1ZJYA

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 102
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zjyA00
4RF4A 2Q1SA 1YVEI 5T57A 2H6EA 3T4XA 4E12A 5CDGA 4N5MA 3SLGA 5ILGA 2GN6A 3S8MA 4DQUA 5A05A 3AU8A 1OAAA 1NPDA 5ITVA 3ASVA 1LLQA 2CZCA 3UUWA 3ZWCA 4BNXA 1YWGO 4DXHA 1GADO 3MJCA 3RJ5A 3A4VA 5C37A 2ZQZA 3H3FA 2NADA 3OEWA 1Q0HA 3TZCA 3K9QO 1VPDA 4E3ZA 3RAJA 1B14A 1E7RA 3TOZA 3OQ6A 4BMVA 3DBLB 6LDHA 5A03A 4C7JA 3W8FA 3W4IA 4I1IA 4RF3A 4DYDA 5BR7A 3GUYA 1EFKA 2NLOA 4KWHA 4CMGA 2YV2A 3U9LA 1GUYA 3DBLA 2Z1MA 3FNGA 4IDFA 3HJAA 1F17A 4H16A 3DFUA 3TZ6A 4I5GA 2EWMA 3MCVA 3L6EA 1SEPA 2D3TA 4YDRA 1U2GA 5TNXA 5G0VA 1DLJA 4BNHA 2EEZA 2OO5A 1K6IA 4YRBA 3ADPA 3KLMX 4J4HA 1DEHA 3FD8A 2O3SA 5AXAA 4DMLA 4MINA 3I83A 3U62A 1BMDA 4I5DA 4PG7A 5CPBA 1ENOA 1SAYA 2CVZA 1LA2A 3OH8A 2WEKA 3JQGA 1EVYA 3WBFA 3AI2A 4R41A 4MVJG 2RAFA 4IDEA 3ZN2A 3DAGA 4CLRB 4OSOA 4TSKA 4BNMA 4IIUA 4XB2A 5L45A 3QIVA 3UKOA 3MJSA 4CL3A 1O5IA 1WPQA 2ZATA 1IPEA 4I5FA 2NVBA 4MPDA 3KETA 5IDYA 5CDSA 1HEUA 1PZGA 3INGA 4CLRA 4IGEA 4XQ9A 5GY7A 2Y1CA 4G65A 4DGSA 1GQQA 5L95A 1JAXA 3GGPA 1EBFA 4YACA 1A9ZA 1BGVA 3UICA 4AVYA 3JQFA 1IULA 2VHXA 3ZWPA 1P1KA 4BIIA 1MGOA 3A06A 3RC2A 1ENYA 2CUKA 3N7UA 3AOEA 3INRA 4XRGA 3D4NA 4BS9A 2GN8A 2O23A 4PLTA 4UVHA 1B8PA 1GQYA 5FWNA 3G49A 1M76A 4D79A 2C07A 3ZCXA 5KIAA 1J49A 3GVHA 3FCOA 4RLSA 4WEOA 4GAEA 3S2GA 5JYDA 5F5NA 3EHEA 2PLAA 4UVDA 2ZCVA 4BHTA 4WCFB 1JWAB 1LI4A 5DOVA 3FR8A 1Y9AA 3C7DB 2PY6A 3EY4A 3NJ4A 3PQDA 3H9GA 3NDRA 1EDZA 4UUOA 4H15A 3PHIA 4WCFA 3SVTA 3WTCA 3ASUA 3LF2A 5CG2A 3TL2A 2TMGA 4NPCA 5TIIA 2WDZA 3U4CA 4L73A 3FBGA 4CQMB 5JCJA 3PGJA 2X86A 2FY8A 4YBZA 3LSYA 4A7PA 1LQTA 1UZMA 4R5MA 3VPHA 3IMFA 2DT5A 3L4BC 1I3NA 2LDBA 4II2A 3P7MA 1D8AA 1I30A 1DHTA 2FSVA 4DREA 2DTEA 2ILTA 3A14A 3BTOA 4ROSA 4IXWA 4K26A 4BO6A 3AUSA 3FPLA 4XR4A 2DC1A 2Y0CA 3WTBA 4UUPA 5ADHA 2X1HA 4R69A 3RFXA 4OAQA 4YT8A 1PJ3A 1U7HA 2GF2A 1B26A 3G3EA 3E5MA 2H5LA 4CLXA 2Q4EA 4FW8A 4YAKA 3UAGA 4MVJA 2AG8A 3OBBA 1NASA 4U6QA 5DP2A 4WOKA 4U0JA 3HSKA 3G17A 5HM8A 3NRCA 5BNFA 4DC1A 3VKVA 1KERA 2C29D 1XKQA 4YAJA 3ZHYA 3KSZO 3ADOA 5AXCA 4KUHA 1GPDG 3UHAA 1NTOA 2UUOA 4Y6PA 1VSUA 1PS0A 4J2OA 3VHRA 3GUCA 3I6IA 4EUHA 2BF7A 1F8FA 3RROA 4KUGA 5JMPA 5ENVA 4CMHA 2GERA 1LEHA 1P9LA 1SCUA 1A71A 4FB5A 5A9SB 3W6ZA 3T4EA 1ID1A 4YB8A 1ZBQA 3WQQA 4EDFA 5C5IA 2X23A 1E3JA 1NFRA 1R37A 1Z74A 2BFOA 3I1JA 4I5EA 2HJSA 3KBOA 4J1NA 4DQVA 2X5JO 4JIGA 3RBVA 5A9SA 1MB4A 1PJTA 1DB3A 2B36A 3MTGA 4I9NA 2CVQA 3LQFA 3GN1A 1BVRA 4QECA 5IN4A 3TDKA 1U4OA 2AE1A 3EGOA 3JQBC 3PFFA 4BKOA 3PVZA 4PCVA 1RJWA 3V5NA 5KJ6A 3NGXA 4RPHA 3KO8A 3RKRA 4PG5A 2XAAA 4RF2A 4OXKA 1Y7TA 4BO8A 1ZO8A 2UVDA 4W7HA 1WDMA 1R4NB 3Q9NA 3UF0A 2R2GA 2ZTLA 2D5AA 4D43A 1XA0A 1EVJA 1PJ2A 1I3MA 2Y1DA 2X6TA 1ISGA 3GGGA 3H7AA 1NAIA 5H81A 2I6TA 1QP8A 2YFHA 1T24A 3LC2O 1R4NA 4IUYA 1GD1O 3B1FA 4TROA 1DC5A 2PWZA 4Z0PA 5LDHA 4JROA 3QVXA 4JNKA 1C1DB 1GCUA 1H6AA 5KVSA 4AJ4A 5L4SA 3K73O 3C24A 4F6CA 1HKUA 4AJLA 2DBZA 4XD2A 3GQVA 3PQEA 3RJ9A 2PGJA 1WNTA 2BGLA 5JLAA 1SB8A 1U3UA 3ETEA 3F3SA 3IJRA 2GZ3A 3VZPA 1C1DA 3EMKA 1Z75A 4XQCA 3WIEA 5C7OO 1QYCA 4P4NA 4WNIA 1IE3A 2R00C 1MV8A 2J6IA 3M1LA 3E1KA 4XA8A 4XQEA 2AEFA 3WQSB 4NBRA 2G82A 3JQ8B 4FC6A 4L74A 2DQ4A 1QXSA 3GDFA 1IZ9A 3WLEA 3ZNOA 1CDOA 4L9RA 4J7XA 4S1VA 3GVCA 2YJZA 4BNTA 2O48X 4EEXA 3SC6A 4PN3A 1WLYA 2HMSA 2UYYA 1VKNA 1DIAA 1ULUA 1B7GO 1EVZA 2CVOA 1O89A 1SB9A 2IEDA 2V6FA 4D44A 3DHYA 2A94A 1UH5A 4HY3A 4HNGA 1PU2A 3KB6A 2VNSA 3H4VA 5KJCA 3F4LA 5LC1A 1U5CA 4YAGA 1WW8A 4I9HA 4Q3AA 1UP4A 4A2CA 2AHRA 4GWGA 3AJRA 4TRMA 5CDYA 5DZSA 4XR9A 1I3LA 4MVJM 1Z82A 4J49A 1RYEA 2Q2QA 2CFCA 4H7PA 3PWSA 3KYDB 2VYND 2DBVO 4AJHA 4L0QA 4IDAA 3WYEA 1AGNA 3ZNNA 4IDDA 2GZ1A 1I2BA 3JYQA 2DTXA 2J3IA 1V8BA 3OHSX 4UULA 1LRLA 4WLFA 3ZHZA 4TQGA 3U49A 4LISA 3Q3CA 1R12A 1T2DA 3GZ4A 3KVOA 4H3VA 4PG6A 3MJ4A 1CQIA 4Z0HO 5TGDA 5T5QA 5HBRA 1L1FA 1GCOA 2JCVA 1QV6A 3DZFA 4M54A 4E4YA 3Q0EA 4IZIA 3ONFA 3OIDA 2DVMA 3VTFA 3GMSA 3Q6IA 2OBYA 1N1EA 3L4BA 4WLUA 4CMEC 3R3SA 1LLUA 2I5PO 3ZU4A 5IDQA 4ONEA 4XCVA 4N7RA 3UW3A 1NVGA 4KUEA 3PLRA 4GX0A 3H2SA 1MC5A 3SLKA 1MG0A 2QRJA 4TVBA 3FN4A 2B69A 1I10A 2DBRA 3GNTA 4B7CA 3NTOA 4JBHA 4IGFA 2JCXA 2YZ7A 1F14A 1VL6A 3DONA 2I9PA 2VTDA 4FOOA 4MVJH 2HKIA 2JFHA 4KOAA 5DNAA 2GCGA 3QVOA 3K96A 3ORFA 3W8DA 3NEPX 4D42A 2E4AA 2EHDA 2HMVA 4CM8B 2AQKA 1HYGA 1ADCA 4F45A 3DBHA 3MJVA 1HDZA 4UEKA 1YXMA 1HWYA 1E6EA 4J7CA 1C0PA 4E33A 4R16A 4PFJA 3IDSA 1O8CA 4CM8A 2FPPA 2B0JA 4XYBA 3RKUA 3NGLA 5L4LA 4IQGA 4J9UE 3PJEA 1PX0A 3UFXA 3ST7A 2YFQA 2NTJA 5COQA 3M2TA 1JQBA 4Q3CA 1LLCA 1ZK2A 2Y1OA 1A4UA 1X14A 3P2YA 4N5LA 4FPXA 2DM6A 1ZK4A 3K30A 1U8XX 3KYCB 5KKCA 3SBOA 1JA9A 2AMFA 2FPIA 4ND2A 1HE4A 1IYZA 3DXFA 1K89A 2X0IA 4XYEA 2ZB3A 4ILKA 1TT5B 2A9FA 2B5VA 3PQFA 4FN4A 4NI5A 1AXGA 4QTZA 3NTRA 2EV9A 3JQBA 4Z3KA 5F5LA 4CLOA 1TT5A 2UUPA 4CMKA 4FFMA 4PLHA 4FGWA 3WNQA 1O95A 4BNUA 1NP3A 3ETDA 4JLWA 2V65A 1D7OA 1XQ1A 1SO8A 2PA3A 4D3DA 5L4NA 5JDCC 3V2HA 1YO6A 4RVUA 2HMTA 3GFBA 5ER9A 5I7FA 1E77A 3GVPA 3PIIA 4ZQHA 3QQPA 3LDHA 2ZJ0A 4DVJA 5B1YA 3ZI0A 3GVIA 1AXEA 2PGLA 3U4DA 3B1KA 3FTPA 1OBFO 2GASA 4WLOA 3T7CA 3WQRA 2A35A 3ZW9A 4BB5A 3KHUA 4EBFA 1Z6ZA 3RVDA 1C0KA 4DPLA 1PZFA 1F06A 2VWQA 2WM3A 1B15A 1SMKA 5KVQA 1DOHA 4DIBA 2I67A 1P1RA 4PZCA 3N58A 1HTBA 4TRJA 3JD3A 1EK6A 1O6ZA 5K9ZA 4GX1A 4JBIA 3PPIA 3UCXA 5BT9A 1UAGA 3PDUA 4BNGA 3SXPA 2H9IA 4YT2A 2PTGA 2R00A 1L7DA 2Q49A 4LN1A 1HDYA 4CMIB 4XYGA 4D0SA 4URFA 1JKIA 3U09A 1SEVA 3JTMA 3EDMA 3DWFA 4CM4B 4L4XA 2WYVA 1IPFA 5AVOA 1YL6A 5J23A 5GZ3A 2GDZA 3F1KA 4RF5A 3JQCA 3GMDA 3VDQA 1ZKMA 2JHFA 3DTTA 1ONNA 4K9DA 4GLLA 4CM4A 3B20A 2XF8A 4RQUA 3SC4A 4B8WA 4XQGA 3OJ0A 2ZJ1A 3GZNA 4BO7A 4K6CA 5L9AA 1FK8A 4M89A 1PS8A 3HFSA 4KDEA 4L8VA 4XRRA 1U9JA 4N18A 4NK5A 2LDXA 3TNLA 1GZ6A 2VRBA 2VCYA 4BNVA 2JFFA 3C7CB 4Y9DA 3I6QA 4J3FA 5F1OA 5EIOA 1N1GA 2JCYA 4JP3A 4D3SA 3JD4A 1NPTO 4MVJF 5G0TA 4XYLA 4D3FA 3C1TA 3R6DA 5KTKA 3FI9A 1OMOA 1EE9A 4R1NA 3BMQA 4FS3A 2PGDA 3W4KA 3E9NA 1Q7CA 3DR3A 4J0FA 5GZ1A 2J5RA 3MJEA 1YOVA 4J4TA 4O1MA 1PZEA 5JAQA 2E48A 4O63O 2Q2WA 3JQAD 4GH5A 4J43A 4CMEA 1LC3A 3I9NA 1JW9B 4JCOA 5DBGA 1H9AA 3GC6A 5U1PA 4BNFA 1XHLA 2AW5A 1H2HA 3WGTA 4YA6A 3BXXA 1KIFA 3Q1LA 2OUIA 4CL8A 1XGKA 1LDBA 3PHHA 1AHIA 5GMOA 1VLLA 1I33A 1PGNA 1LSJA 4BV9A 4D7AA 4YCAA 4GGPA 3LLSA 1HDGO 2QX7A 4PLPA 2B37A 3DC2A 3WX0A 3MWEB 1ZJZA 4IM7A 3PJGA 3PLNA 4BV8A 4R68A 5KJ1A 2IXAA 2VWPA 4P4LA 3UVEA 1KC3A 2C2YA 1EFLA 1DIBA 2B4QA 2OGUA 5EQDA 3K31A 3JQDA 5JDIC 2VHVA 2QRKA 1ISMA 1DDOA 2JAPA 3KZVA 1A7AA 4TRRA 4ZQFA 3ZHBA 5JY6A 4NR0A 2O7SA 2W90A 3HWRA 4WKGA 3CMCO 1Y9EA 3CTMA 4EJ0A 1DLIA 1GUZA 3JQ6A 1YQGA 3FR7A 3KEOA 2C20A 2OBNA 2WTBA 1NVTA 3AK4A 2P91A 1PR3A 1U5AA 1C1XA 4KWIA 2VYNA 2B83A 4LRTB 4ZRNA 5KJFA 1MC4A 1OC2A 4BKPA 1PGOA 1NX6A 1E6WA 1YB4A 4U5QA 3ZWYA 1QRRA 4HV4A 3BMOA 3CEAA 4A73A 2VZ0A 4LGVA 1ADFA 3TFOA 3VPXA 4PVCA 1FDTA 1LSSA 3LK7A 3H9EO 4Y98A 4DRYA 4DC0A 1T1RA 4RJTA 1JWBB 3KYBA 1A9YA 2CF5A 3DAFA 3F5QA 3GDGA 4HFNA 4XX0A 3HZZA 5DCUA 2QZ9A 4RQTA 2QRLA 2PK3A 3PWKA 4QFCA 1P77A 3GPIA 3F1LA 3HFGA 4WLEA 3G1UA 4UEOA 2DLDA 2O3JA 5L53A 5JDCA 4RGBA 1A72A 2IYOA 4OXNA 2BRUA 1D4FA 1E1NA 1MFPA 3AUUA 4BGIA 3KTDA 3ZW8A 2W4QA 1TLTA 2C82A 3QV1A 1IB6A 3QVTA 4GL4A 3DMYA 1ZK1A 2HO5A 2ZQYA 3DQPA 4JXKA 2DUUA 2JAHA 1UXGA 3GN2A 4KQWA 1ARZA 1H6CA 1A7KA 1Y6JA 3FPCA 2EKQA 4GKBA 3IQDB 4LMPA 3DZIA 3VVBA 4GSLA 5ITWA 3ZWAA 1DC4A 5A9RA 4MIYA 4WGGA 3VH1A 1HL3A 1YB1A 1CRWG 3F9IA 1HXHA 1IL0A 5THQA 3PYXA 4GLOA 4E6PA 2VUUA 1TXGA 2WJPA 2X9GA 3H5NA 5G4KB 3OEYA 4I9UA 2QQ5A 2J5KA 3OIGA 4R3WA 4J91A 4D0RA 4RDIA 2A92A 3BMCB 1ISIA 3L0DA 4GGOA 4ZD6A 2B5WA 1WMBA 5FI3A 1VJ0A 1KOLA 5G4KA 3VH3A 3WGQA 4OOFA 4KTVE 1N7HA 1LRKA 4FD3A 1P1FA 5I9NA 3P19A 2Z95A 4IINA 3BMCA 1FJHA 1ZIDA 4WECA 3MZ0A 1XU7A 2X22A 4YJFB 3WJ7A 5FEUA 2PNFA 5DN9A 2Q46A 3QWFA 4AJ2A 4L75A 1E3EA 1V3VA 2WD7B 2WYWA 2EP7A 2X7HA 4EYEA 1DC3A 1NBOA 1C0LA 2EXXA 4FDAA 3TWOA 3K92A 4EUEA 4XGIA 3I9JA 1HE5A 1K5HA 4OH1A 1CWUA 4K1LA 1NQ5A 2DTDA 5JAMA 4HFJA 3HB5X 4HXYA 3PEFA 4R5HA 2NQTA 3OJLA 1V0JA 7MDHA 2ET6A 3GK3A 3NAQA 2HSDA 4B7XA 2GYYA 2P9GA 5G0WA 3WFJA 4BO5A 2RH8A 1DAPA 1C0IA 3W6UA 2Y93A 3AUTA 1P33A 2TMDA 4YJGB 3OSUA 2IZZA 2EW8A 2P9CA 2QHXA 3GA0A 5JY1A 2GR9A 1Z7BA 2VYVD 3OIFA 3L4SO 4J7UA 4ALLA 1EZ4A 4HKTA 4CLDA 1XIVA 1JTVA 3KLPX 4HFMA 1HT0A 4YJGA 5F1KA 1PTJA 3U3XA 4DUPA 3FWZA 2OP1A 4IIVA 2C0CA 3FNFA 2X9NA 3D3WB 2ZB7A 4WASA 1I24A 1VI2A 4YEDA 3B70A 1BDBA 4KP7A 3LVFO 3ZWVA 1G0NA 1YRLA 3ZV5A 2SCUA 4PLGA 1EMDA 5CPFA 4PIVA 1AE1A 3WBBA 1NQAO 1DIGA 5DP1A 4J90A 2P4HX 4ITUA 1PS9A 1QORA 5A5EA 1ZEMA 2HK7A 5C7IO 4W9NC 4CQMA 5JDIA 3H8VA 3L6OO 1P1HA 2Z1NA 1VM6A 3CKYA 1GYPA 4FQ8A 2JL1A 3ZV6A 4AJOA 3JQ7B 4B4OA 1PJ4A 4F46A 3IJPA 3CH6A 5B4VA 4GQAA 4JK3A 4MKZA 4CMBA 1YDEA 2P5YA 4BNLA 4ZA2A 3VZQA 4E31A 1EK5A 1OZAA 2AQHA 5DBIA 5BNTA 1ZJYA 1ZH8A 2I99A 3TF5A 4GX2A 2H63A 3JQ7A 4MIEA 5GZ6A 3BTUA 3WYBA 2QIOA 3L77A 4ZQGA 4AJNA 4Z9YA 4BNYA 1VJ1A 3RU7A 1HF3A 2EP5A 5G2OA 1ZVMA 5A04A 3RC1A 3QE3A 4DPMA 5I9MA 3JQAB 3VZSA 3JD1A 3P2OA 2DPHA 4E5PA 1R0SA 4IPTA 4OQZA 4BVAA 3E82A 2VWGA 1VSVA 1BXZA 5DDIP 3F5SA 3KRTA 3U4HA 3JQAA 2EW2A 2Q50A 3D5QA 4YT5A 4RLHA 5F1PA 2GSDA 4OSPA 2BI8A 3P5SA 1KS9A 1NR7A 1TB4A 2GNAA 3ZNQA 4D46A 2GN9A 4DBZA 4YAIA 3HN2A 2IE0A 5KVVA 2X0JA 1A27A 5JFOA 3WMWA 4CV3A 3JYOA 5TRTA 5JW6A 4CPDA 3GRPA 2H1SA 2VHZA 3L9XA 5CHEA 1UZNA 3TJRA 1E7MA 1B2LA 3QSGA 5JNLA 4Q3NA 3NT2A 1GU7A 1UXIA 1FDUA 1T2EA 2B35A 2Y99A 3FHLA 3JQ9C 1DBVO 3ZWXA 3D5TA 4WNCA 3UOGA 5TT0A 4A10A 4EW6A 1E7SA 4O6VA 4KQXA 4R1UA 4A5OA 4ZVVA 3ITKA 3DHEA 1E3SA 2HK8A 2AE2A 1T25A 2W8ZA 1GDHA 5JXWA 3AFMA 4CUZA 4NBUA 4L4RA 3HDQA 3A1NA 3GGOA 3WGGA 2AEMA 4QO8A 2NU6A 3PXXA 2JJYA 4A27A 1FXSA 4NDNE 4YRAA 1E1KA 1DIRA 1ZFNA 2DPGA 2FR8A 3Q11A 4LSWA 3B1JA 4L4SA 2AA3A 3ZV3A 4E5YA 4PLCA 2FOIA 3DO5A 9LDTA 5U4QA 2VWHA 5DT9A 4DTIA 2JD2A 3IUSA 4CM9D 5IAAA 4DYVA 4YRDA 1H0KA 5JS6A 4BGEA 4EJMA 5T67A 2GGSA 1GPJA 1LLDA 4IXTA 2CDAA 2P68A 3GH3A 1UXJA 1EUDA 1SBYA 4IQ8A 5JPIA 4BUCA 3WDSA 1VRWA 4NG5A 5IZ4A 1M2WA 4ALIA 4J6FA 1OI7A 4BL5A 3TZHA 2W2KB 1GEEA 5TT1A 3WGYA 1ORRA 4OYRA 4ALMA 1ISJA 3RBZA 4TKLA 1LJ8A 2BGMA 3RASA 1Z73A 3WS7A 1NNUA 1EEHA 2C54A 2W2KA 2C5AA 3JQ8A 3STHA 2DAPA 3H9JA 2NQ8A 4FJ0A 4FR5A 5MGBA 1NQTA 2AEJA 3PWZA 4UAGA 5IZCC 3AW9A 2NU9A 1NPYA 2BELA 4R54A 1BHSA 1H94A 3GG2A 1E3LA 1BTOA 1PIWA 3ANLA 1LQUA 3V1TC 2PZLA 4IDGA 3UXYA 4RZIA 1DJNA 2NTVA 2JFGA 5ILOA 1LXCA 3NTQA 3JYLA 2I66A 2PZJA 4B8ZA 3PHLA 2Q1WA 1LX6A 1B0AA 1E3WB 1Q0LA 4Z9FA 4E2ZA 2HDHA 1DRWA 1M66A 3D0OA 3W1VA 4FIZA 4LSMA 1YB5A 1YBAA 3TQHA 4FJ1A 1K6XA 4M49A 2EJWA 1UXKA 4UEJA 5L3ZA 3DAPA 1EBUA 2Y68A 1JKJA 3NYWA 1ZMTA 3TL3A 3ROMA 3RIHA 3KYDA 2VQ3A 4CJXA 1LDYA 2VOEA 3D64A 4J1QA 1DSSG 4DIOA 3OFSA 4HWKA 3HHPA 1MUUA 2HRZA 3G0OA 1U3WA 2FRDA 3EZYA 5COBA 2NWQA 4RPJA 4RPGA 3WJAA 5A4DA 3VH4A 3QWAA 1BXKA 4BNWA 4B4WA 3F4BA 2X5OA 4W9NA 4AJIA 2CDBA 2PD4A 3WWYA 2HJRA 1PL8A 1DAOA 2CY0A 1R4MB 4J2HA 1WZIA 1J4AA 4HNHA 1X1TA 3OQ1A 1PQWA 2P4QA 3NDIA 4R01A 4U8GA 1XU9A 1SNYA 1H93A 3MEQA 1PJCA 1MA0A 1R4MA 1BXGB 1UR5A 2YHIB 1ZK3A 5KVCA 3KSUA 2GN4A 3V8BA 4M1QA 1O0SA 5C3MA 2VTEA 1KEUA 1HDRA 2Y1GA 3BHMA 1R0LA 8ADHA 5CEJA 2X5KO 2Y05A 3F46A 1NWCA 1ZCJA 4OJNA 2EJVA 3WB9A 4RCVA 2VNAA 1DXYA 1KEVA 2YHIA 4A0SA 1HSZA 4ALNA 3KOUA 4BNKA 2OP0A 3VC7A 1YBMA 1U7TA 1Q2XA 1R6DA 2XPCA 2E49A 4LK3A 3PK0A 1FDVA 4C7KA 3QA9A 4KDFA 3V1UA 1XLTA 1E0DA 3IIEA 3O38A 1ZSNA 3ZU3A 4TZKA 3ZH2A 2QZZA 3RUDA 1WZEA 4BNNA 4XGKA 2IYPA 2RHRA 3ZNPA 4YT4A 2D4AA 4ND4A 4ZN6A 2ZYAA 1UDBA 4RPLA 3K8ZA 3QLJA 1LDNA 5CDUA 1GYRA 1O94A 1HDCA 1J6UA 1M6HA 2POQX 4Y8VA 1F12A 1T4BA 2UDPA 3JQ9A 4W7IA 1ENPA 1D3AA 2P9EA 2O3TA 1YH3A 3KYCA 4MKXA 4BNZA 4E2WA 1R15A 3DZKA 5T64A 4IJKA 5COAA 5TS3A 1MXHA 4KZPA 2I3AA 1PL7A 4ZQBA 5EQFA 5CEEA 3LU1A 1QKIA 3AM3A 3V2GA 1A4IA 1E5QA 1HLPA 1GL3A 5TX7A 1ULSA 3DMTC 4QX6A 4P22A 3ZGYA 1CETA 1ZUD1 4HP8A 3OM9A 3WLFA 5JAIA 4NFHA 4PVDA 4AG3A 5BSGA 1JLLA 4A26A 1YS4A 1E3IA 1GV1A 2W2LD 1Q7GA 3M2PA 5DCYA 3PP8A 1I36A 2WE7A 4CR6A 3VZRA 3PFWO 2EGHA 4JGBA 1V3TA 2I65A 1KVQA 2I3GA 5H82A 3JD0A 2HRBA 1PJSA 3DZHA 5TC4A 2QYSA 3RCBA 1ZZEA 1MX3A 3RUCA 4IS3A 2BFAA 1N8KA 1YL7A 4NBWA 4CODB 1U2DA 2UAGA 3NT4A 3HG7A 3ROKA 3OQBA 4M55A 1L7EA 3RUAA 3UH1A 3QP9A 1VC2A 2OOSA 4TRNA 1FDWA 2CD9A 3U4IA 1YJQA 1VKOA 3WG9A 1AHHA 1FF9A 3FSRA 4U6SA 5CEFA 3D4OA 3OF2A 3C85A 1YQXA 2E6UX 3NX4A 4IJWA 3IUPA 4CMIA 3RI3A 2GD1O 3JSAA 1SZJG 2ZK7A 4AJKA 3ZU5A 4L76A 3PI7A 4PG4A 1E5LA 2W98A 2Y66A 3V2UA 1MFZA 3DFZA 5KNLA 4MJLA 5IZCA 1PGPA 2HQ1A 4CM5A 5ICMA 1B16A 4E30A 1YKFA 3ZZNA 2VN8A 2AQIA 3DHNA 4W4TA 1TI7A 2Y1EA 5T6BA 3R1IA 3NDJA 1EE2A 1X15A 1NVMB 4PLYA 4RVGA 2QG4A 2BMAA 2O2SA 2OMEA 3NV9A 1A5ZA 4YPOA 1N92A 4OQYA 1LBEA 4FFRA 1WVGA 3UCFA 1CQJA 1X7HA 4FSHA 4XDYA 4E0BA 4Y67A 1ZSVA 5HA5A 2B4TO 5BQFA 2NACA 1I01A 4QEDA 5AXDA 8LDHA 5EMHA 3CINA 2UV8A 5I7EA 1KY5A 1U3VA 1QR6A 4MDHA 3S2EA 4IBOA 2CSUA 1OFGA 2ZB4A 2VUTA 2BD0A 1QYWA 5K0ZA 1I32A 3WNVA 5HRUA 2WMDA 3JV7A 3RUIA 4QO7A 3AY3A 2F1KA 2CF6A 1NYTA 1WP4A 2Q3EA 5CG1A 4B3HA 3DEYX 4OKNA 4CV1A 4J9VA 3LT0A 2NVUB 4CM9A 3PDJA 1JVBA 3GAFA 1X0VA 1WDKA 1DIHA 1RWBA 4X54A 5JE8A 1VL0A 2PD3A 2FR0A 4GVXA 4UVEA 1UJMA 2C59A 3O9ZA 3HDYA 3RD5A 1N5DA 2FP4A 1HDXA 1IY8A 4PZEA 4PRLA 4CR8A 2VUSA 2Q1TA 3HB4X 4CUJA 5CDTA 3GY0A 3UN1A 2ZIZA 3I52A 2X4GA 3HN7A 4E5MA 1RKXA 1ZNQO 3QVSA 4ALKA 1EUCA 3V1YA 1BDMA 1JVSA 3PHJA 5A02A 3PTZA 2FN7A 4FFOA 1SOWA 3E18A 2NU8A 3ZHXA 1KYQA 1SOVA 4BGVA 3ZWOA 3EVNA 4TMFA 5JSFA 1NXQA 4FFPA 1JU9A 5G4LA 2AQ8A 3ZWMA 4JBGA 3OJEA 4XDZA 3RQSA 2Q45A 3BAZA 2HK9A 5HWSA 1HETA 3H2ZA 3EK2A 3MTJA 3BMNB 3HADA 4G2NA 3DZGA 3GHHA 5B37A 1XYGA 1FDSA 2DKNA 4NBTA 3E9MA 3TPCA 3WGOA 4AJ1A 4I08A 3GR6A 2HLPA 3BMNA 3HNPA 1UP6A 4EI2A 3ENKA 3GPDG 1JDJA 2E37A 2G5CA 2PZMA 4A03A 4D45A 4F3YA 2Q2VA 3IS3A 5IFLA 2E82A 3AY6A 3GRKA 4DBVO 3LC7O 5LCXA 4AJEA 5KKAA 1MXFA 4NMHA 4DPKA 4M87A 4CR7A 4TZTA 3U5TA 3C3XA 5IN5A 2O3QA 1ISFA 3ZU2A 5KCZA 1H9BA 2PD6A 3I4FA 1IUKA 3U0BA 1U28A 4R9RA 4GX5A 1P1IA 3K2EA 5HS4A 2JD0A 4TVOA 2B4RO 3E9QA 1Y8RB 3DMTA 1QYXA 1X13A 3INTA 4IS2A 4ZU3A 3MWDB 4OHUA 3LF1A 3ZWBA 2IZ0A 2X58A 3I4CA 5TSDA 4AICA 1D1SA 3QJ5A 5A1TA 3CIFA 4NU6A 3DBVO 1Y8RA 5JMWA 2ZB8A 2EGGA 3QY9A 4YJHB 3ENNA 4DLAA 5AOVA 5DBFA 4M86A 1PQUA 3K5PA 1S7CA 1U8FO 3L9WA 4ND5A 4B4UA 4CLHA 5CAEA 1Z7EA 3FNHA 5MDHA 1UP7A 5JO9A 4BO4A 4E2YA 3RBXA 2G17A 4JJFA 4YJHA 1WDLA 1LNQA 4CUKA 4UUNA 4G5HA 2EG9A 2FZEA 3AUAA 5IF3A 3CE6A 1H2BA 2PR2A 3VH2A 1DRVA 4CM1A 3QWIA 4AL4A 4B7UA 2NM0A 1XR3A 3E8XA 1UZLA 4YWJA 2ZTMA 1OC4A 2PH3A 1ISHA 3NT5A 4BKQA 4CM6A 4II3A 4PZDA 3LC1O 5THKA 3FNEA 3VAZA 2Z5LA 4RDHA 3GEGA 1V3UA 1XDWA 2RH4A 4FFNA 2BFMA 2D59A 2HU2A 4CLEA 5JAZA 1GFSA 2YDXA 3IP3A 1EVIA 4XWYA 1N2SA 2YQ4A 3C1OA 4XJSA 3HE3A 1GY8A 3G1TA 2VZ9A 5DCWA 2X9VA 4Q3BA 3RC9A 2O4CA 1XSEA 1E7QA 3H5RA 3QWBA 4PLFA 4LRSB 4WK6A 3JQGB 1T26A 2Y0DA 1V6AA 3E6AA 5L7YA 4MVJI 1VL8A 1X7DA 2WD8A 4QFDA 3H5AA 1DPGA 3MJTA 5B4UA 5EINA 1VJTA 1I5RA 3SX2A 3VDRA 1CF2O 3ROQA 4YJFA 1PGQA 1AN9A 1LU9A 4MKRA 4RORA 4XGNA 1PL6A 3KUXA 5G0SA 3CPSA 1KVUA 4WUVA 5JC1A 1ADBA 1O9BA 3N74A 2YW9A 2WD7A 4MO2A 5JC8A 4IMPA 3ZDFA 4JN6B 1M67A 1GTMA 2NNLD 5EERA 2YY7A 1XELA 2OL4A 3IL2A 2Y67A 4IZHA 2YV3A 2W2LA 3L6DA 1PQPA 3RUEA 4O59O 4TKMA 4Q3DA 3LZ6A 3GNSA 4D41A 2HUNA 4IMRA 5BSHA 1W0CA 1HYHA 3D3EA 3QRWA 5JO0A 3EYWA 2BLLA 4RVFA 1H5QA 1GEGA 1T2AA 4PLZA 5U9CA 5IJZA 4OXYA 2FHSA 1F8GA 3TFQA 3HDHA 1C3VA 1OOEA 4BNIA 3WSVA 4MOWA 5JBIA 5L7TA 1H6BA 1CEQA 2BGKA 3UGKA 3EC7A 2Q1UA 4DLLA 3C7AA 3HUDA 4RZHA 5KOIA 1CYDA 1G0OA 4FCCA 5TJ9A 4J1TA 4BQPA 3ITDA 3D3WA 3GDOA 3EZLA 1GV0A 5B12A 2Y1FA 1I2CA 5IDWA 2X8LA 4BB6A 5AXBA 1ZXLA 2EIHA 1MLDA 4CM7A 4J16A 5A5FA 3E48A 3DOOA 1H6DA 3KV3O 1KVSA 2YV1A 1B3BA 2BFPA 4EEZA 2DUWA 5EESA 1B8UA 4J1SA 4YVFA 1K3TA 2BKAA 4BMSA 2PZKA 1X1EA 3IKVA 4GI2A 3OP4A 1PJBA 4HX5A 1MG5A 3DBRB 5T8KC 3MOGA 5DF1A 2NUAA 5EJ2A 1DFIA 1P0FA 2IZ1A 4I8XA 4FFLA 4Q39A 1YONA 2VRCD 4WEQA 1K0UA 1PWXA 1BG6A 4YTEA 4B3JA 4YXFA 1LSUA 3TRIA 3DBRA 2Q99A 1R16A 5CP8A 1PGJA 4ZQEA 4EJ6A 1YBVA 3A9WA 1M6WA 1SC6A 4F6LA 4NJMB 2O2YA 1DFHA 1P44A 4YR9A 1W4ZA 1Q0QA 2A4KA 2D0IA 1UDCA 3S2FA 4R51A 2AG5A 4N5NA 3GEDA 1YJ8A 4NJMA 1WMAA 2QW8A 1S6YA 1E6UA 3GLQA 1HDOA 4NHEA 4DA9A 4ZICA 3NJ8A 2J3KA 4O0LA 3IOYA 4ESOA 4DMMA 2O3RA 1I2ZA 2GLXA 4CQLB 5FI5A 4P8RA 3JYNA 5L40A 3D1LA 4GMFA 4AJJA 3PGXA 2DBQA 1NAHA 3ZWWA 2R6JA 3I23A 3M1AA 1XWFA 5ER6A 2OXIA 2G1UA 4IDCA 2IXBA 5A3JA 4R1SA 4CQLA 5IXYA 2ZTVA 4ND3A 4XYMA 3OMLA 4ZRMA 1ML3A 4UVIA 5I9LA 4U0KA 3BTVA 1K6JA 3D7LA 1IZ0A 1XEAA 2EF1A 1NWHA 3EVTA 1Z45A 4JJGA 1BWSA 1T2CA 3GEMA 3O8QB 4WPGA 3SEFA 5DULA 3TZKA 1GAEO 1P45A 2FWMX 3FRJA 3I9LA 3AI3A 4HADA 4K28A 4RVSA 3R0IA 3RFVA 3FF4A 2XOXA 3LT1A 1EQ2A 2RBEA 2DFVA 3X2FA 3W4JA 4C4OA 3O8QA 2V6BA 3AM5A 1Y81A 3S2IA 3B6ZA 2BH9A 3SJUA 4E5KA 5BSEA 4BO9A 3NKLA 4LCEA 1GQ2A 3GT0A 1PSDA 5KWEA 1P3DA 4CMJA 3VVCA 1YE3A 3AM4A 1T2FA 1I8TA 3GHYA 1RYDA 3JD2A 4LCJA 5DOZA 2OZPA 4NK4A 5BNIA 1XG5A 5FF9A 4FBGA 5EPOA 1K2WA 2G0TA 4OM8A 4BKRA 5IG2A 1RM3A 4EUFA 2JD1A 1KVTA 4GMGA 1LTHR 2C7GA 4HFRA 3OJFA 1HE2A 1Y5MA 3DOJA 3OETA 3M6IA 4DQXA 3WXBA 2O7QA 4UVGA 4BGUA 4PGFA 4XB1A 1NM5A 3AU9A 4OO3A 1IOLA 4NZ9A 4WE3A 3WSWA 4E5NA 3IP1A 1E7YA 1P74A 4WOJA 3WMXA 3L07A 2HMWA 1W8DA 1GZ4A 2X0NA 4GPD1 3ZWNA 3Q2KA 3ABIA 3WWZA 4OGWA 1HZZA 1ONOA 1HRDA 3ROPA 1GYQA 3HQ4O 1T4DA 5EL0A 3LLVA 2RIRA 5I8ZA 1KETA 2PFGA 1PEDA 3MOIA 1BRMA 4Y6RA 1E92A 1DC6A 4PLWA 4GBJA 1YL5A 2GUGA 2J3HA 1X0XA 3VPSA 3PYLA 3A28A 1J5PA 4UREA 4GVLA 4QT0A 1NFFA 4ID9A 2P5UA 4MVJP 3FWNA 1PJQA 1E3WA 1KEPA 5AYVA 3I3OA 1RM0A 4OKIA 3TOXA 5EN4A 5IXSA 2WE8A 3RC7A 1EQUA 4NFYA 3BIOA 3IKTA 4MP3A 1G6KA 1EUZA 1HYEA 3PZRA 1KVRA 3H9UA 3LT2A 4PLVA 1ZSYA 4LW8A 4BO1A 2FZWA 1T1SA 1P1JA 3JCZA 3GFGA 4W82A 3IC5A 2J5QA 2ZYGA 1MP0A 2CMDA 3DZBA 3F47A 4R9SA 2PKRA 3DDNA 1VE9A 1V35A 2AXQA 2FPGA 3ULKA 1N7GA 2EKLA 2C5EA 4E21A 4O5OA 5T8KA 4E13A 1QLJA 2OORA 1ZXBA 1F0YA 3ANNA 3KM0A 1P0CA 4FC7A 3NUGA 1WXDA 2YQ5A 3KXDA 3RUFA 3WIDA 4UUMA 5L51A 3I9MA 5TF4A 6ADHA 3ZV4A 4BOYA 3TZQA 1SPXA 3EAGA 3BHIA 3WR5A 2XXBA 5TJHA 3K6JA 4PRKA 1C14A 1LC0A 1QMGA 2GO1A 3WFIA 4DL9A 1PZHA 1PWZA 3QVWA 4NFSA 2XXJA 3OJOA 4CV2A 2D8AA 1BXGA 3RUHA 4S3MA 1Y5RA 3H3JA 4DLBA 4NH4A 1NR1A 1DFGA 5IDXA 1NFQA 3GF4A 4M8SA 4R1TA 3WGZA 2NU7A 2VYVA 3GG9A 3DBHB 1DHRA 3FTNA 2RHCA 5A9TA 1XCBA 4Y6SA 4B79A 5FYDA 4FJ2A 1CJCA 3ETGA 3BA1A 2VZ8A 3COSA 2DU8A 2NV6A 4XJTA 3ICCA 3CZMA 3FBTA 3H6KA 4IJVA 1RM4A 3AOGA 1LDEA 9LDBA 4J0EA 5LDGA 2ZYDA 3PJFA 4CM3A 2X0RA 1N9GB 1EDOA 4U7WA 2P2SA 4IQ0A 2GPTA 4E2XA 3DOCA 5I8WA 4CMAA 4JJIA 3ANMA 4LVUA 2FMUA 2D2IA 2VT3A 2C2XA 1ZMOA 3EW7A 1Q1NA 3GVXA 1UAYA 3W8EA 4BNJA 1HE3A 2J8ZA 4BQRA 2D1YA 4E32A 3CUKA 1N9GA 4DIFA 1NHWA 2C7VA 3WGIA 1R66A 5K6AC 4GWKA 3DL2A 1TVEA 5JCXA 1WWKA 4AFNA 1I3KA 4JP2A 2JHGA 1GZ3A 4OL9A 2IODA 3EUWA 2V6MA 2OFPA 4FGSA 4HUJA 4CLOB 4AJPA 3GOHA 1WAMA 3S1LA 4MP8A 1LSOA 3KEQA 3PHGA 4LMRA 1GR0A 1ZW1A 4YJDA 2VRCA 4NBVA 1BVUA 4RPKA 4W99A 3PYMA 1ONPA 4CMCA 4BMNA 2IEBA 3I9KA 1IHXA 4Z3DA 4NQZA 2GRAA 4WLNA 4RL6A 4FOSA 4W6ZA 4B4VA 3ICPA 4P4GA 3X2EA 3PIDA 4Z9XA 2ZKLA 5HS6A 1KY4A 3AFNA 4EZBA 1R0KA 1RPNA 1UXHA 3E5RA 3CMMA 3BYZA 2YDYA 2YHUA 3WOHA 1QSGA 2J3JA 4QSMA 3SJ7A 4R4JA 2BHLA 1ENZA 3ONDA 1JKFA 4TWRA 1HSOA 1CIVA 1HZJA 4WLVA 1U4SA 3PZBA 4ND1A 1Y8QB 2VT2A 2FSSA 4RV9A 1AUPA 2O50A 3O4RA 2IDZA 3LYLA 5C7LO 1KC1A 2PKQP 1P31A 1NHGA 2DFDA 4B3IA 1W6UA 4BO2A 1GUFA 1QYVA 5AQ1A 4NU5A 3H9QA 4RVDA 1Y1PA 3PRJA 2I76A 5CFZA 3WICA 1Y8QA 3D4PA 4Q9NA 4PG8A 1RM5A 1D1TA 3RFTA 3VPGA 4HBGA 4G81A 4OMUA 2HAEA 4QXMA 2OHXA 3OA2A 2WYUA 3GZNB 5JCJD 2EERA 2Q4BA 2YUTA 3LT4A 5HTOA 4EITA 3RU9A 4JQCA 1YGYA 3JYPA 1G1AA 2GZ2A 4XKJA 3TN7A 4YQYA 1TEHA 1DRUA 2CNBA 3GNQA 4CQMD 2JKVA 4WCDA 1E1MA 1E1LA 1LUAA 4DWVA 3VPFA 2IRWA 3C8MA 4Z0TA 1LDMA 5KJEA 1KEWA 4OIMA 4ZJUA 1CERA 3BHJA 3TSCA 3I9OA 3WYCA 7ADHA 1BSVA 4KTTE 1KBZA 1ZEJA 1M75A 1UDAA 3BMQB 4N54A 5A3VA 2HCTA 4MVJD 4NNJA 1YOVB 3JQFC 5FFFA 4Z6KA 1NQOA 2O4UX 1YDWA 3VOSA 3UCEA 1DO8A 3AOEC 1QG6A 5ENDA 1ZK0A 1B3RA 4RO0A 3O03A 2NVUA 4ZGWA 4BO3A 1QV7A 3HDJA 3AY7A 4Q3EA 2V6GA 3OICA 2O3UA 2G76A 4GKVA 2RCYA 1E7WA 3GAZA 1U3TA 3RWBA 3I5MA 5I7VA 2FR1A 4MVJE 3Q2IA 4XIYA 3IAHA 4MP6A 2ZCUA 2HMUA 3CXRA 1BW9B 3VTZA 2PH5A 4INAA 5L7WA 1W73A 1XQ6A 4NIMA 1QYDA 2NTNA 5F3RA 1IHYA 2ZTUA 1UUFA 4GSKA 1LRJA 1BW9A 4IJUA 4JX8A 3BTSA 4WCFC 1X7GA 3Q9UA 1YQDA 2D5CA 3S55A 1ADGA 3QWHA 3VKUA 3K2BA 1JAYA 3BZUA 5B4TA 5G0UA 1DJQA 4J4BA 3O26A 1HLDA 3C1AA 2EKPA 3PJDA 3T7EA 4BO0A 3CSDA 2WWRA 3R3JA 5TQVA 5BSFA 5TLSA 3AI1A 4LVCA 4XIJA 2NVWA 4EGFA 1PJLA 3QW2A 5I7SA 2F00A 4OOEA 4ALJA 2NSDA 4QUKA 3DTYA 4YAEA 4QQRA 1TA4A 2VHWA 1QLHA 4YQZA 2CDCA 3G79A 2Y0EA 2QYTA 4IY1A 1C1XB 1Q7BA 4MIOA 1V9LA 4KMSA 4XEHA 3RSHA 5ICSA 4NJOA 5JYEA 4BKUA 4WJZA 1U1IA 2VOJA 4RVHA 1JN0A 2YYYA 5ES3A 5K6AA 3OECA 3BMOB 4K6FA 1FMCA 1I0ZA 5A06A 5F21A 3DZJA 3E03A 4IDBA 4XZ3A 3H65A 4R3NA 3ON5A 3JQEA 1B8VA 2V7PA 3DB2A 4P38A 1TT7A 1J0XO 3CZRA 3F6YA 3KSDO 1PR9A 3WGHA 2PV7A 2BI7A 4ZHSA 5H83A 2PKQO 2VHYA 3AWDA 2WSBA 1LDGA 3ONEA 3OA0A 4YYZA 3QHAA 4CV0A
chains in the Genus database with same CATH superfamily
1NSYA 4FR2A 3JAWA 3TECE 4ZO9A 2BIFA 3T4XA 4JJAA 1L4GA 1W29A 1NXSA 4RKRA 2LVBA 1MT0A 2AKEA 4DQUA 5LL6P 3L8DA 1GM5A 1PDVA 3AU8A 1ISSA 1OAAA 1XQVA 4AMBA 3CY6A 3ASVA 2CZCA 1C50A 4L85A 3EYAA 2WIDA 3ZWCA 1GADO 3MJCA 4PR0A 1T9HA 5C37A 3AHDA 2ZQZA 2NADA 1G16A 4NEGA 2QP3A 4E3ZA 5BWLA 3SFVA 3OQ6A 4MWBA 1C7FA 3AEKB 2VUIB 3R7WB 2QEQA 4B6PA 4X90A 4ZALA 5A03A 5JTUA 5K0JA 1JP7A 4L3WA 2ZETA 1TKCA 4O1HA 3IXQA 3SHWA 5JISA 4JU8A 4CMGA 1CS0B 3ZIAA 5I48A 3DXYA 3GEBA 2ZOSA 1GUYA 4NICA 1E6KA 3R7WA 2GETA 3WZ2A 5JZBA 3KT8A 5FUYA 3R8XA 3IBGA 2EWMA 1GG8A 2P0YA 4I2VA 4Q34A 1KXZA 4PXYA 4YDRA 3RWMB 1CS0A 2IPNA 2ZDGA 5DWVA 2V5AA 3COPA 4PTLA 1JMVA 5TXGA 1YE5A 4DLZA 4DT1B 2R62A 4JV5B 1K6IA 3EEFA 5IT5A 4YRBA 2PJZA 4G5QA 5GP1A 2XUIA 4J4HA 4WZ6A 5AXAA 2JHCA 3HGMA 4MINA 4DMLA 4KVAA 1SAYA 4MQLA 1WZ2A 2CVZA 2IC5A 2BBTA 4JLPA 2AFIB 5CYFA 3D6HA 1E98A 3OH8A 4AECA 4DT1A 5BSRA 2BGTA 4QPDA 4Q00A 4ZZ2A 1W5BA 1I4DD 1XZCA 3D6UA 1CF9A 3CUSA 2RAFA 3DBIA 1FFSA 1PT9A 2HSZA 2NPIA 5JSKA 4IIUA 3IXLA 2AFIA 1FFXB 4XB2A 3SHQA 2HHJA 1ULAA 5EWLB 3MCAA 2V0GA 1H1DA 2ODTX 3B5EA 4P92A 4Y2HA 1NMYA 2Q6LA 2L19A 3KETA 1PZGA 4JI8B 3IIMA 1WL8A 1PG0A 2N1MA 5GY7A 2Y1CA 3CJTA 4DGSA 1GQQA 1V7QA 2P3LA 2YINC 5EWLA 5L95A 2NYAA 4H17A 4FFBB 4BVKA 4YACA 4OHMA 2JFOA 4BE4A 3MMSA 4RKQA 5F7XA 4X6YA 3BGDA 2PAFA 2VHXA 4BMYA 5AKKA 4LJ5A 4PICA 4MZXA 4MH0R 4RVNA 3SJBA 4QM6A 3RC2A 4OXIA 3N7UA 2PXHA 5AFSA 2VJNA 9ATCA 3EIXA 4FFBA 3WK8A 3D4NA 4B4KA 2GN8A 2O23A 1OVMA 1YK0A 3Q85A 4OJQA 4EMTA 3KDPA 4ARCA 1GPUA 3IUJA 1VJDA 5E6UB 2PYZA 2DRIA 1NRJB 3G49A 4H7EA 1OXBB 1I51A 2D0OB 2J0UB 2ORYA 3P9KA 4KVZA 4L57A 3C39A 5EY5B 3W7AA 1SUCA 2H2GA 3MBOA 3O82A 2FZVA 4IV0A 4Y1RB 5EKUA 1HYQA 3CXUA 5HPYB 3GVHA 4CT4B 1R0CA 1DTEA 3KZ1E 3QHPA 2DE0X 1KU0A 2ZCVA 4UVDA 1LI4A 1Y7HA 2WSYB 4MWDA 1TNDA 4N3NA 5KOJB 2J0UA 4XLTA 1Q0ZA 4ZV7A 5JCOA 3EVGA 2GEFA 3DGEC 3RC3A 1TZMA 1N0IA 1YFLA 1H5UA 4AQ7A 1C9KA 1EDZA 4UUOA 3CEMA 4H15A 1Z0KA 4K9NA 2OYRA 5CT8A 3ZKWB 3VKGA 5KOJA 3I3SR 4IJ5A 1EDBA 5CM8B 8AT1A 3NH6A 4LMAA 2GF9A 4JAVC 3TVTA 5KNCA 4L73A 5KYKA 3H11B 1YASA 3DH0A 1IH8A 2X86A 1PQ4A 1U3DA 1J00A 4IUDS 4N3CA 3PX2A 2JPDA 3C4VA 4YBZA 4ZEXA 2PS3A 1FEZA 2GKOA 2VLIA 3HEAA 2OOKA 1UZMA 2W6PA 4R5MA 3L4BC 4E5DA 4WK0B 4AS3A 5JS1A 1SWWA 4II2A 1I30A 2A59A 2X3YA 2DTEA 2ILTA 4G1BA 4ROSA 4J03A 3O91A 3I9V1 1G20B 2XQFA 2XWBF 1F2UB 3EZ7A 3O94A 4G0ZA 4CCAA 4YECA 4RFSB 4L9AA 5MFPA 3D3JA 1XTPA 2CJXA 1XFDA 1EIZA 4RU1A 3IHTA 4ML3A 1FZTA 3HCFA 2PO5A 1YE8A 1YJBA 1Z0FA 3H6HA 5CBPB 1G20A 1XAIA 1G1MA 1CV2A 3C3AA 1QHIA 3E5MA 4RPIA 1J0CA 4UM7A 2C4NA 2ZM5A 3SSNA 1PFYA 4RFSA 4QU9A 1N2EA 3F6BX 3K5IA 5M5BA 3KK0A 3G17A 1FFCA 1KPHA 4BJ3A 1VE7A 2XJ4A 5HCUA 1I4LD 4KRXA 4OGKA 3WWEA 3FFTA 2GHRA 1VZ3A 2Z30A 5CBPA 1JF8A 2FCRA 4A2QA 1H42A 2ABWA 2G0AA 4EYSA 4KUHA 4JL6A 1EG2A 1GPDG 3PUVA 1NTOA 3SDBA 4M1KA 3B1ZA 1E5XA 1Z28A 5A2QA 3KXIA 1Z6AA 3KLBA 5DCLA 3VHRA 4BQQA 4UXIA 3M49A 3QYAA 3P4YA 2WQ7A 1G6HA 1KO7A 4YCDA 1I7NA 3L82B 1K5GA 4DLKA 1XEFA 3H2GA 2F1IA 1F8FA 3N8HA 5FPSA 5JMPA 3CSUA 3KQPA 5ENVA 1T29A 4KN5A 4ZAWA 4V1CI 1GZDA 2EKDA 5HRAA 1VI5A 3AZQA 1IY0A 1UIRA 4L7VA 3UK7A 3L49A 3W6ZA 3M6MD 3C6KA 3OQJA 4YB8A 1WXGA 2VPWA 1XPUA 1N5MA 2X23A 3V55A 1NFRA 1R37A 2IYNA 4KWEA 3AEQA 2GVZC 3ZJ5A 4G0XA 1IAQA 3JXEA 4LRYA 5HJEA 4NV1A 1LV7A 2H4YA 2V03A 4FQ7A 1PJTA 2G9ZA 3OEHA 3VDNB 1UEJA 4DHEA 2PLWA 4MO9A 4DB2A 3PFKA 3LUKA 1W5TA 4JLMA 4PO1A 3HCWA 3GN1A 2IK8A 3W5DA 3SMQA 3G2OA 4UOEA 2Z5FA 1LPOA 1XTTA 2P3SA 1WJGA 2AE1A 2IY9A 5H0IA 4ZYVA 1FCJA 2GK4A 3FTEA 3JQBC 2Y71A 4BC1A 3LOQA 4L28A 4BKOA 2FH5B 1JPUA 3PVZA 2Y76A 4Z2AA 1RJWA 4JSRA 3I2IA 3ILVA 4QDUA 2IUFA 2XAAA 2WWIA 4BO8A 2W6QA 1DOZA 1GA6A 2FRVA 5AW4A 3OOEA 4B0OA 2JCSA 3Q9NA 3RTCA 3V6LA 3N28A 2QXTA 4D43A 4MDYA 1NDQA 4TT3A 2JKZA 4FMDF 2X6TA 1ISGA 3ZDQA 4DNQA 3WAJA 1NAIA 1QP8A 1DAMA 3AKYA 3IXMA 5SYAA 4UBKA 1T24A 2BMJA 5DM70 4JS0A 2H9AA 2WU1A 4Z0PA 3SXJA 5AVTA 2YTZA 4OUDB 2WAOA 4JROA 3FYDA 1Z4NA 3QVXA 4R0VA 1QHNA 1RLIA 4MQBA 3SQOA 1DAFA 1GCUA 2A9VA 1VYHA 1RQRA 2WY2D 3U9SA 2F2TA 3B53X 4QARA 3DEZA 2DBZA 2P1ZA 2P79A 4KGDA 3AR4A 1AKMA 2PGJA 4J0IA 4RUKA 5GV7A 4QREA 1AF4A 1WZNA 3ZZUA 4DYHA 2VBFA 3ETEA 2UUAB 4K0KB 1LGYA 2GZ3A 4GI5A 3LXRA 4BVGA 2V4ZA 1E2UA 3WIEA 5C7OO 1M1YB 3O0DA 1TJ3A 2R00C 3E1KA 5D1NA 2AEFA 2FW0A 3UA4A 5JH7F 5C51B 1PBTA 2DHRA 5EZYB 1GFWA 1JDPA 1FRFS 5ILQA 3DHWC 4X1YB 3EVAA 3GDFA 1WPXA 2NU9B 1SCDA 5K0FA 1CJBA 1M1YA 2R85A 3E0QA 4D9IA 4BNTA 4D5EA 1U80A 2UZ0A 1MCZA 1VB3A 1LNZA 1QHYA 3WK6A 1H8EA 1G3UA 2ONYA 3GL9A 1WLYA 3PC8C 3W2TA 3ZDEA 1VKNA 4X1YA 1B7GO 2YXLA 4Z5XA 4XX1A 4PYIA 5BR1A 2H17A 1FXWA 5IYZB 2Q0XA 1T3TA 2FQ1A 2F3SA 4ZT3A 1SBNE 2J67A 1V6CA 2QMEA 3HA3A 2ADOA 2PMFA 1O57A 1XP5A 4DLUA 2A94A 3R77A 3G2HA 5CA0B 5KOYA 5E7QA 1NRXA 5FI1B 4HY3A 4HNGA 5IRCD 1PU2A 3G2LA 3KB6A 4PC6A 5A62A 5LN1A 2VG8A 2ZAIA 3QVKA 4JJKA 2NXCA 3JY6A 2NZYA 5KJCA 1OB2A 5DGCA 1ODCA 3VYSB 1OLSB 5FFNA 1TM1E 4MGIR 2JIBA 1KI2A 5CA0A 3AJRA 5CDYA 3QEKA 2B20A 2WJJA 1I3LA 2B1JA 2J30A 4MV6A 2DPXA 1Z82A 1U6KA 4RTJA 1QQBA 3ANTA 3LLCA 2Q2QA 3I30X 4H7PA 4W5NA 3ECCA 1JG6A 4OQQA 4DLPA 1SKBA 4AJHA 2YHBA 4K88A 2EF0A 2Q6VA 4M1ZA 1AGNA 5ALVA 4RCYA 4J3NA 1I2BA 3LUFA 3OHSX 4GEKA 4PPQA 1QU3A 3ZHZA 3ND9A 2C2HA 4LISA 3Q3CA 2XYVA 1T2DA 1QG2A 1OILA 1PT6A 1Y0BA 1CQIA 4RH3A 5T5QA 3A04A 5HBRA 2PM8A 2JCVA 3STXA 1E1YA 1RABA 5JS2A 3WLMA 4IZIA 4E4YA 3ONFA 5KNDH 3FNRA 2HNKA 3VTFA 3Q6IA 3FNIA 2XMSA 4LBWA 3UXMA 2DWQA 3L4BA 4OIFA 2B7CA 2F9FA 1DMSA 1LLUA 2NAPA 2YY5A 4GT1A 4HSGA 5CR9A 3PX3A 3NBMA 4N7RA 4KUEA 2OECA 3SZLA 4GX0A 4TWIA 3H2SA 1IN5A 1YIOA 3NTXA 4M0KA 1X8KA 1JHVA 4DQLA 1ZI8A 4RY0A 3THOA 1Q17A 2QD2A 1C2TA 1Y3DE 2PT6A 2RK3A 4EY7A 1NBHA 3T61A 3VXKA 4NCJA 1BGWA 1TCUA 4IGFA 2JCXA 2YL2A 1G66A 2G7MC 1VL6A 2OBFA 3MWLA 1UJ2A 1QAQA 2VTDA 4MVJH 1UBGA 4MHOA 2OV8A 2JFHA 3UXHA 2C88A 2HHCA 3GWGA 3LQ2A 5DNAA 3K96A 2MYPA 3ORFA 4E94A 1K7SN 2IP4A 4HAXA 2MYNA 2A9RA 4U8HA 1P6UA 4KACA 3T7JA 3HS3A 3T3NA 4UEKA 4EW3A 1HWYA 3X1XA 4J7CA 2V98A 4BZWA 1M0WA 4FMCF 4R16A 2PCLA 1E0KA 2VH2A 4KOEC 2XMZA 1OI4A 3ONWA 3IDSA 1JEDA 4K05A 4EGAA 3RSSA 2WBLC 3PKJA 5FPQA 1M0TA 3K0SA 2E55A 3HJRA 4CKEB 5BPHA 1WIWA 4OB8A 1KIMA 3M2TA 5COQA 2FPIB 5LP1A 3WBJA 3GUUA 2FSPA 1OH6A 1I3OA 1W0KA 2VLBA 5EQTA 3P2YA 1M9NA 2LP4Y 3A6LA 3OZBA 1QHXA 4FPXA 1IN1A 3BZBA 1JH8A 4CKEA 1U8XX 4LFCB 5K5EA 1UBCA 3AUXA 3WIUA 2X0EA 3SBOA 3ZHSA 4JT2A 2RI6A 3AJ8A 1T5BA 2FPIA 5ECYA 3I64A 3UT6A 3ZDYB 1K89A 2CLLB 2PGAA 3I9V6 2X0IA 2Q5HA 5HILA 1RQ7A 2B5VA 1GPYA 4IL5A 2O7NA 5KUTA 3BCRA 3EOZA 6NULA 3JVUA 3JQBA 5FOTA 2X8AA 3FVRA 1RRPA 3N70A 1ACJA 1QP4A 3LRPA 4UBLA 1OFIA 1IY2A 1IOVA 2XUKA 4I5IA 1MVNA 4NZZA 1XJ5A 4CMKA 3D4LA 3ENQA 3NDPA 2GPNA 4OP2A 4PLHA 2KW5A 1G8GA 1UKBA 3WNQA 4A0FA 4KQJA 4WBNF 2SECE 2ZRKA 4Q7QA 5KWIA 1HQCA 1K7XB 1D7OA 1XQ1A 2PA3A 2ZR8A 3K7EA 3L0OA 3PF8A 1ESEA 4IHKA 2IBTA 3CLRC 1YO6A 3GFBA 1OLUB 4OHXA 3DE7X 1FOEB 2OFWA 3QX9A 3NHFA 3QQPA 2ZJ0A 1P7VA 5B1YA 2PGLA 3U4DA 3O4IA 3FTPA 2GASA 2GVDC 1VLQA 1RP7A 3QFSA 1V9CA 4WLOA 1XTRA 5DM1A 1L5HA 2I54A 3VOBA 4MTCA 1N0WA 3SYMA 2RGRA 2IU3A 4CI9A 4G01B 1OLUA 1QVZA 5EIBC 3QEOA 4DPLA 1FYDA 1PZFA 2VWQA 3A7EA 2WM3A 3GJRA 1YB6A 4KH0A 1BVHA 1KL7A 1RWVA 1CSEE 1SJ9A 4DIBA 3K16A 2I67A 3J81k 4GVPA 2R87A 4HEA1 3ANSA 1EK6A 1O6ZA 5KYWB 1EESA 4GX1A 3ESBA 3PPIA 3UCXA 5BT9A 1AQJA 2CXPA 1UAGA 4GLFA 2G28A 4HQ0A 4YT2A 4LN1A 2R00A 3BWMA 2Q49A 4RETA 4D0SA 3F2VA 4XYGA 3OQOA 1BMFD 1THZA 1E9EA 4URFA 3W05A 4QGHA 2APJA 1K9SA 4TWZA 5EYPA 5KYWA 3JTMA 1U11A 4B3SB 2F8TA 5LZ2A 3JR3A 4HYYA 2WYVA 2OAEA 4R1MA 3E22B 4D5GA 4O2LA 1JE1A 5J23A 3W2HA 4QQ8A 3SQXA 4PO8A 4PQEA 1EK0A 1K92A 3DV0B 4YJ2B 3LCVB 3GLFE 5K0GA 1YA4A 3PC8A 4ESHA 2GJ4A 2OSBA 5IXJA 1L5WA 1XJWA 4OBWA 4RQUA 2HZ7A 2F1JA 3E22A 4WT7A 3WISA 4XQGA 5D2CA 1EVLA 2XB9A 3C98A 2ZJ1A 3OJ0A 3GZNA 4IJ6A 4N48A 3DV0A 3I42A 4PZAA 1AO0A 3CG0A 1U0LA 1DIOB 2PSEA 3D0QA 4L8VA 5C3UA 2KX7A 2QLJA 2JFNA 3D3KA 4I1YA 4QBKA 4XRRA 1QO9A 4EATA 2G04A 2LDXA 4H4EA 1DT5A 2ZDHA 3OWXA 2O0JA 2PMDA 4OQFA 1XRSB 3PQ3A 4GPIB 1VG9B 5GOTA 4BNVA 4DY6A 5KYNA 1GSHA 5LFAA 3AONB 4D9FA 3F7OA 3SAJA 2YVLA 4OI4A 5AJUA 5KEIA 1ZQ1A 3JD4A 4OQDA 5I7UA 4MVJF 3KFVA 4BGDA 3E8SA 1QZUA 4RJIA 2A9QA 1UK6A 4UFNA 2WHRA 4ZV4A 1RWOA 3R6DA 3EEYA 4X41A 1EE9A 4XXHA 1RKVA 3HCOA 4R1NA 3VR0A 2ZUWA 5KHOC 5GZ1A 2DCUA 4J0FA 2H7VA 1NJFA 3ED1A 4KXLA 1XRRA 1ONBA 2W2XA 2CXNA 5K8IA 2DXIA 1NI3A 4RD4A 4WJLA 1PZEA 1FRQA 4UOZA 2C9MA 2WILA 5LSAA 3U3OA 2RKWA 4O63O 1N1MA 4QUJA 1QRSA 1U04A 3IUNA 3LCCA 2IWHA 2C03A 2PXCA 3ZW7A 1TO2E 5F3DA 2RHGB 4HGPA 2H2IA 3COWA 1RSZA 4WH0A 3WGTA 1J0BA 1NV8A 3TM4A 1PYGA 2XE6A 3P1JA 7MHTA 4LOAA 1YMUA 1LD3A 2PX8A 2VJOA 3FYUB 3EUAA 3C3KA 4PAQA 1JKMA 2DHDA 4YRRA 4NABA 4BQSA 1SBZA 1IJBA 3EIFA 2XGGA 4P5DA 3SD7A 4D9GA 4ZMSA 3AL0C 2A84A 1UT6A 1JDSA 3PHHA 1AHIA 2QE7A 3A9SA 1VLLA 5GMOA 2EBUA 2OYCA 4C2AA 3K70C 2ZUDA 1R6UA 1W25A 2IYXA 4A1OA 2H2WA 1SCKA 4EG5A 2AFRA 4B3IA 4YCAA 3EGXA 3M9LA 1EWVA 4LQ4A 5FBZA 1QYRA 1NVXQ 1RYMA 2B37A 2VJCA 1KJIA 2YYZA 5BN4B 3I2KA 3B85A 3PJGA 4PZPA 1T35A 2DH6A 2QJRA 2WTEA 3HKEB 2C97A 4NECA 1PW7A 5KJ1A 5LPNA 4DV6B 2WB4A 3BKWA 1WX1A 2J45A 2C2YA 3HJHA 1KJNA 2OGUA 2WWTA 2GX6A 1CUUA 5JDIC 2VHVA 1ISMA 3KZVA 4QTXA 5BN4A 3QFRA 3KQQA 4NR0A 2O7SA 1Z6XA 4TV8B 4N9QA 2PMBA 2O8DA 4UJ5A 4NY1A 1C9NA 3N87A 4WZBA 3HBJA 2NT4A 2O14A 2QTLA 1KNXA 4BVEA 4ADSG 2W83A 4M36A 1AGXA 3C48A 1K98A 1CY8A 3N3AC 3VAAA 3Q3IA 3EGCA 5C2JB 4DDMA 3HVIA 4KWIA 3LWZA 5KTNA 3LLUA 1GL7A 3OPYB 4OQLA 2ZT7A 1UADA 4LNHA 1PGOA 4EG8A 1YB4A 1AV6A 4HV4A 4JI4B 3AHGA 4XX0B 4A73A 2VK4A 1U8ZA 3L7DA 4N47A 3GCWA 1KR2A 3FYCA 3AJ9A 3ZQUA 1JI0A 1LSSA 3OPYA 2BMDA 1A7JA 3LWDA 4ZT2A 4PN7A 4Q4HB 2CF5A 5DCUA 1GUBA 4XX0A 4NMWA 1KO8A 1XDDA 4ZO4A 4RQTA 2XWJI 4Y2UA 4YCNA 2QRLA 2PK3A 1P77A 3WNDA 3HFGA 3WGVA 2PSHA 3D43A 3BBPA 2DLDA 1GRVA 4Q4HA 3SBXA 4EHNA 4MQFB 5L53A 2R8ZA 3TIXB 4DR4B 1VBNA 4RGBA 3IH5A 3RTDA 3G9TA 3NC0C 5C8DA 5AI4A 5HFNA 2JCBA 3AUUA 2CB0A 3PA8A 3KTDA 1T5LA 4NV3A 4P9NA 3MAGA 1TLTA 1E4OA 5DIFA 2HREA 5FCDA 4WV3A 4MQFA 2XVAA 2RIPA 1IB6A 2ZUBA 3QBVA 4M7OA 4BJ6A 3IAM1 5KU1A 5M2QA 3QVTA 2DWCA 3ZDZB 1CUZA 1EVEA 1ZK1A 2ZQYA 1A9XB 4JXKA 5JPCA 5H59A 2BH2A 1UXGA 5J4KA 2Y1WA 4KQWA 3T7AA 1TDJA 1FS6A 2EKQA 4HLDA 4ZGGA 4TTSA 4GSLA 3GFQA 1P2BA 3SM3A 5A4JA 4WGGA 3EXHC 4FUTA 1I3CA 4ZC1A 5CXQA 1A9XA 1CRWG 1HXHA 1N8SA 3HP4A 3C8HA 4K8OA 1ZISA 4E6PA 3RGGA 4JDPA 3GAMA 1SXJB 3UKDA 2XADA 2VUUA 4Q9JA 3PTLA 3O8CA 2AYXA 3OEYA 1MF7A 2GJ9A 2QQ5A 2WHPA 4G1EB 1JT2A 4X91A 4QULA 4CKXA 4D80A 2A92A 3ETCA 2W6JD 3H2BA 1N6OA 5CX4A 2FN8A 4B46A 1JEEA 3FPGA 2P9YA 4NAUA 2B5WA 4NYMQ 3TMYA 2OV3A 1SXJA 3KQWA 3WGQA 1WSBA 1ZC3A 3GRRA 4OG2A 4DBLE 3OO1A 1LS1A 5IKPA 1H4SA 4L51A 5I9NA 1P1FA 1XMIA 4WY2A 2V3VA 2Z95A 4IINA 1FJHA 3DAOA 1XU7A 2X22A 4LYHA 2JH8A 2WV7A 1KFBB 3LSTA 4BBJA 5FEUA 5JJKA 5CNMA 1ILWA 1YRAA 4IH9A 2QRPA 1IBCA 3DLHA 5ADVA 2WD7B 4IKOA 3LVRE 3ZZ0A 4ECAA 4EYEA 1LB1B 2ZG6A 4GICA 1C0LA 3L7IA 4FDAA 4EUEA 4BCDA 4XGIA 4JI7B 5CITA 4BLQA 4F4FA 1NQ5A 2XKAA 3S2YA 3GLRA 4ENSA 1LZLA 2OAQ1 2ZZNA 5K3CA 2ZUSA 1V0JA 4V0QA 4IILA 5E95A 1TIKA 2WYOA 3IT3A 4PANA 5GQSA 5G0WA 1IDOA 4HEA6 3WFJA 4DA0A 2BN4A 4GYWA 4QRDA 1DAPA 1YCHA 4RM2A 3HCDA 1Z6GA 3LZDA 5DTRA 2LKCA 2PEYA 1PHPA 4JSTA 2P9CA 2QHXA 1W4RA 2D7JA 2OWEA 2HF7A 5G53C 4C04A 4OLHA 3A3YA 1NKVA 2HPVA 2AOWA 5CVVA 5JY1A 4C7OB 5A3SA 2XCTB 2IS6A 3C3CA 1RPAA 1JPVA 4TLBA 1L4EA 1XIVA 1OTHA 3IRVA 4WK4B 5AM5A 4EELA 2G72A 2ZT6A 1Z4IA 5DYYA 5K4AA 5F1KA 4DMFA 2VDRB 3LHIA 4IIVA 2C0CA 4C7OA 3IODA 1X3LA 2VBIA 4OMFG 4AROA 4DDUA 2NX2A 5JV5A 2QG6A 1DEXA 1L7PA 3D3WB 4Y9UA 1T9KA 4B6OA 1I24A 1VCMA 1VI2A 4YEDA 2QTHA 2BFDB 3NR2A 1T10A 4LYDA 1EX7A 1JNYA 1NQWA 1C2YA 5L3VA 2XHEA 2Z8ZA 1RXCA 1WHTA 4R8MA 2I34A 3O8DA 1RXVA 1ZNWA 3G82C 1WKBA 3NVDA 3ZV5A 1C0EA 1CTQA 2F7SA 2YHSA 4C5CA 2FRDC 1AE1A 4BP3A 4ND8B 2F55A 3RT9A 2ORVA 2XECA 4LVNA 4LMBA 4QUIA 3TRHA 3Q3EA 2YVAA 3U1VA 2W48A 1ZEMA 3EQZA 3IBTA 3PB3A 4EJ0A 5EKDA 2J3QA 5I9IA 4W9NC 2FG7C 5JDIA 3O75A 1U6JA 3FHTA 5H7XA 3V1KA 5JR3A 3SS7X 4ND8A 3CKYA 3PE4A 1WTCA 4FQ8A 4NCIA 3ZUGA 3ZV6A 5G1NA 1J0EA 1H1LB 3JQ7B 4EB0A 1JWLA 3PX7A 5F7ZA 4FI3F 1DAIA 3TOCA 4C6RA 3GUZA 4UUAA 4S05A 1VBFA 1N0HA 3K15A 3NJRA 2P5YA 1CPYA 4ZA2A 3VZQA 1ZU4A 3QE2A 1EK5A 1IB0A 5DBIA 4G8CA 4JH0A 5HHTA 3LBNA 1U3FA 5BNTA 5KYXB 1ZJYA 3IMCA 3LPCA 3NO4A 1YR7A 2I99A 3TF5A 2H63A 3JQ7A 5GZ6A 2VL7A 2ZJ5A 3IELA 3L77A 2YJ3A 4BNYA 3PPYA 1HF3A 2H48A 1ZVMA 2WWFA 4Q01A 3W5VA 4ZI7A 5GJCA 4KMRA 3RC1A 4NENB 5EE0A 5IVDA 3VZSA 3OIYA 1N5KA 4BVAA 3ZEIA 5F51A 1P4AA 4LZJA 4HDMB 2FQXA 2L2QA 4F2HA 3A6JA 2GH1A 1J2UA 2C3YA 4NENA 2Q50A 5F1PA 2IIQA 2ZW9A 3E1GA 4C89A 4CHGA 5GADl 3AM1A 3P5SA 5E6RB 3IDZA 3ZNQA 4HDMA 2XOKD 5EP2A 3OP1A 4Y2VA 1WVMA 1CVRA 5DM60 4D46A 4UHBA 5GONA 1NG9A 2IE0A 3WRVA 2QM7A 4W5WA 1UPCA 1A27A 2DYKA 3JSXA 1Y1RA 5DW3A 1E66A 1XTKA 2RK6A 4NE2A 1JHPA 5D3ZA 3WMWA 4CV3A 2UYCA 5E6RA 1SOAA 2Z2ZA 1WU7A 3LCRA 2P40A 5C80A 1JE0A 3L0SA 4R71A 4RZUA 3BRWA 3L9XA 3RU3A 3QKIA 4ZDIA 1UZNA 1SUSA 2X0KA 1B2LA 2Q6IA 1GVHA 2IPMA 3RIXA 3TJRA 4F4DA 3PBKA 5L3QA 1T2EA 2B35A 2Y99A 3JQ9C 4E5VA 3NALA 5K8VA 3WLIA 2HU5A 5GGYA 2YWRA 1ZS9A 2EX1A 3UOGA 4CGYA 4A10A 3EXHB 4EW6A 3OKCA 4QKQA 3EASA 2ARKA 3LGAA 4KQXA 1GKIA 4R1UA 4XAQA 4D92A 4HNQA 3K1YA 1AK1A 2GXSA 1SQ5A 2AE2A 4DQDA 1JG2A 1FLAA 1JR3A 4YS6A 2W8ZA 4MYUA 1XVAA 1GDHA 5JXWA 4AY3A 1XRJA 2UVPB 3JTEA 4R40A 3EXHA 1JQDA 1CUAA 2GD2A 2ZUTA 2AEMA 2EP8A 4BFTA 2R8OA 1PNRA 4XW2A 4A2PA 1F60A 2OY0A 1EHYA 1JJBA 5IC5A 1WSDA 2CXXA 2ZWIA 1E1KA 2OR3A 5CNKA 4F4HA 1NJSA 2UVPA 2NN3C 4LSWA 5FOWA 3C5CA 4A15A 2FK8A 2QW0X 5BY2A 2BISA 5C1OA 2GA9A 2WP0A 3NM6B 3L8YA 2E87A 3LECA 4E5YA 1DC7A 4JMPA 1T9BA 1FYXA 2CLFB 2QK4A 3VR3A 1E0SA 2FDRA 5DT9A 1V5WA 4DTIA 3UGQA 2C5LA 4LJ6A 5IKXA 3ZOKA 3DYVA 5IAAA 4DYVA 4RTLA 1CULC 4D26A 4FHZA 4BGEA 4EJMA 3LNCA 13PKA 2GGSA 2M6RA 1P7ZA 2G6TA 2YASA 1XK7A 4Y2SA 4O08A 1D0SA 3ZCUA 4BUCA 5JPIA 5JRZA 2P2ZA 4Q1AA 2BFFB 1OI7A 2QW1A 2DR0A 2PLRA 3JYHA 3PV0A 4J6FA 4BL5A 2GM4A 2ZRAA 3TTSA 2W2KB 5FO0A 2FWPA 3DA8A 2R1TA 1EH5A 2JCGA 4LZLA 2QMZA 4OYRA 4AP5A 3CS3A 1XU4A 5EJ4A 1ISJA 1E62A 1MDBA 3AI7A 2BGMA 1Z5OA 4LIPD 2CVHA 5LA6B 1FP2A 3WKAA 3RG2A 2BFFA 1DX6A 2E4WA 2QM8A 4Q03A 3WS7A 2YNMC 4RD6A 3CF4G 1CUWA 2C54A 2C5AA 2EC5A 2W2KA 3C3DA 4NZOA 4X3PA 4Z2YA 3CVVA 1NQTA 2AEJA 4UAGA 5IZCC 3GOQA 3UHPA 3UHJA 1G5IA 3UJ8A 2BELA 5LA6A 4F06A 4YMGA 1GSOA 3ENZA 3GG2A 4QUBA 4AO7A 4ER6A 2BYTA 5HIAA 3OLYA 3U3KA 4BLVA 3OE7A 4X8OA 4RZIA 2HO4A 3HKBA 2O7VA 1T1EA 3KOXA 3S81A 2I7DA 3L0IB 4OYLA 3NTQA 3M4ZA 3LO5A 4IO0A 1TGYA 2PZJA 3GDWA 2X1LA 3P94A 4EDHA 1GZVA 2Q1WA 2J0QA 3D7KA 3P9CA 4PPGA 1PNVA 3QITA 1JEQB 1CCWA 1E3WB 1Q0LA 2P7IA 4E2ZA 1JKJB 1C41A 2BV3A 1EK2A 2CE2X 3D0OA 1F1BA 4UTXA 4LSMA 3FOEC 1UK9A 4GL2A 1ZM4A 3VNUA 2EKZA 5CW2A 3GCGA 3LPNA 4W6QA 4WN3A 4F8YA 1JEQA 1RXIA 1EBUA 2FWRA 5EFOA 4MAAA 5HKKD 1W85B 1JKJA 3ZGOA 4CXMA 1ZGGA 4GRIA 3LTNC 1IK4A 1ZMTA 4AG6A 1RJDA 3TNYA 2VQ3A 1PJAA 3V4LA 3D64A 4GR5A 1CUXA 3SVZA 4B5KA 1WS6A 5ADUS 4N7JA 3KQLA 3IAAA 2Y4OA 2Q8NA 1MB2A 4KH1A 4UHEA 2ZSJA 1U3WA 2FRDA 3NYRA 3O92A 2NZUG 4KI0A 1W85A 5COBA 4LF6B 3UIEA 3LOPA 1X8JA 2WMOB 4OY3A 1WG8A 2FPGB 3P9PA 1G5HA 3GMIA 4Q16A 3VA7A 4B4WA 1F2TB 4PINA 3F4BA 1W1UA 1WEKA 1JIJA 3ILXA 4Q19A 4W9NA 2GLTA 3KJEA 1YAHA 1W5EA 4FUQA 4C88A 5DM2A 6REQB 4X61A 1DAOA 1SZCA 1PR2A 3P8ZA 5FLEX 1Y9JA 4CTKA 1JJAA 1XT6A 5SYMA 2ZJ6A 3VSBA 1WZIA 4AJEA 5KPDA 4Q5IA 4ER3A 3DLBA 1BA2A 2H7CA 2IL1A 3DFFA 3DDSA 4YAFA 3KU1A 5IAKA 3MGCA 3WDKA 4DMKA 4DSAA 6REQA 2BR3A 3QKRA 2HPAA 4L50A 1Z5VA 1SNYA 2BGNA 3HJUA 3MEQA 4IAOA 1PJCA 3WO1A 1V95A 4IIXA 5DW0A 4BMDA 1WQ1R 3QNUA 1UPAA 4BC0A 1RNLA 3AR5A 5AD1A 4V0NA 4M1QA 4JI1B 1O0SA 3AHIA 2VTEA 4MR9B 1HDRA 3E70C 2AKYA 3S2ZA 4B0PA 2X5KO 2Y05A 3NONA 3HO1A 1QWOA 3F46A 1U5BA 3EEIA 3O3OB 1QE5A 2EJVA 1L4BA 3A1VA 4NJEB 4RCVA 5SY6A 2IUUA 1XL0A 1Q19A 3RM3A 1EWRA 1GAXA 4FYJA 1EFVA 3B9BA 2B94A 4CI0B 4MR9A 2Y77A 3O47A 1IEQA 1JZTA 1U7TA 1Q2XA 1R6DA 2W4MA 2E49A 2XPCA 3E15A 4MJ3A 4ZAGA 1NSTA 4EUNA 2FJ0A 3TVYA 4NJEA 5BXQC 2Q6KA 5HUHA 1YU9A 3ZGNA 3IVMA 2ZR7A 4HQFA 3T3EA 1K68A 2JW5A 1J42A 4GZLA 4L27A 3ZHTA 5FH9A 1IZYA 4FOLA 3O38A 1ZSNA 3ZU3A 3NHZA 2AUTA 3RUDA 4C2UA 2GZHA 5LQRA 4CQNA 4C6HA 4YAUA 1ODKA 4BNNA 4BFSA 4WXPA 3WYAA 3OLCX 4YT4A 2YVQA 1F6DA 3LIPA 1D09A 4Y1GA 1OKKA 1CUEA 1IG0A 3BH6A 3QLJA 1BCRB 1GYRA 1I1OA 1TF5A 4IKPA 5ALPA 4MMXB 2UXBB 1E0AA 4KX5A 2QS9A 1T4BA 3JQ9A 3RVKA 4W7IA 3BGVA 1D3AA 3K8YA 3KYCA 1YH3A 4C6TB 4NAVA 1YS9A 1PV4A 3UV3A 5A0FA 4UEWA 3REGA 4IJKA 4FZ5A 2WAMA 3TTXA 1BCRA 3NNNA 3FWKA 3PNQA 1YRHA 3EMVA 4KZPA 4AYTA 2D3WA 1IXZA 1X9GA 4GXRA 4XIGS 5CEEA 5M7EA 3TLXA 4RZSA 1F6WA 3V2GA 1R00A 1ZI6A 4C6TA 5ICMA 1ULSA 4JQOA 4KE9A 3UB3A 3DMTC 2QVCA 2VF8A 3DJFA 1ESCA 1XEWX 3EVFA 1CETA 1M5TA 3L1IA 3QU2A 3WWOA 1ZUD1 3H1AA 1YOBA 3OM9A 4X8HA 2XUZA 1XKXA 3ZI4A 4ZTBA 4M6WB 3KTAB 4NFHA 4AG3A 2QD1A 3THRA 4QBTA 2PIAA 4YV0A 2PWYA 4M9RA 1TIBA 3OT1B 2WE7A 3O31A 3ODGA 1NJ1A 1P75A 1LKZA 2QI9F 3FCUB 2XE8A 2FE4A 3PXAA 2ECPA 4M6WA 3UAZA 1OB5A 2LW7A 3UPDA 2Q5OA 1TUIA 2AI3A 2YMMA 1IQPA 3JD0A 4MZDA 3ZJTA 4D0NA 2AOTB 2GESA 1MHTA 1TZ2A 2HBQA 2HCJB 4TL8A 2BFCA 5AHKA 4XOIA 2V3CC 1U31A 1UOOA 3UJCA 5EE1A 2PUVA 3PGLA 4HCJA 3HYRA 1W30A 5AW8A 4UMVA 6ABPA 1DAHA 1M8FA 3MS2A 3KTOA 1GZHB 2ZRFA 3DW1X 3HO6A 3R3UA 3FIJA 5FTMA 2AOTA 2GN1A 4K9MA 3HYCA 3CLKA 5F4BA 1YJQA 5EUBA 3FSRA 5CEFA 4JJ6A 3K35A 4ISBA 3RVQA 3THSA 2I6QA 1G8SA 2LRHA 1R5OA 1JG1A 1YQXA 2XNCA 1M54A 3OY7A 2V0NA 4CMIA 4UTOA 1BS1A 1QHEA 2DUJA 2LTAA 4RA6A 3RI3A 2YNMA 1SZJG 5SZHB 4MEBA 1E5LA 3MRTA 3R0JA 5C52B 5KNLA 1TW2A 3WLTA 5JJIA 3OWHA 5IZCA 4QZVA 1F8UA 4REQB 1B16A 4U2GA 3L0ZA 2QVYX 4C0AC 4EI9A 5K0TA 3ICQB 1U8YA 1IRIA 4ERNA 2VP5A 5LYJB 2GARA 1TUEA 3DHNA 4IVRA 2CV0A 1CY0A 3R1IA 3NDJA 2ISCA 1O9HA 1UOEA 2PAAA 3IV9A 3PFCA 2EKBA 2CL6X 4DM4A 1YDHA 4PLYA 1VDMA 1QB8A 1ZYUA 4V0RA 1XTBA 3P9ZA 4REQA 1OI2A 4OQYA 2R8YA 3L4JA 3QOFA 5LYJA 1JFLA 1YQUA 1ZIOA 1JKXA 4FSHA 4BFUA 4AW9A 4KXFB 2FVXA 1BDIA 3DOEA 4P3KA 5JQGF 1BOOA 1USIA 4JUCA 2BR5A 4NPHA 8LDHA 5EMHA 2AIRA 3HSSA 3FOAA 1WY7A 3CINA 3L7LA 3IT0A 4TXMA 3RHZA 3U4AA 3WIOA 1KY5A 5BR4A 5F7JA 3GRAA 4WQMA 3VYWA 4P1ZA 3RT7A 3Q3VA 3R5SA 4F4UA 4HLUC 5JWRA 4OK5A 4GUAA 2VUTA 1QDLB 2FUKA 1QYWA 2RGBA 2IOQA 4IV5A 2WMYA 1SUIA 3B48A 3U7EB 4QO7A 3BIJA 2YJ5A 2F1KA 3PUXA 4D9NA 2CF6A 3ADDA 3OEED 2Q3EA 1FNMA 3CH5A 1K3FA 5CG1A 4HNTA 2C7RA 3FWHA 1R5BA 5IFKA 2NVUB 4YUVA 5AI6A 4QEZA 1FVFA 5AW6A 1RWBA 1YR8A 4RGVA 2VKQA 4RMIA 4TS4A 3UGTA 1E5VA 1UJMA 4HNUA 2BEJA 3O9ZA 2ORED 4JQZA 3ZGVA 3RD5A 1XVIA 3SSMA 1S3SA 5KTRA 5FNVF 1KEZA 4CW7A 3UN1A 3CX4A 2ZIZA 2ZJYA 4ZDWA 5J5VA 2XD4A 4UPVA 2X4GA 3CT6A 2VCHA 4OB7A 2JLWA 4IH1A 2G9VA 3SP1A 1UBJS 3LY7A 1JEAA 3QVSA 1VMAA 3AUFA 3UJDA 4ALKA 2WIFA 5EJ7A 4ZCQA 5E3HA 2WNIA 1BDMA 3NC1C 3CW9A 1QZ3A 2HY7A 2L17A 3PTZA 2BEUB 3L79A 4K87A 3FPBA 5JH7B 2NU8A 2O1WA 1KYQA 4L5IA 2FX3A 1NXQA 1RQNA 3QMWA 5CA1B 1A82A 4O4IF 1ZVVA 2P9FA 2ZIVB 3PNLA 3FLBA 3OJEA 5ALHA 4BP9A 1VSQA 2EFDB 1A77A 2ZSFA 3EHDA 4FHFA 3UPTA 2HK9A 3J80A 3PC7A 4DLRA 3OE4A 3H2ZA 1KHTA 2PUWA 3C16C 3HL0A 3R24A 1VGRA 3V7YA 3N6XA 3DEKA 3ESZA 2ZBUA 4ZYYA 3BGOS 3KLNA 4D9CA 1CUFA 3T4UA 4B6SA 5CA1A 3EPKA 1ZI9A 3UV6A 1BFKA 5JXJA 1JDBB 1NA5A 5BR8B 3IURA 4URVR 4S12A 1RI4A 2R68A 2P6RA 1FLNA 4MAMA 1DQPA 4ME6A 4PAWA 1FDSA 2WF5A 3EGDB 1NJ8A 3E9MA 4I55A 2BKXA 3SI7A 3GR6A 1JEJA 1N5JA 2HLPA 2N1BA 2FOLA 5EFZA 2J3MA 1EX9A 4MITA 1JDJA 2PZMA 4A03A 5IHXA 1K06A 3PNBA 1XCLA 3O7WA