1ZJYA

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
251
structure length
251
Chain Sequence
b'SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Lactobacillus brevis
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
total genus 102
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zjyA00
1I32A 4PIVA 1J49A 2HK9A 4S1VA 1MGOA 3JQBA 1L7EA 3EW7A 5A9RA 5KJEA 1T2CA 3CINA 4AJPA 1EQ2A 5HTOA 1PJLA 3EUWA 4QFCA 4B8ZA 2W8ZA 3W4JA 1B2LA 4NJMB 2NLOA 4D42A 1DIAA 4J4HA 3AU9A 4R68A 3PLRA 2ZJ1A 3PJFA 3RUHA 4B8WA 1YBVA 1GADO 2Q99A 3UVEA 1UXHA 3PWSA 1XU9A 4ITUA 4Q3DA 4XYEA 3D4OA 3ADOA 3RUIA 5IF3A 3D0OA 3EZYA 1JAXA 3FWZA 4NFSA 3W8EA 4AJLA 2AW5A 6ADHA 2F00A 3NAQA 4KUHA 4C7JA 2YDXA 1N8KA 3VDQA 2UDPA 1UJMA 3JQAB 3ASUA 3QQPA 3IP3A 3UN1A 2EJVA 3I9JA 4ALKA 1T2FA 1NVTA 1VL8A 5JLAA 1E1NA 1BG6A 1PJQA 2I66A 3GN1A 5A9SA 3W1VA 1J4AA 1Y6JA 3LT1A 4J1SA 3DBRA 3VZQA 1YXMA 1IY8A 4A26A 3GGGA 1NYTA 3W4IA 4RF3A 3FNGA 4Q3NA 4Y67A 3ZN2A 3C8MA 3GG2A 1HDOA 1WP4A 1LLCA 5CHEA 3VVBA 1BWSA 5CG1A 1Y8RB 1YQXA 4FFMA 1GEGA 3C7AA 3JQ7B 1TXGA 3PDJA 4QX6A 4BO6A 1HE2A 3TZQA 4YXFA 3ONEA 1NP3A 4Q3AA 4UVEA 1UXKA 3H5NA 4IDDA 4UUNA 2NU7A 4M86A 4Y6RA 2P5UA 4FBGA 4R41A 3K9QO 4LCEA 5CEJA 3C85A 1B14A 4L8VA 4BNZA 5B1YA 3WTCA 2IXBA 4BGUA 3X2EA 4D3DA 4BNNA 4GSLA 4OQZA 2WD7A 4QT0A 1SC6A 2DPGA 1HDRA 3MJVA 3GRPA 2G1UA 4CJXA 3GN2A 5TS3A 3VOSA 2YDYA 3H8VA 4CM6A 3ZHZA 3DB2A 1E77A 4BO0A 5CP8A 3LSYA 1G6KA 2W98A 3E8XA 4BB5A 3U62A 2NVUA 2RAFA 4H7PA 4OSOA 3TL3A 4II2A 1DAOA 2GGSA 5G0VA 1NR7A 1E3WB 1SBYA 3D4PA 3NTRA 1C1DA 4IIVA 1Q1NA 1VJ1A 2B37A 2J3KA 3DEYX 5THQA 3WGGA 4NPCA 5KJ6A 4ZQBA 4BGIA 4QSMA 1ML3A 1DIGA 1E3EA 4RVDA 4S3MA 1E6EA 3AFMA 3UAGA 1CF2O 1O6ZA 3H5AA 5IAAA 3O26A 3NT5A 1ZSVA 3W6UA 5L7TA 3LZ6A 2WYVA 1A5ZA 1D3AA 3JCZA 1E92A 1DLIA 1U8FO 3DQPA 1T26A 1BTOA 5TF4A 3HN2A 5KKCA 4E30A 2EP5A 4XYBA 4UUPA 1V3VA 5JAZA 4IGFA 1B0AA 1G0OA 4JJIA 2Z1NA 1FJHA 3UCXA 2IYOA 3EC7A 4WLUA 2Q4EA 3SEFA 4MVJD 2QYSA 4K28A 1KY5A 4RVHA 4DIBA 2BI7A 1HDCA 1UZNA 1F0YA 3PQFA 2YJZA 5G4KB 1W8DA 3C1AA 2D59A 2C20A 4CQMB 1E6UA 1YS4A 4JGBA 3FTNA 2GR9A 5FI3A 3EYWA 3ROPA 3ETDA 2J5QA 2O50A 4HBGA 4CLHA 2IEDA 3V1TC 1L1FA 3PJGA 3GAZA 3RFXA 3BIOA 2AE2A 2X5OA 1QP8A 3SC6A 2DBVO 3F4LA 1ZK4A 3N58A 1BXZA 4U7WA 3BMQB 4DC1A 2FP4A 1AHIA 4MP3A 4KMSA 5H83A 3S2FA 2DU8A 5CAEA 1QR6A 4XR4A 1H5QA 4CR6A 2QRJA 3RVDA 1I2ZA 1F8GA 4WCFB 5JE8A 4WEOA 1N7GA 3P5SA 1K0UA 1U7HA 2DTXA 1XR3A 4XX0A 3BMOB 1E3IA 1YGYA 3E9MA 1NXQA 1ID1A 4F6CA 5JS6A 3HWRA 2Y68A 2E6UX 3P2YA 1U7TA 3PYXA 3G79A 1GCUA 3ONDA 2C07A 2BFAA 3GA0A 1ONPA 1E3SA 2YFHA 3CTMA 3O9ZA 1MC4A 5F3RA 1PSDA 5FFFA 5JAQA 3GZ4A 4NU5A 1YQDA 5T64A 2VHXA 4KDEA 1EMDA 3OEYA 1I2CA 3SXPA 3EMKA 3ZNNA 5ADHA 3F3SA 3RROA 4UAGA 1HDGO 1IPFA 1YJQA 5CDUA 3DHYA 1HLPA 3LC2O 1Q0HA 1RPNA 2FZEA 2EWMA 3K5PA 4FQ8A 2W90A 3ON5A 4YR9A 1LDNA 2DM6A 3A1NA 4J90A 1DC4A 1M6HA 5JCXA 3HN7A 2EIHA 3JV7A 4FR5A 2FZWA 2O3RA 4B4WA 1RM5A 1WDMA 2QG4A 3E82A 3OSUA 2FR8A 1XG5A 4CLRA 2BFMA 2PK3A 3DZFA 3GR6A 1DSSG 2Y93A 1ZSNA 2O7QA 4XQEA 1P0CA 4R16A 4E6PA 1GUZA 1KVQA 1T1RA 4OYRA 4CM5A 5L4LA 5ENVA 3RUAA 4BO3A 3PFWO 1Z74A 2W2KB 3E5MA 3RQSA 1P0FA 3TOZA 3D3EA 2C82A 4GPD1 4PLWA 4E5MA 9LDBA 4RLSA 3AUAA 4DQXA 4HV4A 2J8ZA 3JQBC 4CLDA 3WGYA 4MIYA 4E13A 8LDHA 2BLLA 2I6TA 2R2GA 4P4NA 3VPHA 2JHFA 5HWSA 4NK4A 4PZDA 2H63A 4YRAA 1V9LA 2G76A 4U5QA 4XR9A 3ZWPA 4LSMA 4GBJA 3UUWA 2X6TA 4E32A 4M55A 3OM9A 4IDCA 4E0BA 1DJQA 4UUOA 4CLEA 4BNIA 2Q50A 1ENZA 1XHLA 2DFVA 2J5RA 4I1IA 4M49A 4ZRNA 5G0SA 1R16A 1ZVMA 4DBZA 1OC2A 5IN4A 7ADHA 5DDIP 3VKUA 3AM3A 5ILOA 3NKLA 1Y7TA 4Z9FA 3IIEA 5F1KA 3LC7O 2VCYA 1ZMTA 1GU7A 3WG9A 4CV1A 3LVFO 3AK4A 2Q2VA 3NTQA 4OM8A 2VHZA 3FBTA 4G65A 3GY0A 3VKVA 3TZKA 1GTMA 2O3SA 1FDVA 1MFZA 2JJYA 1ZW1A 5IG2A 5H82A 2I3GA 4E5KA 3M2TA 3W8FA 3GHYA 4I9NA 4U6SA 4JP2A 4IM7A 4D0RA 1N1EA 5C7OO 1SB9A 3LU1A 4W4TA 2PGLA 2BFPA 2DFDA 3JTMA 3BAZA 2PKQO 4M89A 1XWFA 3KTDA 1T1SA 4LMPA 2V6MA 5G4LA 2C7GA 2ILTA 4L73A 3L9WA 2PNFA 4EUHA 1YL7A 4OOFA 2NACA 4GX5A 1E6WA 1KVSA 1D1SA 4IZHA 2RH4A 4TKLA 1T2EA 1X0XA 1ZZEA 2PZJA 1U2GA 3IUSA 4CMIB 2EXXA 3KYDA 3LF2A 3QHAA 2VWHA 1JLLA 1NWCA 2GN4A 5L7YA 4A10A 5T67A 5KIAA 3KYBA 4ZN6A 4CM3A 1PGPA 1PZFA 2E49A 2PV7A 3ZNPA 2Q3EA 4D44A 4ND4A 4Q3EA 4BNYA 4GWKA 2X5KO 2I99A 5AYVA 3FR7A 2B4QA 3PQEA 5COBA 4GKBA 1PGNA 4RZIA 4CV0A 2X9NA 4WLOA 5HM8A 3TOXA 2AE1A 4MP6A 1K6JA 5CEEA 2YV2A 1D1TA 3ZCXA 3C7CB 1ZEJA 4GX1A 3INRA 2FSSA 2PD4A 4OHUA 4Z3KA 1HZZA 1P45A 1UP7A 3BZUA 5DP1A 1JWBB 3E5RA 1DC5A 2SCUA 4I9HA 1U5AA 5KWEA 4Y8VA 2R00A 3VPSA 2JAPA 3FRJA 4FW8A 4PLZA 1VJ0A 3RU9A 4F45A 4OXKA 1HZJA 3GGOA 4QQRA 2V6BA 3OJOA 1Q7CA 2HRZA 4A5OA 3JYOA 4R1TA 4WPGA 3EGOA 4CLOA 4Z3DA 3TZHA 4AL4A 1JQBA 3JD0A 3O4RA 1PZHA 3OIFA 4CUZA 3HUDA 2FSVA 2OO5A 2CMDA 5GZ6A 1B26A 4XQ9A 3RKUA 2UUOA 5TJHA 3PLNA 5EQFA 2HDHA 5JMPA 1T25A 1X13A 3KEQA 3RJ5A 3I1JA 1IL0A 3VH4A 1MXHA 4MVJA 3ONFA 1EBUA 3GUCA 3HG7A 1DRVA 3PYLA 4LRSB 4XQGA 2POQX 2Y1CA 3ANLA 1ZO8A 3ASVA 2LDXA 3C1TA 3L6EA 3QWFA 4ALIA 2NNLD 1X1EA 3LK7A 4FJ2A 2HMWA 1EFLA 4NBVA 5EQDA 3ZZNA 3S2EA 1Q0LA 1LSSA 4C7KA 4CMJA 2EJWA 4AJNA 4BQRA 5AQ1A 4UREA 4ESOA 1KYQA 1YOVB 3OEWA 1FXSA 1FDWA 5K9ZA 5LCXA 1PJBA 3C3XA 4RPJA 5FYDA 1JTVA 1N5DA 4BNXA 2P91A 2GYYA 1V35A 1C0LA 4M87A 3FI9A 3WBBA 1HT0A 4DQUA 2GD1O 3F1KA 3A06A 2P5YA 3OJEA 4IJWA 4N18A 3NDIA 2ZQZA 1SEPA 1N1GA 3MCVA 5EERA 3ZU4A 4HFJA 5BR7A 5JDIC 4YJHA 4O1MA 3SJ7A 2Z95A 4JROA 3VAZA 3KLMX 4NQZA 1C3VA 4D3FA 5KVCA 4CQLB 4I9UA 3VPXA 3K31A 4XRGA 3MOGA 3SVTA 1QYWA 5DZSA 2Y05A 4K6CA 1PJCA 4PCVA 4CLOB 1XKQA 4NI5A 4W9NA 3I83A 2IRWA 4UUMA 3NJ8A 5KVSA 3ZV6A 5JO9A 2A9FA 1I0ZA 5CEFA 4GQAA 1Z6ZA 1LU9A 1XGKA 1PIWA 2RIRA 3M1AA 3M2PA 4BKPA 2PKQP 2EKQA 2VWPA 3BMNA 4RZHA 1UZLA 3DWFA 2VN8A 2X58A 2I9PA 3LYLA 3WJ7A 1GZ6A 4R1SA 3I5MA 3ZW9A 5DNAA 1H6DA 5C7IO 4WJZA 3ZWCA 3O8QA 3AUUA 3TQHA 1KEWA 3GEGA 2QQ5A 5AXDA 1DO8A 1EVYA 1YDWA 3A28A 4BO9A 1BXGB 1HE5A 4BNUA 4E5PA 3GVHA 5COQA 4LISA 3ZWWA 1E7YA 2O7SA 2NSDA 2ZJ0A 2IODA 3VH2A 1V6AA 1ENYA 5JW6A 5JSFA 2BKAA 2EGHA 1HRDA 1LI4A 1NVMB 1PJ3A 2AEJA 2XF8A 3CE6A 3BA1A 5EESA 4BV8A 4CMIA 2GRAA 3BTSA 1PU2A 3JQGB 4NK5A 4ZQEA 3H9QA 3ZWVA 1WW8A 4AJ4A 2NTVA 2W2LA 3TPCA 1Z73A 2A92A 2QYTA 2R00C 4FOOA 1KIFA 1UXJA 3FSRA 3ORFA 4IJKA 4INAA 5DT9A 4CM4A 5IZCA 1ENOA 3LT2A 4TRNA 2JCXA 1UH5A 3OFSA 4PVCA 1PGOA 5LDGA 4DPMA 1QMGA 4JIGA 3RFVA 5JY6A 4EUFA 2UUPA 3A4VA 3GMDA 4N5MA 4WLFA 4WLEA 4WASA 2C59A 1WDKA 1ZFNA 2Y99A 3D3WA 3EZLA 4RDHA 5A05A 4NG5A 2WYWA 1LLQA 1NX6A 1D7OA 2J6IA 3OA2A 5KCZA 1DHRA 1H2HA 3WIDA 3IKVA 4FFPA 4GVLA 4O0LA 1O9BA 4PG5A 2HSDA 4PG8A 1D8AA 4E31A 2EF1A 3GVPA 5EL0A 3ZNQA 3PIDA 2Y1EA 2AEMA 1UXIA 5I9MA 1ISJA 2J3HA 4YACA 3KM0A 5GMOA 2OL4A 4CLRB 3S2IA 3GRKA 3WJAA 2Q4BA 1WNTA 2B69A 2ZB7A 4MIOA 2Y0DA 4RVSA 5CDSA 3WICA 4CUJA 1H93A 1GQ2A 4BNFA 2V65A 2ZKLA 2F1KA 3PHLA 3ANMA 2QX7A 3U4HA 1CQJA 4YT8A 4W99A 4M54A 1J6UA 1W4ZA 4FGSA 4JJGA 3F9IA 4AJOA 1AE1A 1R6DA 2XAAA 4UULA 1LX6A 4LN1A 1EDZA 1UDAA 1MXFA 1O95A 4A2CA 1TT5A 4MVJH 1ISIA 5JFOA 2CF5A 4BO5A 3WTBA 3AI1A 1NQAO 4BNTA 1C0IA 1GDHA 2PZKA 3AUSA 3HB4X 4YAKA 2Y1OA 3KVOA 1DRWA 5B4UA 4OIMA 3WGIA 4BO7A 2O3JA 4JJFA 3TZ6A 1NQTA 3BTVA 4BV9A 1O0SA 2CVOA 2HQ1A 3KYCB 4CM1A 3H65A 5BNIA 5EN4A 1H2BA 3IC5A 4IDEA 1X15A 4TWRA 4BO8A 2OHXA 1FDUA 1EVZA 5I7VA 5DBFA 1M76A 4R54A 3ZNOA 3ZV3A 1IE3A 5TT1A 3RWBA 2C5EA 3CIFA 4BQPA 4UEOA 4R69A 1JDJA 3EVTA 1Y8RA 5EINA 5JYDA 2AQHA 2WTBA 2ZTVA 4J1QA 4JLWA 1JKFA 2QW8A 4FFRA 4NHEA 2CDAA 4XZ3A 2R6JA 4DVJA 1Z45A 3BMQA 1DFIA 5ENDA 3DR3A 4ZJUA 1PJTA 1IZ0A 1YB1A 3H3FA 1OOEA 1ENPA 3DMTC 5GZ3A 3GDFA 5J23A 3NT4A 1I30A 3U3XA 2XXBA 2J3IA 4Z9YA 2O3TA 1CJCA 2QRKA 3OETA 3V8BA 2JL1A 1EDOA 2FR1A 5A4DA 4R51A 4YAJA 3QIVA 1MA0A 4P22A 1HWYA 1ADGA 1OC4A 4PGFA 2G5CA 4UVDA 3H2ZA 4GH5A 1HSZA 3BMNB 3ICCA 3BTOA 4OKNA 3IP1A 1I36A 4URFA 3P7MA 2Q1TA 2AQIA 4OH1A 3TFOA 5I7SA 4H3VA 3G1TA 2Y0CA 3L0DA 1ADCA 2D8AA 5F1OA 4NU6A 4FJ1A 4AJJA 1IHYA 1T4BA 3QWBA 1HTBA 2WM3A 3ZH2A 4B7XA 1ULSA 4HX5A 4BNHA 4DQVA 4YAGA 3WOHA 3QE3A 1P1IA 4MVJP 4BMSA 4E4YA 1DB3A 1KC1A 3DMYA 5L95A 3HDYA 5DBGA 1GFSA 2RH8A 2VYND 4FDAA 1NM5A 1ZK2A 4NBWA 2ZATA 2C7VA 1PJSA 1HKUA 2GUGA 3HFGA 1HYEA 1E1MA 3D64A 2X0JA 4XYGA 2X8LA 4I5EA 2O4UX 2GN8A 4YBZA 4WLNA 2DTEA 4UEKA 5JMWA 3ZWYA 1JKJA 1O94A 2BGKA 4ALJA 2UAGA 1YL5A 2GN9A 4O5OA 2RBEA 1I3MA 3E9NA 4IIUA 3VZSA 3QW2A 3OQ1A 4ZRMA 1NAIA 4CMCA 4W7IA 1BW9A 4G2NA 4XJTA 2NU8A 2PY6A 4GX2A 5A1TA 4A03A 2ZYDA 1H9BA 2NVUB 1PR9A 3PPIA 4RPLA 2UYYA 2H5LA 4FD3A 2QRLA 3W6ZA 4LVCA 1DFHA 3WYEA 1C0KA 2FY8A 1YE3A 2JFFA 4AJKA 1E3LA 2GF2A 3EHEA 4J9UE 2WYUA 3GEMA 3ENNA 4DXHA 3WLFA 2ZB3A 4FPXA 3E48A 1LDYA 1YONA 1DLJA 3I3OA 3K96A 4BKOA 4EI2A 5LC1A 4RVUA 1M2WA 4D41A 4YAIA 1GQYA 4F46A 1N92A 1QXSA 4RJTA 4IJVA 3G0OA 3V5NA 2IYPA 2NTNA 4QXMA 3JD2A 3WNQA 4K6FA 1G0NA 4BNGA 3PI7A 5L3ZA 2B4TO 2EW2A 4XDZA 1U3UA 1WZEA 2NVWA 3GT0A 2Q2WA 1UR5A 1PL6A 4WCFC 3HQ4O 3SJUA 5JDIA 5CDGA 4RV9A 3RJ9A 2PR2A 4U0KA 4ZICA 3GK3A 3CEAA 2CDBA 4J2HA 4B3HA 4HFRA 1UDBA 1HEUA 2ZTMA 1QYVA 3PWKA 1XQ1A 4E5NA 1N9GB 5DF1A 5A3VA 3TF5A 3GFBA 5B4TA 5JBIA 1GV1A 1KEPA 3K73O 3VHRA 4JXKA 5TRTA 1YWGO 3ITKA 1CERA 4OXYA 1V8BA 1PEDA 1Y8QB 1ORRA 5HBRA 5JAIA 3KXDA 1UAGA 1ONNA 4RGBA 2NM0A 3UF0A 3JQFA 3P19A 4WEQA 2Q1UA 4HNGA 4XRRA 3H9EO 2G0TA 4WLVA 4IMRA 5U1PA 3S55A 1WWKA 3UCEA 4FFNA 3S8MA 1X0VA 1B8UA 2EW8A 1PZEA 3CMCO 3D5TA 4WE3A 5KJ1A 1DPGA 2OGUA 1Y8QA 4XYMA 4BS9A 1JN0A 4GGPA 1ZSYA 3RUDA 4MKRA 3DC2A 1R4NA 4IY1A 4J2OA 2JFGA 4RPKA 4TRRA 1RJWA 1RYDA 2ZTLA 3IQDB 1YH3A 1HDYA 3CH6A 3TWOA 4BNKA 1WPQA 3RFTA 3OH8A 3FN4A 1MV8A 3NYWA 4TQGA 5KJCA 1A9YA 4YVFA 4GMFA 3RCBA 1PGJA 4E2XA 4ILKA 3ZV4A 2JCVA 5EMHA 5BNFA 3F6YA 4YJHB 3ZW8A 1B8VA 2HJSA 3V2UA 5CFZA 3RBXA 4HFNA 1QKIA 4ND3A 3P2OA 2I76A 2P2SA 3WQQA 1I8TA 3ZWXA 4A7PA 3AU8A 1BVRA 2JHGA 4XGIA 5G0WA 3IAHA 4CQMD 3WYCA 5L9AA 3ZHBA 2CUKA 2B36A 4IDAA 3B1JA 3MJCA 4J9VA 3K6JA 1EUDA 3L6OO 3OJLA 4N5NA 3TDKA 2QIOA 3D7LA 4PRKA 4NNJA 3QVSA 4B4VA 4E21A 3KHUA 1C0PA 4XIYA 3GFGA 3QRWA 1Z7EA 2X0RA 2Z5LA 3L4BA 1ARZA 4XYLA 1PL7A 2YHIB 2IEBA 3WSWA 1B7GO 1I2BA 1LLDA 2Y67A 1PTJA 4I8XA 3HE3A 4TRMA 5JC8A 5KOIA 4GGOA 5DN9A 2YZ7A 1UUFA 3DOJA 4FJ0A 3JQAD 3WIEA 2EGGA 3Q11A 3JQ9A 4IQGA 1TVEA 4UEJA 1CRWG 4YT4A 4PLGA 1YO6A 1KVRA 1YQGA 2X0NA 2WWRA 2EERA 1E0DA 3I9OA 1DRUA 1FMCA 1QORA 4NDNE 1MP0A 2PFGA 3RAJA 2O2YA 1YBAA 3IMFA 5B4VA 4KUEA 2GSDA 3Q3CA 1VRWA 3M6IA 3LLSA 5IZ4A 2WMDA 2VRCA 4IXTA 4MJLA 4OGWA 4R9SA 5KVVA 5FWNA 4J7UA 2GN6A 1R66A 4NH4A 4JN6B 1ISFA 1ZJZA 3N74A 3DMTA 1AXEA 5KNLA 5CG2A 1P44A 2PGDA 4XEHA 1A71A 2C5AA 3V1YA 1T2DA 4IS2A 1U3TA 3AOEA 3UFXA 2O48X 4R3NA 4WOJA 3KB6A 3OHSX 3S1LA 4RPHA 3QA9A 1FDSA 2JD1A 1U3VA 4JX8A 1OI7A 3NJ4A 2NADA 2CFCA 4OSPA 3QY9A 1PJ2A 1UZMA 2E37A 4PLTA 3LDHA 4WCFA 2OXIA 5BSHA 1GL3A 1YB4A 3ABIA 4NJOA 1DHTA 1QYXA 3TFQA 2XPCA 3WYBA 2YQ4A 1GPJA 1A27A 1DIBA 4PLVA 5L4NA 3GOHA 2ZIZA 2EKLA 1RWBA 3NUGA 1AN9A 1JKIA 3GNQA 1B3RA 2DT5A 2X7HA 4UVIA 3ZHYA 3I6IA 4DGSA 2FN7A 1VM6A 1NAHA 3K2BA 4F6LA 3PZRA 3ZU2A 3MJEA 1R4NB 1ZJYA 2OMEA 1PQPA 2B83A 4OOEA 3U9LA 4DLLA 1DAPA 1Y1PA 3DFZA 5JNLA 1LSOA 1ZIDA 1NASA 1ADFA 2NU6A 3KYCA 3QWHA 1AXGA 1ZUD1 4J6FA 2OBYA 4CM9D 3B70A 3INTA 5K6AC 3NGXA 1MFPA 4YDRA 3OA0A 4RF2A 5A9TA 2A4KA 2TMDA 4YJFA 3GF4A 1XDWA 2Y66A 4JK3A 2O3UA 2GPTA 1X7GA 1TEHA 4MVJI 2GLXA 2D5AA 5IXSA 3VTZA 3VPFA 2JFHA 4FIZA 3KYDB 3BXXA 3VC7A 3MZ0A 3UCFA 2BMAA 1F17A 5L7WA 2YY7A 9LDTA 3CPSA 4MVJE 3PYMA 3O03A 4ZD6A 5JXWA 1O5IA 1FK8A 1JVSA 3WFIA 3DL2A 4AJIA 3VPGA 1PWZA 4IPTA 3EK2A 4M1QA 5G4KA 3A14A 3RD5A 4FS3A 1K5HA 4KQXA 3WB9A 3WDSA 3PGJA 1Q7BA 2O4CA 3UW3A 4E5YA 3PVZA 2W4QA 3RKRA 4F3YA 3KSDO 3RUEA 1NFQA 2VUTA 4WCDA 3T4XA 4CMHA 4RF4A 4L0QA 1F14A 2Q1SA 2V7PA 4ND2A 5EJ2A 1OZAA 1LXCA 2I65A 1Z82A 3OJFA 5DCYA 4A73A 1BVUA 1AUPA 1BDBA 1KETA 1Q0QA 1ZH8A 4JBHA 1QSGA 4JBGA 1A7AA 4EJ0A 3WGQA 3ZWOA 5C7LO 3MTGA 3F1LA 4L4SA 4LRTB 3TNLA 4QO7A 4D45A 3V2GA 1TLTA 2VRCD 3BHJA 1U5CA 1MB4A 2P9EA 1N9GA 3FNHA 3PHGA 1YL6A 4TRJA 4HY3A 2HMVA 4IDBA 3BMCB 4G81A 5DCWA 5A3JA 3U4IA 2VYNA 4ZVVA 2VTDA 4BGEA 5DCUA 3LT0A 2ZCVA 4Q3CA 5EIOA 1R0KA 3HB5X 3QVTA 1MG5A 3NDRA 1GY8A 1EVIA 3I9KA 3I9NA 5A03A 3FBGA 5TC4A 3LC1O 1E3WA 1YRLA 5DP2A 4PVDA 1MC5A 4AG3A 1HE3A 2JAHA 5I8WA 1HF3A 4TZKA 3BMCA 3G3EA 5F5LA 4Z0TA 4B4OA 4LGVA 3I4FA 1Q7GA 4YRDA 4NBTA 2P68A 4DLBA 1GEEA 2Y1DA 1UP6A 3GVIA 3WSVA 3JQCA 3DZGA 4AFNA 4X54A 2Z1MA 3QVXA 5JC1A 1GYRA 2AG8A 4DLAA 1S6YA 2BRUA 4M8SA 2NV6A 2EG9A 4BUCA 4GWGA 4XGNA 4CMKA 1E7WA 4DIOA 2ZQYA 1O8CA 3Q2IA 1I10A 4GI2A 2AXQA 1LRKA 1MX3A 1SNYA 3O8QB 5IZCC 3B20A 2BH9A 3QWIA 5L45A 3WXBA 4CV2A 4DC0A 3RU7A 1R4MA 4OQYA 4A0SA 3F47A 3BMOA 1ZKMA 1K89A 2HUNA 1CEQA 1P1HA 1PS0A 1W6UA 3AWDA 3HSKA 3QVOA 1I01A 4PZCA 5T5QA 3OQ6A 2DAPA 1SZJG 3KLPX 3ROKA 3RUCA 3Q9UA 1RM4A 3RC9A 3UOGA 1WZIA 1LEHA 4J1TA 1ZNQO 1FF9A 2OBNA 3PK0A 1PZGA 2NUAA 4GL4A 5IDYA 3RC2A 4QO8A 4CQLA 1QYCA 1DDOA 3DBLB 4N54A 4YPOA 2HKIA 3MWDB 4MINA 2ZYAA 1BXGA 1RM0A 4IINA 4I5DA 2BF7A 4KZPA 1V0JA 3JQ9C 3EDMA 1WMBA 4MO2A 4EGFA 1SMKA 3JQAA 1QLJA 3Q0EA 2GO1A 3W8DA 4E12A 1H0KA 4YRBA 3K92A 4BNWA 4LMRA 5A5EA 1R15A 4Z9XA 3HFSA 3KEOA 2EKPA 1LUAA 3ZWMA 2WJPA 1C1XB 2HK8A 3JQ8B 3PRJA 3I52A 5I7EA 3KO8A 4BGVA 5F1PA 4B79A 1GYPA 1XQ6A 1ISHA 3ZU3A 2FPPA 3ANNA 4QTZA 3V2HA 2WE8A 3U09A 1UP4A 4IQ8A 4PG6A 1TB4A 3FD8A 4EYEA 1W73A 3L77A 4ONEA 3GUYA 4MOWA 3TL2A 1BXKA 4YEDA 3ZHXA 1XEAA 5FI5A 2PH3A 4GSKA 1R0SA 1SPXA 4HP8A 4CR7A 1IB6A 4OJNA 3DFUA 2PGJA 4WNIA 3GNTA 2P4HX 2B5VA 3AM4A 3OP4A 4DWVA 2DTDA 4KTTE 1P77A 2AG5A 3ZWNA 3H9GA 3I6QA 1LRJA 1WAMA 2EV9A 3UGKA 2X4GA 5COAA 4PLYA 2NU9A 4EBFA 2J3JA 4J4BA 3WWZA 3PXXA 5KJFA 5CDTA 1R4MB 1DFGA 4DMLA 2B35A 1PX0A 4BIIA 2X9VA 4WUVA 1NWHA 2BD0A 2HAEA 2CVQA 2GASA 3X2FA 2BI8A 3JYLA 4Y6SA 3ULKA 3W4KA 3WQSB 2X86A 5U9CA 1JWAB 1Y9EA 2WE7A 3OBBA 4L4RA 4PG4A 1YJ8A 1LSUA 3NRCA 1HETA 1J0XO 3CXRA 3IKTA 5JY1A 5TGDA 3ITDA 1CYDA 4L74A 1VSUA 3ROMA 2VT2A 4MVJM 4IBOA 4N7RA 1CDOA 1H6BA 1PQUA 4LVUA 3IJPA 1PS8A 1L7DA 1HE4A 1QLHA 4HXYA 4EEXA 1ULUA 3RSHA 3C7DB 2OFPA 5A06A 1GQQA 5IN5A 3SLGA 1LNQA 5C3MA 3RASA 4DPLA 1GUFA 3GDOA 4MPDA 1CQIA 3PIIA 4H15A 4LW8A 4OL9A 4YYZA 1Z75A 2GZ2A 4YT2A 1K6XA 4NR0A 3D4NA 3HDHA 3NTOA 4YB8A 3NT2A 3HHPA 5L51A 3JSAA 4B4UA 2AA3A 3HDQA 1EBFA 2DKNA 1VI2A 3JQ7A 1V3UA 2X9GA 4ZA2A 1V3TA 3N7UA 4TVBA 2VT3A 4E2WA 3U0BA 4DIFA 2DBZA 3H2SA 3AOGA 4R1NA 1YBMA 5ER9A 5K6AA 3I23A 1P9LA 5ES3A 1WLYA 5B12A 1T4DA 3DBHA 1Y81A 3I9MA 1ZCJA 2HMSA 4R3WA 3OMLA 1P33A 3MOIA 2NVBA 3ENKA 5A9SB 5GY7A 5BSEA 5JYEA 3CMMA 4HUJA 3L6DA 4IUYA 3DZBA 4U8GA 3DZJA 3FR8A 5MGBA 4I5GA 3S2GA 2DBQA 5BSFA 1LJ8A 2C2XA 2NQTA 3K8ZA 1KBZA 4R1UA 2A35A 2VTEA 3TRIA 3HNPA 4BNLA 4B3IA 1DC3A 3NEPX 4XGKA 4YT5A 3ZDFA 3R3SA 3AW9A 4AICA 4CMBA 3R3JA 4TKMA 4CM4B 4I08A 1ONOA 3LLVA 2FHSA 2PTGA 3CZMA 2VYVA 1P1JA 4D46A 4ALMA 2HU2A 2WSBA 4H16A 4IQ0A 2Q1WA 1A9ZA 3JYPA 3B1FA 1BDMA 1HYHA 3Q9NA 5HA5A 1E7QA 2AMFA 3GHHA 2PD6A 4R4JA 5B37A 4CODB 2DC1A 4NJMA 4XJSA 1B15A 5ICMA 1MG0A 1LDMA 1DC6A 1T24A 5IDXA 3PP8A 3NV9A 3CSDA 4NZ9A 4BL5A 3DHEA 1H6AA 1XU7A 3WR5A 3VH3A 1IZ9A 4WOKA 1DOHA 2ZYGA 2EEZA 3BYZA 2VHYA 1X7HA 2C2YA 3MJ4A 3E9QA 5L4SA 3EVNA 2IZ1A 3RI3A 4MDHA 2O3QA 3CZRA 2P9GA 3ETEA 2ZTUA 4E3ZA 3FPCA 3IOYA 4TSKA 3VZPA 5CDYA 3INGA 2WDZA 3WWYA 5I8ZA 2YV1A 1E3JA 2CDCA 4L76A 3PQDA 1GZ4A 1A72A 7MDHA 4CL3A 4G5HA 3AY6A 3KSZO 4D79A 2WD8A 1ADBA 1MLDA 3AJRA 2LDBA 3KOUA 4J7XA 3HADA 3DTYA 1BW9B 1YVEI 4Z0PA 1ZXBA 5JDCC 4C4OA 2V6GA 1DIHA 1EVJA 3G17A 4EJMA 2AEFA 4CMAA 3GZNB 3KBOA 2RHCA 3U49A 2D2IA 2VWQA 4YCAA 4Q39A 4NFHA 3PHHA 2JD0A 4BKUA 2WEKA 4MVJF 4RQUA 4TVOA 4CV3A 1U2DA 3BTUA 4WNCA 3FNFA 4J16A 4DYDA 1JVBA 2PH5A 3MJTA 1VL0A 3AOEC 1U9JA 3A9WA 2FOIA 3JYQA 4R5HA 2X5JO 3OIGA 2P4QA 1ZXLA 2DBRA 1WDLA 1LBEA 4D0SA 4KWIA 1KOLA 3GMSA 4W9NC 5HS4A 3ADPA 2X1HA 3IDSA 3KSUA 4IMPA 4RLHA 1WMAA 2C54A 3WS7A 4CM8A 3KETA 5THKA 3OECA 4YJGA 3PZBA 5A02A 2BFOA 5JO0A 4AJHA 3O38A 1C1XA 1E7MA 3JQ8A 2JKVA 3H7AA 4PZEA 1AGNA 4GAEA 1LLUA 3VZRA 4II3A 1R0LA 4PLFA 4MP8A 3VTFA 4E2YA 1IYZA 4ID9A 1KEVA 1EUCA 4EDFA 4IJUA 1B16A 1HYGA 5K0ZA 4K1LA 3DZIA 3UH1A 2OOSA 3MEQA 4J0EA 2OZPA 4JNKA 4DTIA 5BT9A 3V1UA 3IL2A 4QEDA 2NWQA 2VZ8A 4MVJG 4DL9A 1OMOA 4KUGA 4NIMA 1S7CA 2AQKA 1EEHA 3DO5A 1XA0A 5TX7A 4B7UA 5IDWA 4ND1A 1OFGA 1P31A 3L4BC 1EK5A 2J5KA 2BELA 3PWZA 1TT7A 3IJRA 3KRTA 3T4EA 4KTVE 3U4CA 2IZZA 2W2LD 1RKXA 2BGMA 5I9LA 1I24A 4BO4A 1YDEA 3STHA 1X1TA 4ZHSA 4LSWA 5HS6A 4CLXA 1E1LA 4BO1A 1IOLA 4IDGA 4CR8A 1U8XX 1NQOA 5TT0A 1NNUA 4TZTA 2HRBA 2C0CA 1DEHA 1I33A 4FN4A 4DPKA 2AQ8A 2VWGA 1P1KA 2ET6A 2D3TA 1E5QA 1N7HA 2CVZA 2H6EA 2HCTA 2I67A 4IDFA 4PLPA 3GVCA 1Q2XA 1A4IA 4ALNA 4OKIA 2Q45A 4BNMA 3AI3A 1SO8A 1NTOA 2EP7A 2VHVA 4GKVA 2GCGA 1ISMA 4XKJA 2PWZA 4KOAA 3ZV5A 1VKNA 3DBHB 1KVTA 3K2EA 4IXWA 3SLKA 1LDEA 1NVGA 3OICA 4OXNA 1NPTO 1YB5A 1JU9A 4ROSA 5CPBA 3IS3A 4Q3BA 1B3BA 4R9RA 3DOOA 3PFFA 3DTTA 1LA2A 1PGQA 3DAFA 3NDJA 3QSGA 5F21A 1D4FA 3G1UA 4PLHA 4WGGA 1ZBQA 3OJ0A 1H9AA 1BHSA 3L4SO 3HZZA 4CUKA 1YKFA 3JQEA 1GAEO 1LRLA 2FPIA 4FCCA 3WGHA 4O6VA 3F4BA 4P8RA 3KUXA 2V6FA 4OMUA 2XXJA 4BNVA 4E2ZA 5C37A 4J1NA 4KQWA 4N5LA 4K26A 1M75A 4RVFA 4CPDA 3ETGA 1K6IA 4IS3A 1ZMOA 4DA9A 5IJZA 3PDUA 3C1OA 3H4VA 3GVXA 5T57A 3RBZA 3U4DA 1O89A 2ZB8A 1K3TA 1F12A 3ZWAA 1B8PA 1JA9A 4FFLA 2CY0A 3ZI0A 1P3DA 3L07A 5DOVA 4OAQA 2D4AA 1IHXA 1EZ4A 3ICPA 4YWJA 4AJ1A 1J5PA 1ZEMA 1JW9B 3MWEB 4ZGWA 2HMTA 5BSGA 1VLLA 2VHWA 2HO5A 4P4GA 5JPIA 2HLPA 4NMHA 4XD2A 2GZ3A 1GYQA 2OUIA 3GGPA 1G1AA 1FDTA 1NFRA 4PFJA 3TZCA 4HFMA 2DQ4A 1C1DB 4CL8A 4E33A 1ZK3A 1OAAA 4XB1A 2DUWA 5G0UA 3TJRA 4RDIA 5G0TA 5ITVA 4JQCA 1GUYA 1KC3A 2HK7A 6LDHA 1QV7A 2IDZA 1BRMA 2EHDA 5TLSA 1SCUA 3T7EA 1EFKA 3WBFA 2OP1A 1JAYA 3E18A 2E4AA 1PS9A 4LK3A 5CPFA 5H81A 1RM3A 2B4RO 2YFQA 3COSA 1Z7BA 1UXGA 2OORA 5A04A 5ICSA 1BGVA 2D5CA 4Z0HO 1W0CA 2GNAA 3TSCA 5A5FA 1LC3A 5T6BA 1NFFA 5JAMA 4BO2A 1GZ3A 1WXDA 2CSUA 3DDNA 1IULA 1XELA 2DPHA 4Y6PA 1XLTA 3WLEA 3DXFA 1SAYA 2Y0EA 5TJ9A 2PA3A 4GLLA 3PJDA 1UAYA 1I5RA 4J7CA 2A94A 1HL3A 5LDHA 3CKYA 5U4QA 1VE9A 1U4SA 3GAFA 3RUFA 3ZU5A 1P1FA 2YQ5A 1HXHA 3BHIA 2IE0A 4EEZA 3WMXA 1SOVA 2BHLA 1X14A 2CF6A 4ZU3A 1A4UA 1ISGA 4WECA 3L9XA 3VH1A 4CMGA 3DBLA 1IPEA 2VUUA 2C29D 1N2SA 2UV8A 4P38A 4AJEA 1F06A 4FB5A 3AY7A 1EQUA 3RIHA 3UICA 5T8KC 4YQYA 3LQFA 1E7SA 1LC0A 1R37A 3JD4A 3ZWBA 4RCVA 2PZMA 4PLCA 4BHTA 2IZ0A 4MIEA 4YJFB 3H9JA 3EAGA 3AM5A 4HKTA 4FOSA 1KVUA 1AHHA 1RYEA 3JD1A 4B7CA 4BB6A 2Y1GA 2Y1FA 4KP7A 5I9NA 4XWYA 1PQWA 2TMGA 4Z6KA 1SOWA 4RQTA 4UVHA 4CM7A 2VNAA 4W7HA 3GQVA 4Y9DA 3DHNA 4K9DA 3E03A 4BNJA 4EW6A 3FNEA 2G82A 1LQTA 1CIVA 2FMUA 3RBVA 5MDHA 5L40A 3E1KA 2OP0A 5ER6A 2ZK7A 3OF2A 3ZGYA 2I5PO 1EE9A 3GPIA 3GDGA 3D1LA 3WGOA 2YW9A 1NBOA 4HADA 4YJDA 4Y98A 2PZLA 2IXAA 1ZK0A 1Y5RA 3C24A 4J4TA 2VYVD 4O63O 1T2AA 3M1LA 2FWMX 2Q49A 4GMGA 4D43A 3GH3A 1WVGA 3DONA 4PRLA 3WGTA 1KEUA 3JD3A 3K30A 3PJEA 5FF9A 4IZIA 1SB8A 4A27A 5I7FA 3QWAA 4EUEA 4RPGA 1M66A 3DAPA 3GLQA 4HWKA 4FFOA 4O59O 3AUTA 3PGXA 4CQMA 2VZ9A 4J43A 2ZB4A 4CM9A 3OQBA 4D3SA 1EK6A 3GZNA 2GERA 3NX4A 4QECA 1UDCA 3QJ5A 3QLJA 4U6QA 3WFJA 3FHLA 2QZZA 1IUKA 4I5FA 2YYYA 3FTPA 4KDFA 4P4LA 4YJGB 4NBRA 5AOVA 1LDGA 1CWUA 5JDCA 1Y9AA 2GZ1A 1VJTA 3DOCA 4QUKA 4OO3A 2JD2A 4RF5A 5DULA 4GX0A 4EITA 3JQFC 3KV3O 5DOZA 1PL8A 1TT5B 1M6WA 1Y5MA 2CD9A 3RC7A 5BNTA 4J0FA 3D5QA 4R5MA 3RC1A 4U0JA 5KVQA 4XIJA 3JQ6A 3Q1LA 4XDYA 5ITWA 2WD7B 3D3WB 4UVGA 2FPGA 3FCOA 5AVOA 4LCJA 4NFYA 1DXYA 2Q2QA 3Q2KA 4AJ2A 1NR1A 1M67A 1DIRA 2H1SA 2HMUA 2HJRA 2PD3A 3JQDA 1VPDA 5L53A 2H9IA 3E6AA 4DMMA 2FR0A 2I3AA 1I3LA 1PWXA 1P74A 2PLAA 3QV1A 4GVXA 5TNXA 3FWNA 2B5WA 3F46A 4CMEC 3WX0A 5DBIA 4BMVA 1QG6A 2VNSA 4EZBA 1XIVA 5G2OA 5JCJA 3LT4A 3QP9A 4WK6A 3PEFA 4ZQHA 4KWHA 2YHIA 4XB2A 1KY4A 4R01A 2QHXA 5HRUA 2DVMA 3DZKA 4JBIA 4BOYA 3R0IA 4DUPA 4QFDA 1U3WA 1TA4A 1HSOA 3DBRB 1VL6A 2VZ0A 4J91A 3I4CA 1SEVA 4BVAA 1QYDA 3H3JA 3FPLA 1LDBA 1U28A 3R6DA 4JCOA 4PN3A 3GNSA 5GZ1A 1DJNA 1PR3A 4W6ZA 3FF4A 1HLDA 1TI7A 2YHUA 3WQRA 1GPDG 4DBVO 4XA8A 3GG9A 3PTZA 1VKOA 3VDRA 2ZCUA 5AXBA 3LF1A 1E1KA 2VUSA 1HDZA 5TSDA 2X0IA 1EUZA 4GLOA 2O23A 3ST7A 3JQGA 1LTHR 4YQZA 4L75A 2QZ9A 5BQFA 1X7DA 3R1IA 2PKRA 5AXCA 2D0IA 4FC7A 3I9LA 3H6KA 2XOXA 2E48A 1GV0A 1H94A 3G49A 3IUPA 2AHRA 3T7CA 4TMFA 1VSVA 1VC2A 1PJ4A 2X22A 3WMWA 2VQ3A 8ADHA 4ND5A 4L9RA 3AI2A 3B6ZA 4ZQGA 3QVWA 5IDQA 4RL6A 4RVGA 3DBVO 1H6CA 2DUUA 4DREA 5ILGA 4L4XA 3SBOA 1I3NA 2G17A 5IXYA 1A7KA 3PHIA 5C5IA 3JYNA 2P9CA 1U4OA 4HNHA 3SC4A 4W82A 1P1RA 2VRBA 3H9UA 4XQCA 3OIDA 4ALLA 4BMNA 5KTKA 1NPYA 4XCVA 4FC6A 1DBVO 2GDZA 1QV6A 1LSJA 3U5TA 3TN7A 1XCBA 4J49A 3F5QA 5TQVA 2NTJA 2FRDA 3GEDA 4BKRA 2BGLA 4FSHA 1NPDA 3NGLA 4PG7A 5F5NA 5AXAA 3UHAA 5TIIA 2X23A 4Q9NA 3WGZA 2VOEA 4B3JA 1K2WA 4J3FA 2D1YA 1HDXA 1LQUA 1NHWA 2DLDA 2B0JA 3DAGA 3WNVA 2CNBA 3VVCA 3KZVA 4TROA 1GR0A 4EJ6A 1KS9A 5IFLA 3AY3A 1BSVA 1GCOA 3UXYA 5KKAA 3B1KA 3CUKA 4MKXA 3MJSA 3HDJA 4YAEA 3GPDG 3PHJA 3Q6IA 1ZK1A 4FGWA 1I3KA 5EPOA 4RO0A 4CM8B 1EE2A 2E82A 1XSEA 2RHRA 4WKGA 1E7RA 3UKOA 4NBUA 4BKQA 2W2KA 3DZHA 4YA6A 2NQ8A 5T8KA 3ROQA 4D7AA 5JCJD 1R12A 2JCYA 4DYVA 1KERA 1YOVA 1QRRA 3HJAA 5FEUA 3F5SA 1C14A 2O2SA 4RORA 3H5RA 3BHMA 1E5LA 1U1IA 2YV3A 4CMEA 1CETA 2UVDA 2VOJA 2CZCA 1F8FA 2RCYA 3GC6A 4YTEA 1OBFO 3SX2A 2Q46A 1MUUA 1NHGA 3MTJA 1BMDA 4MKZA 4DRYA 3EY4A 4JP3A 2YUTA 4IGEA 1NQ5A 1XYGA 4ZQFA 1GD1O 3AFNA 4AVYA
chains in the Genus database with same CATH superfamily
2ATXA 2HK9A 1CY4A 4I1SA 1FRZA 3JX9A 1XTVA 3IESA 3B38A 5FTJA 4KDRA 3UMRA 1L7EA 1TCAA 2HF8A 3PF9A 3VYTB 4C20A 5A9RA 5HTOA 1PJLA 3K4PA 4LJSA 1A8PA 1GNVA 1CNFA 1ZIPA 1AB5A 2BIFA 3Q8WA 4HN4B 4U9UA 5T3YA 4RABA 3TNDA 4B6JA 2B25A 1SFRA 2Z3VA 2QN7A 1QP0A 2PMDA 3WLPA 5JS7A 2OHFA 3K0FA 4IO1A 3L0PA 4AS2A 4ETMA 3AU9A 4R68A 3RT7A 2ZJOA 5JMOA 2ZJ1A 3DV0B 3ES9A 2V7BA 3FVTA 4JA0A 3I01A 5IM4F 3ND7A 1F2DA 3LI2A 2ZR0A 5AKLA 4B2IA 4B8WA 1VPTA 2AN1A 4KODA 5JUWA 3MM4A 1PP4A 3Q7QA 4KWEA 5GP1A 3D4OA 2FWJA 2H4WA 5KDDA 1NBIA 3I8XA 1GG8A 4FHGA 1RTTA 4CNQA 3LHKA 3VNRA 3EFBA 4G5YA 4AJLA 4C3ZA 1T15A 3L7IA 1BU5A 1G8AA 3ERCA 2ETVA 2F00A 3GBPA 3NAQA 4KUHA 5BQ5A 3AXTA 4HSGA 3A6ZA 4RS4A 1CFZA 2YDXA 1N8KA 5FL7D 1KYXA 3VDQA 4NESA 3ASUA 1TM2A 3I9JA 3EFEA 5FPHA 1WB9A 1W2WB 4EB6A 4QDTA 3T95A 1PJQA 1REQA 3COZA 5KBYA 2GTPA 2OT3B 3PQ8A 4GLJA 4KQIA 4V24A 2HPHA 5E38A 4UPDA 4J1SA 2B9EA 4BPRA 3BX1A 3N76A 2VHUA 3W4IA 2GQ0A 2WNSA 3OO1A 5K3AA 3K09C 1TM5E 4Y67A 1EPUA 3O2SB 3C8MA 4Q1AA 4K6OA 4ZIRB 1K9VF 2NYRA 3NAMA 2IS1A 1WP4A 4EQZA 7MHTA 3A9RA 2C03A 2XT9A 5K3DA 2GEUA 4FFMA 3I58A 3C7AA 3HU1A 3OF5A 5CLLA 4NU0A 3TUJC 3QNWA 1N33B 5IK2D 1TUIA 3UOWA 1ZM4A 4Q3AA 3TD6A 4FILA 3P9RA 2NU7A 1D09A 1I13A 2P27A 2E9SA 3AR6A 3CPEA 5KWJA 1T2NA 2JI4A 4Y6RA 1DG9A 4N7MA 4OD0A 4ZCIA 2RB4A 1E3TA 2R96A 1PWHA 3DMGA 1V96A 2V7QA 4I3HA 3C85A 5EIXA 1K7YA 2E18A 1U1DA 2ICAA 4G1MB 4TXNA 2XCRB 2IXBA 2PIAA 2R47A 4BGUA 1H2XA 4G1FA 2JASA 4W8OA 4YMWA 1CXZA 3O1LA 4OQZA 4TUYA 4X3CA 2IDJA 3VGPA 1QGDA 2BFEB 4BNNA 4F84A 2BEVA 1NXOA 3FUWA 3GRPA 2F43A 1K7SN 3HC7A 3UWSA 4HH1A 3PNYA 3GN2A 4DG9A 1VBFA 4BJ6A 1NE2A 1GP2A 1I2AA 4E5DA 4CM6A 4H2DA 3HLYA 3AEZA 3G5MA 3PWTA 3Q0IA 4C0BA 3H86A 4UM5A 2PR7A 1M2OA 3WGUA 1G3QA 1KMNA 1RKUA 4NYMQ 4BB5A 3RTCA 3U62A 4C4ZA 4DV1B 3TXXA 2RAFA 3DSRA 3KNZA 2W70A 4C76A 1XRNA 4OSOA 4CDGA 1XL0A 2VJNA 3I72A 3GEIA 2WVAA 4WBNA 1FX1A 1CUVA 4ZCSA 1NR7A 2WJHA 4XWWA 1NLZA 2OYRA 2F2TA 1SBYA 1VDMA 3DE4X 2WHPB 2OZEA 2GZSA 1Q1NA 4LTMA 1VJ1A 3E8SA 3LP8A 5KJ6A 2XCQA 2CLSA 4BGIA 4X41A 5A0VA 4QSMA 1DIGA 5IP5A 3C5HA 5FFNA 5AKGA 3DVSX 3TBKA 2HHJA 1UDWA 1MO5A 3SDSA 1EJBA 4DA4A 4DR1B 4FI3C 2JS7A 2VK8A 4LSGA 4LDJA 3SR4A 3UAGA 2HCFA 2Q5CA 4QDXA 3WA6A 1O6ZA 3ZXXA 2I80A 2CLCX 2XT6A 5IAAA 3BD8A 1KZ4A 4PBRA 4PAGA 1E8MA 3L1JA 4RBNA 1DCFA 2EKZA 5BXQC 3C3AA 2WYVA 2FB9A 4HAUA 3DVLA 5IYZB 3SXJA 4NH0A 1W19A 2C96A 1U8FO 3DQPA 3Q6MA 1NG1A 1T26A 2WIDA 5DRTA 3ELDA 4R9NA 1W47A 1QAOA 1YR6A 2X19A 2BFEA 3CS3A 3ILYA 2Z2YA 4IGFA 5KPJA 4FMCB 2EFJA 2FUEA 1G0OA 2ASVA 3A32A 3GB9A 3HXTA 2H59A 4BFVA 1L5FA 2X8BA 2Z1NA 4F2DA 1FFXA 2IA5A 4RD1A 2A57A 3AYZB 2VP2A 3HBNA 2C97A 3KHKA 3G13A 4MVJD 4PW0A 5SYAA 3R7NA 1KXJA 3M5CA 1CJMA 3AB7A 1EFHA 4RJIA 2BI7A 1HDCA 1TEVA 2C7BA 1F0YA 4DG5A 3MN1A 1X92A 2EHJA 3L0ZA 4G5XA 1ECPA 4MGIR 4UMDA 4K9PA 5KHLB 1UKBA 2CW5A 4Z7NB 1KSGA 1P4RA 4JGBA 1G20E 3FTNA 4M4SA 5FI3A 1PT9A 1NOIA 2DP4E 2O50A 2SKDA 1JHOA 3EA0A 3EG5A 4HBGA 5KVAA 1ABEA 1B74A 1MJFA 4PSDA 5CFNA 5IPFA 1U2SA 3DMPA 1MENA 2WMOB 1NBMA 2QUKA 1RLUA 3TFWA 4FYXA 1QNFA 4QHYA 1ZK4A 2FEWB 2YVLA 5K3SA 3TE6A 2GJSA 3NANA 4IF4A 3BMQB 4WW0A 4BLOA 4XASA 4D92A 4E07A 4KMSA 2QLTA 5E3HA 4RD6A 1GGHA 2JCBA 4NOMA 4ZOBA 1QR6A 5DEIA 5BUCA 1QVWA 1GFWA 1XAGA 4XR4A 1H5QA 1K5GA 3WLRA 4CR6A 2IPLA 5AM0A 1XVUA 4MICA 5H02A 2C9BA 1MJNA 1I2ZA 2J7PA 3MA0A 1EXNA 1L5WA 1L5HB 2C8LA 3QE2A 3K3PA 1H3EA 1LWNA 1U7HA 2DTXA 3AL0C 3BIWA 1G5FA 1GGMA 1G5TA 3BMOB 4QVKA 2OQRA 4BTEA 5CLJA 1NXQA 5E3JA 3H42B 1SXQA 2IS6A 2XGGA 4F6CA 5JS6A 2WWWA 1RAFA 3D2AA 3A6FA 3CR7A 3N2KB 3G79A 1GCUA 3OLWA 1QO9A 3I9V1 3K72B 1G5RA 1W96A 1OGYA 3K9CA 4RK5A 4G4GA 3SEFA 1E3SA 1IAVA 2C77A 3CTMA 1MC4A 3RVMA 2ACKA 5FFFA 2GTHA 4OHKA 4RVNA 3VC1A 4DZTA 2H4JA 2YYSA 5EYPA 1X3LA 2PFSA 2GEVA 1KZ7B 3SIXA 3TOCA 1A9TA 3KZMA 2VHXA 4C0KA 4Q01A 4UM7A 1N2JA 4I1UA 5LLDA 1JTEA 1PQYA 1EMDA 2D74A 3CURA 4M7WA 1Z38A 2OHIA 3SXPA 5FOTA 3UQYS 1EWQA 4KO1S 5J2UB 4NF2A 3F3SA 3PUZA 5IYZF 3RROA 1YZGA 3ED5A 5HNKA 3IXQA 2C94A 3DE5X 1MD9A 2ZANA 4WZZA 4F7DA 3UPUA 3A4IA 1UPTA 3DG9A 5DSXA 4ABYA 1P75A 2CSXA 4FQ8A 1CJTC 1TGYA 4E94A 1N7JA 2DM6A 4H1TA 1SUBA 1AK1A 3F7NA 3JV7A 4EHJA 3E35A 1XNRB 2LRHA 3MWKA 2VCEA 1RM5A 1SQ6A 1I9CA 3QLEA 4WKPA 4B4WA 2QG4A 1GQRA 2P30A 5GJWC 3GUVA 4PPFA 1JGTA 4FDVA 1T0UA 2EZTA 3A9CA 3FSGA 3D2LA 3G2LA 3JRNA 3QKWA 4X20A 3DZFA 1YHNA 3GR6A 4B8YA 3Q7IA 2PMKA 1MB2A 4NCXA 3TOVA 2ZI7A 1VLHA 4JGIA 4XQEA 4WK0B 1P0CA 3TNYA 4H27A 5EG5A 2P40A 3M6WA 4WXEA 2D2VA 4CM5A 4BO3A 4OI4A 4NBKA 3VRHA 4D3YA 3E7DA 3OI7A 1U1CA 2Z56A 1ZITA 1M2OB 1G63A 1JDNA 3HVKA 4JT8A 4MR9A 1N8SA 2C82A 1OROA 2NYUA 1CLEA 2PBFA 2VAMA 3IKMB 3K9NA 4PLWA 3AUAA 4RLSA 3TH5A 4DQXA 3SS8A 2J8ZA 4QIHA 1VP9A 2WZDA 2YVKA 3JQBC 4CLDA 4FDTA 4X24A 3U1VA 1ZR4A 4NYIR 3GLGB 4BLWA 3VOTA 3CC8A 4QTTB 3K0BA 1BNCA 4UTXA 2Z2JA 2PE5A 1XEWY 2YXEA 3KQKA 4KV9A 3AR8A 1U0LA 4KAXA 1NVKA 3B6IA 2FVXA 1M10A 2R751 5ESDA 5L3SA 3NP7A 2NZ8A 2VNHA 4LSMA 1P73A 4GBJA 2CXOA 2Z5GA 3LTEA 2X6TA 3LCUA 2RHOA 5EQTA 3ONVA 2B8NA 2GBPA 3HYLA 4E0BA 3W2IA 2IY8A 4BNIA 1B42A 1Z37A 4C4TA 1XHLA 1MQ8B 1AA9A 1WMFA 3Q1KA 3H1AA 1P0QA 3O31A 3RYHA 4DBZA 3L92A 5IN4A 3E2PA 1M6VB 2O5RA 2XZDA 3QMMA 3U6KA 4BNDB 3K09A 5ILOA 1Z68A 1VGRA 3HO1A 4B2YA 2QJWA 1GU7A 4HXFB 3LVFO 4AKTA 1E5VA 4XCQA 4S0ZA 4OM8A 1U8EA 3X1ZA 1EINA 4LXTA 4V0LA 3FBTA 5KHAA 2VDMB 4BC1A 2FYTA 1FDVA 1P4HA 4CGYA 5DNUA 4QUJA 1JE0A 2JB9A 3PPXA 3LO5A 1X7XB 4I9NA 2RG7A 1CTQA 5TXGA 1SWWA 3EZGA 1JR2A 1ULBA 2KM1A 2O14A 6REQA 4D1YA 4B0PA 4YXWA 2ZI5A 1C9DB 1SB9A 4M83A 3PV0A 4RNCA 2NXCA 4EJFA 1WSWA 4M89A 4FDLA 1JQ3A 1OVMA 1MOSA 1XWFA 3KTDA 3PC3A 5FTKA 1T1SA 1T5SA 2YINC 3LL7A 2OHVA 5G4LA 3L1HA 2XIQA 5JJBA 3PDIB 3L9WA 1B6TA 1YL7A 4P5EA 1SIBE 3F6EX 4OOFA 4UDOA 5ETJA 3BXOA 5ARDA 4GX5A 1YRWA 4H17A 3TEFA 4M21A 4EY6A 2OCLA 4BRWA 1JYSA 4TKLA 1X0XA 1U8ZA 1WKVA 3MGCA 4ARZB 4C88A 1ZQ9A 3FMPB 3IEVA 1LTKA 1U2GA 3GYGA 3IUSA 1XJQA 2FK8A 4FYMA 4AQDA 3WGJA 2QMQA 1NWCA 5ALOA 2GN4A 2Q2NA 2O7NA 4LJLA 5E95A 4A10A 3ZVLA 5T67A 1TYCA 2Z4RA 3FM9A 3PC8A 3JTEA 3T5GA 3ETLA 4E09A 3QVMA 3FHTA 1M2VA 3SEZA 1JEJA 2ISSD 3P9SA 1Z8NA 1AQUA 4MPRA 4DNOA 4G5QA 2I99A 4TKZA 1EUYA 5COBA 4NRDA 2YN2A 5I7OA 1PGNA 2IBTA 1Z5UA 4PFQA 3C14C 3UANA 4O4JF 1DNPA 3TOXA 2AE1A 4EARA 2W6NA 5LIPA 1N1DA 2YVAA 1K6JA 2ZS9A 3G2KA 3S2YA 3JW8A 1Y89A 1YCHA 1ZEJA 2FX2A 2FSSA 4D8WA 5DXJA 5BOVA 3CRRA 3F6SA 2G1JA 1HZZA 1NYRA 1QHHA 2E4XA 2SCUA 4I9HA 3O0DA 5FWYB 4F4HA 1U5AA 3EMDA 4V0ME 2R00A 3VPSA 4MUFA 2CV2A 5CM8B 4QDKA 2JAPA 4FW8A 1U7ZA 3RU9A 2P9FA 2KLBA 2OBLA 4FFVA 2H54A 1TM1E 4G5FA 1MIHA 5G41A 4F45A 3PR2B 5FT9A 4A5OA 2HIAA 3GDHA 1VECA 4WPGA 1NVWQ 3EGOA 4CLOA 4CE6A 2Y1KA 2ZYRA 4M38A 3VU8A 3AVXA 3FPBA 3QLVA 3WKDA 1P7YA 3HM2A 1ESDA 4RFVA 4XH9B 5TQJA 4K9QA 1GVHA 3N05A 3A3PA 2OENG 5FA6A 4XQ9A 3TIVA 2C7QA 1W5BA 2FFHA 3GP8A 1GTJ1 3GGDA 4MZDA 1UJNA 3FMOB 3PLNA 3ZJUA 4I50B 4JL5A 2HDHA 5JMPA 1T25A 1X13A 2WHYA 3KEQA 1ZI6A 4R2HA 1DTWB 1FLNA 3CJQA 1C9EA 1XTRA 5GGXA 2Q4TA 1N2CA 4ZXPA 3TMKA 2ZSBA 3F9CA 3LUAA 3Q7TA 3VH4A 4LFAB 1VG1A 4YJ3F 1YVDA 1RYNA 2NTEA 3CJTA 4UDNA 1KO4A 1TU0A 1WXIA 2Y1CA 3ANLA 4R05A 4ALIA 3AJAA 4HB4A 2P2ZA 1HC7A 4DDWA 2R6GA 4U2EA 2A1TR 1Z0ZA 3R6TA 2HJHA 2CK3D 5DHRA 2HMWA 4RA9A 4LZAA 5ELXA 3G2NA 3LAWA 2QE7D 1C9JA 2NSJA 4AJNA 4B76A 5AQ1A 2VPQA 4UREA 1XXHE 1KYQA 5IASA 2QF7A 1DCKA 1MEJA 3V7WA 2ZETA 2V7GA 5A4AA 5CT4A 2Z0MA 3I28A 2YC4C 4ACAA 3WWEA 3HBFA 2FOLA 4EGAA 4V0QA 3DL4A 1JTVA 2JZOA 4JEUA 2O8EB 5K01A 3FVVA 4TWZA 3DTVD 1Q0SA 4L8LA 1BXRA 2GYYA 4ZYXA 3TL3A 3JVEA 2GH1A 1OHHA 1V35A 3KWMA 3S68A 1ZI8A 5JQGA 2GD1O 2G0AA 1LZLA 2HQBA 2VNKA 3EDOA 3MAAC 4DWOA 4CETA 3OJEA 2R5FA 3GJSA 3R8FA 4TL9A 3RRFA 3NHMA 1N1GA 1SY7A 3MCVA 4URUR 3U1BA 1IEQA 3R3YA 2UXBB 2D2XA 4JUBA 2P3SA 4EJSC 2G3YA 1SG6A 3KZOA 5JS8A 3KJXA 3DZCA 1Z0SA 4O1MA 1UMBB 5AVJA 2Z95A 1O96A 3VAZA 4NQZA 1SVLA 1C3EA 2CJFA 5TMBA 3WB1A 3Q9LA 3WZLA 4CQLB 1A8UA 2PGAA 5KVCA 1ODLA 3K31A 4Y9UA 5ES4B 8ABPA 3DBOB 2HRDA 1DAIA 2WT9A 2IH4A 2D5IA 4YGXB 1Q6ZA 1L2TA 3GRYA 1SOMA 4C22A 4KGDA 4RWZA 3ZJTA 1TUBA 3AIOA 4EW2A 3OTOB 1QKKA 2AFRA 3RRMA 1GTG1 3SNKA 3NVMB 5JO9A 4FLFA 2IYZA 1M9NA 4W5HA 3P32A 2A9FA 4J76A 1ZG3A 3EDCA 1MO3A 2LD4A 2V8BA 4ZOEA 4I4TF 1ESEA 4EAAA 3H13A 5AVSA 2RIRA 1H3NA 2PZFA 2W2OA 3M2PA 3ZD8A 3FSJX 2DY1A 5K7SA 1L4NA 2QL9A 2EKQA 1D6NA 2I2XB 2IKSA 3DWFA 2I9PA 3WL6A 1GZ6A 1R27A 2PQ0A 4OATA 4GO1A 2VLBA 2GLTA 3CR3C 1H8HD 1RQLA 3O8QA 3OQVA 2YC2C 5ERXA 1R00A 3TPZA 3JWJA 4JQOA 1DINA 4B75A 3HHEA 4C7XA 5CB4F 4KPFC 1HE5A 3QHPA 1MIOB 4EA6A 2FP4B 1NQUA 3AEKA 2UVPA 5EXEA 1PI3A 1GKYA 2IODA 5JW6A 3A36A 1JA0A 1EK0A 2CL7X 5ALDA 1NLMA 1ZCZA 1X19A 2Z04A 5JSFA 1U8AA 3RRJA 4TQAA 2BM1A 2XF8A 1N8NA 4KN8A 3D7NA 4CEJA 1UJBA 2GRAA 4BX9A 5KB3A 4OBEA 1ZD3A 3E0XA 4NK5A 4ZQEA 1T29A 1GG5A 2CNNA 2GESA 1YJAA 4RADA 4RK4A 4DV2B 3OZAA 4TMXA 1KIFA 1UXJA 3DBIA 1Q0ZA 3FSRA 5DT9A 4CM4A 5IZCA 4AKHA 1ENOA 3LT2A 3OZTA 1ACLA 3KU4A 2SECE 3BK2A 3W2GA 3KPUA 5ELMA 3PVCA 2JCXA 3ZDRA 1PGOA 1D9XA 1QMGA 3CGGA 4PZZA 2D4HA 2GJ4A 1UFOA 1Q95A 4ENSA 1HNXB 3RIGA 3SWWA 5CNMA 1PJAA 2UUPA 3QJGA 1H69A 1VB5A 1RQPA 5GQSA 4G07A 2I3DA 3GMDA 4J0KA 3OZUA 4N5MA 3DDSA 2P79A 3Q5EA 5AW7A 1QFXA 4WASA 4DB2A 2WJ4A 1H8HA 2DKOA 1T9AA 1UJ6A 2Y99A 2HJGA 4HN9A 1RWPA 4LF7B 2GM9A 3NCHA 3INNA 4HZUA 1HMPA 4K9SA 1RQNA 1NX6A 1QVRA 1ZOPA 4MARA 5FQNA 3BK7A 2ODQA 2R7LA 3OA2A 1AC5A 2R7AA 4YCCA 3V3KA 2QW0X 1DHRA 1OLSA 2C9OA 2WJZB 4LNUB 5BORA 4GVLA 2GK6A 4O0LA 4PG5A 1O9BA 2JLCA 2O0MA 4P3OA 5G1NA 4E31A 2HWXA 5AR1A 3DM5A 4EHBA 1RPZA 4O02B 4LF5B 4XM2A 1NSFA 3QENA 1UXIA 4ENQA 1JTFA 3RAFC 1P81A 5EKDA 3G85A 1I4LD 4YACA 1AF4A 3K1TA 1FYVA 4LVOA 2Q4BA 3ZJYA 4EFNA 2B69A 2X41A 3H8WA 4MIOA 4EPTA 4RVSA 2A30A 3FPGA 2AFVA 4GMDA 2OPHA 5CDSA 1ZGJA 1C7IA 4CUJA 1H93A 2VP9A 2HCJB 2E1RA 2V65A 2ZKLA 4WBNB 2Q62A 2DR0A 4ETNA 2IX3A 2BBSA 1OLOA 2R8BA 1R8YA 5CXXA 4YT8A 1JJIA 2YRXA 4M54A 1TM4E 4NONA 1CJSA 1UWVA 4B6QA 2ZPUA 3F9IA 1WKCA 4X1IB 4HVCA 2XAAA 2C4NA 1J2RA 4GYKA 4IR7A 4C89A 1V1MB 1MXFA 2B78A 3VNQA 2MHCA 1O95A 4M9SA 1JZSA 1TT5A 1ZMXA 1K7CA 2YN4A 3RHSA 5E3IA 2BMVA 4TUYB 5BW6B 3FWPA 2GKGA 1ADYA 2J30A 1SHTX 2WUWE 4QU5A 4FMDB 3EXIA 5AK0A 5HQJA 3K71B 1RWKA 2XNHA 4TXMA 2O3JA 4E5SA 1EWTA 2OXTA 1V1RB 3PC2A 4JJAA 3KYCB 2HQ1A 1V4VA 4CM1A 4S04A 3C3KA 3BH7A 4LK2A 4CDMA 2X3YA 4Z7JA 5H4GA 2BW0A 3F8SA 2H08A 1FBTA 3H1FA 2OHXA 3BJRA 4BO8A 5JJ5A 1EVZA 3KJIA 4ZIRA 4GC5A 4MUMA 5DBFA 3I9V6 5I7VA 4R54A 4UFNA 1JIIA 2RBGA 1YR9A 3ZNOA 5BVHA 2WW8A 3BFJA 4L0DA 2HA7A 4UEOA 1JDJA 1FXWF 1QF7A 1Y8RA 2H57A 2AQHA 2ZTVA 1OIVA 3PSHA 4QQ8A 2A5GA 4J1QA 4JLWA 2QW8A 4FFRA 4MQBA 1UWLA 1DFIA 1NZDA 4CLRA 4ZYVA 2BM8A 3HVUA 1JJAA 2XA2A 3DMTC 4NS1A 2IYLD 1PFKA 2QXYA 2Q3HA 3NT4A 5K0LA 4BUZA 2ZYHA 1FS6A 4X5OA 2FN8A 4G63A 3IVAA 4AECA 3PNQA 3U3XA 5D3ZA 5K3CA 3I5AA 4BDTA 3ZIUA 4HNSA 5D6NA 3HZRA 4JHLA 3WL7A 1NSTA 3OZCA 4AT1A 2ORIA 4WZBA 4JLPA 4N3AA 1CUUA 4HRYA 3RVKA 5I7WA 4GR4A 4YAJA 5EXPA 3QIVA 2W83A 1KNQA 1MAAA 1HWYA 1OC4A 4GGMX 4UTPA 5JJCA 1N34B 4AXBA 4GH5A 1HSZA 5AI0A 4BCBA 1EEXB 3BTOA 3ICCA 4EQ6A 2PT6A 1GN8A 1VOTA 1N3LA 1NU8A 5T4EA 4EKGA 1VYHA 1YT5A 2GRUA 5IVPA 2BOVA 5G02A 3VR1A 2PS9A 3TD2A 2HYIC 4NU6A 3I34X 3LHDA 5DU2A 3SSMA 4F2HA 3ESBA 9LDBA 2C4VA 1HTBA 2GRJA 6CHYA 3A4YA 2Q8NA 1K92A 2C9DA 4YAGA 2FEAA 1IM8A 5DYWA 3V4PB 3WOHA 1JILA 1FZTA 1P1IA 4E4YA 1B0PA 4Q6WA 2YWDA 3RGGA 1XD9A 4HNQA 1XZFA 5L95A 4DS3A 3HDYA 3RC8A 5DBGA 1GFSA 1RYZA 4MI1A 3RTEA 4P5DA 3T4PA 1SCNE 1NM5A 2HO4A 4NICA 1J56A 4EG5A 5C80A 2C7VA 5CXQA 3M82A 3EWAA 4IUCS 1OGJA 2XI4A 5EWLB 5IT9A 3HJTA 4BP1A 2V96A 1NXPA 2GUGA 1Z0KA 1GAWA 1FCJA 1HYEA 1WABA 4EUSA 5BMOA 3GIDA 3ZBQA 4H7JA 5HZHA 4N6GA 5IVHA 4DRXA 4RIFA 4WLNA 3TUIC 4UEKA 5JMWA 3LKDA 1O94A 3DEAA 1C30B 4ALJA 1H22A 2ZE7A 2H3EA 4Q4JA 4QJ5A 1AS0A 2GN9A 4S1OA 4J0HA 3OOJA 4E2FA 1M5UA 1W1WA 3HGQA 4UNPA 2BYTA 4ZRMA 3RS0A 1FU8A 1NAIA 4IFBA 2XCOA 1K06A 3QTLA 3DQQA 3R7AA 4I81A 2I78A 3EXIB 4K6HA 2OBFA 3BGOS 1T3LA 1WD5A 1H9BA 3NFRA 1U28C 2P2DA 3GEEA 4L9WA 1D6JA 1ZC4A 3T35A 1PR9A 4XVCA 2UYYA 3CF4G 3W6ZA 2E21A 5LWQA 1UMCA 5B1DA 1DFHA 2EQAA 5L6MB 1C0KA 2FY8A 1YE3A 3NBQA 3BH6A 2WYUA 3LCRA 1UOPA 3NATA 3O4IA 2C8JA 4JELA 3T5TA 2ZB3A 2WSYB 4J2TA 3QBDA 1YONA 1DLJA 5D5QA 2FRXA 5LC1A 1VHDA 3G0DA 1RRGA 4ZVLA 5DK4A 4G26A 1V43A 3BSFA 4I1YA 2AFIA 4F46A 4RJTA 4EHLA 3R9XB 4IJVA 4KWCA 1D2RA 4R2XA 4QXMA 1R6UA 2B4TO 2EW2A 3LW7A 2I34A 4Q7MB 4RSHA 5DB4A 3KT8A 4E03A 1NGSA 2BFDA 3F5MA 2F67A 3BE4A 1AUOA 4XJXA 4F72A 3UT0A 1QC5A 4YRQA 5KQPA 5GADl 3RNLA 2Z2IA 4HLUC 4JEHA 4OJQA 3T9FA 3HQ4O 3WZ2A 3SJUA 5JDIA 3SR3A 5CDGA 1WLSA 2OV1A 3GK3A 4GKJB 1V2HE 2CDBA 2VDPB 2P1ZA 4INPA 1T1JA 2ZTMA 1XYYA 3CF6R 3PWKA 4M0FA 3HCPA 3M81A 4CCWA 3AR4A 3BKWA 1AQLA 1JEOA 1RABA 5JBIA 5B4TA 2C9YA 4C6HA 1GV1A 2E5LB 1KEPA 5CT6A 1HUQA 4M9RA 2WNIA 5F7ZA 1L8XA 2JF0A 2PUJA 4JXKA 5E9QA 3WGMA 1YSCA 2GFIA 1V39A 4TTJA 1G8PA 5EMLA 3OCJA 5LDDC 1TK9A 2GPYA 3K35A 3PTLA 2PRSA 3ITKA 4X66B 1V8BA 1WCXA 3ZDXB 3O8RA 1USWA 4DMHA 2O7VA 1QV9A 3C39A 4UMVA 4XUDA 4FIDA 5BYJA 4MW7A 5IAEA 3SX4A 1CB7A 3UF0A 4Z1OA 4PY2A 4DSAA 1S2LA 1P4JA 4EYSA 5DHSA 1UMDB 1WDWB 4MR7B 5IMBA 1XEXA 2JGDA 1UFRA 1MC1A 1ULHA 2Q6OA 2ADOA 2ZT6A 3UCEA 3PRKE 3SJBA 4RX1A 5H68A 3ANSA 4IYJA 2LKCA 5KJ1A 1HKHA 4BS9A 3GL9A 1XZQA 1JN0A 4P4SA 1O8BA 3O73A 3UJ7A 3A6GA 4MUXA 3RSCA 1KIAA 1XKLA 5J2TB 3IX7A 1V8OA 3DC2A 2QAGA 1O6FA 5JSKA 2ZTLA 3IQDB 1OLUA 2Z43A 1V95A 4BNKA 2SHKA 1WMDA 2BGJA 1MN6A 2BUAA 3ESQA 1JNXX 1PLKA 4JT4A 1J99A 4FFDA 4QVGA 2IGTA 5FKJA 2HV9A 4ZVMA 4QYIA 2YXBA 3QKUA 1GFZA 2FZ4A 1CV2A 1JG1A 4AZVA 1SD1A 3UV3A 4RY2A 1YRBA 2PX4A 2PYDA 1B8VA 3AHIA 3KE8A 1UBMS 1CVLA 2NXWA 1BU8A 5CFZA 4RH3A 3TTSA 3UJBA 4MYHA 4H1HA 4FS8A 3ZQ4A 3UA3A 3P2OA 2I76A 3STXA 3ZHUA 4BMYA 3G23A 3DDUA 4UMFA 2FAXA 1WHSB 4K9NA 3GLVA 2QVLA 4RY8A 4XGIA 1KSHA 2AEEA 4MR8B 4CQMD 5L9AA 4BTLA 2CUKA 2B36A 4YMHA 1PFUA 4YAOA 1PJZA 3AR2A 3I6BA 4J9VA 4R1QA 4Y3UA 1WV0A 3G2HA 1A2KC 3C6XA 4RL4A 2GHQA 1UT5A 1JA1A 2XITA 2RK3A 3KHUA 3GFGA 4PPNA 4ZREA 2PUEA 2B92A 9ATCA 1AVTA 1SVNA 4KQGA 4GS5A 3G8DA 3TGLA 1QQTA 1G20A 2NNWB 3UJ8A 2ZUVA 1I3CA 5KOIA 5EPUA 4Z4CA 4BMPB 1UUFA 3FCEA 4CIXA 1RW4A 2XNKA 5FEMA 3DVQX 2G08A 4W5NA 1CRWG 1ZW6A 4JJ4A 5DI3B 5KNBA 3DCNA 5TEWA 3RU3A 4K0KB 4WZAE 4LDZA 1NQWA 2HSEA 2IZOA 2R68A 2VP3A 4NYMR 2JLUA 4A82A 2XUFA 3C3DA 2I1VB 3E15A 3R6WA 1ZRHA 1WPGA 4NDNE 1SXPA 5DI3A 3RAJA 2O2YA 1C2YA 3WLHA 3SQMA 2PSJA 3IMFA 1VPVA 1SVUA 4OFZA 3L2OB 3Q5GA 5ALYA 1VRWA 4LUCA 3TEJA 3LLSA 3ND6A 2V6IA 1SBTA 1TCCA 2WSMA 3O91A 4XAQA 4MJLA 3MWLA 2XNCA 5TPWA 1ATIA 3UXMA 3JRXA 3V8EA 2PUVA 3VYVA 3SFZA 2PKEA 3DMTA 1XB2A 1O95C 3A27A 3TGPA 4NAHA 4LHXA 3N6VA 2PIDA 1ZUIA 3E61A 5E4TA 3RHZA 1UDXA 4J4TA 2GKOA 1GILA 2VAPA 4ID3A 3VTAA 5KNLA 4URXR 1P44A 2B94A 2PGDA 1OU0A 2C5AA 2CJPA 2RGDA 1C9NA 3KVYA 3LXXA 3R77A 1Y1QA 1JSXA 3CEPB 1R6XA 4IS2A 2VK4A 3R5FA 4BMCA 3N8GA 3HP7A 3HY6A 3A2NA 3KQNA 3VSDA 1T9KA 1TZKA 1X6VA 1U3VA 4ZOAA 4XVQA 3NJ4A 1DV1A 3AUJB 2CFCA 3PSAA 4OSPA 3FNIA 1UZMA 2E37A 1TD9A 4PLTA 3DAYA 5AK5A 5TQ2B 4EB8A 2VQ6A 1X7ZB 3TQQA 1CY7A 3OCZA 4U8HA 5JEEA 1P62B 4RKFA 4M8NE 1UJ4A 4RV5A 1U6JA 1QYXA 2B1GA 3U3OA 4B3RB 3SCZA 4QZVA 2JRCA 3T3IA 1Y6QA 2UYGA 4BWVA 3U19A 1XT6A 1OXBB 1OAOA 2NXEA 3P26A 2W71A 1TJ5A 3N0RA 1DIBA 1GPLA 4MSUA 3GOHA 4RKEA 3REGA 4ERNA 4DM7A 2MDTA 2BHSA 1RWBA 2P2YA 3O74A 1GSIA 4MV6A 1B3RA 2CXQA 3SJZA 1U8YA 3I6IA 4RXUA 4EKNB 1SM4A 5AFSA 1E6CA 1MOPA 3GLFB 2O1SA 3TB6A 3Q8XB 3LIPA 3ZU2A 5CA1F 5KKNB 1FX0B 1XZJA 4AK9A 1WULS 2FKAA 3MJEA 1R4NB 1ZJYA 5DLYA 1RDFA 3OD1A 2VTBB 4A0HA 1ELOA 3TLAA 2MINB 1PQPA 2QOEA 4JLBA 5AK3A 4EG7A 3C3BA 2HY7A 2ZI3A 4NOJA 4OOEA 4PGHA 3RW9A 4D97A 4DLLA 3GLRA 4F1WA 1ZIDA 1EVKA 1KI4A 1NDHA 2DUJA 1GNLA 2B30A 2QRMA 2WZBA 3EGDB 4NMLA 3S5UA 2ZXUA 5DXFA 3T94A 2HPAA 4JBLA 3QWHA 4OL0A 1QZXA 1ZUD1 1PBNA 1QIDA 2OBYA 2ZZKA 4J6FA 2OHJA 2Y71A 3FVQA 4OAPA 1TMOA 5JVDB 1LS1A 3ILVA 1MFPA 1ZHHA 1GGEA 4JLAA 4Y1RA 4YDRA 1U3CA 2BDTA 3BRWA 2VHTA 1UF9A 4FNOA 4LJ8A 4RF2A 2A4KA 1YQWA 1GZSA 4YJFA 1H4TA 3GF4A 1OH8A 5JXGA 2B61A 1PT7A 3N7AA 4RK6A 1D1QA 4JA2A 4Q4CA 1TEHA 3JWIA 3TYXA 3EYAA 1EX9A 2V0CA 1G19A 1AGXA 4FD2A 2I87A 3DXZA 3OCVA 3KZXA 4WKCA 2ZR8A 4BYMA 1W9HA 3TM5A 1F17A 4L4YA 4RESA 2QN1A 2YY7A 1GCAA 2ZJ2A 3BG5A 2YJ3A 3CPSA 4MVJE 5BMVB 1M5TA 4XSGA 2ZJ7A 3O03A 5HX7A 5JXWA 1O5IA 4LZPA 4JWTA 4HDCA 1SU7A 4DSOA 5FBHA 2YVUA 3DYBA 3LRTA 5BR4A 1SU4A 5DISB 1G8YA 3O94A 4V02A 2H2DA 3LUBA 1TOAA 1TW3A 4B40A 1A7UA 2P4EA 2OXEA 3LCMA 4XJVA 1ZD1A 3PGJA 5KINB 2O4CA 3CZCA 4E5YA 3PVZA 4BEVA 3RKRA 2IYFA 3T4XA 4WCDA 5JRZA 3GIWA 4CMHA 4RF4A 4L0QA 2V7PA 3OCUA 1Z2NX 1VCIA 5TARA 5EJ2A 1KJQA 3U7EB 1Z82A 2BEJA 3WL8A 2PZ8A 4MQEB 4RKQA 3R9KA 4A73A 1F5SA 3EHDA 1KETA 3GLGA 2FMTA 4OUKX 4Y2RA 3KUCA 1IUPA 3I42A 4NMXB 2C88A 4JI5B 3ZWOA 1V26A 5C7LO 3WIOA 3ZY3A 3MMNA 1TADA 1OFUA 1VIMA 5HIMA 3X1XA 1EWYA 5J4KA 1ORDA 3RRZA 1YR7A 4B9EA 4D45A 4PX5A 1TEZA 5KPDA 3KIPA 4YIHA 1NURA 1N9GA 3FNHA 5DHAA 1BJRE 3TW4A 3NALA 3DTNA 4TRJA 4PYJA 2HMVA 4IDBA 5CURA 3ZI4A 1B23P 3U4IA 2QD1A 4BZPA 3MIZA 1A7JA 3B3AA 4XPIB 3AYXB 3T7TA 2OQIA 5CDFE 4DUZB 4BGEA 1DDGA 5DCUA 1NW9B 3LT0A 1QE0A 3OPMA 3RVRA 4YRBA 5EIOA 1R0KA 1T36A 2EJCA 1TM3E 3QVTA 1XEWX 3LPDA 4EYOA 3JQPA 2ZR9A 2ZIEA 1DT5A 5FH9A 1B00A 5A3VA 1M8KA 5KNCD 2BRUC 4HLNA 1E3WA 1YRLA 3PIRA 3NR2A 1GPMA 2ZAMA 5EKTA 1KA9H 5CBPA 2AI2A 2FPUA 2H17A 3IO5A 2YRFA 4RIGA 4TT3D 3THWA 3RVPA 4KQJA 1IMJA 2JIQA 4TZKA 5J5CA 4BRUA 3I4FA 2CUZA 1A95A 1Q7GA 4YRDA 4FYYA 1Z6YA 5EWJA 3W5HA 2VH2A 4KG7A 1RQRA 3IIIA 1P7VA 2AVNA 1GEEA 2E4WA 3PE4A 1UZAA 5JV5A 4B5KA 1CF4A 3DZGA 3V32A 3U4AA 2Z1MA 4KR2A 5D3MB 5JC1A 7AT1A 5IXJA 3FHCB 1S6YA 2BRUA 4JB8A 3ASZA 4BUCA 3CA8A 1IG3A 5HMLA 3M5WA 2V98A 1BHQ1 3Q3JB 4H18A 2GBFA 3VNUA 4KLCA 2AF4C 4DIOA 2QGZA 2ZQYA 4O8ZA 5EYPB 1V4NA 3G9QA 3TTYA 4WV3A 3S81A 1G5QA 3C0KA 1JR3D 1MTOA 2KQUA 3B20A 4QXRA 3QWIA 4I3FA 5C1BA 1Y7LA 1NULA 3SQLA 1CEYA 1NI5A 4LJRA 2QD3A 2OGZA 3LOPA 4ENPA 2IH5A 5BN3B 3ZCTA 3TPFA 1W9MA 2HUNA 1CEQA 1P1HA 2P5TB 2YUIA 3AEUB 2C2ZA 3HYNA 3QVOA 2C2BA 2QTGA 1OWLA 4HQ6A 4XOIA 3RYCB 3T0FA 2HX1A 1NKTA 3R2JA 2OD7A 3F90A 3I6MA 3S27A 4EWLA 3I8SA 3PFKA 2IUUA 1DEAA 5FULA 4J1TA 4X1YA 2VA9A 3S29A 1JVNA 4FXOA 1QQAA 5JH7A 1ZGHA 4P33A 3BREA 1MX1A 1E32A 3PK0A 1PZGA 4GL4A 3DOIA 4CQLA 4CQNA 1OZHA 5SY4A 1DDOA 1TYBE 1JH8A 2BE9A 3PGLA 2ZYAA 1BXGA 4IINA 1KSFX 4X8HA 4DF3A 4I5DA 3KQWA 1V0JA 5DFAA 1RRPA 1W87A 3EDMA 1S02A 3KKOA 1RZVA 4EGFA 1S0UA 1WNFA 3H9CA 3PFBA 2XWBF 2QBYA 2GO1A 4MV3A 5GVRA 1EP3B 1H0KA 1T8PA 2VYQA 4WOCA 4F06A 1GL7A 1P9OA 1GNPA 3QX8A 4PO9A 1J06A 4LMRA 4N7JA 5LUAA 2BFFA 3IV6A 2WIGA 4TKVB 1WVIA 4LGYA 4X7BA 5EZYA 8GPBA 3H1BA 2YIDA 2EWVA 2R86A 3G2JA 8AT1A 3SI7A 3GRAA 3PRJA 3AFIA 3TXYA 4HVLA 4CIWA 4MVWA 5I7EA 1Q0RA 4CXMA 2EFGA 2VKTA 1DG3A 1SOUA 2OAQ1 1PJ8A 3KYIB 4HH3C 5F1PA 1VLJA 1KDOA 3PUVA 1L3IA 1XTZA 1ISHA 2QMUA 3GFVA 3PQ4A 4IGAA 1S4MA 4JYPA 3VJKA 1RKBA 1BC5A 1AY0A 4RTKA 4AKIA 2JJ1A 1UP4A 2NP7A 4UTRA 1SZDA 3B5IA 3SZOA 4UD6A 1N6RA 1I7PA 2XW6A 3AESB 3ANYB 1NNEA 2ETXA 3KQPA 1NF8A 4RTPA 2EAUA 3ZUPA 5AHKA 3L8FA 1WXQA 5C1OA 1V5WA 3RSGA 4RZUA 4KBYA 2Z6UA 3PKIA 3WGVA 4CR7A 1IB6A 1SBCA 4HDSB 2PGJA 4UU8A 4G86A 2PRJA 2C5HA 2XWPA 3AM4A 2I7TA 3ASYA 1CUAA 2FLVA 1P77A 1CQZA 3EMVA 4ZT5A 1FOEB 5LQSA 3EY9A 3V42A 3ZWNA 3D3KA 1ISSA 2FF5A 3QW4B 4F4JA 3STYA 2ZBEA 5COAA 2FFAA 3FMGA 2IYUA 1C0EA 4HOYA 1J0AA 2B8JA 3D6HA 4J4BA 5IANA 2JIOA 1ZRSA 4MI3A 4D2IA 4AO6A 4V0RA 2J5BA 3A0RB 3FFBA 4LQ4A 2NMVA 3O2JA 2KHZA 3VA7A 1TF2A 2ECQA 1C41A 1PX0A