1ZJRA

Crystal structure of a. aeolicus trmh/spou trna modifying enzyme
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
197
structure length
197
Chain Sequence
LVLEKRLKRLREVLEKRQKDLIVFADNVKNEHNFSAIVRTCDAVGVLYLYYYHAEGKKAKINEGITQGSHKWVFIEKVDNPVQKLLEFKNRGFQIVATWLSKESVNFREVDYTKPTVLVVGNELQGVSPEIVEIADKKIVIPMYGMAQSLNVSVATGIILYEAQRQREEKGMYSRPSLSEEEIQKILKKWAYEDVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (Guanosine-2'-O-)-methyltransferase
publication title Structure of a class II TrmH tRNA-modifying enzyme from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 69
structure length 197
sequence length 197
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.34: tRNA (guanosine(18)-2'-O)-methyltransferase.
pdb deposition date 2005-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
A PF12105 SpoU_methylas_C SpoU, rRNA methylase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1zjrA00
4YQ1A 3AI9X 1VH0A 3AIAA 4JAKA 1GZ0A 1V6ZA 4YQIA 4CNFA 3OINA 1NS5A 5FAIA 3AXZA 1UAJA 2V3JA 4YQGA 4YQCA 4CNGA 3BBDA 4YQDA 3NK6A 4YVIA 2QWVA 4CNEA 3QUVA 3OIJA 5D9FA 4YVJA 2EGVA 4X3LA 4YPXA 4YQNA 1VHYA 3DCMX 4YQ8A 4E8BA 4RG1A 4YQ6A 2V3KA 1NXZA 1ZJRA 3N4JA 3NK7A 3KNUA 5GMCA 4YQQA 1MXIA 3GYQA 1IPAA 2I6DA 2YY8A 2QMMA 5GM8A 4J3CA 4CNDA 4YQRA 4L69A 4H3ZA 5CO4A 1V2XA 3BBHA 1Z85A 4YQ3A 2CX8A 4PZKA 4YQ2A 3KTYA 1OY5A 1UAKA 4YVGA 1P9PA 4KGNA 4IG6A 4YQKA 4YQ9A 4YQOA 5GMBA 1J85A 2HA8A 4YQBA 4YPZA 3L8UA 4YQ7A 4XBOA 1UAMA 2Z0YA 1TO0A 4YQPA 4MCDA 4JALA 4YQAA 1K3RA 4MCBA 4YQJA 3O7BA 4YQ4A 2O3AA 4MCCA 4H3YA 1VHKA 4X3MA 1X7OA 4YQSA 1O6DA 3N4KA 4YQ0A 4YPWA 2EGWA 3ILKA 4YVKA 3KY7A 3IC6A 4YQ5A 4YPYA 4YQTA 3E5YA 3IEFA 3BBEA 3OIIA 3KW2A 4FAKA 4YVHA 4YQLA 1UALA 1X7PA 4KDZA 3ONPA
chains in the Genus database with same CATH superfamily
4YQ1A 4JWFA 3AI9X 1VH0A 3AIAA 4JAKA 1GZ0A 1V6ZA 4YQIA 4CNFA 3OINA 1NS5A 5FAIA 3AXZA 1UAJA 2V3JA 4YQGA 4YQCA 4CNGA 4JWJA 3BBDA 4YQDA 3NK6A 4YVIA 2QWVA 4CNEA 3QUVA 3OIJA 5D9FA 4YVJA 2EGVA 4X3LA 4YPXA 4YQNA 1VHYA 3DCMX 4YQ8A 4E8BA 4JWGA 4RG1A 4YQ6A 2V3KA 1NXZA 4JWHA 1ZJRA 3N4JA 3NK7A 3KNUA 5GMCA 4YQQA 1MXIA 3GYQA 1IPAA 2I6DA 2YY8A 2QMMA 5GM8A 4J3CA 4CNDA 4YQRA 4L69A 4H3ZA 5CO4A 1V2XA 4FMWA 3BBHA 1Z85A 4YQ3A 2CX8A 4PZKA 4YQ2A 3KTYA 1OY5A 1UAKA 4YVGA 1P9PA 4KGNA 4IG6A 4YQKA 4YQ9A 4YQOA 5GMBA 1J85A 2HA8A 4YQBA 4YPZA 3L8UA 4YQ7A 4XBOA 1UAMA 2Z0YA 1TO0A 4YQPA 4MCDA 4JALA 4YQAA 1K3RA 4MCBA 4YQJA 3O7BA 4YQ4A 2O3AA 4MCCA 4H3YA 1VHKA 4X3MA 1X7OA 4YQSA 1O6DA 3N4KA 4YQ0A 4YPWA 2EGWA 3ILKA 4YVKA 3KY7A 3IC6A 4YQ5A 4YPYA 4YQTA 3E5YA 3IEFA 3BBEA 3OIIA 3KW2A 4FAKA 4YVHA 4YQLA 1UALA 1X7PA 4KDZA 3ONPA
chains in the Genus database with same CATH topology
4YQ1A 4JWFA 3AI9X 1VH0A 3AIAA 4JAKA 1GZ0A 1V6ZA 4YQIA 4CNFA 3OINA 1NS5A 5FAIA 3AXZA 1UAJA 2V3JA 4YQGA 4YQCA 4CNGA 4JWJA 3BBDA 4YQDA 3NK6A 4YVIA 2QWVA 4CNEA 3QUVA 3OIJA 5D9FA 4YVJA 2EGVA 4X3LA 4YPXA 4YQNA 1VHYA 3DCMX 4YQ8A 4E8BA 4JWGA 4RG1A 4YQ6A 2V3KA 1NXZA 4JWHA 1ZJRA 3N4JA 3NK7A 3KNUA 5GMCA 4YQQA 1MXIA 3GYQA 1IPAA 2I6DA 2YY8A 2QMMA 5GM8A 4J3CA 4CNDA 4YQRA 4L69A 4H3ZA 5CO4A 1V2XA 4FMWA 3BBHA 1Z85A 4YQ3A 2CX8A 4PZKA 4YQ2A 3KTYA 1OY5A 1UAKA 4YVGA 1P9PA 4KGNA 4IG6A 4YQKA 4YQ9A 4YQOA 5GMBA 1J85A 2HA8A 4YQBA 4YPZA 3L8UA 4YQ7A 4XBOA 1UAMA 2Z0YA 1TO0A 4YQPA 4MCDA 4JALA 4YQAA 1K3RA 4MCBA 4YQJA 3O7BA 4YQ4A 2O3AA 4MCCA 4H3YA 1VHKA 4X3MA 1X7OA 4YQSA 1O6DA 3N4KA 4YQ0A 4YPWA 2EGWA 3ILKA 4YVKA 3KY7A 3IC6A 4YQ5A 4YPYA 4YQTA 3E5YA 3IEFA 3BBEA 3OIIA 3KW2A 4FAKA 4YVHA 4YQLA 1UALA 1X7PA 4KDZA 3ONPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQ1 A;  3AI9 X;  1VH0 A;  3AIA A;  4JAK A;  1GZ0 A;  1V6Z A;  4YQI A;  4CNF A;  3OIN A;  1NS5 A;  5FAI A;  3AXZ A;  1UAJ A;  2V3J A;  4YQG A;  4YQC A;  4CNG A;  3BBD A;  4YQD A;  3NK6 A;  4YVI A;  2QWV A;  4CNE A;  3QUV A;  3OIJ A;  5D9F A;  4YVJ A;  2EGV A;  4X3L A;  4YPX A;  4YQN A;  1VHY A;  3DCM X;  4YQ8 A;  4E8B A;  4RG1 A;  4YQ6 A;  2V3K A;  1NXZ A;  1ZJR A;  3N4J A;  3NK7 A;  3KNU A;  5GMC A;  4YQQ A;  1MXI A;  3GYQ A;  1IPA A;  2I6D A;  2YY8 A;  2QMM A;  5GM8 A;  4J3C A;  4CND A;  4YQR A;  4L69 A;  4H3Z A;  5CO4 A;  1V2X A;  3BBH A;  1Z85 A;  4YQ3 A;  2CX8 A;  4PZK A;  4YQ2 A;  3KTY A;  1OY5 A;  1UAK A;  4YVG A;  1P9P A;  4KGN A;  4IG6 A;  4YQK A;  4YQ9 A;  4YQO A;  5GMB A;  1J85 A;  2HA8 A;  4YQB A;  4YPZ A;  3L8U A;  4YQ7 A;  4XBO A;  1UAM A;  2Z0Y A;  1TO0 A;  4YQP A;  4MCD A;  4JAL A;  4YQA A;  1K3R A;  4MCB A;  4YQJ A;  3O7B A;  4YQ4 A;  2O3A A;  4MCC A;  4H3Y A;  1VHK A;  4X3M A;  1X7O A;  4YQS A;  1O6D A;  3N4K A;  4YQ0 A;  4YPW A;  2EGW A;  3ILK A;  4YVK A;  3KY7 A;  3IC6 A;  4YQ5 A;  4YPY A;  4YQT A;  3E5Y A;  3IEF A;  3BBE A;  3OII A;  3KW2 A;  4FAK A;  4YVH A;  4YQL A;  1UAL A;  1X7P A;  4KDZ A;  3ONP A; 
#chains in the Genus database with same CATH topology
 4YQ1 A;  4JWF A;  3AI9 X;  1VH0 A;  3AIA A;  4JAK A;  1GZ0 A;  1V6Z A;  4YQI A;  4CNF A;  3OIN A;  1NS5 A;  5FAI A;  3AXZ A;  1UAJ A;  2V3J A;  4YQG A;  4YQC A;  4CNG A;  4JWJ A;  3BBD A;  4YQD A;  3NK6 A;  4YVI A;  2QWV A;  4CNE A;  3QUV A;  3OIJ A;  5D9F A;  4YVJ A;  2EGV A;  4X3L A;  4YPX A;  4YQN A;  1VHY A;  3DCM X;  4YQ8 A;  4E8B A;  4JWG A;  4RG1 A;  4YQ6 A;  2V3K A;  1NXZ A;  4JWH A;  1ZJR A;  3N4J A;  3NK7 A;  3KNU A;  5GMC A;  4YQQ A;  1MXI A;  3GYQ A;  1IPA A;  2I6D A;  2YY8 A;  2QMM A;  5GM8 A;  4J3C A;  4CND A;  4YQR A;  4L69 A;  4H3Z A;  5CO4 A;  1V2X A;  4FMW A;  3BBH A;  1Z85 A;  4YQ3 A;  2CX8 A;  4PZK A;  4YQ2 A;  3KTY A;  1OY5 A;  1UAK A;  4YVG A;  1P9P A;  4KGN A;  4IG6 A;  4YQK A;  4YQ9 A;  4YQO A;  5GMB A;  1J85 A;  2HA8 A;  4YQB A;  4YPZ A;  3L8U A;  4YQ7 A;  4XBO A;  1UAM A;  2Z0Y A;  1TO0 A;  4YQP A;  4MCD A;  4JAL A;  4YQA A;  1K3R A;  4MCB A;  4YQJ A;  3O7B A;  4YQ4 A;  2O3A A;  4MCC A;  4H3Y A;  1VHK A;  4X3M A;  1X7O A;  4YQS A;  1O6D A;  3N4K A;  4YQ0 A;  4YPW A;  2EGW A;  3ILK A;  4YVK A;  3KY7 A;  3IC6 A;  4YQ5 A;  4YPY A;  4YQT A;  3E5Y A;  3IEF A;  3BBE A;  3OII A;  3KW2 A;  4FAK A;  4YVH A;  4YQL A;  1UAL A;  1X7P A;  4KDZ A;  3ONP A; 
#chains in the Genus database with same CATH homology
 4YQ1 A;  4JWF A;  3AI9 X;  1VH0 A;  3AIA A;  4JAK A;  1GZ0 A;  1V6Z A;  4YQI A;  4CNF A;  3OIN A;  1NS5 A;  5FAI A;  3AXZ A;  1UAJ A;  2V3J A;  4YQG A;  4YQC A;  4CNG A;  4JWJ A;  3BBD A;  4YQD A;  3NK6 A;  4YVI A;  2QWV A;  4CNE A;  3QUV A;  3OIJ A;  5D9F A;  4YVJ A;  2EGV A;  4X3L A;  4YPX A;  4YQN A;  1VHY A;  3DCM X;  4YQ8 A;  4E8B A;  4JWG A;  4RG1 A;  4YQ6 A;  2V3K A;  1NXZ A;  4JWH A;  1ZJR A;  3N4J A;  3NK7 A;  3KNU A;  5GMC A;  4YQQ A;  1MXI A;  3GYQ A;  1IPA A;  2I6D A;  2YY8 A;  2QMM A;  5GM8 A;  4J3C A;  4CND A;  4YQR A;  4L69 A;  4H3Z A;  5CO4 A;  1V2X A;  4FMW A;  3BBH A;  1Z85 A;  4YQ3 A;  2CX8 A;  4PZK A;  4YQ2 A;  3KTY A;  1OY5 A;  1UAK A;  4YVG A;  1P9P A;  4KGN A;  4IG6 A;  4YQK A;  4YQ9 A;  4YQO A;  5GMB A;  1J85 A;  2HA8 A;  4YQB A;  4YPZ A;  3L8U A;  4YQ7 A;  4XBO A;  1UAM A;  2Z0Y A;  1TO0 A;  4YQP A;  4MCD A;  4JAL A;  4YQA A;  1K3R A;  4MCB A;  4YQJ A;  3O7B A;  4YQ4 A;  2O3A A;  4MCC A;  4H3Y A;  1VHK A;  4X3M A;  1X7O A;  4YQS A;  1O6D A;  3N4K A;  4YQ0 A;  4YPW A;  2EGW A;  3ILK A;  4YVK A;  3KY7 A;  3IC6 A;  4YQ5 A;  4YPY A;  4YQT A;  3E5Y A;  3IEF A;  3BBE A;  3OII A;  3KW2 A;  4FAK A;  4YVH A;  4YQL A;  1UAL A;  1X7P A;  4KDZ A;  3ONP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...