1ZJ4A

Crystal structure analysis of the dienelactone hydrolase mutant (e36d, c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.7 a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 78
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zj4A00
3GA7A 2QUBA 4CIBA 1XLVA 1CUUA 5ALWA 1K5PA 2CZQA 1O6GA 5EFZA 1CLEA 1MAAA 1AKNA 1WM1A 3ZLTA 2AJBA 2WFLA 3G9ZA 5CURA 5EIEA 1A88A 1JJFA 4J0KA 1MNAA 4EY5A 3K9BA 2BUAA 2ES4A 1XZEA 1QIFA 2I03A 2O7RA 3LIPA 4UHFA 3WLAA 3C8HA 5ALPA 3F9CA 2FJ0A 4H7KA 1W76A 4GEGA 3AILA 5A7FA 3V1NA 3H2HA 5EHZA 1PFQA 1UZAA 1LZKA 3W9BA 3QMMA 2VEOA 1C7IA 3IA2A 3WZLA 4G8DA 4DYHA 4LKOA 1R1DA 1TQHA 2WHPB 5EHXA 2O2IA 1W1IA 1CUBA 1CUSA 3C5WP 4J3JA 1GQRA 3DS8A 4UHDA 2VT6A 4EA6A 3G0IA 1R9NA 4Y2YA 2VJDA 4B84A 4RE6A 1R9MA 2EEPA 1OCEA 4PNZA 3OM8A 3C70A 4JEIA 4L3WA 5CH5A 5K3EA 1CUEA 3OPMA 1ZD2P 1Q83A 2G5PA 2J4CA 2WUDA 3BDVA 2GYUA 2HIHA 2BGRA 1FFBA 5SYMA 1MT3A 3F96A 1SFRA 4UHEA 1R88A 3A2MA 3ZPXA 1CUZA 2IIVA 2Z5GA 1N5RA 2E3JA 3KWJA 2Y6VA 5AM1A 3V48A 4BDSA 4GW3A 5ALXA 3H1BA 5ALNA 3WL5A 3KDAA 5CXXA 5DWDA 1Y37A 1VZ2A 1MNQA 2C5GA 3DEAA 2PSFA 3FWHA 4OB7A 3O9MA 4JYPA 1LPPA 3LS2A 1AMNA 3E0XA 1X70A 1DINA 1L7RA 1IUNA 5AI9A 3R3YA 2QS9A 3F97A 1MAHA 3TGLA 5HF5A 4PW0A 1G66A 3PE6A 1C7JA 1WB6A 3I6MA 3G0CA 3RM3A 1EVEA 2ZYSA 1XRPA 3UMJA 4DSZA 3WK4A 3C45A 4HXEB 5EHQA 1CUGA 2JGKA 4BE9A 4F21A 1WPXA 2GYVA 5JZ9A 2JBWA 1W6RA 2V96A 2XT0A 1MX1A 1QIDA 5K3CA 4EY8A 1BCRA 4TGLA 4PQEA 3DL4A 3FSGA 4LYEA 3M82A 1G42A 1T4MA 5D3ZA 3RLIA 1UFOA 5EIAA 2C5FA 4FMPA 5ESRA 1EHYA 2WLSA 3OURA 2OAEA 5AH0A 3R3WA 3BL8A 3K6KA 1DQYA 5AKJA 4ZWNA 4EZIA 1HLGA 5ALSA 1UK9A 3MUOA 4QNNA 3WK7A 5AK3A 1HQDA 2XMBA 1JKMA 4P9NA 1XQXA 3O95A 2R8BA 4Y9SA 1FFCA 4DNFA 3ICWA 4K6KA 3HJUA 4X94A 1XLWA 4Z49A 2PPLA 3I2GA 1XKTA 5ALJA 2VATA 1IUPA 3QMVA 1XZIA 4N8SA 4E14A 4PSCA 4G9GA 4FOLA 2RHTA 1XRNA 3D2CA 3VVMA 2HL6A 1QTIA 4P92A 2RAUA 4M0EA 2DHEA 5JADA 4X92A 3WL6A 5BWCA 4H7IA 2X5XA 1CR6A 3IURA 2H7YA 1SCQA 1F8UA 4X95A 3WK8A 2XUQA 5IVIA 2GBGA 5CT4A 2AXEA 3MUNA 2ORYA 1QIEA 1NU6A 1ZD4A 4HVTA 1YA8A 2WG2A 3I1IA 4JYMA 1SCKA 4BAUA 5LZ7A 1QIGA 2XUAA 3AZQA 4X6XA 3SWWA 1MJ5A 1HKHA 1VKHA 1EI9A 1Q0RA 2B4KA 4BP9A 1ORWA 1VOTA 2OCLA 3CXUA 4PF1A 4XVCA 2ZYHA 1E8MA 3U1TA 3AUKA 3CCCA 2WSLA 1CUAA 2W22A 4H7EA 3FYUC 4X6YA 1GPLA 1BS9A 1YB6A 4BCBA 3GROA 5DLPA 4ROTA 1DT5A 1XZGA 4MQLA 4UHBA 1UKCA 4NVRA 1EXWA 3FLAA 4C87A 3ANTA 3D5EA 4X3CA 2H9YA 1J07A 2QXUA 1GPNA 1Y7IA 2B20A 1QJ4A 4BE4A 4F60A 3X3HA 4G4IA 4OPMA 4ZXFA 3BF7A 4BZZA 4AZ3A 1FFDA 5A2GA 4PSUA 5AKHA 2XQKA 4Q82A 2G4LA 4NMWA 1DWOA 3NGMA 2XB6A 3UUFA 3A70A 3L1JA 4KAAA 5ALUA 4XJVA 4C4XA 2BKLA 4O08A 1IVYA 4QWMA 5DYYA 1RWQA 3D2BA 4LXHA 1HPLA 1VA5A 5CT6A 3ESAA 3I1YA 4DTCA 4H35A 1K63A 5LIPA 5JAOA 5A71A 2QM0A 3O4JA 3I6YA 2W6CX 5HK8A 2DQYA 1EK1A 5T4EA 3GELA 3DDUA 4PV7A 5SYNA 1THGA 1JMKC 3BWXA 4WJLA 2BUBA 1KEZA 4AQDA 5DTIA 2XMSA 3PFBA 4Y7DA 4UBNA 1E89A 5DYWA 4PSDA 3TJMA 4G4JA 1XRMA 3R41A 4G8BA 3Q8WA 3QPCA 4U2DA 5FOQA 1QONA 3KD2A 3BF8A 3QVMA 1BU8A 3W06A 5I9IA 1VE6A 3NWOA 2OQVA 2EDCA 2WFLB 1BCSA 4UUQA 2ECFA 3HI4A 4G1FA 2HA2A 1EB8A 3T52A 5ALZA 2EDAA 2XUKA 5C7YA 3O0DA 4BVLA 1BEZA 2WU3A 1JMYA 1LBSA 1CIJA 1J2EA 1N8SA 3BJMA 2VAVA 1OXMA 2CUTA 4AO6A 1ZI8A 5LZ9A 1CVLA 3LP5A 4F5ZA 2OGZA 3HZOA 3E3AA 1GQSA 1XLUA 3PF8A 2PSJA 4BBZA 3IBTA 1FJ2A 4FHZA 5HKAA 2WU4A 3P2MA 2B61A 5AM3A 3H2GA 3BIWA 2GBCA 2AJLI 3R3VA 4FWBA 2WIDA 4Y2QA 3RK4A 5ALHA 3ZLVA 5T4HA 2NW6A 1I6WA 3JYHA 1CUXA 4X6UA 4BCDA 3GFFA 4B7ZA 1J1IA 5K3DA 3YASA 1F6WA 4N8DA 4QLOA 2ZVDA 1JJBA 4ARBA 1L7QA 1ZD5A 2PL5A 4LIPD 4QDZA 1GGVA 4U2BA 2CBGA 4FBMA 1Q0ZA 1H2ZA 4Q3LA 2ZJFA 5IVDA 3SC2A 5HKBA 3DL7A 4JH0A 4Q3OA 1KU0A 1H23A 2WHPA 2CKMA 2XUDA 5AKLA 5YASA 3V9AA 3FCXA 3IDAA 4Q3KA 3JWEA 2DSNA 1CRLA 2D0DA 5FP0A 1AX9A 5FDFA 4X97A 5AIBA 5JAUA 4GI1A 2GZRA 1ZGBA 5HCUA 1CUDA 5AJHA 4CCWA 1R3DA 3ANSA 3D2AA 5JZSA 5J3JA 4EBBA 2PU5A 4RPCA 2HFJA 1OILA 5HQ3B 4FLMA 3W9UA 1A8SA 2LIPA 4DNPA 4CG2A 3ILSA 4NZZA 1EH5A 4EY6A 4AXBA 1H22A 2CMFA 3K2IA 4WDQA 5AM0A 1K4YA 3V1MA 1A8UA 2JGEA 1YSCA 4H7DA 1VE7A 1ETHA 1H2XA 1R50A 4BZWA 1YS1X 2XQFA 1PV1A 3HEAA 4B9EA 1CFJA 4IHAA 4U2FA 3ICVA 2Y2VA 3WWPA 1YAHA 2VJAA 1F0NA 3I2IA 3VJLA 4BAZA 2HU8A 2QKYA 3KXPA 4WFIA 2GBFA 3ZV7A 1TK3A 1MX5A 2HA7A 2QTBA 2GZSA 4MWTA 1XFDA 2XI4A 5DJ5A 1TCBA 2Z8XA 3KOOA 3QITA 4MYDA 2QJRA 4OSEA 2QXTA 4H7JA 3FCYA 4KJXA 5A7HA 1HDEA 3R3XA 3HYSA 1FSSA 2XUJA 1WCYA 1W4LA 3ZI7A 3STXA 2YH2A 1ZOIA 1THTA 4I19A 5H3HA 2J4FA 2WTNA 3PI6A 4Y2UA 5AKGA 2IITA 3D0KA 3EIOA 1TIBA 3I2FA 3PF9A 4IH9A 3OOSA 5JASA 1B41A 4J0HA 4BCCA 1NU8A 2WIFA 5C8XA 4E46A 2RONA 2FUKA 3B3QA 4KE6A 5CTAA 4L9AA 3E4DA 5JALA 5AI0A 5CXUA 4U2EA 3DLTA 4BRSA 1AZWA 4E15A 4J0DA 4CCYA 1QO7A 4K6GA 3WK5A 1CUYA 4QDOA 2ACEA 2XMCA 4IO0A 5AICA 5LZ5A 1MTZA 4QA9A 4UFOA 2WIGA 4UHCA 2I3ZA 2C58A 1XQYA 5AKEA 5KBYA 2VQ6A 3G9XA 1AGYA 4U2GA 4D9JA 1DT3A 2VSQA 1MPXA 2XMZA 3A2LA 3IVMA 4FTWA 2CB9A 1ISPA 4M0MA 3SK0A 5LYYA 4WDRA 4S0XA 4B83A 1JI3A 3TEJA 2VAXA 3WYDA 1M33A 3EQ7A 1XZLA 5AP9A 1JT2A 4G8CA 3LCRA 1TKRA 4A16A 7YASA 3WA7A 5D3KA 1ACLA 4FLFA 5AKYA 3ZLUA 4KE7A 1P0MA 4MQMA 1ZIXA 5IVHA 2DCMA 1CUCA 5KWIA 1LNSA 2Y6UA 2QVBA 1SCIA 3WL7A 4WY8A 4E11A 1LPOA 4I4CA 4OU5A 1ZI6A 1XZAA 4BC1A 5ALVA 2HU5A 3A2NA 4B0OA 4W1QA 2GYWA 1QFMA 2ZYRA 2H7XA 4B82A 2ONCA 2HU7A 1VLQA 3DOIA 4FFVA 1X2BA 1ODTC 5AIAA 2O7VA 3H2JA 4HZGA 3TRDA 4X91A 2WFZA 4J0IA 4J0JA 1J06A 1EINA 1ZI9A 1DX6A 4OB6A 3N2ZB 4DSAA 4BAGA 3D3NA 2WQZA 3ZWQA 2AJDA 2XLCA 4ZGBA 5ALDA 1UK8A 1P0QA 4ZI5A 3AIMA 5JIBA 5FPQA 5BV7A 4EB0A 3R0VA 4BP8A 4P08A 4UBOA 2JF0A 2VJBA 4MJ3A 2H7CA 4DM7A 3ESCA 3R3ZA 3QPDA 2V9ZA 3AZPA 1UT6A 1VXOA 2XMDA 5JAPA 3ESDA 1EDBA 1JJIA 2WJ6A 1EA5A 3WKEA 2ZSHA 4QEKA 4AX4A 1AURA 1IZ8A 1XKLA 5EHNA 2J3DA 3FOBA 4KRXA 1YS2X 4TPKA 3WKBA 1CQZA 3WL8A 3H19A 4KR0A 2K2QB 5K3BA 2OQIA 4C6HA 2XQJA 1H2YA 1VXRA 1WB5A 3G0GA 1ORVA 5DNVA 4TVKA 4OYYA 2OCIA 1WB4A 1D07A 1LGYA 5HQ3A 3EQ8A 1QLWA 2PSEA 5ALGA 3M81A 1MU0A 3AIOA 4LXGA 1UWCA 5F4ZA 1UOOA 3NUZA 2PX6A 2JGLA 4W1PA 4WCVA 4C4YA 4DMKA 4RNCA 1CUHA 1UKAA 3C6YA 1U65A 1XRLA 1XRRA 2QZPA 5AKKA 4C4ZA 3WA6A 4WFJA 5EGNA 4L72A 4OYLA 3C6BA 1EVQA 4AO8A 5JYCA 5AKIA 1ZD3A 1FFAA 1VZ3A 1N5MA 5K5EA 3C6ZA 5K3FA 4BYMA 3DD5A 2PKYX 2Z8ZA 4CCYB 2R11A 2WUFA 2RGUA 3QBJA 4W1RA 1JU3A 2QMQA 2OGTA 1GZ7A 2B9VA 1TCCA 4BDTA 1TAHA 3NOXA 1QO9A 3F67A 4MEAA 2Z3ZA 4B6GA 3EQ9A 1E5TA 5D6OA 1LPAB 3QMWA 4Y2SA 4QDTA 3FVTA 3PICA 5FPPA 4GECA 2XUFA 4A23A 1A7UA 5AK6A 3DJYA 4WY5A 4QLAA 1ZICA 3VJMA 3G0BA 5BWBA 3OC0A 3WIOA 4FDMA 1ODCA 3SX4A 1U8EA 4FFWA 5HF6A 4HRYA 4GHWA 4B81A 4BC0A 4HXGA 2RI6A 1R4ZA 2O2GA 3S2ZA 3STYA 1CUFA 5KWJA 4X93A 4J0GA 5CH8A 3STTA 1Q84A 5FKJA 3O9VA 4HXFB 1LPMA 1E8DA 4Q05A 4QDUA 1LLFA 2ROQA 1WOMA 3WK9A 2QR5A 3D4LA 3STWA 2WJ3A 1O6FA 5CT5A 2D5LA 2BJHA 3LLCA 4MEBA 2HA5A 1TRHA 2QUAA 3IUQA 4W9RA 3BE8A 4C01A 3CN7A 5ALKA 3G0DA 4CI9A 3FVRA 4EY4A 3FAKA 4OD0A 5FXMA 5JD4A 3C6XA 1XZDA 1IUOA 3C43A 1WPRA 3L1IA 1BRTA 1USWA 5I8PA 5JARA 2PUHA 3WZMA 2CJPA 5CH3A 2HA3A 2DFPA 4V2IA 5A7GA 1EB9A 1YR2A 1H2WA 1XZBA 2AJ8A 4HRXA 5JATA 1U4NA 4QE3A 3KWFA 3MVEA 3W2TA 5CRIA 3WWCA 1ZJ5A 5CBKA 5DNUA 3BJRA 2I3DA 3FYTA 5HK9A 3FLEA 2HHAA 1CV2A 2XE4A 1UOPA 2XMQA 1KU6A 4OB8A 4LHEA 1QE3A 3F98A 4RE5A 5E2IA 4GDMA 2PUJA 3HRHA 3L1HA 5ALRA 1VA4A 5ISMA 2XMGA 1UK6A 3DKKA 4B85A 4JUIA 2WG0A 1GXSA 3EF3A 1FFEA 4AZ0A 4MYSA 4EUSA 3I28A 4OU4A 2X76A 5FLKA 2X8BA 3S8YA 1IMJA 2C0QA 2YYSA 1EX9A 4Y2RA 2XQIA 2JEZA 4I3FA 1QIKA 3IUMA 1Y7HA 3FSGD 3T4UA 5KREA 4ARAA 3B12A 2HRQA 4UPDA 4KAFA 3H17A 3AJAA 1LZLA 5HFAA 3VXKA 4H7FA 5JD6A 3GUUA 4QDXA 3WMRA 3AIKA 3O4IA 2WKWA 5ALIA 5EIHA 2BFNA 5LP1A 5LZ8A 1GT6A 4BVJA 4A5SA 3UUEA 3VISA 3OG9A 1WHSA 5AK4A 5LLSA 3I2HA 2XUPA 1XZKA 2WIKA 3G7NA 1X2EA 3RARA 5ALFA 3FYUB 4HAIA 4W63A 3HSSA 4G5XA 2G63A 2BCEA 4Y2TA 5CMLA 3AFIA 3JW8A 1S8OA 3DQZA 3KSRA 3WQHA 5IVKA 2C4HA 2XUOA 5JAHA 1UK7A 2XMRA 4X00A 3QM1A 1DU4A 4KACA 3H1AA 5FUMA 1P0IA 3HACA 5LZ2A 1WHTA 5JZBA 2BGNA 2JGJA 4GWLA 4H7HA 2HFKA 1RP1A 5E4TA 3C5VA 5C8VA 2DR0A 3I6ZA 2G5TA 2Y1KA 2OXEA 4AMYA 3PDCA 1XZMA 4KEAA 4N8EA 5LZ4A 5AHXA 1CEXA 3IB3A 4DMCA 1CUWA 3HLKA 1YCDA 3B5EA 1XROA 4MXDA 3HC7A 4QZVA 2WHQA 1CPYA 3V1KA 4B9AA 2WUGA 1QIIA 4DNQA 3FNBA 1ZGCA 4Y2VA 1RYYA 4UFPA 3Q0TA 3RKSA 1ODSA 2DHDA 4NS4A 2Z3WA 3ED1A 4B0PA 1AQLA 1DX4A 2OPHA 5AI8A 1N1MA 5AK5A 5AM4A 4BB0A 1BROA 3DYIA 5CW2A 2HA4A 4N5IX 2WM2A 5AI6A 4IH4A 3U0VA 2OAGA 3QYJA 2V97A 4M0FA 4AN1A 1P0PA 2IX9A 4Y2PA 1GPKA 4IH1A 3N0TA 3H2KA 4KAJA 5AO9A 3WYNA 1NX9A 3MGAA 3EBLA 3G8YA 2HRRA 4UBLA 4J03A 1XQVA 4DIUA 4QWWA 3QPAA 1QFSA 2WUEA 4UHHA 4PO3X 2XUIA 4C89A 4BATA 2DQZA 3STVA 1E66A 1ZIYA 2O2HA 1GKKA 1PJAA 1T2NA 6YASA 5DYTA 2RHWA 1UXOA 5AM5A 1DWPA 5CT9A 1YB7A 1B6GA 3I2JA 1G4HA 2VF2A 4KRYA 2AJCA 3DNMA 5LKRA 1L7AA 1A8QA 2XDWA 2PM8A 4BVKA 2OLEA 4KYVA 3WK6A 4YX9A 4AO7A 3W04A 1LPBB 4DNOA 3GZJA 4H0CA 2VTVA 3BIXA 2QRUA 5FV4A 2PSHA 3H2IA 1AUOA 1YASA 3WJ2A 2QJWA 3VKFA 5ALOA 4CIAA 3H0CA 2CEKA 2HM7A 3OTQA 3G9UA 2C7BA 4K6HA 5ALLA 3WKCA 4DGQA 4C88A 2VJCA 5HF9A 1CUVA 1MN6A 4ZV7A 2WFMA 4GXNA 4P93A 5AKZA 4L0CA 4OUKX 3WKAA 1BE0A 5JD5A 3WJ1A 1LBTA 3BDIA 4X71A 4AN0A 4G9EA 5IH7A 1K8QA 3ESBA 3D59A 4LYDA 3C87A 4GLBA 2QOEA 4XX1A 1EK2A 4BTLA 4EHBA 4X85A 1HL7A 1DQZA 3H18A 4DMFA 5DTJA 1YA4A 3A6ZA 3IUNA 5E4JA 1C4XA 3PUHA 2H1IA 3WWOA 1K6EA 3QH4A 2ZJ7A 3PFCA 4GBGA 4ZREA 4U2CA 3AZOA 2FX5A 1JU4A 4ZRDA 1MX9A 5K3FB 1MO2A 1XRQA 3I2KA 4W1SA 4AMZA 2ZJ6A 4XWGA 3DCNA 3QZUA 2BUCA 1UKBA 5BOVA 4JNCA 5ALEA 5A62A 2C0PA 3HXKA 2WIJA 5AOBA 5ALYA 3WWEA 2WG1A 5K3AA 5LKAA 2PU7A 4DMHA 2YASA 4XIIA 3G02A 2V98A 3GBSA 4INZA 2HA6A 4FNGA 4YK7A 5I7UA 2HADA 1JFRA 3G9TA 3CCBA 4H77A 3E1GA 1ACJA 2Q0XA 1ZJ4A 2HA0A 1TCAA 5ALQA 4Y2XA 3CN9A 1CQWA 1XZJA 2JGIA 4IQ4A 3C8DA 4YASA 3VDXA 3VJKA 2PBLA 3H04A 2BAGA 3W05A 5C8ZA 3F8SA 4FBLA 5HF8A 5CT8A 4Y2JA 1XZFA 2QT9A 5D7BA 1VJ5A 1QGED 5HZGA 2GBIA 5AOCA 4HTAA 3IUJA 4UFNA 4DLNA 2VA9A 3V1LA 4Q1VA 4MWSA 3FBWA 1CUIA 1BN6A 3O4HA 3STUA 1QTRA 5ALMA 5ALTA 3D7RA 1SOMA 2HDWA 2XQGA 3M3DA 3WWDA 3WI7A 2I78A 5DNWA 1E8NA 5JANA 3LIIA 1SC9A 3M83A 3WKDA 1HBJA 3O4GA 4H18A 3R3UA 2ACKA 3DYVA 2JGFA 3VVLA 5AM2A 2WILA 1GKLA 4OCZA 4FLEA 1W52X 5HFNA 2WJ4A 4KE9A 4K5QA 5C81A 2DHCA 3FLBA 1CUJA 4ETWA 4FNMA 5AI5A 2OGSA 2YXPX 1U2EA 2UZ0A 5IKXA 1BEEA 4ITVA 2FJPA 3HABA 3DOHA 4UBIA 1LPSA 4X7BA 2XUHA 2JEYA 4HS9A 1AC5A 4KE8A 1F0PA 1EDEA 4J7AA 3IIIA 3R40A 4CFSA 3AINA 4WFKA 2VT7A 1QOZA 4X90A 2XUGA 1QIHA 5AKXA 5FRDA 2OCGA 4BRZA 4UBJA 2XLBA 3IULA 4UBKA 4Q34A 5A6VA 1G5FA 5T4BA 2ZSIA 1QZ3A 4UBMA 2WHRA 2OG1A 4RGYA 2OCKA 4FKBA 2RIPA 4CG1A 4J0CA 1XZHA 2PVSA 4K2AA 4ZV9A 1LPNA 4F0JA 4EY7A 2JIDA 2P8SA 4G4GA 1QIJA 4AB1A 3FYUA 1QIMA 2PSDA 4YPVA 4LXIA 1W75A 4CG3A 3BXPA 2WTMA 1UOQA 1DWQA 5AOAA 1E3QA 3WIBA 5E4YA 3PUIA 5T4FA 3DKRA 2Y2UA 2ZYIA 1XZCA 4N5HX 1EDDA 2JGMA 5EI5A 4BTVA 1YAJA 1Z68A 4B80A 5AI4A 2J3QA 1XQWA 1BN7A 1DTEA 1IZ7A
chains in the Genus database with same CATH superfamily
4UM9D 4PPFA 1QHXA 5D5QA 1KYVA 2Q2QA 1QPBA 5EP4A 2QUBA 4CIBA 1BWSA 5K6AC 1NXOA 4YNBA 2RCYA 3S5JA 4JGGA 3LX4A 3P9NA 5JISA 4YMVA 2CUZA 3OIUA 4DQ0A 2O3SA 2W6JD 1MAAA 2CK3D 3ENNA 4U5XA 4OX9Y 3DF9A 4NTZA 3BCHA 4NZ9A 1IJEA 2AJBA 3A1TA 3ZLTA 7ADHA 3BYZA 4MCIA 2IUEA 1VJGA 1P5ZB 3L6DA 4I4TF 4E5UA 3T1OA 5LOVB 4DA4A 2BR4A 3Q98A 3CG4A 4GYKA 1SKMA 5FA8A 5FLYA 1A88A 2EF1A 2JI9A 1CYEA 2I80A 5LBUA 5ULLA 1Z45A 3QWAA 4G23A 3OWOA 4OSOA 1KC3A 3HMQA 2MCFA 1HQYE 1SKUA 2BBTA 2CXHA 2O7RA 4PLTA 1C8BA 2ZB3A 2ZI9A 3D6NB 4UDXX 3LIPA 4WT7A 3ZCSA 4DYDA 4C2TA 5CM8B 3WLAA 3OU6A 2CL5A 4W6ZA 3ZY2A 2PS3A 3E9RA 1N3LA 4BRWA 3ROMA 5DGDA 3SSMA 4OAPA 3A2KA 3RBZA 1QX4A 1C0IA 1A5SB 1P7ZA 3LP6A 3UB2A 5JSFA 1Z63A 1JG3A 5SYMA 3VHLB 3NYWA 4YO7A 5A7FA 4L02A 1YK1A 2O59A 3REOA 3V1NA 4HNVA 4DYVA 3B1KA 1PKXA 1T3GA 5KVCA 1NL3A 4WI1A 5E95A 3DPIA 4FT4A 1NJ1A 2WWRA 3ANNA 1LZKA 3N6VA 3QMMA 1XDSA 1HDZA 3C4QA 3M1IA 2JANA 3QVSA 4NDAA 2VEOA 3F4KA 3N28A 3Q9LA 3X44A 1PLLA 3O8DA 3ADPA 1MZVA 1U90A 4AVYA 4C1NA 1O6CA 5C34B 3U16A 4Q4DA 4EG1A 2H0RA 1L7NA 1AF4A 3WO1A 3MJEA 1GPMA 4D4HA 4TRJA 3OIWA 1BDBA 1EGVB 3RYFA 3VMMA 1HOXA 4HX2A 2FVXA 1YE3A 1R1DA 4L5AA 1R4AA 1KY3A 4LNUA 4A0HA 4C3UA 2A1TS 1Z5OA 2PXCA 3O2QB 1RBQA 5DU2A 4R83A 3VBEA 3VC3A 2VKTA 2I6SA 1CUBA 2V7VA 3D9QX 3EF0A 4MB0A 2DSTA 1SIOA 2DJ5A 3GT4A 2PTGA 4URZR 2BBOA 4QU9A 1LWNA 3F9RA 1KOGA 2K7ZA 3BD9A 1XNQB 3CSSA 1FDSA 5B6JA 3OZXA 1GQRA 3V1TC 3I32A 4UHDA 5DW3A 2NOAA 3CX4A 4LQCA 1MMFB 5JZOA 1TF5A 2OO3A 4WNAA 2PK3A 4L74A 3NHSA 2NG1A 3T38A 3ROTA 3LECA 1O6BA 1Y5MA 2O8BA 4DCJA 3EC1A 1ANKA 1VL8A 4KQGA 1PFWA 4IMRA 4C06A 3OKCA 5CW1A 4LI3X 2R4QA 4PNZA 5CHYA 3PTLA 5FAXA 3FMVA 2W5UA 5CH5A 3UA4A 2BW0A 4X1KA 3WYCA 3K70C 2C7QA 1UQUA 2R68A 4ESHA 2YYZA 3QLTA 1PJCA 2E4XA 1V1MB 1ZD2P 4YLEA 1YDHA 2J4CA 2A0KA 2FWJA 3KQQA 2WUDA 4R7GA 5KC9A 4Z4FA 2PUFA 4ECEA 5JO9A 1OXVA 2CHUA 2A5LA 2P4QA 3GF4A 3H13A 4FUQA 3GN1A 2VDNB 1IY8A 3RDPA 1MT3A 4B2IA 1V16B 3Q2IA 5DB4A 3QXSA 1SFRA 4J7XA 3AY3A 3O2JA 5ESXA 4TTVA 3A2MA 1G7CA 4K2HA 4ZEXA 1KE2A 4GP7A 4F4FA 3UQYS 1LVUA 5L51A 4I3HA 3ABQB 1J2YA 5DHRA 3VNRA 1VRVA 3OCCA 1C3OA 5AM1A 3V48A 1Z2PX 4IOLA 2WJHA 5IK2A 4ZQHA 4K9OA 1JHAA 5ALXA 2OXCA 3TINA 4PG6A 2ALJA 3EXIA 1G21B 3A7DA 3H1BA 1ZP6A 2F8LA 3KDAA 4HNGA 4OP2A 5CXXA 3NEPX 5ALNA 4YIHA 5F9FA 4KQCA 4JLBA 2Q3JA 3KSDO 4CBVA 1QS0A 2YWCA 3G82C 1OFHA 1JPNA 1QHNA 3MAGA 3DEAA 1RLTA 2IHVA 2VF4X 3MJRA 4UU0A 5FBZA 3ICOA 1GU7A 3MQ4A 1C8LA 5DFAA 2JGRA 4N9QA 4D4MA 3IXQA 1PD0A 2VNJA 4Q4HB 1AMNA 2HPVA 4XGRA 2M32A 2XRYA 4DV3B 1JAIA 1DEOA 1AGRA 2VSFA 2G7MC 1KO5A 3IEPA 2X4IA 4XSVA 5PNTA 1YL5A 3OX2A 4IG9A 4RJLA 5IYZA 1IDOA 4GI5A 2WKSA 3T3NA 1YI1A 1U7DA 2BFEA 2IOHA 1T0PA 2QS9A 3AI7A 4JUAA 1KEWA 1M1ZA 1FX0A 3CUYA 1J0DA 1WVGA 1OGJA 3F97A 3FYHA 3LWNA 3SSAA 5C5EA 3TGLA 4PW0A 2AFIA 2HZBA 2W71A 1K08A 1DKPA 1ZWKA 1DTWA 1C7JA 3EWSA 4IIEA 3NTOA 3I6MA 3F5MA 3HGMA 2IXAA 4MPDA 2YVQA 4RVSA 2BJWA 4RFSA 2Z5LA 2V0NA 4JEHA 3IRVA 3LSYA 3UMGA 4D9KA 3UMJA 5IZ4A 3WK4A 1ZFNA 4CMCA 4JLDA 4D42A 4GP6A 1JIIA 3DMHA 3AY0A 4JXJA 1E99A 4IIBA 3TQHA 1ORTA 2V45A 4RADA 2PS1A 2ZJ2A 1B0UA 2ORWA 4I50F 5DSTA 3ZS8A 1GD1O 1HRKA 1OI2A 2EZ8A 3U60B 2Q50A 3ND7A 1CUGA 2JGKA 1A82A 3INTA 2FMHA 3LBNA 3QI2A 4ALMA 4BE9A 3GP5A 1WPXA 2GYVA 1DC8A 1T3SA 2VS1A 3PC6A 1I14A 3BB3A 4DNXA 3LQ1A 2HLHA 1E2JA 1W6RA 1KMNA 2V96A 4GVLA 3E8MA 2CUNA 4FYJA 1PD1A 2R1TB 3D3QA 2VHTA 3DWIA 4J2OA 5C4GB 1BCRA 1H2FA 4NSNA 5JSUA 3KQNA 3EDRA 3ZYZA 4TGLA 4DM4A 2DEUA 3C3YA 1YZUA 3FUTA 2GCNA 4CM4A 3J80A 2PO7A 3M82A 4R5HA 2IYFA 4JVLA 4R9RA 3GPLA 1G42A 2VK8A 4PZEA 1G9SA 4ALIA 3HBJA 1E1LA 4QGBA 3THOA 2F4VB 1JLRA 3WNZA 1KGSA 3GT0A 3TFQA 4QLBA 3TF5A 2KPOA 5EIAA 3GJ7A 1YR3A 3A25A 4A2WA 1WXQA 1N2JA 2D3TA 2IZOA 4B7XA 3QP9A 3AVQA 4Q1FA 1KI9A 1SVIA 5SY4A 3UOWA 1Z8DA 1T5BA 3HEBA 1IM5A 1ECCA 2OAEA 1YO6A 3IPRA 3OQOA 5DN9A 4R0MA 3BL8A 4HLUA 1DQYA 4ZWNA 4F97A 1HLGA 2E21A 4IGIA 5HFJA 1MZPA 3AV3A 1JI0A 1RZ3A 2YINC 3JARB 4QNNA 3I1FA 5KTSA 1OAOC 3OFKA 4INPA 4ZI7B 1DAIA 1NNI1 5GONA 3DMNA 3L7NA 2NWQA 4OI2A 4Q3BA 2WNHA 2RKBA 3FDZA 1TO1E 4C3OB 2EZ9A 2XMBA 4J29A 3MELA 4CMIB 4DQVA 5AW5A 3ICWA 1F51E 3K16A 3KKZA 1LLDA 1O6ZA 3OM9A 1W49A 4HNAA 1EZZA 1E0DA 4P5PA 4BX9A 2GHRA 4FFPA 4CL3A 5IXJA 2ODEA 5IDVA 1RAEA 3BHMA 3HJUA 4X94A 5GOTA 1P60A 1XLWA 3QW2A 3H1FA 2QRVB 2VHUA 1FVOA 3N2GA 4IMPA 4LYYA 4RQTA 5CB4A 3D3JA 2CDNA 5BT9A 2VATA 4L6IA 3QMVA 5H9WA 1FUKA 3QVVA 3LJKA 4D4LA 4KNYA 1SUSA 2IIPA 1RXCA 2YMMA 3B5IA 3S6JA 1G5QA 4N8SA 4BFVA 4YUZA 4RHYA 5JPIA 4F04A 1I5OA 1E1QA 1JEJA 2VPPA 4TS3A 1DIRA 5G0VA 5F1YA 5BYKA 5HTKA 3UJ7A 1XRNA 4JI3B 4DVGA 1TE2A 3ZW8A 2QT0A 1XU9A 3OCWA 5ITZA 3EA0A 2Q8QA 1X7XB 1SUFA 2MINB 4P92A 4TLDA 2JFXA 4HI0E 5IH3A 1D2RA 2CN1A 1CERA 4G1CA 2DCUA 2CV1A 2BZ0A 3BWMA 2WB4A 3PXAA 1TMYA 2DHEA 3BMQA 5C5CA 4OQEA 4PC6A 4J8PA 1B23P 3WL6A 2BM8A 5BWCA 3ONDA 4IMJB 3EGEA 1SQ0A 4H7IA 4KVZA 2PKQO 3SYRA 3AG5A 1LSJA 1UL1X 4KUGA 3IURA 1Q7BA 2H7YA 4OG2A 1SCQA 1T0BA 1L5LA 3ER8A 1IQPA 3IEXA 1ZPDA 2BI8A 4FFOA 3PSHA 3QV2A 2VPQA 5DHTA 1JIUA 2KX7A 4ZI7A 5BN5A 1Q2UA 2PRYA 5DM60 2FN4A 2Z3VA 3UICA 5AQ1A 2OOSA 1SELA 5IVIA 1RRCA 1A9OA 1NULA 2EGUA 1X38A 3EZNA 3HWRA 5L45A 5BVGB 3IEVA 4MRVA 3KJZA 4D41A 5CDSA 1II8B 4K88A 1VE5A 3EMKA 4PHFA 2BFEB 3EIWA 1YR9A 4GSKA 2I34A 1YA8A 2WG2A 4P82A 1QLJA 4JYMA 2AT1A 1AKQA 4RD2A 1PZEA 1U8FO 1GZUA 1Z73A 2QK4A 3R77A 1NJ6A 4ARIA 5A5EA 2R6AA 4RMHA 2X0DA 1ZRSA 2PLNA 3P20A 4BKMA 1U1GA 3UGQA 3O1HB 4H1TA 3AZQA 2PGNA 1Q95A 1UCFA 4RAQA 1MJ5A 4YRLA 2JLCA 3NAZA 4ZCPA 2PKXA 3RJTA 1NXPA 1VKHA 1GQYA 3GRRA 1A8IA 1XVTA 2OL4A 2B4KA 3E53A 1ORWA 3IESA 2BISA 1P0FA 1VOTA 2EAUA 2JIMA 5BVHB 5KOHA 5JTTA 4DR3B 1GILA 1SRQA 3VO2A 1UH5A 3D54D 4JT8A 2R8XA 4DV1B 4RCYA 1T3LA 3K6RA 3JVVA 3DZFA 1WZ2A 2VPTA 2GHQA 1GQ2A 3B1VA 1Z4KA 3ORRA 5K01A 3CTMA 1CUAA 4D9CA 3V7WA 5G41A 3U5ZB 1TUIA 3DVQX 2FLVA 3FYUC 3I9FA 3Q88A 3JQAB 3ZQJA 1CR1A 3WGUA 3K5WA 4DDHA 2Z2IA 4UUNA 4HBGA 1PQ4A 3GYGA 2CXSA 1Y1QA 2O1SA 3I01M 4C5AA 4AZ0B 3GROA 4Z2YA 3MA0A 5EIFA 3AUTA 4HBZA 4F1WA 1IWOA 3FNHA 4HQLA 1GUBA 4ROTA 2OA0A 2VRBA 5CBPA 3HXOA 1UR5A 3B38A 5IP5A 4ID9A 2HHHB 1A04A 1FE8A 4E1VA 5C51B 3KLPX 1NXQA 5DULA 4BPRA 1EE2A 3DR3A 2W6OA 2Z57A 4PPNA 3G6WA 3PZRA 3RVLA 1RVDA 2JJ8A 2JPDA 4DIBA 1WULS 3UYLA 4IZOA 3CISA 5JS2A 3WGMA 3IAM6 2QZZA 5FYQA 4GGOA 1VKOA 2WM8A 4RJJA 1L4MA 4EYOA 3CM0A 2AYZA 3FHOA 2AA3A 2XA1A 1CCWA 2FPLA 3LPLA 3MWLA 1J07A 3CW2A 3WTCA 4UTNA 1Q21A 1U1EA 4IHJB 4GYYA 1GEEA 4GOMD 4MR7B 1SNYA 4EVQA 2ASVA 3PX2A 2B20A 4GR5A 2IJGX 4IYRA 1VJCA 1BDIA 3X3HA 1LSSA 2Q07A 3M49A 2B37A 3R5TA 5EE1A 1GNPA 3TIFA 3F6SA 2YWEA 4WKPA 1P2UA 1L0BA 2W6QA 1EYZA 3BF7A 4ZK2A 3GMIA 1E1MA 2O8NA 3PA6A 1IDN1 1QC5A 2X7JA 2FZVA 2L18A 4K9NA 2LW7A 2EXXA 4PSUA 4FHFA 2NQTA 5AKHA 4RJTA 1C30B 2XQKA 4YRSA 2C2YA 1DC3A 5AJWA 3AM5A 3F47A 3K9NA 3DV0B 2QIOA 1YZHA 3B85A 5HQJA 3OX1A 4IIHA 1SD2A 1TM1E 2J9GA 2WAMA 3EYWA 3GRPA 4QYTA 2LIVA 4XASA 5KNBH 2IU4A 4XJVA 4C4XA 2CXNA 2L82A 1EFPA 2B6HA 3DTYA 4QPDA 5TVGA 1DJQA 1WZCA 1I9GA 4R1OA 3SVZA 3NT4A 1PN3A 4QWMA 1Y6QA 1OROA 3KJIA 3SC4A 4EPTA 3IAAA 4YHBA 3CWCA 1QGOA 2D7JA 2X8JB 3D2BA 3FRHA 3DE4X 3HP4A 4XJTA 4F5WA 2J67A 3DAGA 4ZICA 1FPMA 1OZHA 4I1YA 4GMDA 1Y3CE 4OM8A 4XVUA 1N2CE 3L0CA 5JMPA 2P4UA 1HPLA 3EMDA 4MDHA 3HCWA 2E37A 4N40A 4NBSA 5THXA 2XTNA 5CT6A 3TRIA 5ILQA 1HTBA 3OHMA 3T3EA 3I1YA 2Q9UA 1UADA 2R8EA 5T41A 2NU9A 4H35A 5CAEA 3HTXA 4O3FA 1ZZGA 1LS6A 3C3JA 4IDGA 4CM8B 4DAEA 1GVNB 5CFRA 3I2YX 3PNPA 5LIPA 3VDMA 2D1YA 4ND2A 2BRUA 5CVVA 1U8XX 2J5KA 3ADDA 3ADKA 2GETA 4BO4A 3VV3A 3P27A 4NBWA 1KMHB 2F3UA 4M89A 2VYVD 3IUBA 3VPCA 1YQEA 3CR8A 5HK8A 3DM5A 4L15A 3WY9A 3GZNA 4AUKA 1UP6A 2QP4A 3IVRA 3FW1A 3GELA 2COEA 1OWOA 2D2XA 2HMUA 3DDUA 3X1YA 4LSGA 4MWGA 3ZIAA 4CQLB 1G8JA 2BTQB 3GWZA 4TVOA 4FR2A 3UUGA 1ADGA 5ESDA 4WJLA 4IXDA 2QN2A 1D7AA 4AN4A 4TYNA 4YLGA 2X0IA 4ZP1A 1ITZA 4OXIA 3PFBA 3DHEA 5MGNA 4FW8A 4JOCA 1L9XA 1ZUNA 2NV2B 4Y7DA 5EUQB 4F9EA 4QKQA 2BFCB 1U3FA 1E89A 1M54A 4G3XA 2IY7A 4FGUA 2DUJA 4EG7A 2GPTA 1DZIA 5BSKA 5FUVA 3DZJA 2KS6A 1O77A 2WC1A 5I9BA 4X1IB 1DDGA 3AR7A 3PQ4A 3QRWA 3OLVA 3BZUA 2PHZA 5TEWA 3U26A 4PSDA 5A4DA 1KOFA 5AVSA 3AHIA 4TV9B 1C9JA 4G4JA 1XRMA 3HI6A 2HGZA 3NYRA 5H9VA 2PMKA 1J00A 3K9CA 3R41A 3QPCA 4ZPJA 1XU7A 5THQA 1DTSA 2FP4B 5ER9A 3ZG6A 3JAKA 3KQWA 3PEWA 2C3YA 4PXSA 3SJBA 3DXZA 5KSZA 2E82A 8OHMA 3NASA 2CFTA 4NCAA 3H4VA 3IDSA 1HE8B 1W5TA 2YYYA 3G8DA 1F7UA 2ZBUA 5MN5A 1DG9A 1VE6A 4MH0R 1SXIA 2VNHA 4E7PA 3UENA 2OQVA 2P9QA 1OBHA 2PZEA 3OIDA 1VHTA 2HUPA 2A9PA 2WFLB 4YUYA 1CBUA 4TKZA 4WHMA 4ZIRB 5J4KA 5KTYA 4LF5B 2ECFA 3A6HA 3WNVA 4QOFA 4RA6B 4ETMA 3IC5A 1KMQA 2EDAA 2VPIA 2VH1A 4G2NA 3ETHA 1ISFA 2QM3A 2C9DA 3MBOA 3DHNA 1G59A 2NQ8A 3I64A 4HH0A 1DQRA 5G3ZA 3RSCA 1G19A 3DMGA 4DUGA 3CC8A 4YRPA 4FYPA 2WU3A 4YJ3B 1JMYA 1WE2A 2NZVG 2AR9A 3EFBA 3GVIA 1YMQA 2WD8A 3QENA 1OLOA 2YY5A 1FP1D 1I7SB 5LQSA 1Z5PA 3KOXA 4O2BA 3TLYA 3TXAA 4EGFA 1Z8HA 1QWOA 3TQIA 1Z08A 1J8QA 3LYAA 4YXWA 2XXAA 4AO6A 3IA7A 2VLIA 5CYOA 5LZ9A 1O87A 5SICE 4C4AA 1NTRA 3G8BA 2J0QA 2OGZA 3F2IA 2FKAA 1YJAA 3HZOA 1XLUA 4ER7A 2IDJA 3M3PA 3OQNA 1P75A 1V5GA 2O3UA 4MS1B 3DAYA 2GM4A 3ZWAA 2HF2A 3Q8XB 1G6HA 1AK9A 2YWJA 4D4JA 2XWQA 4FZRA 5BSRA 1F5SA 1K92A 3B3GA 3ZYCA 2WU4A 4ZHSA 1KGDA 1MJNA 4Q9IA 4ERXA 2RGGA 5TQVA 2JI8A 5LMNB 3KUCA 3H2GA 4AYXA 1OX5A 1ZVMA 2OLKA 2PMCA 3OUZA 4BJ6A 2QE7A 3BMOA 3EXFB 5DGCA 3ETLA 5AFSA 2OHJA 2A9RA 3I8XA 3EZLA 1ZBDA 4TV8A 3IXLA 4UHKA 4ACAA 1SRRA 3PQEA 4QBIA 1KI6A 3PUVA 5T4HA 3LT5A 2NW6A 2GESA 3T7EA 5F2NA 3MHTA 2FWNA 4NLLA 4LJLA 1XVUA 2ZRGA 3A26A 3WS7A 1E2EA 3HVIA 3JYHA 4BCDA 1G17A 1MC4A 2ZSJA 3GFFA 4W5HA 2ZITA 3CSDA 5DHAA 5HBRA 3SI7A 2WT8A 2Q4BA 1D2AA 3K5HA 1EM6A 5DYGA 1D2HA 3YASA 1JGTA 4N8DA 4QLOA 2ZVDA 5E3JA 1USKA 4JI6B 3U39A 1RLOA 4BB6A 4G1BA 2PJDA 3GRKA 1RP7A 2A9VA 1RAIA 4J2TA 4OHWA 5LJLA 4FYIA 2G70A 2W2PA 4BN4A 2CBGA 4FBMA 4PIVA 4K46A 3ANYB 2J9ZB 2ZJFA 2YZMA 2ZWPA 1CY2A 1GLNA 3F90A 1ZM3A 4XJSA 2CF6A 3FYCA 5ECWA 5HKBA 3DL7A 1Z4JA 2SECE 4FYMA 1R4MA 3B1FA 3WJAA 1H23A 1U0NA 4D99A 1ZRMA 5LP6A 1XKQA 2IOFK 5D87A 5BSUA 1XO1A 1A98A 1M2NA 4G1EB 2NU9B 3RJ9A 3V9AA 5A4JA 3SD7A 3JD4A 1PV4A 4NH4A 1FTWA 4CM8A 1JDBB 2H0QA 4E32A 1DE0A 1I4EB 4MS1A 4URFA 2MDTA 2ILTA 2Q9AA 3VTZA 3MTDA 4BFCA 2DSNA 1Z4OA 1D2GA 2ZEJA 5E1OA 5J43A 1TTHA 5TGTA 2NQ2C 5KYWB 3ZD6A 3U7QA 5FORA 3BILA 5FP0A 3VUFA 4M1KA 1RTKA 1JVSA 4IIJB 4AJPA 1OWNA 2DWOA 5FDFA 2CHQA 2R47A 3DMRA 3ESRA 5DOZA 2M6KA 3WMGA 5C8YF 2HSJA 1PFGA 5BOSB 1CQPA 1RKXA 5AIBA 1UT5A 1YJBA 2J33A 4MS4B 3IT1A 3IAFA 3R0XA 3RHZA 3GJ8A 1J0XO 4N01A 3RRYA 2B9EA 2UZ4A 4NMMA 5HS6A 2FWMX 1KF0A 3AI1A 3CHYA 4OMUA 4RDIA 4X1KB 3GLTA 4B4KA 3FPJA 1SKBA 3WNQA 1F3OA 4Q7KA 4YA6A 3NUGA 4L5YA 4YDRA 4QRIA 4LYGA 3H97A 4YP5A 4MB2A 3AR6A 5JZSA 1OFGA 5BN5B 3V7UA 2J7KA 4YCJA 1MV5A 5J3JA 1HE4A 1QV9A 4MVJF 4A26A 4M1SA 1YVDA 3HG7A 3WLJA 5J2UA 3W7BA 2HBQA 4QNMA 3UB4A 1EVKA 3QXJA 1GARA 1V26A 4IDEA 3KL2A 4L8GA 1WMDA 2H00A 2IYYA 3O8NA 5DX8A 3EN0A 1QBGA 1X1SA 4OHYA 4JHLA 4O4JF 2PA3A 2WAYA 4NZZA 1EH5A 4JI2B 2EFEB 1HUQA 2WD7B 3IHTA 3DBRA 2RJOA 2OFWA 4TX1A 2ZBDA 3S44A 3O74A 1HT2E 4IYJA 3RGGA 3V32A 3K2EA 1OHHD 4RD1A 4WJKB 4BV3A 4DVJA 2R48A 3N0RA 1WXEA 4BNMA 1Z5ZA 1ZHHA 2GEFA 3ZGXA 1VKNA 1X7HA 4MUMA 1ZH8A 3TZKA 3S7ZA 1V4VA 4QTTB 4ENSA 5KWEA 5HW0A 3WGLA 1TL7C 2HD4A 2RHHA 1CETA 4A2PA 4FZ3A 1V3VA 2QTVA 2JS7A 4CIWA 2A9QA 2XWSA 2ZR8A 3B1YA 4TMWA 4B9EA 1CFJA 4BLSA 3WYGA 5KOHB 4LV6A 4ER0A 3OP1A 3L7KA 4GOJA 2HF8A 3HDQA 3KUDA 1COWD 2A4MA 1MB3A 3LH5A 1S8AA 3AJ8A 1L9KA 4B6PA 3PFHA 3AP3A 3AY7A 4MRMA 4Q4JB 3RH0A 1E2QA 3TR0A 5HWSA 1H6BA 1YAHA 1P2SA 2QP9X 1F0NA 2ZT6A 3BVPA 2AI3A 4MQ4A 4BBJA 4CYMA 3L4KA 3AVTA 3ETNA 1TF7A 4HTFA 2ONZA 4IFTA 2RGXA 4BFYA 2P2YA 4X0EA 1RPNA 1OFVA 4RMNA 4DR7B 4MQBA 1TYZA 3KXPA 3I37X 4WFIA 5FEMA 1YZGA 1H6DA 4Q4AB 2FB9A 2DT5A 4PTZA 2BJVA 4V0NA 2XSZD 2BM9A 3MS4A 4G4SO 4PZ0A 1B15A 3OT1B 5DJ5A 1K7FB 3EEFA 2WU8A 3UC9A 3KD3A 2GF2A 4L7VA 4WKBA 3VZQA 1NBOA 5A05A 2Q7XA 4MYDA 3MCZA 3TLMA 1MABA 5A5VA 2YY7A 1HDOA 4OSEA 1R7RA 221PA 3IKVA 4F91B 4LC1A 1HE3A 3E35A 4ZVKA 1LFAA 3INRA 3TMAA 4ZN6A 1UMKA 3EXG2 1F1BA 1PVDA 2AFRA 1A9YA 4WZAE 3K96A 5J59A 1FQJA 2WI8A 1JU9A 3ETGA 3M5DA 4RY0A 5BR7A 5G0WA 2OMEA 2IV2X 1QGUB 1K7EB 1M0EA 3IMGA 1WCYA 3AKEA 2JATA 4N0EA 3ZI7A 3USZA 1E0JA 3GJYA 2W90A 1IL0A 3OESA 3QVKA 2RBEA 7GPBA 4N7JA 4I19A 1UWLA 1CQIB 3P45A 5E3HA 3IUYA 1VBMA 2WTNA 2OV4A 3H6HA 4R3NA 4TV8B 1KI6B 1XPRA 5AKGA 1Y6ZA 2B4RO 2IITA 1GRQA 3CVOA 3ELDA 3D0KA 4RF5A 5REQA 5DO9A 3UMFA 3UHAA 4NCIA 4WZAB 4QTZA 1M2JA 2WYUA 2PT9A 4PZZA 3URKA 3PF9A 4GEKA 1RCFA 3OOSA 3DV0A 5JASA 4PX9A 1NI3A 3U62A 3SSOA 4EKEA 3OZRA 3T5TA 3UT0A 5HTOA 3UZUA 1LW6E 1XXHA 2BH9A 4UXHA 2QG9A 1QRAA 3M4ZA 4MB6A 1GJRA 4G9BA 2O7SA 4KWTA 3CURA 4KE6A 5EQDA 3ELBA 4DIOA 1EFRA 1QRTA 2VBFA 3EVNA 1NVWQ 2H63A 4AUNA 2VOEA 4DDVA 2P4HX 4DZRA 4DIDA 5EE0A 5JALA 5F9HA 3IDFA 3QBEA 4OM7A 2AOUB 2BTOA 1JEDA 3T06B 3DLAA 3EY4A 5JECA 4JXZA 3DLTA 1VGVA 4GD3Q 1WV0A 1MJGA 4S1PA 3H5RA 1C9NA 3EGCA 5D3MB 4CCYA 4KBFA 1Q0LA 4K6GA 5FQNA 3F74A 3WK5A 4YN3A 1FRZA 3IV7A 1M6VB 2XMCA 3ZGLA 1U0TA 3HJNA 1Z88A 4RNDB 1QSGA 2ZRHA 4QFCA 1XJ5A 4DJJA 2QN1A 5AICA 3QFCA 4Q7MB 4UDYX 2A1IA 5EXEA 2NZJA 2RG1A 1V8DA 4AQYB 3AEXA 1FJHA 4ZU6X 3SXUB 2QTGA 3ZOZA 1LXCA 2H7VA 4UFOA 2B0JA 2F2TA 2PA0A 1UUFA 2D5IA 4B3XA 1N6LA 3VR6A 4HGZA 5K0BA 3N8DA 4A6PA 4K9SA 3NHZA 3FOCA 4ND6A 3CLVA 1IXYA 5KBYA 4Y2GA 3DL0A 3MTEA 4U2GA 4TMXA 1OI4A 1XZPA 1GUYA 4D9JA 2PKWA 1NG1A 3U4IA 1DT3A 1BQEA 1I6KA 1RSZA 3FPGA 5GZ6A 2CDBA 2Y0CA 4TKVA 2FEWB 3EVEA 5IKEA 1XEWX 4KIUA 4YJDA 3CW9A 3SMVA 3P2OA 4E5MA 4QQKA 4QXQA 1FCJA 2WJJA 5BSMA 3ST7A 5BSWA 2FZGA 2G40A 1D8TA 1YZYA 3OUUA 4WDRA 3UOAB 2IHUA 1SKAA 3G5TA 3W8NA 4M9QA 4RESA 4LRQA 1QVVA 3PJFA 2H08A 2YV5A 3WYDA 3U6BA 1AKVA 1ENYA 3VPFA 1VE9A 1YMVA 5EOVA 4L2IA 4EITA 3RYFB 4XM2A 1Z0AA 4KSCA 2GKOA 1UBHS 2DGDA 1JEOA 1WPGA 1AUQA 1TKRA 2UZ1A 2X9QA 4LDQA 4A16A 3GUVA 2FX3A 5FOTA 1UT8A 4NDZA 3KJFA 3V8MA 1KPIA 1YDFA 1GA6A 3GDHA 4MWOA 3OBIA 1ACLA 1W0KD 4OHCA 1IVNA 4R1QA 3OLXA 1MOPA 5AW3A 4HG2A 5EWMB 5TE9A 1JIQA 2QYTA 3KOUA 5EEHA 2H3EA 4OKIA 1CNFA 4PGAA 4PLFA 4PYRA 3Q7QA 1SIWA 4F2DA 4HJXA 5J5VA 5KTRA 1Q7EA 3DXYA 2BE9A 2CYBA 4K0RA 3TIXB 7MHTA 1ZX1A 2IOQA 3HU1A 4Y18A 2IY9A 4TQAA 5C1BA 2GKGA 3MM4A 4R1MA 1HFJA 3A6GA 4KO1S 1INLA 1QE5A 3IBCA 1US8B 3WL7A 4ZYVA 2LGJA 7MDHA 2BGWA 3IBFA 3EVAA 3AV0B 5F33A 3FPHA 1SHZA 1ZI6A 3BUSA 3BRSA 4QEZA 3JD3A 1YULA 4ZOBA 3NS7A 3A2NA 3BRWA 3EIFA 4ZYYA 2V1UA 1WXWA 3H8JA 2BLNA 3FJOA 1G3IA 4E5YA 2IUFA 1YNOA 2AG5A 1C9EA 1QFMA 1XDUA 5CB4F 2ZYRA 1KP3A 3FFAA 4BJ3A 5KDOA 3B48A 1OC4A 2A67A 2H7XA 4B82A 2HT1A 1PGJA 4RETA 3QIAA 5EJ4A 2UZIR 3WFZA 1B0PA 2YUTA 3JQGB 2ONCA 5BSHA 4JN6B 1VLQA 4Q9HA 4B8WA 5B7QA 3DOIA 4E4YA 4FFVA 3DGEC 3MC1A 1X2BA 4XQGA 3RYIB 3C15C 1ODTC 1T9BA 3GPIA 5AIAA 3TR5A 1Y6FA 4DABA 5HX7A 4CETA 1BKSB 1VC2A 2CHVA 3ONVA 5JG7A 3FHTA 2Z6UA 5BNZA 3LGSA 4LF7B 4AY3A 4F4HA 3PXDA 4MIYA 3VR0A 2V65A 2E48A 3TL3A 1Y8ZA 1YKSA 2XB8A 3O82A 4RHUA 3SEAA 4AMVA 1VIAA 4J0JA 3SYKA 3WYAA 1DRJA 4J6FA 1NW7A 2RKOA 1EINA 2Z08A 3TL6A 4BNZA 3I9JA 4YRGA 2XKKA 4PCLA 4M87A 4RVNA 4RDXA 1KP2A 5E9AA 3D3NA 4ONEA 4BAGA 4EI7A 1QGAA 1QRRA 1ZQ9A 5EMNA 2GT1A 3ZE0B 3JX9A 5J40A 4XZ3A 2R5WA 3MJCA 2JI4A 2XLCA 3Q87B 3QYPA 2BSQA 3NVKI 1GCIA 3EEYA 5ALDA 3THWB 5C46F 1MOQA 2IU6A 4TXJA 3KUUA 5SYAA 5CLGA 3B82A 5TQ2A 2EYUA 1NJ5A 1SUDA 2GERA 2H2AA 1NFQA 2PWBA 1M6HA 4I5EA 1PGNA 3EHDA 4H6XA 5GGXA 3FUVA 3UM9A 2B99A 1MP0A 4OQYA 4YJKA 3RQSA 2EBHX 1CK4A 4HPXB 2P9JA 3KQMA 4OGLA 1YRWA 3A4LA 4X44A 3LBFA 3U80A 4C7VA 4E5PA 4Q0MA 5FWAA 3MFQA 3VR5A 3PC4A 4UBOA 2JF0A 1RQXA 2B3DA 4XOIA 1RXWA 3OZIA 3VPDA 3HCDA 4MJ3A 4R9SA 2RH8A 1X94A 3QEMB 2IC5A 2NAPA 2OBYA 3EXHC 4B4UA 4FE4A 2V9CA 4FE3A 5IWAB 3BWCA 3GJ6A 3KPWA 2WKPA 1Z16A 1Z83A 5L7YA 3AZPA 5JY6A 4EH1A 3U7IA 1JILA 4P3NA 4QT0A 2J09A 1K0UA 3ESDA 1FTSA 4D3SA 2WDPA 1TTQB 4Z4GA 2DLDA 4HWRA 4M76B 3T1TA 4HSGA 5IJ0B 5CDHA 5CFPA 2ZT7A 2VQ3A 3K4PA 3MSXA 4PZ9A 3WQRA 2ZSHA 5DNAA 1ECFA 4IDFA 3AERA 2GGSA 2PAAA 3ZWBA 2ZRAA 5FJIA 1XTVA 3FF4A 1I32A 1JS1X 4NV0A 5AQEA 2HIMA 3S2IA 4PYKA 4RL6A 3C97A 4TPKA 5LU9A 1E6UA 1S3IA 3HCRA 4KR0A 1TD9A 1HYBA 4P1ZA 2HEIA 2MYPA 3UAGA 3Q7IA 1I51A 2NYRA 2P6MA 1YVUA 2PFKA 1JDNA 1V25A 1JSXA 2BDEA 3AFHA 3KLNA 3KYDB 4FDTA 4JUCA 5DNVA 5IM4F 5C1DA 3NO4A 4OYYA 2FG5A 2JFYA 3ROGA 1A8PA 2FRDA 1MB9A 1HXHA 2QYSA 3EQ8A 3EBOA 2QVYX 2PSEA 5CDUA 1E9BA 3LTNC 3GBVA 2P9EA 4P36A 2IP2A 3AIOA 4UOZA 4X84A 1KERA 4UCWA 1OXSC 1UWCA 2XMPA 3DZBA 1UOOA 3E58A 4LC0A 5B2FA 3NUZA 3AVVA 4CM6A 2CL0X 3EAFA 2R96A 1KMHA 2AK2A 2PX6A 2JRCA 4RKYA 3NEAA 1P3Y1 4YYEA 4CKXA 1ECGA 2OZLB 2WAAA 2HSZA 2JGLA 3C4JA 3QWIA 3RUEA 1EGQA 2DVMA 4G24A 2Z1MA 3FYSA 1KZ7B 1DSSG 1MQAA 3W1VA 2D06A 3GIDA 4FPXA 2IYZA 1QGZA 4DREA 2HK8A 1DAFA 4DMKA 1IM8A 1CUHA 2YY6A 3G2KA 4G0QA 1TB4A 3HU3A 1U65A 1XRLA 3LX6A 3N2EA 2OPHA 1RPZA 3NALA 2REXB 1IQRA 1WXHA 3PI7A 3WLQA 2P79A 4XVHA 4N12A 3RJ5A 4DLAA 3C16C 2ZB7A 2FPUA 1WXDA 1HE2A 4FDLA 3PHCA 4KCGA 1E3JA 3D5QA 1RHJA 2H1CA 5G4KB 1UBOS 1JP7A 4UTVA 3B9PA 3C6BA 1E3WA 1JQEA 4QPPA 2Y77A 3T35A 1BC5A 2IXBA 2PKQP 3GAFA 5E4FA 5AKIA 4P2GA 4V38A 3SS8A 4YRNA 1DFGA 2PT7A 2OHHA 1AHIA 3OEWA 4QGAA 3H7IA 2H0AA 5K3FA 1P4GA 2I6QA 1XMJA 2ZATA 3RWOA 2J41A 2IV3A 4YJ2F 5AD1A 4BYMA 2C7RA 5HUHA 3ZVKA 2HC9A 2Z8ZA 3LF1A 4C4SA 1SCUB 5EPOA 2OSVA 2R11A 4TS4A 4DMUB 2WUFA 2JCBA 2ISQA 4W1RA 2OHVA 1GKUB 4ENPA 1E7RA 1E92A 1IN7A 2B1RA 2EJUA 2ERXA 2FYTA 4ML3A 3SC6A 3ZH9B 2EWWA 3UMSA 2BHLA 4TMFA 1TCCA 2J9XB 4GKAA 2PN1A 3TLCA 1TJ4A 3VO9A 1I4TD 2B2CA 3ASVA 1QO9A 3WISA 1OW3B 1MV8A 4BO3A 4MEAA 3WWYA 4B2PA 2RK4A 1G7SA 1PO7A 1RI4A 4B34A 3QLVA 2EVWX 4X64B 1P7WA 3ZXUB 1ODFA 2IZ6A 2QLJA 4BNJA 1E5TA 4LJYA 2AMLA 3LTEA 4O4HB 3ANMA 3V7FA 1HSOA 4L95C 1BOOA 3RFCA 3OFVA 2RHJA 3A32A 4RY2A 2D0OB 4GECA 3GA5A 2ZVQX 4G1UC 5AK6A 1GZ5A 4YP7A 1DXYA 1E3SA 3FTPA 3DJYA 2V6GA 2IKSA 1P5RA 3HCFA 5G4KA 4KITB 2FZ5A 2INGX 5KOJA 5CM9C 1W93A 4HDQB 4RFVA 4QVIA 3BN3A 3D7NA 3SDBA 2YVAA 3E9NA 3GXOA 1YR1A 1DV2A 4I46A 2FPRA 4JKYA 4QX6A 4B6SA 3Q41A 4ECAA 5ITVA 5LXTA 4MUHA 1J8DA 5HF6A 1T8UA 2GZAA 4HRYA 3P9XA 2ZCUA 3RJMA 4B81A 1QCCA 3W4IA 4KREA 4CM5A 4DR2B 4EPXA 1R4ZA 2OV2A 2ZI7A 3JR7A 3QQ5A 3BFVA 3BCRA 3UUWA 4CKBA 1MC8A 3RSQA 4DUYB 5IBQA 4DT1B 2FRDC 1NNEA 4IHQA 1JAHA 2PZFA 4XDHA 3WSWA 3PEFA 3QU7A 2GJ4A 3MUFA 1OZGA 4RM3A 1Q84A 5F98A 4DB2A 4OUDA 5DEIA 2ZCJA 2EBWA 5CVJA 3PQDA 1Z4LA 3QX7A 3ZWYA 1UJ6A 1E8DA 4D56A 4JJAA 4QDUA 4NMHA 2HY7A 2ZYWX 2PR2A 4DARA 3L8MA 3MIZA 4S2UA 3IMKA 3LW7A 4RJKA 3WK9A 1IHUA 3DBIA 4FYWA 5DBEX 721PA 1JNYA 1SBQA 3MS7A 4PGFA 1G0NA 3H11A 5C9ZA 1NBME 5KWVA 1ZD8A 2A94A 2ZTLA 2CXOA 4LISA 1ZCZA 4HVAA 5BSGA 1P77A 5SZHB 2D5LA 2NSHA 1Q6YA 3PNBA 1H4TA 1Y48E 3IUQA 3ZE2B 2QRMA 4YRZA 1Q50A 4RHXA 3KRTA 4WOPA 4B35A 4RTQA 3CN7A 3G0DA 3DV2A 3JCZA 1KSGA 1VLZA 1GSHA 1K5DA 3Q3IA 2UAGA 3QTBA 5FXMA 2BEUB 2IV7A 3A9CA 2RHCA 2EFDB 3PFNA 1M1XB 3NKLA 2GK4A 4V0QA 3WE7A 1TI7A 3B9QA 2R6HA 1XZDA 1G8FA 1JXMA 4V03A 3C43A 2R1VB 1WPRA 3UJHA 1BRTA 3K2QA 3D5TA 5I8PA 3KXKA 4UEOA 2ZJOA 1DAPA 2UXCB 2UXBB 3HKBA 1X14A 2AL7A 4WLEA 4IDPA 3RAJA 3COWA 1B00A 3T7JA 1XALA 5BQ3A 4H7PA 1IB6A 1V2HE 3LG2A 1XD9A 1T2UA 4PRYA 1PEYA 1EXVA 3VVBA 3HK2A 2HV8A 4XX0A 1YZ3A 4ESEA 2O50A 1OBFO 3MVEA 4MV9A 4CF3A 1X1RA 5CRIA 1MGPA 1VG0B 2ACVA 4X45A 4HFRA 5TF4A 3HDTA 3PHJA 2BEWA 3M5CA 5TJ9A 2G5CA 4L0DA 1AOXA 4G0NA 3KSMA 2QENA 3A9SA 3BJRA 4ZJZA 1HNNA 4N6OA 3TPFA 1XI2A 2P3OA 4CJXA 3FLEA 3FTCA 1W9HA 3LFHA 3T5GA 5A4FS 5K0JA 1E9EA 1UOPA 4XR9A 3RT9A 2JH8A 1B3RA 2YXBA 3FDXA 4LECA 5TR9A 4LHEA 1QE3A 1Y63A 5E2IA 3C1OA 4NYIR 2V7EA 1Q6ZA 1GTZA 1YHYA 1C9DB 2EX4A 4POAA 1VA4A 4DF3A 2IS1A 2JLSA 2C7VA 3D43A 3QELA 3COZA 5EMJA 3BULA 3GT3A 3HYRA 3O0TA 4IRMA 2WG0A 4MRNA 5FR2A 1N2SA 5B1IA 3RS8A 5F51A 4A03A 2VK1A 4D26A 1KJNA 3KEMA 4P4SB 2VAPA 3L1UA 5B53A 2ZXEA 3WOVA 4C29A 4ZTZB 4Z4IA 5KU7A 3BIJA 5JWHA 4EUSA 3I28A 5J5CA 2BC9A 1G8SA 2RHMA 3B3AA 3V00A 2RI1A 2ZYAA 1KVTA 4XR4A 3I45A 1EESA 2FUCA 2X8BA 4IXMA 1BWQA 3BMNB 2C0QA 1WSWA 4HQNA 1Y1LA 2C5SA 4Y2RA 3JPYA 5I7WA 1EFKA 5B12A 2XZDA 1QIKA 5J47A 1ENOA 4IJQA 1BE1A 5FBVB 3R5HA 1RDFA 2VQSA 3PDIA 4ACBA 1AKMA 1OXTA 1G5HA 5IHPA 1OV4A 3FSGD 4J1NA 2H1LA 4W5TA 5MDHA 2IELA 2BOVA 4P32A 3RNLA 3S8MA 4BLRA 4EGQA 4ZZ1A 4N6NA 4NE2A 3D6MA 4WXHA 3JZFA 5ITWA 1LBQA 4XX0B 1XFAA 1HDIA 1LLUA 1OD6A 2OB1A 2N1BA 3DBVO 1YJ5A 3L84A 4GX2A 4KAFA 4PONA 3NH6A 4TTJA 2W93A 2BEWB 3H17A 5A4KA 2HF7A 3GDFA 3K35A 4H2DA 3PKJA 3E7PA 2PZBA 4ED9A 4EJSC 3MRXA 3C3WA 4NQRA 3IV6A 3HCOA 1GPUA 4H7FA 2VQDA 3U13A 2IVFA 1XR3A 3UAYA 1ZITA 1FXUA 4YJFA 2PUEA 4WADA 2O5EA 5IX8A 4M7RA 3ISVA 2VHCA 1WDKA 3QVJA 4IVNA 5H4HA 3P4YA 2IYXA 3IO3A 2HX1A 3OCZA 2H07A 2YHAA 5ED4A 1I3OA 1SOWA 1ESCA 3WRWA 1G4AE 3IBGA 5TQ2B 1L6IA 2I76A 3BTOA 4GBMA 1QM5A 1E77A 2B1JA 3VISA 5ARDA 4YAIA 3OG9A 5KNBA 1SOUA 1AB6A 4C6SA 1RWBA 2PL9A 3ZWPA 4BWVA 2FSUA 5AK4A 1XMPA 4MR8A 3VU1A 4NBVA 1V6AA 2ZBVA 5AJTA 2AW3A 2H4YA 3I2HA 3S5UA 2Z6QA 2X0RA 4L6CA 3INGA 4NULA 3AVWA 2GASA 4I9UA 4JJ4A 2GILA 3ZNPA 1MRNA 2N3ZA 2W48A 3QE0A 2FI1A 5G53C 3RARA 1KH2A 3M2TA 1J39A 4HAIA 4HFNA 4HJRA 4G5XA 3R3HA 1F2UB 2G63A 4JC5A 1FP4A 1RQGA 1JPUA 4LQ4A 5IM5A 1XBTA 1JSZA 4I8IA 4OEHA 2VRCA 1N7JA 4O3MA 5JLJA 4G5QA 5KSWB 3WP1B 4UVHA 4C0QC 1I33A 2VP9A 2FMUA 1J21A 1LY1A 2W6PA 2NPIA 2CLCX 1KI1A 1X77A 3IAUA 3L07A 4CLRB 4MLZA 3WQHA 4BLOA 2NPFA 3OKPA 1XXLA 1SVSA 1WD7A 4Y98A 3CBQA 3QVGB 5EN4A 2XAAA 3SZLA 4C5CA 1G3RA 3CVVA 4WAUA 1FXWF 4MP8A 1N5OX 1U2SA 1U5BB 3ZU2A 5D6NA 1RKBA 1BD4A 3IAHA 4ITRC 4X00A 2XYHA 5E1DA 1F8YA 5FUXA 5AW0A 3I6IA 1J1UA 2FV8A 3H1AA 5KOIA 5C80A 3RASA 3AF6A 3BTVA 3PDHA 3S1AB 1CP3A 2NXEA 3S1LA 3MWFA 4AC9A 4EL0A 1YKGA 3FY4A 4IBOA 2NSYA 2QD1A 3OOYA 4BLQA 4CL0A 1TZJA 2CXXA 1TO6A 4HDRB 5JZBA 2BGNA 3F6RA 4DV7B 3CZAA 2QVXX 1IG3A 5EJFA 3WFIA 4XWWA 3LQ2A 1CG6A 2DTDA 1SEPA 2H85A 2VN8A 3N1UA 5DCLA 4YRKA 1T8TA 2DR0A 4CL2A 3I6ZA 3GLIA 1MO5A 3O2NA 1QFYA 4B3MB 3RCBA 4NNOA 1HZZA 1JDJA 1XZMA 2XGOA 4Z0PA 4N8EA 2DMRA 3DDSA 1D6JA 3IQFA 1KFEB 2VP0A 4R0NA 3GAZA 4ZI3A 3RVSA 1EJ0A 1I24A 1YUNA 1IBKB 1QDLB 1CUWA 1FTQA 2J9YB 2BWJA 1NV9A 1PCXA 1YCDA 1ZKDA 4F85A 5DNCA 1XROA 3IMEA 1B26A 4MXDA 1Z28A 2L42A 3D4IA 3AB3A 3F78A 3LC0A 1N2XA 1MG0A 3G49A 4ND3A 4C0JA 1E6KA 4X24A 3IR7A 4C7OA 1P1RA 4ZT6A 4DNQA 3P0EA 4A27A 4XQEA 4RA9A 5JS6A 4L4UA 1PR5A 1EM8B 3OJEA 4GM1A 1KARA 2H5LA 3TAXA 1JWBB 1KY2A 2GCPA 2ODNA 1U5BA 1CNMA 3DEKA 3RKSA 4AYTA 2XVXA 2AOTB 3BQMB 2IE8A 4MARA 5KAMA 4DJ5X 2D2IA 1UBUS 1V7ZA 4QUDA 3AHJA 2AI2A 4WW0A 1U2RA 5P8WA 1LI4A 1Z0IA 1P19A 2YNMA 1Z4QA 4N49A 3UC5A 1OREA 1JHOA 1B2RA 4CZ2A 3QJYA 4XLTA 3K8ZA 2VYND 3N3AC 3LOPA 4F38A 2B5VA 5JS7A 4RULA 1O5TA 1XHEA 1AHHA 1FMTA 1NT4A 2ZUSA 3QKTA 4W5OA 3P9ZA 4YONB 1QQAA 1DBPA 3ELYA 5EWMA 2FN8A 3C3XA 4QOEA 4R2JA 5JQGA 4C4OA 1FYDA 1TVKB 3HJAA 3N5CA 5LYJF 3MJFA 4MV3A 3RUHA 3L4BA 4YR9A 2C8JA 3IDOA 3H8WA 3LRXA 4RH0A 3QYJA 4ZEWA 3U0VA 4A91A 1X8KA 3LRPA 3HUFA 1MB0A 2PGLA 3PZBA 4AN1A 4TVSA 2GM3A 4RTOA 3GLKA 1P0PA 2ZPTX 4IINA 1V47A 4FCTA 2K7FA 1N33B 1VG1A 1KOJA 1US8A 1RLUA 3NBFA 3A3YA 4IX1A 1JL3A 2NM0A 4KAJA 4EYGA 3ZQ6A 5BSVA 4KWIA 2FFBA 5AO9A 2VPWA 3NBUA 4V2UA 4YUVA 3MGAA 3NT5A 4S1OA 3WGQA 1JLMA 3V4FA 5LMCA 4IILA 3K4QA 1Y98A 3JYLA 3RS5A 3G8YA 3TXXA 1EP9A 3ZDBA 1EHIA 1LWOA 3QUSA 2W6ZA 4DIUA 1MJGM 3QPAA 1QFSA 2HTEA 2WUEA 1AS0A 3QHPA 4R8LA 1J42A 4A92A 1Y8RA 2C9BA 3R7BA 1WZIA 4PO3X 4DUZB 1OX4B 2XUIA 4X63A 3Q12A 4DA7A 2C2KA 2HIGA 4DRXA 4L07A 5F5NA 3KFXA 3TKYA 2O8DA 1E20A 1T4CB 3AVPA 2KQUA 1ETUA 1LB1B 4J9VA 2VBGA 4YP9A 4YWHA 1GKKA 3ZIUA 3FHLA 1PJAA 3RYCA 1XTQA 2HMSA 4FGLA 2PZJA 2QNIA 2BFBA 4L76A 6YASA 3UB3A 2FPXA 4XUDA 1PUXA 1UXOA 1BX0A 1PZHA 4S1WA 4UOEA 3O83A 3NGLA 1Z6ZA 3GT7A 4N7BA 1YJXA 2JLQA 5L6MB 3OLYA 4O1MA 2BMEA 1ZD9A 3I53A 4QJIA 1G4HA 4A6EA 1BJKA 3NBXX 3SHOA 4KRYA 2GARA 3LYHA 1JQBA 3V6MA 4BFLA 1N2GA 1VHWA 2EW1A 1U7TA 2O1EA 3HPRA 2YWBA 3VAYA 4C4TA 1NV8A 4QXMA 2B6NA 2YOGA 1HDYA 2R8YA 3QLEA 2JFPA 4YHHB 1G2IA 2F3QA 3A58B 4ZO6A 3E5RA 2YZGA 1Z29A 3EAQA 1KS9A 4BVKA 4MW1A 3K30A 2GDZA 3B89A 2BI4A 4BO8A 1ESEA 4O4LF 4C14A 1A4IA 2BMDA 3UOGA 3LHSA 2R44A 4K03A 1QZTA 3VDRA 4NYMR 1LPBB 2O0LA 4UNIA 3SBXA 1WG8A 4DNOA 2X40A 2F43A 3QKWA 4H0CA 1HURA 3K9GA 5GAJA 4BNIA 4US1R 3HR4A 1CY4A 1M74A 2G06A 2YC4C 4EG3A 5LBTA 1SU7A 2R1TA 4FC7A 2ZPAA 3ETCA 3R24A 2QRUA 3LUJA 2VUUA 3LOQA 4YDSA 2FQYA 5DT2A 5JZMA 1OH8A 3ICEA 2QTLA 3H2IA 1TK2A 4PG8A 3BMXA 4I36A 5CFLA 1P4HA 3EQ2A 3KBOA 3OQVA 1TYDE 3A6JA 4MX8A 2FE4A 2ON6A 1KS2A 2HCBA 2ZYGA 5IBRA 5KI6A 2JJ2A 3KTDA 4G5GA 3SDSA 3I8OA 1DG3A 4UZEA 3VKFA 1USUA 1ZMBA 3MMXA 4R2KA 3VSBA 3GLIB 4V0KA 3H0CA 4L85A 1FNCA 3N76A 3SX2A 3LFUA 3R7DA 2EC5A 2QB5A 4Q7EA 3QE2A 5KCZA 3AVOA 3HKBB 4H1VA 1OLUB 5ADHA 2QN9A 2X1LA 4F1JA 4IJWA 4X54A 2LXNA 1ORDA 2ATEA 2ZIXB 1YB5A 4U7GA 1XDZA 2Z1DA 3LUGA 3KQUA 2DTEA 1YONA 3C3CA 1C3XA 1HEUA 3V4VB 3FKSA 4CIYA 1CJUC 3GZNB 5DM4A 5M04A 1AHNA 1CUVA 1BVYF 2YWRA 3BL5A 4ZV7A 2WFMA 5KSYA 2FX2A 3PBKA 4P93A 4GT1A 2E85A 3JARA 4XRRA 2JA2A 3NOVA 3TZQA 4O2RA 4BN0A 3V4SA 1U1IA 4OH1A 3K6JA 3AUXA 1XHLA 2Q3FA 3WKAA 4LHXA 2ZWOA 1LBTA 4CU2A 1W0CA 1RE0A 2DPYA 3P2YA 1YKFA 2B4AA 3AM1A 5IN4A 4X71A 2CFSA 2HXYA 3DONA 4G9EA 3CNNA 4AZ3B 4ID3A 3T7AA 4XWTA 4GP9A 1OXXK 1RZRD 3DLHA 5DTRA 4YT8A 1HYGA 2GCGA 2ZRNA 1Q0SA 1SK8A 3ESBA 4LYDA 4PTYA 1MXFA 2KSQA 1V3QE 3OQJA 4ZODA 3CZ5A 1FUIA 2Q6IA 3L4JA 1JV2B 2OUKA 4Q4CA 3NVMB 4OQPA 1U94A 5B7NA 4Q15A 4XX1A 1NQOA 4MKGA 1DRVA 4BKOA 5CA1F 2AVNA 2W83A 2X41A 2BMAA 1SHTX 4EHBA 1JG7A 1T35A 2CF5A 1DQZA 1T9CA 4DMFA 1EWKA 1M34B 5DTJA 4JR0A 1VHJA 3A6ZA 1T2EA 3CS3A 1E4EA 4KLRA 2IXDA 3NKFA 3S27A 1JDZA 1N6RA 1RI2A 1LRLA 3KDSE 2OVFA 1IQUA 1ZK1A 1TU3A 4IVQA 3TRFA 1DKNA 3MCVA 1VLMA 3BS4A 4H31A 2JKYA 4ASUD 1K6EA 4RW0A 2GEBA 3WLRA 5GY7A 1XA3A 3KAJA 2C97A 2QR2A 1HZJA 3KQVA 4GBGA 2IPOA 1W2GA 3NM5A 4U2CA 3R7LA 5CK5A 3F9IA 5B1DA 4X8MA 4JU9A 4UC0A 5M7EA 1JZTA 1DQSA 2PWYA 3AZOA 2P9HA 4MA5A 1F8XA 2ATIA 4WZBA 1NMSA 4CLDA 4HAYA 5BV2P 3GPCA 4R81A 3TIIA 4ZRDA 2MSLA 3KS9A 3LZDA 5IFKA 1UODA 5K3FB 1XRQA 1R16A 5JU6A 1GNRA 3SBEA 3KV1A 1UKZA 3AYZB 1QCDA 2ZJ6A 4XWGA 4QJ5A 5DPMA 5FV7A 4FIZA 4NWIA 2LV8A 1R18A 2VBIA 3BH0A 5AWFC 2P9FA 4PFQA 1NN0A 3Q72A 5KYUB 4RIFA 2BFBB 3FCSB 4JFRA 5BW5A 2RGRA 3GYBA 5DM1A 2F8TA 1XX6A 3WNDA 4OO3A 2FTKE 1D6SA 1P1IA 4YQFA 3IP1A 2LZ0A 2X8AA 3OJCA 2NZWA 5TC4A 4DLYA 3QLUC 4LXTA 2DWQA 2VF5X 2FDXA 2X2FA 4Q39A 1ZNXA 2ZJBA 2X8WA 5EVJA 3RSOA 2D4AA 1XCOA 3A9VA 4DQKA 2Y0DA 3GBSA 4INZA 2YYAA 4ZOLB 3DFKA 3H5WA 4YK7A 1NHWA 2JHAA 3NWJA 3EG5A 4FFLA 3N0VA 3ZXXA 4AECA 3G9TA 3LDHA 1WABA 5KUTA 4TKUB 1WQ1R 1G9TA 2WIAA 2C57A 4IJKA 4NOJA 4ZYXA 3S81A 1JKIA 3HSKA 1DMSA 3RVDA 1X0XA 3I9V6 4L8YA 4UDOA 1W5AA 1WQ3A 1WBBA 1E7SA 2GOYA 1MFPA 2OO5C 1Y5RA 3DFFA 1Y82A 5LQCA 4MVCA 1QP8A 2F7SA 4RS3A 1QFXA 3KJHA 4OMCA 1NUTA 4GKBA 3N59A 5ESWA 2RAFA 2NNLD 5B4TA 3ONFA 2IFTA 4YASA 1E3TA 1BG6A 2B8NA 1ZXBA 4RXMA 3I5YA 1WUTA 2BZSA 2XYRA 3GO4A 2G72A 4OQNA 3S0JA 3ZS9A 1PBNA 4YAOA 4NV3A 3CRMA 1ONPA 3BT7A 5TVKA 1Y1SA 1D3AA 3FJ1A 4JUFA 4D0GA 4F6CA 3QLJA 5DE3A 3UWSA 1I1HA 4N3CA 5C8ZA 4JJ7A 1GPDG 1N1DA 3IHWA 3O8OB 3F8SA 3OQ1A 4OL0A 1GFIA 1VKJA 3TW0A 4AJNA 3PXXA 4TL8A 2RJ3A 4RL4A 3KKMA 4M1TA 5TS3A 5A6SA 1TZMA 3OZDA 2A5DA 3VM6A 1N0IA 1NVTA 2WF8A 3SCZA 2DPLA 2OCBA 2QT9A 1JSCA 2W2VA 5IKPA 5KTMA 5AW4A 3QU4A 5E38A 2ZOSA 5CLQA 4M6WA 1S4MA 5D7BA 1VJ5A 3PEEA 2O48X 4B7AA 1QE0A 2QLLA 3NAMA 2IUUA 4JB2A 1PFVA 1Q1QA 1FNMA 1EUDB 3RSHA 4IS2A 2ADMA 2RHBA 3KAKA 1TJNA 4HQKA 3WDMA 2GPSA 4OKSA 5HM8A 3U56A 1FDTA 1UDRA 3SC3A 4B8YA 4YCMA 2BIFA 4JQZA 2ISSD 3QPWA 1Y1TA 2IZ1A 3AGPA 1CUIA 4F8YA 5T7BA 2XCQA 4GFDA 4BNFA 3AUUA 1ZA1A 3RVPA 2BDTA 3HP7A 1QTRA 4QPJC 5DNEA 5ALMA 5JLAA 4EDHA 3R3SA 2LNDA 4JUBA 4DSNA 3D7RA 2XQGA 3K4HA 3KVRA 4YC7A 2WYOA 3FHCB 3T94A 1FRQA 2KHZA 3LHFA 3RODA 3HHPA 3QKSA 4K8RB 2NO1A 4B3HA 5J4YA 5BURA 1W36D 4AJKA 1BHQ1 3C3EA 1XV5A 4WOJA 1EA7A 3NYIA 3ABIA 4WKNA 1KORA 3ROQA 4CV0A 3DBRB 3BD8A 4LA4A 4AIIA 1KHHA 1Z0SA 2XRMA 5WRFA 2EQBA 2P7IA 3A9RA 3O4GA 5IAOA 5LQUA 4WZZA 2W0MA 1Z4NA 1WEHA 1BDJA 4RAOA 1HE1C 2QL7A 2JGFA 3NT2A 4QUKA 3VVLA 1AQIA 3JQCA 4DQDA 2G04A 1NG9A 4KXWA 3CRW1 4OHPA 4OCZA 4OHZA 1LD3A 4FLEA 2D7DA 1A9ZA 3CRVA 3P9IA 4EQ6B 3A6FA 2DLNA 5HFNA 1BMFD 1SCJA 3Q40A 5BMVF 1C3LA 1Y8QB 1H0RA 3A9WA 1Q5PA 4OL9A 4BVBA 3LVBA 4DY4A 4JV5B 4EVIA 4TVBA 4NYIQ 1D2MA 2BFDA 3GGGA 1L4KA 1SHUX 3K20A 3NZEA 5JT1A 1YZFA 1DBRA 4WZBB 1ZVQA 3G5AA 3O31A 3A4VA 3PNQA 1CUJA 2H16A 2REQA 5D1NA 3MINA 3I4LA 3ZZ0A 4FNMA 1WCIA 4L4SA 4EA7A 2OGSA 3JWHA 4XRGA 3VU9B 4XUCA 2YXPX 2J08A 3MHPA 4F6RB 1ZUNB 5F7XA 5IKXA 1X1CA 3QMPA 2YQ5A 4BWYA 2JCSA 1Z4IA 2UYYA 3V46A 3AW9A 4AW9A 4AUEA 2W37A 3FNRA 1C7RA 3DC7A 3ZJVA 5IF3A 3DOHA 1UFRA 2J6BA 3N9IA 2AZMA 3X1JA 3HHEA 4J76A 4NICA 4ZVTA 1ZUHA 2NZ2A 3GFRA 4ENQA 1U7XA 2KB0A 5EE9A 4Y1GA 2JEYA 1FLAA 3LC1O 3B3JA 5C8YA 3NCTA 2O5CA 4HS9A 2WYHA 4RZUA 2HMYB 4YMWA 4DS3A 3I83A 1AG9A 1Q16A 3IIIA 3VR4A 4RIGA 2C4VA 4CL8A 1P8AA 2H4XA 3CLSD 1JEEA 2VT7A 3ESYA 3KQSA 3S1SA 3HCEA 1JLLB 2N42A 1QOZA 2X77A 1FEZA 1F2TB 2JZNA 3NATA 3PPIA 4X90A 1DJLA 1DKRA 3RAEC 3DHVA 4YCLA 2M6LA 2HCRA 5AHWA 5FTKA 3RRZA 1L7BA 2W2TA 2B5WA 3TRKA 1C8VB 3LUHA 2MMCA 4GZ5A 1ATIA 2AN4A 2WV7A 3CQ9A 1A4XA 2VP5A 3KXDA 3NAGA 4H3KB 4UBJA 3RBAA 5JZVA 2C2XA 1OFTA 3BAZA 3KYBA 4HC4A 5LA6B 2EFJA 1ZHOA 1Z56C 1IOWA 1XMIA 4DLRA 1Q1EA 5I9MA 2BFDB 1NDQA 2BN4A 3HNRA 2VBCA 4LRTB 1KVSA 2HJGA 4Q34A 3G2QA 3Q11A 4QD3A 5A6VA 2VYVA 3D6HA 5EE5B 3WIEA 1RC1A 1QZ3A 1OFUA 1A1SA 1YQDA 4P4NA 2ZW9A 1Y80A 4B48A 4HVCA 1RAGA 5EZ5A 4CG1A 3H9QA 2QMYA 4J0CA 3WR5A 1XYYA 3G5MA 3ZCQA 3Q3VA 1XCPA 3RYTC 4YY3B 3MJTA 3I42A 2P8SA 2FSSA 1DADA 1QIJA 3ADOA 2C99A 1DL5A 4AB1A 3NC1C 1N6IA 4TT8A 4IHJF 4NJMA 3RRXA 1KRXA 1MBZA 2WVJA 3M6WA 1OU4A 5K51A 2UYHA 3D1JA 5K1ZA 3RFVA 3UMCA 4CG3A 4IXTA 2F62A 5LDDC 2TMDA 2GEJA 4R2XA 3ZV6A 4E0BA 2ZYDA 2EP7A 2FK7A 1KFBB 4LPKA 5EJ9A 2NO4A 5CTJA