WU3A 4E46A 1ZD2P 4X7BA 5CT5A 4BZWA 3BE8A 2VF2A 2WSLA 2WLSA 4K2AA 5LZ7A 5HQ3A 3WK4A 1E8DA 5HF5A 2OXEA 1XRNA 1DWQA 3G0BA 4BYMA 3R40A 2XMDA 1LPMA 3G9UA 1THGA 3A6ZA 2B9VA 3CCBA 3CCCA 4YPVA 2HA7A 3AFIA 1DWOA 4FNMA 3KXPA 3FYUB 3WWCA 1LPBB 5AOBA 4B9AA 2OCGA 3KDAA 5AKHA 1UKCA 4AO8A 1XRQA 1IMJA 4TVKA 3DKRA 4OB7A 4FMPA 4Y7DA 3ED1A 3M3DA 3CXUA 3FWHA 4ITVA 2ZVDA 3V1MA 2WFLA 1OILA 3O9VA 4DMHA 2OCIA 3C5VA 1CV2A 5AI5A 4OD0A 1QIDA 5C8VA 5EIHA 1ODTC 3DOHA 2ZSIA 1UKAA 3GUUA 6YASA 2HA6A 3D7RA 4Q34A 5LP1A 2QRUA 2BGRA 5CH8A 3I1YA 4BDTA 1H22A 3GFFA 1EHYA 3WKBA 5ALLA 5JZ9A 3WL6A 3IUJA 5E4TA 5HFNA 4BVJA 5AM2A 1F0NA 1C7IA 5AKYA 4BTVA 2JF0A 1QIGA 4P9NA 2WU4A 1NX9A 2WTMA 5AM3A 3C70A 5JD6A 1L7QA 5E4YA 5CH5A 1MJ5A 2HADA 2DSNA 1FFAA 4I19A 5ALVA 2QVBA 5JADA 1QFMA 4BP8A 5ALGA 5FUMA 3RKSA 3FYUA 4BC1A 3WKCA 1ORVA 3D2CA 4GHWA 4NZZA 2D0DA 2HU5A 3E3AA 4ZXFA 2VT6A 2DQZA 4QDOA 4X93A 2PUJA 3NUZA 1EB8A 1EDBA 4U2DA 4M0MA 3AINA 3LIPA 4NVRA 1TCCA 4GECA 2FUKA 4FTWA 3H18A 1XZBA 3IA2A 4HRYA 3HACA 1HL7A 1XKLA 1EA5A 2V98A 4IH4A 2OQVA 1TK3A 1DX4A 4DNPA 3EF3A 1HQDA 3BF7A 2ZJ7A 4BBZA 5CURA 3F96A 3STVA 5LZ9A 3C8DA 3ESBA 4Y2SA 2WM2A 1ZD5A 1SFRA 2P8SA 3G9XA 2Z8XA 3A2NA 1F0PA 1VKHA 4LYEA 2OCKA 3GELA 5AKGA 5ALRA 1ZI9A 4U2BA 3CN9A 4MJ3A 5JD5A 3RK4A 5A62A 1MN6A 1G66A 4GXNA 5LZ4A 1G4HA 1IUPA 1WM1A 3FAKA 4Q1VA 5HK9A 1CUCA 3LIIA 1QO9A 5A7FA 5CBKA 3FVTA 2G63A 5AKIA 2WTNA 2ZYHA 5AICA 4UHCA 3YASA 1MAHA 5A7GA 1VJ5A 1Q84A 4BVKA 4AO7A 4X6UA 1CUFA 2PBLA 2G4LA 2Y6UA 2V97A 4AX4A 5EGNA 3DLTA 4CG1A 4QA9A 4QEKA 4EY7A 4E15A 4RPCA 1VLQA 5K3FB 4UHBA 2XMGA 1CUIA 3VKFA 5AIAA 4ARAA 2JEYA 3HRHA 2IIVA 4J0HA 1UK6A 5AKXA 2PSDA 3AZOA 1TIBA 1AKNA 3M82A 5ALEA 2WJ6A 1Y7IA 4PV7A 1J2EA 3WK9A 3C5WP 3QZUA 1UFOA 1XLVA 1LNSA 1IZ7A 5ALUA 3H0CA 3DKKA 4PF1A 3IDAA 3ESDA 4XWGA 2O7RA 1KU6A 3JW8A 3MGAA 3D2BA 2WG1A 3ZLVA 1ZJ5A 4UFOA 5CXXA 2OQIA 2E3JA 4EB0A 2G5PA 5JAPA 4B80A 5ALHA 3R3UA 2JGLA 4F0JA 4HS9A 3WMRA 1MAAA 4H7DA 4H77A 2PPLA 4FLMA 3SWWA 2PU5A 4HXGA 1DINA 3I1IA 1EXWA 2H1IA 3MVEA 4UUQA 5BOVA 3EIOA 4HTAA 1XZDA 3M81A 5JALA 4XIIA 1X2BA 3O4IA 4KAJA 4BCBA 4J3JA 2PKYX 2VATA 4CIBA 1P0PA 1UK7A 4UPDA 1AQLA 1T2NA 4B81A 2FJPA 4Y9SA 5D3KA 5C7YA 4DSAA 2OG1A 1U65A 4UBJA 1FJ2A 2AJCA 4G8BA 5D7BA 3PUHA 1H2XA 2XUHA 2R8BA 1ZIYA 2XUAA 5SYNA 3GA7A 2O2IA 5CT4A 4Y2XA 3WL5A 1BN7A 2J3QA 3FNBA 2ONCA 5EHNA 1PV1A 5IVDA 3OG9A 2VAVA 3A70A 5LZ5A 4MQMA 3TRDA 5CRIA 3E0XA 2WUGA 1UOQA 2LIPA 1ORWA 4KAFA 2WFZA 5CT8A 2YXPX 2ZSHA 2XI4A 5DNWA 4CIAA 3VJKA 2QR5A 3D3NA 3VISA 1AZWA 1DX6A 1ETHA 2PSEA 2PVSA 1NU6A 3N2ZB 1LGYA 3STWA 3DD5A 1B41A 3DNMA 2XUKA 5D6OA 3VDXA 3H2HA 4KRXA 5IVIA 3F97A 1CUHA 2Y1KA 5ALFA 1MX1A 2JBWA 2XT0A 2I03A 1FSSA 1PJAA 1ZICA 4OU4A 2EDCA 4BVLA 5LZ8A 2QKYA 3ANSA 2XDWA 1GT6A 3U1TA 3PUIA 4AMZA 4CI9A 3IURA 2ZYSA 3C6YA 2V9ZA 3UUFA 4DMKA 4EA6A 2XE4A 1GKKA 5AM0A 5HF8A 2QM0A 4FKBA 1HLGA 2EDAA 3DJYA 1TQHA 2PL5A 3LCRA 4QDXA 1E8MA 3O9MA 5CTAA 3I2HA 3AUKA 3C6XA 1U8EA 1VA5A 1YS1X 3WL7A 5T4FA 5JASA 5CW2A 1CQZA 1U2EA 3D4LA 2PUHA 5EFZA 5K5EA 3BIWA 4UBLA 3TJMA 3GZJA 3MUOA 2HL6A 1R3DA 1A7UA 4FWBA 1NU8A 3IVMA 3D5EA 1CUDA 5JATA 3W04A 1LLFA 1FFCA 2QXTA 3H2KA 1W75A 4P93A 3OTQA 3IB3A 4LIPD 4ZGBA 4CCYA 4IO0A 1P0IA 5AI6A 4BRZA 4DSZA 3O4JA 4K6GA 1W52X 3R41A 2AJ8A 2W22A 1YASA 4BCDA 5KBYA 2X5XA 2DQYA 3I6MA 4FLEA 4DIUA 1YS2X 4BATA 1CUYA 1YA4A 1HPLA 4N8DA 4N5HX 1RYYA 2HFKA 4X94A 2B4KA 1MPXA 3QMWA 2XMRA 3HYSA 4FFWA 5E2IA 1BCRA 1W1IA 3FSGD 1QO7A 1CQWA 3OPMA 1F8UA 1LPSA 1GGVA 3C6BA 3EQ8A 4FOLA 3F8SA 5HQ3B 1K8QA 2ZJ6A 3QVMA 4G8CA 4G9EA 4ZREA 1P0MA 2BUCA 3STTA 3LP5A 3PF9A 2PU7A 3ESAA 4DGQA 5K3EA 2XUJA 1XZHA 1N5MA 1MNQA 3L1JA 5BWBA 4CFSA 5A2GA 3QBJA 2QT9A 1R1DA 2XMQA 1GXSA 4UBKA 3V48A 2UZ0A 1HKHA 1W4LA 3RLIA 1LBSA 3L1HA 3I2GA 2QJWA 1LZLA 1XZGA 4X85A 1C4XA 4KAAA 1R9MA 4J7AA 3D59A 2WIDA 5AOAA 3BF8A 1ZD3A 4KEAA 2C0PA 5DTJA 1JI3A 1BRTA 3ICVA 2OGTA 3UUEA 2XQFA 4UBMA 3IUNA 1QGED 3AJAA 3NGMA 4E14A 5AM5A 3WJ2A 5ALOA 4Y2TA 1N5RA 1XZEA 4LKOA 3R3VA 5LKAA 3PFCA 3PE6A 3GROA 3WKDA 5ALQA 4H7HA 1XKTA 2VTVA 5A6VA 3WJ1A 1P0QA 1QJ4A 3WK5A 4X92A 1UWCA 2AXEA 3QPCA 4WY8A 4WY5A 2PSHA 2W6CX 5DWDA 5EI5A 5CT9A 4OYLA 2H9YA 1SCKA 1D07A 1ACJA 5HZGA 1CUBA 1K63A 3QMMA 2OGZA 2GBIA 4WDQA 3JYHA 1ZOIA 1WB6A 3G8YA 3SC2A 1XROA 3K9BA 1UOPA 1XZAA 3NOXA 4W63A 1J06A 4F5ZA 1VXOA 3SK0A 5ALMA 1UKBA 1E66A 3W9BA 2C7BA 3WZMA 3GBSA 1THTA 1QE3A 2DFPA 5AKJA 3PI6A 1EI9A 3HI4A 4RE6A 3O0DA 1T4MA 3LS2A 3F9CA 2Y2VA 3WWEA 3BDIA 4ZRDA 3IUQA 1K4YA 5LYYA 4AQDA 5T4EA 3R3WA 3JWEA 4UHHA 4C88A 2XB6A 1CPYA 2VJCA 3DS8A 4AZ3A 2FJ0A 3OC0A 5JYCA 1QTIA 3DCNA 4WFKA 3CN7A 2XMBA 3QH4A 2XUDA 3BIXA 1EDDA 4BRSA 4QZVA 2HDWA 1EX9A 4BB0A 1XRMA 4OPMA 5AO9A 1EVEA 3L1IA 2Y2UA 4PSUA 3KWFA 1AGYA 1DTEA 2YH2A 2PX6A 1XQWA 2V96A 2GBGA 2WIGA 2XUIA 1ZIXA 3DYVA 2QS9A 1TKRA 3T4UA 1CLEA 4FDMA 3C6ZA 2NW6A 1SC9A 3UMJA 4UHDA 3VVMA 4L72A 2JGFA 1YAHA 2HHAA 2WG0A 3IUMA 5FV4A 1XLWA 1SOMA 3IBTA 1DQZA 3FYUC 2XLCA 4IH1A 5YASA 4H0CA 2WIFA 4DMCA 1CUAA 1AC5A 1SCIA 1VXRA 1YA8A 3I6YA 5FXMA 1DQYA 1YAJA 4PO3X 5AK6A 4Y2RA 2VAXA 4B9EA 1GPKA 2JGIA 4INZA 5T4BA 3OURA 1USWA 3V1NA 1E89A 5DYWA 1F6WA 1N8SA 3RM3A 4EY6A 1YCDA 3G7NA 3P2MA 1EH5A 3E1GA 4C4ZA 1E3QA 1N1MA 2C58A 3LLCA 1VE7A 5F4ZA 4GDMA 4JYPA 2EEPA 4B0OA 3FOBA 4BCCA 2BUAA 4BTLA 3HJUA 1EVQA 3D2AA 4B7ZA 2WIJA 1CUZA 4D9JA 5DTIA 5EHZA 5KREA 4ARBA 2I78A 1EINA 1ZJ4A 1Y37A 2RGUA 4PW0A 5EHQA 4H18A 5HFAA 2XMSA 1CUUA 4C4XA 3W2TA 3HLKA 3W9UA 2OCLA 4C89A 1G42A 3O4GA 2AJBA 3R3YA 4W1PA 3R3ZA 3BXPA 1CUEA 1OCEA 1QIIA 1W76A 4X91A 5AKKA 4J0DA 4H35A 4OCZA 1CEXA 4M0EA 1EK1A 4AZ0A 3WWPA 2QTBA 4NMWA 2X76A 1UXOA 4Q3OA 5AOCA 3KSRA 2JGMA 3IIIA 1GQSA 1KEZA 2ACKA 5ALSA 4QWWA 2XQIA 1XZFA 2RHWA 2ORYA 4MWTA 3QM1A 3C8HA 3FVRA 1IUNA 2QJRA 2RI6A 1XFDA 3WLAA 3IULA 4ZWNA 4HRXA 3WA6A 5HF6A 4DM7A 4XVCA 1KU0A 4EHBA 4JH0A 2ACEA 4K6KA 1ZI8A 1JMKC 4FBMA 3H2JA 2CJPA 3STYA 1LPNA 3R0VA 2RIPA 3HABA 4ZI5A 4GWLA 5DNUA 1QTRA 3WK6A 4U2CA 4YX9A 3S8YA 1GKLA 1QIMA 5C8ZA 5AK4A 1E5TA 1JU3A 5AM1A 1Y7HA 4KJXA 3G0DA 4M0FA 3WIBA 4KACA 3NWOA 2WUFA 4EBBA 5EIEA 3WWOA 1BU8A 2CEKA 3G9TA 1DU4A 1JFRA 5LKRA 3AZPA 4AB1A 3B5EA 3HXKA 2CUTA 1AURA 2CMFA 4O08A 4EY8A 1J1IA 1MX5A 4RGYA 2VJDA 1LPAB 1XZIA 4H7KA 4W1RA 4KRYA 1VZ2A 1XZLA 4AN0A 1R9NA 5FP0A 2XUOA 3BJRA 4OB8A 2VQ6A 2Z5GA 5EHXA 3QMVA 2ZYIA 2XUQA 1LPPA 2HA4A 3B3QA 4OUKX 3C45A 4P92A 4B82A 2QZPA 1RWQA 4L9AA 5AKLA 2OLEA 1TAHA 5IVHA 3B12A 5H3HA 3WKAA 2QOEA 4QLOA 2Q0XA 1CR6A 2JGJA 1QFSA 1YB7A 3H04A 3O4HA 5ALYA 1GZ7A 3G0IA 1QLWA 4ZV9A 5D3ZA 1OXMA 1G5FA 3BL8A 5AK3A 3FLEA 3DDUA 4OYYA 3DYIA 2WJ3A 1Z68A 4X6YA 4FNGA 1CUVA 3H17A 2HRQA 4HXEB 5JARA 3HZOA 1R4ZA 1GPLA 1QZ3A 1H2WA 5FPQA 1ZGCA 1A8UA 1WOMA 3W06A 5ALNA 2VT7A 1CUGA 3F67A 5K3DA 2DHDA 3WWDA 4C4YA 4HXFB 3QPAA 2GBFA 2Z3WA 1E8NA 4KE9A 1L7RA 2RHTA 5AIBA 3WA7A 4B84A 1TRHA 2PSFA 3H1BA 1CUXA 1ZD4A 2JEZA 4PSCA 4W1SA 4TPKA 4X71A 2VEOA 1CUWA 1MX9A 1TCBA 2OPHA 5JIBA 2JGEA 1CRLA 2ROQA 2HRRA 2DHEA 2O2HA 5AKZA 2WG2A 4UHFA 1WPRA 2VSQA 3DEAA 2WJ4A 5EIAA 4XJVA 5CMLA 2VJAA 5LLSA 4PSDA 1DT3A 1WCYA 5AKEA 4IH9A 4K5QA 5HF9A 1VZ3A 5CT6A 5K3CA 3QPDA 1XZMA 4Q82A 2QUBA 5AI4A 1CVLA 3K2IA 3SX4A 4J0IA 1MT3A 3H2IA 1WPXA 5FPPA 4BE4A 2HA5A 5AI0A 4LXIA 2FX5A 3PICA 1Q0ZA 2YASA 5AHXA 3HC7A 1C7JA 4J0JA 1YB6A 4Z49A 4LXGA 4CG3A 3HSSA 4X6XA 3TEJA 5I9IA 1O6FA 3S2ZA 2O7VA 4DNQA 3K6KA 3ZV7A 1JT2A 2J4CA 5JAUA 1AX9A 4L3WA 3VJLA 1XQVA 1EDEA 4KE8A 4WFJA 2ECFA 2XLBA 4F60A 4OU5A 2WKWA 1WHTA 4U2GA 1JJBA 2BAGA 4WJLA 1U4NA 4EUSA 2WUEA 1Q0RA 4EY5A 1BROA 5ALIA 2DHCA 4AN1A 2J4FA 4BAUA 1R50A 3WQHA 4G4GA 1JU4A 3AIKA 3WK7A 1LPOA 3BJMA 3HEAA 1UOOA 3WZLA 1M33A 4G4IA 5ALXA 1QIJA 5T4HA 4DNFA 4MWSA 4WFIA 4RNCA 1XQXA 2GYWA 4Y2PA 3DL4A 5K3FA 3I28A 2HA2A 5KWIA 1W6RA 4J0KA 3I2KA 2WHPA 2XMCA 3ANTA 1XRRA 2VA9A 2H7YA 3I2FA 1K6EA 4V2IA 1QOZA 2XQKA 3WKEA 3G0GA 2Z3ZA 1BN6A 1CUSA 5AJHA 1X70A 4MYSA 1YSCA 4BC0A 4PQEA 4HVTA 1ODCA 1A8SA 3PF8A 1H23A 2H7CA 1VOTA 4ZV7A 4MEBA 2GYUA 4BDSA 3FLAA 4H7FA 4IHAA 1H2YA 5JD4A 4YASA 5JZSA 5JANA 4N8EA 3G0CA 4YK7A 1UK9A 4GLBA 2HM7A 4DMFA 2WHPB 4X00A 4CG2A 4E11A 2IX9A 1DWPA 3W05A 2HA0A 4J0CA 1MU0A 1K5PA 3ZLTA 1QIEA 4B85A 2CBGA 1EK2A 4BE9A 3V1LA 3BWXA 2OGSA 3C87A 2ZJFA 3A2LA 1UK8A 4IQ4A 5IKXA 3STXA 2C5GA 3AIOA 2I3DA 2WFMA 2XMZA 5ESRA 1VE6A 3FCYA 3I2IA 3PFBA 5HK8A 1HDEA 2ZYRA 4QDUA 3EQ7A 3U0VA 4B83A 1BEEA 2K2QB 1H2ZA 1MNAA 1SCQA 4Q05A 4C01A 3G02A 4AO6A 3WK8A 5AI8A 2HFJA 3PDCA 2QXUA 4G4JA 5AI9A 2J3DA 4QE3A 4S0XA 2HA3A 4AMYA 3I2JA 5J3JA 1XZKA 4ROTA 4CCWA 4DLNA 2O2GA 4N5IX 3KOOA 1JMYA 4GI1A 4X97A 3I6ZA 4JNCA 3DOIA 4DTCA 4EY4A 4W9RA 3AZQA 5ALJA 4QNNA 2WUDA 4I3FA 1XLUA 5AP9A 1PFQA 4LXHA 4J03A 2BUBA 1WB4A 2JIDA 4BP9A 3EBLA 4TGLA 5BWCA 4Y2JA 2GZRA 3FSGA 4KR0A 1UT6A 3H1AA 1VA4A 2R11A 5FLKA 2B61A 4QLAA 3QITA 4OSEA 4J0GA 4QDTA 4DNOA 1GPNA 3BDVA 2CZQA 1QIKA 1XZCA 4X95A 5A7HA 4UHEA 4QWMA 2X8BA 2BKLA 4UBOA 4MQLA 3R3XA 2GZSA 3EQ9A 2CKMA 7YASA 3ZWQA 5JAHA 2RONA 4FLFA 3WI7A 2AJDA 1O6GA 4U2EA 4JUIA 2HIHA 2Z8ZA 3D0KA 5FDFA 1XRPA 1XRLA 2PSJA 4H7JA 3OOSA 4BAZA 1QONA 5LZ2A 4MEAA 4GEGA 5HKBA 3WL8A 2GBCA 4HZGA 2BJHA 3DQZA 5E4JA 3VVLA 5IH7A 1LBTA 2I3ZA 5AH0A 1BE0A 3ICWA 2IITA 1A8QA 4H7IA 4Y2UA 4B6GA 5ALKA 1S8OA 2YYSA 2C5FA 4WCVA 4DYHA 2XUPA 1YR2A 4BAGA 1ISPA 5CXUA 1FFDA 5ALDA 2QUAA 3VJMA 4HAIA 4JYMA 4A23A 1L7AA 4X3CA 2DR0A 3V9AA 1R88A 1IZ8A 1LZKA 3C43A 1GQRA 3N0TA 4W1QA 4CCYB 3TGLA 4OB6A 3VXKA 3FLBA 4Q3KA 5CH3A 2GYVA 4XX1A 1AUOA 1ZI6A 3KWJA 4G9GA 5ISMA 2C4HA 4GW3A 4Y2YA 4C6HA 4UBIA 4G8DA 2H7XA 4LYDA 2BFNA 1ACLA 5ALZA 1A88A 2WFLB 3WYNA 4X90A 2RAUA 1HBJA 1RP1A 1BEZA 1EB9A 2BCEA 1B6GA 1IVYA 1FFBA 1CUJA 5DYYA 3V1KA 3ESCA 4MYDA 4N8SA 4RE5A 2D5LA 5ALTA 3DL7A 5JAOA 1WB5A 1QIHA 2ES4A 3F98A 5A71A 2OAGA 4FFVA 4H7EA 5FOQA 3E4DA 5AM4A 4GBGA 3STUA 3T52A 3AIMA 4UFPA 1X2EA 4UBNA 2HU7A 5DYTA 2C0QA 1JKMA 2DCMA 5I7UA 3Q8WA 2VJBA 5DLPA 5ALPA 2XQGA 4PNZA 4LHEA 1XZJA 5IVKA 3M83A 5C81A 4L0CA 4EZIA 3RARA 4KE6A 2PM8A 4A16A 4QDZA 5K3AA 3WYDA 2QMQA 3H19A 5C8XA 4KE7A 5KWJA 2WHRA 4Y2QA 4F21A 4FBLA 1CIJA 3A2MA 3O95A 5JZBA 5BV7A 2B20A 1WHSA 4BZZA 4JEIA 4P08A 3Q0TA 1MO2A 2XUGA 2JGKA 5K3BA 3FYTA 1MTZA 4B0PA 4NS4A 1ODSA 3QYJA 2OAEA 4I4CA 2CB9A 5DNVA 1JJIA 3MUNA 4U2FA 2XQJA 2WQZA 4Q3LA 4FHZA 3FCXA 1FFEA 1XQYA 3ZI7A 1J07A 3KD2A 4MXDA 2AJLI 1CFJA 3ZPXA 5HKAA 5LIPA 1BS9A 4KYVA 3X3HA 5SYMA 2HU8A 4G1FA 3OM8A 2Y6VA 1ZGBA 4G5XA 1Q83A 1IUOA 2G5TA 5AK5A 2XUFA 2BGNA 4A5SA 1TCAA 1QIFA 1UZAA 5FKJA 4UFNA 5DJ5A 4Y2VA 4C87A 1JJFA 4ETWA 5HCUA
chains in the Genus database with same CATH superfamily
3C85A 1F51E 3HPQA 5ESXA 4GKKB 5CVUA 1BCSA 3EFOA 1RJDA 4L8YA 4RETA 1FVXA 2HRBA 4Q15A 1SBCA 3MWDB 2WPDA 4WDRA 4ZAYA 4CM4B 3ZG6A 3T1QA 3O8LA 4ASUD 4DDTA 3HNOA 5A3RA 1GZSA 3LL7A 5CYPA 4AROA 4JJZA 2WJJA 4HZUA 1L4UA 1Z07A 4QNMA 1ISFA 1EQAA 1DRUA 3P26A 1T6XA 1D2GA 3LSYA 4BN4A 2DZDA 2PMKA 3LYLA 4R9RA 2NX2A 1NZJA 5CT5A 5L3RA 3OCXA 1C5KA 2OBFA 1PQWA 3L46A 5IH3A 4D0NA 1AGNA 1LVGA 1EM6A 1RHJA 1ZLXA 2VP4A 4K2AA 1I7PA 4F6CA 2C3PA 2ZRAA 3BE5A 5THXA 1Y3AA 2IODA 3BWCA 3DNFA 2PUEA 1I2ZA 4UQPA 5EJFA 1HLDA 2F67A 1U7UA 1X94A 3N8HA 4TSKA 3T3NA 2AG0A 2OXEA 4WBNA 2HJ9A 3HDVA 1KOJA 4PG8A 2FE1A 1KI8A 1WABA 2W6ZA 3G0BA 1J8YF 1L4HA 4Q19A 1JEYA 4R6XA 1Q1AA 3QWFA 1K9SA 4JASB 4B4WA 3VR2A 2RHDA 3WB0A 1M8GA 1RBMA 1LPMA 1ABFA 3EVEA 4CUKA 4BQIA 1SG0A 1E96A 3QVWA 2PKQP 4W5JA 5IM4F 1X39A 5PNTA 1U9IA 1FRQA 2RHJA 4HOYA 2HTFA 1NC3A 2PAAA 3NWPA 3G9UA 1PE0A 1D8AA 1U3CA 3RJ5A 3ADDA 1A9SA 1D2CA 1DXHA 2BDEA 3M1AA 4LRSB 5FWXB 3CCBA 3MCVA 1TZKA 2GVDC 3L04A 3JR3A 1V3TA 2YVAA 4YPVA 1VM6A 3AR2A 2HA7A 2E5LB 1SWWA 2Z6AA 4Q1BA 4G9BA 2FW7A 4XQEA 5EZYB 4KQ2A 4D98A 1FLDA 2QMOA 4BNUA 5KTYA 2PVCA 2L69A 5AOBA 3SHTA 3TMKA 2IPXA 3KDAA 4GKBA 4PU0A 3ECAA 4X1YA 3IESA 1YU9A 3COVA 3K8OE 3VYVA 3FKJA 4CMCA 3P0EA 1UBUS 4K3VA 4AO8A 4BVBA 1TUEA 1SXJD 3QVTA 2VUTA 1PWEA 3PT5A 5JZOA 4FFRA 1NOJA 3UOAB 1Y3BE 4O33A 4KQ1A 2KW5A 1NUTA 5CLHA 3DVQX 2AG5A 4ZQFA 3OF3A 3CXUA 4NFHA 2GH1A 2XXAB 1IYZA 4IDPA 2HV8A 4ITVA 4W9MC 3G0OA 3O31A 3GK3A 2HNBA 1PYOA 1EUQA 2VFAA 3O9VA 4DMHA 4FWTA 4YMUA 3DD1A 2IZ5A 2OCIA 4UPVA 4UXIA 3ZXYA 4UOZA 2CXPA 3BYZA 5KU1A 3ELYA 1ZH6A 5JMWA 2K7FA 1QIDA 3ZWCA 1ONPA 5C8VA 4CETA 1ODTC 3UMGA 3VV2A 4TRRA 2ZRLA 2ZUVA 3GUUA 1Q44A 3JVDA 5CVTA 4MZDA 1E5QA 2LTAA 3F3SA 6YASA 3D7RA 3QQPA 1Z2AA 2OD9A 1YHNA 2Z9DA 2B37A 3EEBA 3F71A 1B26A 4TS4A 5DRYA 2QRUA 3HCOA 4M0PA 4UM8B 3SS8A 1GUAA 2H0QA 3NTXA 2IEDA 6LDHA 2BGRA 1DLIA 1B2RA 4E30A 4YCNA 3V7YA 1T1IA 3C6MA 3T54A 5EQDA 1VPLA 3HBJA 4BO3A 1NYLA 2A92A 3GFFA 2BFMA 3BKWA 3GGCA 3I2YX 5B1DA 3AF3A 2OZKA 4ZZ1A 2C2ZA 4NZOA 5H3CA 1RXSA 2FMTA 1G7TA 1X6VA 1EHYA 3AY3A 1TM3E 4F4JA 3UMMA 1BIFA 4ENTA 1M54A 2FPGA 1KDZA 1JI0A 2O19A 4R1LA 5EMMA 4MA5A 3W8NA 2R6DA 5FT9A 2FQYA 1FDTA 3R1IA 2IEYA 3TSZA 2HJRA 5B3KA 3ASZA 3V1UA 1E69A 4B8WA 1ISIA 4GOMD 1I0ZA 3NT5A 1JTFA 3V2GA 1JG1A 2IYNA 2HF2A 2Q27A 2D2VA 1HK7A 2Z5FA 2HB6A 1P4RA 2Q2VA 3A6DA 4GZMA 1XXHA 5LNK6 4EYGA 2OILA 1AM4D 1L7BA 2QRQA 2JJMA 3A1NA 4K6OA 5HGJA 1Q57A 4I08A 3C3XA 4MS3A 2WTMA 4RQAA 4MVJH 1FS6A 1V16A 3QW4B 2EW2A 4PFKA 3OICA 4CLEA 1BNCA 2Z4TA 4ZOBA 1OAAA 2HF8A 1MJ5A 1H6BA 2HF9A 3MLBA 3SOZA 3A1SA 5C18A 1FFAA 3Q5GA 5ALVA 5IFKA 4K6FA 3OZWA 2QVBA 3KAJA 4YAIA 1FS5A 5HPYB 1JKXA 3K0HA 4OQNA 2FMHA 4HF7A 4BP8A 1T1JA 1HTBA 1OREA 1WZUA 2XZDA 3DR3A 3B1YA 3JZFA 4I50F 3UVEA 4F96A 1V5FA 2IYPA 4ZGGA 5FUMA 1UAGA 3RKSA 5JNTA 9MHTA 4HAXA 2XKKA 4DQKA 1I2AA 3IEUA 4LSMA 3FDFA 4BC1A 1AMNA 4X62B 3CVVA 4DV6B 1U0BB 3QXXA 4QL3A 3S7TA 4F2GA 3TPZA 4LVCA 4NZZA 1GQ2A 1YBFA 4DT1A 4G26A 4NG5A 1UWLA 2H2FA 3A9RA 1VL1A 1X14A 4IKPA 1MC4A 4CEJA 3OC6A 4L76A 2P6RA 1L5ZA 2APJA 3DHEA 5IHXA 2BD0A 3N6RA 1SBHA 5G4KA 3KHSA 1RQGA 4JS0A 3AHJA 4WASA 1XNHA 3X1KA 1D03A 4QTYA 3EE6A 4BVFA 3ENWA 2B8EA 2FEPA 3SNHA 3K9WA 4M83A 1ZMXA 3LD9A 3E7PA 3LIPA 4TMYA 1PQPA 1TCCA 3OESA 4YO7A 3HVJA 1NYRA 4HWSA 3MTJA 3PUJA 5HE8A 3TSCA 1ZJWA 1BQ4A 1RRMA 2Q07A 1L4EA 4HRYA 3S2GA 1KH3A 5K0EA 2OESA 1O58A 2WE8A 3M9LA 3B52X 2PFGA 3CUVA 3IKVA 5TX7A 1DFIA 3BG5A 1U7OA 2ISSD 3L6RA 1FLVA 1U8YA 2A5FA 4ICIA 3U0BA 4DCJA 1AK1A 3GBPA 1NHGA 1HQDA 1WCXA 1VKNA 4I55F 3BF7A 5A03A 1LD3A 4JP3A 2ZJ7A 1RP7A 3ELWA 4BBZA 3D1VA 3CO0S 3SQWA 4TL6A 5AXAA 3F96A 4GOXA 3LW8A 5A5EA 5LZ9A 3MJFA 4DUGD 2IYSA 3ESBA 3ISJA 5JSZB 2VYVA 1KVRA 2PO5A 3M4XA 4D97A 2ZPUA 3KDPA 3FBTA 3SVLA 5DBFA 5CEFA 1KEEB 4NRDA 4HP8A 3TF5A 3R5FA 4JX8A 4FI3F 2Z8XA 3QUSA 2FPRA 4H7PA 3A2NA 2OC9A 3H5TA 1KAGA 1DKMA 4NMXB 3U26A 2PG3A 4OXXA 1JHRA 2IIQA 4D5GA 1PR4A 1RWOA 2Z4SA 3OSZA 4MV4A 1P74A 2KS6A 3TH5A 1QZXA 3JZDA 4GQBA 4DXHA 5AVVA 1FBTA 2OCKA 1N77A 4N6GA 2Q8NA 1X15A 1TOAA 1TUIA 3I9NA 4MUEA 5CCBA 2FEOA 1GTVA 2A7XA 5I7AA 1F2DA 2QUHA 4Y0NA 4MW2A 2O8EA 3TSYA 1T1SA 3ABOB 2QRPA 2WWWA 4QYIA 4JLDA 4RZQA 4XSHA 4LX0A 1X1QA 1DIBA 1XQ9A 2O3UA 4O63O 4Y3UA 1G4HA 2HJHA 5LZ4A 2H06A 3LSTA 5HK9A 3SYTA 4BE7B 1CUCA 3A27A 3LIIA 2EJUA 1ONBA 4YAEA 3CB4A 2EWWA 5B37A 4JWTA 5CBKA 1KHHA 4CU2A 3L8GA 2H2WA 1OI7A 3FVTA 4ZCQA 2AYYA 3UUGA 4BQFA 5KNCD 1QPZA 1NQUA 2GDZA 1JBEA 4UDNA 2ZQ5A 3KOXA 1MDFA 1UPUA 1US8A 3BTUA 1M1UA 4F2PA 1CJUC 5I01A 2ST1A 5LQAA 2IUUA 2FUCA 3H2ZA 1Q84A 2JCVA 4PLWA 3IXQA 4V0RA 3ZHXA 2YV4A 3B9RA 4IIXA 2ZIXB 1CUFA 2DHQA 2ZYGA 1G6OA 1M1YA 2PBLA 1WO8A 3FZEA 3N2GB 2D1QA 2V5UA 2EAUA 1HQYE 2G4LA 2Y6UA 2XWPA 4HEQA 2GJ8A 1DAPA 2AN3A 4JDPA 4M1MA 4AX4A 1LH0A 4CG1A 4E12A 1UXIA 5HDBB 3QW2A 3QLEA 4CKBB 2MSCB 1GVNB 4OQFA 5G0VA 8LDHA 5K7SA 1FBNA 1G2IA 3ZY6A 1E0JA 4E15A 4UHBA 2R79A 4LA4A 2KI5A 1RJ9A 3VUFA 1GAEO 1R37A 3C24A 1A8PA 1U7WA 4Q9LA 1E62A 4YV0A 1JEQA 1DQSA 3GHYA 4HWRA 4H31A 1X38A 2IOYA 4ADSG 4AYWA 4TWAA 1UFRA 3UKOA 1Z0AA 3W1VA 3NS7A 4LC0A 5I8WA 4KO2S 1TYAE 2VC2B 4BMOB 5KNDH 2VAPA 2JEYA 3CEHA 4NPCA 4CIVA 4F9TA 2IIVA 1TUGA 3NIDB 4H16A 4IUBS 5DYGA 1ZN2A 3GFPA 1ZR2A 1MQ8B 1QCDA 2ACWA 2ETXA 4JZYA 2PSDA 3L0DA 1YFZA 2ZULA 1KP9A 2OZPA 4KPYA 1TVKB 3PUYA 3B1JA 5LBUA 4RTRA 4MR8A 3LYUA 1Z2NX 1ZO8A 5EJ7A 3DOEA 5D6NA 3LX6A 1TECE 1R6DA 4PV7A 4WNIA 4N03A 1NM5A 5DB4A 1SPXA 3HU3A 3B20A 3LW7A 4DM4A 5CR9A 1ZM2A 4MX8A 5KVSA 5IC5A 3WK9A 3QTBA 2G88A 3LFHA 2QX4A 3U7IA 1NXPA 3CZPA 2DJ5A 5FBRB 2H92A 4DDVA 2QPLA 3AEKA 3NP9A 1P2SA 3LYAA 5IN5A 3ZDCA 3LZCA 4IS3A 5ALUA 4Y1EA 1AUXA 2JBHA 3H0CA 5FUYA 3RU7A 3VSBA 4D41A 1NPTO 3DKKA 2F3QA 5B7QA 5FJJA 4I55A 3IEMA 1C50A 1SVOA 1PGNA 4PF1A 5CYOA 3M6VA 2OZVA 5TQJA 4AY3A 1BKSB 2Q49A 4RAQA 1TEZA 1SU8A 4BB9A 4XW2A 5T8KC 1LA2A 5H1YA 3T7IA 1NN1A 2DKFA 2ZB8A 2QUZA 3MOGA 3V4FA 1YK0A 4LOHA 3RRXA 1RBYA 1F20A 2WG1A 3D2BA 3ZWPA 4ZOQI 4LHVA 2JLYA 4NU6A 4KO1S 1ZJ5A 4FIZA 3AVYA 4ARCA 4H1UA 2Y99A 4TYPA 4AYTA 5EJIA 2G5PA 3QVJA 3BTSA 1ZZEA 4U5QA 4B80A 3GLIE 2JGLA 1NKSA 2VH1A 1VMKA 3GPIA 4HS9A 4K86A 3B5IA 3QPUA 4IIDA 1KERA 3B3GA 3QEAZ 1V8DA 1WU8A 3NIWA 3WGOA 2WD7A 4UCWA 5TQ0B 3RIXA 2SKCA 2IL1A 1CTQA 1JPVA 1O57A 2GD2A 2P9CA 1C8BA 3BH7A 5ENDA 5IJZA 3AVXA 1W1WA 2ADOA 1UCFA 2E85A 2P4EA 3I1IA 1VLZA 4QGSA 3E0QA 4G0MA 1G9XA 2D1SA 3USES 2TMYA 3INRA 3P9ZA 3PJEA 4YDSA 4BNVA 3EIOA 5THQA 1O4WA 1GZ6A 3GAFA 4KN9S 4HTAA 5DNAA 2W98A 3JARB 3K32A 1GLGA 1M0WA 4ZTZB 3SD7A 5DBOA 1KKUA 5BT8A 4TROA 1BVHA 4C3VA 2WOJA 3UA3A 2TMKA 3FCSB 3NRBA 2VATA 3CRVA 4A0HA 3ND6A 1P0PA 4BNYA 1ZQ1A 1G8AA 1QDUA 1YHYA 2AOUA 2H00A 3BERA 3FMOB 1AQLA 3GWGA 1YBMA 3HN2A 4HDNA 5I9MA 2O7SA 4YREA 2J0SA 4HB2A 1E9AA 4GOND 4Y9SA 2Q5LA 2WLTA 3UIEA 2Q0SA 5D3KA 3B38A 5LOVB 3GO4A 4XWWA 1Z8FA 4TWRA 1J1ZA 1SBNE 1P2DA 1U65A 4PGGA 1YQWA 3RS4A 1T24A 1SUIA 1FJ2A 1FLAA 2AJCA 4ND4A 5F51A 1MT0A 3DZGA 5D7BA 4ISBA 3OFKA 1JDTA 2R8BA 1UMBB 1PFVA 2R68A 1V6AA 1X1DA 2RB4A 4G0WA 4RD3A 4YCDA 4EVRA 2PMFA 5SYNA 3H4TA 4KWCA 2O2IA 1NBIA 4OVKA 5K8VA 2NMVA 2EFJA 2Z0MA 4Y2XA 1KZ7B 3C4VA 3G1TA 4MMXB 4A0FA 4YUAA 4QO7A 5JMTA 3NASA 3EX7C 2NP7A 2ONCA 2BGUA 3L49A 2EKBA 4XDYA 4BNFA 5D01A 5EHNA 3W34A 4D9HA 1KS9A 1OT5A 4BP3A 2AQHA 2F1KA 3B9BA 4ZYZA 5CLJA 3QHQA 1L8OA 4HDRB 4Y2GA 5DM60 5FQNA 5IVDA 1R6TA 1N57A 1R0XA 4QT4A 4BX2A 1C29B 2WTXA 4QYMA 4CKEA 5K20A 2ZZNA 4IXTA 2IEBA 3TRDA 3Q3GE 2D5CA 2XWBF 3JQGB 5WRFA 4NWIA 6ABPA 2NU8A 1ZFNA 2WYVA 2WUGA 1B15A 4EJMA 3PPVA 2YYZA 3C16C 1BX1A 3IMGA 5CNMA 3R75A 4EFMA 1RWMA 3VR2D 5E1MA 4KIJA 2YTZA 1KOFA 4B7UA 4AAYA 4ZOLF 4E2ZA 5JNVA 3R5HA 1J42A 3NORA 3NDIA 4KGDA 1ORWA 1J2RA 5EINA 3TE7A 4AVYA 3PQ8A 4BJHB 4EF6A 1U0RA 3QKSA 4NBTA 2NVWA 4R3NA 3AF6A 3AUSA 1PLKA 5DDIP 3GC6A 2ZSHA 2XI4A 4F7DA 3U4GA 4K1XA 1D09A 2W70A 1LK5A 3D3NA 3ROGA 3VISA 1ETHA 3ZOZA 1NJ1A 3UENA 3QU5A 1T8UA 1GD1O 2PVSA 2D7CA 3B6JA 3N2ZB 5FUWA 3U7QA 3BMNA 3UK6A 3RS2A 3NHJA 3VR6H 2C97A 1DJLA 2X9VA 1QE0A 1X80A 2K6GA 1LLUA 2W8ZA 3HCFA 3GJ6A 3M6XA 4PC3A 1I4TD 1X7WA 4LJ4A 3VDXA 2VOEA 4GYYA 1WV0A 1E64A 1GSOA 5IVIA 5IKPA 3MS2A 5J2TB 4CN8A 1FRNA 4Q66C 5ALFA 5KCMA 1O8CA 4E33A 3H2SA 1MX1A 2JBWA 3PHLA 1HDRA 3T1YB 1JDNA 3WBBA 1Z5NA 3RFXA 1GG2A 1T0BA 1ZGGA 1KY4A 4RPIA 1C41A 3UC5A 1ZICA 2PLFA 3UBMA 4CFYA 1WXQA 3MFQA 2EDCA 4BVLA 3D4PA 1RKUA 4AD8A 1PSDA 3NLLA 3L7IA 3ANSA 1U5BA 3ASUA 4GGOA 4BN0A 3EVZA 4CF5A 2R48A 1GT6A 4JX9A 5ESDA 3MUEA 2ZWAA 4ZKEA 1ZITA 3A9TA 1Q22A 1LLQA 1TLTA 3LC1O 4HQFA 3IURA 4CV1A 4C78A 1HEIA 3U9SA 2R8YA 3EXAA 4F3KA 4MV3A 2BISA 2WKPA 2J5RA 4CL0A 2WNHA 3AP2A 1G21B 1KYIA 5H9WA 3FYDA 1JHQA 2F43B 1C0LA 1Q95A 5E6RA 2NVUA 3P2KA 5F3RA 4EWLA 1FRFS 4DIKA 3JWHA 1VLMA 2GXQA 4JJGA 4D82A 1OR8A 1E2KA 3C8MA 4WK0B 4ENQA 2FLWA 4MV8A 2A1UA 1ZN9A 2OHOA 3AFOA 1NJ2A 3HADA 2YY6A 3HHPA 2QLJA 3VOBA 1ZONA 4DV2B 2LRHA 2A94A 2QM0A 2FSHA 3C3BA 2CNNA 4XJSA 3L92A 1GTSA 1J0CA 2O6LA 1Z7BA 3DJYA 3WO1A 5BUQA 2O6HA 3UWOA 3C3MA 3DMTA 4JQZA 3JYNA 1I4EB 4QT0A 1DJOA 3HYRA 3WHLA 3MC1A 3UHFA 1H1LB 1QYDA 1WD7A 3O9MA 1CDEA 1UPCA 5CFZA 1KEUA 3NDBB 1SUPA 5FI3A 2AUNA 3AKYA 5T67A 1Q74A 1C4KA 2WWIA 3AUKA 2XHEA 1M6VA 2ZWMA 2Z6VA 4EEXA 3WL7A 5T4FA 1FQOA 1PRYA 4TWZA 1JV2B 1JIKA 2UYQA 3AP1A 2X0DA 1N3IA 3SKXA 3WC4A 1A2BA 1U2EA 2CNWA 2GLXA 3SPXA 3WJ7A 3EDMA 5CDFA 2W6JA 3FRHA 2BEWA 3HO6A 4B2LA 3AESB 2QVGA 1GU0A 4X7PA 2R97A 4UBLA 4UNQA 4AWBA 1EVZA 1CHDA 1NULA 3WLEA 2EKZA 3VSAA 3SSAA 5K01A 3TJMA 2YMLA 3VC1A 221PA 4JJKA 1BZYA 3I83A 1U90A 3GZJA 3ENVA 3MHPA 1MTOA 4AFNA 5G4LA 3K96A 3FZNA 4XYMA 1APBA 3FPBA 4W5QA 2Q4EA 1N33B 2PZFA 1CNMA 3W3AH 4WOKA 1R3DA 4JYBA 4ZVNA 3LUJA 1A7UA 3H1PA 4L6CA 1JRLA 2ZE5A 4K6CA 4LCEA 5EMLA 5HVNA 5JXIA 4BEVA 3HGMA 3QEBZ 3ZXUB 2F1HA 3MWJA 5F73A 4AKEA 1K0FA 4D9BA 5BV2P 3GYGA 2VNJA 3D5EA 1CUDA 1QF9A 3JD3A 5K8CA 1T1RA 2JFFA 1L5LA 3W04A 1UDRA 1J8QA 3TOZA 1OZ0A 2D6FA 1LLFA 1MIOB 1PT5A 3ACCA 3HXTA 1PTKA 5DXFA 2X9LA 1A9YA 1AXRA 3KVRA 5EJEA 4JLNA 2VJNA 5JS6A 1FFCA 2NUBA 2QQ0A 3H2KA 4DLUA 1TIPA 1XAGA 2Z04A 3IKJA 4BO6A 4E3WA 5AUPB 3HJFA 1YVDA 2FWIA 3HUDA 4B1FA 2AG8A 1DUIA 4HGYA 4RKYA 4CCYA 1PLLA 1P0IA 3H86A 5AI6A 5E9WA 4BRZA 4DSZA 4E07A 3HCPA 4EATA 4PC6A 3K0CC 3EXHC 3GNTA 2JIQA 3R0IA 3O4JA 4MV9A 4B3DA 1W52X 4RBNA 1FK8A 2AJ8A 5KNDA 2CDBA 3WRVA 3IMFA 4IOKA 2PZ8A 4BCDA 5KBYA 2J6BA 1SQ5A 1F2TB 4P1ZA 3HXQA 4DIUA 2ZK7A 4DLKA 3GNSA 3N2KB 4U63A 5KYYB 4N8DA 1J21A 1DEOA 3D0OA 1DEXA 4N5HX 4PPFA 5JI2E 4IVPA 3HNPA 5L8VA 4CEIB 1TVEA 3KB6A 4A6DA 2HFKA 3UFBA 4PWYA 2ZE7A 4FDUA 2B4KA 5H7XA 1MOPA 1V4VA 2IXFA 2XMRA 5EUCA 2IHYA 1ZUWA 2ZXEA 5H02A 4F06A 3L7YA 4TXJA 5JAQA 3AGPA 1KH2A 3FMVA 1OI3A 2PEYA 1A4IA 3OEWA 3PXEA 3EG9B 4G5SA 3L0SA 3O82A 4JZKA 1QO7A 5JCJD 5GJCA 1M0TA 4LMPA 1XWWA 5D5PA 1J0XO 4NBUA 3QFHA 1W2WB 4P4TA 1F17A 3AF2A 4O4LB 1ZCZA 5HBGA 4AY5A 4JBWA 2XA1A 2WR8A 4LZWA 3KJFA 5EYPB 5AYVA 5DX8A 4FOLA 5H5JA 1Y8QA 2C31A 4QVIA 1NW6A 4KIFA 3F8SA 1GIAA 1W36D 1RZ3A 3T5DA 4NX2A 4U6QA 4Z9FA 1TQ4A 1XTUA 2PL9A 5CB0A 2HPAA 3HCBA 2XNKA 4F9GA 1E3MA 2NO6A 2OCBA 3WNVA 3D8TA 4B3XA 5JJBA 4IR7A 4ZREA 3MTEA 2WHEA 4RZ3A 2BUCA 4M9XA 1ISJA 4TUYF 3M4NA 5AQ1A 2B3TA 3LP5A 1IATA 4C05A 3H4IA 3ISTA 4Q4JB 2LGJA 3SC6A 2XCRB 3QVLA 2SKEA 1IXKA 2PWYA 1R15A 1E3JA 1SCUB 4IDNA 5JMPA 3WY9A 5FWAA 5IPFA 1XVVA 1XZHA 2Z2IA 2D2XA 1MNQA 4TVSA 2Y1GA 3AFHA 3S5UA 1JTEA 4ABTA 6NULA 3ZVKA 3A06A 4CFSA 5A2GA 3ZTWA 4CBVA 2VP2A 1HT0A 2LV8A 2JFHA 2P4HX 3FNGA 3QKUA 4NJOA 5KKCA 1R1DA 4S04A 3U09A 2D2FA 2X0RA 2C5BA 3AL2A 3MK31 4OJKA 4TTRA 1JVNA 4LE1A 3V48A 5BMVF 2UZ0A 1UT8A 4W5NA 1PCXA 1D5CA 2N9UA 1FXSA 1HKHA 4G2NA 5ARCA 3RLIA 3B53X 5FPSA 3L1HA 2AFHB 2R1TA 2FE4A 1Y8RA 4HDKB 2PA0A 4FFNA 4LWOA 3FPKA 3MIIA 3NXSA 4HX5A 1XZGA 2NO4A 3AB3A 1AHHA 3JQRA 4KAAA 3D59A 2B4RO 2WSSA 4WESB 3ZJUA 1XTIA 2AXPA 1D6JA 1T8TA 1VP3A 1N2IA 3L7JA 2FEKA 2FP4B 5GJWC 5DTJA 5REQB 2ZIVB 3EBOA 2OGTA 3QX9A 2HXYA 1VKRA 4HJXA 4IGFA 4I6EA 4TLDA 4R2KA 4UM7A 5HILA 3LUAA 3IUNA 2VDVE 3NGMA 5AM5A 3L41A 4QPPA 4XGKA 1BKDR 2ON6A 1DP4A 4ILKA 4Y6PA 5EQJB 1BKYA 2NUTB 1WVGA 4LKOA 1GXSB 2EHJA 1HNZB 1IDN1 2XDQB 5CIQA 1VRWA 1S2OA 2JCGA 3CGGA 1H2FA 4QPNA 5CA1B 5J5AA 1Q91A 1OBVA 3OZGA 1SIOA 2XY4A 3PUKA 3UOGA 2A5JA 2NZ2A 3PE6A 3PYMA 4JLVA 1U99A 3GROA 4ZYWA 2OEPA 1BHQ1 4TV8F 4MB0A 2MSEB 1W5TA 4E4TA 1VHLA 1NF3A 4WWHA 5DZSA 3WYEA 3T9CA 2I4LA 4H7HA 4MW1A 1EYZA 1M2KA 1LNZA 1N1EA 2QT0A 1I94B 2ZU0C 5A6VA 3IT0A 2WKSA 3S1SA 3R2JA 4Q9DA 1Y63A 5KVCA 3E8MA 4L3VA 3H1TA 3VFDA 2PFKA 5LA6F 2AXEA 1GSHA 1C9JA 3IAXA 1JHMA 1GNVA 4BZQA 2ERYA 2ODQA 1LUAA 1DJQA 4QPZA 3D5QA 4ZXPA 3MCAA 4Q9AA 4RVHA 3QELB 4B5KA 1E1RD 2JCXA 2SKDA 1N2BA 3TIIA 1XTTA 1UJ4A 4TQUS 4Z4EA 4JODA 5CT9A 3HWWA 4OYLA 3DE3X 2HYIC 2GN4A 2G82A 3IYLW 1VPWA 3D8UA 1P91A 1I24A 3DG9A 4NXNB 4XPZA 1E4YA 3NFYA 5LYJF 3U6KA 4NICA 1EHIA 3IKTA 1JSXA 1SHJA 4CT0A 4EAQA 3T3MB 3ANXA 1P6QA 3PQ5A 3FRIA 4WZZA 1OI4A 2ZTUA 3U13A 3VOSA 2WU8A 1NQOA 3JYHA 3ROPA 2VPIA 4EGSA 1WB6A 2Y93A 3SLGA 4G09A 3GW8A 1XNRB 3ADCA 4ARIA 4HVLA 3K9LA 2BOVA 4DCOA 1YULA 4LISA 1UOPA 5EE5B 4BXOA 1NBME 2HRCA 3NVMB 1PT7A 3VNBA 3DHVA 3RSQA 2ADMA 4HH4A 2C7BA 1EDOA 1SG9A 2XRYA 5KOJB 3DTVA 1M2VB 4F5EA 2FB9A 4MI1A 3SDZA 2KE5A 4GLOA 4L8GA 4C7MA 1YRAA 3KWLA 2LP4Y 1Y9AA 2XGGA 1N92A 5BSFA 1Z45A 1XU7A 2ZKLA 4G0UA 3QNUA 5B6PA 2H4YA 1RWBA 2GVZC 2BR5A 1IC6A 3T95A 2ZS8A 4PGHA 3UWMA 1TK2A 1T4MA 1M72A 1ZOOA 3F9CA 3TSOA 1WMBA 2EZ9A 1MVLA 3VH2A 2FPSA 4LHWA 1M66A 2K7ZA 1FSGA 2JLAA 2W58A 4HAOA 4TT8A 5KWSA 3GLIB 4AS1A 3GCWA 4B43A 1ECJA 4TM7A 4CLRA 3F6BX 4K9LA 4DY4A 4QBTA 2Q6OA 3IUQA 5CDYA 4HFRA 5K0SA 3CWZA 4ZVOA 5LYYA 4G97A 1KFJB 1K06A 5EN4A 5T4EA 3JWEA 1Z47A 1OFUX 2I6SA 2QN8A 3KQOA 5FA8A 4TMWA 2ZPAA 1CPYA 3SLRA 1YUBA 1Y7PA 4GU5A 2EQBA 4I2VA 1V5IA 2PMBA 2PO7A 4XDZA 1PHPA 1RC1A 1UDXA 3EC1A 3TPFA 3TZQA 1MRSA 3EA0A 3O2JA 5ILOA 2VDRB 1YS9A 4N0DA 2IXTA 5F64A 1DKUA 2MT9A 3E18A 4AUEA 1NHWA 1ZMBA 1QTIA 1ZVVA 1Y33E 1XIVA 4Q3EA 4QNRA 5FO1A 1UZNA 4U4AA 4L6IA 4WFKA 3EGXA 2JS7A 4GL4A 5J63A 2YV3A 3CN7A 3MCUA 3K0AA 5FUVA 4GFDA 1Y1LA 5HM6A 2XMBA 4KBYA 2UZ3A 3F3YA 3TTUA 3OH8A 4NU5A 4ZT3A 3QKRA 1VGQA 2UVQA 3BIXA 5ICFA 2QVXX 1J8VA 4PXAA 1BVRA 1EDDA 5CP8A 2QI9C 2GS9A 3LPCA 4PN3A 4QIHA 3RV4A 2RGNA 1E2NA 1EX9A 2OCAA 1F3OA 3MZ0A 3CEMA 2ZSKA 2FFHA 1VL2A 2CJXA 2MYPA 1DIOB 2AWNA 1XRMA 3JQ6A 5BN3B 5FTJA 2FVXA 2I0FA 3G5TA 5L3SA 5CD1A 4ZO8A 4QOJA 4OPMA 4YMWA 1LSUA 1T1EA 3K53A 4HNQA 4M8SA 5F7JA 3RBAA 1GLVA 2ENUA 4AZTA 1S2IA 4YPOA 1EFVA 2J46A 3QSYA 2V4UA 4PX3A 1NNSA 2O23A 4JVSB 2JIZA 4KK4A 4PSUA 1LBQA 3ZU5A 1DTEA 5LA6A 4OATA 3IQHX 3TUJC 1XMIA 2REQA 2YH2A 3EA5A 2PX6A 4NE2A 4HDQB 2GBGA 3GA5A 2CJFA 5G0WA 1E9RA 4UMEA 5FULA 1HDZA 3RFUA 3DYVA 3SC2B 2H9AA 4JOCA 3GEIA 1XCPA 4LW8A 2ZDQA 2QTHA 3VPHA 5DK4A 1OY1A 5F23A 1YB2A 1JECA 4HATA 4A82A 1RKVA 4X41A 3ZDDA 2J9FB 2BFCB 2AB0A 3KOUA 3OX1A 2PZJA 2R4UA 2DFVA 3F1KA 4KP7A 4GQIA 4HGQA 1NNEA 2W2LD 2I4OA 5JAZA 3MOIA 1WX1A 5EKUA 4RO0A 2JGFA 2VR1A 2HHAA 2WG0A 1TEHA 1D9ZA 1SBIA 2BKVA 2VA8A 4N7RA 4NJMA 4RKWA 4KR6A 3PG5A 4LDZA 5KAPA 2VRNA 4Q39A 3GEEA 4S0ZA 2VSYA 2P3LA 4CZ2A 4ZALA 2QX7A 2X3YA 3IVXA 4IOJA 2CUNA 1R6XA 2ZGVA 3D8BA 3I0ZA 4G23A 2MYUA 1HDIA 4F04A 3PPXA 4IH1A 1V8OA 4H0CA 5YASA 2CLKB 3CH7A 2AMJA 3TJZA 1E1MA 3ZVLA 3R8XA 1EBUA 2QM8A 1AC5A 3FR7A 2EG9A 3KTOA 3R6GA 4XGRA 5CGQB 3I6YA 4E4RA 5AVZA 4M7RA 3AHFA 4DLWA 4HTFA 1GPWB 4HLUA 4XQ9A 2YXLA 3RVKA 1QCYA 3S3TA 2AD1A 1KDYA 4MV5A 3TTVA 9LDTA 4DDMA 2DEUA 4E5SA 3QWAA 3OLZA 3F8WA 4RJ2A 5DIFA 3KKOA 3WNZA 1P6UA 1YAJA 4MVXA 1G8PA 3TD9A 2RG1A 3NYRA 4BX8A 2J0EA 4JAVC 4V0SA 4PO3X 1P2VA 1ZSYA 2V7UA 3ZWVA 4YRSA 4Y2RA 1JQAA 1DG3A 3BUSA 1H6AA 3EXIB 3ZI0A 5ECGC 3AU8A 5B3JA 5TARA 3FH0A 4IF6A 3M6IA 4TKUA 4TXHA 1JFTA 3AEQA 4TZ0A 1USWA 3KSUA 5JDCC 3L0BA 3BSSA 4DYHA 1MO5A 2JHFA 4LDPA 3P5BA 4L57A 1M10A 4P3PA 4RD0A 3U62A 3DB1A 1E77A 2LPMA 1X7GA 5DYWA 5FEUA 3PHGA 1WD5A 3RM3A 3WGMA 4BX0A 3GF4A 1YCDA 4MQUA 2O2DA 4CM3A 4AKIA 1HNNA 4QTUB 2CFTA 1PW5A 1HDXA 4RVSA 2QM7A 3KYDA 4JNKA 1E3QA 4B3HA 4U7DA 4OTZA 4Z1MD 4FI3C 1SXJA 1E9DA 3X1DA 3IJPA 2Q5FA 5THKA 1UBCA 1VKZA 3GVIA 3RBZA 1JWBB 3ZU2A 1WXEA 1P18A 5KNBH 2NYUA 2JLVA 2VK8A 4MCIA 1USUA 2Z8YA 4YIKA 4JYPA 3QXHA 2DB3A 2N1MA 2ZUSA 1EXNA 1BHJA 2G28A 5DLQC 1VQ1A 1LDMA 1Z2DA 3FOBA 1J5XA 2BUAA 4BTLA 4GBJA 3HJUA 5CHYA 4FN4A 3HFRA 1FC0A 2ZIEA 3MT9A 1EVQA 4UNPA 4D3SA 4E2YA 3GBVA 4XPIB 4HH0A 4MKZA 4ZT2A 5AXBA 5LU9A 1LXCA 1DC7A 2V54A 4FEEA 3LWZA 2Z2KA 4GP7A 1H4VB 4LXXA 5TY0A 3SHVA 2NPFA 2EL9A 1QH9A 3KAKA 4POAA 3ABIA 4JFRA 4ARBA 4D8UA 3HB4X 3ZK8A 1EINA 1S3SA 1Y37A 1NXXA 2D5BA 4RHXA 2YN0A 2CFOA 2C04A 1TW2A 2O2SA 4J4TA 3DFKA 4QULA 3RASA 3SHOA 1E2IA 1FUYB 1FYVA 2RIRA 4WESA 3WLLA 3ZJ4A 3PHHA 5HP4A 1ENOA 1OWMA 1E2PA 1G8HA 4I9NA 1H85A 1RLMA 3W9UA 3SFTA 2HSDA 3BL6A 3QWIA 1IY2A 4RK7A 3CIFA 4OQXA 4CUZA 3MWEB 3LKZA 2AJBA 2LVBA 3N8KA 4GX5A 3HPRA 4JB8A 4QUEA 5AVOA 3VM6A 5E9AA 2C96A 3JSAA 3AB7A 1QX3A 4R0MA 2C00A 4FCTA 5EUMA 3BXPA 2BT4A 5K09A 1P33A 2AZ4A 2WM3A 4KQEA 3TTWA 4D9KA 3DDCA 1UWVA 3KT8A 4TXNA 1P8AA 1V2HE 1W4RA 1RRGA 2IW3A 5AKKA 3HEMA 5A02A 3BFVA 3AHHA 4J0DA 3L3BA 1FNBA 1ZM4A 3EVDA 3FDZA 4OCZA 1CEXA 3KZMA 1QRUA 1EK1A 1YQXA 4YNBA 1ESEA 3HBMA 3N5KA 4NMWA 2EG5A 2MINB 5KYUB 2CZGA 1EFRD 2CVOA 4DCSA 2L0XA 4OGKA 1JDZA 1X1AA 3UJHA 5DOZA 3HM2A 1R5BA 3D6HA 4BKUA 4EECA 1GRNA 4HN9A 3BL5A 4ZVSA 3T7CA 2E4XA 3NHZA 3Q6IA 2C61A 4M89A 4R7ZA 3R5KA 1QAQA 4J94A 1ZK2A 1SR8A 1QYIA 3PNYA 4MUYA 3VR4D 7MDHA 1XXLA 1NXSA 3WGNA 5ALSA 2ENWA 5JJIA 1LB1B 3RIHA 3H9UA 3A58B 3OOHA 4IUYA 1XZFA 2ZSAA 3KUDA 4F12A 1R8JA 4HVCA 1P9LA 4IKOA 2Z6QA 1QGZA 2P62A 3GCZA 1GYPA 3L6EA 3LQ2A 4N3GA 4DWVA 5BW8A 1IBMB 3C8HA 1CB7A 3KZVA 2X0IA 3G2OA 4BKPA 4EJ6A 2C20A 5KINB 3A6FA 2II6A 1IUNA 4ETIA 3NWEA 2HJVA 4AUMA 3MGBA 5C4MA 3QE2A 2RI6A 1XFDA 1VSUA 3WLAA 3RWBA 1IRXA 4CIDA 2I7VA 4FDVA 4WT7A 3B13B 2C4MA 5AVKA 5A6SA 1NVKA 2ZCVA 3OKFA 3P97A 3AF5A 5HF6A 4EQ6B 2FXVA 3MTIA 1E3IA 3UV6A 2ZE6A 4D7AA 2OFOA 3B2QA 3ZHSA 5C3MA 1L5OA 1E6CA 1WMAA 2FW6A 2VNKA 5BP7A 5AVUA 1R4MA 2D74A 4FOPA 2OM2A 2Q3CA 2IU0A 1FTGA 3MLAA 1QGYA 2VZ8A 3BWBA 3O4VA 4L8VA 4MV1A 4UE3S 4ZGWA 4L4ZA 4FMCB 4J4HA 2GA9A 3I0NA 4K7JA 1LPNA 3IP7A 4G36A 3BS4A 1TQDA 3TCKA 1Q1EA 1WP4A 2Z2YA 2ZRHA 2TSYB 3ETCA 2HNAA 3HABA 1CNEA 2D62A 2OXIA 4DJAA 4EELA 1N6LA 1W93A 3CR3C 1H0RA 3U80A 2FPUA 3KPVA 2W0SA 3CLTC 3QI7A 1I4LD 2YWFA 3VR5D 1PJ4A 5HGXA 1V3VA 1JXQA 2OHVA 3E9ZA 3M2TA 3NKLA 4KJXA 3K8ZA 1O0CA 4F4UA 4DXDA 3N28A 1KMHB 2FSVA 4OHZA 1TA0A 2WUFA 1F4VA 3I8XA 3JQFC 5EIEA 1XVUA 1ONNA 3KHTA 4OK3A 3ZJVA 1LRKA 3KJNA 3NCTA 4RIGA 1I3CA 4DR7B 5TMBA 4BLVA 2RMKA 2CXTA 1DU4A 3DZHA 4ZCPA 3W2HA 2GZHA 2CXXA 4FHFA 2A78A 4R8LA 4YDHB 4BJ1A 5LKRA 5IN4A 1HDGO 2VHTA 5BYAA 3B5EA 4GPTA 1E2BA 3C3AA 3LUGA 3S28A 1WUKS 1TD9A 2IXEA 4OI2A 1KFKB 4XAQA 3TKLA 1AQ6A 2GWHA 4JVOA 4BWVA 3QKIA 2O8FA 2WYOA 4O08A 2Z8YM 1HY3A 2BF4A 4DC1A 4TMTA 5JY6A 1E1CA 4KWEA 1M3SA 4XM2A 5K0NA 3LUBA 1MAUA 4QBHA 1LJ8A 2CVPA 3F6SA 2J6IA 5CLIA 4I1VA 4V1CI 4W1RA 5EE3A 2XQVA 3ZHZA 1F5NA 1H5NA 2QSYA 5HJ2A 5CDUA 2X40A 3ELDA 1VIVA 2QE6A 4JQSA 5FBQB 2IYXA 1R9NA 4M1KA 4PZUA 5BR8B 3AF1A 1TAQA 3ON5A 1C2TA 2RCYA 2GJSA 5A3VA 4O8CA 3H5LA 2OTCA 4J7XA 1BWPA 1T2CA 4OB8A 5IMBA 1DG1G 3EDQA 3WHIA 4HVAA 3THYA 1EQUA 3DQPA 4RMJA 2J30A 1EFPB 2I33A 1FUEA 1OC4A 1Q7CA 2QMYA 2XUQA 2ZYIA 3M70A 4BFTA 4EEZA 2A1TS 1A8HA 3WISA 2P6MA 3TZKA 4B8ZA 3QKTA 3QF7A 3O8QB 3DCJA 4FFMA 3C45A 3CZ4A 1LJUA 4MVJF 1YRHA 2HUNA 5B5SA 621PA 1GZ5A 2H31A 2J7KA 4EDFA 3AT1A 3MT0A 4LFAB 3D8NA 4G0OA 3RS7A 5FV7A 3MMPA 4CM8B 1A77A 4WOCA 4FMDB 3L8EA 4JJ4A 5E7IA 1TAHA 2BTQB 2RI0A 4HYYA 4RK0A 16PKA 3KLMX 1S2NA 5EJMA 5IVHA 2XOKD 3LQFA 3NG1A 3P9YA 1X42A 3GH3A 2BEVA 5ECWA 4ZCLA 2PYZA 2OAP1 3G9QA 1QFSA 1JFVA 2RBEA 2FI1A 1XTJA 2QN7A 5GIPE 3UM9A 2XTJA 1SK9A 5LUBA 4DMLA 2IH2A 4MS4B 4YH1A 4GUAA 4M1WA 4E5MA 3ZDAA 3ICQB 3TZEA 3PQDA 3AGQA 4L0QA 4H1WA 5HE9A 4LNAA 3MGCA 4ZRMA 3TG8A 3G0IA 2GPAA 2XT6A 1XJCA 1TT5B 3NYQA 5JYBA 1HTTA 2CUZA 3PWTA 2QQ5A 4ZV9A 4FGSA 4R8RA 3PNOA 5IUKC 4EQZA 5C8DA 1G5FA 3RTCA 4FYYA 3OZ7A 4RHCA 2X7JA 4X6YA 4FNGA 2ECKA 3RG8A 1CUVA 3GEBA 4Y2HA 3TXAA 1UBKS 2F7SA 2J5KA 2J9XB 3GEHA 3LA6A 4KYIB 4ROSA 4W8OA 4YALA 3T3HA 4ENVA 3RWMB 3PZRA 2ZVPX 1WXXA 1RT9A 3SZRA 3KUKA 2CBXA 2NIPA 4JR2A 3QLUA 3QWHA 1QZ3A 1PDWA 1H2WA 1EBBA 2FEAA 1ZGCA 2VG8A 5I5GA 5K8TA 4UDOA 1SA0B 5K9ZA 1CUGA 2CC2A 2D3TA 3F67A 3OAAA 4IUCS 4U9IS 4WKNA 3SYNA 1Y4DE 4OXQA 2VHQA 2NSYA 2VJQA 3AR5A 3GDGA 5BW6B 1A69A 3VYRB 4YJHB 4PG7A 2YDYA 5ABPA 2OFWA 1HZZC 2ESRA 3DBOB 5GPBA 5CDSA 3K2EA 4QKQA 4EF4A 1A9OA 3EW7A 4KWHA 4FHCA 3CGWA 4KE9A 3ERCA 3RHFA 2C4KA 3HCDA 4CKWB 3GUCA 3JQPA 1K68A 4NOJA 3WICA 1USGA 4A2WA 3SJAA 3IKMB 4ENUA 1R74A 4F1WA 4GOOD 4I8IA 1BU5A 2W6OA 4NIMA 4UEWA 3SBEA 2B4TO 1JLLA 1G41A 5DFAA 4O8ZA 7ABPA 1JXAA 3MN1A 1E7MA 4FE7A 2OWEA 2OPHA 1B3BA 5BR1A 1SVIA 1MP0A 1A95A 3SCZA 3U48A 4EPYA 4PZDA 2BHSA 2O2HA 3MUFA 1PEKE 5AKZA 4HRVA 4IIJB 2VSQA 4X65B 1HT3A 4KLCA 2B2XA 2NZYA 3QEJA 5F4BA 3VZDA 5FL7D 1FP6A 1N0WA 1XXHE 4XJVA 2YR0A 5CMLA 3TW0A 1KVUA 1Z33A 2EBFX 2O52A 2HUPA 5J2TA 5KYWB 1H5QA 1UL1X 3BMCB 1FP7A 1DT3A 1Z4MA 2HMTA 1YIAA 4IH9A 2YS6A 3GJZA 5UKDA 4K5QA 3ZQJA 2QPOA 4W9NA 1NXOA 4MHSA 3NVAA 2KMLA 5HF9A 2OV1A 2F3PA 2H3EA 2ODTX 4Q01A 1VZ3A 4JT8A 3FTFA 1E7RA 5C32A 2C7RA 1JEOA 1OZAA 1WSAA 2CB0A 4MI9A 5EOVA 2PTHA 5KHLB 2WMYA 4KXFB 4OHXA 1XZMA 4JC0A 4QVKA 3IAS6 3IAM6 1OC2A 2QUBA 4JFAA 2IUTA 2ZAIA 1CVLA 3O4FA 2O8EB 3K2IA 1TE2A 4FU0A 1JYSA 4JI6B 3SHQA 3FNQA 2AQKA 2DU8A 2ISQA 4F4CA 1P7WA 4DW8A 4DLXA 2BC9A 3OE7A 2C4NA 2B0CA 1JDBC 4FZVA 4HZIA 2E4YA 1I2DA 1TZ2A 2Q1WA 2Q9BA 1SRRA 5ERXA 4MDHA 3EFBA 3TR5A 2FX5A 3PICA 3FETA 2Q5QA 2QV0A 3HDQA 5KOHB 2CJYA 4WN3A 1JLKA 4YRPA 4OHYA 2JDID 5BV8A 3CVUA 2YVQA 1F6BA 2QRJA 4E5KA 1YS4A 4X6XA 4FFBA 4GZ3A 4I5GA 5CCXA 3KETA 3VRHA 2JIZD 3TEJA 4RK6A 1O6FA 3WGUA 5J2UB 5KWVA 3S2ZA 1XNJA 5LWQA 1AZTA 3D0QA 1QCCA 2V59A 3QOYA 2O1XA 3W0LB 3DOFA 4J29A 4JI5B 1JKFA 3IPYA 3COJA 1FDSA 4KZKA 2GN2A 5JAUA 4JT2A 1VIDA 4L3WA 3VJLA 5CTJA 2Y1OA 1XQVA 1XMJA 4WFJA 2XLBA 1WHTA 1AGPA 1TLFA 3WYFA 1WOYA 4R9UC 4OKNA 1QPGA 3CJQA 2BAGA 3PPIA 3PE3A 5C5CA 4R0NA 1G98A 1LVHA 4ER6A 3LGAA 3JQ8B 4U39A 1CERA 4JEUA 1Q0RA 2QG9A 3MMSA 1WY5A 1XA4A 3U56A 1NASA 1O96B 2AJTA 2ZAMA 5ALIA 1W44A 3EEOA 2G7ZA 2J4FA 4R54A 2Q1TA 4OH7A 3O2NA 3WQHA 2LNDA 5F9HA 2QTZA 2V4MA 4NOKA 4ZVPA 1EXVA 2B69A 2FG6C 3CISA 3WK7A 4HNTA 1P7CA 4LGMA 5LQCA 4DUYB 4F8YA 4FDLA 3UA4A 5ALXA 1L5SA 1WEKA 3AR4A 2PQ0A 4IL5A 1UBEA 1VPVA 5HM8A 1UM9A 1Q0PA 2GYWA 3PIIA 3R5XA 1JILA 3NOOA 4EL0A 4BFCA 1F48A 3GHHA 1YR9A 3HB1A 3KAQA 4Y2PA 1GRRA 4DZTA 3WGZA 3NTRA 3DL4A 3K92A 3SIPA 4M7OA 2EKLA 2M6KA 4L8FA 1SVSA 2I76A 3C3PA 1GTRA 5TQ2B 2ZUDA 4PTZA 1PQYA 2HA2A 1SQ6A 3COZA 1PJ8A 2XDQA 2IV7A 1RDFA 2VUUA 3RIGA 5CB4F 4J0KA 1NVEA 3I2KA 1RI5A 4U7TB 3USZA 4EPRA 5JFTA 1TT7A 1IVNA 4EA8A 1P5JA 2WWVD 4AKSA 1XLTC 1PJRA 2JCSA 4G81A 4KOAA 3LY8A 3DULA 4QBGB 5B6IA 3T3EA 1DEAA 3IA7A 1G7CA 5KEIA 2M9MA 3FZYA 1NFFA 4F6LA 4JIGA 3PHBE 2X4DA 4IDGA 3H0EA 4KH0A 4LYGA 5F35A 3WMEA 4IBOA 2NUPB 3RVQA 1DMRA 4OHVA 121PA 5FHQA 2QAIA 1YC2A 1UC9A 5ER6A 5IAKA 4BNWA 5ITWA 2XKAA 2ZBFA 4IGKA 3G0GA 3DO8A 1DARA 1EVYA 1PWXA 1IOWA 3JRNA 4PE5B 5IXJA 4BC0A 4GDFA 1ODCA 1TMYA 1A8SA 3ACDA 1A2QA 4DN6A 1A72A 3ZHYA 3RUFA 4F5WA 3R77A 1IJKA 3M9XA 1YRQA 2H7CA 3O6VA 3PT9A 2F3RA 2PWPA 1K0UA 1VOTA 1KYQA 3DO6A 3H6GA 1HYBA 2GYUA 4H7FA 3SMQA 4ZYTA 4WZBE 4BMPB 1BTOA 3L18A 4TX1A 1Y1TA 4JLAA 2BP7B 1DKPA 3KUXA 5GM2A 5KQMA 1P7PA 2XV1A 3G0CA 4IRXA 3AM5A 4O3FA 5FPHA 3LBIA 3GL9A 4B2IA 1PP4A 3D7MA 3O92A 5CVDA 1KRHA 1L5FA 2PH1A 2BM9A 1IIRA 1YS6A 2WHPB 3AHCA 4EG5A 1LSSA 3EIQA 4ZP1A 4LF8B 1NAHA 3JARA 3JS5A 1A7KA 2Y1FA 3L0IB 4YP0A 3DFUA 2I4RA 3GU3A 3PNVA 5ARDA 4AICA 3RLFA 1A04A 2DWCA 3TTTA 1ABBA 3FSEA 3WYCA 1MO4A 4Z2AA 1BG6A 2P9QA 2Q9CA 3AP3A 4ZVVA 3TOSA 2DBQA 1YFJA 1T2DA 3VMMA 1K5PA 2BN4A 1KSJA 1YZQA 3JQ7B 2IOHA 4XEUA 1K7YA 4GRIA 5AHKA 5TR9A 3O5AA 4ZANA 3FPLA 1MV5A 3HDYA 1PUIA 3FJOA 3CNBA 4IDDA 1MB3A 2IWRA 3FWYA 3RT7A 4B85A 5GOZA 4DB4A 4WLEA 5AVYA 4L22A 4I4IA 4TWJA 3NCHA 3ZDEA 2JJYA 3IB6A 1Z25A 5L6MB 3T0GA 1YGPA 2GYYA 2WKRA 3FR8A 2ZJFA 4J7UA 4P32A 3W6OA 3KSBC 1G8KA 4GVLA 2GCGA 4RFVA 3RHZA 3ZCSA 2YJ3A 4FW8A 4EUHA 1UK8A 2OBXA 3GEMA 2CHVA 4CF6A 2I3DA 2WFMA 3P4XA 3A9WA 1VMAA 3SP1A 5FCDA 5LFAA 1VE6A 5LC1A 1DBVO 4DG9A 3BWMA 3FCYA 821PA 4QYTA 2BHTA 1F2UB 1R9GA 3FF1A 3I2IA 3BMQB 3EIHA 3P96A 3OQIB 3PQ3A 4M1QA 3L0ZA 4UM5A 1XTBA 2B7BA 3I52A 4RANA 1JP7A 4RELA 3A6PC 3CU5A 5JTUA 5SYAA 1P1FA 3U0VA 4HAVA 5G41A 4TLLB 2I67A 2HSJA 3FI9A 3NC0C 1BEEA 4B83A 5ADHA 4DJJA 2JA1A 4D42A 1MNAA 1U1CA 4P6VF 4V02A 2EF1A 3EDRA 3AEYA 4C01A 4AO6A 4EIWA 1N2CE 2A0KA 3PBKA 1VJTA 4JCOA 1D2AA 2JJ8A 1CR4A 3OCWA 3WWYA 2FSIA 1ZDMA 4DDWA 1GCIA 1U3DA 4R2IA 2HFJA 2AG6A 3ODPA 3V00A 5HR5A 2QXUA 3HCEA 1FZQA 1NMSA 3LNTA 4NU8X 1Y5IA 3TL2A 4B76A 4CTOA 3E9RA 4GX2A 2QIPA 1PR9A 3OQ6A 4C2BA 2Q21A 3D8RA 4DFDA 1NYQA 1Z74A 3FPCA 3VKWA 1HLPA 2VJMB 2F1OA 5LP6A 4AMYA 4XARA 4RCVA 1ZP6A 2PX4A 4D25A 3KKMA 1DCMA 1P9NA 3WR5A 3KT0A 1E92A 1BD4A 1KMCA 3R0QA 4FEAA 1QDEA 1HE1C 1SAYA 4RZHA 3AV3A 4WH0A 3K70C 3CWQA 2YZGA 4GP9A 4HQ0A 3KS9A 3ED5A 4JOBA 4MQEA 1HDYA 4RK1A 4DLNA 1XJ0A 2QMHA 4NAUA 3EF1A 4O29A 4PAQA 4YRNA 3MEQA 3IPLA 2XA2A 4TXMA 5K0FA 5GAJA 2P4SA 3KLOA 3DTTA 5D7NA 4ZTBA 2L19A 3SDBA 2VDMB 4G0VA 2I7DA 1JZSA 2AFRA 2RGXA 4DTCA 2WSBA 4C5AA 4Z9XA 1M6EX 2XRFA 3WP1B 5CVVA 4MH0R 2FU5C 5I7EA 2WOOA 2IYAA 4CGZA 1P5HA 1JH9A 4BO8A 1OUMA 2GD6A 3WQBA 3H1EA 2C2XA 3UMVA 3PDUA 4QXMA 2D4HA 3GR6A 1G20B 4H15A 2BUBA 3O21A 1L7DA 1ULTA 2C9DA 2X41A 3LQYA 4X64B 1VE1A 3HQ4O 3D1JA 1EJ0A 5D1NA 1WW2A 4CT5A 3GN1A 4HUTA 3EBLA 3PFWO 3UJPA 4TTAA 2A4MA 2AVNA 2CFCA 3EFEA 3NNNA 4FW9A 3I9MA 3ZCPA 1SM4A 4RC9A 4Y2JA 1J2TA 1Y4AE 3TQIA 2NSHA 2GZRA 4B7CA 1KTVA 5JHGB 1BXRB 1JS1X 3RYFA 1VA4A 2ZYTX 4Q02A 5BN1A 2HDHA 4EHJA 3F6CA 3QITA 5JECA 1YACA 5BPFA 3HCNA 2ZJ4A 4IIJA 4QDTA 3UF0A 1TADA 3WL4A 4G56A 2HLNA 5G0SA 4DNOA 4E32A 2GCOA 3E03A 4TXLA 1GPNA 1OZHA 2P68A 3BDVA 3UAXA 3GZNB 2G4CA 4Z0PA 1PWHA 1P9RA 1A0OA 1X7XB 4S05A 3P52A 2GCNA 1XVTA 4EY3A 2JBAB 2MSDB 3NM6B 5AW1A 4C7OB 3L0CA 4GO1A 4WZAA 5CLGA 2EX1A 3C48A 2G0TA 4X95A 2QUKA 4EI8A 2VDUE 1E9FA 5KNDD 4ZVRA 1O94D 4OV6B 1ZN8A 4O4JF 3INNA 4GSKA 4KAXA 4RLQA 3QUQA 1OX4B 1RWKA 1RADA 5EGSA 1W5EA 3GRUA 5DI9A 2OHJA 4B3JA 4ER0A 2ZTVA 1QCZA 1L7OA 3P27A 3C3EA 4QBIA 1YBAA 4KIWA 3O9ZA 4YRZA 4X3OA 2ZQYA 3BFXA 1P4JA 4RKRA 1RHMA 1WCIA 2QTGA 1EWQA 2VCHA 1FUKA 2B1JA 4QREA 3TLAA 4FLFA 1QK4A 3W4KA 1T2UA 3INYA 3ZBTA 1Q1GA 1QAMA 5B7PA 1UMDA 4U2EA 4JUIA 4WERA 3K0FA 2W90A 2P5SA 3K1TA 2QP3A 3ZLJA 2AEEA 3TX2A 2Y77A 2JL1A 4DCUA 2C29D 1D4OA 1XRLA 3KLNA 3KRTA 2DTDA 1JDSA 2XVAA 4G86A 4LYFA 1QONA 3IV7A 1XZNA 2IP1A 4U00A 5LZ2A 1Q3HA 4KL8S 3P4UA 4OSOA 5GONB 3BCHA 4ZEMA 4G0QA 1VB3A 1D7AA 2EJBA 1Z6XA 2FPWA 2PZAA 3FA2A 8AT1A 4LBVA 4JCCA 2O2XA 3GPCA 4YGXB 4I5EA 4MWBA 4JBXA 1WU7A 2I3ZA 4L4XA 1L7EA 1BE0A 3LP8A 5GQSA 5GMOA 4MA4A 3CLSC 2ZSEA 3E15A 2VEDA 2O4CA 4B6GA 1NLUA 2G71A 3LHFA 1DO8A 2ZJZA 2ASVA 4BQSA 1PNRA 4ZCTA 2QL9A 5E8RA 3UK1A 4B40A 4H6XA 4W5WA 1LF5A 2GZDA 1X3SA 1Z0KA 1V2GA 2F55A 2BEVB 1GPDG 1S3IA 4A8JC 5NLLA 1T5LA 1Z6AA 3K0FB 2H08A 2ZRCA 3GOHA 4K0RA 1FFDA 3FPHA 5TEVA 4ZI7A 5IC4A 1PVOA 5LQNA 2SCUA 3KPUA 1BVYF 2A14A 5TGTA 1ZH0A 4RIFA 3ZV5A 4GEKA 1A3CA 3TRKA 5IANA 5M04A 1RABA 2VYQA 4JYMA 1WB9A 1YXMA 4OF4A 4XPIA 3R4VA 8OHMA 3ZJ5A 4L9WA 1FTYA 4I9HA 1GLNA 2UZAA 3MBIA 3OT4A 2DR0A 5BORA 1T8PA 3LRPA 5EZ5A 1N2SA 1ZRHA 4O0LA 2V7WA 1RXEA 2YFHA 3BHNA 2AFIA 3OPYA 2Q3BA 4PLYA 4UULA 2IH5A 1N6IA 1VPEA 2F1RA 5EPEA 4B6RA 4RTOA 5TE9A 3CUSA 4IIYA 3RE1A 4OB6A 4HB0A 3CNHA 3QBEA 4Q3KA 1AHPA 4F1JA 4G5FA 1XGKA 4F92B 1FS4A 1Q0QA 3GJ3A 3K1YA 2P7HA 2C1ZA 4RTLA 3SXUB 1JSCA 1X7XA 3KWJA 4I1YA 1F4LA 3P0HA 2HSEA 1LSOA 721PA 2H1WA 4L7VA 1B42A 4KWTA 1R4NB 3NTLA 4GW3A 4Y2YA 4UBIA 2QLMA 3ZWMA 1V8ZA 2FZLA 1OASA 2C84A 4Q1AA 4QGGA 4ZT6A 2JEOA 3JQQA 5FORA 1LV7A 1NMYA 3LECA 4NY1A 3UQYS 3NEJA 4Q7MB 3VJRA 5JAIA 3ILVA 1Z2CA 4D4LA 1L5GB 1A97A 1Q1ZA 1W0JA 2IYOA 3GP5A 4G01B 5EUQB 2BCEA 2RAFA 2WKQA 2B8NA 1SQ0A 2GKSA 2W6PA 2J85A 3G2NA 3DMHA 4RMHA 3T1OA 4F5YA 1T9GR 4MQFB 1MG5A 2PFSA 2RBKA 3I39X 1IHOA 3G1UA 3PPWA 4L2IB 4N8SA 4TTPA 3V1KA 1Z2PX 3EZXA 4KV9A 1OH8A 1PGPA 3ZE6A 4XYGA 2VBIA 2WSIA 3MTAA 2NXCA 1L1EA 3GQBB 1SKBA 2HEIA 3I12A 4KYUA 1GAXA 5FOUA 3V8PA 1SCUA 2XXBA 1PZGA 4B47A 1DPFA 4WK6A 3ZVNA 1EXDA 3DR5A 5D86A 1XDDA 2ES4A 4QOSA 1O5OA 2D0OB 3REQB 1H66A 3NC1C 3CX8A 4MCAA 1IMOA 1TEXA 1YIDA 1CT9A 3ESQA 4J9UE 2BGTA 4BMZA 1C7RA 3O7MA 4FFVA 4KUGA 3RUCA 3JQAD 3R09A 3REFA 1YK1A 5DLDA 2Q2OA 5K6TA 1OLUB 2G5GX 2P0EA 3E4DA 3A9CA 1Y3DE 2W4IA 3CUKA 1DSSG 1QB7A 4YC7A 2RARA 4M99A 2CHUA 5J59A 5BSGA 4R7GA 3HMQA 1OVGA 1U28A 4QHYA 2QF7A 4I55B 1S8AA 4FWIB 2C9ZA 3UJ7A 3AJRA 4PCUA 3I45A 4NF2A 5E3HA 3G79A 2XAUA 4HY3A 1LWOA 2A5DA 1S4QA 2HYDA 1VYUA 2Q2NA 3GXOA 3TEMA 4AIIA 4F1KA 3DYBA 2HHHB 3ETEA 3HSKA 2H2DA 2CLDX 4B3RB 3CZAA 1C8VB 3SI7A 2DCMA 1Y9JA 4YROA 3H9CA 5DLPA 4PNZA 4U6SA 2A88A 2IIBA 4M49A 3H5IA 1C1DA 1KZ9A 1MOZA 3BDAA 5HEKA 2EXXA 2Y9PB 2KBEA 3DE1X 3D9QX 3JAWA 3VAYA 3WMFA 4KXUA 2HQBA 3B2EA 4TMXA 5IC6A 3G88A 4E22A 2PLRA 3WNQA 1ONSA 1JHPA 1RHUA 1H0SA 4WLNA 4A16A 4QDZA 2F3SA 5K3AA 1MORA 4AG5A 4DR3B 1DO0A 1YJ5A 4NKRA 4EZBA 3NHLA 5EZQA 5BRJA 1D0IA 1QWOA 5C37A 4D43A 2QAJA 3E9YA 4GE0A 4B7XA 3ANMA 2WHRA 4Y2QA 2Q4TA 2BR3A 2JK0A 3WRWA 4FBLA 4MUIA 2N0SA 4F21A 5HKKA 1CIJA 4WVFA 1UIMA 3LWNA 3S2EA 2RGBA 3FSRA 3R3JA 2D06A 2WJWA 4IMPA 3T7JA 3WXBA 1JAXA 2F9FA 3DT8A 4ZA2A 1WHSA 2MSNA 1U31A 2QRHA 3VNSA 2QW1A 2NV6A 1NDUA 3FPFA 4FYMA 3O7WA 3COPA 4C30A 2QQGA 2CV2A 4LHYA 3A4NA 1II8B 4AWXA 4DG5A 3NHRA 4K03A 3PJGA 2NSJA 3Q0TA 4MVJD 4WCFB 4DR1B 1NTOA 3H4VA 5KQRA 4UNNA 2JGKA 5K3BA 2VHZA 3FYTA 5EWJB 3EG9A 3L9XA 2A59A 4PX2A 3R5SA 3T3DA 2C2KA 4XDHA 5IBQA 4XTCS 3GX1A 5HFJA 2FX2A 2EERA 4XTRA 1WF3A 1Q0SA 3HBLA 3NBKA 4J1TA 4MLPA 3WLIA 4I4CA 2CB9A 3CC8A 3HNRA