1ZJZA

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 101
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zjzA00
3AOEC 5CG1A 1Z45A 3GUYA 3WMWA 1BW9A 4MVJG 3WLFA 8LDHA 3DC2A 3JQ7A 1B8PA 2WD8A 5B4UA 4WE3A 1PJ3A 1Z82A 3VC7A 3JYNA 2C07A 1YJ8A 3DHNA 3DZFA 3H3JA 2PWZA 2DC1A 4R5HA 3TFOA 4YJHA 1LEHA 3C85A 7ADHA 3ZV4A 2DAPA 5L40A 4MP8A 3TL3A 4MKZA 1Y6JA 2PNFA 4PZEA 4TKMA 1H6AA 1PTJA 1VI2A 3WBFA 2AQ8A 4YT5A 2E48A 4XQGA 4CPDA 4OSPA 2NVUB 5GZ1A 3T4XA 2VUTA 2Y1OA 2QRLA 1R6DA 5DF1A 5JXWA 4UVEA 2DTEA 5L45A 4L8VA 9LDBA 3LC2O 3RC9A 4RVHA 4CJXA 3RKRA 5JCJD 2WJPA 3F47A 4RVSA 3OJLA 4GH5A 1KETA 2HAEA 3AWDA 3D5QA 3HNPA 3VZQA 1U3TA 5ILGA 1B3RA 5TQVA 2HCTA 1T4DA 2W2LA 3KTDA 1UXGA 4CM9A 1WWKA 2C54A 3P2YA 5AXBA 4CMEC 3UKOA 3PYXA 5DT9A 1P31A 3KYCB 1RKXA 3FI9A 2BGMA 4Q39A 4MVJH 1CEQA 5DBIA 4DREA 4DPMA 1ONNA 1YVEI 3KHUA 2ZTUA 1ZVMA 5EL0A 4A7PA 1GCOA 1HL3A 3DBVO 5G4KA 2XAAA 2ZYDA 4R1NA 4ESOA 4XIJA 3INGA 4ZQHA 4DPLA 3U9LA 1K2WA 1PQPA 1H2BA 3GF4A 4BB5A 3WDSA 2AG8A 2QYSA 1M67A 3B1FA 4HFMA 3VH3A 1R12A 3P2OA 3IAHA 1EDOA 2J3KA 1SOVA 1QMGA 3RAJA 4ZJUA 3DOJA 1JTVA 3OHSX 3GOHA 3PWSA 4IMRA 4DC0A 4IPTA 4OXNA 2E49A 4R51A 2PZLA 1GQ2A 2VCYA 1WMAA 4HNHA 1I30A 2B0JA 1H6DA 4BNXA 4YEDA 1SAYA 1WMBA 2X86A 2Z95A 3LQFA 5FYDA 7MDHA 4XRGA 4FFOA 1QYCA 4OSOA 5JC1A 4UVIA 1U5CA 2C59A 1XA0A 3K30A 5HS6A 2HMVA 4EUHA 1PEDA 5JLAA 4FOSA 1U7TA 5ES3A 3GZNB 2VYND 4IMPA 1EVIA 3UFXA 3PRJA 3R0IA 1GD1O 2Z1NA 4OXYA 4M86A 5T8KA 1YBVA 4ND1A 3PJFA 1KY4A 3CEAA 2PKQO 3ZWOA 1XELA 5KVQA 4LK3A 3ROKA 4EGFA 3DMTA 4O6VA 1EEHA 3JQAA 4OHUA 1ENYA 1W8DA 5AXAA 3NGXA 3UCXA 2POQX 3WNQA 1ZKMA 1PJCA 2HO5A 1T4BA 1LX6A 4RF4A 2H63A 3GMSA 4J1SA 3PHHA 5L4LA 4S3MA 4ZA2A 2WYWA 4B79A 2O3SA 1PJ2A 2WM3A 4Q9NA 1SC6A 2BMAA 3OFSA 3DB2A 1ZZEA 3R3JA 5FEUA 4ZGWA 4RPJA 5EQDA 4XQCA 5JDCC 1X0VA 3SC6A 2A92A 3GDGA 1M6HA 4N54A 4WNCA 5HRUA 2CVQA 2W2KA 3G17A 1BRMA 1YOVA 5JW6A 3TL2A 1ISIA 4WCFA 5L51A 4DVJA 1KVTA 4JP3A 3V1YA 1NR1A 2JKVA 5I8WA 1OOEA 3WJAA 1N7GA 3MWEB 4NJMA 5EN4A 4XJTA 3VVBA 1UXKA 4O0LA 1Z75A 3UUWA 4R3WA 3VTFA 3KB6A 3D3WA 1ZEMA 3Q11A 3T7EA 4CM9D 1KC1A 2JCYA 2CF5A 3ENNA 1ENOA 3UH1A 3VH1A 1S6YA 1Q0HA 2EHDA 1V3UA 1GPDG 3HN7A 3OIGA 5ICSA 1C1XB 4CM5A 4Q3EA 2IZ0A 4N5MA 4B4UA 4EJMA 2Q1TA 3E5RA 3JCZA 2C2YA 5I9LA 3VZSA 4E21A 5LCXA 3C1OA 1D1SA 1XSEA 2O3UA 3A06A 1IPEA 1PR9A 2X9GA 5ENVA 2CVOA 3ANMA 3T7CA 5U9CA 3ON5A 4E5MA 1NVTA 3UAGA 5L7WA 1PZHA 4DGSA 1YQGA 4BS9A 1DBVO 3ZN2A 4OGWA 4RL6A 3WFJA 3SBOA 3FCOA 4CM4A 1IYZA 1VJ1A 4WCFC 2VYVA 1D3AA 2PGJA 5MDHA 1PS9A 1P3DA 1YQXA 1PQUA 1UDAA 4QT0A 1UDCA 3ICCA 3TJRA 1LTHR 5F1PA 1HYHA 1GY8A 2FR0A 2FWMX 2WD7A 3FTNA 4IS2A 3RUHA 1V8BA 1DO8A 3ZWXA 1QKIA 1ONPA 3NT2A 4ZRMA 4BMSA 4Z0HO 1QLJA 1QORA 4GX0A 4PGFA 5KJ1A 3D5TA 1XYGA 1HSZA 1N9GA 1TT7A 5ADHA 4YVFA 1W73A 1E1KA 1IZ9A 1DHTA 4JCOA 4UVDA 3GGPA 2J6IA 3HFGA 2Z5LA 4J1TA 1ADCA 4FFMA 1O89A 2BD0A 2OXIA 2VHVA 3MJ4A 2D3TA 1KEVA 1RM4A 3SLGA 3E5MA 4UUOA 2A4KA 3JQAD 3GVXA 3CE6A 4BNWA 1EMDA 5A5FA 5A3JA 5KOIA 2HU2A 4CMIB 3BTOA 2O4CA 5DBFA 4TROA 1VKNA 3ENKA 4R1TA 4YA6A 2I9PA 2UAGA 2X58A 3AW9A 3C7AA 3IOYA 3WYEA 1E0DA 4CLXA 2OORA 4R01A 1DPGA 5ER9A 5IDQA 4E2XA 3EHEA 4CM8B 1O8CA 4BGEA 1KEUA 2V7PA 2EKPA 2RBEA 4AJEA 4FJ2A 2FPPA 2V6GA 4LISA 1Z7EA 4OO3A 2R2GA 3T4EA 1OAAA 1E7YA 1KVSA 1NM5A 4YJGA 1K6JA 3U09A 2I5PO 4PVCA 3CZMA 4CQLA 5A05A 2NU8A 2PA3A 3QJ5A 3GAFA 3GA0A 3WGYA 4FFPA 4GGPA 1B16A 4TRMA 2ILTA 3NUGA 1ZK1A 4P8RA 2JFGA 3F3SA 3ZWCA 3HN2A 4ALLA 3SLKA 3FWNA 4LCEA 1PGJA 2ZQYA 2IEDA 2PKRA 3NJ4A 1U8XX 2H9IA 1M75A 3WIEA 5DBGA 4J9UE 3G49A 4Y9DA 3FNFA 3EVNA 3BHJA 1CYDA 1TA4A 3K73O 2VZ8A 3F4BA 1EUZA 2OL4A 4AL4A 4DQXA 3M6IA 1E7WA 1BWSA 3PZRA 5KWEA 1CDOA 1GPJA 3BMQB 2CUKA 2NVBA 3AM4A 5JDIC 2UYYA 3H2SA 3TZ6A 2NVUA 1UZNA 4RPLA 4JBIA 3TNLA 3U4CA 4PG5A 1RM0A 5I9MA 1HSOA 1R0LA 3JQ9A 4XQ9A 2PD6A 1AN9A 1B0AA 2E82A 3I5MA 2VYVD 4II3A 1ULSA 3UW3A 2IEBA 1LLDA 2YQ4A 3JYLA 3GPDG 4XB2A 2PZKA 1YO6A 3TZKA 5JO0A 2VWPA 3BMNB 1ZSVA 3QVWA 1QYVA 4KMSA 3HG7A 1ZK3A 4P22A 4TMFA 3PYLA 1T1SA 3VZPA 1KEPA 1PZEA 3JQDA 4MKXA 2LDXA 1SB9A 4WLVA 4AJIA 4CMKA 2XXBA 3AU8A 1EBUA 5KNLA 5HBRA 2J5QA 4EEZA 5KKCA 4GI2A 4IZIA 4JNKA 4DLLA 2I65A 1KYQA 4CM1A 3JQ7B 5EIOA 4DBVO 1T26A 3EUWA 5JY6A 3FR8A 4YAGA 2B69A 3OA2A 1C14A 3L4SO 3NTOA 4J4TA 1JKFA 1E5QA 4HP8A 2YV1A 5A9TA 1H2HA 1JVBA 2AE1A 2C82A 4AJ2A 3DWFA 2WE7A 2A94A 5CPBA 3FNEA 1QSGA 2ZCVA 1QV7A 1DB3A 3RJ5A 4PG7A 5I7FA 3ZU5A 3BMCA 3I4CA 3JQ9C 1DIGA 1HWYA 1LI4A 2CNBA 2GLXA 3G0OA 3O8QA 4Y8VA 4WJZA 3K96A 2CFCA 1A4UA 4EITA 2HRBA 2VRCD 1DIHA 1ADFA 3OJEA 4TVBA 3DMYA 3WBBA 3VH4A 4W7HA 4NBTA 2BI8A 5HM8A 1ENZA 1WZIA 3JD2A 1QLHA 1VRWA 5KJCA 9LDTA 4R69A 1JN0A 4C7KA 2YDXA 3D4NA 4AJLA 1WP4A 1MA0A 1IHXA 1GADO 2JD0A 3LLVA 3RU9A 2RHCA 3DO5A 1YS4A 2P68A 1OC2A 4Y6RA 3U49A 4WLEA 1PR3A 4WLNA 3DFZA 3PLNA 2EERA 4U6QA 4BV8A 1SPXA 4BNVA 1T2AA 1DFGA 1EFKA 4KTTE 2IODA 1C0IA 4KQWA 3DL2A 1Y9EA 3L0DA 4PZCA 1HDCA 2FMUA 4KDFA 3PHIA 2OGUA 5AOVA 3ZHZA 1LUAA 1ISJA 3PI7A 4RV9A 2R6JA 2WEKA 3A9WA 4A73A 4FJ1A 3ONEA 4DYVA 1ZFNA 5KCZA 2X4GA 3NX4A 5C3MA 4U6SA 4RGBA 4CQMA 2HLPA 3CUKA 1HDOA 1R37A 1MLDA 5JCXA 4OOFA 2AEJA 2W4QA 5ER6A 1J6UA 3I9OA 4FR5A 4B4WA 1NASA 2VUSA 4OYRA 3AUAA 3CINA 2C0CA 2GD1O 5JNLA 1FDVA 1PJQA 1TLTA 3L6DA 5TNXA 4W82A 1AE1A 4ALMA 4MVJM 4ZQBA 4NQZA 1U2GA 2Q50A 2VHWA 4IXTA 2YV3A 3JD1A 4Q3BA 4E32A 1XWFA 2Q3EA 3A1NA 1H6BA 2Q45A 1P0CA 3WQQA 3HE3A 3I52A 1M2WA 1DC5A 2GNAA 4KZPA 3PFWO 4NK5A 4BNJA 4Z6KA 3W6UA 5T67A 4IQ0A 3U4HA 3TPCA 4BNKA 3DZJA 1EVZA 2Q2QA 3QQPA 3RBZA 3QSGA 4D3DA 1H9AA 3ADPA 2FOIA 4FW8A 2PR2A 4M89A 3GEDA 3UOGA 1NPYA 1KS9A 2SCUA 3KZVA 3PIIA 3W4JA 3C7CB 4Q3DA 1YOVB 4CUJA 1MGOA 1DC3A 3LT0A 3RU7A 2X0RA 4WCFB 4AJOA 4MIOA 1HE3A 1HDRA 4Z0PA 3ZU4A 1EUDA 2D5AA 3RUFA 3W6ZA 1I33A 5B4VA 4NJMB 1ORRA 4AJJA 4R9SA 5IG2A 3OEYA 1MG5A 1O6ZA 4LMRA 1V0JA 2EG9A 4MVJE 3S2EA 4ND5A 5L3ZA 3EZYA 3GG2A 4D45A 1NP3A 3D3WB 3RSHA 3E1KA 3JQFA 4J7CA 1TT5A 1T2CA 4QUKA 3BA1A 4YJFA 4W4TA 2D4AA 5TSDA 2RCYA 1XCBA 1YB1A 2PZJA 1T24A 3WJ7A 5CDSA 4RPGA 4QXMA 3QRWA 3W4KA 1BDMA 2FR8A 2GSDA 3DZHA 3WSWA 3LSYA 5IDWA 2VHXA 1O0SA 2YUTA 1HXHA 1I2CA 2ZJ1A 4G5HA 4TSKA 4BUCA 3JQCA 4CM6A 3S55A 4FGWA 4CMIA 1QYDA 4RZIA 4ALKA 1WVGA 5H83A 1YONA 3UHAA 2YFQA 4CM4B 1P1FA 3IC5A 4FSHA 2FZEA 3WMXA 3VDQA 3ULKA 1A9ZA 1QRRA 2B37A 5KVCA 2VTEA 4PLGA 3ZV3A 4A2CA 4NBWA 2DUWA 4UUMA 3NJ8A 3Q9UA 5BNFA 6LDHA 2V65A 4NBUA 4UVHA 3I1JA 2FZWA 1YXMA 5EMHA 4BMVA 2AXQA 3G3EA 5JY1A 2EKQA 4OQZA 1N9GB 4O59O 1HKUA 3KO8A 4IDFA 2EWMA 3HDQA 4HADA 1K89A 1R0SA 1TXGA 1X14A 3GGGA 4E3ZA 4XDZA 3UGKA 3RROA 2D5CA 1GR0A 3PHLA 1NPTO 4EUFA 5EPOA 2FY8A 1VL0A 1C0PA 1ML3A 1DFIA 1FF9A 3GRPA 4WLUA 3WYCA 4AJ4A 1UP4A 2GZ3A 2DT5A 1JKJA 3INRA 3PTZA 3PWZA 4GL4A 5COBA 4YAEA 2EJVA 1GZ3A 2W90A 3GLQA 2VT2A 3WGIA 5CDYA 4CM7A 3A28A 1O94A 3UXYA 4ALJA 2OBYA 3JQGB 1MFPA 4Z9XA 1NR7A 4P38A 5DZSA 3ONFA 2BRUA 2QHXA 4F6CA 3H5RA 3KVOA 5TS3A 2NTVA 1XU9A 2Q1SA 4IDAA 4J0EA 3K6JA 4U7WA 4BNUA 3PLRA 2AA3A 4U0JA 1U4SA 3EW7A 3O9ZA 1G0NA 1VC2A 1ZXBA 1I2ZA 2BGLA 4Z3DA 4LN1A 4HFJA 4JJFA 2AE2A 4BO6A 5COAA 1PJLA 2BI7A 3FRJA 3ZNNA 4G65A 4YRDA 3VZRA 3I83A 1NQOA 1V35A 1XDWA 1UXHA 3EK2A 3UICA 3C3XA 4JJIA 4MJLA 4IDEA 4CMEA 3D0OA 4LRSB 1DHRA 5G0UA 1RJWA 3RUCA 3HSKA 4EJ0A 1Y9AA 2VT3A 2J3HA 4PVDA 3GVCA 1VL6A 3JQBA 4UEJA 4HNGA 3FBGA 4BNIA 3DFUA 4OM8A 4Z9FA 4IQ8A 4OJNA 3EC7A 4IBOA 1X1EA 1OBFO 4RQTA 3PEFA 4U5QA 3JQ6A 3G1TA 3LT2A 3CSDA 3ADOA 4YACA 4AJNA 3IP3A 1I2BA 4UEKA 4R54A 4Q3AA 4RVDA 1A5ZA 2Q4BA 3H4VA 4X54A 2IRWA 4QO8A 4P4GA 4YWJA 1QV6A 4H16A 4M87A 3DOCA 4BO4A 3LDHA 1LRJA 1W6UA 2C7GA 3OIFA 5FI5A 1BXKA 4IDCA 2PKQP 4J4BA 4BB6A 1LDBA 2PV7A 3AY3A 1U3UA 3AM5A 1X7HA 1NNUA 3TDKA 4GMGA 3OBBA 2GDZA 3ITKA 3BTVA 4PLWA 4RVFA 1DJNA 3GY0A 1DXYA 1NFFA 1XKQA 2NACA 4FFRA 4EBFA 2OUIA 4D3FA 3QVTA 4KOAA 1P33A 4NDNE 3JQBC 5BNIA 4NI5A 4IIUA 3TRIA 2IYOA 4RPKA 2AEMA 5G0SA 3K5PA 1LRKA 1CIVA 3H6KA 3WX0A 1F14A 3GEMA 2X0NA 4IS3A 4WNIA 2JCVA 3QLJA 3E6AA 4GKVA 4A0SA 1WNTA 3KUXA 4DQVA 2OHXA 5I7SA 3DAGA 2GRAA 4BOYA 1C3VA 1FMCA 2VNSA 3BMCB 3DOOA 1OI7A 1OC4A 4FC6A 3O8QB 4PG6A 3QW2A 4Z3KA 4IQGA 3F9IA 3L07A 4DMMA 2C5AA 4ALNA 5JDCA 4OMUA 2B4TO 1RYDA 1PJ4A 4J4HA 1R4MA 1D8AA 3N7UA 1VPDA 4ITUA 4BNLA 3AI2A 3PHJA 1GTMA 1LSOA 3WGTA 4CMHA 3W4IA 5CEJA 1DIAA 1P74A 3MZ0A 3RKUA 3U3XA 3HDYA 1BMDA 1NQTA 3GN1A 4GSLA 4PFJA 3ETGA 1P1IA 2VOEA 1LDEA 2QX7A 2D1YA 5EQFA 1I01A 3NDRA 1EE2A 4FBGA 1A7AA 3H5NA 5JBIA 5JYDA 3E82A 3TQHA 1O95A 3H65A 4FQ8A 4RCVA 1WXDA 1LXCA 1JDJA 2CMDA 2C7VA 3ZW8A 1D4FA 3GH3A 4MVJF 5TRTA 4BV9A 3SJUA 2ZTVA 1R0KA 1PU2A 3HUDA 4ND3A 1WLYA 2PZMA 4IJUA 5FFFA 2JFFA 2UV8A 4I08A 4AJ1A 3KBOA 4C7JA 1FK8A 4I5EA 4CQMB 3WLEA 2BFAA 4GKBA 2D0IA 3GG9A 3VTZA 4NMHA 1CWUA 5BR7A 5TT0A 4WCDA 1PJSA 2EIHA 1XGKA 2GN8A 1T25A 1K6IA 3D7LA 3DQPA 3TOXA 4NJOA 5L7YA 1GZ4A 3EDMA 4CMJA 2DFDA 2BFMA 4I8XA 4YTEA 2X0IA 2FPGA 5G2OA 4BIIA 5ICMA 1E92A 4F6LA 3I3OA 1Y8QB 5A02A 4CV2A 4I1IA 4BHTA 3W8EA 1PJTA 2W2LD 1ZMTA 2ZIZA 2E4AA 3EMKA 1IUKA 2BHLA 4CL8A 4E2YA 5BNTA 1NFRA 4GX1A 3WWYA 4D0SA 2CZCA 1LC3A 4EW6A 3DBRA 1PGPA 1Q2XA 4KP7A 3VKVA 3F1LA 4XGKA 3HWRA 5L4SA 2Y1EA 5JYEA 2DBVO 1IOLA 3ROMA 4UULA 4E31A 1DDOA 1E6WA 3L6EA 4M55A 1LDYA 4K9DA 3ZWVA 4LRTB 3U4IA 3S1LA 5T5QA 2JD1A 1NBOA 3TSCA 1HRDA 3CPSA 4DLAA 5CFZA 2EV9A 2B4RO 1NXQA 5TX7A 1N2SA 4BKOA 1R15A 3PYMA 1EDZA 5IXSA 1VL8A 4CLOA 1C0KA 2HSDA 2YHIB 1ONOA 5JAQA 1EBFA 1TI7A 1PSDA 2EF1A 3HHPA 4O63O 5DP1A 3U5TA 4B8WA 2G0TA 4B8ZA 4YAIA 1MXHA 4GPD1 3V2UA 3DTYA 2G82A 4YPOA 3L6OO 2PGDA 2DUUA 1PWXA 1TT5B 3KV3O 3AOGA 1GQYA 4E5YA 4YJFB 4W7IA 1ZH8A 3BAZA 3SXPA 4MP3A 4XGNA 5L4NA 3GDFA 3GPIA 4EI2A 3DR3A 3NGLA 1AUPA 4D79A 4RORA 5C7OO 2FRDA 2ET6A 1PL8A 3WIDA 4RJTA 1T2DA 4HBGA 1ZUD1 4J1NA 4PLFA 3NYWA 3FNGA 4CMGA 2QW8A 4GX5A 3W1VA 3JQGA 3GVHA 1U9JA 3DEYX 3VPHA 2DBZA 4OKIA 1GV1A 3MJSA 1FDWA 2I67A 3RVDA 4MO2A 4YB8A 3OA0A 3VPFA 4FC7A 4PG4A 5B1YA 2B5WA 4AG3A 4L0QA 4YDRA 5JDIA 1DRUA 2VRBA 4FN4A 4KUEA 2QZ9A 3QVOA 4UUPA 4NK4A 1P0FA 3WS7A 4OOEA 2X23A 4RDHA 3NRCA 2IYPA 5A4DA 4Y6SA 5L7TA 4XYEA 5CEEA 1ADBA 3RUEA 5DULA 3W8DA 1JLLA 3PGXA 1ENPA 4AJHA 4IUYA 3D4PA 4J3FA 2P5YA 1YB4A 2OZPA 1JWBB 1XG5A 2O50A 1VE9A 4YT2A 1X7GA 2XPCA 4KUGA 1VSUA 2HRZA 4IDDA 5T57A 1EK5A 1I32A 4IJVA 3WG9A 4E4YA 6ADHA 3S2GA 3RQSA 2X9NA 3AI3A 1ZXLA 3GMDA 1XIVA 3EY4A 4ILKA 4L4RA 2XXJA 3WR5A 5C7LO 2PD3A 1QXSA 3SX2A 4ZVVA 3ZW9A 1Q7BA 3RUDA 1PJBA 1Q0LA 3KLMX 4JN6B 3ITDA 4N18A 4BMNA 3S8MA 2ZYAA 1MX3A 3B70A 2ZB4A 4J16A 2ZYGA 3GNSA 3VOSA 3WYBA 4Z0TA 1HDYA 1U28A 1XQ1A 1J4AA 2FHSA 3RD5A 3JD4A 3KM0A 4JLWA 4JXKA 2G1UA 3ZWYA 1YDWA 2NADA 3HADA 3JYPA 1NVGA 4BNFA 4D7AA 4XEHA 1WDMA 3EVTA 2GASA 2GUGA 2NWQA 1EK6A 3O4RA 4XGIA 5TF4A 5A9RA 1LSUA 1P1KA 4MVJA 1UP7A 4QECA 1ZMOA 3L77A 4XR9A 5IFLA 5B4TA 1E1NA 3PQEA 2EW8A 3Q2KA 3VHRA 1GQQA 2ZTLA 3QWIA 4P4NA 1DAOA 1ZJZA 3DHEA 4NBVA 2WTBA 3V1UA 4R68A 5HTOA 2X5JO 4QFDA 5DNAA 4QTZA 1JKIA 3VDRA 4CMAA 4MDHA 3RJ9A 1SEPA 2CD9A 4KDEA 3Q2IA 3DDNA 4JBGA 5I7EA 1DRWA 4RF3A 3H3FA 4GX2A 2DPGA 4E33A 1E3EA 4DA9A 4L74A 2E37A 1DIBA 3PP8A 3ROQA 4GGOA 4BVAA 3F46A 5A03A 1GEGA 1ZIDA 1HEUA 2PTGA 4RZHA 3OSUA 1BTOA 3QA9A 2J3JA 3ZNPA 1S7CA 4N5LA 4R5MA 1WDLA 2P4QA 4URFA 4I9HA 5A04A 4NFHA 2CVZA 3KSUA 2NTJA 2HK9A 3RC7A 2OP1A 5CAEA 1ISHA 1E6UA 3LZ6A 3IIEA 5FF9A 4A03A 1R4NA 2QRJA 3E9QA 2HJSA 2WMDA 5EERA 1CERA 1DJQA 1LU9A 1Z73A 2VTDA 2OP0A 2Y68A 3KYDB 4BNZA 4F3YA 4OXKA 1E7QA 4A5OA 1N1GA 1ZSYA 4XYLA 2H5LA 2Q1UA 1VKOA 2P9GA 3D64A 3L4BC 5JMPA 2ZB3A 3V8BA 1DLJA 1UH5A 4DIOA 1QR6A 3ZH2A 2JFHA 5CDTA 1SEVA 4FPXA 3NDJA 4CR8A 1GYQA 1U2DA 3RBXA 3UF0A 1CQIA 3WGOA 3KETA 1GZ6A 1HLDA 3FPCA 4OL9A 3L9WA 4GAEA 3MJCA 5TT1A 5A9SB 5GZ6A 1X7DA 3R3SA 4MINA 1AHHA 2I3AA 2JJYA 3MTGA 4TQGA 3NV9A 3GZ4A 3LT4A 1JU9A 1EZ4A 1EVYA 1JAYA 1YBMA 2PH3A 3M2PA 1HETA 3CKYA 1K0UA 2B35A 1WPQA 5H82A 1ZNQO 2XF8A 2Y05A 1R4MB 3N74A 1UDBA 5K6AC 1YL6A 5L95A 2EGHA 4Q3NA 3B1KA 3CMCO 2GZ1A 3ZNOA 2NSDA 3X2FA 3FNHA 5T6BA 1Y8RA 3I9JA 1KC3A 4C4OA 4OKNA 1Y8QA 2QZZA 3TZHA 3HZZA 5JC8A 2VZ9A 5B37A 3IKVA 5TLSA 4J7UA 4NBRA 1M66A 2XOXA 3K31A 2OBNA 1XHLA 3QWFA 5IZ4A 3IKTA 2H1SA 1GYPA 1LQTA 1SCUA 4HXYA 1F8GA 1Q7CA 4W9NC 5TGDA 3VPXA 3C1TA 4B7CA 1MB4A 4NHEA 3ZHBA 3ANNA 1NWHA 2DM6A 3I9KA 1B7GO 3F6YA 3SJ7A 1V6AA 1ZBQA 4TRRA 4DQUA 4IJWA 3RFTA 1TVEA 3H9EO 2C5EA 5A1TA 4BKPA 5ITWA 4JGBA 4BQRA 4QO7A 3AK4A 1UR5A 1XR3A 1JA9A 3TF5A 1FDSA 3JD3A 3H9QA 5ENDA 4ONEA 4W6ZA 3WGZA 4DMLA 5KKAA 3GHYA 2FN7A 4XIYA 5JE8A 3V2HA 5FWNA 1U5AA 4FGSA 1NQ5A 4ZQEA 2ZCUA 4J7XA 2ZB7A 1IHYA 5AXDA 1NWCA 3TWOA 3AUUA 1U7HA 2YHIA 4M49A 5JSFA 4KWIA 4GWGA 4GWKA 3OJOA 2P9EA 3IQDB 4PLZA 4MVJP 1SNYA 3WXBA 1B8VA 3TZQA 4E12A 1B8UA 3TOZA 3UVEA 4R4JA 5DDIP 4CMCA 3NTQA 4J2HA 3BMOA 4YQYA 5C7IO 3OQBA 5C5IA 3OP4A 2VUUA 2VN8A 4GLOA 1E3JA 3DBRB 3KYBA 4L4XA 2ZJ0A 3CTMA 4CR6A 5IN5A 3N58A 5FI3A 1A71A 1SZJG 3FHLA 1T2FA 4MIEA 2GCGA 1AXGA 1H6CA 1R16A 3QHAA 4XWYA 3FR7A 3KEQA 1UZLA 1AXEA 3HB4X 2Q99A 1IPFA 3GC6A 4RF2A 4P4LA 2Q46A 1LLCA 4L75A 4PCVA 3BHIA 3CMMA 5LDHA 1C1DA 4WOJA 4DL9A 1YL5A 4WEOA 1ZK4A 5B12A 1DEHA 5CEFA 3BTSA 3IS3A 5DOZA 1I3KA 3EYWA 1Y7TA 1BVRA 4B3HA 2Y1GA 2B4QA 3WQRA 4NG5A 3RBVA 1OFGA 1N92A 4AJPA 4CLOB 3PQFA 1O5IA 3SC4A 1E3IA 1H5QA 2H6EA 4LW8A 2PFGA 3WOHA 1XLTA 3KRTA 1LQUA 5JPIA 1YL7A 4CQMD 4E5KA 4QFCA 3DAFA 5COQA 3M2TA 3BYZA 4ND4A 3GQVA 2I66A 2YJZA 1NHGA 1P1RA 4R16A 3WWZA 1HYEA 3WICA 4MVJI 3EZLA 5ITVA 4Y98A 1CRWG 4RVGA 2GN6A 3IP1A 5F3RA 4ZD6A 1IZ0A 1NQAO 2B36A 2HK7A 3U0BA 1LA2A 1GYRA 1X13A 2GZ2A 3NKLA 5JCJA 1F12A 4E30A 1MFZA 1LSSA 4XCVA 1KVQA 1GEEA 2JCXA 1PL7A 3V5NA 4BNTA 3FTPA 3OJ0A 4BO9A 2Q49A 4BGIA 1R66A 1H94A 2HKIA 5TJHA 4D41A 3I23A 4OAQA 1MC4A 4EYEA 4RLSA 4G2NA 4CV1A 3INTA 3IUPA 5GMOA 1JAXA 1N5DA 5TIIA 2EP7A 2NU7A 1M76A 4NNJA 3IUSA 2PGLA 5TJ9A 5BSEA 3GT0A 2VQ3A 2WYUA 4LGVA 1Q1NA 3I9LA 5DCWA 1B15A 2BLLA 1A27A 1KY5A 2WYVA 4IY1A 3GHHA 1UAGA 4LVUA 5T64A 3KSDO 4B3IA 4BO2A 3I9MA 3OMLA 1V3TA 2JL1A 3VAZA 2DKNA 4R9RA 5A3VA 4XR4A 4W99A 3JQEA 1AHIA 1ISMA 3AM3A 5KVVA 2G5CA 4FFNA 1NAIA 2YHUA 2BH9A 3IJRA 1KIFA 4XA8A 1E1LA 2JAHA 5GZ3A 3QVXA 5IZCC 3L9XA 1YE3A 4H15A 3HQ4O 4WGGA 4HY3A 3AJRA 4FD3A 2G76A 3H8VA 4WK6A 3GN2A 3C8MA 3NT4A 3PK0A 4IJKA 4N5NA 3V1TC 5BSFA 3M1AA 4BO3A 2GN4A 3BHMA 3H9UA 4MP6A 4B3JA 4YR9A 4FJ0A 4CLRB 1ZJYA 1N7HA 1NHWA 3ZWMA 3QV1A 4YXFA 2EJWA 4JIGA 3LT1A 3ZWWA 3FN4A 4BKRA 2Y0CA 4AICA 1HLPA 1MP0A 4AJKA 2O2SA 3CH6A 4RVUA 4FCCA 1LDNA 4CLDA 2RH8A 5K0ZA 3ZGYA 1ZW1A 4UUNA 3H5AA 3HFSA 3TFQA 3H2ZA 1CF2O 1UJMA 5U4QA 3OM9A 1HT0A 1PZFA 1IY8A 4PLCA 5F1OA 4CM3A 1FJHA 2F1KA 2Y66A 5HWSA 4IGEA 2X5OA 1PS8A 4ZHSA 4ID9A 1YBAA 1YQDA 3KYDA 4E2ZA 1DFHA 1GCUA 2VHZA 3E48A 4XYMA 3ZV6A 4AVYA 2QIOA 2DBQA 1U8FO 4GVLA 1I10A 2X8LA 1L1FA 5JMWA 3OETA 1UXIA 2UUOA 4INAA 3GNTA 3ZWPA 2GO1A 4NU5A 1FDTA 3JYQA 2ZATA 2Y1DA 1RWBA 3RASA 1ARZA 4B7UA 5KJEA 4F45A 1Z6ZA 1ISFA 3B6ZA 4MIYA 3ZU2A 1LRLA 1FXSA 1C0LA 1PGQA 4IIVA 1SMKA 3MWDB 1Y1PA 3AFMA 4BNMA 2HMSA 2Y93A 4DUPA 2ZQZA 4BNNA 3AFNA 5A9SA 1MV8A 2V6BA 5LDGA 2J5KA 4BKQA 4EUEA 2PY6A 2W98A 4CV0A 1GL3A 1A4IA 4J9VA 4I9NA 4XX0A 2BFOA 4J91A 4DRYA 4RPHA 4EZBA 1XQ6A 2Y1FA 2DTDA 4WECA 4PLPA 3UN1A 5BQFA 3HB5X 3DZKA 1R4NB 3PZBA 4R1SA 3WTBA 1P1JA 4KWHA 4YJDA 4LSWA 5EJ2A 1NFQA 3NTRA 4CMBA 4JROA 1SOWA 1QG6A 2FP4A 4PLTA 4HV4A 1KERA 1I24A 2RIRA 2TMGA 2X5KO 4J90A 5KJ6A 4JK3A 3JSAA 4NH4A 3SVTA 3RIHA 3Q3CA 1Z7BA 4JBHA 4KQXA 4OH1A 2FSSA 3DXFA 3RFVA 1KEWA 3VPSA 3VVCA 4F46A 4PLYA 1L7EA 1LDGA 2NLOA 5KJFA 2J8ZA 3O26A 1A72A 1PWZA 4L4SA 3F5QA 5EINA 4CV3A 3WFIA 2C29D 1EUCA 3TN7A 2WWRA 1WAMA 3F5SA 1FDUA 4HKTA 4E6PA 3EAGA 1RPNA 1W0CA 5BSHA 1V9LA 1ZK2A 3O03A 3FBTA 1YDEA 3VH2A 2D59A 4PRLA 4B4VA 1L7DA 2UUPA 3OJFA 3LC7O 5CP8A 1I3MA 3RC1A 4LSMA 1HZZA 4E0BA 4A27A 4FOOA 4NU6A 4AFNA 4GQAA 1E7SA 4HX5A 2C2XA 2PK3A 1Y8RB 3PHGA 4EJ6A 2IE0A 1P45A 3GAZA 3R1IA 5G0VA 4YAKA 1E6EA 3MJTA 3DZBA 1GUYA 2B5VA 4WOKA 2O3QA 1BHSA 1G6KA 2AQHA 2RAFA 1BSVA 3GUCA 3ZZNA 4UVGA 3OECA 3K2EA 4L73A 5THQA 2AHRA 1H93A 4UAGA 3A4VA 3E9NA 4J49A 1JW9B 3ABIA 3HDJA 4IGFA 1V3VA 5K9ZA 4TZTA 5IAAA 5T8KC 4K6CA 3MJEA 5JAZA 3MJVA 4D42A 2GGSA 3GRKA 1K6XA 2CDAA 4H7PA 3E03A 2B83A 3DMTC 3KXDA 5I7VA 1Q7GA 3OQ6A 3LK7A 2HUNA 3BIOA 1H0KA 2Y67A 3AUTA 3KEOA 1G1AA 4NFYA 2EXXA 1OMOA 1ZO8A 3WGGA 1J0XO 2BKAA 3DTTA 1JVSA 3C24A 3GVPA 3JQ8B 2VZ0A 3NDIA 1MG0A 5I9NA 2EW2A 1HYGA 2ZKLA 2EKLA 2WDZA 1VJTA 3DBLA 2Q4EA 4LVCA 5A5EA 1XEAA 4XYBA 1U4OA 1Y81A 3X2EA 4J0FA 3WGQA 1I3LA 4BQPA 1YH3A 2Y0DA 3BMOB 5U1PA 1Q0QA 3PJDA 4XDYA 1IL0A 2AG5A 2HMUA 4WLOA 4CL3A 2Q1WA 3W8FA 1YB5A 3D4OA 4WASA 5IF3A 4TZKA 3ZNQA 3U62A 4XZ3A 1PQWA 4CUKA 2NM0A 2OMEA 2GN9A 4XYGA 4BNHA 3PJEA 5THKA 3WQSB 2PLAA 2F00A 5GY7A 2NV6A 2AW5A 3P5SA 4HFRA 2VWGA 1GAEO 4TKLA 1U3WA 1C1DB 1HF3A 1CETA 4IDGA 3HJAA 4DPKA 4MPDA 4K6FA 3ZCXA 4CODB 3GGOA 3GR6A 1GU7A 4CR7A 3I9NA 1XU7A 4DIBA 3LF1A 1ISGA 1X0XA 4DC1A 4I5GA 3VPGA 4RDIA 4ZU3A 4B4OA 1I36A 2Y1CA 2P9CA 2AQIA 3LVFO 2YQ5A 4WKGA 4LCJA 3ONDA 4WUVA 3H9GA 2J3IA 4BKUA 3SEFA 4FFLA 3ZWNA 1ID1A 2DLDA 1IE3A 1NX6A 1E3WB 5CPFA 5AYVA 3K9QO 3R6DA 2Y99A 1NVMB 3OQ1A 1B26A 5AQ1A 1LSJA 1DAPA 4NFSA 2VRCA 2BGKA 1E3LA 4L76A 2OO5A 4GSKA 2JHFA 1E7MA 5DCYA 2NQTA 2PH5A 2RH4A 5J23A 3B20A 1I5RA 5HA5A 4FB5A 1BXGB 5TC4A 2I99A 3P7MA 1VLLA 2YZ7A 1VJ0A 3Q0EA 1AGNA 4GBJA 2AMFA 1I0ZA 4BGVA 3LU1A 4TVOA 4EDFA 4RF5A 4CLRA 2DBRA 1UUFA 1F06A 3B1JA 4MKRA 3DBHB 5CDGA 3EGOA 4D44A 4NZ9A 1F0YA 2IZ1A 3C7DB 2D8AA 4YRBA 3PPIA 2OFPA 2Q2VA 2CF6A 3RUIA 5IJZA 4O1MA 1K3TA 1PX0A 4FS3A 4ZQGA 4BO8A 2NTNA 1DOHA 4YAJA 4JJGA 4QX6A 4JX8A 3MTJA 3GK3A 3PFFA 1UZMA 4ROSA 3K8ZA 2FPIA 3RCBA 5IN4A 1LJ8A 1Z74A 1GUZA 2AEFA 2VHYA 4MOWA 1BDBA 2NUAA 3OIDA 1U1IA 2BFPA 5F21A 3L4BA 2IDZA 2PD4A 1ZSNA 2V6MA 1EQUA 2O7SA 4XRRA 2GYYA 4YT8A 4JP2A 1PGOA 1JQBA 1OZAA 4BNYA 1T1RA 2ZTMA 3VKUA 4CLEA 5CDUA 5JFOA 1YGYA 3JYOA 1TEHA 3ZDFA 1LNQA 1HE4A 4IZHA 3IL2A 2NNLD 4OQYA 1BVUA 5AVOA 3RUAA 1P77A 1E5LA 4CLHA 1F8FA 3DZGA 3WB9A 3NEPX 4BO7A 3ETEA 3GEGA 2WSBA 3MCVA 1IULA 4XKJA 3KYCA 1BW9B 4J43A 4RO0A 5A06A 3Q6IA 3GDOA 1HZJA 4DWVA 4I9UA 1BG6A 2BELA 1UAYA 1YJQA 3E8XA 4K1LA 1HDGO 2HQ1A 3AU9A 2NU9A 1GV0A 3JTMA 4KTVE 2VOJA 1DC4A 1MXFA 2NU6A 3LF2A 4ZICA 1BGVA 3E9MA 4GVXA 3GVIA 2X0JA 4YJHB 5C37A 3ZHXA 3DONA 1N1EA 5K6AA 1M6WA 4M8SA 4WPGA 1I8TA 2P5UA 4J6FA 1DLIA 4QEDA 1E77A 3H7AA 3H9JA 4J1QA 4IDBA 4IINA 3DAPA 2ZB8A 4UREA 5JAIA 2TMDA 3U4DA 3IMFA 4FDAA 1F17A 2HMWA 2O23A 3ASUA 3AI1A 3QY9A 4EEXA 4W9NA 5JAMA 1DRVA 1G0OA 2I76A 3CIFA 3QP9A 2UDPA 2HDHA 3CXRA 3D3EA 1T2EA 5F1KA 3ZWAA 1PL6A 1E1MA 1B3BA 1P9LA 4GLLA 4E2WA 2O48X 3GZNA 3BTUA 4HFNA 3LC1O 4ND2A 1HDXA 1IB6A 3AY7A 4H3VA 4HUJA 4NIMA 2I3GA 1HE2A 5G4KB 1Y5RA 5JO9A 3ETDA 3F1KA 4J2OA 5IXYA 2HK8A 2O7QA 4PN3A 4PLHA 3WNVA 5BT9A 2RHRA 5G4LA 1YKFA 2DU8A 4YYZA 3STHA 1QP8A 1QYWA 3RC2A 1MC5A 3QWBA 4WLFA 2VWHA 2X6TA 4A10A 4MVJD 3QWAA 1PIWA 4N7RA 4PRKA 3WGHA 2YV2A 4DYDA 4NPCA 4CUZA 3PWKA 4BO0A 1MUUA 4BNGA 4BO5A 3E18A 2NVWA 1Y5MA 3PDJA 5ILOA 3Q9NA 4RQUA 5MGBA 2YDYA 4D43A 1JWAB 4D0RA 2P91A 5IDYA 3RWBA 1TB4A 4I5FA 3KSZO 4YBZA 1X15A 4XJSA 2EP5A 3ZV5A 4R3NA 3GFGA 4Y67A 5DN9A 1GUFA 4PLVA 4M1QA 3G79A 4R41A 1YRLA 1WZEA 2NQ8A 5IDXA 3OH8A 3HDHA 3I4FA 4IXWA 8ADHA 3PJGA 2W8ZA 1LLUA 2CY0A 3PVZA 4PG8A 3FPLA 3A14A 1WW8A 3JQAB 2EGGA 3AY6A 3WTCA 4DLBA 3BZUA 3ANLA 4U0KA 1X1TA 2AQKA 4Q3CA 4BGUA 3PXXA 3ASVA 1C1XA 4NR0A 2R00A 2CDBA 2FSVA 1ADGA 1KOLA 3JQ8A 5KVSA 1QYXA 5F5NA 3RFXA 4YRAA 1LBEA 3JD0A 3QIVA 1UXJA 2O3JA 4TWRA 4OIMA 4K26A 3IJPA 4QQRA 3Q1LA 3DZIA 1HTBA 3AUSA 3V2GA 2GERA 3ZHYA 3NT5A 1DIRA 2QG4A 1EFLA 2YY7A 3MEQA 2JAPA 2QRKA 2YW9A 2W2KB 2UVDA 1NPDA 2X1HA 1B14A 2O3RA 3FWZA 4DTIA 1K5HA 1P1HA 3K2BA 5F5LA 1B2LA 2IXAA 3NAQA 4RLHA 4DXHA 1W4ZA 4E13A 2G17A 2O4UX 4E5NA 1D1TA 1EQ2A 1NTOA 3S2IA 4G81A 4KUHA 1SBYA 3S2FA 3P19A 5CG2A 1A7KA 1SB8A 2DVMA 4ZRNA 4ZQFA 3ROPA 2HJRA 3KOUA 4QSMA 1O9BA 1RM3A 2J5RA 3C1AA 1BXZA 1EE9A 3ORFA 5BSGA 4IM7A 1HDZA 2DQ4A 5KIAA 3TZCA 5L53A 4WEQA 5H81A 3JV7A 1ZK0A 3ZI0A 1DSSG 2R00C 2IZZA 3QWHA 1E7RA 3CZRA 2VNAA 2IXBA 3ZWBA 1PS0A 2V6FA 4PZDA 5HS4A 2A35A 4K28A 1RYEA 3PDUA 3DBLB 1A9YA 2ZK7A 2JD2A 2EEZA 4L9RA 5CHEA 3PGJA 1E3WA 1KVUA 2DFVA 2Q2WA 3QVSA 3UCEA 2A9FA 3I6QA 1I3NA 1RM5A 1ULUA 4I5DA 4YQZA 3WSVA 4ALIA 3ZU3A 2O2YA 5KTKA 5G0WA 4BL5A 5I8ZA 2YYYA 4BO1A 4DIFA 2LDBA 2DTXA 3MOIA 4CM8A 3G1UA 2WD7B 3RI3A 4LMPA 4B7XA 4YT4A 1KBZA 3FF4A 2OOSA 5IZCA 1J49A 1DC6A 1LDMA 2X9VA 3O38A 3OF2A 1BXGA 1LLQA 4Y6PA 1P44A 2GPTA 2JHGA 3JQFC 3M1LA 2FR1A 1CQJA 4A26A 2GF2A 3F4LA 1VM6A 1ZCJA 2YFHA 4E5PA 1SO8A 2X22A 2DPHA 3DHYA 2VWQA 3PIDA 3QE3A 1YWGO 4JQCA 1ZEJA 3FD8A 2CSUA 2D2IA 5DOVA 3DBHA 4O5OA 1J5PA 2QQ5A 3LLSA 3D1LA 2GR9A 2P2SA 3AOEA 1GFSA 2CDCA 4R1UA 4U8GA 1GDHA 3PQDA 5G0TA 4M54A 3FSRA 4TRJA 4XQEA 5LC1A 4D3SA 5DCUA 3BXXA 1D7OA 1NAHA 1UP6A 4ZN6A 2X7HA 1PGNA 1U3VA 1LC0A 1HE5A 4TRNA 1KVRA 1VSVA 3OICA 1H9BA 2E6UX 3UCFA 4D46A 2P4HX 4YCAA 3BMQA 1E3SA 3I6IA 3COSA 1N8KA 2Z1MA 2C20A 2WE8A 2HMTA 4Z9YA 5AXCA 3ICPA 3MOGA 2I6TA 1EVJA 2BF7A 1WDKA 1PZGA 4UEOA 3LYLA 4PIVA 4S1VA 4XD2A 4YJGB 3GNQA 3IDSA 5EESA 4CQLB 4GMFA 5DP2A 4II2A 3GFBA 2VYNA 5L9AA 3BMNA 2Y0EA 3OEWA 2O3TA 1CJCA 4DBZA 4FIZA 4HWKA 3ST7A 1NYTA 5JS6A 3KLPX 3K92A 2QYTA 4XB1A
chains in the Genus database with same CATH superfamily
2B1QA 1UBTS 3AOEC 3BN3A 3OM1A 4IHJA 2R5NA 2MJLA 2VP3A 3NOVA 5SZJA 3GUYA 1MDBA 1SXGA 2H0QA 2UZIR 4RFVA 3IMGA 2X1LA 2Q6VA 1E1QD 2QX9A 2VLIA 2ZYWX 1TA9A 1UBNA 2WHEA 5CX1B 1XAGA 3QNWA 4FMDB 5ALRA 4AT1A 2BBOA 5B4UA 1PJ3A 2PLNA 2GVDC 1A5AB 2H2AA 3OX4A 2FW9A 1REQB 1N2OA 1L5QA 2C98A 3DHNA 3UC9A 3O3MB 5K3AA 4XVUA 3HBNA 2PWZA 3NWOA 4GNKA 4Z53A 4RKRA 1A4RA 2BRUC 3E3OA 3HBLA 4R5HA 4M1YA 4C9BA 4RIEA 4BVGA 3W5JA 2XGOA 2FPIB 4LZAA 3UBMA 4MP8A 3ZV4A 4YV2A 4X92A 3TL3A 4PZEA 1Y6JA 5KSWB 1PTJA 1WHSB 1W94A 3NG1A 4LYAA 1K8XB 3WBFA 3MCWA 1IXYA 2AQ8A 2VQDA 2E48A 3RPEA 3FROA 4UHCA 4Q82A 3DE3X 1C3OA 4RJ2A 3T4XA 4UVEA 5SZKB 4G4JA 3JALB 2DTEA 5HMMA 5L45A 9LDBA 4NARA 3NI2A 2C4WA 3SXUB 2WJPA 1Z62A 4D6PA 4LMAA 4B8YA 4EK9A 1RBZA 2FSIA 3ETCA 2QUAA 1SN7A 2HAEA 4MZXA 5JNVA 1FDOA 1G17A 3JSXA 3RS4A 1W93A 3KJGA 2HCTA 4F11A 2R0QC 4HN4B 1WWKA 3P2YA 2ERYA 3MLEA 2F9FA 3C48A 4CMEC 5LA6F 1QKJA 3EYAA 3PYXA 1GPBA 5DT9A 5MN5A 2R6ZA 2UZ3A 4F3CA 3ZIDA 1CEQA 5FBLB 3AR8A 3GQBB 3B60A 3L7DA 2C5SA 3TRKA 4AP5A 1DE0A 5WRFA 4DPMA 4DREA 5CXQA 1QQ5A 1BKDR 1SCDA 2ZRJA 3ESRA 3PXDA 1EZZA 3DBVO 4NKRA 1YZYA 3EE6A 4HGNA 3WV5A 3P2IA 1UFRA 3IO5A 3QTBA 1L8LA 3L06A 4GOLD 4XIJA 3NC1C 3G8YA 3VNVA 3U9LA 4HI0E 3BHNA 4IH4A 1VE5A 3H2BA 3JWGA 1K2WA 1Z06A 2NSYA 5JT1A 1PQPA 1H2BA 1QRAA 2Y8EA 3MS4A 2OGTA 3SCZA 1ABFA 4X0EA 2WJ3A 4KO2S 4QQKA 2B20A 3B1FA 1OZHA 1F2VA 4Y18A 2A1TR 3IAHA 3C5EA 1EDOA 1PX2A 1SOVA 1PYDA 2J3KA 2PR7A 2R11A 3G2LA 1NIJA 3KE9A 3QE4A 4JT2A 3FOWA 4DRXB 5JQWA 5JSQA 1NNLA 1NBEA 3PWSA 4Q4AA 4E07A 4L57A 4HDOB 1XE3A 2FZCA 1SG6A 4KXYA 3RYFA 5EZYA 3FGNA 4N4AA 4AKEA 5FYDA 1N1MA 2X86A 3L7NA 4HQ6A 3VJKA 4ZYLA 1WR8A 3L5OA 3PXAA 7MDHA 4XRGA 4HD8A 5H16A 5DNCA 5ECGC 2HMVA 1PKXA 2QU8A 3DEAA 1MW8X 1FS5A 1QQ6A 1U7TA 2YWCA 2Z58A 3GZNB 4IMPA 4TWBA 3AESA 3PRJA 2D62A 2GEVA 4JXJA 1GZHB 1W44A 1BCSA 4M86A 5T8KA 4ND1A 3UNXA 1T10A 2QLNA 3MBOA 1KY4A 3QYFA 3R7SA 1KO8A 4NU8X 1R8JA 1MABB 4OKSA 4QNNA 1WHTB 2A9RA 1SZPA 1S3SA 4KLAA 2OA0A 5DYYA 2HWWA 3DMTA 4MS4A 2X8WA 4QEKA 4TWZA 4YASA 4AY6A 3JQAA 1H3EA 4C14A 1A9OA 1CUVA 4UM8B 3LL7A 2C4UA 1ENYA 2HNKA 2Z09A 5AXAA 3NGXA 1CU1A 2POQX 5DTIA 1ZKMA 3OZGA 3FLBA 5FUBA 3PHHA 4JSTA 3T1VA 4ZA2A 2IDJA 2WYWA 2VVTA 1FW8A 3L8DA 2BMAA 3OFSA 2ZBEA 2C3YA 4HNQA 5FEUA 3SZLA 4ZGWA 3VR2A 5IBCA 5TMPA 1WMSA 721PA 2CNOA 4Q4JB 2G9VA 4N54A 4TN5A 2P4UA 3FMPB 2NZWA 4FYIA 3G17A 1BRMA 1YOVA 1C29B 4AECA 3RSCA 5AUPB 1AXRA 1MOQA 3RC3A 5JATA 5LYJB 1JA1A 4A6EA 3BREA 1NR1A 1UZUA 4WESB 3WJAA 4JUFA 4WK4B 1PK8A 3H1FA 1UBRS 4JGIA 3HZOA 4RDXA 2DCUA 2OVFA 2YZMA 1UXKA 4L8YA 1AS0A 1CE8A 4O0LA 4DCVA 1ZM7A 2VP2A 3LDFA 1Z75A 2BFBA 4JR2A 1R9NA 4XB6B 3AIOA 4MYCA 2FU5C 3KB6A 3UWOA 2OCGA 4NYJR 5J4HA 5E38A 3JWPA 1H5NA 2A0FA 1D07A 3EOZA 2YV4A 4A0GA 2JCYA 1V5WA 2WT4A 3EGXA 4CEIA 2VXYA 1VYHA 1JXAA 3GIDA 3CRMA 3UH1A 2V4ZA 3H1AA 1Q0HA 5LLTA 2J33A 3IHTA 1ZN7A 3L02A 1GPDG 1TL7C 3E4DA 3PUKA 3OIGA 2IWHA 5ICSA 5C32A 2YVQA 2XUKA 2IZ0A 4Q3EA 1PSZA 1JRLA 3HI6A 4EJMA 3BG5A 1RP1A 4IQFA 5LCXA 1S8AA 3C1OA 4K86A 4M9UA 2O3UA 5ENVA 5GJCA 3BFVA 2CVOA 4R81A 3ANMA 4FKZA 3WKBA 5E8RA 1WMDA 5L7WA 2IHBA 1VCOA 3F9RA 4DGSA 1FLVA 1YQGA 1O0BA 1DBVO 1AN0A 3MLBA 4RL6A 3D1VA 4D98A 1PFVA 4HYTA 4EHNA 1GKLA 1L4HA 1MB0A 2XB9A 2XWSA 4WCFC 3LV8A 3VYSB 2IVZA 3BDVA 1NDHA 3N8IA 1E5TA 1FBNA 1OAOC 2NUTA 2E4VA 3R6TA 1QU3A 1KDVA 3CEHA 1Z26A 4NRDA 1R9MA 1PQUA 5AI6A 2RGRA 1Y8AA 3ICCA 1Q0UA 3OEED 5I5EA 1FNMA 3DE1X 2FR0A 3DVAA 4KNYA 4BWGA 3T5CA 2ZZMA 1GO2A 2OXEA 3K8QA 4B83A 1ONPA 4ZRMA 2QM3A 3U56A 3NTXA 3BFKA 1SD1A 4YPVA 2OFOA 1EP2B 1QLJA 3B1VA 3BH6A 3M5PA 4GX0A 4LZLA 4Z0HO 4CQNA 4P7BA 2HQSA 3D5TA 4TUYB 3VR0A 1JBEA 1E2NA 1HSZA 2GQ0A 5J4KA 1RNLA 4ML3A 4YVFA 2O59A 1DRJA 1GIAA 1W73A 1D6MA 1G8JA 1KTIA 2ZUEA 1LI5A 2OHOA 4KK3A 2AR7A 3V6LA 1LPPA 4D4JA 2PX3A 2WYHA 2Q7DA 3HFGA 3UWPA 3C7TA 4ZCPA 4Z49A 2WIJA 3SK0A 5KYYB 2JFVA 1M33A 4NG4A 4Q1FA 3EGWA 4LF5B 3SGLA 3TLGA 1O97D 4DB2A 1G42A 2XOKD 2A4KA 3KZNA 3CX8A 2JGLA 3CE6A 3KHSA 4EW3A 3FGPA 4B74A 2BEWA 3NP9A 1UEIA 2IOYA 1Q6ZA 5CH8A 3W0LB 1H0SA 3C4JA 3NKFA 4JB0A 4CMIB 3AXTA 2JIPA 3L1UA 4U7HA 3ND7A 1OLXB 3K9HA 1QO0A 3AW9A 3IOYA 2RG1A 2GAJA 1RSZA 4R0NA 2OORA 3T15A 5K8TA 4RELA 4UBMA 5H1YA 1SU6A 3WFZA 1AO0A 3DCIA 1JE0A 3W1EA 4BGEA 2DPXA 1P5ZB 1GTG1 2AFIB 2H7VA 3AF3A 1S8NA 2II6A 3QLTA 5EMMA 3ZXSA 2REOA 2KYRA 3BK2A 5TR9A 4OO3A 1ZUNB 3CNHA 4XLZA 1C4OA 3W5IA 1P7WA 1KVSA 3AYZB 4P3OA 4PZZA 3IAXA 3R24A 1HDEA 2NV0A 3CZMA 5CLLA 4NENA 5A05A 4C4PA 3GA0A 1VLJA 1PBNA 4DG8A 4U7JA 3TVTA 1OX5A 1G2QA 1O6GA 2OE2A 2VXBA 3NUGA 3KHKA 4J1TC 2CL6X 2JEOA 2VBIA 1X39A 2JFGA 3EXHB 3BMXA 2P2YA 3F3SA 3ZWCA 3HN2A 3KPUA 3S2UA 5KREA 1YR7A 4AQYB 1TNDA 2ZQYA 1IWOA 3WYFA 5KOHB 4P6VF 1VG0B 3IP5A 2X19A 3OU7A 4HMOA 3ZHTA 4WZ6A 1QHNA 3D81A 1G41A 3OMWA 3VSEA 3CKMA 5DBGA 4J9UE 3G49A 2O6HA 1BROA 3RIGA 3WIEA 3DDUA 3EVNA 3G88A 1GZVA 4FHEA 2QN2A 1LKZA 4K9NA 3AHGA 4CU2A 2RAUA 3S68A 1TCBA 2R7KA 3F4BA 4KQIA 3GT3A 1EUZA 5I9MA 2VAXA 2XRFA 1KNQA 4AL4A 1MOPA 4Q37A 1E7WA 2P30A 5H3CA 1BWSA 1E62A 3GZJA 3HRHA 4Z4GA 1GA4A 2FETA 3M83A 5KWEA 1S3FA 1CDOA 2NVBA 2XDQB 2Y6UA 3AM4A 3CH7A 5JDIC 3W5AA 1FQWA 4R8KA 3HBJA 3SQMA 1E1CA 2ZZNA 4IIYA 4RPLA 2CJXA 4JBIA 3TNLA 2OXRA 3G1WA 3OBIA 1R5OA 2VYVD 2NOAA 4ZCTA 1LLDA 1VIVA 3GPDG 1J0BA 4EKEA 1W96A 2Q21A 1NYLA 5K8VA 2EG5A 1WW2A 3FA2A 3IAM6 2VWPA 2J9ZB 3HXQA 1TQ2A 4Y2UA 3PNYA 4FZVA 3R0XA 2IH2A 1CVRA 1KAQA 2LTAA 3GYGA 2J0EA 3ZJVA 3PRKE 3MLAA 4KIWA 3PYLA 4P22A 5CCXA 4KXVA 2IBTA 3VZPA 2QVXX 4NV3A 1PZEA 3JQDA 2DFLA 2FG6C 1SB9A 2HY7A 2LDXA 1K86A 5DBEX 4AJIA 3AU8A 4IHJB 3Q15C 5A0TA 3WL5A 1EFTA 4JODA 4G86A 1XNGA 4DLPA 2WSIA 4DSNA 4JNKA 4WVFA 3W7VA 1KYQA 1N2GA 2PAFA 5BR8B 4MKIA 2WVAA 2IBMA 4DBVO 2RHWA 5I4BA 3GD7A 1CQZA 3FR8A 2I87A 2B69A 2CUZA 4EPXA 5JIBA 1L5FA 1EAMA 3WLKX 4H7EA 2R8RA 4HP8A 2YV1A 1KMQA 5FTWA 1H2HA 1JVBA 3HUUA 5LQMA 2H1VA 1EVQA 3CVJA 3GD5A 4DC9A 7YASA 2RBKA 4PINA 1G64A 3NR2A 4DCSA 3OAAD 5TVKA 2GD0A 3KXPA 3UA3A 3RG8A 3V4ZA 4L3VA 2A94A 2QYHA 5CPBA 3LUAA 2VJDA 4B71A 4MCHA 7GPBA 2IW1A 1QV7A 1ADYA 2ID4A 2Y77A 1CULC 2JI4A 4K9LA 2VKTA 4L5CA 4OK6A 4N03A 2GCIA 4ROTA 1RLOA 3BMCA 1C3OB 2HPHA 2VDMB 2WAOA 3I4CA 4NNPA 1UPBA 4EITA 4WSOA 2VRCD 1IMJA 3RRXA 2ZEJA 2ALJA 3FYUA 1JILA 3PUIA 4TVBA 2ZM6B 3DEKA 1V39A 4W7HA 3ZLTA 4BMZA 4BQSA 2D06A 2XA1A 3ABOB 4FZ3A 4DFDA 2ATIA 3FPSA 3U26A 5HM8A 2O8VA 1A1VA 1GP2A 1NZFA 1QLHA 1RTKA 1EBBA 1VRWA 4LNAA 2NN3C 4IDHA 4LY9A 4CBVA 5JAOA 1RC0A 4AJLA 2AWNA 2JHCA 4G5SA 1MA0A 1NC3A 4BJHB 4FFBA 3FTCA 3G0IA 5CLJA 3TS1A 1PFYA 1UC4B 2LBPA 1AVTA 3ILYA 3MCTA 2XUGA 1J1UA 3NVAA 2P79A 5HCIA 1POXA 1UMDA 4FEEA 3S1SA 4KL8S 2OM2A 1M2NA 5E1OA 5EXPA 2QENA 3KK0A 4L5YA 3U4GA 1EFKA 3L1VA 1WXFA 1XBTA 1ZD9A 5EFZA 3AR6A 2HF7A 2DOKA 2IODA 1C0IA 1N6IA 2B2NA 2G8LA 3X44A 3DL2A 4DZTA 3T7DA 4G84A 3AINA 3CZAA 3B6KA 2XA2A 5AOVA 3GAAA 4JT8A 4DV4B 1LUAA 3IQGX 5HK8A 3A9WA 2IOFA 4OV6B 4A73A 2ZSIA 2KX7A 4S2UA 3ZDQA 1ECBA 1F6BA 1RC1A 1NDUA 1ANKA 3GJ3A 4LBZA 2O8EB 2X4GA 4Q4AB 4GGMX 5DNUA 3KAKA 3ZDDA 3J81A 4DR3B 3N8GA 2K5UA 4OOFA 3RYFB 1M5UA 3LA6A 1Z18A 1J6UA 2IZ6A 1IG3A 1ORIA 3D7MA 5DYWA 3DDSA 4EG1A 1HNZB 3LWNA 3SDZA 3SZGA 5JZVA 2YR0A 3LX8A 4QU9A 3AUAA 3WKDA 1QCYA 2C0CA 2YIMA 5JNLA 1FDVA 1TLTA 2WOJA 3L6DA 2Y4NA 3U9SA 4BN0A 3DQZA 2VAVA 5DI9A 1OLOA 4W82A 1NW9B 1ABEA 1QGUA 3V7NA 1N3BA 3NH6A 3DDZX 1KYIA 2HADA 3V4VB 4ALMA 3O9MA 3QPVA 4NVRA 3NHUA 2ZSJA 1YIAA 3L05A 3NZEA 1U2GA 3C5HA 1H0HA 3EC1A 1GSAA 1XRNA 2BZGA 1U2DC 4HDRA 4RD1A 4G25A 1DXQA 4OFZA 2VO1A 2Y9MB 4UFPA 3LVRE 4Q3BA 5F4BA 4E32A 1XWFA 2Q3EA 3A1NA 5B1HA 5LOVF 3HE3A 1M2WA 1A69A 2GWHA 4KZPA 2HWXA 5FPTA 1KO7A 3CS3A 4FHDA 2H07A 2VPXA 3TB6A 1L7PA 4RD4A 2QUBA 1RWNA 3CTPA 5HKKA 1PZMA 3ESXA 3T1OA 2WIAA 3ZBQA 4RETA 3ZTTA 5K0CA 4B3BA 1H9AA 5TDHA 4TXNA 3WNZA 3RVOA 4TM8A 4M89A 2ODPA 3OQHA 1NPYA 4O2BA 1SK9A 2PJDA 5HE9A 3B3FA 4YO8A 1VBNA 1PYOA 1YOVB 2A58A 2CVFA 1DC3A 4HR7A 4NLLA 3C3BA 4AJOA 5IASA 2BKVA 4MIOA 3BT7A 2ZULA 4FDTA 2J41A 1JSLA 1M34A 1ZY2A 5JSZA 1C41A 3DF7A 4IIJA 3RUFA 3LXUX 2FP3A 1CDZA 1I33A 3GCDA 5B4VA 3ICQB 1BA2A 3G0DA 2B4AA 2D2EA 2OCIA 2ZJYA 3H1PA 1PVDA 2C1XA 4I9GA 4LAFA 3GA7A 3ZQ4A 4DM7A 1CE8B 4M8NE 5MN6A 1M1NA 1V0JA 4MVJE 2GD2A 4WDQA 5L3ZA 3S28A 3EZYA 4WXPA 3T3DA 1FQJA 3BA6A 1NP3A 3RTBA 4KXFB 1H4TA 3QEAZ 1P19A 1GNPA 1YD7A 2HO4A 3OE7A 3W7AA 3X0DA 4ZCMA 3EGXB 1TT5A 2WPNA 2BKEA 4ZQCB 5E7IA 1MQSA 4W4TA 1UK9A 1T13A 4LRXA 1F8XA 4U7PB 4G67A 1Q20A 2W7TA 3D6MA 1ECJA 4EGCB 4RPGA 4BUJA 5B55A 4RZSA 3PFCA 1BDMA 3QBJA 3LWBA 3LQYA 5GP1A 4EY4A 1YDGA 4JMPA 4MUIA 3K0AA 4ZP1A 3SC3A 2JCBA 2C04A 2IUEA 1I2CA 2J6HA 4G5HA 4TSKA 1GFIA 3HJRA 4FGWA 5DGXA 3WZ2A 2W6MA 4ALKA 1WVGA 2NYUA 4UBOA 2CKMA 1P1FA 2PZ8A 4MEBA 2CV0A 3EUEA 1ZHFA 4UHBA 3I30X 5JXGA 4RTKA 4O3MA 1YI0A 5HKLA 2O54A 3M4YA 5D2CA 3VDQA 2QTMA 4JR1A 4KQGA 3OY2A 4XVHA 1K9VF 2CHQA 2I1VB 2MR5A 4C2AA 4A2CA 2FMXA 3DVAB 3GP3A 2VTKA 4DW8A 2WW8A 3NJ8A 4MV4A 5BNFA 4DR5B 6LDHA 3AI7A 1K06A 1D0IA 3BEOA 4NBUA 4UVHA 4Y2HA 3T0FA 2XADA 3K0CA 1YXMA 5DTJA 4ER0A 1X80A 5BN4A 4O2AB 5KEIA 2QTVA 3PC2A 3HDQA 2W5UA 3KKZA 1K89A 2CMFA 3OCWA 4HADA 5LQRA 1KNXA 2XD4A 3X1WA 2PANA 4UDYX 1XCGB 3CLSD 2H8KA 1GAWA 4XQ0A 1CK4A 1RI5A 1J39A 1NMSA 2CNWA 1U94A 2PJUA 4LHVA 1Z4OA 3DBOB 3KFVA 4W8HA 3W04A 3QFFA 4UU7A 1VL0A 1PWEA 2CB0A 1DFIA 1FF9A 2DQSA 5EQTA 3PNMA 1Z15A 3WYCA 4AJ4A 3QKSB 3TLGB 4XIIA 2HT1A 2DT5A 3PTZA 1APBA 4RANA 1DCMA 4P82A 4GBED 2EZ4A 2EJVA 4K6OA 2BEWB 4HH4A 4ND8A 2D3WA 2XUPA 3K2IA 4L0DA 1J1ZA 2VP4A 3PT9A 4CM7A 2O8BA 4ALJA 2DR2A 1JIKA 1RAFA 1MEOA 4PEVA 1AKMA 3DV0A 3WDKA 2AZDA 4JB8A 4P38A 1BVHA 3QOXA 4L7QA 4F6CA 1NBME 1T9HA 1RRPA 2H11A 3H5RA 5DLPA 5TS3A 3SI7A 5AVJA 1ZJ4A 4N3NA 1NT2A 2O1WA 4JJ8A 4BNUA 2AA3A 3NWEA 3V46A 4DILA 2G06A 3NM4A 2L2QA 4QREA 2BFNA 1G0NA 4IHKA 1ZXBA 1I2ZA 1NXTA 2PUTA 1E60A 4FWBA 5HTKA 4LN1A 3ZQJA 3K1YA 4G8DA 4FQ7A 1CX9B 3OTGA 5KWSA 3LDAA 3QUTA 2C57A 5K0FA 3FRJA 2JLXA 3ZNNA 4YRDA 4ZIRB 3VZRA 1QGAA 1QV9A 2VJNA 1IXKA 3LGXA 1V35A 3EIEA 1A7JA 1UXHA 2GBPA 2CNNA 1O87A 1BYIA 3MWGA 4JJIA 4MJLA 4U3JA 1XTTA 2XMGA 2O5VA 1RFLA 2HHJA 1LS1A 2Y1XA 4QJ4A 1DAEA 3WB2A 3MD9A 4D9KA 4NBLA 5G0UA 3KT0A 1VRCA 2B3TA 3QX9A 3UMVA 1RJWA 2J0VA 3HBMA 4U7GA 2VT3A 1WKBA 4KPUA 3K5IA 3RUCA 4F92B 3BXHA 4BNIA 4WFIA 2H48A 4D0GA 2R6DA 3GFPA 3ZH9B 1BS2A 1R0WA 1O94C 2C4VA 1SUPA 4DIUA 4YXWD 1WF6A 2VJOA 1D6JA 4X7MA 3FLEA 3EC7A 2PKXA 1X1EA 1R8YA 2WAYA 3HCAA 3SSAA 3DEFA 3IUMA 4JJKA 2XYVA 1CUWA 4TYQA 4QBGB 4ZK2A 2ZSFA 1ND6A 4DLSA 2F1OA 4OCZA 4YACA 3IEUA 2CLEB 2ZXEA 1ZWKA 1PVVA 2H59A 3T3OA 5ICFA 1XZNA 4GPBA 2X0FA 3ZJUA 4JXZA 1I2BA 3BF8A 4BVEA 1E1CB 1A5ZA 1YI1A 3H4VA 2IRWA 4QO8A 4P4GA 4TWIA 3ZOKA 4E08A 1FBTA 2AOXA 5DLQC 2HUPA 2PX0A 3LE8A 2I03A 3M70A 4IEEA 4KXQA 4MUAA 1CQPA 2C7GA 2PX5A 3OIFA 5EVJA 1BXKA 2PKQP 4J4BA 2IKQA 4BB6A 1MZPA 1LDBA 2PV7A 3AM1A 1D2MA 1KI4A 1U3UA 2ORWA 4PSKA 2VNKA 1X7HA 3B12A 1NNUA 1QRTA 3I2HA 5IABA 1MT3A 4N47A 2ZQ5A 3TDKA 2BTQA 2NXCA 5LQSA 4F8JA 1KH2A 3STTA 3DHWC 4PLWA 4RVFA 4P92A 9ABPA 1WUKS 3KVNA 4KX3A 3ZDEA 5IT5A 4ZTBA 4AWXA 3OZEA 1OWMA 4OIFA 4D3FA 3ZX5A 1XAHA 1KE1A 4KOAA 5KNCA 3K1AA 5KAPA 4CTMA 3JQBC 2FSHA 3KU1A 4TKVA 4NI5A 3DF9A 4IIUA 4M8IA 1TUBA 1UPCA 1P9RA 2NAPA 1ADJA 2VUHB 4N0EA 2L69A 1QX3A 4RPKA 2XVMA 4V3CA 5C46F 4WD3A 4GI5A 4UHDA 3H6KA 1Z4JA 3F97A 3N2NA 2JGKA 3GEMA 3UW1A 3WX0A 2IIQA 1U11A 3FUXA 1J5EB 1F3OA 4WNIA 5IHXA 1NNSA 2OBLA 4RH0A 3E6AA 5KNDH 5EMJA 4MUKA 3PPXA 3QUCA 4TT3A 2OHXA 5I7SA 2AOVA 1Y6GA 3PB3A 3USCS 1C3VA 2D00A 3BMCB 4KHPB 2PWPA 5E1MA 1I7NA 3EFOA 4QDOA 3GEEA 3OZUA 2BMWA 4PG6A 4Z3KA 2CNLA 1UBSB 4RESA 5KYXB 3F9IA 2G40A 1JB9A 1CD5A 1PFQA 2C5AA 1LK0A 3QGMA 3S40A 4OMUA 1BKYA 1ZMBA 2X15A 2XZPA 4A6PA 4GUAA 5CG1A 3R7WA 8GPBA 5LIRA 4CXMA 4JI5B 1RYDA 4TV9F 4BAUA 1FLDA 4BFYA 2RGUA 3I04M 4J4HA 1E3DA 1R4MA 4XFJA 2XCIA 2B9EA 3N7UA 3AI2A 1TJNA 4JDUA 2EWVA 4HEQA 1VA5A 4YJ3F 4CMHA 5CEJA 1S3GA 3MZ0A 5EZ5A 4OL0A 2JW5A 2VBGA 1ULBA 3EC2A 4P5DA 1AUVA 1NQTA 1M0WA 4FFBB 9ATCA 1KJIA 3UG7A 5HIKA 1P1IA 2ZRQA 3D3QA 3GXOA 4L9WA 4MUGA 2D1YA 4POAA 1IBCA 4BFUA 5A4KA 3K6KA 4I1PA 1VPWA 2C5HA 1BO6A 5C2JB 3CLHA 3CW8X 3IJ5A 5JBIA 1A7AA 1UMDB 2CMKA 2JGAA 3EZ6A 1IM5A 5A1JA 5JYDA 3EEIA 3U7EB 3DKPA 3A1WA 4RFLA 1WXDA 1JDJA 1EXMA 1IATA 1LJLA 1N8TA 2F3TA 4RYLA 1GG2A 1QGYA 3ZW8A 1TCCA 2P41A 2QD1A 3G89A 5ALKA 1P73A 1XTVA 5TRTA 2YOFA 2ETVA 4AQDA 3WB1A 4B6GA 3PEWA 3BGDA 2PN1A 3DOIA 3HUDA 4U7TB 4W5WA 1JHZA 5HP4A 4ND3A 1WLYA 2GM4A 2ZI3A 2X4DA 1NXSA 4X91A 2OTCA 2QKYA 3PEUA 3O8BA 2ZIFA 4NCNA 3IDAA 3RSSA 1ACMA 1P4HA 4C7JA 4DDVA 5J47A 2IPXA 4MTLA 4ZEWA 3RLIA 4Z7JA 1J9ZA 2GKSA 2DHCA 4K9RA 3KKNA 2IU0A 4F91B 1XEXA 2CK3A 3UYLA 1IRXA 1CWUA 1PT8A 2PBLA 4PZUA 5FA8A 3RS5A 4BU1A 3PITA 1XGKA 3RU2A 4CDGA 4IRXA 1K6IA 1F4LA 4C6TA 3L8HA 3P9YA 1LK5A 1PUXA 3GWZA 4N39A 4Q21A 4UHEA 1M5RA 2DFDA 9MHTA 4R84A 4WKCA 1KSFX 1N5MA 4B7ZA 2F8MA 2FPGA 2HEGA 3LLMA 1M74A 1QGUB 3I3OA 3M5DA 1Y8QB 4FGJA 4HUTA 4WW0A 4ZVRA 4BHTA 1ZM9A 1XJQA 1XMPA 2AZMA 2XTJA 5EA2A 3VR5D 2E4AA 3CRVA 3EMKA 3FFWA 4LNUA 5JFGA 4OQ4A 3A1TA 1PWHA 2MYTA 4CL8A 3T8YA 2ZPAA 4ER7A 1KDRA 1IK6A 4GC5A 5K7SA 1TPYA 1PV1A 2A9QA 2CDRA 1U0LA 1XKTA 3TQRA 1A76A 2O5EA 1NVVR 3VKVA 4LV6A 3SC2A 3F3KA 4LF9B 2BWJA 3QE0A 2H85A 2WF7A 2B2XA 1XJ0A 3GJ4A 4L2IA 2DBVO 4YFYA 4UULA 4E31A 1E6WA 4FOLA 3L6EA 5GONA 4O5AA 4LF6B 1BN7A 2C9ZA 5C1BA 1LDYA 4K9DA 1V43A 4LRTB 1FJXA 3OIYA 4B3FX 1KK3A 4B3XA 3RT9A 2NG1A 1PZXA 3F49S 3QFHA 2YY6A 4IIHA 4GNRA 4I55F 2H1HA 5AKIA 1I80A 3P0RA 4G1UC 4MQFA 3X1JA 4PM4A 3NBUA 4JH0A 2JKZA 5CURA 3W78A 4C3VA 1EGQA 1OX6A 4BKOA 4TKZA 3HZHA 3KNZA 2XGGA 4FNMA 4QL3A 5IXSA 4Z54A 3CIOA 1UBKS 2GEUA 3P27A 4Z1MD 5BW8A 4A8TA 2A33A 1TUEA 1JQKA 2NZUG 4ZC8A 4EHIA 3HHPA 4O63O 1GTSA 3NMUF 1M1NB 4UU0A 1NATA 4GOND 3UK0A 4B8ZA 2PSDA 4L15A 1I4LD 4U7FA 3C8ZA 2G82A 4YPOA 1NN5A 2BFDB 2DP4E 4PHFA 1TT5B 4TLBA 4UQLA 5KNBH 4E5YA 3N2KB 1ZH8A 1XZ8A 1E9SA 3HSYA 4MP3A 4P4UA 4M8LA 4UXHA 4XGNA 5BNZA 5D01A 2GBLC 2ECPA 5EUCA 4ZZIA 1K3FA 2EATA 3FMFA 5L4NA 1Y1KE 4AKIA 1X77A 4BFSA 2ANCA 2IXGA 2FLVA 3NGLA 4WERA 4Q9LA 1AUPA 1YQ9A 2VSQA 3G85A 3W05A 4RORA 4D79A 1WQ1R 4J3NA 3K0AB 1PL8A 4RJTA 1XF9A 3H87A 1A2BA 1THTA 1I4WA 1ZUD1 3E84A 4CKYA 2YWFA 3FNGA 3PC8A 3DAHA 2ZUSA 3GVHA 5F9MA 3C1UA 3VPHA 5K3EA 1IQRA 3QNMA 2UZ0A 1RI2A 5EKUA 4MO2A 5J43A 4LJRA 5C8YA 1O57A 2O2XA 2XHZA 3KL2A 4H6XA 3EF0A 4HDSA 5DNEA 3B9BA 2B5WA 5B58C 5EP2A 4L0QA 4JVMA 1DRUA 2VRBA 1VZ3A 3K9CA 3QVOA 3KR0A 4NK4A 2WK1A 5LYJF 1PLJA 3N76A 4RDHA 4JEMA 3JU3A 4MUXA 4ZYVA 1MX1A 4LYEA 1ADBA 2FWJA 3JVIA 1X80B 3M89A 5DULA 5EJ7A 5BN4B 3PGXA 1UQUA 1Y1QA 2QTVB 2RAVA 3IIIA 1SHKA 3A0RB 4S1TA 1V8ZA 3JAWA 1WCIA 1T6ZA 2P5YA 3CLKA 1KOGA 3MAAC 1XP5A 1T0IA 2FXIA 2ODAA 1S2GA 2G7MC 4MV6A 1DQZA 4TXLA 4YT2A 2A84A 5DHTA 3OKPA 5FUXA 2HRZA 4IF4A 4EENA 1FMTA 1I32A 4E4YA 6ADHA 3S2GA 2P9YA 3NHLA 3LUKA 1XIVA 1GN9A 2C8VA 2LWIA 2ZT8A 3PLAE 1QIHA 2YMLA 3B1XA 4L4RA 2Y9PB 2XXJA 3OLWA 2PQ2A 3ZDZB 4CEJA 1IEVA 3WR5A 3LC0A 4R8LA 1QXSA 3R23A 1N5JA 5EE5B 1XOIA 2C7PA 2FK7A 2IQIA 3DLPX 2D7DA 1SWWA 1OH7A 1UOOA 3DV0B 1L8QA 3K15A 2NU7B 3RJTA 3PGMA 2QRPA 4BLQA 3FBWA 1TQ6A 1KP2A 2E4YA 2PRIA 1QFXA 4J16A 3U16A 3MTQA 4YCNA 3QI7A 4HZGA 3KTFA 4K2HA 2V6IA 1U28A 4KIFA 3TW0A 2V5AA 1Q83A 4P5PA 5DKFA 3WRXA 5JHGB 5CBPA 5DM70 2H00A 1AKQA 1KIAA 1J24A 2NADA 1WOYA 1S1CA 3BF7A 1NVGA 3UFBA 4H6PA 3EGDA 2Q27A 1NQXA 3GNLA 1WDMA 3A4LA 3EVTA 5TF4A 5KS2A 3WQHA 2JJ1A 1NSYA 1LSUA 1C7ZA 1XZBA 4MVJA 3NBZC 3QKWA 2VHEA 1UP7A 4PYQA 3WP1B 5F3WB 4G8CA 2NV2B 1QH8B 3ENQA 5BXYA 4B73A 1IH8A 4QAQA 5EQJB 5B4TA 1ISPA 4REQA 1E1NA 1TYCA 2N9UA 4U3JB 4KXMA 2ZJ4A 1K5DA 2PZEA 3C14C 3ESZA 1P7ZA 3DHEA 3H4IA 4RKYA 1JIQA 4UOZA 2PO7A 4RLFA 5AICA 3FJOA 3RJ9A 3AUYA 1QUFA 1GCIA 2NO7A 1ECPA 3AV3A 2VEDA 4QLAA 4R9NA 1RJFA 3SBDA 5I7EA 1DRWA 3A4NA 2VSOA 2QL9A 3FCSB 2YJ5A 4GX2A 3P9KA 1U6JA 2Z4RA 3BIXA 3FY4A 4L74A 4EG3A 2ZM5A 3PP8A 1KFJB 3Q3GE 5TS2A 3ROQA 10MHA 1XZKA 3NC0C 5A03A 1ZIDA 4HQOA 3R76A 1PJRA 1QP4A 5K8JB 4P08A 3LHDA 3OX3A 4MCAA 3OWXA 3NB0A 3B48A 5K3SA 2IITA 3IXQA 4N5LA 3K35A 4U2KA 2K2QB 4PE5B 5JCPA 1GNRA 2P4QA 3P20A 3KSMA 5FFMA 1P7YA 4URVR 5M3BA 5A3RA 4ZZ3A 4H1VA 4OB8A 1ZS9A 2OZKA 3KSUA 1ZITA 2GPAA 2XVXA 2OP1A 1ISHA 2CUTA 5T6MA 4L8WB 2Z2XA 5GTDA 4I1OA 1E89A 1FY2A 2WMDA 3LOPA 1C3EA 4BFVA 1Z73A 2BTQB 2CFSA 2QE6A 1H65A 3KYDB 2XZLA 2PRKA 1GGFA 1ZOIA 1N1GA 1WSDA 4EHJA 3QU2A 4MUEA 1SRRA 2DH6A 1ZSYA 2QL7A 2CXXA 5ELXA 3PUXA 4BVHA 2BM1A 3D64A 3Q6MA 4HZUA 1JQAA 3RIMA 2UUCB 1G3QA 1IMOA 1A9QA 3K1AB 4XOUA 2G09A 1EX6A 2H51A 2JVJA 3QHQA 5E95A 3T4PA 4BMDA 2JFHA 1TUBB 3CT4A 1CB0A 3QLVA 2YWBA 3QMPA 5CIWA 4RHCA 3TUIC 1OQAA 1YR6A 2QSYA 1GYQA 4LJ9A 4W1SA 2G28A 3RBXA 3OPYI 1AT1A 3CG0A 3LZCA 3WGOA 4B47A 3FPCA 1HLDA 4TXHA 4Y3UA 1BOOA 3TCXB 5M04A 1GUBA 4FGLA 3MJCA 5BSWA 4WBNA 5JZ9A 5J1SB 1QIDA 4X8MA 2Q5JA 3M4JA 4DLXA 5CIQA 4R7GA 1PEKE 1JDBB 2WWGA 5E9QA 1AGRA 2PUEA 4OQQA 1NBMA 2JJYA 3ZJYA 3VO8A 3NV9A 3D8NA 4TTQA 3EFOB 5EIWA 3VR5H 1PFGA 1JU9A 3OM0A 3THXB 3KQNA 2HRRA 4Z8XA 3IOCA 3UANA 1THGA 5LZ5A 4X90A 5J59A 4KQ9A 3DTVB 2MSEB 1ZNQO 1YFZA 3KXIA 2ZR0A 4G24A 1T5IA 4OHOA 4AIRA 1TVMA 1N77A 1R4MB 4H4DA 2TRSB 5BPFA 4NZPA 1RYYA 2I78A 4ZDKA 1UANA 1WS6A 2GZ1A 3UBTA 3RG2A 3PQ2A 1K7SN 3IKJA 4KKXB 4JZKA 4C4OA 3IYLW 3PFHA 1XTKA 1RHUA 4FE4A 3HZZA 2BFCB 4WXHA 2BUCA 5LU8A 2TSYB 3IKVA 5TLSA 4J7UA 4IHJF 1F38A 4PYOA 2G9NA 3K31A 4Q05A 5DN6A 3F6SA 3OESA 4P3XA 5GM1A 1GYPA 2VK2A 2YL2A 3USES 3ZHSA 1EESA 4FZRA 3OFKA 4B7CA 3VPXA 3C1TA 3LCCA 1QP0A 3J7AC 1MB4A 2ZRNA 3DVQX 1DAGA 1L5ZA 4NHEA 3WLHA 4F8EA 2RKOA 1G1MA 3Q88A 4ASUD 3D2CA 3SJ7A 1VGRA 1AA6A 1V6AA 4H0FA 3RSGA 4TRRA 1CVLA 4B3GA 3L8CA 4JEHA 4HGZA 1OTYA 5HKBA 3FMIA 2B1JA 2XF2A 3H9EO 3TAHA 3B82A 5ITWA 4JGBA 1XWIA 2Q8PA 3ACCA 3EGIA 3AK4A 1XR3A 3ESBA 4X3PA 1JA9A 4MPJA 4UXJA 1RXUA 1FDSA 1S2DA 3JD3A 3UQYS 1IUNA 1W1UA 1ZD4A 2R7AA 4M98A 5ENDA 3O4FA 3SYRA 3VJMA 5KKAA 3GHYA 3EA0A 1CLUA 1XEXB 4NCKA 2XWPA 1I1NA 3JTEA 1Y3DE 1OGJA 2OBXA 4J7XA 5FT9A 4C6TB 1ZNYA 4GXNA 1FS4A 1WY5A 1NWCA 4NMWA 5BN1A 2GPNA 1HMYA 1MHTA 3T3GA 1SCJA 4AS1A 5CA0A 2ASEA 1U7HA 2YHIA 2QVCA 3AUFA 4DY4A 2FPGB 1YC2A 4N49A 2NXJA 4NL4H 5IAOA 3EARA 2BZ1A 4NONA 3I1FA 4ZOLF 5IULC 5EEHA 4MVJP 2J0SA 2ZE6A 4OP3A 2C5GA 2GYWA 4ETMA 3B2EA 5JD5A 1MORA 1UODA 3EXEA 3TOZA 2GM3A 4LNUB 1IUPA 4R4JA 4J2HA 3WJ2A 4HDCA 2OGWA 2HJGA 2XYPA 1SUWA 3B7WA 4K9MA 1ZGBA 4CDNA 1PG2A 1YR1A 2MSDB 4L4XA 4WOCA 1PN3A 4QFBA 3ZEAA 5IN5A 4DM4A 4KSCA 1SZJG 4OGKA 4L2IB 3GEIA 2GCGA 2NZVG 1FX0A 1M1ZA 3KFLA 1C7FA 4KN9S 5GONB 3ZJ4A 2VYQA 3VYRB 5LQAA 1D03A 2O7RA 2W6ID 2Q99A 1IPFA 3HB4X 1I7LA 2I2FA 2P5TB 1WLSA 4HXFB 2DBYA 4WN3A 1D09A 1P7CA 2EQAA 4L75A 4F5EA 2F6RA 3BHIA 3NHZA 5CT4A 3S5JA 3MN1A 1XDUA 3PD1A 5AVSA 2GM5A 2O2CA 3HL4A 4WOJA 1P60A 1ZK4A 4X9XA 3UQZA 4P35A 4KNWA 3BTSA 4MKFA 1GVHA 3DOHA 4BN5A 5KINB 4F93B 3RM3A 1V9SA 3INNA 4XUEA 1Q22A 3BEDA 2QUKA 1JR3A 2D5LA 4YCDA 3W5DA 3C3DA 3SC4A 1E3IA 4LW8A 5C8ZA 1N0IA 4Q19A 5EZYF 1G2IA 1XLTA 4TSFA 3KRTA 1E9CA 2C7RA 5HZHA 1W5EA 2QJTA 4FMCB 3T5MA 4E14A 3DAFA 5COQA 5IPFA 1S02A 1C3JA 3BYZA 2XQKA 3DKIA 1Q21A 2JZCA 3WWZA 1P1RA 1WE2A 2QJWA 5DFAA 2XE8A 5TQ0A 3O8OA 4YMTA 1KXJA 3EZLA 2I54A 3I6YA 4Y98A 4UM7A 1L5HA 1NN3A 2GN6A 3I01A 5IK2D 4TM7A 1IZ0A 5AM0A 3GAMA 2XQIA 1X13A 4QU5A 5JCJA 1A7UA 4TLAA 1F12A 1LSSA 2OQ2A 1KVQA 1UKBA 1V1RB 4QQ8A 3U1BA 4BO9A 5JYCA 1WUTA 1B43A 4EELA 1E2BA 2F4NA 4DHEA 3CH4B 5TJHA 4RH3A 1MH1A 3ADKA 4TV8B 1SVSA 3RJZA 4E5VA 4RLSA 3EBLA 2MT9A 1V1JA 5AW1A 3INTA 2OXFA 3IUPA 4CTNA 5GMOA 3SQLA 2YUIA 3LKDA 1N5DA