1ZJZA

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
molecule keywords R-specific alcohol dehydrogenase
total genus 101
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zjzA00
4IIVA 5BQFA 4HNHA 1I0ZA 3PGXA 1A9YA 4NBWA 3K6JA 3BMQA 4XIYA 4LMRA 2WWRA 4JROA 4F3YA 1PIWA 3GT0A 4E12A 1I10A 2JCYA 3E03A 4DIOA 4CLHA 1R12A 1R16A 1PEDA 1X13A 3UH1A 1ISIA 3WYEA 2EKQA 1X7GA 2OFPA 1KS9A 3RBXA 2X5KO 1H94A 3FI9A 4I08A 4RF2A 5ENDA 3GNQA 4AJOA 4AJHA 1ADCA 3U62A 3PQEA 4KQXA 4PLHA 4WEQA 4PG8A 1W4ZA 2AQIA 4GWGA 3WGHA 4BO3A 3DHYA 1NQTA 4BV8A 3WFIA 4E30A 2VTEA 1KERA 4KWHA 3IKVA 4GKVA 3S2IA 3OM9A 1UXHA 4E5KA 1FJHA 3ANLA 3RU9A 2PGLA 5KIAA 4TZKA 2YY7A 4I1IA 1M2WA 3BMQB 3W6UA 4UUNA 5IAAA 2C20A 1J4AA 2NU7A 1YRLA 3JQAD 1UAYA 4XYEA 3I3OA 2WD7B 3MJCA 4BNNA 1EK5A 3CH6A 3PDUA 4IDBA 4ALIA 1S7CA 3GVHA 1WZIA 3TJRA 4BNMA 4FOOA 5JXWA 4BNKA 3PVZA 3QVWA 4Y6PA 4PCVA 3L6EA 4Q3NA 4RGBA 1FDVA 4HX5A 3B1KA 1ISMA 5EPOA 4JJGA 2ZIZA 4UEOA 4QUKA 2RH4A 2EWMA 4BO1A 4O0LA 3EZLA 5ADHA 5JC8A 1YB1A 3HJAA 1Y81A 5HM8A 3DFZA 5JE8A 4CMIB 4ZRMA 1QV7A 1E5LA 2FN7A 3OEYA 4X54A 2E4AA 5TIIA 1NYTA 1WNTA 3LYLA 2BFMA 2NU8A 4OMUA 3MWEB 3B70A 1TT5A 5CDTA 4RCVA 5G2OA 2AEJA 2O4UX 3DBLA 1I3NA 2WDZA 4B3HA 1ULSA 1YONA 5AXBA 3QLJA 1SB8A 5FYDA 5CDGA 1A72A 1NHWA 2NU6A 5EIOA 5TJ9A 4EUFA 1YXMA 1WP4A 2VUUA 3UOGA 4CR7A 1GQQA 3ZWWA 2ZCVA 4LVCA 3UCFA 5IZCA 1FDUA 1SBYA 4CM9A 1T26A 2FPGA 1CF2O 3WGZA 4PG6A 2ZYDA 2RIRA 2LDXA 1E6EA 5JSFA 4R01A 3ETDA 2WD8A 3OQBA 5C7OO 3RBZA 3D7LA 4L74A 2H1SA 2BH9A 1XU7A 2J3HA 1D4FA 1WDKA 3W8DA 1I8TA 5L53A 1HDOA 1LSUA 4PRKA 4JN6B 3DTYA 1UXIA 1ZEMA 4FBGA 5CDUA 1QYVA 1LLQA 5MDHA 3VVBA 4PLFA 3G17A 3DMTC 2FRDA 4H3VA 2W8ZA 4MDHA 1IHXA 1O9BA 1Q7CA 3AM3A 4ZQEA 3NTQA 4FD3A 3BAZA 1JN0A 4OGWA 1EUDA 4R5HA 5U4QA 2PD3A 3O4RA 3K9QO 4TRNA 1GYRA 4PLYA 1IHYA 3ZV5A 3RUEA 3UCXA 4D41A 4BGUA 4WCFB 3F4LA 3BXXA 3FNHA 5C7IO 4RDHA 3KM0A 1MLDA 1TA4A 1LRLA 4YBZA 5THKA 4IY1A 4GQAA 3LT4A 4WPGA 1ADGA 1ARZA 1PWZA 3LZ6A 4A03A 3SXPA 1H9BA 1EMDA 4MVJP 2ET6A 1V3VA 3WICA 1Z74A 1WWKA 3VKVA 1X1EA 4EUEA 2Y0CA 2VYNA 1EQUA 5EINA 4CLDA 2BI8A 2J5RA 3RJ9A 1JWBB 1PGOA 4TRJA 2JAHA 4UREA 2QYSA 5IDXA 1YDWA 3TWOA 4LSWA 2V6FA 2C2YA 3KHUA 4EBFA 5F1KA 2ZB7A 1UDCA 1N5DA 5CFZA 3FCOA 4RZHA 3RFVA 1UZNA 1GTMA 2I5PO 2HMVA 3GVIA 1ZKMA 1ZVMA 4D3DA 4DREA 3PQDA 4IJVA 1FF9A 2D3TA 3GN1A 4K9DA 3QE3A 4NMHA 1YL5A 2JHFA 3KSZO 3OBBA 3WNQA 4CM7A 2Y05A 4DLAA 1LDBA 2NTJA 1LEHA 3BA1A 3NAQA 2NUAA 5HRUA 3RFTA 2R6JA 1WXDA 3LC1O 3HQ4O 3JQGA 4NK4A 2WMDA 1QMGA 2RBEA 3HHPA 2RCYA 1ZJZA 1VL8A 3DBRA 2GD1O 3DZBA 3QWIA 4MKXA 1I36A 3ZWYA 4CUKA 4IDAA 4RZIA 2W2LD 3AI2A 3KUXA 4XYMA 3NYWA 3DAFA 1C1XB 4MIEA 3AI1A 2DBRA 3KYCB 4YJDA 5GMOA 4Q3BA 5JAZA 3F6YA 2HMSA 3PWKA 4OHUA 2PLAA 3ZWXA 3BIOA 5B1YA 2D0IA 3UICA 4DBVO 3JQFA 2FWMX 5TT0A 3ZN2A 5K6AC 1HDCA 4FPXA 3RAJA 2UDPA 5CEEA 4B3IA 3AJRA 4KQWA 2C59A 2X5JO 2DBQA 4KUEA 1XSEA 2YYYA 3ZU5A 3BMCA 4IINA 1SO8A 4MVJG 3TDKA 4BKUA 4PIVA 1C0PA 3LC7O 3MJSA 1RM4A 3A28A 2ZYAA 2YZ7A 2HO5A 2G82A 4PG5A 4ZD6A 4AJ4A 5BSFA 1DIHA 3UGKA 1RJWA 1R4NB 2IEDA 3AI3A 3VTZA 3D0OA 3PHGA 3DQPA 3QVSA 5A03A 4BNHA 4DPLA 4DQXA 2B83A 3ROMA 4RPKA 5H83A 1N1GA 1NVTA 3DZIA 2XF8A 4BMVA 1LBEA 4CLOA 1XU9A 1T2EA 3COSA 3PIDA 2X23A 4JLWA 1ML3A 3ZU2A 1E3IA 7MDHA 2NTVA 3E82A 3WQQA 5C5IA 2NVUA 3Q9UA 4UVEA 3JQ9A 3VZRA 3DAPA 2I9PA 1V3UA 3KZVA 4M87A 1KEVA 1I2CA 1PZHA 3I6QA 2Q2VA 1OFGA 3N7UA 5T67A 2ZK7A 5COBA 3RROA 1X0VA 3WTBA 3ICPA 5KVQA 4LVUA 1ZXBA 5KJCA 2CUKA 5F1PA 3G49A 4M55A 5EESA 3F1LA 3PDJA 2WYUA 1BSVA 1IB6A 1K6IA 1L7EA 1H2HA 5CG2A 3I6IA 2F00A 2DTXA 4OQYA 1M66A 3EMKA 5K9ZA 4MVJH 5JNLA 3WNVA 4U8GA 1SB9A 3C85A 5I8ZA 2VT3A 4DUPA 5ICMA 2G1UA 3KSUA 1U4OA 3ROPA 4FGSA 5BSHA 3GG9A 3OH8A 4Q39A 1JAYA 2NVUB 1DC3A 3RBVA 3GEDA 3EVNA 2X0NA 1Q0HA 3E48A 1NASA 3CXRA 2W2KB 4GGPA 3IDSA 3W4JA 4YT4A 1DOHA 3ZHBA 3A06A 4YA6A 2OMEA 1YQGA 5JCJD 4EW6A 2PD6A 1NWHA 1D7OA 2AE2A 1WVGA 3H3JA 4L8VA 2JD2A 2ZKLA 3FBGA 4BO2A 3SJ7A 3ZWMA 1LJ8A 4GBJA 4J4BA 3HN2A 3ONFA 1P3DA 1M75A 4J3FA 1XKQA 4CM3A 2A9FA 4K1LA 3AOEC 2I3AA 2WJPA 4OXKA 2FP4A 3ASVA 2EG9A 1K89A 5ES3A 1DXYA 3RD5A 1H9AA 3H9JA 3PHIA 4E6PA 3DWFA 2X0JA 1JVBA 3BTOA 1BW9B 1PGNA 1E3WB 3F1KA 4NJMA 2HRBA 3WBBA 4URFA 4UVGA 2BLLA 3N58A 4FFLA 2TMGA 4B3JA 2PKRA 3EYWA 4DC0A 1DFGA 3DZGA 1ZMOA 3FPCA 5L7YA 1GV0A 1LI4A 1LXCA 1HZJA 3ENNA 3PHLA 4E5MA 3LF2A 1GUFA 1XA0A 4L4SA 2VZ8A 2EF1A 3RUAA 4B4VA 4YAIA 4FB5A 1PS0A 3TZQA 4MKRA 4BO9A 4UVHA 4FCCA 4JK3A 5A9RA 3B6ZA 3UCEA 3PYMA 4KOAA 4IZIA 3WQSB 3OFSA 4YRDA 3QWBA 3R1IA 1D3AA 1X14A 1X15A 3CPSA 3DBRB 4XGKA 5DBIA 1SZJG 3FPLA 1YE3A 3IJRA 3WGTA 2J3KA 4PRLA 2FHSA 2V6GA 3BHJA 4MP8A 5EERA 3VPHA 1E0DA 1GEEA 3WGGA 3HFSA 1HE3A 1YB4A 5THQA 3ZHYA 2ZTMA 4TKMA 3L4BC 3ZW9A 2Q46A 4RQUA 3T7CA 2G17A 4NBVA 1PJTA 2WD7A 2FZEA 3OHSX 3QY9A 2PKQO 5J23A 3SVTA 1TT7A 1EBFA 4BIIA 2CF6A 4CV1A 3GPIA 4KUGA 3DZHA 3GA0A 1C0KA 4WCDA 4MP6A 1DO8A 1P1KA 1HE2A 3JYOA 4GI2A 4RVHA 1WDLA 3DOJA 3G1UA 4UEKA 3TL2A 2XOXA 5IJZA 3OEWA 4L4XA 4CLXA 2Y93A 1DLIA 4R16A 4J0FA 4MINA 3L9WA 4HFRA 2Q3EA 3F46A 4RF4A 4J1SA 5G0WA 4B7XA 4F6LA 1UDBA 4TKLA 5JDIC 3GEMA 4RLHA 4PLZA 2YFHA 2O3UA 2I99A 2VWPA 3G3EA 3ONEA 3ZZNA 1OAAA 8LDHA 3DBHA 5KWEA 3IS3A 2C7GA 5BNTA 1F8GA 4DTIA 1FXSA 1R4MB 2EXXA 4EYEA 4DMLA 5A3VA 3DONA 3JQ7A 4ID9A 4P4GA 4LMPA 3VTFA 4J1NA 1P9LA 4M89A 1JKFA 3E18A 1U1IA 1XLTA 5L4LA 2GERA 4I5EA 4BVAA 5IFLA 1C0LA 1T1SA 1V6AA 4TRRA 4BQPA 4L73A 4N18A 1I5RA 1U7HA 4BV9A 3VPSA 3RJ5A 2HJRA 1X7HA 3L77A 5DP2A 3KLMX 4BO4A 4GH5A 1E3SA 1G1AA 1ADFA 5T8KC 2YV1A 4J1TA 4D43A 5TJHA 4XR9A 1UP6A 4PG7A 1IY8A 4IUYA 1ZCJA 3A1NA 2O2SA 2AG8A 4MO2A 4BL5A 1DC5A 3I4CA 1UUFA 4GSLA 4AJNA 4PN3A 1I24A 1NX6A 3HDHA 3I9KA 1W73A 3PLNA 3OA0A 4CMIA 3IAHA 3NGXA 4ZRNA 1J49A 4XD2A 1L7DA 2QIOA 2CMDA 5KJFA 2O3RA 1GDHA 4XCVA 4D44A 3GQVA 5B4TA 4IIUA 2Y1EA 5JC1A 2NQ8A 5ILGA 5U1PA 4CM4A 1HYHA 1IULA 2EHDA 3KB6A 3MJEA 3ZU4A 1Z7EA 3ST7A 2YW9A 2VYVA 3R3JA 2EERA 1J0XO 1XEAA 2I3GA 1RM5A 1YB5A 2CNBA 4DQVA 3H2ZA 3TOXA 1VLLA 1QP8A 2FPIA 4L0QA 4IJUA 3K31A 1BHSA 2PA3A 1LX6A 2QRKA 3DBLB 5EMHA 3TFOA 1TT5B 3H9EO 1KVTA 4NK5A 3RFXA 5FEUA 3QA9A 5GZ1A 1PS8A 1IOLA 3DHEA 3JQCA 4XYLA 4O59O 5JDIA 2P4HX 2DUWA 2YFQA 4UULA 5T64A 2DAPA 3NKLA 2Q1UA 3ON5A 3JYLA 1JLLA 4PLPA 4M86A 1UZMA 5FWNA 3DTTA 4P4LA 5G0UA 4BB6A 1PJ4A 5HWSA 2Q99A 4OL9A 4IS2A 2B0JA 4G2NA 4HNGA 1CERA 4PVDA 4QO7A 3WYBA 4I9UA 4FDAA 3JQEA 3E5MA 1KC3A 3TOZA 1CIVA 3WGQA 5KVCA 3VC7A 3GOHA 3HNPA 3MOIA 4BNIA 4CMHA 4EUHA 1XELA 6LDHA 1B8PA 2YJZA 3DZKA 5JO9A 4R69A 4B7UA 1V9LA 2I65A 4N5LA 2XXBA 3DHNA 2PR2A 4Z6KA 3JYPA 3ZNPA 2JCVA 3FTPA 1GAEO 3KXDA 4R1UA 3AU9A 1NFFA 3JYNA 3MCVA 2VZ9A 2D4AA 3JQ7B 3WIEA 1YJQA 2RAFA 1S6YA 1NNUA 4KP7A 4A26A 2JFHA 1R4MA 3GLQA 1C1DA 3W8FA 2VHXA 1BMDA 2OHXA 4YJGB 4BOYA 1A4UA 4AJ2A 3DBHB 4M54A 2C7VA 4ND5A 2FOIA 4QXMA 4F46A 3WMXA 1PL8A 1K6XA 4J7XA 4IMRA 2JHGA 5ICSA 2IYOA 2PGDA 4TROA 1LQUA 4G81A 1Q7GA 3FRJA 1T25A 3PGJA 1B2LA 1WW8A 2HMWA 3CKYA 2V65A 3FF4A 4GX5A 3K8ZA 3MTJA 2YV3A 4JP3A 5H81A 4R3WA 1YBMA 2PFGA 3HB5X 4J91A 1PS9A 1YGYA 3ANMA 1CETA 1A5ZA 2OOSA 3L6OO 1MUUA 3GF4A 1PZFA 1DIRA 1UJMA 3QSGA 3A4VA 4RVFA 4YAEA 1U3UA 2HAEA 2G0TA 3ASUA 2Y0EA 3CE6A 3EY4A 3U4DA 3GN2A 3DDNA 2OGUA 1EQ2A 2VUSA 3CINA 4GX1A 2P68A 3O9ZA 3WFJA 4IGEA 2PNFA 2H5LA 5B37A 1JW9B 1PR3A 3AUTA 4CMEC 2JCXA 2X8LA 2XXJA 4XKJA 4ZU3A 1KETA 2VYND 3MTGA 3IL2A 1N9GA 4UAGA 4XYBA 2DFVA 4RO0A 1AN9A 1A7KA 3JD3A 4J7CA 3D1LA 3BMNB 4KUHA 4ND1A 1ISFA 4AICA 1YVEI 4HP8A 1U8FO 1M67A 5HS4A 4O63O 4E13A 4R1TA 4Q3EA 4DA9A 1T2AA 4GPD1 2HU2A 4S1VA 5A9SA 1QYWA 3F9IA 4ND4A 4OKIA 1CJCA 5I7VA 4G5HA 5KVVA 4BKQA 1SAYA 1CYDA 1UR5A 4DYVA 3I9OA 4BQRA 1XWFA 2EW8A 2J3JA 2JFGA 4J16A 1HL3A 3DR3A 3HSKA 2IEBA 3RSHA 4C4OA 5MGBA 4BB5A 1E3WA 2VRCA 2PGJA 4AJJA 2VRCD 5T6BA 3T7EA 3GAZA 5L40A 4RORA 3WWYA 4LCJA 4FJ2A 3W6ZA 1DJNA 2ILTA 1WDMA 4EITA 2DQ4A 5CDSA 1P33A 5TSDA 2QRJA 4EJ6A 2G5CA 2BFOA 2AEFA 5BSEA 4PLCA 5A3JA 5KJ1A 2WE7A 2B69A 3IJPA 4DBZA 5HTOA 1SC6A 4B79A 4Z0HO 2HMTA 1PQWA 3FN4A 3GDFA 4RPGA 1HTBA 3KEQA 4N54A 3E8XA 5BR7A 4J90A 2CY0A 4CLEA 1ONNA 1EVZA 2B4RO 3AFMA 2Z5LA 1N2SA 4L4RA 3ICCA 2DKNA 4LGVA 1I2BA 4PLWA 4NH4A 4BKOA 4YPOA 4CODB 2Y1DA 1N7GA 4B4WA 2NM0A 1JA9A 5JPIA 3FTNA 4BKPA 2X0IA 4Z3DA 1RKXA 2O4CA 3JQ8A 1FMCA 5AQ1A 4IGFA 4JJFA 4PZDA 3G1TA 4WNIA 1I2ZA 5TNXA 4XB2A 1SMKA 1ZZEA 1A27A 2SCUA 1O6ZA 2E49A 3NUGA 4AJIA 2DPHA 4GLLA 5BNFA 1Y6JA 2NU9A 3DL2A 3NV9A 3TN7A 1YS4A 5ENVA 1J6UA 3PK0A 3VH1A 1OI7A 1DRVA 5JAIA 3ENKA 4GVXA 3CSDA 4TWRA 1UH5A 1BWSA 3P2OA 4I9HA 1Q0LA 2B35A 2PZMA 4J7UA 5L3ZA 3QW2A 3UHAA 4ESOA 1ZMTA 5CHEA 5DP1A 4OSPA 4EEZA 2GGSA 4J4TA 4CQLA 1QRRA 4E31A 4Y98A 4DPKA 4CV3A 2GDZA 1EUCA 2IXBA 2VHZA 1ONOA 4II2A 3O8QA 1R15A 4JXKA 5A1TA 1NR1A 4GX0A 4Q3DA 3RUFA 1IE3A 3JD1A 3FWZA 4AG3A 2GZ2A 2JKVA 3INRA 2B37A 3JTMA 5A06A 2VCYA 5COAA 4DLBA 1R0LA 2Q1SA 2P4QA 3KVOA 4DIBA 1VJ0A 3FWNA 1ISHA 1K2WA 4LW8A 1CQJA 1F06A 3KEOA 1GUYA 3IP1A 2CDAA 3LLSA 2B5WA 2EV9A 4OH1A 5B4VA 1P1HA 4LCEA 1PGJA 2I67A 4PVCA 1ZBQA 4NBTA 1QYCA 4YVFA 1UP7A 3PLRA 1FK8A 3GGGA 4LSMA 4XB1A 2O3TA 3HADA 3RUHA 3JD0A 3S2FA 5JY1A 3MWDB 3Q11A 1V35A 4TSKA 3BTUA 1MA0A 5KTKA 1ENPA 2D5AA 4A2CA 1EE2A 5U9CA 2J8ZA 2YDYA 1ENOA 3H7AA 3HDYA 1NVMB 4J4HA 4QEDA 1GPDG 1V8BA 3TL3A 1DPGA 1KY5A 2ZQZA 3BMNA 5JBIA 2DTDA 4JQCA 5TS3A 3AUAA 1WZEA 5F5LA 4CQMA 1YL7A 3PFWO 3DEYX 5AVOA 2FZWA 3BTSA 1EVYA 4QFCA 2X1HA 1Q7BA 2YV2A 4XDZA 5KOIA 3MJVA 1DC6A 3BHIA 1GFSA 3DB2A 2HLPA 3WR5A 4KTTE 2R2GA 3ZDFA 2E37A 2IXAA 4LISA 3WJAA 1HKUA 3LT1A 1NHGA 3HFGA 1V3TA 4WKGA 2YHIB 4PZCA 3IKTA 1HDYA 1Y8RB 2PH3A 1CEQA 1EVJA 1EEHA 2E48A 3BMOA 4U6QA 3OF2A 2HKIA 1DHTA 3CUKA 3M2PA 1P44A 1GUZA 1GZ6A 2GF2A 3OICA 4R5MA 3MOGA 5ER6A 4D45A 2IZ0A 4ILKA 1I30A 2IRWA 3GUYA 3GVCA 4HWKA 1QSGA 4FR5A 4DIFA 3NDJA 5CDYA 1B26A 3RASA 1LDEA 1YKFA 3JQ9C 5DBGA 2B4QA 2GN8A 1NPTO 1P45A 5TLSA 3TZHA 4CM9D 1VJTA 2BRUA 2Y1CA 2OBNA 4R51A 1HLPA 3E1KA 3L4SO 5IDYA 1LSOA 1PGPA 3S8MA 3LK7A 4S3MA 5T57A 1MFPA 2D5CA 2B4TO 2GASA 3H3FA 1NAIA 3SC4A 4WK6A 1NWCA 1BXZA 3H2SA 2VT2A 2Z1NA 2ZTUA 2NWQA 2FSVA 1DIGA 2OP0A 1VM6A 2QG4A 1NPDA 3GFGA 4ZA2A 2AHRA 4U7WA 1CDOA 4J9VA 4GAEA 1UDAA 2JFFA 4ZHSA 3M1LA 4ZQBA 4IDDA 1E1MA 4K6CA 1P1FA 1IYZA 1B8VA 1B14A 1OC2A 3RIHA 4E2YA 1XDWA 1F17A 1DIBA 4J6FA 5IF3A 3U09A 3OJEA 3TZCA 1H6DA 9LDBA 2VNAA 1AHHA 1NQ5A 1TB4A 1Q0QA 2NTNA 4AJEA 3GMDA 1P74A 3WGYA 1LUAA 1OOEA 5KCZA 4YCAA 1HSZA 3PYXA 3Q2KA 1K0UA 4NFYA 4FIZA 4EJ0A 3B1FA 1YOVB 2Q1WA 2P5UA 1X7DA 2EEZA 3PEFA 3F3SA 4FQ8A 4NIMA 1NAHA 2P5YA 1H93A 5F1OA 1QYDA 3OA2A 4WLNA 4M1QA 4NU6A 1HT0A 4E4YA 1E7QA 3H9QA 1G0OA 4YJFB 1BXGB 1DFHA 5LC1A 2IDZA 2X4GA 5DULA 4NNJA 5F5NA 4FJ1A 2NVWA 1U5AA 2IODA 3AM4A 3QP9A 2WYWA 2EKPA 1Y8QA 3RC7A 2JL1A 3GHHA 5DOZA 3W1VA 3WB9A 4CR6A 4XQGA 4B8WA 5CP8A 3IUPA 1QXSA 2Q2QA 3NTOA 1RM0A 4Y9DA 1UXKA 3W8EA 4E33A 5F21A 4R54A 3AFNA 4YJHA 5IG2A 2VWHA 3PFFA 3HUDA 3QIVA 2I66A 1LU9A 3O03A 3PHJA 3PXXA 3B1JA 4PG4A 1Y9AA 1XQ1A 5ITWA 5T5QA 2CFCA 3JQAA 1HRDA 1B3RA 3D3WB 3T4XA 2A94A 1VKOA 4YJHB 1GL3A 3UXYA 4B4UA 4PGFA 1A7AA 3ROQA 1MX3A 1DLJA 4O1MA 4BO7A 1H6CA 1ORRA 5G4KA 4DRYA 3F5SA 3CIFA 1R0SA 2A35A 1K6JA 3INGA 4GLOA 3WLFA 4U0JA 4WLUA 4IDFA 1PJBA 5B12A 2O7QA 4E2ZA 1HXHA 4UUOA 2HMUA 4XQ9A 3D5TA 1EBUA 1DEHA 1NVGA 1ZUD1 2V6MA 1YJ8A 5G0SA 2BFPA 1LLDA 2HDHA 2BGMA 3UKOA 2VYVD 1DRUA 2YUTA 2Z1MA 2GLXA 1MP0A 1RYDA 2O7SA 3AUSA 4WGGA 4E5YA 1KVRA 3GGPA 2I76A 2VRBA 1HWYA 1B16A 3GHYA 5DDIP 4AL4A 4K28A 5G0VA 4IXWA 4WEOA 4FFNA 3PWSA 5L9AA 1B7GO 5EN4A 5COQA 1HDZA 5TF4A 2DC1A 4BNZA 4W6ZA 3HZZA 4CJXA 3I4FA 1E3EA 3DZFA 3FNEA 3K30A 2HK9A 1MC4A 3DOCA 4R4JA 3QWAA 1RWBA 1U3VA 2G76A 4QQRA 3QJ5A 4JBIA 3DBVO 4P4NA 4Z9YA 4B7CA 3TZ6A 4WASA 4YXFA 2GCGA 2BI7A 3O26A 4WUVA 3UN1A 1F14A 2R00A 3LF1A 3PTZA 1IZ0A 3TPCA 4NU5A 3C7AA 5JDCA 1GCOA 2OL4A 5DCWA 2D1YA 5ER9A 3LVFO 3BZUA 2WTBA 3C1AA 4LRTB 1KEUA 4HFJA 5IDQA 3GUCA 3SBOA 1PJLA 4YB8A 4UUPA 5JDCC 2JD0A 3BMOB 1SCUA 4RL6A 3HB4X 1PTJA 4W4TA 3S2GA 4DC1A 3U4IA 4YAKA 5A04A 5C3MA 3I9JA 1VI2A 1ZO8A 3SEFA 4BNYA 4EEXA 4W9NC 3ITDA 1W0CA 1PJ3A 2QZ9A 4E32A 1MGOA 1LDMA 1AXGA 3IC5A 4DXHA 3VHRA 4CR8A 1GZ4A 3LLVA 3K73O 1PJSA 2X58A 3PI7A 3U4HA 1ZEJA 2CD9A 3D5QA 1H6BA 3GZNB 4OXYA 3ZHXA 4BNLA 4CMBA 1BRMA 1YBAA 4MP3A 2BMAA 4RLSA 1YH3A 3QVTA 4D0RA 5DT9A 3WTCA 4D3FA 3PJFA 5AOVA 4DPMA 3ANNA 2OUIA 5A4DA 1KVSA 4OYRA 2UYYA 2RHRA 3GMSA 1VRWA 3JQBC 5L4NA 3GH3A 3I1JA 3E5RA 3GAFA 1ENYA 4XX0A 1W8DA 4L9RA 1WPQA 4KZPA 1XQ6A 3H5AA 2QQ5A 2QX7A 1LTHR 3C7CB 3KLPX 4NR0A 4YDRA 2X86A 1BXGA 1ADBA 1NP3A 3A9WA 1E7SA 2C07A 2J6IA 5JS6A 2DTEA 2HK8A 2DT5A 3WG9A 3GR6A 2FR0A 3C1OA 2NSDA 2Y1OA 4MIOA 3EHEA 3U3XA 1PR9A 1ZK3A 4YAJA 5G0TA 2O23A 1JDJA 3MEQA 1WLYA 2H63A 3KETA 2X9VA 3OJOA 3V1TC 5I9LA 3AY3A 3OIFA 3ZH2A 1BG6A 3SLKA 4HY3A 4PFJA 3PJEA 2DBVO 1A4IA 1JKJA 3DXFA 4CMKA 2W98A 5C37A 1D1TA 3GY0A 3NEPX 4QX6A 2HCTA 1U28A 2B36A 2WYVA 4BNWA 1ZSNA 5JYEA 4ZVVA 4XR4A 2ZYGA 1UXJA 4WCFC 2PK3A 5ITVA 3H9UA 2X9GA 4ZN6A 1LSSA 4R3NA 3GRPA 1HEUA 4R1NA 4M49A 2HUNA 3WOHA 5DN9A 3E9MA 1HE4A 5IXSA 3MJ4A 4MVJF 1LDNA 2PWZA 3H4VA 4JNKA 4MVJI 5A5FA 4W7HA 3ADOA 1ONPA 1GYPA 2ZTVA 4E0BA 3UAGA 4CPDA 3F47A 4OKNA 9LDTA 3EC7A 1P1IA 1SNYA 1Y9EA 3H9GA 3U49A 5IN4A 3HG7A 1CWUA 4UVIA 1DBVO 3S2EA 3KYDA 2Z95A 2EJWA 1VL6A 1OMOA 3X2EA 4CMCA 2AXQA 5FFFA 1E6UA 3JYQA 5DNAA 2ZB4A 3ZI0A 4MVJA 1KYQA 1H0KA 4Y6RA 3EDMA 1AHIA 4DWVA 1EDZA 1LRJA 2VN8A 1T4DA 3I9MA 3ETGA 1Z75A 4YT8A 4J2HA 3U4CA 3QVXA 4IPTA 3QWHA 3B20A 3ROKA 2O3SA 3M1AA 5TX7A 1O95A 4G65A 3NGLA 1E6WA 4RPJA 2J5KA 4RDIA 3U0BA 1QLHA 4C7KA 2GNAA 1I3KA 1GY8A 1K5HA 2FR8A 5KJ6A 3Q0EA 3V8BA 3D3EA 1G6KA 2BELA 3V5NA 1DSSG 4YR9A 2EP7A 1AGNA 3K96A 3FSRA 1KVQA 4UVDA 5CPBA 4BNXA 2B5VA 3ITKA 1DC4A 5JW6A 1Z73A 1YWGO 4B4OA 3GZ4A 5I7SA 1GEGA 1KVUA 3WGOA 2VZ0A 4Q3AA 5LDGA 4NHEA 2ZJ0A 1HYEA 1MV8A 2VHVA 1NTOA 1SEVA 2OBYA 4CUJA 2CDCA 4Q9NA 1PL7A 2HK7A 4QSMA 1YBVA 3UUWA 1GADO 3PPIA 5JCXA 4A73A 1Z82A 3H6KA 1NFRA 4OM8A 1MXHA 5JY6A 3FR8A 4EGFA 3BHMA 3OQ1A 2AEMA 2XAAA 4IMPA 4RVUA 3PZBA 4CL3A 4O5OA 3HN7A 3K2BA 3KOUA 4A27A 1X0XA 3GPDG 4NFSA 2TMDA 1T24A 1EDOA 1BTOA 5G4LA 3V1YA 2H9IA 4WOJA 4AJLA 4MJLA 3RKRA 5KKCA 2GSDA 3QWFA 3F5QA 3G0OA 4Z0PA 4E21A 4YYZA 3KBOA 3V1UA 1U8XX 3PJDA 2D59A 3EAGA 3P5SA 1C3VA 3L4BA 3UW3A 2C54A 4LK3A 4XRRA 3K5PA 4JX8A 2WSBA 2F1KA 3W4KA 4BNTA 1N92A 1E7YA 1KIFA 1T2CA 4O6VA 3O8QB 1Z6ZA 2C2XA 1T2DA 4ALMA 4JP2A 3AOGA 2EKLA 1P0CA 1GQ2A 2AW5A 5JYDA 3C7DB 1NPYA 2AQHA 3ZWCA 5HA5A 5AYVA 1ZXLA 2HQ1A 2C0CA 3D4OA 1C1DB 2J5QA 3JD2A 3I52A 3HWRA 5F3RA 3F4BA 1M6HA 4OQZA 2GO1A 3RU7A 3H5RA 3JQFC 4AJKA 3LQFA 5JO0A 1JVSA 4TQGA 1DB3A 3NT5A 4OAQA 1PWXA 4WOKA 1MG5A 3ZWAA 3JQ6A 3PYLA 4WE3A 4CM8A 1LRKA 3I9NA 4WCFA 5AXAA 4QTZA 4YACA 5BNIA 4W7IA 4FC6A 4XJSA 1U3TA 4CV0A 1I32A 2POQX 1GD1O 2HSDA 5ILOA 5DZSA 3KRTA 2D2IA 1E5QA 4R9SA 3WDSA 2Y1FA 1J5PA 3TRIA 4FSHA 4DYDA 5AXCA 4Z9XA 1C0IA 3EZYA 2X7HA 1HZZA 3KYDB 5DF1A 2JJYA 3ZU3A 1HDGO 3RWBA 1QORA 4ZQHA 1KBZA 4RJTA 3HE3A 3NTRA 3NX4A 1RM3A 4WECA 1Y5MA 4AJ1A 2GN4A 1R66A 3NJ8A 3M6IA 1VSUA 2BF7A 3AY7A 4JIGA 4XGIA 3LDHA 2Y99A 1ID1A 1JAXA 2Q1TA 1GCUA 2PZJA 4IQ8A 3ZWBA 1ISJA 5I9MA 5A05A 5GZ3A 5KNLA 3TSCA 3ZCXA 1C14A 1LLUA 4IJKA 3GGOA 2W2LA 3TFQA 3UFXA 1QYXA 1MFZA 3PP8A 4U5QA 4W82A 1IZ9A 5TC4A 4D3SA 1O89A 2E6UX 1M6WA 1JKIA 1ZIDA 1U2DA 3UVEA 3MJTA 2NVBA 5KJEA 2O3QA 1ZK0A 4BMNA 1OZAA 1YQXA 1GU7A 3QHAA 1GPJA 1MXFA 4N7RA 1PZGA 1TVEA 5TRTA 2WE8A 4F6CA 3BYZA 3WXBA 3D3WA 2ZCUA 2GN9A 2O48X 3JQAB 4ALKA 1WMBA 2Y67A 1ZK2A 5IXYA 1DJQA 1KC1A 3GFBA 4A0SA 3VH2A 1O5IA 1XCBA 2VOEA 4IZHA 1VKNA 2DUUA 5JFOA 1Q1NA 1AUPA 1PJCA 1BGVA 4JCOA 3RUCA 1ENZA 1DDOA 1JWAB 2X6TA 4FFMA 4QFDA 4BUCA 1O94A 3C8MA 3IMFA 3FR7A 2AQKA 1L1FA 1VSVA 3EW7A 2NLOA 1B0AA 1A71A 1BVRA 5IZCC 7ADHA 3AM5A 4BO0A 1M76A 3KV3O 2DBZA 3EUWA 1HLDA 2Q4BA 2X22A 4GWKA 5I8WA 3DMTA 3OP4A 4ZQFA 2NV6A 5T8KA 4HKTA 5KVSA 1PL6A 3ABIA 3WQRA 4YJFA 3GC6A 5BT9A 3E9NA 3Q3CA 2H6EA 4DGSA 5L95A 3DOOA 3D64A 2PH5A 1Z7BA 4Q3CA 3P2YA 4J9UE 5CEJA 4BNUA 4HXYA 2GZ1A 4HUJA 4H15A 1DRWA 1KY4A 1XYGA 3RQSA 3P19A 2EIHA 2NNLD 1BXKA 1LSJA 2JD1A 3OMLA 4IJWA 5TGDA 1ZNQO 1ZK1A 5H82A 4A7PA 4UEJA 3EVTA 4OO3A 4XDYA 2GZ3A 3AY6A 4YAGA 1D1SA 5JLAA 4DVJA 1BVUA 4PLTA 2GPTA 4ZQGA 4WLEA 3OQ6A 1GQYA 2ZTLA 3ZW8A 2YQ4A 1B15A 1E3LA 1GYQA 2EP5A 3X2FA 4AJPA 1A9ZA 4OSOA 5I9NA 3I9LA 4Y67A 3WYCA 5LCXA 5L45A 2VWQA 1T1RA 4RQTA 4D7AA 4HV4A 4BO5A 1LDYA 1TI7A 1PU2A 3FNGA 3PIIA 4I9NA 2VWGA 2C5AA 4IXTA 3GNTA 4NG5A 1LLCA 4IBOA 4E2XA 3LC2O 4ALNA 1KOLA 3R6DA 3IP3A 3QRWA 5FF9A 2A92A 1E7RA 3LU1A 3WGIA 2O3JA 1G0NA 3VKUA 3ZWPA 1T2FA 3S1LA 3AU8A 2OORA 2OZPA 4YTEA 4BO6A 1U7TA 2VOJA 4NDNE 4NJMB 2ZB3A 4XJTA 5EQFA 3IOYA 1HYGA 2D8AA 4H16A 4FFPA 3ZHZA 4R1SA 1E3JA 1YQDA 1U3WA 3PRJA 2DLDA 5JMPA 3VH3A 4FS3A 3WMWA 2Q45A 1HSOA 3CMCO 4CL8A 3DO5A 1Y8RA 2QRLA 2YHIA 4R9RA 3OSUA 1E92A 2VHYA 1YL6A 3FBTA 4YQYA 2VUTA 4K6FA 1MB4A 1OC4A 2OP1A 3JV7A 5G4KB 2P2SA 5GZ6A 4KMSA 3SJUA 2EGHA 3PQFA 5JMWA 4ROSA 1IUKA 4D0SA 4XWYA 3VOSA 4IQGA 1OBFO 3AWDA 2FR1A 1Y7TA 4GL4A 1LQTA 1YOVA 2AA3A 3EGOA 3OECA 4L75A 3K2EA 3OJ0A 4WLVA 1WMAA 1BDBA 2W2KA 4IDGA 1BW9A 1H2BA 3NDIA 4F45A 1Y5RA 1VL0A 3VPFA 4II3A 3DAGA 3RC9A 2UAGA 3EK2A 4RF3A 4PLGA 4J0EA 1PQUA 2C29D 4GMFA 1T4BA 4U0KA 4EZBA 1AE1A 2VTDA 1Y8QB 4MVJE 1DHRA 2ZATA 4WNCA 3VDQA 1YO6A 5JAQA 3VH4A 1U9JA 2QHXA 1U2GA 1IL0A 3C3XA 4PZEA 4CMJA 3OETA 2P9EA 4LRSB 1PGQA 4W9NA 4D79A 3H65A 2Q2WA 4BHTA 1E77A 3VPGA 1ZJYA 1R6DA 1LA2A 4BNJA 2VHWA 1DAOA 1DAPA 3INTA 1F12A 4YT2A 5A5EA 2Y68A 1E1NA 2QZZA 1UP4A 5AXDA 4NFHA 3RI3A 4ZICA 5JAMA 4BMSA 4PLVA 1E1KA 3SX2A 3ZV3A 4ONEA 1NFQA 2CF5A 4OIMA 1PJQA 3ZNQA 1U4SA 1VE9A 1P1JA 1K3TA 1XIVA 3GK3A 5HBRA 3BTVA 4L76A 1HE5A 1NQOA 4P22A 4UUMA 2DVMA 5L51A 1UXGA 1VC2A 1RYEA 3L0DA 2BFAA 2IZZA 1LC0A 2NADA 2O50A 2YDXA 3RKUA 3AW9A 3N74A 4CLRB 4EI2A 2NQTA 4ZGWA 4MOWA 4E3ZA 5I7EA 3JQBA 2EGGA 3PHHA 2IZ1A 4XGNA 1MC5A 1XGKA 3GEGA 1HDRA 2OXIA 2RH8A 3MZ0A 4XZ3A 1LNQA 2O2YA 2ZB8A 3RVDA 4CM8B 5DOVA 3GVXA 4MVJD 8ADHA 1I3LA 4HBGA 2V6BA 1R37A 2AQ8A 1QV6A 1SOWA 4IQ0A 3STHA 4JJIA 4NPCA 3LT2A 4NI5A 1B3BA 4TVOA 4QT0A 1YDEA 4FJ0A 4IS3A 4KTVE 4XQCA 3H5NA 4YRAA 3GDOA 2FMUA 3RC1A 5CG1A 2VNSA 2UV8A 5DCUA 5CAEA 2FY8A 3WJ7A 4CQMB 2HRZA 1NBOA 4CLOB 3JD4A 2X0RA 4ND3A 1TXGA 3IQDB 2FPPA 3KYCA 1KEWA 2FSSA 3CMMA 2P9GA 3R3SA 3RUDA 4WJZA 3I83A 4A10A 5L7WA 1F8FA 4GKBA 4JBGA 3VDRA 3DZJA 1GZ3A 1FDWA 4WLOA 4J49A 1R4NA 4XYGA 3PWZA 3VPXA 3WIDA 3ZWVA 4ZJUA 1E1LA 2Y0DA 4JGBA 2PTGA 1QR6A 2PY6A 3AK4A 3KSDO 5IN5A 4NQZA 3ZV6A 2Q4EA 3CZMA 3O38A 4CMEA 4BGEA 4HADA 4WLFA 3QVOA 5K0ZA 2BKAA 1BDMA 2JAPA 3BMCB 3R0IA 4Y8VA 4Z9FA 1MG0A 3V2HA 5C7LO 4XIJA 1VPDA 5IZ4A 1E7MA 3D4PA 4EJMA 2W90A 1XR3A 2P91A 3GVPA 5EQDA 2BGLA 3TQHA 1N8KA 2UUPA 5CPFA 4YT5A 2WM3A 1Q2XA 2PZKA 3ULKA 1FDTA 4R68A 4JBHA 2GUGA 1KEPA 3HDQA 4BNVA 1WAMA 1EUZA 3C1TA 2V7PA 1ZSYA 3KTDA 4D42A 5K6AA 2A4KA 4DQUA 5KKAA 3FD8A 1C1XA 1EZ4A 4RVDA 4CM1A 4CM6A 1P77A 5L7TA 1EFKA 4C7JA 3OJLA 2WEKA 1SPXA 4MVJM 1NR7A 4J43A 4KDEA 3I5MA 4GSKA 3Q2IA 4H7PA 5B4UA 3TF5A 4OOEA 2HJSA 3T4EA 3H8VA 4IM7A 3AUUA 2C82A 3ADPA 4BS9A 1N9GB 4NBUA 2CVQA 5LDHA 1H5QA 2Q49A 3OJFA 3ZGYA 2UVDA 1ZFNA 1CQIA 2AMFA 3A14A 4BGVA 3OIGA 4HFNA 4NJOA 2CZCA 3DC2A 4CQMD 3CTMA 3IIEA 1HETA 1UZLA 3AOEA 2ZJ1A 1JTVA 1D8AA 1N7HA 1I33A 1NQAO 5BSGA 1I01A 4RPHA 4ALJA 1QLJA 5CEFA 2BHLA 3VVCA 4D46A 2DU8A 3WWZA 4CLRA 5FI5A 2LDBA 4A5OA 3RCBA 3GRKA 3HDJA 4XRGA 3SLGA 4N5MA 4BNGA 3NT4A 2AE1A 3FHLA 3JQ8B 4IDEA 4AFNA 1ZK4A 1ZH8A 1E7WA 3RC2A 1GV1A 1NXQA 1O8CA 3GG2A 4TRMA 3JCZA 1EK6A 4LN1A 4MKZA 5TT1A 4FW8A 2OO5A 4GGOA 4FOSA 2PZLA 4RVGA 1PSDA 3PJGA 1W6UA 5A9TA 4KDFA 3G79A 5FI3A 2PKQP 4DL9A 4OJNA 4ALLA 3D4NA 2IYPA 1QG6A 4QECA 3U5TA 3ZWOA 3NT2A 3I23A 2CDBA 4CQLB 1UAGA 4I5DA 5A02A 2AG5A 2RHCA 1N1EA 1SEPA 4FGWA 3P7MA 3JSAA 1CRWG 4IDCA 2NACA 4I5GA 2BGKA 3ZWNA 4YQZA 1IPEA 3U9LA 3W4IA 4OOFA 1DIAA 1EFLA 3QV1A 5JCJA 3NJ4A 3L9XA 3QQPA 2J3IA 1I3MA 3OIDA 4BO8A 1X1TA 2Y1GA 4ND2A 3C24A 1P1RA 1JQBA 1PX0A 4MPDA 1XHLA 4XQEA 3V2GA 2XPCA 3KYBA 4K26A 2CVOA 3GNSA 4CV2A 3VZSA 4RPLA 4P8RA 3ORFA 3IUSA 3VZQA 2Q50A 3S55A 2EW2A 4RVSA 2GR9A 3CEAA 4GVLA 5DCYA 4OXNA 1LDGA 2GN6A 4M8SA 4AVYA 3ZV4A 2X9NA 1TLTA 2QYTA 1EE9A 1U5CA 1DFIA 2CVZA 4FFRA 4NZ9A 2BD0A 3WLEA 4R41A 4E5PA 4GX2A 3WBFA 6ADHA 4XEHA 2DPGA 5GY7A 5A9SB 1IPFA 4P38A 3PZRA 3NRCA 3Q6IA 4E5NA 1NM5A 4TVBA 1AXEA 2P9CA 1PZEA 4HFMA 3V2UA 1Z45A 4I8XA 2C5EA 2IE0A 5L4SA 3KO8A 4BGIA 2YQ5A 3ZNNA 4FFOA 4DMMA 2QW8A 3SC6A 1HF3A 3WSWA 3E6AA 1HDXA 4YWJA 3Q1LA 5TQVA 1P31A 3JQGB 5EL0A 4CM5A 3LT0A 4DLLA 2CSUA 3RUIA 3VZPA 4MIYA 4CUZA 2E82A 2Y66A 1PJ2A 2GRAA 1JU9A 1EVIA 4INAA 1ZW1A 1O0SA 2ZQYA 4CMAA 4NBRA 2DFDA 1GR0A 4BNFA 4CM4B 3ONDA 3UF0A 4XA8A 4EDFA 1TEHA 3NDRA 3TNLA 5DBFA 4Z0TA 4TMFA 1QKIA 4B8ZA 2I6TA 2R00C 4J1QA 2YHUA 1PQPA 2PD4A 3DFUA 3FNFA 4Y6SA 4YEDA 4FC7A 4W99A 2X5OA 3DMYA 1RPNA 1V0JA 4RF5A 3M2TA 2UUOA 3Q9NA 1ZSVA 3ETEA 4TZTA 4YRBA 2DM6A 2PV7A 1FDSA 3GDGA 2W4QA 1Y1PA 3JQDA 4RV9A 3VAZA 4N5NA 3GZNA 4GMGA 4Z3KA 1XG5A 2GYYA 1SOVA 4FN4A 4BKRA 3L6DA 5IDWA 2EJVA 3K92A 5EJ2A 5HS6A 1LC3A 1ULUA 3E9QA 4YJGA 4U6SA 1H6AA 1ISGA 2VQ3A 3WX0A 5I7FA 4QO8A 4I5FA 1VJ1A 1F0YA 3LSYA 3TZKA 4ITUA 1R0KA 3WSVA 4CMGA 3ZNOA 3L07A 1B8UA 3CZRA 1P0FA 4J2OA 4KWIA 3WS7A 4E2WA
chains in the Genus database with same CATH superfamily
2Q62A 3H75A 2P8SA 4HDSB 4TL8A 1RT9A 3K1ZA 3MSCA 4ZQIA 1FJGB 2RB4A 1SUEA 3PGXA 3K6JA 3MJHA 5J59A 3V48A 3W9SA 2EFGA 1Y1LA 2FF7A 1D6JA 1G64A 4JROA 4F3YA 2XB6A 3GT0A 3LE8A 4MWCA 4UNIA 9MHTA 1XOIA 4E12A 1FJXA 1VIAA 4XVUA 2YOHA 6AT1A 2NUBA 2NMVA 2DFNA 1FBNA 2ZU0C 3D8TA 1EBBA 3UH1A 1ISIA 5HOQA 3WYEA 5IJ9A 5CD9A 2OFPA 1KS9A 4LY3A 1H94A 3OLQA 5CK5A 2CE2X 2OK7A 2V54A 2CYAA 4X7MA 2PL3A 4GEKA 1IJFA 2P3OA 4LPKA 4U7GA 1KO5A 2GPJA 3NDBB 3U62A 3ZHSA 1FFHA 1XZAA 3AFHA 4LRWA 4WEQA 4X1KA 3GLFA 4N41A 4TLMB 2Z6AA 2G7ZA 3DHYA 1MBZA 3PX2A 3WFIA 3P9YA 1KERA 2NW6A 1NUTA 1NI4A 1WP9A 4GKVA 4UXIA 4E30A 4NAUA 3OM9A 3UXMA 1UXHA 1T10A 1FJHA 3IALA 3RU9A 2GPSA 4JL5A 1M73E 1UJ4A 4OP1A 3T0GA 5LMNB 1LBSA 2WT4A 1L7QA 1FZTA 5DVZA 2LGJA 3BMQB 4B4VA 4OLHA 1X9IA 2VKQA 4K9PA 2KYRA 3W79A 2C20A 2IXFA 3BGOS 4B6GA 5K4HA 1BFKA 1WIWA 3EA4A 4LHWA 1V8OA 1C81A 2WD7B 1X39A 1EVKA 2VJOA 3H3XA 1FUYB 4HGPA 4KAJA 1RSZA 2I8LA 4QDJA 4IDBA 4ALIA 3TJRA 4BNMA 3LPCA 3QVWA 2PS9A 4PCVA 3SE0A 3WBKA 4MDEA 4HX5A 3B1KA 5H59A 4FKZA 1ISMA 2I2AA 5TXGA 4JJGA 2YZGA 4F3RA 2A88A 2ZIZA 3V4VB 4UEOA 5B36A 3ROZA 4WN3A 1XDDA 4L5YA 2UZ0A 3NQ41 4B3FX 1M8GA 1R1DA 2QMZA 3EZLA 3CVYA 5JC8A 2X2EA 3COPA 3HJAA 5KYWA 4CMIB 5EP4A 1QV7A 2FN7A 1C3OB 3OMWA 3R6LA 1D2RA 2E4AA 1NYTA 2ZROA 2ZSFA 1XK6A 1L7RA 4PFQA 2NU8A 5AUQA 4OMUA 2E7ZA 3GZJA 1NJ6A 4RV5A 2BVNA 5EP1A 3T7IA 4BYMA 5HEKA 1NNI1 1CY0A 3U3MA 4HNVA 2AOWA 1H5UA 1I3NA 2BCJQ 3GQBA 1YA6A 2MINB 4X1YA 1QHNA 4MUEA 5AXBA 3TPFA 5D5HA 1KWKA 1DX6A 1SB8A 2Q9CA 5FYDA 2PZAA 2YFKA 3CUUA 5D87A 5TJ9A 1YXMA 1WP4A 3D7NA 2HW8A 3NEAA 1KK3A 2JZNA 2VUUA 3TKYA 4CR7A 2WT9A 4JB2A 5LQNA 2PFKA 3ZWWA 2F9LA 3EZ6A 3UCFA 5IZCA 2ZOSA 4PZ9A 1VKRA 2QTHA 2ACEA 4NCIA 3WZLA 4CM9A 4DLXA 1EM8A 3WGZA 1XQYA 1ESZA 3Q6NA 2QY6A 4DUZB 4AY2A 1L3CA 2NZWA 2RIRA 2YCLA 1O94C 3NV7A 5MN4A 1O7JA 2AV6A 5H80A 5JSFA 2O8NA 1OU4A 2JJQA 2NU7B 3ETDA 2AN9A 3ICOA 5ALSA 5KYXB 1YI1A 4LWPA 4B5KA 3R6TA 1CQXA 4P5EA 3UJBA 4ZJPA 3IIMA 1YDHA 3DJYA 4GI3A 2JAXA 1BKSB 1I8TA 1NW7A 3EULA 3GBPA 5L53A 5E1DA 4PRKA 1PVDA 1E2GA 2P35A 3DTYA 2P6PA 1VJRA 2WTXA 4NV1A 1AK1A 4DYHA 4RJKA 5MDHA 4IXMA 1L5OA 5DT2A 5K0FA 5LFAA 3VVBA 1ZOSA 3QFFA 1R3UA 1C9EA 2NYAA 3H5LA 5LJLA 4MDHA 4XGQA 3TXXA 2DQSA 2ODQA 3NUQA 1K7XB 3RTDA 3UWKA 1JR6A 2QYOA 3HJUA 1HA3A 3F3MA 3MQFA 3EFOB 1Q7CA 1JXMA 1NNEA 2BE9A 4ZQEA 3RVOA 2XDQB 2QM0A 4FD3A 3ZQKA 5LQKA 3H4TA 2YN0A 4OGWA 1EUDA 3KOOA 3PXUA 4K6OA 2ZVDA 3UGTA 5E1BA 1XF1A 3K72B 3OLZA 4PLYA 3T7RA 1IHYA 3B7WA 2Y6VA 2G08A 3KFVA 3RUEA 2OC4A 4ZVLA 1AIPA 3OZAA 4AP9A 1TUIA 4HWTA 2LIPA 3RRBA 3NO4A 5C1BA 3KQOA 4I66A 4RKEA 1YRYE 4ZFNA 3NWEA 1EVLA 3ML1A 4IX1A 2W2NA 2WPDA 3NVAA 4JLNA 3ROTA 1TADA 1V2HE 1RHKA 4RDHA 1X92A 1G6OA 2VT7A 3AR2A 1SQGA 2I4TA 3ENWA 1B41A 4YBZA 1S3FA 5DM1A 1U8UA 4ZARA 1MH9A 2RGRA 3ZGVA 3W2HA 1SKUA 4PGAA 5TEWA 1ADGA 3N59A 4DG9A 4EYKA 4W1SA 1PWZA 3KQTA 4A03A 4DSTA 4TTVA 1EMDA 4MVJP 2ET6A 1NT2A 4AZTA 1GUBA 3G0GA 3WICA 3Q3IA 5C5EA 1WETA 4K7JA 1IN7A 4K8OA 5FPYA 3W5UA 4LZAA 1IJKA 1R8QA 2HJHA 3CSSA 1PK7A 2Y0CA 1WHSA 2GFIA 3G2PA 5F3DA 2ECKA 2XZDA 2J5RA 2PQMA 1ST3A 2BKEA 4TRJA 4MSUA 2ZYTX 4HEHA 1IHPA 1O6GA 3UXEA 4B7ZA 1JHVA 3TWOA 1NRJB 1YA8A 4MW5A 5IDXA 4PAMA 3WK5A 5LN1A 2DWUA 2P4EA 1XJ5A 1RMQA 3DEZA 2C2YA 3I4LA 3TBFA 4CCWA 1AQJA 1ONSA 1R00A 1Z38A 5F2EA 4WBNB 5T4BA 1N5DA 4RZHA 2A1TR 1JDNA 2V6JA 3LSTA 1DAEA 4QJ5A 4ZV9A 4A0GA 3ORSA 2H2HA 1QHGA 1ZN8A 1FW8A 4KIUA 4TKVB 3K0FB 4IEIA 1ZKMA 3WNDA 4C87A 2J9GA 3ZE7A 4DREA 1W48A 1ZGZA 4AQ7A 1J0EA 1BHQ1 2JLYA 2D3TA 3FWYA 4HS9A 4NBSA 1UBFA 3MA0A 1P2GA 4XJVA 1KMMA 1YL5A 5D1NA 1PE0A 3KSZO 4UE3S 3WNQA 3DJFA 2IYLD 3K0AB 5DHUA 1KZGB 2Y05A 4XFKA 4Y2GA 4PTYA 3U39A 4CEIA 3K0KA 3UOWA 3R0JA 4IVRA 4UMDA 2OXTA 3GV0A 3DFMA 3JR3A 3NAQA 4HTFB 3G6KA 4EJSA 3RFTA 4KQEA 4JBNA 3NOOA 5KOYA 5AJHA 1CEYA 1PSZA 1QMGA 4OAOA 4C04A 3D81A 4MVCA 3SOZA 1NUPA 1W85A 4JI5B 2CT8A 3HB9A 3NHAA 1J8YF 4IDAA 1BYIA 3GLGE 1MB9A 3SYMA 2J9FB 4D9FA 2XTZA 3KUXA 3A2KA 4MIEA 4HX9A 5FTJA 4NMXB 1G59A 4DMRA 4YJDA 3TI9A 3FPJA 5GMOA 2JBHA 2OBXA 4K05A 5JAZA 4I1PA 3G5TA 2PQ6A 1L4UA 3O0TA 3PWKA 3OX3A 4JBYA 2Q5LA 4OHUA 3NWOA 4JJ7A 3N2LA 1ABEA 2D0IA 1V1MA 4DBVO 3I0NA 421PA 4ZRDA 3JQFA 3SDZA 3KNZA 3CLRD 4OQNA 1HDCA 1XRLA 3VR2A 4QE3A 4PTLA 2BZSA 4MQEA 2QTAA 3IYLW 2UDPA 4BN4A 1U7XA 4B3IA 4LIPD 4DEXA 1PFWA 3AJRA 2Q5IA 3AF5A 2C59A 2X5JO 2QP3A 2EQ5A 2ZP1A 3QU5A 3NWPA 3SWWA 5LZ4A 2JLUA 1Y3AA 2DECA 3DZ8A 4LZNA 3BMCA 1ODKA 1ZJ5A 3K1JA 2RGYA 1X1SA 4PIVA 4AN0A 1S8AA 3A28A 3NPMA 3AR5A 2AUMA 1JQDA 3NONA 5LQAA 2BISA 4PG5A 5CLLA 1RJWA 1R4NB 3FMPB 1WVMA 1ZN2A 3ZBPA 1R0YA 2FNAA 3CLSC 2QUKA 3CO5A 1E4EB 1B1CA 2PT9A 1H66A 3GCDA 5AKLA 4ZAYA 5A03A 5K3EA 3VR6A 3GGSA 1FPQA 2IIQA 5CLIA 3ROMA 2G1PA 3LY5A 1US8A 2Z98A 3GRAA 2X77A 5ADWA 3IIJA 4ZALA 3BRQA 5HE8A 1V45E 2C9ZA 1XU9A 3OT1B 2GM9A 4BJ6A 4CLOA 5H4GA 1O58A 1T2EA 3UQZA 4I3FA 4O1IA 3J7AC 5KNDH 4UOEA 3KSAC 3OZRA 2FHPA 3QVGA 3F7TA 1PK8A 1YHYA 3R7BA 2X23A 4JLWA 4F0JA 1FDRA 4JLAA 1QZUA 3ZGLA 2FKNA 2D00A 3OUZA 1YF3A 2PL5A 3GAMA 2MR5A 2NZ8A 2QVLA 2E4WA 1A8UA 3DAPA 3FKQA 2I9PA 3CRVA 3GELA 3ESRA 3JQ9A 3KZVA 4ZANA 2OQVA 3O91A 3T5GA 1PZHA 5DM0A 3I6QA 5CJJA 5T4HA 3ZY5A 2P5TB 3HRHA 2H5IA 3LPAA 1YVRA 1OU0A 1QQTA 2WSSA 1ZXBA 5F1PA 4ARUA 4FUQA 2QDKA 2ZRCA 1WMSA 5JD5A 1L7EA 5CG2A 3K0CC 3I6IA 5DLEA 1VCMA 1AB6A 4AYXA 2HSZA 4ZAFA 5IEJA 3A04A 4MVJH 5JNLA 3WNVA 4U8GA 4D74A 821PA 2JPDA 1M8JA 1F38A 1PJAA 1TKBA 2PT6A 1N33B 1EDBA 1UKAA 2AOUB 5ICMA 3IAEA 1TU3A 2BMDA 1M1XB 1U4OA 2YZNA 4JOBA 1QGUB 2FPKA 2GZDA 2OBBA 2QTWB 3WLOA 1L1EA 1WXEA 3GGJA 3GG9A 3OH8A 5EJ5A 1QUFA 1ZYUA 2VDPB 1SJ9A 2IXEA 1XALA 2YVQA 2HIHA 3RBVA 3GEDA 4EAQA 4ZDIA 2ZUVA 4FNMA 2X0NA 3A37A 3RHTA 2HWKA 1OLXA 3W2TA 5KTSA 4YT4A 3WWPA 1GPMA 3GEBA 3EWIA 1HC7A 2OMEA 2XNDD 3QM1A 4EW6A 5JCOA 1TVKA 3PE6A 3BCUA 2V7XA 1IG3A 4BMXA 3QLUA 5FYQA 4MARA 3S2YA 3E9EA 1E6LA 2GJ8A 3DLPX 4LTNA 4B76A 3FBGA 4DA7A 3FDZB 1G2PA 1AKUA 3ZWMA 4R1QA 2XQIA 4W7SA 3EQ9A 3OPYI 3QBEA 4A8TA 2KM1A 4RTSA 2QLLA 2A9FA 4FEAA 4JC4A 4K1LA 2PXCA 2WJPA 3RAEC 2P11A 2DHEA 1Z35A 3HL4A 3N2GB 1K5GA 1NV8A 2HU8A 2ZDQA 1DMSA 4OFXA 1ESMA 2IHVA 4KYVA 4OA8A 5AI6A 3R4VA 5FHRA 4ZI5A 3URKA 4LJ5A 5I8PA 1H9AA 1M8KA 1E60A 3EGDA 4PXSA 1FY2A 3GRVA 4ATNA 1P39A 2BEUB 1JVBA 1ZI9A 4D97A 4JENA 1E3WB 2BLNA 2C5BA 1SUAA 4I55B 3WBBA 4ES6A 4URFA 1K92A 3UJ6A 3UJCA 3J81A 4YP5A 4KG7A 2BLLA 2FUCA 3LW7A 3TM4A 4O3MA 5HIAA 4URZR 1LB1B 2CMFA 2I7CA 2ID7A 2NU6B 1Q7EA 3HRKA 1TKCA 2XKJE 3PENA 3SK0A 4EQ6B 2P9FA 4DC0A 3DVLA 3E4DA 2HWUA 3N76A 4X6YA 3VGPA 2MINA 1QX4A 4CXMA 4WKCA 1LXCA 1NW5A 3ENNA 3FCXA 4BFCA 3AFGA 1NQUA 1F2DA 3LF2A 4RADA 1CB0A 5LYYA 3GUHA 2CHUA 2PRSA 3O47A 4FU0A 4HQ0A 4UVHA 4FCCA 1B2RA 1QG0A 3TSWA 1KDOA 2JNWA 1WUYA 1C3OA 2VRNA 3PYMA 3T5CA 4ACBA 5FJJA 4UUAA 4INPA 4QDXA 5K8UA 3QIAA 5B1EA 3WQSB 1HURA 1Z08A 3U7FB 1JILA 3OFSA 4AXBA 3R1IA 1CVIA 3E27A 1W85B 3R5FA 1JFLA 5ALQA 2F1IA 2IU0A 1SZJG 1XP8A 2ORYA 2P27A 1RVV1 3MUOA 3SBEA 2HDOA 3QE2A 4YI5A 4O4JF 1BKYA 3UHPA 3CX4A 1SCUB 2P1RA 2J3KA 1MGPA 3KJGA 4R05A 3JRNA 1XTTA 1KQFA 1EFDN 2V6GA 3BHJA 4MP8A 1ECLA 5I5GA 1P62B 2H4WA 3DDHA 3WGGA 4U2GA 4ANFA 4HATA 1YB4A 2VP0A 3ZHYA 1WEHA 2WFLB 2E4YA 1ZU5A 3T7CA 1NLMA 2FAXA 1R6VA 3LNCA 4EPYA 1XAIA 1P5HA 5D85A 1HKHA 2FZEA 3MMSA 2PKQO 3LP6A 3K8OE 1L6IA 1BJKA 1TT7A 4GHWA 5ICEA 4QNMA 4BIIA 1BWRA 4KVGA 2JG3A 3DQZA 1XFDA 3GLSA 5ALPA 4CLOB 5EHGA 4ENPA 3IELA 5DTMA 3W2EA 4YPFA 4HNAB 4ZO8A 4WCDA 4OF4A 1XMXA 4ZCSA 1ZPDA 3BMXA 2H3EA 3M6MD 1SXJA 3JYOA 4GI2A 4MP6A 4UEKA 4UU0A 3ZXUB 1XMPA 2XOXA 1KRXA 2XCQA 1MRZA 3CNQS 2FMKA 3OEWA 4WBXC 2PKXA 1DLIA 4LI0A 3RVLA 1X8JA 3SX0A 3HGQA 3RQIA 4ID3A 2MCFA 5EIBC 1VIVA 5HF9A 4GPBA 3VOTA 5DNUA 1TMYA 4RLHA 4CKBA 3TD6A 1GPLA 2I99A 2ON6A 2VSOA 2VWPA 1SQ0A 3IS3A 3DHVA 2FPXA 2C7GA 4AM8A 3THWB 3M82A 3EDYA 2X8BA 1VXOA 1X6VA 2R1TB 2BL4A 1DDIA 1QIKA 1R4MB 2FQ1A 3MUEA 4GLFA 4AZWA 1B93A 2FUKA 2EXXA 2OKGA 4CFZA 3G2HA 4DM7A 4IF4A 1X9GA 5BMVB 3DONA 3JQ7A 3ZOZA 3C39A 4LMPA 5IFKA 4MHSA 5D5PA 3EXHA 4QDZA 3SFZA 3HV0A 1P9LA 2KBEA 4U2KA 4Q6BA 4WN9A 2F4NA 4W8HA 5FUYA 1JDUA 2V9PA 4Q9AA 1J1ZA 2QL6A 5LWQA 1ZHOA 1V6AA 1OA1A 4N18A 1UQRA 4RVOA 2VCEA 2IYEA 4GICA 4EKEA 5EHXA 2JI6A 1Z06A 2BM8A 1YE8A 2HJRA 3OY7A 1F2TB 2QTBA 4J2TA 1RQGA 3NXSA 4LVOA 5DP2A 3L0BA 4BO4A 3OZFA 1G1AA 1CNMA 2XNKA 3L8EA 4HDNA 4CF6A 3DWIA 1TQDA 4J1TA 4H4DA 4JI4B 1EUDB 1AOXA 1CQPA 5AW0A 3CF4A 1USVA 4IUYA 4OXXA 1WUHS 4PF1A 1DO2A 3WL5A 4ZTUB 2IY9A 3G82C 4MO2A 2BBTA 4OHMA 3TMKA 4AWBA 1KNXA 4C0HA 4DJ5X 1U1CA 2I6UA 5LU8A 3OOYA 4JB3A 4RSHA 3DNFA 4JI1B 2C2WA 2D2XA 2D06A 3I9KA 3CVWA 2WKRA 1ZVQA 1W73A 5JQGF 1F1JA 2G1KA 3W05A 1JXQA 4CMIA 3WSTA 3OIVA 3WK7A 3IPXA 4IJ5A 2BUBA 2IITA 3A31A 1NJSA 1CP3A 5DV9A 4BJHB 2IYTA 3GQVA 4IILA 4K5QA 4UTXA 5B4TA 1DNPA 3DOHA 3ENZA 3ODGA 4Z7OB 1AC5A 1JGTA 1E1CA 3SS7X 3RANA 4X00A 4EA9A 4PQRA 1QKJA 2NQ8A 3BQNB 4NE9A 1HYHA 2YIJA 5EHZA 2CSXA 1AKTA 1KY2A 1EXDA 3E1SA 3ZD8A 5FWDA 1WMFA 1YUMA 5LVAA 3R3JA 1T0UA 3EZNA 3U44B 1YB5A 2A0WA 1ZC3A 1SUCA 3MUFA 2I78A 1QP8A 4RWZA 1CF9A 3T5AA 4M83A 3ILXA 4WERA 1LX6A 2QRKA 2XIJA 3PXDA 5C0OE 2GRJA 4XWKA 1TT5B 1VE1A 3HJNA 3H9EO 3UHFA 3OEEA 3R3YA 2AKAB 3RFXA 5GZ1A 3D1VA 1L5NA 1IOLA 3FOFC 3DHEA 3JQCA 5SY9A 4O59O 3WDMA 4C2AA 1JHRA 2M6KA 2DUWA 1SKBA 2NYUA 2AFHA 2TMYA 2C4UA 3EDCA 2REBA 4PO8A 4QEZA 1FFXB 2GHIA 4PLPA 1JR3E 5I51A 1HLGA 4M86A 3A4MA 2CL7X 2V7QA 3ASZA 3UA3A 4EB3A 4B3MB 3DTTA 3HLYA 2QZPA 2EFDB 3K53A 1PJ4A 5G0UA 2Q99A 3FCEA 4IS2A 2OGWA 2B0JA 3O31A 4HNGA 4Y0AA 4ACAA 2JK0A 5D3QA 1XRNA 3WYBA 4I9UA 2BEJA 2FR8C 4PV7A 1WB5A 2MJLA 4KR0A 1KC3A 2MSLA 1CIVA 3CY6A 3WGQA 4UDXX 5KVCA 1IN6A 1SG0A 3HNPA 3MOIA 6LDHA 1JPUA 3V55A 2DWPA 3D6MA 3DZKA 3NM5A 3G2MA 3ILYA 4B7UA 4QXRA 2XXBA 3ZWQA 3DD5A 2PR2A 5CIYA 3ZNPA 4ZGGA 2JCVA 2JRCA 1VCIA 3PXAA 4KITB 3FTPA 1RZRA 1AKWA 2H08A 3NBXX 1GAEO 3KXDA 4OUDA 2E4VA 2ZUCA 4RD6A 4MVYA 2O57A 1RTTA 3AU9A 3JYNA 3QI7A 3TUZC 3MCVA 5FA8A 2XDYA 3PC7A 1YU6A 1GTZA 1YJQA 2RAFA 2V55B 3K5HA 3WIEA 2Y4NA 3FKSA 4A26A 1Q84A 3QITA 2PWPA 4NSNA 5FIUA 5JYCA 3WKEA 1G41A 2IY7A 2J46A 2XMPA 2ZYWX 3G9QA 1A4UA 3ZXYA 4Z4IA 3QA3E 1JFFA 2C7VA 4IHQA 1ZOLA 4ND5A 1UJCA 2UZ1B 3K1AA 3N8NA 1OKKD 4FDMA 4HGRA 4K88A 5B2ZA 1PL8A 1K6XA 4RHTA 4EY8A 1V11A 2HCRA 6REQA 3H99A 1KAEA 2VPXA 3WLSA 2C8JA 1T25A 3MNFA 3TIGA 5EQJB 3SZMA 4BB0A 2YJ5A 1JE0A 4MEJA 2V65A 5TJHA 3MTJA 4OHKA 4HGYA 4N65A 1ELOA 2PFGA 3HB5X 4J91A 4YRCA 4YUYA 3ANMA 2CXUA 2FSGA 2OOSA 4DSZA 2Y77A 3WRYA 4F9EA 1IAQA 1UBNA 1CUAA 1DIRA 4X9XA 3TDNA 4MUBA 1U8EA 4RVFA 1C0EA 1RJ9A 4NRDA 5LYJA 1GILA 1T6ZA 3GN2A 2PX6A 1XROA 2JI8A 3DDNA 4CMGA 1WV0A 2EEPA 3LCRA 4GOMD 4YECA 4GZ6A 2GNPA 1KI6B 2P68A 2Y1KA 3WFJA 2ISSD 2PNFA 2IH2A 2D13A 3AUTA 1PR3A 3IDQA 4MW6A 4FYWA 2ZT7A 2ZTHA 4WDQA 1W94A 2JCXA 3L0IB 2XXJA 2VI5A 4DIUA 4JL6A 2ZQ5A 1FYDA 1PKXA 5FFMA 1OTHA 2XTJA 4TXLA 3VAAA 2DPMA 1MJHA 3I8XA 1AN9A 4J7CA 2ZAIA 3ZC3A 1JEDA 1Z0IA 3D1LA 3V7NA 4B44A 2E4XA 3DVQX 3MTAA 3PT9A 5E2BA 4ZT4A 4N6OA 1ISFA 2DQKA 1YR6A 3AR8A 4ND1A 4AICA 1M67A 2V3WA 1U80A 4HX2A 4E13A 5LB4A 4DA9A 1Z4LA 1N5OX 4RFLA 1UXOA 3IUJA 4S1VA 1IM5A 4W5HA 5A9SA 1RAAA 3FBWA 4G5HA 4ALLA 5IT4A 1SAYA 1CYDA 4KQKA 1KEKA 1JJFA 4DYVA 4RHFA 3M1YA 2P0AA 3I9OA 4BQRA 5KNCA 3B6MA 2F7SA 5GONA 2B7BA 3DR3A 3RYIA 4G41A 3NWJA 3L1JA 3V4PB 5HRAA 5MGBA 3DE5X 2AF3C 3RVJA 3O3OB 3L7BA 1EGQA 4YRPA 4A15A 1SC9A 2V59A 3NETA 4AJJA 4ZCMA 1CJTC 1H2YA 2HA5A 3I0MA 5GOZA 4JLVA 4FJ2A 2PLFA 1EGAA 2ILTA 3VR1A 2H17A 2C2KA 4ZOEA 3EEBA 2C3OA 3OG9A 1PLKA 5NULA 4EECA 5CDSA 4Q4HA 1P33A 4V38A 2GN0A 2ID9A 1U7ZA 3G2QA 3UJ3X 1F7VA 3CZQA 2AEFA 2IPMA 5BSEA 2OYSA 3IPYA 5A3QA 3HBAA 3VX3A 4C0SA 5KSYA 2AOTB 1NF8A 1BU8A 1UWKA 1YS1X 3DULA 2I2FA 2NUPA 3CUEF 4AZ0A 4B79A 4MWZA 5LQMA 4R71A 1JSRA 4KPYA 5G41A 4GQIA 5H02A 3EUFA 4CTMA 5A04A 2HMTA 3OZVA 3FN4A 4MV3A 3KEQA 1ZNWA 3SDBA 3SP1A 4KFCA 3HCCA 4TUYF 3ROEA 1EG2A 1OJ7A 3CF2A 3F8SA 3H97A 4J90A 5J4YA 2W71A 1JI0A 3LA8A 3LOUA 4JBLA 2FWIA 4WZ6A 3T7AA 4KLZA 5JRZA 3D3NA 1E9CA 1I5EA 4KQJA 2JFOA 2DHDA 1X7WB 4L4RA 5D86A 2VP9A 4MW7A 3WRWA 1E2NA 4LGVA 4L4ZA 4NH4A 4U9IS 2RGAA 3PCXA 4BKOA 4Y2XA 1IBMB 3N2KA 2OBFA 1PT5A 1JJBA 2AN4A 4M1TA 3JASA 3FTNA 1CUJA 4MMZB 4BZPA 4D8XA 4Z3DA 4G8JA 1BZYA 3JQ8A 1FMCA 4YRTA 1QFMA 1T13A 2B99A 4DANA 4PZDA 2W6MA 1L4BA 4KFUA 3E7XA 4EMUA 3JZIA 3PT5A 3QI2A 4LV6A 3OX1A 5JZBA 1NE7A 2F59A 3WOVA 3WK4A 4V1CI 2QP4A 2SCUA 4JP5A 2AJDA 5DGHA 5BNFA 3TN7A 1YS4A 5G40A 3PK0A 3VH1A 2QTMA 1DRVA 2O8DB 3V7WA 1C4OA 5CVUA 4S35A 5EE1A 1VHWA 3TLEA 1UH5A 1BWSA 1G21B 3P2OA 3AEXA 2AR9A 4J7UA 5L3ZA 2GBFA 5IBQA 3UHAA 4A91A 5ALKA 5CGQB 2OC9A 2CLCX 3EFHA 2GGSA 1LFAA 1DTWB 2GXQA 3FOCA 1QRRA 2ONCA 4DPKA 1IOVA 1N5RA 3ABZA 3CPHA 3HUTA 4IQ4A 3VR5H 1EUCA 1EFVB 4J29A 4JT9A 3I9FA 4RY0A 4XCXA 1E9BA 1ONOA 1FTGA 4LGYA 2Q9AA 4FCVA 3O8QA 1R15A 1R50A 2AZ4A 3IP6A 4RKFA 3EXIB 4ON9A 5A1TA 4C7OB 5HF8A 3Q8LA 3AVOA 3OU7A 3EG9B 4Q3DA 2Z5VA 3NTLA 1BCRA 4AG3A 2GZ2A 4R83A 5CNJA 1PR6A 5A06A 3HU3A 4C3OB 1R0LA 3SC2B 5LKAA 1ZD3A 1VJ0A 1WOYA 3FWNA 1ISHA 1RHUA 1AS3A 2WJGA 1CQJA 2Y27A 4MHTA 2B1IA 1BOOA 4EO7A 3RAPR 3LBNA 1GUYA 5KSOA 3N8HA 4KI0A 2PO5A 1N0WA 4KQMA 4QDUA 1KP9A 3IP1A 4EKGA 2CDAA 1T91A 5EIXA 1RP7A 2ZRFA 3MINB 3OCCA 1LVGA 2FN4A 4E7PA 2R8ZA 2FSIA 2JLQA 3CUSA 1E9SA 4ZKEA 3KD3A 4PVCA 2HTFA 3HLTA 2QF7A 4JIMA 1N8NA 1KS2A 1KA9H 1L8AA 1ZBQA 2CZQA 2PMWB 4IV8A 4NBTA 5ALMA 3TRJA 1MPTA 1UMCB 1UP7A 3PLRA 4IHJA 5EZ5A 4CF3A 1RQXA 4M0EA 1ODJA 4KRFA 1T9GS 1J9EA 1M0TA 3HADA 3QUCA 3MWDB 2P9QA 2XUHA 4M3NA 1UANA 2OXFA 1MA0A 5T6MA 3EGWA 1GGJA 3RSZA 1OB5A 2J8ZA 2HCBA 3LQKA 3CNLA 2WF7A 4EY4A 3CWZA 1Z5GA 1G17A 2GNOA 2AN3A 1A9SA 1QGOA 1YE5A 1B43A 1RYYA 2DTDA 2R9VA 1EX7A 4FOLA 1OR8A 1WVIA 3I2IA 3ZHCA 1JMYA 3RREA 3PFWO 4G0ZA 3PPYA 2DGDA 4H18A 5AVOA 1HEYA 1MABB 1GUAA 1F4PA 2R84A 2IHYA 2VK2A 3OURA 3H16A 3HCPA 3OQMA 2AXPA 4GOJA 3MJVA 5IVKA 2P1DA 4KN5A 3AJ8A 2DR2A 2JS7A 1NW3A 5LP1A 1TEZA 3E8MA 4Q12A 3OPYB 3HVIA 3DB2A 1K6MA 3FOAA 4KFRA 4ZI7F 4KTTE 1UBKS 2YXBA 1UFQA 3IUEA 4G86A 5C8YA 2E37A 3DLCA 2ZUUA 4LISA 2HIGA 2A5JA 4BN5A 3VNVA 2IOHA 1EP9A 1WO8A 4LMAA 4WKGA 4EW2A 1MEJA 1U0SY 2IS1A 3CISA 3EXG1 3BIFA 2QR5A 4N3CA 4S04A 4OM7A 1E0JA 4UUBA 5BN4A 5KU7A 3HP4A 1GUZA 2GF2A 1GZ6A 2O0MA 1N5MA 3JRXA 1E61A 4OLAA 4AKHA 1J2YA 2AC7A 1I30A 4HWKA 4LHEA 1WB4A 2HA6A 2LP4Y 1FFAA 3H2IA 3L93A 3MWYW 5EJ4A 1YKFA 2BMFA 4MAMA 4ADSG 3ZCRA 2WF8A 3W5IA 5GINE 1D5CA 1WXFA 2BT4A 2IU3A 1PR5A 3PFCA 5E9AA 1YZTA 2OCAA 2L82A 4XVQA 2Y3IA 1VJTA 4YALA 4P4SB 5E95A 1P2DA 4RMNA 1ESCA 3STXA 2NO7A 1AO0A 2BBSA 2JLSA 2OV3A 3FIJA 3FLMA 1PGPA 3PDIB 3LCUA 1OFIA 4H7DA 4S3MA 3HCAA 2XR1A 2X6QA 1NAIA 4N9QA 2V4ZA 3SC4A 1NWCA 3PIRA 1RJEA 4A4DA 1XD2B 3B1ZA 1Z7WA 5DEIA 3V4SA 1MC8A 1ZR4A 1DIGA 2OP0A 1V3QE 3UC9A 1SXJD 4BC1A 1GLVA 1J8VA 4PSVA 3HA3A 3MT7A 4IHJF 5JAPA 2AHRA 2WSLA 4IDPA 2H1IA 3IVXA 3MQ4A 1CDOA 4P3PA 3RG8A 4JA0A 1JE1A 1JLRA 1S2NA 2M6LA 4XWOA 1W9MA 4GI1A 1UDAA 3LH5A 3QPAA 3BWBA 2JFFA 4F2PA 1EFRA 3LD9A 1KYTA 3A9UA 3M1LA 3ZXIA 4ZHSA 1JBKA 1OFHA 1X1BA 5MFZA 1S9DA 1E1MA 4YJ2B 2WP8J 2CLEB 1OC2A 4IW3B 4RGYA 2Q0QA 1XDWA 3FMGA 1WXHA 2WV7A 4ZOQI 4DV3B 2HH9A 2Y4OA 1DIBA 1ZD1A 3O9MA 3VOBA 2QVBA 3OJEA 4ITRC 2XUZA 3TZCA 2A0YA 4JX9A 3KWLA 4DARA 1GNQA 1TB4A 3IAS6 5ESDA 1CT9A 1MOQA 3LQ1A 5I9IA 3RJTA 1IH8A 2FVXA 2LKDA 5C1IA 3WXMA 3WY9A 3RIEA 5GADl 4YP0A 1TJ3A 2D5BA 3GA5A 3EOZA 1EIWA 4Q1FA 1LUAA 2DPYA 2XQGA 4JVOA 4IGKA 3K70C 1YS9A 1RWQA 2OEPA 3PYXA 2Y0PA 2VT6A 3RFUA 1M2HA 4UMFA 3AERA 2HWWA 2OVBA 4MITA 1YR7A 2VK8A 4EW3A 4AY5A 1MHTA 2VDRB 5H70A 3L6RA 3U48A 4B73A 2NP7A 5F1OA 3OA2A 4WLNA 1NW6A 1QVAA 2WB2A 4Q48A 3A2LA 2GB4A 1HT0A 3SS8A 2FRXA 4BCCA 1E7QA 4NCAA 1LVUA 3UIEA 3HU2A 4YJFB 4QYWA 3OCYA 3V80A 4AF6A 4C06A 2DLCX 1DFHA 1YA4A 2IDZA 2REQA 5B1HA 4GOOD 4MR7B 5F5NA 1PKEA 4KFSA 4LV8B 1FZQA 3A9RA 2GKOA 2IODA 3QP9A 3PRHA 5CNMA 1MEEA 2EKPA 5CCDA 3L6UA 1WPGA 3CG4A 1THMA 4IMIB 2JL1A 3PQ3A 5DOZA 3RC7A 4KX5A 1U7DA 4H3SA 5AI4A 3W1VA 3WB9A 4CR6A 2G70A 4B8WA 5CP8A 3BOSA 4X8MA 5FI3A 3B2NA 3B7GA 4N3NA 3IUPA 1CQZA 1P0IA 3E3AA 4Y9DA 5ALVA 4MH0R 4REQB 5CVCA 1HNNA 5C32A 5MF6A 1CUGA 2NO6A 3ZZMA 3GFTA 1R0BA 3LK6A 1PJZA 2XTNA 1CZKA 1KO8A 1V9SA 4GPEA 5BT8A 4AKGA 1H8EA 1W88B 2XVMA 3HUDA 2W8BA 3ZY2A 4QWWA 1LU9A 1M9NA 2R79A 1Y9AA 1XQ1A 3HJTA 5ITWA 5T5QA 4CKZA 3LQ2A 2HXGA 1SK8A 1CG6A 4H17A 2EKBA 2WUEA 2ZANA 3WV5A 2QBYA 3O7MA 1HO3A 2A94A 1WD5A 4YJHB 1C7JA 1JHAA 2KI5A 1S1MA 4U7TB 4F2GA 1A7AA 3H1AA 2G7MC 2E21A 2WIJA 3W6NA 4DRYA 2YV4A 3F5SA 1FLVA 2O2CA 3HBJA 4KGDA 4LJ7A 3V7YA 1E2DA 5EMKA 3VU1A 4UBKA 2FOLA 4HC4A 3LY7A 3D5EA 4ZEXA 3ZD9A 3R5XA 4RESA 4D3ZA 2OD7A 2WWXA 4WLUA 1OV6A 4IDFA 1PJBA 2O7QA 3EPJA 1TL7C 4L5IA 2Z1DA 3D5TA 1DEHA 3TOSA 4LBYA 1NVGA 3Q4GA 5JQWA 3T34A 2V6MA 1T5IA 3U7IA 3R3HA 1TJPB 2YWJA 2BGMA 2ZRQA 2YOFA 3FJYA 1DRUA 2Z1MA 1MVOA 2GX6A 3ACBA 1OGJA 3ET4A 3GGPA 2KBFA 3I42A 4DV7B 1UAAA 3GHYA 3IVAA 5BY2A 4K28A 4MQ4A 3I2FA 4WEOA 4FFNA 1JR3D 3AMVA 3FOBA 1ZGGA 1Q7RA 3CCCA 2IUTA 3P4YA 4W6ZA 2QW1A 3GARA 3I5YA 2W42A 2YWEA 3DZFA 1SBIA 2ZRJA 3FNEA 1RIFA 2OCDA 4ZMSA 1FLAA 2QNRA 2C2GA 3A3NA 3C7TA 3DOCA 2OD2A 3QNUA 3ZJ4A 5KTRA 3FGNA 3COWA 3IV9A 3G5MA 3O4FA 4A8JB 3FYCA 4CW7A 4P4NA 3QMVA 3DKPA 3KPYA 4L78A 2E4ZA 4IFBA 3TZ6A 4GMXA 4B46A 2GCGA 3O26A 1QF7A 1HR0B 3O4VA 3OZSA 3PNSA 3AETA 1VZ2A 4TTRA 4FR2A 4ETMA 1EFRD 5GTDA 1J07A 1FX0A 3V4RA 3MQ2A 5DCWA 2WINI 1UBTS 3Q3JB 3SSNA 1IC6A 3BZUA 3I05A 3IOCA 3WV4A 1RXVA 2VZLA 1VMIA 5DLDA 1M72A 1IB0A 3WAJA 3KUDA 2AS0A 3SBOA 1QRTA 3KFLA 1ACLA 4ZO4A 4UUPA 1ZM2A 5JDCC 2ZIXA 4MV0A 4N39A 5C3MA 4B3RB 1UMBB 3I9JA 2WTUA 1VI2A 3CVOA 2WPDD 4FBMA 3SEFA 3WNCA 4F5DA 5AESA 1CS0B 4W9NC 1W0CA 4LXIA 3AVWA 2XGJA 4HAYA 4DGQA 4GDFA 3OPYA 1OILA 2QZ9A 3L0ZA 4K9SA 3LUBA 1LDMA 1HFJA 2WT8A 4KZKA 4MYRA 4CR8A 4LJ6A 2DETA 2QSZA 4HGOA 4MMXB 4JLDA 5HCNA 3PI7A 2QM8A 4WMLA 4WSOA 2YMPA 3ZHXA 3SFTA 4Q5IA 2UVQA 4CMBA 4QPJC 1D7AA 2YN4A 5NLLA 1YBAA 1NC3A 3VU3A 4EGCB 1UZUA 2ZU6A 3ROGA 4GEGA 3BL6A 4D0RA 4D3FA 3PJFA 3W7BA 1I2DA 1A8SA 1XD9A 3OZUA 3FPSA 3SIPA 3RG2A 4BN0A 5A4DA 2MYPA 1Y8CA 4F91B 3VJMA 1KVSA 3LLUA 1B6GA 3WADA 4NAVA 1Z15A 1NX9A 3ZH9B 2H1LA 2RHRA 1CPYA 1E18A 5A5DA 2O0HA 2B92A 3U7EB 4FGJA 5HDBB 3OM0A 1QQBA 4TMZA 4FIDA 1K5DA 5EEHA 3GP8A 2EHJA 3W1WA 2XGSA 4DMUB 2P6MA 4QGHA 1IXSB 2GO7A 1SVKA 3P4XA 3FPBA 3K6SA 4C21A 1GG8A 2P77A 2PU7A 2ZBDA 5FWXA 4FNAA 4JYMA 4YGYA 2DR3A 1GOTA 2KQUA 1ADBA 3DUWA 3MINA 4DCNA 4QUIA 2DTEA 2WQ7A 4K8RB 5AI0A 2DT5A 1X94A 2FR0A 5ALRA 4N76A 5JDIA 2Y1OA 1IHDA 3A4NA 3EHEA 1PR9A 4QULA 1Y5LA 1S2MA 5CUQA 5G0TA 1DKUA 1HTTA 3MEQA 1I4TD 2NOAA 5AD1A 1U2RA 3V1TC 1RI1A 5AW3A 2RK4A 4HZGA 4F5WA 1M0SA 4RA6A 3SLKA 4HY3A 4HAOA 4PFJA 4FZJA 3SHOA 1VPLA 4UD2A 2WWYA 1JKJA 3X1MA 1Z7YA 2VUIB 4DDWA 1IM2A 4EG5A 4BBJA 2R65A 1D4AA 3GY0A 3NEPX 4QX6A 5AKGA 1TOAA 2HCTA 2PBRA 3B3JA 4C43A 4OD0A 1U28A 3TIXB 3ZKWB 4BNWA 3X1XA 5JYEA 5CH3A 4ZVVA 3Q7EA 4WINA 4TZ0A 1DWUA 5FI0B 1PQYA 5C3UA 2O8EA 5EKUA 3DEKA 1PTKA 4X1IA 4L3OA 4A0FA 3IGFA 4R1NA 2CNDA 5IHPA 2HUNA 5JJ5A 3WOHA 3MW8A 5F7OA 3L7DA 5DN9A 1D4OA 2E87A 1E99A 2HC9A 3D31A 5IXSA 1SWWA 2LD4A 3MJ4A 4XLTA 3H4VA 3BIXA 1D2HA 1HQCA 4XM1A 4W7HA 3GH1A 3ADOA 3EJ6A 2HBRA 2GUWA 3AF1A 3UAGA 1Z5VA 2V5UA 3TMYA 5FOUA 5J63A 4D8YA 4HAWA 1SNYA 3DTNA 3EVFA 5IK2D 1Y9EA 2CC2A 3MGCA 1AD2A 2ZIUB 2ZSKA 3OIUA 2DPLA 4FEGA 3W0LB 3HG7A 3PGLA 4JVSB 4RJIA 5FNZA 3ZG6A 1W29A 3T6KA 2BFDB 2CJPA 3KYDA 2EJWA 2XEXA 1RXWA 1KJNA 3I1FA 3QUTA 1H4VB 4IDOA 4M1KA 1LPMA 3Q3HA 2V4MA 3AXTA 2QVZX 4MVJA 3P52A 1H0KA 3QKSB 4Y6RA 4WXPA 1JB9A 3QE0A <