1ZJZA

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 101
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zjzA00
3JQGA 4CM1A 3W8FA 4I5DA 1O5IA 4KTTE 4PLVA 4WCDA 4L73A 4KDEA 1UJMA 3LT0A 1T2DA 1P33A 1X15A 7ADHA 5A5EA 1M66A 1K6JA 4MJLA 5JE8A 1LXCA 2BI8A 4UEOA 3V1TC 1H6CA 4XYEA 3SVTA 3PTZA 1V35A 4L8VA 1AHIA 3RUDA 4JROA 3KSDO 4MVJI 2PD3A 3QLJA 4RV9A 2EJVA 1SC6A 2BMAA 4BNNA 3DR3A 1GCUA 2ZYDA 4RL6A 1WMAA 1EUZA 1E7WA 1W6UA 2A94A 4XB1A 3PJDA 2G17A 3GY0A 1C14A 4NDNE 3TFOA 1UDBA 3R3JA 5A9SA 1UAGA 1PR3A 2HRBA 2Q2QA 1M76A 4NG5A 4R16A 5KTKA 3KZVA 3FSRA 2Q49A 3BA1A 1ZK3A 1XIVA 3RUHA 2HO5A 1A71A 2Z1NA 1NFRA 3WTCA 2C29D 2ZB7A 3AI2A 3NDRA 1Z82A 1R66A 4AJHA 4UVIA 1Y5RA 5FEUA 1H6DA 3DBHB 2AEJA 4OSOA 1R15A 2ZTLA 4YR9A 2QRKA 2RIRA 3EGOA 5COAA 5I7EA 1KVQA 4IJUA 1NVMB 2I65A 2VZ0A 2Q2VA 1MUUA 4QSMA 1HF3A 3PLNA 3ZNQA 4Y9DA 1LDBA 1GV0A 3C3XA 2PFGA 2NV6A 2P2SA 3RC1A 3H9JA 1RM3A 3CINA 2C7VA 3BMOB 4EITA 4E4YA 3U9LA 4UVEA 5AQ1A 4FW8A 4WK6A 5EQDA 3IAHA 4BMSA 2HMUA 1GQ2A 3KSZO 2P9EA 1JVSA 1E92A 1YXMA 2VQ3A 3CE6A 2IE0A 2RH4A 4B3JA 4NK4A 1VM6A 3PIDA 1WP4A 1N8KA 5B4UA 3BMCA 1PJSA 3UOGA 5TSDA 3CZMA 4IQ8A 1PL7A 3QV1A 3TRIA 5JY6A 2VOJA 5H83A 1R4MA 1PQWA 1PTJA 3GLQA 1XCBA 1JKFA 1ZZEA 2C59A 1GCOA 3B1KA 2Y67A 3GVXA 1U5AA 1YB5A 2HCTA 3GZ4A 4QFCA 4OXNA 1ISMA 4UVDA 2D2IA 1MC4A 4D0SA 3C7CB 3E5MA 5B1YA 4DIFA 1I0ZA 3B1JA 2HDHA 4EDFA 5KVQA 1VLLA 4I9NA 4J9VA 1A9ZA 4KP7A 1EVJA 4HV4A 3IC5A 2B35A 4PLYA 4ESOA 4ZJUA 5G4LA 1ADBA 3ANMA 3WGOA 4ALJA 4J4BA 2WE7A 3CTMA 3FWNA 4BNUA 1RJWA 3P19A 4Y67A 3E5RA 4BS9A 5JCXA 3I23A 4GMGA 4R1UA 3GFGA 2BFPA 4UULA 1P1KA 4INAA 4BO8A 2NVWA 2Q1TA 5BSGA 1P0CA 2EXXA 1ISFA 1NNUA 5TJHA 1EDZA 1D7OA 3HHPA 1HRDA 3MJVA 4XCVA 4W6ZA 4WECA 1LSSA 4IJVA 1R0KA 4JLWA 3NDIA 4BKQA 1IPFA 4YDRA 4A26A 4CM4A 2ZJ0A 5HS4A 5KJEA 3OJEA 3RKUA 3WWYA 4GWKA 1VRWA 2O4UX 3RROA 1MGOA 2ZATA 1NQ5A 2NADA 1KVUA 3N7UA 2RH8A 2C82A 4DXHA 1XHLA 4J1TA 3A06A 2HK8A 3PHJA 4CM4B 1P74A 5F3RA 5IF3A 4NJOA 4E5KA 3WLEA 1E3LA 3KHUA 4OKNA 5FWNA 1BDBA 4J0EA 4DWVA 2QW8A 1RKXA 3QSGA 3JV7A 4AJLA 4CLOA 1WAMA 4EEXA 4LMPA 4NFHA 4D79A 1N1GA 3GG2A 3N74A 1X7HA 5HBRA 4DREA 1YOVA 3QWHA 5G0VA 5CPBA 5AVOA 5JO9A 1KERA 1HDCA 1ZO8A 2QZZA 2XXJA 3FTPA 3NT2A 3PQDA 2A35A 4U0JA 4MVJE 3V5NA 4E5NA 4YPOA 4ALIA 2POQX 4YAKA 4CQMA 3TOZA 4CR7A 3ZNPA 4G65A 1YOVB 3ROPA 4GSKA 2SCUA 5KVSA 3OBBA 4W4TA 3IP1A 3U49A 3GH3A 4NQZA 1HTBA 1XKQA 4DL9A 4FFRA 1GD1O 4CQMB 2PZJA 3JTMA 1VKOA 4BKUA 3I9OA 1SEPA 1VSVA 3F46A 2Y1FA 4CV3A 4IS2A 1LSOA 1YH3A 2J6IA 4ZRMA 1C1DA 1NWCA 1RPNA 2IXBA 1NHWA 2YYYA 2VZ8A 5JAQA 4KOAA 3RU7A 1PL6A 1ZEMA 4E3ZA 1KY5A 1SB8A 1AUPA 3LC1O 3KTDA 4TWRA 4IGFA 1JN0A 2DUUA 4L75A 1KVSA 4TROA 1E0DA 3GGOA 4BVAA 3PPIA 4XYLA 1UXHA 1NVGA 5ILOA 1HYGA 4K26A 1DIRA 1DLJA 2EP7A 2QHXA 3WSWA 4IIVA 4ND3A 1R0LA 3PGXA 2YW9A 3QRWA 1L1FA 3RSHA 3S2IA 2RAFA 1OMOA 1UP4A 4E12A 5DULA 4UUNA 3VDQA 4B4UA 3WQRA 1Q7GA 3HE3A 5TJ9A 1R16A 3PP8A 4GVXA 4NJMA 4ID9A 4DUPA 4J2OA 3UW3A 4C4OA 3Q3CA 3FD8A 4W9NC 2EKLA 1RYDA 1U4OA 4UAGA 5JCJA 4M1QA 1Y9EA 3DDNA 3LSYA 3O38A 1DC6A 2X0IA 4MINA 4NJMB 2AQHA 4XIJA 2OO5A 4YWJA 3WLFA 1GAEO 3OEWA 1TB4A 3GZNA 4J90A 5COBA 3RCBA 5IAAA 2JCXA 1HLDA 3KYDA 3X2FA 1GZ6A 2R6JA 2W98A 4YJGA 3RIHA 4DTIA 3TFQA 1VI2A 3W6UA 4OM8A 2JAPA 4IJKA 4PIVA 3GZNB 4W9NA 3ENKA 3K30A 4ZRNA 1OZAA 4B7CA 5LDGA 1A5ZA 3F47A 3I9LA 4LSWA 3KYDB 4AJEA 3T4EA 2C7GA 3OMLA 2O2SA 1PL8A 4YJGB 3EZLA 1F14A 3LQFA 3PYXA 4LK3A 3WGTA 3ICCA 5HRUA 1MA0A 1YO6A 2FR8A 4KDFA 3GVHA 5F5NA 3GG9A 3QWIA 1PGNA 3ROMA 2JD2A 1ZK1A 3DBRB 2GERA 3JQ8A 5CDTA 1BWSA 2FP4A 2CZCA 2DPGA 4M87A 1K0UA 2VT3A 5L3ZA 5DDIP 4ZGWA 1DIAA 4NI5A 1DPGA 3H9GA 2R00C 4MIEA 1LRJA 1I8TA 4Z9FA 2VYND 3FBGA 3JQ8B 2BLLA 3OA0A 1DSSG 5LDHA 1LEHA 2PY6A 4GAEA 2OP0A 4RCVA 4ZN6A 1GQQA 2R2GA 4FR5A 5DCWA 4NHEA 1UDAA 2Y99A 2GZ2A 3I6QA 1NTOA 3PYMA 4YBZA 2JD1A 1GYRA 5I8ZA 5BR7A 5T5QA 1ENYA 1V9LA 1IB6A 4K9DA 5J23A 4DPMA 3UHAA 3DEYX 2GASA 1UP7A 1PIWA 5A03A 5ICSA 4EJ6A 3DZGA 3E9NA 2X0RA 2R00A 3E9MA 1HE3A 4B79A 5ITWA 2DTDA 1P9LA 2X58A 3DFUA 3QA9A 4YRBA 3DZJA 3ITDA 4DMMA 3BIOA 4B7XA 3NJ8A 3FNEA 4E5MA 6ADHA 4IDDA 3C24A 1YB4A 3WG9A 5CAEA 3WOHA 3TN7A 2GGSA 3DBVO 1PWZA 4II2A 3W4KA 2V6MA 1G0OA 3K2EA 1MFPA 3DTYA 1P1HA 5GZ3A 4DIOA 3C1OA 5C37A 4IPTA 2ZQZA 2DC1A 1ZBQA 3EZYA 1LLDA 3AI1A 3AY6A 5HA5A 4Y6PA 4PN3A 3BZUA 3UFXA 4AVYA 1W8DA 2EJWA 4B8ZA 1MV8A 4CPDA 2X5KO 2NQ8A 3NGXA 4P8RA 1KVRA 5CEEA 4WUVA 2PGJA 1GL3A 3JCZA 5A04A 1QMGA 4BB6A 4BNMA 3JQBC 2FSVA 1JKJA 1MXFA 1KEPA 1BMDA 1Q7BA 4XDYA 5F21A 1Z45A 3FF4A 4WCFB 4Q39A 5FI3A 1U5CA 4LISA 3WBBA 4XGIA 3DZBA 4J0FA 4BNTA 1JA9A 2DT5A 3W4JA 3KLPX 4FB5A 3WJ7A 1E3WA 3AFNA 3FHLA 4JCOA 5KJ1A 5F1PA 5KOIA 5CDGA 3F3SA 3KYCA 4K1LA 3HFGA 1RM5A 2HJRA 1DIGA 4HFJA 4RQUA 3AM4A 5K9ZA 2W2KA 3H9QA 5L7TA 3K2BA 4TZTA 3JQBA 5EMHA 3V8BA 2W8ZA 1CQJA 2P4QA 1HE5A 5TX7A 3SLGA 4AJNA 1UR5A 2IYOA 4EUEA 3IQDB 1YBVA 1U2GA 3Q11A 3HDJA 4BO7A 2W2KB 5KJCA 2DBVO 4FBGA 4YJFA 2GPTA 1H5QA 3JQAA 3JYQA 4E2WA 3U4CA 1VL8A 1E77A 5JSFA 4Z3DA 3JD3A 3PZBA 5T67A 3VH1A 3TZQA 2WD8A 5JBIA 4AL4A 1KEUA 3G79A 3ZWMA 4YJFB 2I6TA 3G3EA 1ZVMA 3I1JA 3TZCA 4EUHA 3O26A 3AY3A 3GAFA 3MTJA 3AI3A 2EIHA 5DOVA 2NLOA 2Q46A 4TKMA 3F4LA 4ZA2A 4KZPA 4RF4A 3HDYA 1D1TA 2D4AA 1FDSA 1C3VA 2PH3A 3MJTA 1LC3A 3GRPA 3LDHA 1PJ4A 3UCXA 1LI4A 3H3JA 3WQSB 3HDHA 1JTVA 2VWGA 4RQTA 1VPDA 2PKQO 1PWXA 4ALLA 2EHDA 4CLXA 3AUTA 5EJ2A 1ISHA 3GHYA 2UUOA 2OOSA 4KQXA 2YFQA 4MVJM 5A4DA 1U3UA 2J3JA 3FR8A 4GMFA 2EW8A 4Q3BA 4BNVA 5TS3A 3JSAA 1P45A 3I4FA 3H5RA 4H15A 3WIDA 3IIEA 1DIBA 3IDSA 4GWGA 4IDEA 4MVJF 1BW9A 4Z0PA 3ROKA 3ZU5A 4WLUA 2G0TA 2PD6A 1BGVA 1VL0A 2FZWA 3V2HA 1HZZA 1PQUA 1MG5A 5JS6A 4J91A 4Z9XA 1XU7A 2Y1GA 1U3WA 4BKRA 4N7RA 4D0RA 4CMAA 3SLKA 1JU9A 2BELA 4NR0A 3WICA 2PZMA 2A4KA 4FJ2A 1PQPA 4EZBA 2BI7A 3FI9A 3S2FA 5A5FA 4BB5A 1E3SA 1NQAO 1V3TA 3EHEA 1Q0HA 3K9QO 1UXIA 1E6WA 3LK7A 2OHXA 3R0IA 4XRRA 5COQA 3WJAA 3MEQA 2O2YA 1Y8RA 4OH1A 1GYPA 3WGGA 1OC2A 3IUSA 1NYTA 2OBNA 4QT0A 1NFQA 1O6ZA 2PD4A 3E8XA 4HWKA 2O3UA 4KUGA 4PZDA 5K6AC 3VC7A 3PWSA 3U62A 3QVTA 3GN1A 3WYCA 5C7OO 3OQBA 1FDUA 1QP8A 3EC7A 2WD7A 3U09A 1T24A 2NU8A 1PGOA 1SAYA 1HLPA 3NRCA 1HE2A 2F1KA 2O7QA 4FOOA 4HADA 1DJQA 4J43A 2HMSA 1X13A 3GNSA 4MVJD 2WD7B 4R1SA 1TEHA 1U3VA 3O4RA 5A05A 3W8EA 1AE1A 3EDMA 2TMDA 4Z9YA 1DFIA 1KY4A 4FGSA 5L40A 1B8UA 1G0NA 4CUKA 1E6EA 1DXYA 5K6AA 2VZ9A 3WMWA 2C20A 4R51A 3OECA 2CDCA 3V2GA 1HDYA 1QORA 5L45A 5I7FA 2JFHA 2JAHA 1CRWG 4U8GA 2VHXA 1YVEI 3OA2A 4A0SA 1XWFA 2AQ8A 4ND4A 2H63A 4P4GA 5IDWA 5TIIA 2I76A 4N5MA 4NBVA 1NM5A 5MDHA 1JKIA 3ZI0A 1T2EA 3AM5A 3ETDA 5A3JA 4XR4A 2IEDA 3U4IA 4CQMD 4N54A 4CMEC 3G49A 3ZWYA 4IMPA 4JBHA 2J8ZA 4DRYA 4RORA 5I9MA 2YHIA 5EERA 1AXEA 1ZNQO 1JVBA 4OXKA 4BUCA 1TT7A 2P9GA 2YZ7A 4D3FA 1F17A 3C1AA 4U7WA 4YAJA 5F1KA 4XJSA 4ND2A 2AG8A 2WYUA 1DDOA 1LQTA 2BKAA 1UZLA 1R4NA 2WM3A 3K8ZA 4FJ1A 4XR9A 3ZHBA 1N92A 3TPCA 3KO8A 4F6CA 4HFMA 3CUKA 1YQGA 2EV9A 1A4IA 1B14A 5CPFA 1N7GA 2DM6A 4CMEA 3L07A 1LLUA 1I30A 1GY8A 1QR6A 3PLRA 4Z6KA 3TWOA 1R4NB 3CKYA 4PLWA 3TDKA 1ZCJA 1YONA 3CPSA 4DLAA 2O23A 5C5IA 5A02A 2YV3A 4FFOA 2O50A 2H9IA 5JDIC 1VJTA 2WSBA 3VZRA 2G82A 3CSDA 3AU9A 4BO1A 1PS8A 3PFWO 4CQLB 4JN6B 2OXIA 4AJJA 4ZD6A 3PWZA 4TQGA 2GF2A 2XOXA 3HJAA 2NTVA 3JQFC 4NMHA 1XELA 3JQGB 1SMKA 4L9RA 2NM0A 3T4XA 3K31A 5TT1A 6LDHA 4BKPA 3LT1A 3ZDFA 1HETA 4O6VA 4YYZA 4O59O 1LTHR 2YFHA 5DBIA 1ZEJA 4FPXA 4I5EA 3PZRA 2IEBA 5DOZA 2G1UA 4RVUA 2ZCUA 5G4KA 5JDIA 5B12A 1WDKA 5A3VA 2O3JA 3OIGA 4AJ4A 2A9FA 4CM9A 4GVLA 4LCEA 4WNCA 1R6DA 3ZV4A 3JQ9C 3M1AA 4TMFA 1YDEA 2HRZA 1H6AA 3DHEA 4RDHA 4RO0A 2OORA 3OM9A 1J49A 5G4KB 4J6FA 2NU7A 5BSHA 2GCGA 2I67A 5I9NA 3A14A 4OAQA 1L7DA 3CZRA 3RUCA 5DP1A 4IBOA 1YL6A 5A9SB 3DAPA 1U8FO 4LVUA 5EN4A 3HN2A 1SZJG 3COSA 2GNAA 3CMCO 4XZ3A 1ARZA 1EQ2A 4BNXA 1MB4A 3KBOA 3MCVA 1Q0LA 2ZB8A 5JMPA 1W4ZA 4FS3A 4ZQHA 3TNLA 1EVZA 3JQ9A 3DWFA 2WTBA 3D5QA 4HNHA 3GMSA 4MP6A 1DEHA 2J3IA 4R9RA 5JAMA 1YBAA 2E37A 3AOEC 1HKUA 1DHRA 2PTGA 1T25A 2CVQA 1AGNA 1ID1A 5LC1A 1BVUA 2Y0CA 3VH2A 1O9BA 2ET6A 2QRJA 2AEMA 3DZHA 1KS9A 1V3VA 3ST7A 4QO8A 4BNHA 4OMUA 1JDJA 4DIBA 2BRUA 4PLTA 1SB9A 5AXCA 3GDFA 1EDOA 3DZKA 2GYYA 3RC9A 4YB8A 1PS0A 3L6OO 3Q1LA 1E3EA 1ORRA 3QVWA 1XYGA 1KEWA 1SNYA 3PFFA 4GSLA 4AJOA 4URFA 1ENZA 3G0OA 2GD1O 2WDZA 2A92A 1OOEA 3WTBA 4BO2A 3GUYA 1KEVA 3AOEA 4CLHA 1EFLA 5ES3A 4CMIA 1D1SA 3WSVA 2D0IA 1RWBA 1Z75A 3OFSA 4DYVA 2I3AA 3BMCB 4YEDA 2Z95A 1ZFNA 4LGVA 2YDYA 3GF4A 3GOHA 3WYEA 5GZ6A 3VHRA 2PK3A 1CQIA 1R4MB 4CMIB 5B4TA 3NKLA 2VUUA 3FRJA 2W2LA 4AJKA 2NWQA 3NEPX 3HADA 3K92A 3RVDA 4BGIA 5BSFA 3LZ6A 4RLSA 1U28A 1LDGA 3MTGA 1E3IA 1U4SA 3QY9A 2WEKA 1F8FA 4IGEA 1HXHA 1FDVA 3TZ6A 1Y81A 4RPLA 4GX1A 4E5PA 2X9GA 3U0BA 4BO0A 3HQ4O 3W4IA 1G6KA 4WNIA 3S55A 4ONEA 4BQPA 4A7PA 4A5OA 1QXSA 3TL3A 4K28A 1S7CA 5FFFA 4ZU3A 4JX8A 4LCJA 1M6WA 3DZIA 2E82A 4YRAA 4AJPA 4F3YA 4CV1A 2D59A 4CL3A 1PGPA 3GDGA 3HUDA 4E5YA 3MZ0A 1HZJA 4UVHA 1VE9A 3STHA 2VUSA 2WE8A 1BXZA 2VNAA 4OJNA 4EEZA 5IN5A 2VHZA 4MVJG 4R54A 1W0CA 4FIZA 2CNBA 4J4TA 5T64A 4UEKA 4J1QA 3TOXA 5THQA 1P1RA 3INTA 2VTEA 3RFTA 8LDHA 2BFAA 4FC6A 1GEGA 2RHRA 1GFSA 3INGA 2Y66A 1E7QA 2IRWA 3KEOA 3AU8A 4E30A 1V8BA 2JJYA 2P91A 2C5AA 3S2EA 3GEMA 3FPLA 4BNFA 1NQTA 1Q1NA 2DAPA 5CG1A 3HSKA 3JQEA 3K5PA 1EVIA 2D1YA 2DKNA 2IDZA 2OMEA 3MOIA 3OETA 4P4LA 3ZWWA 4CLOB 2Y93A 5BQFA 2JD0A 1ZUD1 1XG5A 3H5NA 4W99A 1LA2A 3GFBA 2ZJ1A 4PLFA 2D3TA 3UAGA 1XLTA 4EGFA 3ZWCA 1QG6A 4WLOA 4BIIA 4DPKA 3JQCA 4IQ0A 2HQ1A 1TI7A 2J3KA 3M2PA 4M8SA 2GUGA 3D4NA 4KWHA 5L53A 3KLMX 3U5TA 3NTRA 4IDAA 5L7WA 2YQ5A 4YT2A 2P9CA 1QSGA 2UAGA 3EW7A 1IY8A 3H3FA 1DRUA 3KYBA 3VZPA 1NVTA 1MFZA 3R6DA 4NH4A 1A7AA 3I9JA 4XEHA 2DBZA 3ULKA 2ZB3A 1S6YA 1E7RA 5CDYA 1PU2A 1U7HA 5EL0A 2G76A 1UDCA 5DF1A 3D1LA 3O8QA 4MPDA 1X1TA 4P38A 3RD5A 3QQPA 1KIFA 1C1DB 1IE3A 4Q3NA 2JL1A 1ML3A 2E6UX 5CDUA 2Q1WA 4EUFA 1I01A 4LW8A 4BKOA 1EZ4A 3QIVA 3O8QB 1XEAA 1Y5MA 2PZLA 3RC7A 3EY4A 4L4XA 5JAZA 4JP3A 1BTOA 3ZW8A 5AXBA 2J3HA 2VT2A 3JD1A 3FNFA 4Q3CA 2GN8A 4BNIA 1U1IA 1T2CA 3C1TA 3IP3A 5KIAA 1LRKA 3AUAA 1GUFA 2ILTA 4DGSA 1T1SA 4MKZA 2NU6A 4YT4A 2UVDA 2GDZA 4U5QA 3KXDA 1KVTA 1O8CA 4EBFA 1AHHA 5CG2A 1P0FA 1DJNA 1MC5A 4BGEA 4D7AA 4CLRA 4BMNA 1X0VA 1WDLA 1GADO 2Q1UA 3PHHA 4M86A 9LDTA 4Z3KA 4CM6A 5IZCC 2V65A 2D8AA 1LU9A 4BV9A 4TVBA 1ZIDA 4IUYA 4NBRA 5I8WA 3K96A 4CLRB 5ADHA 1DFGA 3GGGA 1IOLA 3ZU4A 2EW2A 2VWHA 4B8WA 2VCYA 1TXGA 2Q3EA 4PRLA 2DUWA 3E9QA 2VRBA 4XQCA 2X6TA 2FSSA 1PZHA 5ENDA 4PLCA 4I5FA 4WE3A 4RVSA 4XGNA 1CJCA 1EK6A 2UYYA 5IZCA 2J5QA 4JBIA 1LJ8A 3AUSA 1Z73A 4IM7A 3QWFA 5DZSA 4RZIA 4XQGA 3BYZA 2P68A 3B1FA 4AJ1A 3UCEA 1U3TA 3HFSA 1IYZA 2NACA 2B69A 2EKQA 2JFGA 1N9GA 3IS3A 1F8GA 1JQBA 4GX0A 4IJWA 3H2ZA 5AXAA 4IIUA 5CDSA 1DLIA 2Y0EA 1MG0A 1H9AA 2ZIZA 5DNAA 4UUMA 2IZZA 1QYCA 1DRWA 3G1UA 2W90A 4MVJP 4OL9A 1WW8A 2VYVA 3JYPA 4E21A 5IN4A 1UP6A 4MP3A 2YV2A 5BT9A 3ASUA 4XQEA 2BFMA 1I3MA 3KETA 1B0AA 4CM8A 4DLLA 4XDZA 3DBLA 3RJ5A 1GUYA 2JFFA 5TC4A 2H1SA 2ZQYA 1NBOA 5T57A 1HSOA 1F06A 1IPEA 1FDWA 3UICA 3I83A 2YY7A 4IDCA 1PR9A 3GDOA 1YL5A 4PZCA 4NFSA 3GA0A 1E5LA 3DBLB 1H9BA 5U9CA 4BOYA 1R0SA 1QYXA 2NVUA 4FFLA 4D46A 3WXBA 3TF5A 3N58A 3RAJA 1FXSA 1I10A 3VPHA 3WMXA 4BO5A 3ZH2A 3S2GA 2AA3A 2EP5A 2YV1A 2Y68A 4TSKA 4FFMA 2GN6A 4IDFA 4YA6A 2HLPA 1N5DA 3O9ZA 2E4AA 3H65A 2AG5A 2ZTMA 1LSUA 4IDGA 2WMDA 3ONFA 3WBFA 4CR6A 1XSEA 4A03A 4O1MA 9LDBA 1Y8QA 1Y7TA 1EE2A 2AQKA 4K6CA 3UVEA 3ZNOA 1NAIA 1JLLA 2E49A 5AXDA 4MVJH 4XD2A 1E3JA 3VPXA 3DC2A 1Q2XA 1VL6A 2PV7A 2PKRA 4YACA 2GLXA 3KSUA 3ZWPA 1CF2O 1HWYA 3DXFA 1B26A 2I9PA 1GEEA 3PWKA 4YRDA 4OGWA 1NPDA 4Y6SA 1RM0A 2VWQA 1LLCA 4J1NA 3WX0A 5BNFA 1HYHA 5A1TA 2CF6A 4BNKA 1N7HA 2UUPA 4D3DA 2DU8A 3IKVA 3LF2A 4Y6RA 2VNSA 4ZQEA 3PHIA 4QTZA 4A73A 4R4JA 2VWPA 2NTNA 4CL8A 3MWDB 3PRJA 1OBFO 3QJ5A 3VDRA 3UF0A 2DLDA 4BGUA 1ISIA 4CM9D 2Q4EA 4QECA 1ZKMA 1E3WB 3ZZNA 1I2CA 4FOSA 1KC1A 4OOFA 3SBOA 3O03A 3KYCB 4TRMA 1IL0A 3U4DA 3EVTA 3VTZA 5L4LA 3P5SA 4YAEA 1YQXA 5AOVA 4CV2A 4BO6A 4UVGA 2PGLA 3RKRA 4IXWA 5JMWA 1VJ1A 2YJZA 5GMOA 3P7MA 1G1AA 1LDNA 4ALMA 5HM8A 2EEZA 4B4VA 3BHJA 3JQAB 1C0LA 2HMWA 4U6QA 1D3AA 1WVGA 4TRNA 3FWZA 2B5VA 3I6IA 3INRA 2FOIA 1V6AA 4XYGA 3NTOA 3RI3A 3F5QA 2AEFA 4WEQA 1W73A 3DO5A 3E18A 4MP8A 4GH5A 4B4OA 3EVNA 4N18A 1L7EA 2Y1CA 3GR6A 3VPSA 1DO8A 4E31A 2BGLA 2C2YA 2V6BA 4II3A 3VZQA 3HB5X 1K5HA 1LSJA 1WMBA 3FPCA 3ZCXA 4GKVA 4CR8A 4OQYA 3KOUA 1E5QA 1PEDA 2OBYA 3CIFA 1ZSVA 1PJ3A 2WYVA 1HE4A 4Z0TA 4FN4A 4PZEA 1GR0A 4J7XA 3ZHZA 3DHYA 3DZFA 1J0XO 2Y0DA 3K73O 4L0QA 1T4BA 3HWRA 2GO1A 3A9WA 5G2OA 4FFPA 4J2HA 4E33A 4NBUA 3QWBA 4FDAA 3ZV5A 1HL3A 1V3UA 5EIOA 1F0YA 3WS7A 3S8MA 2OL4A 4CM5A 1T4DA 1WWKA 3ONEA 1NXQA 3R1IA 5ENVA 2LDXA 1ULUA 2IODA 4WJZA 4JP2A 5BNTA 3OJ0A 5G0SA 1ZXBA 4FFNA 3A4VA 1XR3A 1BHSA 2W2LD 3BMNA 3WGQA 1H94A 1YJQA 2FHSA 3H9UA 1BW9B 2Q2WA 5AYVA 5TF4A 4PLZA 4CMJA 3ON5A 1ADCA 4B4WA 3P2YA 4HUJA 2GZ3A 2BH9A 3AM3A 3EK2A 2FPIA 2V6GA 4GGPA 4HFNA 3TZHA 1V0JA 1IUKA 4XYBA 4EW6A 1I5RA 4N5NA 2WYWA 4FQ8A 3BMNB 3AOGA 3ZU2A 1HDXA 3I4CA 4FCCA 3PK0A 1U2DA 4OQZA 2PLAA 4NU6A 4DLBA 4E2YA 4C7KA 4Y8VA 4NBWA 4J49A 3PJFA 1IZ9A 4R1TA 3I9KA 3PJGA 1Y8RB 4GL4A 2AQIA 4A2CA 2DBRA 5THKA 3DAFA 1PS9A 3WYBA 1PGQA 3I52A 3RUEA 4IXTA 5HS6A 3UH1A 3VAZA 2P4HX 3U3XA 4OXYA 3OJFA 3ZWAA 1M6HA 2ZCVA 1ADFA 3FR7A 3TL2A 5HTOA 2H5LA 2GR9A 3ADPA 4D44A 4NK5A 3JYNA 1BDMA 1SOVA 1SEVA 5F1OA 2EKPA 4BNJA 4E6PA 2HK9A 3NGLA 5JC1A 3Q2KA 3W6ZA 2ZYGA 1TT5A 5KWEA 3BAZA 4NPCA 3SX2A 2O3RA 4XA8A 4CUZA 1CYDA 2CDBA 1UXGA 3UXYA 3SJUA 2CUKA 5IDXA 3UGKA 2X4GA 3WR5A 1MP0A 2OGUA 3D7LA 4EI2A 3EYWA 2Y1OA 3GGPA 2YDXA 4R3WA 2VYNA 5CP8A 5LCXA 3KUXA 3SC4A 1TLTA 3SXPA 4GI2A 3BTUA 3E1KA 4P4NA 1PZGA 4E2XA 1QLHA 4W82A 3DOJA 4PGFA 5IXSA 3MJSA 4OHUA 1HDZA 4RF5A 1P44A 4XYMA 2HMVA 5KCZA 1BSVA 3BHIA 1GTMA 4G5HA 3RJ9A 3GPDG 3IL2A 4TZKA 4OIMA 4R1NA 2YHIB 4ZQGA 4A10A 4BO4A 1FMCA 4D41A 5L4SA 1I3LA 3VVBA 1XQ6A 3GVCA 4XKJA 4QQRA 1OC4A 1CWUA 3RU9A 1GDHA 1P1JA 4W7IA 5H82A 1NQOA 1LLQA 1B8VA 2VRCA 3F5SA 3V1YA 1A4UA 2DBQA 2X86A 3LT4A 4XQ9A 4RVGA 5U1PA 1EBFA 1BXGA 3OIDA 1DOHA 1WNTA 2P5UA 3ANNA 2XPCA 1B16A 3AJRA 4MDHA 3GRKA 1P3DA 3X2EA 1DRVA 2FRDA 3L4BC 5G0TA 1MXHA 3AK4A 1I2BA 4O0LA 4QO7A 4QX6A 4X54A 1LNQA 3JQ7A 1M75A 1BXGB 2VOEA 4J4HA 4UUPA 5JYDA 1BRMA 1I32A 5CEFA 1Q0QA 1PGJA 2Z1MA 4IQGA 4PRKA 5JXWA 1YDWA 4MO2A 5JCJD 3WB9A 5JDCC 3UKOA 3DMTC 3BMQA 3OEYA 5G0UA 1B8PA 1DAPA 1R37A 2OZPA 4AJIA 3D64A 4ALKA 3PDJA 2VHYA 4L74A 2QQ5A 3RFXA 1ZK2A 5ITVA 5U4QA 4D42A 2BD0A 1YGYA 3L4BA 4BO3A 1X14A 4I9UA 3FBTA 1CERA 1DFHA 1H0KA 2FMUA 1UUFA 3JD4A 3NAQA 5B4VA 1X7DA 3BMQB 5EINA 3Q6IA 3CXRA 3OP4A 3E48A 4BNLA 4DVJA 3H8VA 5CHEA 5IJZA 3D3EA 2BHLA 3JQFA 3BTSA 5K0ZA 3OJOA 5DCYA 3DB2A 1MLDA 5JDCA 1Z7EA 5JO0A 2DFVA 3DMTA 4R9SA 2PA3A 3PVZA 3WNVA 2HMTA 3ZHXA 1LBEA 4IDBA 1JWAB 3PQEA 3PGJA 5ER6A 5TQVA 4CV0A 5JAIA 2D5AA 1UZNA 3ASVA 4FJ0A 4JK3A 4WLFA 2NUAA 3QW2A 3WNQA 4YXFA 1YE3A 1ZK4A 2UDPA 3DBHA 1J4AA 1K6XA 3GQVA 5DBFA 3I9MA 3RFVA 4JJFA 4TKLA 2BF7A 4BGVA 5G0WA 1PSDA 1NPYA 2GZ1A 4KWIA 3KV3O 4OKIA 2NTJA 2HKIA 5DT9A 1X0XA 2VYVD 2FPGA 4XIYA 1UXJA 2PKQP 1ULSA 3BMOA 4JXKA 2CSUA 1KBZA 3F6YA 2O48X 1Y6JA 3JD2A 4WKGA 3I5MA 2NSDA 1SBYA 2GRAA 3ZWOA 1ZMTA 1NAHA 2O7SA 3JQDA 3ICPA 1E1MA 5A9RA 1CEQA 3Q9NA 3IJRA 1P1FA 2X5JO 1YB1A 3F1LA 2CFCA 3GNQA 2X0JA 4C7JA 3ZV3A 7MDHA 3QVSA 2ZTUA 2NU9A 3ZWNA 1T26A 1GZ4A 1E7SA 3QP9A 4WOJA 3NV9A 3KVOA 4CJXA 1HEUA 2WWRA 3L6DA 4NIMA 4EJ0A 3JD0A 4F45A 4J7CA 1P77A 2F00A 1PJCA 2X23A 3MJ4A 4Q3EA 1JAXA 2C5EA 2JCVA 4YVFA 3RBVA 5L4NA 3ITKA 2BGKA 2V7PA 2H6EA 4L4SA 1BVRA 5JC8A 5DBGA 1GZ3A 1NR7A 1GQYA 4JJGA 3LU1A 3GC6A 2CDAA 3H9EO 1FJHA 1ADGA 4JJIA 1DBVO 1OI7A 4RZHA 4FSHA 5CFZA 1OAAA 4RJTA 4MKRA 3E03A 2VTDA 4J1SA 1Q7CA 4YT5A 4CM7A 2J5KA 2X9NA 3KM0A 5F5LA 3M2TA 4NZ9A 4YJHA 1QRRA 2X5OA 4BHTA 2ZTVA 3GEDA 4I1IA 4LRSB 3B6ZA 4OSPA 3PQFA 1QV6A 1DC4A 3ZHYA 8ADHA 3VKVA 3C7AA 3ORFA 4PFJA 2QIOA 3DONA 4YJHB 1J6UA 5BNIA 2JKVA 1YJ8A 1TVEA 4I5GA 2I66A 4ILKA 5TT0A 4EYEA 3MJEA 1EUDA 4AG3A 5L9AA 5KKCA 1H93A 4MOWA 2HAEA 2LDBA 1EQUA 4S1VA 3GK3A 1ZW1A 5L95A 4TRJA 5FF9A 2RHCA 3D4OA 3GT0A 1FF9A 3L9WA 3BTOA 1EE9A 4QEDA 1X1EA 3WFJA 1ISJA 1ENPA 4YAGA 2C2XA 1DIHA 1ONPA 2BFOA 4I08A 4XRGA 4ALNA 3ZW9A 5DN9A 5GY7A 1GV1A 1UXKA 2AHRA 4PLHA 2O4CA 4Q3AA 4W7HA 5MGBA 5TNXA 3F4BA 4MVJA 3JQAD 1T2AA 4H3VA 2PGDA 1QYDA 4P22A 4HP8A 4YCAA 2JHFA 3P2OA 4ZVVA 1CDOA 1FDTA 3QE3A 4BNWA 2B37A 4D45A 1LRLA 5JFOA 1B2LA 1QYVA 5T8KC 5BSEA 1C1XA 3DFZA 1HDRA 3LLVA 3GUCA 4Z0HO 4FGWA 4CMGA 5TLSA 3B70A 5L7YA 4YT8A 4RVFA 3M6IA 3V2UA 3I3OA 4DQUA 3FNHA 2UV8A 3B20A 3ZWBA 4Q9NA 1C1XB 3SJ7A 2CY0A 4UEJA 3HG7A 1K6IA 4RPJA 3DOCA 2YUTA 3L0DA 1EFKA 3KEQA 1P31A 4O63O 3ZNNA 4N5LA 1E7MA 4CMKA 3GN2A 4HY3A 4L76A 3EUWA 4RPGA 2D5CA 5T8KA 3GHHA 1A72A 3LLSA 1ZMOA 3OJLA 3KB6A 2Q50A 2B36A 5B37A 4LN1A 1LDMA 3PEFA 2X7HA 1P1IA 2VN8A 1YRLA 4D3SA 1N1EA 1X7GA 2YQ4A 3U4HA 1U7TA 4L4RA 4DQVA 2HUNA 3LC7O 4DYDA 2FPPA 5ER9A 3ZN2A 4M49A 1ONOA 1JW9B 3WGYA 3AFMA 1I2ZA 2HK7A 5IDQA 4LRTB 5KKAA 3HDQA 2B4QA 3ZWVA 2X0NA 2NQTA 4QFDA 3NTQA 3HZZA 2C0CA 3W8DA 5KJ6A 3TZKA 3OF2A 2BGMA 4CMHA 2NNLD 3LT2A 1O89A 1LDEA 1EEHA 2G5CA 4KQWA 4LMRA 1NX6A 1EMDA 2Y05A 4WEOA 3AUUA 3OQ6A 5IFLA 2B0JA 1E1NA 4DMLA 3F1KA 3H2SA 2DTEA 5C3MA 4ZICA 4IS3A 4YQZA 1XDWA 1GYQA 1IZ0A 3BTVA 3R3SA 4RVHA 4HBGA 4WLVA 5TRTA 1CETA 1NR1A 3G17A 3LC2O 1FK8A 4GBJA 2W4QA 2O3SA 1WPQA 4UREA 4R68A 4BNYA 1GPDG 4PG7A 3RUIA 3ZWXA 1NASA 4M55A 4O5OA 3WIEA 4BL5A 5CEJA 1YS4A 3WFIA 4OYRA 3ONDA 2CVZA 4B3IA 5A9TA 3VPFA 3ETEA 2X1HA 5JNLA 2IZ0A 3Q2IA 1DC3A 3IUPA 5DP2A 4S3MA 4MKXA 1XU9A 3L9XA 4D43A 3RUFA 4IZHA 1WLYA 2CMDA 4MIOA 3SEFA 2I3GA 1PZFA 4DA9A 4JGBA 4PG5A 3DBRA 2FY8A 3H4VA 4UUOA 1I24A 5IG2A 4WGGA 1XA0A 2O3TA 3OHSX 2RBEA 1E1LA 5KNLA 4E32A 3F9IA 4R5MA 4IY1A 3VH3A 3JYOA 4NU5A 1I36A 3HN7A 3WGIA 5KVVA 3RBXA 1A7KA 3T7EA 1N9GB 1E6UA 1RM4A 5I9LA 1RYEA 2E48A 1GPJA 2FWMX 3EAGA 4GQAA 1HDOA 4F46A 4JBGA 3GNTA 1K89A 3L77A 4RLHA 4HNGA 1DAOA 3V1UA 2EWMA 3SC6A 4DBVO 3E82A 4CM8B 1YBMA 4XGKA 4OO3A 1GUZA 3AW9A 4ND5A 4ZQBA 1UH5A 3GAZA 1Y9AA 1BXKA 1ZXLA 5T6BA 1O0SA 3GMDA 1I33A 3DQPA 3VOSA 3LYLA 4PLPA 1E7YA 1DB3A 2XAAA 3WGHA 1PJQA 1VJ0A 4QXMA 1E1KA 4GKBA 1GU7A 4LSMA 3JYLA 2NVUB 4R3NA 3W1VA 3VPGA 2B4RO 4B7UA 1PZEA 4HXYA 2WJPA 1AXGA 1SOWA 2B83A 2O3QA 4I9HA 5JPIA 4RPKA 2AE2A 2VRCD 1PJLA 1Z74A 3ZU3A 3PJEA 4Y98A 4WCFC 3RWBA 2ZK7A 2QYSA 4GPD1 4WPGA 3QVXA 4Q3DA 2EGGA 1Y8QB 4DPLA 1MX3A 4BNZA 1EVYA 1ZH8A 4FD3A 4E0BA 2QX7A 3NYWA 1XQ1A 1NP3A 4CLEA 1VSUA 4HKTA 4PLGA 3Q9UA 4AICA 3AWDA 1NFFA 4WLEA 3UUWA 3DTTA 3BHMA 3MOGA 1Z7BA 2C07A 1IHYA 2OFPA 2Y1DA 4HX5A 4RF2A 1BG6A 1TA4A 3S1LA 3TQHA 3C85A 5DCUA 1CIVA 2PNFA 2IZ1A 4WCFA 2HJSA 2QZ9A 4KUHA 3PXXA 1NHGA 1KC3A 3FCOA 2I5PO 5IDYA 2FR1A 3RBZA 2PH5A 3E6AA 5KJFA 1ZJZA 2IYPA 4OOEA 2Y1EA 4XWYA 4PVCA 1B3BA 4PCVA 4CM3A 1HSZA 1VKNA 5EQFA 1PJBA 3CMMA 4K6FA 3T7CA 4E13A 4IINA 1KETA 4U6SA 4TVOA 4R01A 3PHLA 3PYLA 4HFRA 3DOOA 1YQDA 2B5WA 5I7SA 4J9UE 4A27A 2JCYA 1LUAA 4NNJA 5EESA 1C0PA 3A28A 1H2BA 4R69A 1KOLA 2EG9A 4JIGA 1WZIA 3PHGA 1VC2A 2XXBA 2B4TO 1HYEA 1DC5A 1Z6ZA 1YKFA 1D8AA 1ZK0A 3JQ6A 1R12A 2OP1A 3VH4A 1DHTA 4I8XA 3PI7A 4IMRA 4TRRA 1NPTO 3VKUA 2X8LA 2DQ4A 5C7LO 4R41A 3ANLA 3L6EA 3UCFA 5ILGA 1UAYA 3PIIA 2CF5A 1QLJA 3QHAA 4J16A 4BQRA 4YQYA 4GLOA 5L51A 4B3HA 1U9JA 3DL2A 2DTXA 4M89A 4WOKA 1SCUA 4DC0A 1K2WA 2P5YA 3C8MA 3FTNA 1LX6A 1XGKA 3WWZA 4YAIA 3DMYA 4XX0A 3LVFO 3OSUA 2VHVA 3D4PA 5IXYA 4WASA 2VHWA 3D3WA 5TGDA 3IMFA 3KRTA 3FNGA 3CEAA 1OFGA 1B7GO 2AMFA 2HU2A 4U0KA 3IKTA 3HNPA 1HT0A 3MWEB 2PR2A 1EUCA 4KTVE 1PJTA 1M2WA 3NT4A 4NBTA 3WQQA 4F6LA 3D0OA 4KMSA 5IZ4A 3EMKA 1O95A 2Q1SA 1LDYA 3D3WB 1F12A 3MJCA 1HDGO 2CD9A 1ENOA 3DAGA 1QV7A 3ABIA 1JWBB 2FR0A 3ZV6A 4M54A 4BO9A 4CMBA 4GX5A 1AN9A 2HSDA 3ZGYA 3H5AA 3RQSA 3OQ1A 5FYDA 1WXDA 4CUJA 2FZEA 4R5HA 2FN7A 1NWHA 2QYTA 3Q0EA 1C0IA 3IJPA 4LVCA 2V6FA 1UZMA 1YL7A 4H16A 2Z5LA 4RF3A 4J3FA 1QKIA 1LQUA 2IXAA 3QVOA 4J7UA 3QWAA 2J5RA 3PDUA 2XF8A 3OH8A 3L4SO 1KYQA 4MIYA 1K3TA 1H6BA 3M1LA 3I9NA 4DC1A 5GZ1A 2OUIA 3NDJA 2CVOA 1EBUA 3RC2A 2AE1A 4ND1A 3H7AA 4GX2A 4IZIA 1T1RA 2GN9A 4ROSA 2QRLA 1EK5A 2AW5A 2AXQA 2GSDA 2DPHA 3OICA 1A9YA 3VTFA 1WZEA 5JW6A 1M67A 1WDMA 1YWGO 4FC7A 1A27A 1J5PA 4JNKA 2I99A 1U8XX 1TT5B 2EERA 3A1NA 1ONNA 3GPIA 1B15A 4H7PA 1Y1PA 3NJ4A 4BMVA 5H81A 4YTEA 4RPHA 2X22A 3IOYA 4CMCA 5ICMA 5JY1A 1IULA 2Q45A 4RVDA 1D4FA 1ZSNA 2JHGA 2Q99A 2ZKLA 3LF1A 1PX0A 4E2ZA 5FI5A 1I3NA 3G1TA 4XB2A 2YHUA 4CLDA 2PWZA 4QUKA 4WLNA 2TMGA 3VVCA 3D5TA 2QG4A 4GLLA 1H2HA 4XJTA 2RCYA 1SO8A 1I3KA 2ZYAA 3NT5A 3NX4A 5KVCA 5A06A 4PG4A 4YJDA 4CODB 4EJMA 2DVMA 4AFNA 3ENNA 1JAYA 4KUEA 3TSCA 3C7DB 4PG6A 1LC0A 5JLAA 1O94A 3TJRA 4DQXA 5C7IO 4DBZA 3GVPA 4BV8A 3AY7A 3GVIA 4PG8A 4RGBA 3HB4X 4PVDA 4AJ2A 1QYWA 4GGOA 5JYEA 5HWSA 1SPXA 4G81A 2VUTA 2DFDA 2C54A 4JQCA 3ETGA 4ZQFA 2EGHA 1ZSYA 3FN4A 4G2NA 2GN4A 3WDSA 1PJ2A 3GEGA 3WGZA 4NFYA 5EPOA 1IHXA 4RDIA 3RUAA 3BXXA 3ADOA 4ZHSA 2X9VA 1ISGA 3RASA 2Q4BA 2PZKA 1ZJYA 5I7VA 1C0KA 4ITUA 3K6JA 4CQLA 3CH6A 3DHNA 2ZB4A 1N2SA 3UN1A 1B3RA 3NUGA 3VZSA 1T2FA 3ROQA 3JQ7B 2EF1A 3OIFA 3H6KA 4BNGA 2NVBA
chains in the Genus database with same CATH superfamily
3TR0A 2BTQA 3JQGA 4GOOD 4I5DA 1O5IA 5HQTA 1C7QA 1HPLA 1P0QA 2E89A 2HLHA 3WC4A 4WCDA 3WV4A 3W0LB 4D8UA 3ODGA 2R1TB 4J75A 3B3AA 1T2DA 4YP5A 4HXGA 1KP3A 3D7RA 4FDTA 2C88A 5LWHA 2APJA 1XMIA 2F8TA 1UZUA 4CEHA 3U0VA 1K6JA 1VL5A 3AHEA 4KAAA 4MJLA 4BVEA 4S05A 1H6CA 2Q8PA 4RIIA 4UHHA 3SVTA 4GOMD 3HCWA 1AHIA 5FULA 1F7UA 5LD2B 5KNDD 1NU6A 1X9IA 2CZQA 4NQRA 4ZU6X 3T1NA 1FB5A 5IBRA 5K51A 3ZTYA 5H02A 5ITZA 3HBMA 4U9UA 5JAUA 1GPKA 4L4UA 4NOMA 3CR7A 2J9GA 1OX4B 4DMCA 2Y2UA 3V8MA 1G55A 2IELA 4PFSA 3T1YB 1WBJB 5K3SA 3T7SA 2H4FA 2GI4A 3GY0A 4NARA 4W8HA 2J3LA 4FZRA 3R3JA 4XJXA 1YS1X 1PR3A 4EPVA 4TVSA 5AJYA 3V6MA 2WWXA 4DNFA 3OZCA 4QAJA 2O20A 1TUBB 5ICEA 3CT4A 5KTKA 3VNVA 2WZDA 3DMNA 1XIVA 3L0SA 2PZEA 2CL0X 3EDOA 3JWGA 4X95A 3VMMA 2JLRA 4CL2A 3KCQA 4BJ5A 1CUUA 3AI2A 1VMIA 1Z82A 3NDRA 3W9YA 4NENA 2OV2A 4AJHA 2X0FA 3SR0A 3BIXA 3GZTB 3CISA 2WPNA 3DBHB 1R15A 2ZTLA 1RI3A 2YN0A 4F5ZA 2ZJ4A 2IOFA 2KS6A 1FVFA 2ZRLA 1Y5NA 4IVRA 4RHEA 1FBNA 1GARA 4QSMA 5B1SA 4AZSA 4G37A 5EGSA 2IOHA 1EFAA 4B6JA 3C3XA 4M1OA 2PFGA 2BCEA 2NV6A 3GB9A 4K0RA 3SQXA 4UTNA 2RI6A 3H9JA 4H08A 3DOUA 2EJCA 5K1ZA 1RM3A 5LOVA 3G0CA 2EX1A 4B1FA 2IH2A 2KMLA 1ANKA 3RYHA 3BULA 2CVHA 4E4YA 4EITA 4F11A 3L8DA 2VO1A 2WJGA 4O08A 2HQOA 5JEEA 3JQRA 1P4SA 2EBWA 3OPMA 3QW4B 5CJPA 4FFWA 2P9EA 3H8SA 4C0BA 1KZ9A 1PT5A 1RE0A 3WBKA 1E92A 2VQ3A 2DGDA 2XYHA 2VSQA 3CE6A 2RH4A 1NLFA 3S40A 4NK4A 3PIDA 1RPZA 5B4UA 1OYWA 1PJSA 3Q40A 3UOGA 5TSDA 3C4VA 3H2IA 4MJ3A 4D9KA 1PL7A 3QV1A 1MEOA 5H83A 5IX8A 1T8WA 1PQWA 3OM0A 1K97A 1PTJA 4IIGA 1PT7A 4GPZA 1XCBA 1JKFA 2C59A 1KK0A 4QVKA 3DLHA 4NEQA 1YB5A 2DHDA 1Y8AA 2ZITA 3ZLUA 4XTCS 4QD3A 1R0CA 2XSZA 1H2EA 2V7BA 2XCRB 4D0SA 1DO0A 3F6RA 2CNOA 1UM9B 1TU4A 3C7CB 2HA0A 5E7MA 1BVYF 2QMQA 5ERYA 3V4LA 3KQLA 4J03A 1K6EA 4E94A 3OQMA 3HK2A 2B78A 5AHOA 4IMJB 1EVJA 1L5HB 3U56A 3M5DA 4ESOA 1M7BA 5F2OA 1S02A 5TMEA 5G4LA 1ADBA 1D5CA 3IT1A 3USCS 1YJAA 4RIHA 2CEAA 1TKBA 5ARBA 1XE3A 1J7KA 2OUKA 3OCWA 2GXAA 1TPYA 3JAWB 5L6LB 1MAHA 4V0LA 4L3WA 4BU0A 2PX5A 2O06A 3UTDA 4M0UA 1GSAA 5HILA 3UT5B 2L18A 3BCHA 4OHVA 3UO8B 1QNLA 4F92B 4LE0A 4BLTA 2ST1A 1P0CA 4DR4B 2QW0X 4J1TC 1NNUA 1D7OA 1HRDA 2HREA 3AFGA 1O6FA 4NBKA 2IIQA 2CLIB 1EXMA 2W9XA 2C03A 4W6ZA 4WECA 4BVFA 5CBKA 3GLFE 3R9WA 2HSJA 4IJVA 1DKRA 1KAHA 2W6JD 2Y71A 3RSQA 2BSQA 1H8HA 2P6MA 3AJEA 3NDIA 4Y0AA 2JIQA 4BKQA 5ES4B 4PHGA 4E11A 1QFXA 1IPFA 1XRQA 1XX6A 2XTMA 4A26A 3ABOB 1B74A 1KZHA 3EPJA 2BMJA 5AVSA 3OPVA 5HS4A 3IDOA 1XQVA 2ECKA 4JELA 4GWKA 4ZHQF 1P8AA 1NVXQ 3RSZA 3H6HA 1MGOA 1WD7A 1D1PA 3G2IA 1T8UA 3N7UA 2C82A 1C4OA 1XHLA 1PBNA 1J2TA 1QGUB 1UWVA 3A06A 5IF3A 5F3RA 3HP7A 5PNTA 1EG7A 4BDTA 1PEAA 4GXRA 3I2FA 2BP7A 2CWDA 2EP8A 1O58A 2QW8A 3C8DA 3QSGA 4KV9A 1BS1A 1Z0IA 2HV9A 1WAMA 2Q4OA 4QYWA 3T35A 4HPJB 4NDZA 1OWMA 2J07A 2H1IA 4EEXA 2FW8A 4MQ4A 4Q7JB 3M4JA 4AURA 1L4HA 3ND8A 4DREA 1P9WA 1JG3A 1Q7TA 5IPFA 5NULA 5CPBA 1MOPA 2F3QA 4S0XA 1KERA 1FU7A 2BGUA 1W0KD 2QZZA 3FTPA 5HF8A 2G9RA 3ID6C 3O9MA 3IULA 3R5JA 1TYBE 2JJ1A 2DY1A 2JBAB 4RV5A 1ZD3A 1CFJA 2Q5QA 3DWEX 2ZIXB 1YJBA 3ROPA 2G0NA 2DEUA 4GSKA 4KXXA 4KXVA 1YI1A 5C2JB 1KI9A 3U49A 4MW9A 3GH3A 1GPNA 3HLKA 1I7PA 2WSSD 4DL9A 4CQMB 4ENUA 2PZJA 1RKUA 2ZBEA 3GJTA 1S0UA 5EWLB 1DG9A 1R0WA 4CG1A 2EJUA 3N8KA 1SEPA 3NBMA 1M2NA 2VQFB 2Y1FA 2J6IA 4H18A 4L5BA 1C1DA 1NWCA 3SFVA 2PFKA 1NHWA 1QIKA 1LWNA 4AQYB 1OIWA 4FYVA 1PL6A 4E3ZA 1X1SA 3C74A 2OYRA 1SB8A 1E8DA 1QDEA 3KLNA 5JU6A 4GECA 4TWRA 1O1YA 3D8TA 4LOIA 3VV3A 2HPAA 3ACCA 1WF6A 3JU3A 2J7PA 3D6AA 4GBMA 3L2OB 4JEIA 3VC1A 5E6UA 5EPEA 2FPPB 3A9TA 3PPIA 4XYLA 1T0IA 2FOXA 4X3OA 1RJEA 1LTQA 1HYGA 1SN7A 2NZVG 4K26A 3QE0A 4HDSA 2EP7A 3EDCA 2QHXA 3AF2A 4IIVA 4ND3A 1YQUA 4O4IB 3PGXA 1S5PA 3QGMA 1KF0A 5J2TF 4UU0A 4M6WA 1H2XA 1UP4A 1IIBA 2AN4A 2QP4A 3ZH2A 2FEAA 3WY9A 1CUBA 1O95D 1E4YA 3X3HA 1RWVA 4NATA 4IH4A 2WU8A 4EOGA 5HQ3A 1XCJA 3AUYA 2E85A 1XNGA 2JK1A 2XDQA 4MKIA 1PT6A 2VT6A 5TJ9A 1JALA 3UK6A 3PP8A 3CVVA 1JDBB 3R3ZA 1RBMA 2BUBA 4DQ0A 5ALYA 2X3YA 4DB4A 4QJIA 2WU1A 4IOLA 1YKSA 5HMLA 3OT4A 3REQA 2V7VA 3BJRA 4C4OA 1K6MA 1ODTC 1YS7A 4Q18A 5HDBB 2EKLA 1U4OA 2KBEA 4MAMA 2HFKA 4FM9A 3ZGZA 5ELXA 1MV5A 5IMBA 4HNTA 2UVQA 5CK5A 2GFHA 3AYXB 2YNMD 3DT9A 4QOSA 3K9NA 3W06A 4CDGA 4NJMB 1YU9A 3NKFA 4ENWA 1H0RA 2G6BA 2QL9A 3WLFA 2UUBB 1OXTA 1RZVA 3C3KA 4RVCA 3UFBA 1UIRA 3P9NA 4JI2B 1N32B 1NMSA 4J90A 4YMHA 2W2NA 1TPZA 3PICA 1A8SA 1HLDA 2JCXA 2MOKA 4TMVA 1TTQB 2HSGA 4YXWD 4YJGA 3C3WA 4RXMA 4C14A 3TFQA 2O2GA 1V2HE 2XB9A 3QMPA 1ZVJA 4J0JA 4BAZA 1G4HA 1L5VA 4W9NA 1IBRA 3NAGA 3L4EA 4HDMB 5EC8A 1PCXA 3EASA 4Q05A 5LYJF 2YVKA 4B7CA 2ADOA 3FMFA 3ZC3A 1PL0A 3I9LA 1H0HA 1P7ZA 2VJPA 1PWEA 1VHTA 3R9XB 1A5BB 5DLQC 4ENTA 2O2SA 3AP2A 1PL8A 2WIGA 3SF8B 2OHFA 3EZLA 3R24A 3T3HA 1HG0A 1M6NA 2XZOA 4NCXA 5IM4F 4J6EA 2RGBA 1YZYA 4Z4CA 2BFWA 4G9EA 1VHQA 1CSEE 5DK6A 3VA7A 3DBRB 2GERA 5KU1A 4JR0A 4R8LA 1NC1A 3ANSA 5ULLA 2HCJB 4L4YA 2OYCA 2JRLA 3RTCA 4BJ3A 4TS1A 4EPXA 1GO2A 3I5XA 3DEHA 1BMQA 3PE6A 1NP7A 3GJ4A 4ZAFA 3SZ3A 5L3ZA 4PY2A 5DDIP 4QLAA 1DIAA 4ZGWA 2VAXA 4Z9FA 1LRJA 2R6CA 3N2GA 2A8YA 1T3GA 2BLLA 3JQ8B 3PDCA 5DGXA 1RU3A 4Q82A 5LLDA 1V7ZA 5I5GA 2GNOA 2O5VA 3IEXA 3U80A 4MVCA 3MMNA 5DCWA 2FPSA 1G5FA 3VR5A 2GN2A 4M37A 3WNCA 4ENRA 2NXEA 4IO0A 3BK1A 3CRVA 4YBZA 3MCAA 4K8OA 4Z4EA 5BR7A 5CRIA 3SXUA 1M6YA 2YOGA 2ZWAA 4HYTA 5T5QA 1IB6A 2PGAA 3N3BC 5LPNA 1RAAA 3LHIA 3LCJA 3ORYA 1JBEA 4RMGA 5FBRB 2J6BA 2J48A 2H00A 1AF7A 1UP7A 4Q37A 1M34A 5D1HA 3U3DA 3W05A 4YCLA 2P2CA 1UPCA 4FGLA 1XMSA 1ND6A 3FYUB 4EFNA 1YHZA 2OCKA 3N8GA 4KB5A 2DTDA 2ZSIA 3Q3EA 3NIWA 2EZUA 5IC6A 5DHFA 5C81A 4D8YA 3DFUA 5BYAA 3QJGA 1C2TA 3OJCA 2EEPA 3BWMA 3P20A 5CLQA 1FNMA 1KSJA 1P6XA 2EYQA 2Z8YA 3BIOA 4KO8A 4OHRA 3T61A 4B7XA 1E2BA 1XBTA 1Y3IA 2JGIA 4IJ6A 3OMXA 5AI4A 3WG9A 1ID8A 1H8ED 3STTA 1JFFA 3G8AA 4KXLA 3W4KA 4C7MA 3KWMA 3K2EA 4DDMA 1NBWB 1P1HA 1V5GA 2IPLA 1SUIA 1QLWA 1XWIA 3DTYA 4DIOA 5GZ3A 1T5TA 2QRNA 1JHRA 4JJKA 1TDJA 5C8YB 4MICA 1AQJA 1ZGGA 4H1HA 3R74A 3QUCA 3QA3E 3AUKA 3AB7A 3IELA 4OLFA 4LXHA 4Y6PA 3NWEA 5IJ9B 1YGPA 4IH1A 4YRJA 2RH5A 4RK4A 3SDBA 3VVCA 2NQ8A 5BV2P 3D6NB 1DU4A 1NXXA 4G97A 2MIIA 1G7CA 2QTMA 1Y82A 1NU8A 4WUVA 3V4SA 1GL3A 1OWLA 5A04A 2XDYA 4RE6A 3MSCA 4BB6A 1C0EA 3C5WP 4LDQA 5C31A 4BNMA 2YL2A 4E4TA 3P5BA 1KEPA 3QTTA 1TMGE 1BMDA 3LWZA 1Q7BA 2C4MA 1Z45A 3C41J 4Q39A 2BV3A 1UFKA 3LPDA 5A4MS 3L43A 3KEGA 3KVVA 3FFAA 3DZBA 4J0FA 4KYIB 5BO5A 3HHEA 3AVTA 3W4JA 1F20A 1W2GA 4MVWA 1NVDA 4FB5A 1T0BA 3O94A 3LWBA 2R0QC 3FHLA 3QMMA 1WZNA 3FYTA 5TQ0B 2J0UA 5CDGA 4TLLB 4WFQA 3FY4A 4BVHA 4DC9A 2VQ6A 4EY3A 4YCMA 2MR5A 1CJBA 5JRZA 4RQUA 1E9BA 2ZJ3A 3MT0A 3SSNA 3ND6A 1XTSA 4MQFB 1GGKA 2W2KA 1KMHA 1P3Y1 2WFLA 3R3UA 4NBLA 3M3DA 1Q91A 3AMVA 4TZTA 3RC3A 1V11A 1F3OA 2REBA 2I7XA 1CQJA 2C92A 4DT1A 3SLGA 1VCIA 4NMXB 4Z2YA 3QPWA 1Z4IA 1YAHA 3KJEA 2FDXA 4Y2TA 4D9BA 4HSGA 3Q11A 1U2GA 4BO7A 1PJRA 1GQRA 3HDJA 3IO5A 4FKBA 4TN1A 4H6VA 3V8VA 2DBVO 2O0MA 1Z8HA 1MO6A 3DCIA 1Z4KA 1Z13A 2GPTA 2QLNA 3JQAA 4E2WA 3T94A 3T99A 3K7EA 3CKKA 1W47A 3HFRA 4FGKA 1JIVA 3JD3A 2SECE 4F8YA 4DRXA 5EZ6B 2GBPA 1WSWA 2AHOA 4MV3A 4PGMA 5SV2A 4YCBA 1K7CA 2CHFA 4YJFB 4ZVRA 1A7UA 5LQAA 4LYDA 3ICQB 1PLKA 3EIHA 3AX6A 4C07A 4O4JB 1MJFA 3THYA 3VKFA 5DBEX 2ZYRA 4OHPA 1VOTA 4PYKA 1AHNA 2DP4E 4IFEA 1RTKA 2CZGA 3LE8A 2Y8EA 1Z8NA 2JATA 2NZ8A 3OU6A 2CK3A 5SYAA 2PH3A 1SQSA 2GOYA 2VFAA 1VTKA 3MJTA 3X1MA 4G8JA 3M83A 3GRPA 3VVLA 3X1KA 1EFRA 2IITA 1LI4A 2WJ3A 3B5EA 3HDHA 4ZAVA 5FUWA 5HZGA 2PKQO 1Q57A 1E9DA 4YCSA 1PWXA 3BWEA 5AWFC 3M82A 2XTJA 4CLXA 1YS6A 4BC1A 1QAMA 2JEYA 2JJ2D 3R8XA 2WILA 1B4DA 2XWJI 2UUOA 3M5WA 4XX0B 3SVZA 4F2PA 5JNVA 4ZVPA 1OTHA 1G3IA 3FOCA 3HA3A 5CX1B 4R1MA 4FIDA 4NYMR 4LEIA 1SK9A 4MR8A 1YR6A 5IRCD 4CGZA 3Q6NA 3RUPA 2R7AA 4NEHB 1WSBA 4GMFA 3HO8A 4Q3BA 1UJNA 4YRCA 3I4FA 5TMBA 4H15A 3VPAA 3ESRA 3IQEA 5AK0A 2H1RA 3WIDA 4ND6A 1KEEB 1CVIA 1DIBA 3EDRA 4MVJF 4XPIB 5BN3B 1VKJA 1RABA 2HMAA 1HEYA 2RB5A 3BB3A 1SXJA 2PD6A 3DE2X 3MK31 1WB4A 5HP4A 1FX0A 1YQWA 2AK3A 3RPEA 4R0MA 2UUAB 4ZZIA 1KMCA 3I0NA 1HH4A 4LOKA 2FXVA 2GVDC 4L95C 4XWKA 1QAQA 4LFAB 4J91A 1TUGA 1XU7A 2QY6A 2Y1GA 1U3WA 3DDOA 5DW3A 2VJOA 3RVJA 3N59A 1QG4A 2BFCB 1VG0B 3RARA 5KU7A 1EK2A 1PQPA 1V71A 1ZQ1A 3C6YA 1T29A 1U9YA 2W2XA 3KXLA 4HN2A 1WHSB 3EHEA 5A5FA 3G2LA 2RHDA 1Q0HA 3G88A 3K9QO 3LK7A 4TLEA 5EMKA 3G2JA 3PC8A 3LYHA 1D6NA 3VM6A 3VYUB 2O2YA 2G3YA 3OQIA 1KYWA 1NYTA 4QT0A 3HCRA 3SGLA 1O6ZA 2DR2A 3BQMB 2J9RA 2PD4A 4HWKA 2O3UA 4Y3UA 5LBTA 3HJBA 5HE9A 1FUKA 2D54A 2ZU6A 4TKVA 3WYCA 5C7OO 2JI8A 4LZNA 3RAEC 1GM5A 4MDEA 4FYKA 3QLEA 1Y6FA 1T24A 4RVNA 1AS0A 1PGOA 2R66A 4R71A 1HLPA 1M8KA 2AOUA 4K6KA 4FONA 3JASA 3OLQA 5KS2A 1KIAA 1O03A 1Z9BA 2AG0A 4HAZA 2LBPA 4BZQA 3TW8A 4RSGA 4RSRA 2IPNA 1NM5C 4MVJD 4R1SA 1TEHA 5AK4A 4PPNA 1AKQA 2TMDA 5EQJB 4OHZA 4C6SA 1KY4A 4Y1FA 3LS2A 4FGSA 4HS9A 3PFCA 4O4IF 1X7XB 5K6AA 1E6EA 1DXYA 1G3RA 1XZQA 4R1OA 4YC7A 1ZU4A 4Z86A 5JJ5A 2YYSA 3DWGA 5EVCA 2FZCA 5J63A 2GRJA 5KJ1A 1CUEA 3CQ9A 1QORA 2A33A 3KSMA 4DZTA 2ZR9A 4Q5IA 5CDFA 3R40A 2JAHA 2VHXA 4GW3A 4H7HA 4A0SA 1E5XA 4NL4H 4AWBA 2NXWA 4ZPXA 2IHBA 4ND4A 4P4GA 5C4GB 4F12A 2O5EA 3EE6A 1L7NA 1GKYA 1P72A 5C53B 4JENA 3MELA 4X92A 3MT9A 4YI3A 3TO5A 3WGJA 1T2EA 3SE0A 3ETDA 5A3JA 3AGQA 3U4IA 5C0OE 4CQMD 1QFMA 1JZQA 3AV0B 4GI1A 2NG1A 3G49A 2DH5A 3ZWYA 2XY4A 3B1ZA 4G89A 4DRYA 1S2NA 3DDWA 5I9MA 5F4BA 5BR8B 3TVDA 3KKNA 4RTJA 1P18A 2Q0SA 5LZ9A 1ZHOA 4BUCA 1JVBA 3BE4A 4HDCA 3UMRA 2UXCB 3GT3A 3T9DA 2QV0A 2YZ7A 1F17A 3NH9A 1UDXA 4U7WA 1I4LD 2BBSA 1T3SA 1UKZA 1PFVA 4XJSA 5T4HA 2FMIA 3FLBA 3T3MB 1ZD4A 3GLIE 1OGIA 4WNAA 5JUWA 1DDOA 1Y8ZA 4IEEA 1UZLA 3P9CA 1JR3E 2PH1A 3ZHBA 3QKRA 4EGCB 1E4EA 3FKSA 2FKNA 1G60A 2EV9A 2L69A 3CUKA 3H1EA 5CT8A 3ORSA 4CN9A 1CUIA 2DM6A 2HCRA 3FCEA 3PT9A 1SCQA 4HMPA 5EP1A 2P0EA 2VVTA 5AESA 3N6VA 4PLWA 3O7WA 1ZCJA 4JOSA 2ODAA 2IU3A 3MNFA 1YONA 3RVBA 2RHLA 3S5UA 3SM9A 4C0AC 1QH0A 4CCWA 3WE7A 5HKLA 1LV7A 3VZBA 4CTMA 1QIGA 1TEVA 2H9IA 1U65A 3QX7A 3OZ7A 1GQFA 4BO1A 3FCSB 4CQLB 4MUJA 2V3VA 4JN6B 3KPWA 2UZ3A 1V1MB 4TQGA 4H6XA 3MERA 4PNPA 1IY1A 2OORC 3QG5A 3Q0TA 4X7MA 4EF6A 4NMHA 2BTQB 3JQGB 2H7CA 4R9VA 3TGWA 4AY3A 4FDMA 2ZREA 2HXSA 4D25A 1ITZA 1I4DD 4YP9A 3ZDFA 4BKPA 1UKBA 4M8IA 1NURA 4YYZA 2AGVA 2IA5A 4O59O 3EXHC 3B9RA 1BA3A 1GITA 4I1YA 2ZI6A 4HZIA 1M2HA 1O6GA 3PZRA 3I30X 4D5GA 5A5DA 1EDBA 3B60A 2G1UA 2J33A 5G4KA 4BX8A 3HBAA 2F7SA 2I8CA 3KYIB 3OIGA 4MRRA 2UZAA 3CRW1 3OOHA 5DLYA 1Z22A 4ZRDA 5FADA 4LHWA 4CM9A 4LCEA 3RJTA 3ADCA 3FKQA 5ITZB 5KINB 4BB0A 3ZV4A 1VQ1A 3M1AA 4KN6A 2LE0A 5C18A 2QR3A 2XUZA 4B2PA 4TMXA 2HRZA 3I8SA 5JS7A 1ZJWA 3EPPA 2RC5A 4RO0A 3NIFB 2QLTA 3EXIB 4Y2XA 4LA4A 1T8TA 2NU7A 2PKEA 3A14A 2QYOA 2ERXA 5JZBA 3ZOKA 3RUCA 4G5XA 4Z4GA 1WY7A 3C97A 1WDTA 2H9YA 1ECFA 1CDDA 5JXJA 3NYRA 4LVUA 2EVWX 1U1DA 2BM1A 2PCJA 3HN2A 1SZJG 2ID7A 3QE2A 4LF6B 1COWA 4JR2A 3NYQA 5DM60 5AFSA 1MB4A 4TX1A 2BRUC 1Q0LA 2O8NA 4W1SA 4RELA 3ONVA 1SULA 3R5HA 1W4ZA 4EHIA 3AVQA 4QU9A 1DAKA 3UJPA 5C8YF 1NJ1A 3LDAA 3UENA 2BONA 2JGLA 3DWFA 2WTBA 3OLXA 3EH1A 2NVOA 1TO1E 4HNHA 2GBLC 4OK3A 1YBAA 4BFXA 1Q1QA 1DHRA 1BGWA 5ERXA 4BMXA 4D26A 3EWNA 3PR1A 2CVQA 1ID1A 5E2IA 2Y0CA 1N2HA 3AR8A 1O9BA 4WXMA 1N36B 2ET6A 4KGZA 3W8RA 5EHXA 2QRJA 1HI9A 3ST7A 3WMEA 4QOEA 4U7HA 3NWBA 3G0GA 4DIBA 4PLTA 1SB9A 4BRSA 3DZKA 2GYYA 2K87A 3B36A 1PS0A 3L6OO 3SFZA 2P9BA 4UQOA 1ORRA 4X41A 3WRXC 4EYOA 1W88A 2FDCA 1F8XA 1NLMA 5HF9A 3RYHB 1T6NA 2BEVA 1ZW6A 2FEKA 1BD3A 3DE6X 2QL7A 5GGYA 1OOEA 3VDNB 4A5SA 1OBHA 4HWSA 4BO2A 3GUYA 2A67A 1K8ZB 4Q1FA 2EZ8A 3LQKA 5LKRA 3G02A 1FMTA 4CLHA 3JALA 1D1SA 4XM2A 4NJEA 3D6HA 1X2EA 1Z3IX 3NGMA 2D0IA 1NI4A 2OSVA 1OYOA 3MYRA 4BZPA 4DYVA 3PEYA 2NP7A 3SVLA 1WMDA 1ODCA 4LGVA 5B64A 1CUSA 2HQSA 1YDHA 4E5DA 4EHDA 3GOHA 2PGXA 2PK3A 4CCAA 5JS2A 3ZX5A 5B4TA 4F4DA 2QAIA 2XUOA 2P90A 4QUDA 5EKXA 1Q0UA 2BR3A 3PKIA 4GOXA 4W1QA 3ZZMA 4MVXA 3BSWA 1CUAA 4AJKA 2HYDA 2NWQA 4QDOA 5IJ0A 4E5SA 4FLMA 4FHDA 1U4SA 5F9MA 5HFJA 2WEKA 4EKGA 2W22A 2BFBB 1HXHA 3WWEA 4QASA 3MUNA 2I22A 3W4IA 4EGJA 1G6KA 4WNIA 3W5IA 4ER0A 1C3LA 3TCXB 4ONEA 2O8CA 1T4CA 4LQ4A 3WP1B 1QS0A 3DBIA 4GPEA 2QI9C 4ZAXA 5ALLA 1OF1A 3E9ZA 1W6RA 4O4JF 4RTNA 3E35A 2ZDQA 5FFFA 1ZM4A 3IIKA 3K6SA 1RW4A 2MJLA 2XE8A 4AJPA 2B6NA 2D59A 2PUBA 2XX3A 1PGPA 4E5YA 1IU9A 1HZJA 1RXSA 2XMPA 3STHA 2VUSA 2NO7A 3R5XA 3SJAA 4ZTUB 3AILA 2R9VA 1KEZA 5LKAA 3ROTA 1NP6A 3ZHOA 1HYBA 2Q8QA 4HH1A 1L5NA 2M6KA 3ZZTA 3SR3A 2ZUTA 4EEZA 1USIA 2BZ0A 1WNFA 4OIFA 1RYFA 1XQ9A 4O25A 3PC7A 5KUTA 1NF8A 5F98A 3A3NA 4MVJG 4W1RA 4J4TA 3TUZC 4PV7A 4UEKA 1K3UB 3V42A 1SXQA 1P8JA 3RSLA 5LU9A 2H54A 3RFTA 1W93A 5IHPA 2IPOA 3F8SA 1ZJ6A 3PGLA 3EVZA 3P71T 3E2IA 4M9ZA 4OF4A 1JSCA 2EKDA 2P2NA 2RHRA 1IVNA 2OO3A 2IRWA 1PP4A 1XDZA 2YICA 1FFBA 3FDFA 4R8SA 1XLTC 3K9HA 2BJHA 3GRFA 1QIIA 2KM1A 2WF7A 3AU8A 3GA7A 1YR8A 3QKWA 2P91A 3SEZA 2O2DA 1ZN7A 4IIDA 1W85B 2SKCA 3FSJX 3AJ9A 5HK8A 4AECA 4RFVA 4BNFA 4MO9A 4RTKA 4LDAA 2ZTHA 3FJ1A 2NXJA 3WKEA 5F5XA 2JFZA 3U3RA 5C3UA 3O47A 1EVIA 4P4LA 1YCFA 3MG9A 3S2ZA 3GBSA 1KJJA 2JD0A 4TYPA 1ZUD1 5LYYA 3JR3A 4IOJA 3GFBA 3OM1A 2I7VA 1KS2A 4PO9A 2EX4A 2FUEA 5K3OA 1GNLA 5F77A 1YQEA 2SKDA 2ZRAA 4JKYA 4M8SA 1ATIA 1GG9A 3O2NA 5FH9A 2Q6KA 3KLMX 1DBWA 1XXHE 2F43A 5FLKA 5KYXA 4A9AA 1D2MA 4M83A 4B45A 5BXYA 3FOZA 3DMFA 3A36A 3WB2A 3UMYA 3A11A 2XB4A 4UW9A 1MFZA 1VMKA 1XZ8A 2IYNA 1WXWA 5IFKA 4H35A 3ORQA 1AUQA 2OB1A 6NULA 3ISVA 3O73A 4DMUB 3CF4A 1W44A 5DF1A 8ABPA 3FI0A 1ZWLA 2XTNA 4C1BA 1W36B 2BDTA 1A2OA 1KKUA 3RD5A 3T8YA 3KJZA 3KQHA 3N0RA 1C1DB 3KVYA 1FSFA 2FPRA 4M0PA 1E5VA 3KPUA 4BRWA 4UOQA 4BWFB 2JL1A 1UOPA 1ML3A 2JANA 3BE5A 3NH6A 3TLCA 2E6UX 5IS2A 3E9DA 2I8LA 4DDWA 1VB5A 3TJMA 1WKVA 2J3MA 3A4MA 2ZRGA 4U6NA 3SBXA 1FXWA 3O8QB 1Y5MA 2ZB2A 5BMOA 5K2OA 3W9SA 4MDYA 2I6GA 4NEGA 1H4QA 1OVMA 1IHDA 2GQ0A 2CB0A 4JP3A 4PYIA 4C08A 4PAGA 1BTOA 4X1IA 5DXFA 3O3NB 1JHXA 1CUJA 2J3HA 2OFOA 4HDSB 1JUDA 2G09A 1K7FB 1NBAA 3NFRA 3MS7A 4CNQA 5KTTA 2QQEA 4PBTA 3H87A 3OHMA 4BNIA 4RLFA 1T2CA 2D00A 1NYLA 3C1TA 1ML4A 4H3SA 3ZUGA 5HQ3B 4JV5B 2ERYA 1O08A 5BSKA 4OXXA 2XDQB 1W9MA 3QEJA 1VJDA 2XCSB 3OQVA 4EBFA 1AHHA 4IHAA 1SIUA 3FYSA 2LVBA 3CLUC 3REQB 2J85A 4BLWA 1DJNA 5A71A 1VIDA 1Z7WA 1KQOA 4PAMA 5EP2A 4YPFA 4D7AA 2NU6B 9LDTA 2QLFA 4M86A 1Z6PA 4IL5A 3O31A 3X0DA 1PLLA 2V65A 2XNJA 3CLRD 4M76B 3G7UA 4C0KA 1A98A 3NQ41 4LNHA 4CF5A 4I0WB 1N25A 1XPOA 4K9KA 3QXJA 4IUYA 4CKZA 2ZRFA 3X1YA 3H1FA 1XTTA 5DPMA 1EIWA 1C50A 1DFGA 5A0FA 2XCLA 4UARA 3U7GA 1N4AA 3E58A 2HSEA 5SZIA 4K7JA 4MCAA 3LFUA 2ATVA 4TLMB 2PEYA 4ZOLA 2ZS9A 2QTRA 3E9QA 4LSZA 5LBUA 3ZLVA 4Y9TA 4IWNA 5EXXA 5AI9A 4Y9SA 1U9IC 1ZNWA 5BNWA 2XD9A 2V9CA 2X6TA 2X5NA 2FSSA 6Q21A 2GYVA 3ZH9B 4E07A 1OTXA 5CIQA 3H0EA 3HO1A 1DBPA 1NJ5A 4XGNA 4JHXA 2Z5VA 5IZCA 1CJKC 1U0BB 5INTA 2I4RA 1LJ8A 2CL7X 3ICWA 1ZN2A 1Z73A 3AL3A 4IM7A 4EFKA 5BUSA 1XZDA 4RZIA 2RHOA 5LMNB 1LI5A 3B1FA 4AJ1A 1T43A 3L1VA 4OBBA 1TE2A 3PITA 3QENA 3J7TA 4UHJA 1XZIA 4U3JA 5BUCA 5FBHA 2F4VB 1EXNA 3DJYA 3IURA 2ZRNA 1SZPA 1CZHA 1LTKA 2FVYA 3K35A 3LW8A 1LH0A 2ATCA 3HRIA 3MD9A 2RC6A 4JKIA 3L8FA 1T3HA 5BSUA 3U26A 2VDOB 3ZY4A 5DT2A 2IZZA 1J39A 3QEOA 1CQXA 4HDQB 3WZLA 3JYPA 4UAVA 3N2GB 1UJBA 4K3VA 5DWQA 5A62A 1UP6A 3C3CA 2W37A 2HI0A 2PSJA 2DY0A 3L6UA 4WZAB 2NPOA 5BT9A 9MHTA 2BFMA 2PG3A 3KETA 1B0AA 4DLLA 3I12A 2AWNA 1PK9A 1GUYA 2JFFA 5TC4A 2ZQYA 3II6X 1E3DA 4UDXX 1KYTA 3BBPA 1HSOA 1X77A 4KEAA 1XZKA 1IPEA 4L9SA 4WI1A 3UICA 3I83A 3ZCRA 3B9BA 5CA1A 4S35A 1GL7A 1YL5A 3IPAA 3ZWQA 4LXYA 1X39A 3T0GA 1X7ZB 1Z25A 1OE0A 1Z0ZA 2FMKA 1KZ4A 2GVZC 3A6DA 3GA0A 4OLHA 4ND7A 5FL7A 5LOVB 1TZKA 5CHYA 1O94D 2GMWA 4B40A 4BOYA 1QYXA 2NVUA 5ALEA 4DABA 5BW5A 5JR3A 4OM7A 1M34B 4C5AA 1NBIA 5JWHA 2V8BA 1I10A 1IY9A 1CDEA 1V4NA 1ZXXA 5A4KA 2JIRA 3GLKA 2AA3A 5AUPB 2Y68A 1E61A 1BRTA 1NJ8A 3R44A 5KB3A 3BORA 2HLPA 3WGVA 2GCPA 2QD3A 1KQPA 5E4TA 2ZZMA 4J76A 2CKDA 2PL5A 2WTNA 4DSOA 1Z62A 4IDGA 2WMDA 4ZT4A 2J9YB 1CRQA 3OEHA 3A1EA 3IV7A 2WT8A 1X1DA 2DFKB 4O1MA 4RHTA 4EX6A 3HB7A 5HXAA 4DR5B 3FVTA 3RTEA 3SAJA 3KKEA 1Y7TA 1BROA 5ENZA 1JFFB 4WBSA 5G3ZA 3WYDA 1MKYA 4QYIA 3ZJ4A 4NAHA 1N6OA 2E49A 3P32A 4QPCA 1UMCA 4XD2A 1JDVA 2ZETA 2FWBA 5KX5A 3FOEC 1C8BA 1Q22A 4EB8A 1AV6A 3KQYA 2GLXA 4LHZA 1IXRC 3BWCA 4L50A 4C06A 1HWYA 2B34A 3PQ4A 1M2VA 2O8FA 4F9TA 2IPXA 3HJCA 4PINA 1IUNA 2Y4NA 1NPDA 4Y6SA 3DW1X 1DTEA 5IKXA 1FMFA 3LCVB 4FD2A 4X85A 3RO7A 2D06A 3MWLA 3PU6A 2X0KA 2ZJAA 4M9UA 3R76A 5A1TA 2I4MA 3PXAA 3TNLA 2JI4A 1N7HA 4HYEA 1Y3BE 1K7YA 4PIPA 4BNKA 2JF0A 2DU8A 3UGQA 4Y6RA 4CDNA 5LOVF 3AVYA 1W29A 2CFRA 4PYNA 4XUGB 1TYEB 4EUKA 1S8NA 4PXYA 3F5MA 4DM3A 4JLPA 3HGMA 4CL8A 3CBQA 5GINE 2ID8A 1D2NA 3OCJA 3VDRA 2VXYA 3UF0A 1EGMB 3UQYS 1OFUA 1ZKMA 3ZQUA 4ZKDA 1I2CA 2Q41A 1QHSA 2J0UB 3OLWA 2RFLA 3QFCA 4QBHA 4HZGA 4BC0A 4EHNA 3PSHA 5MF6A 3A70A 1JYEA 3P5SA 5B3JA 4XWOA 5DB4A 3GLGA 1WSAA 2WFLB 1SVLA 1KMHB 2H57A 5AOVA 4CV2A 3G8CA 3OOEA 2AJ8A 2FKAA 2PGLA 4IXWA 1CQJB 3B52X 4KGVA 3S68A 1I9GA 1VJ1A 3PPYA 4FDVA 4DT1B 3G7SA 1A0OA 2I6SA 3H3XA 3L05A 5GMOA 1OH6A 3DDZX 2PZBA 1IY2A 1CQZA 1FTNA 1LDNA 1QP4A 4RABA 3OPNA 1HRKA 1D09A 1VDMA 4TSFA 4D4HA 3PUKA 1F5NA 4HGZA 4QL3A 1J8DA 3Q7SA 3JQAB 5FPPA 2W6QA 4U6QA 4WD3A 2PIAA 4W5OA 1ODSA 4QPDA 4UMFA 5A1JA 2KQUA 5E2AA 3FWZA 2B5VA 3INRA 2FOIA 1KO1A 2HCFA 2MR6A 3NTOA 4G0OA 4QHSA 4XYGA 4DRXB 2DJ5A 5GIOE 2ZZNA 3DO5A 4M1SA 4BPRA 2IX9A 4B4OA 1MX1A 1HT1E 3EVNA 4B6SA 5AD1A 2CFSA 1XQYA 3KKZA 5TY0A 4KREA 1V47A 1PWHA 4YP6A 4II3A 2GVNA 2XWPA 3RS0A 5DTQA 3THYB 4NZOA 3RIYA 4DARA 1APBA 5FO1A 3ELYA 4EHBA 4HRYA 1LSJA 4W5RA 1GGJA 3ZCXA 3DDCA 4OQYA 2NW6A 3KOUA 2OBYA 5CH5A 1ZSVA 4EWLA 1PJ3A 3T9CA 4QA9A 3QLVC 1Q1BA 4LJ9A 1AU9A 4B83A 1YCGA 1IJKA 3GLUA 1DJPA 2BW0A 4PC1A 4D6PA 6CHYA 3DSRA 1GR0A 2PZ8A 3M6LA 4QREA 4ZVQA 4F2DA 2WVHA 2IDKA 4KYUA 2H2GA 4X5OA 3OY2A 2GO1A 5G2OA 5D3MA 3ZV5A 3WS7A 4C9BA 5CCXA 1ACJA 2CJWA 4V39A 1M2FA 1SBQA 1WWKA 2XSZD 1LZKA 2ZULA 3T5PA 5FJIA 4MR8B 1QO7A 2IODA 2BPOA 5ADWA 2AR9A 2MSEB 3GJ5A 1L2TA 3A4VA 4LBVA 1F2TB 1N6HA 4NULA 4X8HA 3N9IA 5J2UA 1ZOIA 3GCXA 3BMNA 3C87A 4LGMA 1UT6A 2DWUA 2XVYA 3OQPA 4UAUA 4EVQA 3T1HB 2CV0A 5TF4A 3TSAA 2AC4A 5K0SA 1SXJB 3I5UA 1RVV1 3KLBA 4MCJA 5EZYA 4C3UA 1FX0B 4OQ4A 2I34A 5A4JA 3VSEA 2GZ3A 5EMMA 3CLTC 2YXDA 2ZR8A 4HFNA 4EW6A 1V0JA 1M7GA 1Y34E 1I5RA 1SHJA 2RSLA 2WIJA 4MWZA 3AOGA 4PYOA 2FX3A 2PKXA 1TIPA 1XEWY 2DMRA 1YIAA 2IC5A 1U2DA 5J43A 2ZVJA 4OQZA 4ZMRA 1VE1A 1GPWB 3TQCA 3T12A 2D2VA 3MWKA 4E2YA 4F9FA 2WIFA 4NF2A 4LOLA 5JZVA 1K0FA 4C7KA 5HSGA 2RGCA 1O97C 2B61A 3DOEA 2ATEA 2A5LA 1IZ9A 4KAXA 4YCNA 3W7BA 5HJ7A 1B0UA 2YIDA 3I9KA 4GL4A 3SHQA 1ACMA 4D97A 2WQZA 3KQSA 1GRNA 3GWZA 1BJKA 4RMJA 2V4UA 4XZ3A 4DJ5X 3IEUA 1J20A 3LA6A 3RIXA 3W9BA 4IXTA 2H2WA 3OU7A 4EM6A 4TKVB 4R8RA 4DA7A 2CXPA 3AHDA 3E81A 3GZJA 2ZBUA 1JQ5A 1SELA 3EW9A 3TK1A 1M6HA 4Q4JA 4OHYA 3WRYA 3F7MA 3KZKA 3LIIA 5DW0A 3PR2B 2WUFA 2GR9A 1Y4DE 4DNXA 3ADPA 5HTOA 5K6TA 2AOUB 3A1FA 3UK0A 3KOYA 5CW2A 5B7QA 3T1QA 4BNJA 3TW8B 2HK9A 1AKTA 1XD2A 2CMKA 3F9RA 2GJAA 4FFBA 2V4ZA 3W6ZA 3LCUA 5LWQA 3FMGA 4FR2A 2QXTA 1LY1A 5DSTA 1TYCA 3SX2A 3NBXX 1XMPA 4MSUA 4Q9LA 4D9MA 3EISA 1CYDA 3UXYA 3TS1A 1I9CA 2HF9A 4ZCPA 1QRDA 1SOMA 4JT8A 4UQLA 1G3QA 1K08A 2XBLA 5FL3A 1F1JA 2RKWA 4CT5A 1XUOA 1CRPA 2BZ1A 1WZUA 3GGPA 2EBHX 2YDXA 3KQQA 4R3WA 4BQNA 5B55A 2PL1A 2CKMA 1SKBA 1N6IA 2R65A 4ZK2A 3BTUA 2F9LA 4KRXA 3WK5A 4X97A 5CXQA 4OXQA 1MX9A 4LJRA 3N3AC 1Z5ZA 1QE0A 3E22B 4HDRB 4HWPA 1QFYA 3NANA 1HTTA