1ZJ4A

Crystal structure analysis of the dienelactone hydrolase mutant (e36d, c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.7 a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 78
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zj4A00
3TRDA 4BP9A 1QIGA 3BF8A 4PQEA 2RAUA 1KU0A 1IZ7A 1TCBA 1E8NA 4FFWA 1UOPA 5C8ZA 3C8DA 3DEAA 2DHDA 5YASA 5ALOA 4AMYA 1QOZA 1G4HA 3WMRA 4QDZA 4FWBA 4QDUA 1XZCA 1IUNA 2JGKA 4BAGA 1UK6A 4ZI5A 3DOHA 2AXEA 5AO9A 5AKKA 1CUCA 3RARA 1EINA 1QO7A 2ZVDA 4DMFA 1N5RA 1MU0A 1T2NA 2XUHA 3AIKA 2JIDA 1E8DA 4B0OA 1FFEA 2XQKA 5A7FA 2HA6A 5KWJA 4KEAA 3O4IA 2FJ0A 3OTQA 4KRXA 5FV4A 3STUA 5AM2A 5ALJA 4INZA 3B3QA 4ZRDA 5ALRA 4MWSA 5AI9A 2GYVA 5AKZA 1WHTA 2BUAA 1QLWA 1MAAA 3O9MA 5SYMA 4GWLA 4KACA 2V98A 3STWA 3DQZA 4QLAA 5T4FA 2WSLA 5HKBA 4YX9A 4U2CA 5AIBA 3ED1A 4FNGA 4AZ3A 1L7RA 1DWPA 5HF8A 2XUJA 3ESAA 2CB9A 4P08A 2GYWA 5DNWA 4IHAA 4M0MA 2VATA 4OU4A 5ALYA 3WL8A 2JGIA 4FHZA 1CUFA 4G8DA 2H7YA 1QIKA 5HF5A 5DNVA 4BBZA 3AUKA 5FP0A 2XUKA 5AK4A 2HADA 2ZJFA 2XMZA 2WIJA 2Y2UA 3TEJA 3GROA 5C8XA 1ZD4A 3BIWA 1K5PA 2X76A 1JJBA 2E3JA 4KJXA 1QFSA 2AJBA 2WIGA 1XLVA 4WFKA 3H18A 3ESCA 1VA4A 1K4YA 3ICWA 3H1BA 2Z3WA 1O6GA 3BXPA 5EHZA 2XLCA 5HQ3B 4N5HX 1THGA 1EA5A 1DINA 5LZ9A 1F8UA 4E14A 3GZJA 1BS9A 2JGJA 3I2FA 1T4MA 4HS9A 5ALGA 5K3FA 2I78A 1XRNA 3R3WA 1TQHA 5ALHA 2ZJ6A 4AN1A 2QZPA 3U1TA 2QKYA 3N0TA 2O2GA 3ESBA 4AO8A 1NX9A 1TCAA 1C7IA 4FDMA 1CUAA 2XMRA 1FFCA 3D0KA 1YR2A 4KAAA 3LS2A 4EY5A 1W4LA 3W04A 3MVEA 4LIPD 4NZZA 1ZD5A 2OAEA 3BWXA 4GECA 2IX9A 4MXDA 1G42A 5K5EA 2YH2A 4O08A 4Q3LA 4UHDA 1LZKA 5BWCA 1YA4A 5D3ZA 1QIJA 1GT6A 4AQDA 4X94A 3T52A 4H7JA 2OLEA 2ACEA 5ALXA 5JALA 3U0VA 4EHBA 4LHEA 2JF0A 2ZSHA 5CH3A 4BZZA 3DS8A 3IVMA 5HF9A 3P2MA 4PNZA 4JH0A 1H2XA 2WIDA 1DWOA 3G9ZA 5AHXA 1MT3A 4AX4A 3GFFA 1LPBB 3W9UA 3I2KA 4NS4A 3WWPA 4AB1A 2VF2A 4C88A 1QONA 2DQYA 4HRXA 3W9BA 4ZGBA 5HCUA 2X5XA 4Y2XA 3I6YA 4G1FA 2XQIA 1QE3A 3G8YA 3QZUA 4HXGA 3ZLUA 4LYEA 2QR5A 5EGNA 4AMZA 5K3BA 3MUOA 1A8SA 2WFLB 2C0QA 3W06A 2BAGA 4EBBA 4PSUA 4XIIA 4Y7DA 5IH7A 2DFPA 1QJ4A 3BIXA 1R9NA 1ZIXA 5AI6A 4CCYB 1BROA 2G63A 5ALEA 3WK7A 4CIAA 4X91A 1JT2A 1QIHA 1FJ2A 4UHBA 1EDEA 2WG0A 1UXOA 5FPPA 4BTLA 1IZ8A 4JUIA 2Y6UA 5AI8A 4N8EA 3KD2A 3D59A 7YASA 1G5FA 5ALKA 1WB4A 1MX9A 3CN7A 5DNUA 3C45A 5LKAA 4F0JA 5JD5A 4X6XA 3M83A 3FOBA 4H18A 4UHFA 4OUKX 4HRYA 2FJPA 5E4TA 2EDAA 1XQXA 4LYDA 2CBGA 3AIMA 2WJ6A 2PSEA 1VXRA 4EY6A 1VJ5A 1CPYA 2VSQA 1OXMA 4F60A 3BE8A 1XZKA 2XLBA 1QIDA 5AM5A 4E46A 4B0PA 3QPDA 2NW6A 3HACA 4KE7A 3RLIA 1UWCA 2HL6A 4IH1A 2ES4A 2WKWA 4EY4A 3V1KA 2CZQA 4OPMA 4WY8A 1JI3A 1E8MA 5AOBA 4W1SA 3PE6A 2PKYX 1B6GA 5ALSA 1E3QA 2J3DA 4C4XA 5LZ4A 4M0EA 1QZ3A 4C4YA 3AZOA 3DOIA 4BCBA 3IUJA 3E3AA 2W6CX 2VJDA 1Q84A 2LIPA 1K8QA 1EHYA 5AP9A 2C7BA 1UK9A 2WHPB 4B9EA 3I6MA 4YPVA 1LNSA 5SYNA 3ANTA 5IVDA 2BGRA 3WL7A 1XZFA 4ARBA 4B85A 1N1MA 3E1GA 1QIIA 2B4KA 4G4IA 3HEAA 5CXXA 1AQLA 3WK8A 1TIBA 2PUJA 4H0CA 3WLAA 1QTIA 4W9RA 5CMLA 3PDCA 5DWDA 3KWFA 2RGUA 2B20A 5AK5A 2WHPA 5JYCA 5E4YA 1XKTA 5A6VA 1BEEA 3LIIA 4RPCA 3EQ8A 1USWA 3I2GA 4J7AA 1UZAA 4Q05A 1U4NA 2O2HA 3G9XA 1FFDA 5AI0A 2WTMA 1QTRA 4PSDA 4MEBA 3E4DA 2D0DA 1YCDA 3WK5A 4Q1VA 1ETHA 4EB0A 1XLWA 3WWEA 4H77A 2XUGA 3CN9A 4Y2RA 4X90A 3W05A 2O7VA 5T4BA 2JGMA 4D9JA 1ODTC 2WM2A 4J3JA 3IBTA 1NU8A 5FKJA 1CUIA 2Q0XA 5ISMA 1JMYA 1EX9A 3I6ZA 2DCMA 1NU6A 1W6RA 3DNMA 3D2BA 4G4GA 4IQ4A 1GQRA 5AICA 1XZMA 1J07A 4HZGA 2PL5A 5ALIA 3FAKA 3ZLVA 4OB7A 5EHXA 3VKFA 5E2IA 3FVRA 2VJCA 3PFBA 3X3HA 2WJ3A 3H19A 1R9MA 4P93A 5ALWA 5A2GA 5AM0A 2AJCA 1E89A 3HSSA 4Z49A 4AO6A 1E5TA 4KE6A 4CFSA 1VOTA 1WM1A 4H7DA 1CRLA 3D7RA 2VAVA 2HM7A 1UKCA 2IITA 1BCSA 2OCIA 4JEIA 3AILA 1OILA 3BF7A 3B5EA 4AZ0A 1DT3A 1P0MA 3SK0A 5AKEA 3NUZA 1ZJ5A 3VJKA 2G5TA 2ZYIA 4BRSA 2QXUA 2K2QB 4K6KA 5T4EA 1AX9A 2XUQA 4FMPA 1CEXA 1G66A 4LXGA 1LPOA 4DYHA 4LXHA 2OCGA 4HVTA 4M0FA 4ZXFA 5JARA 1M33A 1CUVA 3R41A 1ZGCA 1TRHA 1LBSA 1XFDA 2XQJA 1HL7A 3G0GA 3LLCA 1LPPA 4KR0A 1XQVA 3IURA 2Y6VA 5CW2A 4C6HA 3GELA 1UT6A 4FLEA 4BYMA 4DMKA 2ZYRA 4G9GA 4XWGA 3V1MA 1U2EA 4ITVA 4UFOA 4DM7A 1VKHA 4WFIA 2QOEA 3JYHA 4ZV7A 1Y7IA 4QWWA 1JU4A 3A2NA 4X93A 1KEZA 3WKEA 2YYSA 1MO2A 1DWQA 4QLOA 3H17A 4MJ3A 5LZ7A 5AH0A 1XQYA 1A8UA 4JNCA 1SCKA 1F0NA 1YB7A 1XZGA 4FNMA 4K6GA 3KDAA 3MGAA 3WWOA 2RHTA 1LPAB 2WFLA 3NGMA 1GKLA 3YASA 3I2IA 4HTAA 1IVYA 4W1QA 5A7GA 5LKRA 1RYYA 4FBLA 4UBMA 1AUOA 3K2IA 1XZAA 4FOLA 5CT6A 3R3XA 5JZ9A 3EBLA 3QM1A 2OAGA 2V97A 3NWOA 1SFRA 3RK4A 1GPKA 3IA2A 2WJ4A 1EH5A 1P0IA 4W1PA 4EUSA 5BV7A 4L0CA 4B82A 4A16A 3QVMA 5C81A 2XMGA 3HABA 1R3DA 4UBIA 5CTAA 5LYYA 3OG9A 5JIBA 3G0CA 4ZV9A 4U2DA 4FFVA 1XLUA 5AKLA 3WK6A 3BJRA 2RI6A 1X2EA 1CUEA 4IH4A 5ALQA 4U2BA 4X6UA 4AXBA 2G4LA 2QXTA 3H0CA 4J03A 3ZI7A 3D3NA 3FCXA 1AURA 1P0PA 3O4JA 2PX6A 1HPLA 3PICA 3G9UA 3AFIA 1LPMA 1C7JA 1X2BA 1RWQA 1YAHA 4BP8A 1JU3A 5CH8A 3QMVA 5DTIA 4BDTA 4TVKA 4DMHA 3VJLA 2XMCA 4BVKA 2HU8A 3R0VA 1FFBA 4Y2TA 3E0XA 2B61A 4FTWA 5LZ8A 4BCDA 2PU7A 4UPDA 2OCKA 5AK6A 2JBWA 3EIOA 4X92A 2AJLI 3O4GA 4L9AA 3BL8A 3ZLTA 3FLAA 4WY5A 5AKXA 3I1YA 2XUFA 5A7HA 4G5XA 3WK9A 4CG1A 4Y2PA 3OOSA 3HXKA 5F4ZA 1A88A 4FLMA 5A62A 2WU4A 1W76A 1BN7A 2WG2A 2GBGA 4B83A 4J0CA 1XZJA 1ACJA 3GBSA 4E11A 4UFNA 4YK7A 4BAUA 4DGQA 3H2IA 4F5ZA 3PF8A 2CUTA 4H7HA 4GW3A 4DNOA 4P9NA 1ODCA 5AKIA 4FLFA 4J0IA 4BVLA 2XUIA 1YASA 4X85A 4WCVA 3C6BA 4CG3A 4DLNA 3WWDA 4J0GA 3F9CA 5EIHA 4OCZA 5AKYA 1LGYA 1AMNA 1XRLA 2ROQA 1CQZA 5JADA 5FPQA 4DSAA 1CUJA 4DMCA 5JZBA 3FLBA 1XQWA 4K5QA 4RGYA 1UOOA 1B41A 3HLKA 4OD0A 3D4LA 3ZPXA 3DL4A 1N8SA 5D3KA 1EI9A 4UBOA 5C8VA 1IUPA 1AZWA 3DJYA 4HAIA 5DLPA 2H7XA 4HXFB 3ZV7A 1LBTA 4UBKA 1UK8A 5D7BA 1CUHA 4OSEA 1E66A 2ZJ7A 4GHWA 2FX5A 1U65A 5CT9A 1JJIA 3AZPA 3H1AA 5K3FB 1XRRA 2QVBA 4KAFA 2JEYA 1EXWA 4V2IA 1QIEA 2WG1A 1WHSA 2O2IA 4DTCA 2PSDA 3PF9A 3VJMA 3WYDA 4CIBA 2I03A 1J1IA 3CCCA 4DNFA 4A23A 5FDFA 4U2EA 2WHQA 3G7NA 3OURA 1EDDA 1XZEA 4J0KA 3WJ2A 5HFAA 5I9IA 5AKGA 1UKAA 3KWJA 4MYSA 2GZSA 3VXKA 3KSRA 4S0XA 3FBWA 4LXIA 5C7YA 2VTVA 1CUBA 2VA9A 4L72A 4MYDA 5DJ5A 4EY8A 3WL5A 2BCEA 2V9ZA 2VEOA 1SCIA 4UBLA 4AN0A 2CEKA 3ILSA 4DIUA 4QDXA 2XMSA 2P8SA 3STYA 3UUFA 5HK9A 1EVEA 3LIPA 1JMKC 5AKJA 4KE8A 5KREA 3A2LA 5CBKA 1W75A 3GUUA 3FNBA 1GPLA 3B12A 1C4XA 1WOMA 5HFNA 5E4JA 1ZI8A 4DNPA 3H2KA 5J3JA 3G0BA 1HDEA 1WB6A 2Y2VA 2Z8ZA 1K6EA 2WU3A 3DYIA 1BRTA 2WHRA 1OCEA 2HU5A 1JKMA 1HLGA 4MEAA 5CRIA 5JAHA 3CCBA 4EA6A 4J0HA 2XQFA 1CUXA 4IH9A 5ALUA 1WCYA 4KRYA 5ALTA 1R88A 3WIOA 2VT6A 1YAJA 5I8PA 5BOVA 3M81A 3KXPA 2YXPX 3FYUC 3PUHA 5CT4A 5IVKA 1W1IA 1MPXA 4BDSA 2PPLA 4X6YA 1R1DA 4ZWNA 3EQ9A 1K63A 3FWHA 3VISA 2WFZA 3O9VA 3WA7A 1ZGBA 1XROA 2WUGA 4H7IA 3S2ZA 1BN6A 2I3ZA 2EEPA 4OB6A 1VLQA 1RP1A 4N8SA 1BCRA 2VQ6A 4BRZA 1L7QA 4J0JA 4X7BA 3C5WP 5FOQA 4PV7A 4CG2A 3FSGA 2PSFA 4H7FA 4WDQA 1ISPA 3WKBA 4KYVA 3S8YA 4BVJA 4B80A 1AC5A 1QFMA 1F0PA 5DYTA 4BAZA 5CXUA 3WJ1A 3WQHA 1R50A 2DHEA 1UKBA 4OU5A 3G9TA 3AINA 5KBYA 1QIFA 2X8BA 2XUAA 2H1IA 2CMFA 2FUKA 4IO0A 4Y2QA 2Z3ZA 3EQ7A 3V1NA 1JFRA 5I7UA 3K9BA 3HZOA 2OGTA 1GXSA 4B84A 2XUDA 4Q34A 3QMWA 4OYYA 2PSHA 1MX1A 2HA2A 4X95A 4QDOA 1ZICA 4H35A 1CUWA 5EHQA 4BATA 2HA0A 2HA5A 1A7UA 4JYPA 3DDUA 2HFKA 5AM3A 1DU4A 3Q8WA 4DSZA 2EDCA 5ALZA 1WPRA 4FBMA 5HF6A 3IUQA 2VAXA 1CUYA 2QT9A 3H2JA 3AIOA 3D2AA 5EIAA 3R40A 1GPNA 4C4ZA 4QEKA 3C5VA 3FYUA 5EI5A 1XZIA 2RIPA 2C5GA 2DHCA 5K3CA 3G0IA 1XZHA 5JASA 2ECFA 1YB6A 5AOAA 3L1HA 3QITA 2GBFA 4Y2UA 1Y37A 3UMJA 2GBIA 3KOOA 5ALLA 3C43A 4B7ZA 2HHAA 1ODSA 5K3EA 4JYMA 2WQZA 3R3VA 5T4HA 3Q0TA 4DNQA 5H3HA 1Q0ZA 4CI9A 6YASA 1CUSA 5FLKA 3LCRA 1VE6A 3BDIA 3H04A 4XJVA 1X70A 1J06A 3I2JA 4X3CA 5JANA 4GXNA 3F97A 1ZI9A 2W22A 3TJMA 3OC0A 4UHHA 3IUNA 2RHWA 2C4HA 4CCWA 5LIPA 4GDMA 2ZSIA 3JW8A 3PUIA 2GBCA 3SWWA 4I19A 3WKDA 1S8OA 3NOXA 3DLTA 3VVLA 3DCNA 1DQZA 3QMMA 1WB5A 1QIMA 4Y2VA 3WZLA 1Z68A 4QE3A 1XZDA 5JAPA 3C6XA 2PU5A 2Z8XA 5AI4A 2OGSA 5AKHA 5K3AA 3SX4A 4BB0A 3H2GA 2GYUA 5FUMA 5ALDA 1VXOA 2ACKA 3DKKA 2J3QA 1VZ2A 5LZ2A 1EK2A 4RNCA 4EZIA 1DX4A 2HRQA 5DYYA 2ONCA 5LP1A 2H7CA 2OQIA 2B9VA 4UHCA 3K6KA 2YASA 3DL7A 3MUNA 4U2FA 1Q0RA 1ZD2P 2WILA 4I3FA 2H9YA 3AZQA 3WWCA 1CVLA 2HU7A 2C58A 3ESDA 5CT8A 3DKRA 2Y1KA 1H2YA 1ACLA 3ANSA 4I4CA 1MN6A 1YSCA 3V1LA 2C0PA 4KE9A 2JGFA 4Q3KA 1P0QA 2BUBA 3WZMA 3ZWQA 2WTNA 2QUBA 3GA7A 3T4UA 1MJ5A 1HKHA 1XRPA 1TK3A 3D5EA 1EB8A 1LLFA 1CUGA 4B9AA 1GZ7A 1MNAA 3O95A 2OGZA 1O6FA 4PSCA 5EIEA 3L1IA 4B6GA 4H7EA 1KU6A 2XE4A 5HQ3A 2XQGA 3VDXA 2WIKA 2XMQA 1AKNA 3HJUA 2UZ0A 2BKLA 1XRMA 1SOMA 2V96A 3M3DA 2QUAA 2XI4A 2JGEA 4U2GA 1AGYA 1H2WA 2HIHA 3OM8A 4HXEB 3WL6A 2HDWA 1F6WA 1ZI6A 5FRDA 3FVTA 5CH5A 4BZWA 4BTVA 4NMWA 4PO3X 3C87A 4TPKA 4UFPA 2JEZA 4OYLA 1YS2X 4GI1A 4TGLA 4RE5A 3V9AA 2BFNA 2R11A 1CQWA 3FYTA 3WI7A 3WK4A 1TCCA 4QDTA 5ALPA 3A6ZA 3F98A 1SC9A 5IVIA 3QH4A 2XT0A 2J4FA 1ZD3A 2WUEA 3IB3A 5CT5A 5HZGA 5D6OA 4K6HA 1ZOIA 1J2EA 4PF1A 1LZLA 1JJFA 1LPSA 5AM4A 5JAOA 1GKKA 1XZBA 2XB6A 1XRQA 5JD4A 1UOQA 3D2CA 2DSNA 5A71A 3STXA 3W2TA 3O4HA 4QA9A 5HKAA 4QWMA 3FSGD 4GEGA 3R3YA 3C8HA 3F96A 1EK1A 5K3DA 2OQVA 5EHNA 1CUDA 3RM3A 4J0DA 1I6WA 1XZLA 4BC1A 1DX6A 3DYVA 1ORVA 5JZSA 2QS9A 3G02A 1HQDA 2BUCA 4UHEA 4A5SA 1PFQA 3IIIA 3HRHA 1CV2A 2PSJA 3BDVA 4LKOA 2BJHA 3IUMA 1IMJA 4WJLA 2PUHA 5ESRA 4E15A 5AI5A 1YA8A 3I28A 3UUEA 3IDAA 4QNNA 4BC0A 2BGNA 4B81A 4UUQA 5AIAA 3WIBA 3PFCA 4UBNA 4XX1A 1CUUA 4L3WA 1GQSA 5LZ5A 2VT7A 1UK7A 2ORYA 1CIJA 4CCYA 1R4ZA 4XVCA 4PW0A 1PV1A 4G9EA 4X97A 1H23A 4Y2JA 4Q82A 3I2HA 1N5MA 2I3DA 4Q3OA 2CJPA 1H22A 4YASA 3SC2A 2G5PA 3L1JA 2WUFA 2PM8A 3FCYA 1MAHA 4UBJA 5AM1A 4OB8A 5EFZA 4FKBA 2XDWA 2QJRA 4N8DA 4GLBA 2DQZA 4F21A 5HK8A 1TAHA 4W1RA 4X00A 3A2MA 4MQLA 2HA3A 3HC7A 1BU8A 4N5IX 1VA5A 5AK3A 2XMBA 2GZRA 4K2AA 4H7KA 3R3ZA 3HYSA 5ALFA 5JD6A 3WKCA 3A70A 3CXUA 5LLSA 3O0DA 5AJHA 4BCCA 1MNQA 3STVA 3F8SA 3HI4A 3FLEA 5JAUA 3TGLA 2OG1A 2RONA 4EY7A 3C70A 3QPCA 1ZJ4A 3OPMA 1EVQA 4ETWA 4WDRA 4NVRA 5DYWA 2HA7A 1U8EA 1BEZA 2XUPA 3N2ZB 5DTJA 2AJDA 5ALMA 3EF3A 1DQYA 3I1IA 2J4CA 1SCQA 2QJWA 2WFMA 2XMDA 1MX5A 4W63A 2VJAA 3WKAA 5FXMA 2QTBA 2WUDA 1YS1X 5AOCA 2ZYSA 2CKMA 2ZYHA 1CFJA 1EDBA 4QZVA 3ICVA 5IKXA 2O7RA 2HRRA 1D07A 4ZREA 3WYNA 2DR0A 4MWTA 1FFAA 3FYUB 4G4JA 4BE9A 2C5FA 1W52X 3M82A 5CURA 1DT5A 2HA4A 4RE6A 3STTA 4AO7A 3DD5A 2WLSA 3C6YA 4MQMA 2OPHA 1CUZA 2PVSA 4Y2YA 3WA6A 1Y7HA 4ARAA 2PBLA 4C89A 2OCLA 3VVMA 1HBJA 5IVHA 1FSSA 1A8QA 5KWIA 1GGVA 1THTA 1ZIYA 4KAJA 3R3UA 1WPXA 1QO9A 1PJAA 4C01A 1TKRA 3AJAA 1MTZA 3PI6A 2AJ8A 3H2HA 1LPNA 2HFJA 4WFJA 1ORWA 4Y9SA 2WIFA 2Z5GA 2XUOA 4X71A 1DTEA 3QPAA 3G0DA 3BJMA 5BWBA 3V48A 4C87A 1IUOA 1CR6A 4G8CA 1H2ZA 1L7AA 5JATA 2OXEA 2QMQA 3C6ZA 2QM0A 5ALVA 2VJBA 1CLEA 2D5LA 2QRUA 3QBJA 3IULA 1Q83A 1XKLA 2JGLA 4GBGA 3LP5A 4BE4A 1QGED 1UFOA 2IIVA 4ROTA 4G8BA 5ALNA 1VE7A 1BE0A 4Y2SA 3F67A 4P92A 2R8BA 3JWEA 1EB9A 3QYJA 1VZ3A 3RKSA
chains in the Genus database with same CATH superfamily
1WU7A 3E70C 2J7PA 3SC4A 2XJ9A 2VQFB 1IDN1 4BMZA 2G9UA 3TVDA 3IO3A 4PTZA 2LCIA 3JAWB 1FLNA 3LCMA 2VP3A 4U9HS 2AIRA 3AI7A 3FWNA 3REQA 4C0BA 1V8OA 4L7VA 1SUCA 2H1CA 2WSBA 4ALIA 3K15A 2IUFA 4F6LA 1Z0IA 5I9LA 2CLMB 4MUNA 4QBHA 5SZJA 3OY7A 3V7YA 1KU0A 2J3EA 3DAOA 2FDXA 3JQAB 1TCBA 1OAAA 2ZZKA 4WGGA 4C76A 3D8HA 4PFKA 1Y9JA 1ZGZA 1XP5A 2ZKIA 4RPKA 3K0CC 1OV6A 1XQ9A 1V1JA 2QRKA 1ENPA 2J7PD 1R5OA 1VMDA 1XCOA 2WVHA 3IIKA 4FFWA 1FQWA 3RT9A 4CHTA 4ZHSA 3DV0A 2XJ4A 3EAGA 2VF8A 1UOPA 3GLIA 3C8DA 2E49A 3DEAA 3RJ5A 5J4KA 3AVPA 4V1CB 5JRJA 4YDSA 3TDNA 2XDQA 3HGTA 1J9ZA 4U02A 1QOZA 2HAEA 1G4HA 3L05A 4NLLA 1I0IA 2WTBA 1R3UA 4GKKB 1HT0A 3B1FA 4JP2A 3N0RA 5BN1A 2OXRA 1XZCA 1E7SA 1Y0BA 4N82A 4BAGA 4NZ9A 4RAOA 3JR3A 4F4JA 3EE6A 5HIKA 2IZ1A 3U3XA 1T1SA 2Q3LA 1R64A 4GU5A 3DOHA 2AXEA 2I80A 3RREA 2A1UB 1GZ3A 4R5HA 1S7CA 5LFAA 3T5TA 4C0WA 3O8CA 2ZIEA 2AN1A 3A1TA 4RPJA 1WSDA 4L4UA 1QO7A 3BJIC 2ZVDA 2QBYB 1EJ2A 1CRQA 4Q21A 1N5RA 2B69A 3EHDA 4OHUA 4ZZ1A 2W58A 3QTTA 3ONNA 1I4TD 3MLEA 1WSBA 1G4UR 4QGFA 3THSA 1KARA 1JZQA 4AM8A 4UARA 1K68A 2ICAA 1OQAA 2GZMA 1P80A 3LDHA 1RZUA 2BEVA 2B8NA 1I3NA 3AUAA 2XQKA 4ZAYA 2XB9A 2HA6A 5A7FA 5PGMA 1JKFA 2OECA 4L07A 4KEAA 4OXNA 4JI1B 3TXAA 3NAQA 3ASYA 3WLFA 3CVXA 4Y9UA 4ZDWA 1TGVA 2Q3DA 3OTQA 1O94D 3AB7A 3W4JA 2WJZB 3DLCA 5IT5A 3FFBA 1DZIA 3MJHA 3I4LA 3AI2A 4CM7A 1G8FA 1WUTA 5CJPA 5D51S 2GWHA 3QVWA 1OVGA 1S89A 5EINA 3DMYA 5IJ0B 4D82A 4BLPA 3SYMA 2IP2A 1AHPA 2RH4A 3OO1A 4YCLA 2O2EA 1I3KA 2Z3VA 4IHJB 2WKPA 1UBEA 4M60A 5HDQA 4IHKA 3K0HA 2GHQA 2X4LA 2N9UA 4MWSA 3BWCA 3V8VA 4PGHA 3JX9A 2RHJA 5KYNA 4M89A 4KP7A 3U7QA 1I51A 2BUAA 2AWNA 2EKBA 3PDJA 1P6XA 4R2IA 3JZIA 4CT0A 1N33B 2AFRA 3OZDA 4KAXA 3LNCA 1MAAA 1R5NA 4MW2A 4M8SA 4D4IA 1WQ3A 1QRUA 3GRAA 2X7XA 1G2OA 1TZMA 4RM2A 2YXEA 4C21A 3HJTA 3RSZA 1EFKA 4GWLA 2ADOA 2CYBA 4KACA 2V98A 3CB4A 4XI9A 3UMVA 2HIMA 3NPAA 1DC7A 4NCHA 4AUNA 2NP7A 2I5PO 1RBYA 5T4FA 3ESYA 4EYQA 3E0QA 2WSLA 3AQIA 2HXYA 4NBTA 4U0JA 5AIBA 4WA8A 1DIOB 4FNGA 4EECA 5J43A 1HFEL 1JDPA 3PYMA 2Q4TA 3PX2A 2ODBA 1DWPA 1P9NA 3KXIA 5DCLA 4F4HA 5JSUA 2Q2OA 2CB9A 4ZOEA 5DNWA 2EFDB 3RHSA 1OY1A 1X77A 3EUEA 3C3AA 2R7LA 1HETA 2ZUCA 3OT4A 4CPDA 2ENWA 2QM7A 3HP1A 2EU8A 2DQSA 2XDYA 3FOAA 3QPVA 2JGIA 4LN1A 2DFVA 3DULA 4J94A 5LNK1 4DV3B 1TLTA 2ZJAA 5HA5A 3Q85A 3ZHYA 3H11B 2WAOA 4PGMA 2WQ7A 2GCEA 3F3KA 1HDRA 2XYPA 5HF5A 1MC5A 3QELA 4Y9TA 3GEBA 2CCJA 4HSGA 4L8YA 3NTOA 2RB5A 5LP6F 4C7OA 5AK4A 3VR2D 3D6JA 2FY8A 5G53C 3B1YA 3TZBA 1Z6ZA 5JH7F 5BN3A 4OKSA 5E3IA 1JE0A 2XMZA 3TNYA 2Y2UA 3BIJA 5CAEB 1SPBS 3TEJA 4BEVA 1ND6A 4KYIB 4D41A 3ZXUB 1QXSA 4YCCA 5JS7A 3TMYA 2HEIA 3CWZA 1DEXA 3CX8A 3DVAA 5BWMA 3OLXA 4U7TB 2E3JA 4PLHA 4UKDA 4EF4A 2Z2IA 2AJBA 1GQQA 1V11B 2WIGA 2WKRA 3E3NA 3PXCX 4WFKA 1YKGA 2HBYA 1MXHA 1X9HA 5F77A 5HQJA 4OAQA 3SCZA 4QHSA 3TINA 3JZFA 4AJLA 3CLVA 4HL6A 3BMNA 1R18A 4KUGA 1KMHA 3UWDA 1QHNA 2Z3WA 3COSA 4A8JC 3L84A 2VTBA 1P7VA 5EHGA 4Z53A 4LCBA 1USUA 3QNUA 2JLWA 1DAEA 1GYRA 5HQ3B 2REXB 3Q3CA 4YMUA 4D6YA 1H42A 5EJ7A 2G76A 3LY9A 1UIMA 1BXKA 4FJ0A 4MUBA 1T0JB 4WA7A 4N5HX 4Q01A 1SUEA 1O0CA 1DINA 5HS4A 1P75A 3QXGA 5G1NA 1M0SA 2VXYA 3WLOA 5LZ9A 5K4AA 4E14A 1MJNA 4OQMA 2JFOA 5TRTA 3V4OA 4NH0A 4IDGA 1LW6E 2TMGA 3ZHSA 1BHSA 4O5AA 2CNWA 2NPIA 4C0XA 1KI8A 4WLVA 4ZHQA 2AG8A 4B3JA 5H68A 3VSEA 4HS9A 1YQEA 1XNQB 4M87A 3EVZA 3MWLA 3C5EA 1SKMA 1MJHA 4ZPXA 2R44A 1THMA 3D7SA 5EP1A 1NE7A 2WJJA 2WPDD 5HIMA 3R09A 1TQHA 3KD3A 1RVV1 1OGJA 4AN1A 2GHRA 2IUYA 1NAHA 5ELXA 1U2DC 4IMIB 1FDVA 2QKYA 4IIHA 4LXYA 2ANCA 2EW8A 4MVJD 5LQDA 4N3GA 4N47A 3B6ZA 5IUKC 4WMLA 1IXSB 2BM0A 3NAMA 1R15A 1S6YA 3VO9A 1T8TA 2OCBA 3ZJUA 5I4CA 4MRSA 4ODIA 3KZMA 1ZWKA 1KY3A 1AE1A 2H48A 4EI8A 1XK7A 4KAAA 1YR2A 2G4CA 2G25A 4DA6A 2IL1A 4EH1A 5K8JB 4GDFA 1HXHA 3R6GA 1B0PA 2IA5A 2ZTLA 4FS8A 4EY5A 3IOMA 4POAA 3LVFO 2V6JA 4RL6A 1MVLA 1W4LA 3PHIA 1CZOA 2V0NA 4UMDA 4KOEC 4C6TB 4WGFA 3D6NB 5F5LA 3HYNA 3MVEA 3U7EB 3W04A 4NZZA 1W35A 3O8QA 3W1VA 5TB5A 4KN8A 2P4HX 1N6IA 3BS4A 3HKDB 4YYZA 1B8VA 2E4AA 3GJTA 4NZYA 3RRMA 2JLCA 1KOJA 4O08A 3R3HA 4CL2A 4CMJA 1KFEB 1T8RA 4BMCA 1RHRA 3OIVA 1P17A 3O03A 2DCUA 3A6JA 4PN3A 2Z5FA 1LZKA 3KEMA 4YT2A 5CB6A 5J2TF 1QIJA 2V5VA 2GZHA 3PA6A 3QMPA 4CM6A 4KWCA 3DDWA 3RRFA 5ICSA 1SVOA 3SM9A 4ZQBA 1RFLA 2BBOA 4Y6OA 3GGCA 2J1LA 1UAGA 2D7CA 1SCAA 3AFOA 3C5CA 2Q9UA 1YUNA 2PD6A 2R6GA 3BSFA 3FPBA 1OWPA 2OLEA 4H7JA 1YNOA 4HQFA 1KH3A 4TQUS 4TV9B 3TX6A 1SHZA 1E9DA 1DAKA 3CB2A 2KYRA 4GEKA 4N7RA 3AL3A 1KMIY 3LOPA 3H9EO 2D13A 4UM7A 1E98A 4DUZB 3U0VA 4EHBA 4GVPA 5TNXA 3QBEA 1BKDR 1RWMA 5L4NA 4YRLA 2GXSA 2ZSHA 3AETB 4CE6A 1D3AA 2LV8A 4KSCA 4BZZA 3NHJA 5C18A 1T1GA 3EZ9A 3IVMA 1GG5A 2XNJA 4KFTA 4C0KA 4MOWA 4QPPA 3H7IA 5CNIA 4JJFA 3CW8X 5U4XA 1DWOA 2QPTA 4LRWA 3D7KA 4NDNE 2C4WA 2QT1A 3A9RA 5G4KA 2WPDA 4U2KA 3DLHA 2ZTMA 3K9QO 4DC0A 2G70A 2R79A 3AUUA 2VDWB 3KTAA 4QU5A 4BBPA 4AX4A 5CB4F 3MCTA 3OMXA 1JIUA 1WIWA 3TQOA 4JKYA 3ZG6A 1DGQA 3Q5EA 4G2TA 2B1JA 3N8IA 3QLUA 4B4WA 5BSWA 4NZOA 2Q46A 4V0KA 3TVYA 4I1YA 4AB1A 2VF2A 1PTJA 1EWYA 1QONA 1RYDA 4K46A 3X1ZA 1QZUA 3WWZA 3OIFA 3S99A 3GLHB 1Z8NA 4UQLA 4MVJI 2Y93A 5AM2A 5HCUA 2XKKA 4XYEA 3HY4A 2IIPA 1N9KA 3C97A 5A03A 2CXNA 1QS0A 4UUAA 4WV3A 4LYEA 1ECJA 2QR5A 3UJCA 1REQA 2BFMA 2IHUA 3O93A 4AMZA 1ORRA 2EATA 3IR6A 2ONYA 3F90A 4TLCA 2PX8A 1U3DA 1Z29A 4CLHA 1Q0PA 2AW5A 4EQ6B 2WFLB 2QRVB 2VHQA 1GNLA 5DO9A 1NR1A 2YWDA 3KTAB 5JTUA 3TSWA 3K2BA 4F86A 2NNWB 4FZ3A 5K3OA 4DCMA 2HHHB 1IMOA 3I9NA 4G0QA 5FWAA 4AL4A 4B71A 3PL5A 5BY2A 2DFPA 3LLSA 1SBZA 3HFSA 3VU9A 3ZE2B 3SIRA 4B74A 3S81A 1MR3F 3A6DA 3DHYA 3CC8A 3V8RA 2PCJA 2RD2A 2WY2D 3OHSX 5IXJA 1RKQA 2N75A 3EFOB 1BD4A 1ZNWA 3HR8A 3JYLA 4OGWA 4PZLA 4FCWA 1N2EA 2PA0A 1ZVMA 1WCIA 2D7JA 3TW8B 2G63A 3K09C 5AHKA 5ALEA 5CHYA 2MOKA 2OHHA 3DKPA 4DR4B 5FO1A 2Z1MA 4H6XA 2Z09A 4F2HA 4CIAA 3FXAA 2YOFA 3A1FA 2AUTA 3JVDA 1U3FA 1FJ2A 4UHBA 1YR9A 5KCMA 4YUWA 5L4LA 4LRXA 5CNJA 3WOVA 4DADA 4P7FA 4GL4A 4IICA 1EDEA 2XTNA 1GPDG 4P36A 5FPPA 3P8ZA 5JWOA 3WSVA 1WXDA 3U16A 2Y6UA 4MAFA 4ZEXA 4I5EA 3C3PA 4YGYA 5TMEA 1G8PA 1TQ4A 4DEVA 2K7ZA 3W6NA 4CLEA 1YMQA 4Z4FA 2QYTA 3QX7A 5KTNA 2P9HA 3KD2A 3L82B 3CLSC 4ER6A 1F2UA 3GWZA 5IF9A 1F4PA 2HWKA 4NFHA 2JAXA 1Y5LA 4NBVA 2HDOA 4RMGA 2C07A 1EUDA 4P3YA 1ZN9A 2ZBUA 4F2PA 1NBEA 1WB4A 2IWRA 4PNPA 4CETA 4AY5A 5IM5A 1AB5A 2QROA 2HQRA 1Z06A 2BWJA 2GAJA 3BOSA 3CS3A 3C45A 3MRXA 4G5OA 1NIPA 3B1WA 1XN4A 5EG5A 3R9XB 1INLA 1EYZA 4X6XA 4UHFA 1T24A 3RU2A 3WO0A 3MG9A 1B8UA 3ZS9A 4U7DA 2H00A 2XV1A 3FUUA 4MR8B 4RVUA 1CDDA 3UXEA 1RWBA 2AQ8A 1M0EA 5WRFA 3MTBA 3V55A 1F8YA 1U9IA 2XGJA 1II0A 1KP2A 1AD2A 2G80A 4LRUA 1VCNA 2RARA 4JIMA 2Q8PA 5BPFA 5LD2C 2D2FA 1YI0A 3OT1A 4M1ZA 1WD7A 2F9MA 4L15A 4DLRA 1ILEA 3P45A 1VJ5A 2O8DA 1ISRA 3QJYA 3R5HA 1MEJA 3D0RA 3K8QA 1R0LA 2PNFA 1Z6AA 3H8VA 1E6EA 2C83A 1CY0A 1ZNXA 4I9HA 4FB4A 3BE8A 3ND8A 3RYHA 2VP0A 3ZYCA 4F8EA 1XZKA 3GJ6A 5BNWA 2UXBB 3FNQA 2WWYA 2C95A 5C31A 3S5JA 4FWTA 3RD5A 4E46A 1L6IA 5K0EA 5E1DA 4B0PA 3C98A 3QPDA 1QQ6A 1ZIPA 4JODA 4PC7A 4RKEA 4LFCB 4DMLA 4L02A 1I7DA 2GAIA 1TJ4A 3OH8A 3QVVA 4P2BA 3R74A 4X60A 2HSJA 4IH1A 3C0KA 3IP7A 4GPIB 3ZCTA 1IBCA 1JHYA 3FRHA 4PYLA 3OCZA 7REQB 2I4MA 1VDMA 2HSGA 2WKWA 3CPHA 3FTPA 5DI3B 3V33A 4BVGA 4KTTE 4WY8A 3O84A 5HEKA 1SKQA 1QHGA 5H82A 1YOBA 3AG6A 1E8MA 4GLOA 4MIEA 2WTUA 5JNRA 3ZCPA 4MKRA 1YFJA 5AOBA 3K72B 1L5VA 3LPCA 3G8AA 4EATA 2G9ZA 5HJ5A 1TAUA 4WKCA 4E2FA 4ZDJA 2O2CA 2UXCB 4AAYA 3PE6A 4Q12A 5CFPA 4ZI7F 1GARA 3GQVA 4INAA 1NQOA 3DLPX 1TGYA 1YKSA 3DZFA 3H87A 3IPAA 1Y8CA 3NTXA 4TZKA 5T6MA 1B6GA 4RFLA 3Q8KA 5FWYB 1P73A 5IJWA 4KWIA 1X1CA 2B7BA 1LLQA 2J3DA 3E3MA 4Q4LA 4DUYB 4F97A 5KQGA 1EVYA 2JD0A 3DV9A 1ZBDA 2ODWA 5GONB 3SC3A 2BTQA 5KDLA 2HSDA 4HRVA 4PPNA 3TQSA 1K0UA 1JPNA 2JFWA 3N7UA 4YAEA 4DGSA 3BMNB 1ZM3A 3ZY4A 1XQ6A 4OMDA 4GBED 3I2YX 4OYHA 2HQOA 4PINA 1TMYA 3UZUA 4W5RA 1J9EA 3G9QA 4MCAA 4BCBA 1AMUA 1VRCA 2II6A 2QEQA 5LB2A 1WXGA 1I4LD 4NR0A 3DAYA 2OSVA 4Z9FA 3NCHA 3OTHA 1Q84A 2P11A 4AKHA 4KN9S 2LIPA 1NVUQ 2A0KA 2VK1A 3DVAB 3P2IA 4H3HB 4INOA 5A0FA 2FEPA 3WFZA 3BERA 1EFVA 4B9EA 4D57A 3NETA 1AG9A 3PQ5A 4OXQA 1A82A 1VL6A 2FKNA 3AF1A 1BQEA 3RQIA 3ZR4B 4OI0A 5IVDA 3O8QB 3MAJA 1GQYA 4LF6B 2EYQA 3K4PA 3I34X 1XZFA 3HWSA 4HUTA 2ZCJA 1E1KA 4ARBA 4ZAVA 4NG5A 2XNDA 2F4VB 1PJQA 2PH3A 2JIBA 4IKOA 2GF2A 3ZU3A 3RRNA 1F5SA 1NQAO 4QG3A 3HVIA 3UKJA 2BN4A 3MTIA 3HA2A 1V2GA 5DXAA 1PJ2A 3LT1A 2O1WA 4RADA 1XB2A 2WICA 3LBAA 1H4TA 3NZEA 2EQ5A 1GV0A 2EJBA 2PUJA 4NCNA 3E84A 3RS4A 3MSCA 5CMLA 2FF7A 4YRQA 1M0TA 3CIFA 3P52A 1A9XA 1ZR4A 1L7NA 2QTNA 1YIAA 2XE7A 1BDMA 5AK5A 3M1LA 2VDWA 1D4OA 1SKYE 1NHGA 4G01B 3P9YA 3UEOA 3MYYA 4UUOA 4COKA 4NONA 1JEDA 5FTJA 2ZUTA 2C5SA 3OCYA 1KZ1A 2AMYA 1XKTA 4G6ZA 4LYFA 4MPPA 4U5XA 4ZVTA 4R0NA 1GGHA 1KFCB 1OX4A 5A6VA 4RPCA 3QKWA 2CXQA 4ZCLA 1USWA 3JQ6A 4QPDA 1PLLA 3H9UA 4HQKA 4TS1A 4D0LB 3LDUA 4QVKA 4ZTBA 1UXGA 3B9PA 4MO9A 3CX6A 1TXGA 1OT3A 1TZKA 1TAQA 3I01A 3IVAA 4Q05A 3S1AA 2FPKA 3U3DA 4DLVA 2C88A 2O2HA 3EUFA 2PMFA 4C0QC 2XYHA 4KXXA 3LYAA 4MVJE 2GAFA 4OQFA 3KU4A 4MI9A 3FPAA 1QQ7A 2MSNA 2I33A 4M99A 4N7MA 3L93A 1XJ0A 4IDHA 3A1EA 3CF0A 3RUHA 3TMAA 4GRIA 4MB2A 3MIIA 4A5OA 4DSUA 1X7ZB 3ETLA 3E4DA 4D0NA 4BKRA 4MUHA 3LYHA 4DZZA 3WDSA 3C8UA 2D0DA 1P9LA 3OA2A 3QVXA 4QTUB 3RV3A 3CRQA 4GM1A 4R16A 1A8IA 1KE1A 4EB0A 1IHDA 3LC2O 5EC8A 3WGZA 2B1QA 5FPYA 3ZOKA 2I6SA 2UZ3A 3TM5A 4IM7A 1GA4A 2ORED 1L5LA 2XUGA 3MMXA 5DXFA 4W8HA 4Y2RA 5C53B 3LCCA 3D6FA 4DRXA 1AS0A 4OXYA 4HUQB 4G86A 3HB4X 5T4BA 4G0VA 4ZHQF 1FP4A 2FW6A 3FSJX 3SI7A 4D9JA 2WM2A 3KPUA 1RAHA 3H75A 4NBRA 1P2BA 1NU8A 3KRTA 4PHFA 1P44A 4OH1A 5JCOA 4Q4CA 4Z7NB 4HRAA 2X6RA 4C78A 4EQZA 2Q0XA 5FI0B 5KSPA 5EQDA 1KH2A 3R6WA 1C4WA 3P19A 2WMDA 5H4GA 4EHJA 2F90A 1EX9A 3NB0A 1XL1A 2CVQA 1BH2A 3OCCA 2VIIA 1NU6A 3LW8A 1W6RA 3IR5A 3G8BA 4LJ4A 1USVA 1IN6A 4J9VA 2ZRQA 1Y33E 3OLVA 1XRJA 4PQFA 5DXJA 1JHAA 2HPAA 3M7IA 3PFGA 4IQ4A 4BO5A 4Q02A 4Z9AA 4IXDA 4YAGA 3IAXA 1W4ZA 1FB5A 1ZUWA 2M9MA 4KUHA 4NABA 4HMQA 4AQ7A 1KF0A 3HVUA 2EP7A 4RIHA 2QG9A 5CFOA 1G9XA 3ICOA 3S2YA 1SD1A 3FAKA 3NV7A 3L8DA 4HZIA 1SK8A 3FDJA 1EJ0A 5REQB 3RF6A 2P2LA 4MWBA 1L5YA 3E3OA 3HXOA 4E70A 1GPH1 5IAEA 3EUAA 2WK1A 1CG6A 5DLQC 3QUSA 1IY2A 1A77A 1C1YA 1TUBB 2YDXA 1XE3A 3E7XA 2ZRBA 3PFBA 5EJ8A 4L27A 1O95A 4ENRA 1EWTA 1VG1A 2DUUA 5A2GA 5AM0A 1NJ6A 3HE3A 4BECA 5IASA 4PN7A 2OPBA 4FC6A 4M1OA 3PC3A 2G0NA 3RPEA 4BO9A 4FZRA 1C9KA 2VPTA 3GRRA 3LU1A 4A2CA 4GH5A 3P32A 1E5TA 3C8MA 1XHLA 4RL4A 1RRCA 1T1IA 1TYDE 4NCBA 3D6UA 2Q4RA 3RSSA 1HTWA 3TOVA 3WLLA 1B1CA 2ECOA 1TJYA 3DDSA 1QH1A 1SXJC 4MVXA 1S3IA 5G3ZA 1ULHA 1WDMA 3TQCA 3KJGA 3PV0A 3AILA 1QDEA 1J00A 3F6SA 1NFQA 2PXXA 3TVTA 1RXEA 1UBRS 1WXQA 1FVOA 1L7DA 5LMUB 1T2EA 1UANA 3A9TA 2JIOA 2P9EA 4U8GA 4XCVA 1F8GA 4HATA 1BTOA 3I9JA 2V7WA 4Z1OA 5KCZA 4DEXA 3SK0A 3ZHQA 3JR7A 1PFKA 1U6IA 2OSBA 5AKEA 1JPVA 1GL9B 2HK6A 2Y27A 3NUZA 1J0CA 3P5SA 4UNNA 5BN3B 1FFYA 1MAUA 1P4AA 3TRJA 2G5TA 1IE3A 3VJKA 5LXTA 1Q12A 1RJEA 1R4MA 5LWHA 1HE4A 2QXUA 1D8AA 3BB1A 3RVNA 1M2OB 2LKDA 5JCJA 4MKFA 4Y0NA 4F91B 1W5EA 1U99A 2OBFA 3PP8A 4BGVA 4CIVA 4HDRB 2B1RA 2F1KA 4I5GA 1VPDA 3R0ZA 4LXGA 3TM4A 4K6MA 4JUFA 4BS9A 1EVJA 4LXHA 4TYYA 1FUUA 2GF0A 4ZXFA 3A05A 4EMUA 5JARA 1G8JA 1IATA 2JKYA 1BCSB 4M9UA 4FWIB 1JKIA 3GJ4A 4JX8A 4XR4A 4V1CA 5LQCA 2IOQA 3I05A 4BC1A 5KKNB 3JSAA 3ZKAA 4AY4A 4QUAA 1YRLA 2PT5A 4JEHA 1KYWA 2VZLA 5DOVA 4PLYA 5BURA 1XQVA 4ZT3A 3TQFA 3DYBA 1P3Y1 2Y6VA 3DF7A 3O3CA 1OI2A 1T29A 1FQJA 1VPEA 5CW2A 1G5HA 1HT3A 1S3SA 3OE1A 5JJCA 1ULTA 3HG7A 3NBXX 1TYZA 3KOWA 4D9CA 4C6HA 4J7CA 4CDNA 3VH3A 5CG2A 3VKUA 3MQFA 5ERYA 3VO8A 3IKVA 1TM2A 1AO0A 1J42A 1EU1A 2YJ5A 1S1MA 5E38A 3PEEA 3MQ2A 5DTQA 4CQLB 1NLYA 1E4YA 2VHTA 3AO0B 3IALA 4MULA 1XD8A 1OLOA 1O57A 1QB8A 4RANA 2IVFA 5F52A 1DJOA 4GOMD 1NT2A 1ZU4A 4B45A 3RYIA 1NP6A 1U90A 1UEXC 3FHLA 4HAXA 3PWTA 4QICA 3TMKA 3HFJA 2OO3A 4JJ8A 2CJFA 3FDFA 3OOJA 4UFOA 2R1UA 1KGSA 1H8ED 4N54A 4IJ5A 4ZC8A 5G4LA 3HCDA 3M4ZA 2ZSBA 4Z2YA 2QOEA 1J2YA 2JEOA 3X1WA 4BO6A 4B3SB 3HB7A 1GN8A 2C94A 4V0ME 3CBQA 2HD4A 2CFTA 1E1CA 2XCIA 3AH8A 3SF8A 1Y63A 3T0GA 4UE2A 4B3CA 3Q9NA 5DM2A 2VSFA 3RVKA 4M1MA 3EH2A 2JBHA 2QTVB 3DCYA 2GILA 1O0BA 3DFIA 3ORYA 2QD5A 3DGEC 2J4DA 4DPMA 3GEDA 3H42B 4MJ3A 2DFKB 1Z2PX 4OK5A 1KO4A 5LZ7A 2F1IA 2COKA 1S2DA 1SCDA 2FNAA 2FN4A 1XQYA 1IN8A 2GKOA 3TQRA 1RCTE 4JNCA 1CJMA 1E61A 1KHHA 2C99A 1X7DA 2OHIA 1Z39A 4MUFA 4BGUA 1CB0A 1YB7A 3DOOA 1DNPA 3E2IA 3K1JA 4K6GA 1NRJB 3Q8LA 2IYEA 3IB6A 2DBYA 3MGAA 5CYOA 1IG0A 2CCKA 4WLUA 1LPAB 1Q7TA 2RGCA 2WFLA 1AV7A 3OJXA 4HH3C 1DVRA 2OYRA 4PWYA 3T7DA 1GKLA 1EEHA 1H5NA 2FFBA 3N2GA 2NXEA 3WR5A 5LVAA 1V3QE 2OBXA 2ZP1A 3P2KA 1S8AA 4HTAA 4ZQEA 1Q6YA 4KPFC 2ZIUB 1CLUA 2PEYA 4NSNA 3R7LA 2E9SA 5LOVF 3AUTA 5C1DA 1YZ3A 3HDHA 5MFZA 4COOA 4UTVA 1GILA 1V6AA 2NZXA 1Q1AA 1W94A 3L40A 4X8HA 3LECA 4F3NA 1F2TB 2X2EA 2XIJA 1P4RA 3PQFA 5EPOA 4DZTA 2PS0A 2H3HA 2QUIA 1XYVA 4TXJA 3RSLA 1ADGA 4LMPA 4Z8XA 5CT6A 5TARA 1T35A 2L18A 3NHUA 3GNTA 4Y18A 3TEFA 2XYVA 1I2CA 1I5RA 1IBKB 3MILA 3FYDA 2DH5A 4NP6A 4QECA 3O1LA 1QGUB 3EUWA 1BDIA 4BMXA 1F17A 4PGGA 1OBHA 1SFRA 3FAZA 2IS6A 2W4IA 2CXOA 4KRGA 2A5GA 3COYA 4KXVA 3GRKA 4XDGA 3FIJA 3MS4A 4GZ5A 1NBWB 5EQTA 3UTDA 3EGXB 2CL0X 1VTKA 3MBOA 3QFSA 2O6HA 2FCAA 1KZYC 2WJ4A 1ZC4A 5DFAA 5ELMA 5TS3A 2C5BA 3DOCA 2QXYA 2OVBA 3EF1A 3IKMB 3ITDA 4OQQA 4YUZA 4AY2A 4A16A 3G5TA 3QVMA 5AJXA 1TFUA 3C48A 4LJRA 1LKZA 2IDKA 2BDUA 3OPVA 3K70B 3A3NA 3I5MA 4QQNA 5DHRA 4OFWA 2E82A 3GT0A 1SZPA 5I9TA 3ZV6A 1PR1A 3O26A 1LX7A 5LYYA 5JIBA 1EX1A 1D04A 3EOZA 1JHDA 4G1VA 1Z0AA 4PS0A 4D92A 4ZI7A 1ZH0A 4QL3A 4LYHA 4FFVA 1XLUA 2RJNA 4A6DA 1BZYA 3IEIA 1ZNZA 4L0QA 1ZL0A 3WK6A 2C78A 2P77A 5H83A 3AEKA 3AR7A 4ZVLA 2IS2A 1N2ZA 3OQVA 3REGA 4LZLA 3PUJA 1OXXK 1YJBA 4JWTA 2XSZA 2ZVPX 2QV0A 1VECA 5ALQA 3H05A 4U2BA 3T3PB 2X86A 4X6UA 2Q0QA 1F0KA 1IQUA 3ZCUA 4AXBA 5CA1A 5H0IA 1T5OA 3RJMA 3C4VA 3P2YA 3KOMA 3H0CA 3ZC3A 2CHGA 2FWPA 2BF7A 5THXA 1JEAA 1KAOA 3D3NA 1QYWA 3W8FA 3WB1A 3ZI7A 4Z4CA 5D85A 4CLRA 1AURA 4GI7A 2EFEB 4YJFB 3TFWA 2J9YB 4MR7A 4AKTA 1JFSA 1D2HA 3A6KA 3PICA 3PGMA 4QHTA 2PXHA 3ROTA 3AFIA 2ET6A 1EQUA 3SYTA 3VPAA 4BWGA 4A1FA 1JLMA 1L5RA 3LY5A 3QI7A 4K9KA 4C30A 4QKQA 3FDZB 5SZKB 1Y1SA 1YK1A 3DDHA 2BTQB 4XZ3A 4MUEA 1RWQA 4WK4B 1V8FA 5C5DA 1V9SA 2AL7A 1J2UA 3NOOA 3QMVA 3TD9A 3WGVA 4DLTA 3RYCB 1XMPA 3B9BA 4AT1A 4WQMA 4FIZA 2R6JA 5M29A 1NC3A 5C52B 4Y8VA 4GD3Q 4YVFA 1QR2A 1COWA 2LUOA 3ZW9A 1HNWB 1M6VB 2QLJA 4MV7A 4E2ZA 2CHEA 2ZWAA 2EJTA 3GG9A 2YFKA 4YHHB 4RY0A 4DMHA 3EG5A 3REQB 1OJ7A 4EJSB 1IHOA 2QLFA 4YA6A 4CODB 1BX0A 5E0KB 3HYRA 1CC1S 1X7WB 3MUEA 4IZIA 3R0VA 2AF4C 1Q0UA 5IARA 4YV0A 1GN9A 2ZJOA 1ISHA 4NCIA 4E31A 5JSHA 4DJTA 3O8BA 1LI5A 3OJ0A 2J48A 4ZVNA 2BTOA 1NKVA 2VWGA 1M6EX 3L6EA 4AF6A 3JVEA 4I5IA 3RWMB 3N2LA 4DV2B 4Y2GA 1FDOA 2ZEJA 4NBLA 3R9XA 4I55A 5I3CA 4UPDA 3G2HA 3HXTA 5CYGA 4G0PA 3L0DA 4YP0A 3OHMA 4RS3A 4EJFA 4C03A 3T94A 1TK9A 2FRXA 4IFEA 5L3VA 3HGQA 1HK7A 2KMLA 3EIOA 1I14A 4BUZA 4HNUA 1KERA 2J3IA 4L9AA 1JDBC 3T15A 1Z3IX 3F5FA 3TFQA 3OICA 3WC4A 3QVKA 4PYNA 4QYIA 1KAEA 4WH0A 2BJVA 1YL6A 1DZ3A 2VC2B 4BQOA 3DXXA 3OX4A 5TT1A 2KS6A 5T8KA 4QUDA 4PXAA 5AKXA 4KU4A 5DTMA 3V80A 8ABPA 1GAXA 4WK2B 1N4DA 1F3LA 2ZM5A 3QTBA 3KQMA 1NMYA 1H8EA 2QQGA 5BXYA 1XCLA 2GDZA 1YQQA 1QV7A 2GPAA 2R9VA 1MDBA 3OUTA 4M0DA 1NR7A 3DE4X 3UWKA 3ZXYA 4ETNA 5EXDA 1I30A 2IY7A 1FLDA 1C0KA 4RSHA 3T1NA 1WZEA 3ENVA 5HVNA 3LC0A 4FLMA 5DDIP 3BE6A 3LC1O 3ICPA 1W76A 1X8JA 1E7RA 3OQHA 1MGPA 1RAFA 4HNAB 1BN7A 1H3FA 4I1IA 1I2DA 2GBGA 4URUR 1OLSB 1G5TA 3MM4A 1EBUA 4Y1RA 4B83A 3PKZA 3RCBA 4TZ0A 1L7MA 3M2TA 4Y1FA 4LYJA 2GASA 4HGYA 1UQTA 1Z4JA 1DDGA 2ZU6A 4XW2A 1SUFA 1UIRA 4QFMA 1G2IA 3FFTA 1NI4A 3OE7D 4MR7B 4UMVA 4L51A 3PE4A 4J91A 3PF8A 3UJNA 3JQFA 1E2NA 3BMCA 5L7YA 3HA5A 3N53A 3QYPA 1PQUA 5CG1A 5K6RA 3T5PA 3RGGA 3L8MA 3CNLA 1PYOA 4L5YA 4M0UA 3WGIA 2LCFA 4MMZB 1PDOA 5IHPA 3UKDA 4KV9A 2PY6A 1E7MA 2EFHB 3A25A 1ODCA 5AKIA 4FLFA 2OYSA 1KK3A 2JJYA 3VHLB 1YASA 3KEOA 4X85A 2BT4A 2NZWA 3RJZA 2YBEA 2NP6A 3C6BA 2V45A 4DLNA 3BEOA 5PNTA 1MX3A 2FWJA 2POQX 2J5BA 3WWDA 3PQCA 2UVDA 4B31A 2DJIA 3SZMA 4UEWA 1O96B 3PWSA 2OILA 5AKYA 1LGYA 1PZHA 3RSFA 4TL6A 5B7QA 1PIWA 5KDOA 2GK6A 2XNHA 1CQZA 4RPLA 4N41A 2RK4A 1NYLA 3HJRA 8AT1A 2RKBA 2BIFA 3QTLA 2G77B 5FPQA 1YZVA 2CNBA 2OXFA 2FR8C 2P40A 1N2CE 3QKRB 4DSAA 1AU9A 3NRCA 1G8YA 1KO1A 4QBFA 4QXMA 5JZBA 5KNDA 1L8OA 1Z47A 4RGQA 3K0AB 2GMWA 3QYFA 1PJ4A 4OQPA 4BVAA 5TIIA 3IAS6 4Y67A 2HWUA 4J1QA 1SCUA 4ZEOA 2R2GA 3PPXA 2R6HA 2P67A 4TV8A 1Z22A 2OY0A 4YMTA 3HN2A 2SKEA 5D3KA 2A5DA 1TU4A 1Y5IA 3I6IA 1N1EA 5K4GA 4LE1A 2HT6A 1XUOA 2IDJA 3UWSA 2H59A 3VX4A 2CDAA 1QGUA 2H2WA 5DLPA 1TUEA 3TUJC 3B3AA 2H7XA 1C29B 3S2IA 5FULA 2BC9A 5D7BA 1A2QA 3WLPA 4OSEA 2CJWA 2FE4A 2OORC 4QM7A 3CR8A 3SR3A 4BV2A 5KC9A 1M1NB 2I4RA 2ZJ7A 4J6EA 4JBWA 4QG7A 1MFZA 3L7NA 5CT9A 1QVWA 1L7OA 4K9NA 1E59A 3DTTA 3H1AA 4EDFA 5BWNA 1XRRA 2ERCA 2HCFA 1VFPA 4FKZA 4IO1A 1GZ4A 2XX3A 1N0VC 2AN3A 4Z3OA 1V8ZA 1D7AA 2WM8A 4G5FA 3WNCA 3ZWMA 1M1XB 5LBTA 4QT4A 2ACWA 3F73A 1R0ZA 4DTCA 3H5RA 3AMVA 2PSDA 3C1TA 2IYWA 4D8TA 5CEEA 5JS6A 4X66B 4RQTA 2GVDC 2P2YA 3VJMA 2GFHA 2REBA 2I03A 2NSHA 4L8LA 3S3TA 5M7EA 1YDHA 3BMXA 4P38A 1OYOA 5DSTA 5KHAA 3ZS8A 3ZCSA 3KB1A 2QX9A 1L5QA 1V9LA 1J8QA 3DHVA 1QYRA 3GFTA 3RO7A 3WNBA 4YRNA 1W30A 4DNFA 1KEPA 5GAJA 5FYQA 1RYBA 4A0FA 3ZZMA 1OIWA 4WOCA 1E9CA 1UMBB 4PZZA 1TZCA 3N6XA 1N9ZA 4DJFC 3AY6A 3CZCA 1FMCA 3OURA 3H3XA 3GJQA 2XODA 4R3NA 3ZDRA 7GPBA 4J0KA 2AUNA 3GD5A 4RESA 3WJ2A 4E07A 3B60A 2N47A 5BW8A 3BFKA 4QODA 2P4UA 3HWX1 2CV1A 1D6MA 1UDRA 1G2PA 1ICIA 2IZZA 3DBLA 5AKGA 3OFVA 4E2WA 3NALA 4Y0AA 4ETIA 2H2IA 2YHUA 2UUOA 3KWJA 4MYSA 5FLEX 2SKCA 1TKAA 3IT0A 4GVXA 4H27A 4MRPA 2BKAA 3DQPA 4RHYA 3VXKA 3OBIA 4WXYB 2JH8A 3RE1A 4X84A 3KSRA 1EK0A 3IAAA 4LTMA 3K53A 4RMHA 4TMYA 2WBLC 3FBWA 4D9FA 4EX7A 4WKGA 3DAHA 2BKUA 3QQ5A 1T2VA 4ZYWA 2WWWA 3B5JA 4LXIA 2EF0A 1JJVA 2XZPA 3UJHA 1NMSA 1Y3CE 5C1PA 3NP9A 3L7KA 4C1BA 5E3JA 2C2OA 3UGJA 5HZMA 3TXYA 3SXJA 4CEHA 4C6TA 4WZAB 2QL9A 1AZSC 1QP7A 4HGOA 5B37A 3HL0A 1JDBB 3BK7A 2HB6A 2QR3A 4G0YA 5DJ5A 3D4NA 3GLHA 2BCEA 2QF7A 2BMJA 2P6MA 2VEOA 1PFGA 5LQKA 13PKA 4RXUA 5B6PA 1WCWA 5C5EA 4QJ5A 2JLRA 4TROA 4D46A 4DIUA 4ABTA 3ROKA 3MT9A 3PI7A 3WFJA 2WB4A 2XMSA 3SSNA 1KP9A 4H59A 5HK9A 2HYDA 1J56A 1IM2A 5GMOA 1J97A 2QLLA 3GGGA 1GCOA 5C8YB 4YDQA 3D8UA 1OKKA 2ZB7A 5AKJA 5EVJA 4M21A 5KREA 2Q9CA 4IG9A 3A2LA 3OU6A 1W75A 4TL8A 5CBKA 2VTBB 3CVJA 4GR9A 3DH0A 3R7BA 2O8EA 2BCJQ 4MV6A 4C0HA 3LSTA 1CZKA 1M6VA 3LSYA 2XA9A 3H4VA 1WOMA 1C3VA 2C5LA 3JWHA 1KVRA 1Z2CA 5E4JA 2YJGA 1E6CA 3UFBA 1JYFA 2QN9A 2G08A 3ZW7A 5J3JA 2AX4A 4GZMA 4MV4A 4CKZA 4MWCA 3ZXSA 5CCDA 1N5IA 2LWIA 2Z2JA 3HRIA 4EYGA 1D09A 1T2UA 1Q5PA 3NCTA 4Q9KA 1FVXA 1NXXA 1XPJA 3SC2B 1QBKC 2JFBA 4BB5A 1ID8A 4E1AA 2H2FA 1O4WA 2WDZA 2VZ0A 1HQCA 1Z9BA 3KYBA 4AS1A 1JSZA 3VC7A 1D03A 4HOYA 4XDHA 1EXNA 2HU5A 2A9PA 2QT0A 2ID8A 3NIDB 4NJMA 1JKMA 3EH1A 5ESXA 2QAIA 1PK8A 3E5RA 3N75A 2W11A 2C5HA 3OQ6A 2G6BA 5H7XA 5JTTA 1JN0A 1WCYA 1ZOPA 4OYRA 5TGTA 3JYOA 4QGSA 2QV7A 3GA0A 3RSCA 1QU2A 2VPQA 3PZRA 3BULA 4P34A 3DPIA 5IZ4A 2DETA 1EVIA 5I7FA 3WIOA 3D1LA 5KTOA 2FSIA 1Z26A 2PV0A 1N8NA 1Z8FA 5D5PA 5I8PA 5BOVA 3E6AA 2V5AA 1BGXT 4O2BF 3FFXA 2IH2A 1OWLA 1JPUA 1ESNA 3DTVA 2WM9B 4OL0A 1IOZA 1V16B 2QRJA 2R8EA 4XARA 2B2NA 1MPXA 4JC0A 1O97D 4EKEA 3BHIA 2PPLA 3PXAA 3SOZA 1JEQA 3IQZA 2WF6A 5BXQC 4FEYA 3TQTA 4ZWNA 2YIMA 4A26A 2QG4A 1KK0A 4MK4A 2QPLA 1EFRA 1SVNA 3L04A 5FUBA 2GCIA 3RS5A 3HCRA 4QOFA 3GP3A 2QRLA 4YRCA 4IINA 4UUNA 2B78A 3T4EA 2WUGA 4HG2A 5E6SB 1T2AA 3WHIA 2A1TS 3HDYA 4TRMA 1JLKA 4JI7B 2I3ZA 1GUDA 4OB6A 1VLQA 3EGVA 1YE5A 2VNAA 3GCZA 2R6DA 4N8SA 5A1JA 1BJTA 3C3DA 2Y4NA 4OHZA 2PGIA 4BRZA 2GEKA 1W49A 3ORFA 3QLJA 3C3KA 3C5WP 1CETA 3FCOA 3N2KA 2ZBEA 2VP4A 4I6GA 5HJ7A 4IYRA 2ZYVX 1NBMD 3AY7A 1P61B 1WLSA 1YU9A 1YS4A 1P31A 4RTOA 3KZ1E 1V71A 5IJAA 1C9DB 1RCUA 2WV7A 5C5CA 3D1VA 1VKOA 4BLVA 1A8HA 1N4AA 3RRYA 4MRAA 3TJRA 5J4LA 1MQ8B 1GR0A 1YRBA 3NUQA 4P86A 2X0EA 3O94A 3ADKA 1V8BA 3FUXA 4MS3B 4PBTA 1PK7A 3IP8A 2LTAA 5KNCH 4M7WA 4RSMA 2J8ZA 5FPKA 3VPFA 4R8KA 2PK3A 2XA2A 3SYNA 2WP8J 4PAMA 1YFZA 2HLPA 4BAZA 4YUYA 2FX3A 3P20A 3WJ1A 3WQHA 2OCAA 4O33A 4EA7A 1XI2A 3DAPA 3EAQA 1U6JA 4DAEA 1HRDA 4YAUA 5THKA 5JFGA 1RXUA 2RJ3A 3FY4A 2A1UA 5BUCA 5ILGA 1D4AA 2X8BA 1C9EA 2WT8A 4R0MA 3KJHA 2XUAA 1PEAA 2Y76A 1NMEA 2I9KA 3EMDA 3P4XA 1AT1A 2J31A 2GJ4A 1IU9A 2HSZA 3HDTA 3A1UA 4RZIA 4YRTA 5EWLB 1EA7A 2CD7A 3VBCA 3ZDEA 1G7RA 4EHDA 1C80A 4Y2QA 5CFQA 1JFRA 2GK4A 4TQ9A 1WKVA 5I7UA 1VIMA 3K9BA 4FOTA 4S12A 2GWRA 3N5CA 2B35A 1XA0A 3HZOA 4M9SA 1ND5A 3FW1A 5H9WA 1NW3A 1RU3A 4O4IF 3PC8A 2ZSKA 5JZOA 2FQWA 2XITA 3AKEA 4GIBA 5F51A 3WKBA 5GWXA 4JJGA 3KPWA 3NATA 1JIQA 1DC6A 5DX0A 3V2GA 4CBVA 1ILWA 2XGGA 3NRBA 4YJHA 5B58T 3AUXA 3OX1A 4Q34A 3WGOA 3QMWA 5AVWA 1TZ2A 2OMKA 3UPUA 3H65A 3KQSA 5C34B 4IRUB 3U39A 1VCHA 1FYFA 2P2SA 1D5CA 3RS0A 3DZBA 1ZICA 3H5TA 1DXHA 1YD7A 1LCIA 1W25A 4J76A 4M46A 4PYRA 3PUVA 3G5LA 5EHQA 1LDBA 2JHCA 2VRNA 4B3HA 1QNLA 2HA5A 4MVJM 3TLXA 1LWNA 3MAAC 5H70A 2B3TA 5E2AA 1JBEA 1VFNA 3BD6A 2HFKA 4LZAA 5AM3A 3ZU5A 3WGTA 1DU4A 2EIXA 4OA5A 5K2MA 1LTKA 4KVFA 1CP3A 1LDEA 2Y99A 1C8LA 4FBMA 4Q03A 3G2MA 3QXJA 4W5WA 3UCXA 3DL2A 3HJBA 4KW7A 4LGMA 4O2AF 4U5QA 1IAQA 3VYSB 3PUZA 1BOFA 1HYQA 2R5WA 1V95A 1LK0A 4DAOA 3SYRA 2QL5A 3GN2A 4QOSA 5EIAA 2GQ0A 2NG1A 3WLMA 4BZQA 1M73E 4QLBA 5LU9A 1JG6A 4AIIA 3COPA 3AKZA 1U7PA 2LDBA 1MB0A 4W99A 1GPNA 5DLYA 4UQPA 5EJ6A 4O8CA 3GLGB 5CCBA 4XJTA 1KRXA 4KN6A 1LLDA 4HDOB 3F9IA 4FYXA 1E94E 1OSNA 2W00A 4QEKA 3KOYA 4WWHA 4D3YA 2VCYA 3PFFA 5EI5A 5CK4A 2EAUA 5E7IA 3HB9A 2NZYA 4ZRNA 1NVXQ 4ALJA 3AGQA 3MB5A 5JASA 2TRSB 4XIGS 4LDNA 4EPRA 2YXBA 2HDHA 1J0BA 2ZPUA 1K7YA 1UBTS 1YB6A 4RKRA 1WA5A 2CMDA 2A1IA 5GM1A 3X43A 5DH9A 1QCCA 4QAJA 5FQOA 4YMIA 2JCYA 3P7MA 1H2EA 1X7XA 3KOOA 4EMSA 1U8CB 1IB0A 3SE0A 4F2DA 5HILA 2NUAA 4B7ZA 1ODSA 1HYGA 2RGNA 3QBDA 4JYMA 3EW9A 3EIWA 2OR3A 1TUGA 2A5LA 1T9DA 1NF2A 4BX9A 2ZUFA 3Q0TA 2V0CA 3H3FA 1A2OA 1EFPA 1Q0ZA 1T5TA 4HZUA 1EM8A 2QMUA 5F3DA 5H3HA 4DBVO 6YASA 2G36A 4RUKA 4RH3A 1IY0A 2QN1A 1VE6A 3LCRA 3IHLA 4S1OA 4YRDA 5JC1A 4BEBA 2EQAA 3I2JA 4GBMA 5GV8A 2C9ZA 2QAJA 3Q88A 4JOCA 3GVPA 3G0HA 4FPXA 3RDPA 3F97A 5FAXA 5FHQA 3A6FA 4IGIA 1ZI9A 4WPGA 3HKDA 4X1KA 1A69A 4BNVA 4KK4A 4MQEB 4K9LA 3MWDA 5C9ZA 1G60A 2DTEA 2IPOA 2RHWA 4ND7A 3SICE 2ZATA 4CCWA 3L6CA 5LIPA 3NR2A 1QHSA 2ZSIA 3OZVA 4GDMA 3KS9A 3NV9A 4UTXA 3THOA 1FTYA 3QOWA 3AVXA 3JAKB 5K0TA 1JDUA 2FLWA 3M33A 3TUIC 3VJRA 3A4MA 1Y42X 4WCFB 5FTKA 1S8OA 1IK4A 3OPXA 2ZRGA 3PS9A 3UHOA 4JN6B 4BE7B 2JFNA 3IIJA 1WB5A 3FTDA 4P4UA 4WTOA 4Y2VA 2OKCA 3WZLA 1XELA 3DWIA 3NKVA 3TKLA 1VRVA 1AHIA 3C14C 4TX1A 1RJGA 1VJGA 1F1BA 4S1NA 3IEUA 4FINA 2PU5A 4DM4A 4TKMA 2Z8XA 1NE2A 3LDFA 1JH9A 1RSZA 1SQ0A 2OGSA 2WSMA 3GUYA 5HM8A 3UHFA 4MYRA 1VG0B 3H2GA 3OE7A 10MHA 4LJ5A 5ALDA 3RC9A 1WUHS 3K16A 4Z4EA 1VXOA 3DE3X 3NYRA 4EFLA 1F7UA 1ZK4A 3KLMX 3K92A 3TK1A 4TOIA 4C6RA 4AJ2A 4A2WA 3GVHA 4M22A 2GXAA 3NIFB 3QKSB 3P0JA 3GNQA 3I62A 1HEUA 1I10A 1PSWA 4HTFB 3QG5A 1UPCA 3DDOA 2RK6A 1Q1NA 2DKNA 4P33A 3WS7A 5IK2D 5LP1A 2H7CA 4BO4A 2OQIA 3L4KA 1ZM2A 2YASA 4GQBA 1RKVA 4RF5A 2REQB 3PNOA 4H16A 4XEUA 1WY7A 1G20A 2QX4A 3T1HB 4EGFA 2YJZA 1ZD2P 3UHAA 1SXQA 5K8LA 3FVWA 1PJCA 4QPCA 2W6JD 1NKTA 3MGGA 4NOMA 4Z0PA 3RVQA 1SXJB 2Q6OA 1JHUA 1MOSA 2WKQA 3DC2A 3E9CA 3WRYA 2BFEA 4XD7A 3U7RA 2QL6A 3QLUC 4B2YA 4OREX 1COZA 2Y1KA 4I3GA 4PE5B 1UJNA 1RBQA 1ACLA 1BDJA 2WHYA 3PFHA 4R4JA 2IHZA 6REQB 3K70C 4DREA 2H1SA 4AJJA 5JJIA 4I4CA 2NUAB 1YSCA 4R7ZA 2AN4A 3T5BA 3THRA 1KI4A 2C0PA 1RHMA 3UMRA 5EVCA 3CRNA 4TT8A 4Q3KA 4XM2A 3X0DA 5JI3E 1GSHA 1Q7BA 3DUFA 2ZDGA 3SYLA 4N3CA 3FUCA 3CKKA 2BUBA 3BWYA 4WOPA 5C1IA 5JS8A 2FQXA 3VPDA 1GO2A 2OV4A 2LBPA 3A3YA 4WINA 1MJ5A 1HKHA 2NV0A 3T4UA 5AW7A 4NH4A 3IP5A 4U8HA 4MV1A 1EB8A 1LLFA 2I6UA 4NZMA 4RMNA 5LXTB 1I3MA 1O4VA 1K2WA 3O90A 3EJ6A 1ONNA 1YR1A 1LUAA 5AQEA 2KE5A 3QVLA 3CU5A 2O2JA 1YBFA 3RFXA 2X2PA 4K6OA 4WSOA 3RBVA 5KHOC 1FXUA 4XQ0A 1G21A 1O6FA 5K0FA 1ONOA 5ABPA 2WRZA 1I33A 1NTRA 2O8VA 4L1KA 3L1IA 2E5WA 3CMCO 3KT3A 1ZW1A 2EYUA 3WHKA 1ISIA 3IFSA 3L1UA 1MRNA 1KU6A 2XE4A 1P81A 4Y6QA 3PK0A 4A0RA 1PI3A 3TPZA 3OO0A 1EEXB 1Q0SA 2BMEA 4NHOA 2HMSA 4GKBA 4GUAA 3RUFA 1BCRB 2XQGA 1NRXA 3VDXA 2XMQA 3RVMA 1I1HA 1TM5E 4CKEB 4CLXA 1UDWA 3GU3A 4KPYA 3NAGA 1TUIA 3C7TA 3BILA 3NBQA 3E03A 1F9EA 2UZ0A 3IEPA 3TRFA 2FXIA 3F4LA 3HKBB 4W6ZA 4ECEA 4KBGA 4MV3A 1AH2A 2BGLA 2HUNA 3PG5A 1I9GA 1RZRD 3KKKA 3S5UA 1SOMA 1E64A 2RI0A 3SLKA 5JD3A 3Q2OA 1NOJA 1FVHA 1T3HA 2FEXA 3PGLA 4XLLA 3VR3D 2VPWA 3SZUA 2AI1A 3CTPA 1N6LA 1HE2A 2B9EA 1IAVA 1Y1KE 1A76A 1UC8A 3NBMA 2FZWA 3WL6A 4BJ3A 1DPGA 3HPRA 5CGZA 3CVWA 3AKYA 4RVSA 3RH0A 3S70A 3DBHB 3Q7SA 4TTRA 2GCNA 2GJKA 2NSLA 4OP3A 3X1MA 1E0SA 2O06A 4KXLA 4PO3X 2VF4X 4YO7A 1ADYA 3C87A 4LEIA 1L5HA 1B23P 4UFPA 3HN7A 4JB3A 3WV5A 5E9JA 5DP2A 1US8B 2IQIA 3PJGA 3P9KA 4EFKA 4TKVA 3C3XA 3L6UA 3R24A 1YS2X 2D4HA 5DOZA 4KH0A 4GI1A 4RQAA 3S7ZA 5B2FA 4LQ4A 4RE5A 3F4BA 1FXSA 4IQ8A 3JQFC 3HKBA 5EJAA 3MTGA 1M83A 1T10A 1IHYA 2BFNA 3BTVA 4TLEA 3SJCA 2WYOA 4HP8A 1NY5A 1KMCA 5DCYA 3RABA 1OR8A 3F3SA 4UHJA 4CIXA 1DBQA 1D2NA 4QDTA 1XVLA 5ALPA 4MW4A 1NXOA 2VWQA 4EZEA 2IF0A 3OLZA 1X9GA 3A6ZA 1EFUA 4UHKA 4OBXA 1FNDA 4IOJA 4KLZA 1WPQA 2CF6A 4LSZA 1FFGA 2R65A 2ZVQX 3UXMA 1FP2A 4TSKA 4XGIA 3VHRA 2V3WA 4DB2A 4A9AA 4RK1A 4EY3A 1NZFA 4BQIA 1TA0A 2H4YA 3B6KA 3FUTA 3CRMA 1XNRB 2TECE 1QOQB 2HRBA 2IGBA 4TMWA 1TD1A 3U7GA 2VF7A 4MMYB 4Q47A 4DR2B 1AV6A 1I8TA 2AFHA 4EYSA 5DE3A 2ZROA 1FSFA 1J2EA 1ZOIA 4PF1A 4RIFA 3KQVA 5I7AA 1JJFA 1NVFA 3TBKA 2PQ6A 3BGSA 3KEQA 1Q0LA 3FNRA 4QSMA 1DG1G 4FT4A 5JAOA 1GKKA 4CJXA 2OBYA 1KEUA 2XB6A 5AUNB 2OL4A 2PUGA 4LK3A 1JXOA 1Y4DE 3L07A 5A71A 3O4HA 2PX3A 5DT2A 4KI7A 5KZMB 1J2JA 5HKAA 1UXIA 2H52A 2IEDA 4EJ2A 4P5EA 2ZB2A 3LL7A 2M32A 2YZGA 5J1TB 2HJWA 5KYYA 2XXAB 1YVPA 3CNHA 1CY6A 3FB4A 2EBWA 1TVCA 3C8HA 3RC7A 4D8WA 5EHNA 4JLNA 1DOHA 5COAA 4AUMA 2JAOA 1JR6A 4J0DA 2JA1A 3S7TA 3CZAA 3O8LA 4HAYA 5EJEA 3AHJA 4ZARA 2V6IA 3QIVA 5E1OA 3UH1A 5ICFA 4Y0VA 2PO5A 2R5FA 5JSYA 2A9RA 2IW1A 2IYNA 2EIHA 1DX6A 2XVZA 3DBRB 1N5JA 1A0OA 3DYVA 3HM2A 1DI0A 1XEWX 4OLJA 4X41A 1MQ9A 5A9TA 2QS9A 5JZSA 1EWQA 3ONFA 1MEOA 1Y4SA 4C0JA 1HQDA 3OZWA 3KETA 4GOND 3H8JA 1GL6A 2MMGA 4LMBA 3B2EA 4P7BA 1T0IA 2GNPA 1EAYA 3TLKA 3KLPX 1Y5NA 1EHCA 1GPYA 1QRDA 1V6SA 1UDXA 4H0NA 2C61A 1DAHA 5FL7D 3ENKA 1E2LA 1WQ4A 2OLKA 1QH0A 1KDZA 3BRQA 2PSJA 4U63A 3ZN2A 3TZCA 4YIKA 3UBMA 1IMJA 3JQ9C 2H57A 3HPQA 3CJRA 3ZIAA 5DBOA 4WJLA 4OHPA 4WY2A 4E15A 2CMKA 1ODJA 3I28A 1LVHA 3IDAA 3D5TA 4HDAA 3IDOA 3TRIA 2ODNA 2VZEA 4XSVA 1PKEA 1RYNA 1FNCA 4B4DA 5BVHA 4KK3A 2YZMA 3GJ7A 3QFHA 4FSXA 4B81A 4QYWA 1YB5A 5BMVB 3LO8A 5A0VA 3PFCA 3HJAA 2I29A 3ZWOA 1TTQB 4XX1A 2Q6VA 3SLRA 5IDYA 1P2DA 2GXQA 1GIAA 2G83A 1A27A 1SC4A 2VJYA 1PGJA 3BD9A 2VT7A 1I4WA 1YZTA 4LWZA 2COEA 3AEQB 2ORYA 1IWPB 1CIJA 4CCYA 2FPIB 1Y4ZA 4NU8X 3VYUB 3UVEA 1QG6A 4CDMA 4O0MA 4XVCA 3LKVA 4XTCS 5KNDH 3CEJA 2CVZA 2I1WA 1PV1A 2A5FA 3L49A 4LQLA 1ZUIA 4M88A 3R23A 3W6ZA 4Y2JA 4LV5B 3I4FA 3I2HA 3P9RA 4Q82A 4QXAA 5CGQB 5FFMA 1N36B 4G5SA 1WP4A 3U7IA 4BQRA 4Q3OA 1QGOA 2OM6A 2QTZA 4QFCA 4PYOA 4HF7A 2G7MC 2CJPA 2ZSEA 4GNRA 4HYEA 3RVSA 4ZU1X 3MWEA 4CQMA 3HCAA 1N3IA 3EOBI 1T5SA 1U2ZA 2YHIB 2JIZA 3AF0A 2XEDA 3R2JA 3ZLBA 4BFTA 4UOQA 2VS1A 1QAOA 1XALA 2FMUA 2PM8A 3GQBB 4LJ6A 2GEJA 2G9VA 4OJQA 2AKEA 3FX2A 2GPTA 4N6GA 4BLWA 1M1YE 1HWYA 1T0UA 3ACDA 4N49A 3D3WA 5DCUA 4BRUA 4BFZA 1OIXA 1UPAA 4AS3A 1LJUA 2AZXA 4PZAA 1MJGA 4N8DA 1LNZA 1C7EA 1W9MA 1XU4A 2FYTA 3HJHA 4G2NA 4L73A 5AJWA 5DP1A 1DAPA 3GFGA 1L4KA 2VNKA 1RM5A 3E8XA 4JYAB 3FPHA 4JLJA 2HIAA 3DPSA 3VU8A 2DY1A 2H07A 2YC4C 3AGPA 4YDRA 3VC1A 3G2QA 1H6BA 1XZ8A 1U1CA 4PQRA 3URKA 1SY7A 2C4UA 1E2DA 4YJ3A 2PBRA 1CQXA 2W0MA 2M1ZA 4TMTA 3OPNA 3UENA 3AHCA 2QSYA 5SZIA 2RGXA 1N25A 5IYZA 2KQUA 3RC1A 1VA5A 3WRVA 3URMA 2QK4A 4QATA 2FF5A 4QDJA 1HDOA 3OHPA 1GLNA 4E03A 4GO1A 1WMDA 1KIAA 3T3GA 3U4DA 5JLJA 1JLRA 1R10A 2UVPB 3QUBA 4CM5A 4TKLA 2GD2A 4HDMA 3RT1A 4DIKA 1W34A 4ASUD 3QHQA 3C3MA 3K0FA 5FCDA 3KTOA 1P5RA 2PUTA 3HI4A 4QUBA 3CLHA 2AYYA 3RFFA 5A4DA 5HTOA 3H0EA 1M8GA 4BJHB 1A1SA 2TS1A 4BNMA 5ED0A 2XNSA 1X42A 4QUHA 3ZUPA 3FSEA 3RYCA 4EKIA 4ZYYA 2BSXA 2OG1A 1RM0A 2RGDA 1X1TA 1E4EA 5C7OO 3CLKA 3L4EA 1PZNA 2A59A 4IFBA 2ZIFA 4ID9A 4PZPA 3GX1A 3AOGA 4U9UA 4WKPA 5DYGA 3ELBA 4WJKB 3UICA 2O0MA 3ZIUA 1ZJ4A 1EVQA 2Q5EA 4WNAA 4I9NA 2BDEA 2FW1A 4PRLA 1E79A 3R0IA 4WDRA 4NVRA 4FHDA 3UMCA 3B5IA 2BVNA 3VUFA 2VNJA 3OIUA 3H4MA 3W8EA 4C5CA 1VCIA 2VJQA 1KQGA 1XN1A 3TSOA 3W2HA 4GYJA 5J40A 1KFKB 1BHQ1 3ABRB 1DBRA 1ATZA 3QFRA 4KLAA 3RBXA 5CU7A 2VTKA 3BGWA 2J4CA 2YC2C 3EZGA 3C3EA 3A9WA 3IS3A 4GP9A 4L16A 4Q1CA 3R7WA 4CF5A 2A3RA 2G0TA 4OGLA 2BKXA 1S2LA 2Q1UA 4X1YB 3U3RA 5J4VA 1FE8A 3H4IA 2G9RA 1OB5A 4XIFA 2IY9A 2WUDA 4IJQA 2CYCA 1L5HB 2LNDA 1SG0A 2OV8A 5AOCA 4C2UA 3MWEB 4KXUA 4MUGA 1S2NA 4ND5A 4AURA 2CKMA 2V65A 2ZYHA 4GFDA 2W2LD 3TTTA 2P2ZA 2ZUUA 3F7OA 4R9UC 3CNBA 5I7OA 1IIRA 3ICVA 4F2WA 5E9WA 1IWBB 2W6MA 2WF9A 4RIEA 1JHRA 1P1JA 4IUYA 2WU1A 5LD2B 2HRRA 4K2HA 4OV6B 1D07A 2X2FA 2ID7A 4R81A 2A5JA 3BICA 1Z33A 2MU1A 4XFKA 3L92A 2FETA 2A0UA 4N0DA 1NONA 3O91A 5DIZA 1LD3A 2PWPA 4G4JA 3AP3A 3RI3A 4DFDA 1Z45A 4LZZA 1YZLA 4BQPA 1XCBA 3GV0A 1FXWA 3A9CA 5J63A 3UJ7A 3E7WA 3ORQA 3BTSA 2EZ4A 2ZB3A 1MIHA 2PUWA 1Z12A 1O6BA 2MR5A 3FRIA 4LZJA 5KWSA 3RAEC 4U1RA 4UM5A 3RIXA 3D3JA 4ZYVA 1GT91 3L4BA 2P9FA 3DD5A 1JFFA 3U4AA 5F9HA 2ZK7A 3MFQA 4IQGA 4MQMA 3PFIA 1DPFA 4GPTA 1I32A 2OPHA 3SPXA 3HYLA 2ZQYA 2AMFA 2Q4BA 3MMPA 4K9MA 2XB4A 1Y7HA 1B00A 2APJA 3P0RA 1JAZA 4D3DA 3S2EA 2ON6A 5DRYA 3T34A 4HADA 2A1TR 4BXOB 3DM9B 3VVMA 4DDHA 1FSSA 2GBPA 5AW9A 4TTSA 4EKDA 1UINA 3G23A 4X0EA 4FYKA 2E7ZA 1V0JA 1ZIYA