1ZK0A

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
251
structure length
251
Chain Sequence
b'SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 100
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk0A00
4BNJA 4R68A 2H63A 3HZZA 2PD6A 3EMKA 1CETA 1ZCJA 3QVTA 3VKUA 1TT7A 3O4RA 4DC1A 4PZEA 5GZ6A 3ZHYA 1PS9A 1ZK0A 2IZ0A 5JO0A 1K2WA 1NHGA 3T7CA 5JCJD 3VTFA 4NU6A 4XKJA 2TMDA 1U3UA 2BLLA 2QZ9A 5DF1A 4BVAA 1H9AA 5TSDA 4WJZA 1W6UA 3BHMA 1EVIA 4U7WA 3JQFA 1P1FA 3BIOA 2B4TO 1A9YA 4IDBA 1UXKA 1C1DB 1KC3A 2PLAA 5ENDA 2VTEA 3PQDA 1GR0A 1JKJA 3K2BA 4WLOA 3FBTA 4D3DA 1D4FA 4OHUA 2YDXA 2C29D 1QSGA 2CD9A 2BH9A 4ND2A 2EW8A 3JSAA 1ISIA 3M6IA 2XOXA 2Y93A 1RPNA 1ADFA 3ASUA 1QV6A 1EK6A 1EFKA 1IUKA 1V3VA 4E2ZA 3GZNA 2C5AA 2DQ4A 3WGYA 4BV9A 5IZCC 3TF5A 4Y6SA 1T2EA 2E48A 3NAQA 4DBVO 3WMXA 2ZTUA 2G82A 3M1LA 5DT9A 4BNNA 1LDGA 2E6UX 3PQEA 3QSGA 2ZYAA 1PGQA 4E5MA 4RDHA 3JQ9A 1B7GO 1ONNA 4E30A 3QWIA 4GI2A 3D3EA 1XDWA 3QWAA 3WGTA 2ZTMA 3G3EA 2HJSA 4RLSA 1FMCA 1NVMB 3E6AA 1H2HA 2O4CA 5G4KB 4ZVVA 3W4JA 4IMPA 2QHXA 2CZCA 4QQRA 3VPSA 2YZ7A 1N7GA 1DB3A 4KTVE 2FY8A 4N5MA 4NBVA 4WKGA 4ZQBA 3ZWYA 1J6UA 2NTJA 2O2YA 5GZ1A 2CMDA 2QG4A 4FGWA 5IJZA 4DIBA 5KJEA 4JLWA 1GCUA 1X0VA 2VNSA 3VDQA 1XG5A 2GF2A 3FTNA 4HFNA 1XA0A 4DTIA 3U0BA 1LEHA 1U8FO 3HB4X 3GHHA 3DBLB 3EVTA 3MJCA 1SOWA 1T2CA 4FFPA 1Z6ZA 1ORRA 2PV7A 4YT8A 1GU7A 4N5NA 4U0KA 2JCXA 4UVDA 1E7QA 5JAIA 4R4JA 4PLTA 1JDJA 1AE1A 4E4YA 5AYVA 5B37A 1ZJYA 5G0WA 1ZSYA 1DSSG 1HDYA 1E3IA 3AOEA 1DRWA 4DYDA 2YV2A 4IUYA 2PH3A 4BO6A 3OJFA 3P2OA 4CODB 5BQFA 3LDHA 4UVGA 3RC2A 1NYTA 3V1TC 2Q2WA 1F14A 3B1FA 1I2CA 3JQEA 4GAEA 1Y6JA 3L9WA 1SC6A 5JS6A 3S1LA 2IEDA 3GPIA 4FJ0A 2GUGA 2VT2A 2I3AA 2VCYA 5ILGA 2EW2A 5BSHA 4A26A 3KVOA 3RSHA 4OXYA 5I9NA 4K6FA 3JTMA 2OZPA 2H9IA 3ZV5A 1YL5A 3ANNA 2NUAA 4FDAA 4XDYA 1PL6A 3ZNQA 2Y99A 3RASA 5THKA 5BSGA 1ULSA 2X5KO 3O03A 4IGEA 1FK8A 4LGVA 5G0SA 1Y8QB 1JKIA 3DBRB 1CDOA 4YACA 2Y67A 3I9MA 4BNMA 9LDTA 2JKVA 3B20A 1E6EA 3RFXA 4CM9D 4S1VA 4CV3A 1R66A 2FR0A 5KVCA 1SEVA 1C3VA 2PA3A 4DIOA 1F8GA 4JBIA 1C0KA 5G0VA 1EUCA 3KSDO 3OJLA 3R3SA 1U3VA 4J2HA 1T24A 5T8KC 3UF0A 3F3SA 3VHRA 3BA1A 3JD1A 4IXWA 3M1AA 2NQTA 1A5ZA 3MJEA 4HP8A 3ZWMA 2UUPA 4AJOA 1AXEA 4Z9XA 4ILKA 2WJPA 1ADBA 2JHFA 2ZTVA 3S2FA 1GPJA 1XKQA 1HRDA 3V1YA 1Q0HA 1YQDA 3DBVO 3DWFA 3GN2A 3VVCA 1VE9A 3TJRA 3DHEA 4TRRA 4G81A 1IOLA 5IDXA 1XYGA 2EV9A 4KQWA 1Z75A 5CHEA 5BR7A 5KCZA 4U5QA 4YWJA 2GDZA 3R3JA 3OA0A 4JXKA 3TZKA 1PQPA 4W99A 1VM6A 5BNFA 3ZU5A 1F12A 5JCXA 2ZCVA 3KV3O 4IINA 3I1JA 4KMSA 1LSUA 5L9AA 2ZTLA 1NAHA 2V6FA 5H82A 1LJ8A 3L9XA 2AEMA 4MVJH 3GT0A 1XU9A 3B1JA 2ZATA 4WCDA 5DOVA 4CR8A 2RHRA 4EW6A 4A7PA 1R4NB 4INAA 4K9DA 4BQRA 1R16A 2X0RA 2GZ2A 4TZTA 3KXDA 4BNVA 3F5QA 5AXCA 3H8VA 5A06A 2RCYA 5HBRA 4ZA2A 4PLCA 4GVLA 5JC1A 3HDJA 3PWZA 1DFIA 3AY3A 1AXGA 2O3QA 3BAZA 3IKVA 4J4BA 1K6XA 2ZJ1A 3ADOA 3ABIA 3ZHZA 4E13A 4PLVA 4LRSB 4XGIA 3PFWO 3VVBA 5IZCA 4CL8A 1U3TA 3EK2A 2HUNA 1D7OA 1CYDA 1T1RA 2DVMA 1PQUA 4CLDA 2C59A 2RAFA 4BKPA 3DZGA 4YJFA 3L6DA 4FFNA 5FF9A 4XRGA 1UJMA 2WDZA 3RWBA 4NK5A 1VKOA 4PG7A 2G5CA 1DXYA 1IE3A 1XR3A 2HLPA 4YQZA 1LDEA 3H2ZA 4GPD1 3GG2A 1B15A 1Q0QA 4DMLA 3DHNA 3K9QO 1UP4A 1U4OA 2ET6A 3UW3A 4BO0A 4XDZA 3U4CA 1I10A 2FSSA 2HU2A 1W4ZA 1LLDA 2BKAA 4J1TA 1LBEA 3ZHBA 2CY0A 3PHLA 3PZRA 4BO5A 3HG7A 4L76A 4FOOA 2R2GA 2A94A 3UAGA 1NQAO 2UVDA 1T2AA 1KY5A 2A92A 2GO1A 5A9RA 1YO6A 2J5RA 3BZUA 4O0LA 4XQEA 4M1QA 3H65A 5L7WA 1R12A 1VC2A 2OL4A 1HYGA 5KWEA 4RF3A 3DMYA 4ALIA 1UP6A 3AI2A 4XB2A 5JCJA 4Y67A 3L77A 5L7YA 7MDHA 4DYVA 4RPJA 3Q2IA 3DMTA 3UXYA 2DU8A 1Y8RA 4H3VA 2GN6A 2DFVA 2Q45A 3H4VA 4XYGA 4DVJA 1O0SA 4E21A 6LDHA 4HWKA 4WLNA 3C3XA 1UZNA 2BMAA 1DIRA 1DHTA 1UXJA 1P0FA 2NM0A 4ROSA 5L4SA 1NWHA 1BWSA 1FDUA 4CMJA 2HAEA 4UAGA 1H6CA 4RLHA 1C0IA 1J0XO 1N92A 4FN4A 4DBZA 2NLOA 2EJWA 3ZWOA 1QP8A 3TWOA 3A14A 2D2IA 4E2WA 1ENZA 5EMHA 4AJPA 1YJ8A 3NYWA 2XF8A 3GNTA 2BELA 4J3FA 3ST7A 3TL2A 1YS4A 4EUFA 4YXFA 3NJ4A 3A1NA 3ZNOA 1YL7A 5LDHA 3IOYA 1E7WA 1HYEA 3WQSB 1U7TA 3WSWA 3HN2A 3DAFA 3OM9A 3IKTA 3OH8A 3FSRA 3AU8A 2AG5A 3EDMA 3VPFA 2E49A 1DIAA 4ZGWA 2C54A 1DFHA 2G0TA 3S2GA 5A3VA 3ZWVA 2VHXA 3I4CA 2W2LA 1WPQA 4U6QA 5ILOA 2OFPA 1HDXA 5K6AC 2DC1A 5C37A 2IODA 2ILTA 1ZH8A 3PIIA 3AW9A 4NFYA 4DA9A 1ADCA 5IXYA 1RYEA 2VYND 4CM4A 3OFSA 3Q9UA 4FS3A 1ZIDA 4MIEA 4ZHSA 3K6JA 2VZ0A 4NMHA 4CV2A 2Q4BA 2JFGA 2AE2A 1J5PA 2OUIA 1LDMA 3GEMA 3W8FA 2VN8A 3FPCA 4ZQEA 1I01A 5LCXA 3JYNA 2V6GA 1H6DA 1ZXBA 4FFMA 4LCEA 3VPHA 1AHHA 3TNLA 3JQ8B 3GMSA 5MDHA 2AQIA 1ENYA 1OZAA 3WIDA 1U2GA 1E7RA 1XEAA 2V7PA 5B4UA 3P2YA 1CRWG 4CLHA 4MP8A 3CE6A 4C4OA 5CP8A 3UKOA 1QV7A 4E5KA 5A9SA 1HDZA 1N1EA 2I66A 2VHWA 2YQ5A 3E18A 3G17A 1SNYA 4Z3KA 1GTMA 5L95A 2R6JA 3T4EA 3PWSA 4FGSA 4UEJA 1YOVA 1UP7A 1OC4A 3DOOA 3QWHA 4E12A 1CEQA 1YB4A 1BW9B 1VJTA 3AOGA 4EUEA 4EEZA 3HN7A 3WFIA 2Y0CA 2QQ5A 1HWYA 3CSDA 1F0YA 4AL4A 5CEFA 4GWKA 3HB5X 1C14A 3VPGA 2W98A 2BF7A 3PPIA 2UAGA 1AGNA 4LK3A 4BO4A 3SVTA 1CERA 4FFRA 3KHUA 4E5NA 3O38A 1K3TA 2Y66A 5U1PA 2NTVA 4DPLA 3GR6A 2I99A 5GZ3A 4LVUA 3JYOA 2Z1NA 4XIJA 1EVYA 3L4BC 3JCZA 4F6LA 1C1DA 1DDOA 1KS9A 4QFDA 1L7EA 2WEKA 3CXRA 5DULA 5TJ9A 4I1IA 3LSYA 1SPXA 4IM7A 3PVZA 3VZQA 4CM8B 1U8XX 4NZ9A 1MB4A 4YBZA 5F21A 3C85A 3VKVA 3IP3A 2I76A 5A04A 1DOHA 4CMHA 1IZ9A 4BGIA 1E6UA 3ETGA 5F5NA 3QLJA 1NWCA 5CPFA 4TQGA 5B4VA 2FR8A 4J43A 1X1TA 2GPTA 2X86A 4WLFA 4GL4A 4XA8A 1UXHA 3Q9NA 3MCVA 4P22A 1A7KA 1LLCA 1KVTA 1UDCA 1LXCA 5TQVA 1O89A 4JP2A 2NSDA 3AM3A 1MLDA 2POQX 5ICSA 1LI4A 2X7HA 1UAYA 2P9GA 3NRCA 5JXWA 2Y1GA 1WMAA 4E31A 4F3YA 1Z7EA 4NQZA 5G4KA 2J5KA 1MGOA 3DL2A 4DIFA 4E32A 3LT1A 4GGPA 4DQVA 1NTOA 1NNUA 3K5PA 1GFSA 1R4MA 3NTQA 3UH1A 5JY1A 3FNGA 1X1EA 3FI9A 2DBRA 3RBXA 3W4IA 4KUHA 1X0XA 3N74A 1NFQA 3D3WB 4WLVA 4RPLA 5A03A 1EDZA 4OSOA 2I6TA 4IZIA 2F1KA 1AUPA 3IP1A 5G0TA 3WGOA 5AQ1A 3ICPA 1Q7CA 1YGYA 2YW9A 3RUHA 1IHYA 1EFLA 3DFZA 4CM5A 4E6PA 3GMDA 1HTBA 3UHAA 3EZLA 1BG6A 2VUUA 1FXSA 3GGOA 5JAZA 8ADHA 1ZVMA 1VPDA 1OBFO 1EUDA 4LMPA 4OL9A 2IXAA 1AN9A 2DKNA 2X0NA 1DC3A 2A4KA 4OSPA 3EZYA 5T5QA 3ZV6A 2H6EA 3GNSA 3GK3A 4FJ1A 1NVGA 1XGKA 3NJ8A 1MC5A 4KP7A 4NNJA 1WDKA 2GZ1A 5K6AA 5HA5A 1X13A 3INTA 2GN9A 3GY0A 1HT0A 3QIVA 3PIDA 4C7JA 1P74A 5F1KA 3WBBA 2EHDA 1MXFA 4MVJE 4RORA 1ZEMA 1LRLA 4Q3DA 2J6IA 2Q1WA 4BNGA 4CQMB 2PY6A 4TVBA 3LVFO 1E1KA 3OETA 1WWKA 1Y8QA 2JD1A 3DBRA 4HADA 1I0ZA 3U62A 1HE5A 4L0QA 2PKQO 4OKNA 4J16A 3MOGA 4I5DA 3EUWA 4XYEA 1IZ0A 2ZQYA 2I67A 2VHZA 2VWQA 3DC2A 2D4AA 1ENPA 2QX7A 1NQTA 4WUVA 3E1KA 1T2FA 1M2WA 3IUPA 2ZJ0A 4JROA 4DLAA 2AW5A 2LDBA 3QWBA 3I3OA 4MVJD 1HE2A 2Y68A 2WYWA 3VTZA 3I9OA 4HY3A 4AJHA 4GGOA 4IDEA 1F17A 5DCWA 1EBUA 2O48X 4ZQFA 3JQAD 5KJCA 1E0DA 1YBMA 4QSMA 4F45A 3HHPA 3L6OO 4XIYA 4K1LA 2PH5A 2J3JA 1LLQA 2ZB7A 1P1IA 3G79A 2BGKA 2X5JO 3KBOA 1JTVA 4CLRB 5K9ZA 4A0SA 3MJSA 5KTKA 3IIEA 1BSVA 3DBHA 3GGGA 3O8QB 4ALKA 2PKRA 4PZDA 1KERA 1GL3A 3L4BA 5AVOA 1LDNA 1HKUA 5U4QA 1B3BA 2O2SA 1LTHR 1DRUA 4CR7A 1T2DA 3VH4A 4YVFA 4ZQGA 3TQHA 1BHSA 1NQOA 3H9UA 2PD4A 1G1AA 2D3TA 2FMUA 4ZU3A 1N7HA 2WWRA 4MPDA 3FF4A 3GGPA 1NFRA 2P9EA 2RHCA 4P38A 1PQWA 5CPBA 3WTBA 4BNZA 2AHRA 3HSKA 3NTOA 4FB5A 4RVUA 2BI7A 5TT0A 1JQBA 4NBWA 4U8GA 1MP0A 2PGLA 2BFAA 4DPMA 1DIBA 3JD4A 3KB6A 3I9KA 3OIDA 4R5HA 2Q46A 3PI7A 5ER9A 1KEUA 3FWNA 4XQ9A 1H6AA 3N58A 4CL3A 4TKLA 4H15A 3ETEA 4MVJP 3S2IA 3WDSA 1ZSNA 2B36A 3WGQA 3NDRA 3OQ1A 3WMWA 3U4DA 4DXHA 3PJGA 4CM3A 3ENNA 4JP3A 5GMOA 4FD3A 3FNEA 3E5RA 1N2SA 1Y5MA 1LC0A 1SCUA 5A5FA 4O1MA 1GUZA 1F06A 1QKIA 1TT5B 2VWHA 3FCOA 4PG6A 4YJHA 4J2OA 3ULKA 3UCFA 4CV0A 4A5OA 4EYEA 1YVEI 4YCAA 3F47A 1ZMTA 2QZZA 1D1TA 1ZZEA 2FHSA 3GEDA 5JPIA 2X1HA 3NDIA 4GSKA 1IPFA 5IF3A 1MUUA 3K8ZA 2WYUA 3F4BA 1P45A 2PD3A 1U3WA 2VUTA 4MIYA 1E7YA 2FPPA 5HS4A 3DZBA 4AJ2A 1SOVA 4B4WA 4O5OA 4XB1A 4NJOA 3V1UA 4B79A 4NDNE 3G1TA 2DUWA 4ZRMA 5A3JA 2CVQA 2HMTA 1XQ1A 1A72A 3GUYA 4QFCA 4RJTA 4Y98A 5TC4A 4NPCA 3K92A 4IQ8A 5AXDA 1PGOA 4R16A 3RUCA 5JAMA 3DOJA 2Y1FA 3BTUA 4J7CA 5JO9A 4DMMA 4XR9A 1RYDA 3INRA 4FC6A 4UVEA 2W2LD 2VQ3A 1E7SA 4Z6KA 3VH3A 2CSUA 2J5QA 2GCGA 4FW8A 2BHLA 3FHLA 4L74A 4CLOB 4ESOA 3H9GA 1NXQA 1XCBA 2OORA 3ONEA 2E37A 3WSVA 1G0OA 4LVCA 3WLFA 2GNAA 2VOEA 4W9NC 3I5MA 4NG5A 5AOVA 3CINA 3NT5A 3JQBC 2AA3A 4RZIA 3R0IA 3OBBA 1P44A 4D0SA 1I30A 2HMSA 2XAAA 4JJIA 1K6IA 4WE3A 4M89A 4AICA 2JHGA 3PHIA 2HMWA 3BMQB 2IRWA 3KUXA 4PRKA 2GRAA 2PZMA 4IJVA 4Q3EA 3OP4A 3CMCO 3KEQA 3R6DA 3H9EO 4AJEA 3PP8A 4A2CA 4IY1A 1I2BA 2GGSA 3GHYA 1N1GA 1XWFA 3AK4A 5COBA 1HE4A 3WYCA 5C7OO 1O8CA 1PWXA 1PL7A 4HFMA 5JBIA 3MOIA 4ONEA 3ZWNA 2G76A 3MZ0A 1TA4A 4CMIA 4HX5A 2SCUA 5AXAA 2YDYA 1V35A 2C7VA 3WIEA 1P1KA 4P4GA 4BGVA 1R0KA 2AQ8A 2FN7A 4NK4A 4CV1A 3AI3A 3DXFA 4DRYA 2AQHA 3BMCA 3WLEA 3UUWA 2Q50A 5EINA 3E8XA 4CMBA 4XEHA 2V6MA 1YB5A 1DIGA 2ZYDA 4N54A 4YT5A 2B0JA 1S7CA 4LSWA 1SO8A 2Q1SA 4Q3NA 3KLMX 3ITKA 4J1SA 1JA9A 2AG8A 1D1SA 1CIVA 3E03A 3DDNA 1DLIA 4J9VA 1LX6A 3ROKA 2WD8A 3RUAA 5KJ1A 1UR5A 1O95A 4D45A 4JIGA 4CQLB 4Z9FA 3N7UA 4YPOA 2PTGA 4CMEA 4NBTA 2H5LA 5JMPA 4PLFA 4ALJA 3GNQA 1GEEA 5DZSA 3RU9A 1Y5RA 3LK7A 1P1JA 3Q11A 4FOSA 4NJMA 4XWYA 1NX6A 1QYXA 2CDAA 4J1NA 4PRLA 4K28A 5DP2A 1TXGA 3A06A 2NTNA 2GR9A 2J8ZA 4YJDA 3BMNB 1BXKA 1X7DA 2XPCA 5B12A 3A4VA 1E3JA 3ROMA 3PWKA 2NVUB 2JFFA 3JD0A 3OF2A 1IHXA 1Z82A 4A27A 5ES3A 4Z0PA 1E5LA 1KOLA 3FNHA 4I08A 3QP9A 5BNTA 3OQBA 1N8KA 2E82A 2P91A 4G65A 4I9NA 4KUEA 4XZ3A 4RGBA 3ASVA 3D4OA 3OQ6A 1BVRA 1EMDA 3PYLA 5FFFA 4CM8A 4PLHA 1R6DA 3OIFA 2OHXA 1QXSA 2F00A 4RPGA 1EDOA 1BRMA 1NM5A 1LSOA 1DRVA 3KYCB 5F5LA 3RVDA 1T4BA 4ID9A 4BHTA 1U28A 4MVJA 3UICA 3VZSA 4BGEA 3D1LA 3GVPA 4Y9DA 3C1TA 3A9WA 2FOIA 3JQAA 3TOXA 3NTRA 5I9LA 5A5EA 3EW7A 4WCFB 2X0JA 4Z9YA 5G4LA 3AU9A 2GN8A 2Q1UA 2NU8A 2Z95A 4PG8A 4R54A 1JAYA 1NASA 4J6FA 4QECA 4XX0A 3ZV3A 4XYLA 4ALLA 1IB6A 1PSDA 1Z7BA 4MKXA 1NQ5A 1TEHA 1CJCA 2PGDA 4JBGA 2FSVA 3EGOA 4FJ2A 5KJ6A 4BNHA 5CAEA 2HK9A 5H83A 1P33A 3JQ7B 3GFGA 3U09A 3F46A 3BMOB 4XJSA 4CM1A 5IG2A 4YEDA 1MC4A 4HFJA 4YQYA 4WASA 1ZK2A 3WICA 1XU7A 1X7GA 3KYBA 2Q99A 2PZKA 1A27A 4BO1A 4IIUA 4MIOA 2FPIA 3G1UA 3GUCA 3IAHA 4J0FA 5CDGA 3AY6A 4FCCA 4W9NA 1GV0A 1ZO8A 3SX2A 3AM5A 4W6ZA 5I7VA 2VT3A 4EUHA 4IMRA 1HXHA 4L4SA 1N5DA 4W7HA 1KEWA 1IPEA 1PWZA 5DN9A 5L45A 2IZZA 3ZZNA 5A9TA 5A4DA 1TLTA 1FF9A 4BB5A 1OI7A 3MJ4A 3UCEA 2D1YA 3IS3A 3T4XA 4Q9NA 2O23A 4R41A 4BNLA 3GDGA 1YBAA 4LMRA 5ITVA 2Q4EA 4BNFA 3GF4A 1BXGB 4FFOA 1NHWA 4RZHA 1LDYA 1ENOA 2BGMA 5HM8A 4O59O 3WS7A 4B3HA 1ID1A 1PL8A 3R1IA 1XELA 3DO5A 3BHJA 3PYMA 4BB6A 4PG5A 3ZHXA 1AHIA 4CQMA 1PZEA 2GERA 4BNYA 3JYPA 3GZ4A 1KVUA 6ADHA 1MA0A 2G17A 4HNHA 1UXIA 3UN1A 4DPKA 4E2XA 4YAIA 5C5IA 1HZZA 1XIVA 3ZU4A 1R15A 4CM7A 4ZJUA 4J91A 3WYEA 1BVUA 1EQ2A 1ISHA 4GWGA 4FBGA 4RVFA 2DUUA 1I32A 1BTOA 1DPGA 4J4HA 2P2SA 4P8RA 3QVSA 4GLOA 3JV7A 3W6ZA 3IQDB 4ZN6A 4DC0A 3D64A 1W0CA 4BO8A 3NUGA 2O3TA 2DBVO 3KYDB 3ZCXA 4R5MA 1K0UA 5T8KA 3H2SA 3KSUA 2AEJA 1Q2XA 2BRUA 2P9CA 2HDHA 3KSZO 5KKCA 3H3FA 4NBRA 4OQZA 1CWUA 4I9HA 3F1KA 2ZB8A 4QEDA 1P31A 3U49A 3WR5A 3TZHA 4D42A 2ZK7A 1CQJA 1QLJA 3VDRA 2CUKA 2QRLA 3PQFA 1E1MA 2VHYA 1TVEA 3SXPA 5FWNA 3DAGA 2I9PA 4U6SA 3GDOA 3ZW9A 1EBFA 2VUSA 4MVJF 4O6VA 3E5MA 4RV9A 2P68A 4UVHA 2B69A 2YJZA 1NFFA 5C3MA 4QO7A 3ANMA 2JAPA 3AM4A 2EF1A 5CDSA 2EGHA 4OOEA 3H3JA 2FRDA 2VOJA 4BNUA 4AVYA 3C8MA 4RQUA 3B1KA 3SBOA 1LDBA 4UEOA 3T7EA 1LRKA 3GN1A 3RKUA 3Q2KA 4J9UE 1ML3A 1B8PA 4MVJM 3WGHA 4X54A 4RDIA 1RM4A 4WEOA 3QW2A 2X22A 3ZWWA 1I3LA 1DIHA 1HLDA 2Z1MA 3FRJA 3H9JA 3TZCA 3ZWAA 4ALNA 5KNLA 2NADA 4J1QA 3ADPA 1XHLA 3DR3A 5F3RA 3WNQA 1I3MA 4B4OA 2Q3EA 5I7EA 3P7MA 3FWZA 4ND5A 4L75A 2NVWA 4OM8A 3QY9A 3OJOA 3IUSA 3UGKA 1KC1A 1HETA 2UUOA 4PZCA 1IL0A 1EUZA 4TWRA 1DJNA 1H2BA 1S6YA 3DZJA 3ROPA 3S55A 4LRTB 3Q0EA 3RUFA 1ISMA 3RJ9A 2Q49A 2CFCA 4N7RA 3ON5A 2HSDA 3F1LA 1BDMA 4GBJA 1DAOA 4R01A 1NPTO 3KOUA 3BTVA 1WDLA 2HK8A 4H7PA 3I4FA 2EP7A 4ZRNA 1KBZA 3K30A 2D0IA 1T25A 1U5AA 4WCFC 5EESA 4TKMA 3A28A 2PZJA 1K6JA 2OBYA 2YY7A 1HZJA 5JAQA 2IZ1A 3ANLA 3H9QA 4DWVA 1RJWA 4MDHA 2NWQA 4FR5A 3LZ6A 5L51A 3RIHA 4U0JA 2FR1A 1I2ZA 3HWRA 2EP5A 1GZ6A 2Y1EA 3I23A 2EIHA 5T6BA 1HDOA 4NHEA 4IDFA 3I9JA 5KVSA 2ZCUA 2HMVA 3PJEA 3P19A 4EDFA 3X2EA 2HK7A 1ZKMA 1V9LA 3QRWA 3ZNNA 3ZV4A 4A73A 5F1PA 3D5TA 3IMFA 5JYEA 4DL9A 3SEFA 3TFQA 2WSBA 3H5NA 2RH4A 3I52A 1DC5A 2JCYA 3INGA 1JLLA 2Y05A 4G2NA 1O5IA 3ROQA 1C1XB 2NVBA 3BTSA 5BT9A 4CLOA 3U4IA 8LDHA 2RBEA 3AUSA 2UV8A 3HUDA 1ISFA 4JK3A 4XQCA 1D3AA 4D41A 3RKRA 1PJ4A 4L4XA 1DC4A 3AUUA 4BMVA 1IY8A 3DBLA 1N9GB 5DCUA 2WD7B 3JQFC 3EY4A 4YJFB 1GQYA 2ZKLA 1JU9A 3U3XA 4AJKA 4DUPA 5EJ2A 4P4NA 1Q7GA 1W8DA 5KIAA 1VKNA 1KETA 1Q1NA 2FWMX 5DNAA 3DZFA 4KDEA 3TOZA 4YYZA 1RM0A 3MWEB 4D46A 4YB8A 3WYBA 4DQUA 4PLYA 1CQIA 1LU9A 3HNPA 4QUKA 4OIMA 3W8EA 5LDGA 3E48A 5T67A 5IDYA 1E1LA 3Q6IA 2R00C 3JD2A 5G2OA 1JW9B 4Y6PA 2P4HX 3QVXA 3NT4A 2WTBA 1EVJA 1E7MA 4IXTA 4GX1A 3IDSA 5JFOA 1QMGA 3F6YA 2X4GA 3AUAA 4I5EA 4XRRA 4YRDA 4RVHA 2I3GA 5GY7A 5TF4A 4EBFA 2HMUA 4GQAA 4EJMA 4BKRA 4UUPA 3BHIA 1WP4A 2XXBA 3WQQA 4BNKA 4GMFA 1X7HA 4XR4A 4JN6B 4BGUA 4WPGA 5JW6A 1JN0A 3NDJA 4YAEA 4XGNA 4GX2A 5HS6A 3RBVA 4AJJA 1KEVA 3HADA 4WGGA 5IXSA 4PCVA 1QYVA 4IDAA 5G0UA 2FPGA 3O26A 1DO8A 1RKXA 5EIOA 3W4KA 4RVSA 4TRMA 1ZW1A 3PFFA 4BO9A 3BMNA 1PS0A 2PFGA 2PK3A 3W6UA 4CMCA 2X5OA 2EERA 3L0DA 4NR0A 3DONA 1ZNQO 5DBGA 3QJ5A 4GMGA 1NPDA 1O94A 3HDYA 1B0AA 4IS2A 4IS3A 4BKQA 4E3ZA 4OKIA 3CH6A 4B8ZA 3WXBA 4W82A 5I8WA 3DZHA 4HKTA 3PXXA 3Q1LA 5EERA 2J3IA 2EG9A 4JCOA 4D0RA 2PWZA 1ISJA 3FTPA 4YJGB 2DFDA 1E3WB 3DZKA 3L07A 4WOKA 3DOCA 3JQDA 4RVGA 1M66A 3ZWPA 4YA6A 5F1OA 2OBNA 2G1UA 5C7LO 3DZIA 1B8VA 1U2DA 1VJ0A 1E1NA 2WE8A 1QR6A 3ZH2A 4B4UA 1R4NA 2YHIB 2BFPA 5AXBA 3AI1A 2VNAA 3GVCA 3PRJA 4OYRA 3OA2A 3NGLA 2Y1CA 1VLLA 4IBOA 4NBUA 1J49A 1DAPA 1DBVO 2W2KB 3SC6A 3V2HA 4CM4B 2X0IA 3RAJA 1PGJA 2YFQA 3PJDA 1OOEA 2B5VA 3D0OA 2DPGA 3I6IA 4II3A 2PZLA 1W73A 3PGXA 5ENVA 3I9LA 1YDEA 4IDCA 2JD0A 4RF4A 4PN3A 4Q3BA 1SZJG 1YDWA 2UDPA 3ICCA 3HQ4O 3C7AA 3KEOA 1JWBB 1F8FA 1GYQA 4Q39A 1YE3A 4QTZA 4CJXA 1I33A 1ULUA 5ADHA 1QYDA 3JQCA 4MP3A 1B14A 4XYBA 5FI5A 4H16A 5A9SB 5U9CA 1GQQA 1K89A 3SLGA 3IJRA 2OXIA 2QYTA 4R1TA 5IDQA 3QHAA 1E3LA 2WYVA 1J4AA 5A02A 5DCYA 3WJ7A 4CUZA 2IDZA 2HO5A 4CM6A 4PLPA 4BOYA 4EI2A 1ARZA 4AJ4A 3EVNA 5BNIA 4TRJA 2B5WA 3RROA 2O3RA 1UAGA 5JY6A 3QE3A 1GUFA 3B70A 4JGBA 1GD1O 2ZB4A 5THQA 1ZK1A 1Y1PA 4CQMD 3SC4A 2NQ8A 3SJUA 5JC8A 1I8TA 3AFMA 2C82A 4IQGA 3LLVA 1PGPA 1NPYA 2RH8A 4IDGA 2YV1A 4LCJA 2CVOA 1SB9A 3NEPX 2IYOA 1JWAB 3C24A 2W8ZA 2C5EA 1DLJA 4YAGA 1ZK3A 2IEBA 1DEHA 4PIVA 1QORA 4PGFA 3HE3A 3FPLA 4GKVA 4XD2A 3QA9A 2HJRA 3RC7A 1BXGA 1WAMA 3ZW8A 4CR6A 4E5YA 3G0OA 1GZ4A 3LQFA 3OJEA 4DGSA 1IULA 1DHRA 3PZBA 2R00A 1NBOA 3MJVA 5TX7A 2EKQA 2O7SA 1M6HA 3M2TA 3P5SA 4JJFA 2BGLA 3D4PA 3DHYA 2EGGA 3FR7A 1ONPA 1YRLA 1Q7BA 2X23A 1WVGA 3GRKA 5CDUA 2VTDA 1ZMOA 3DAPA 4E2YA 3LC7O 4M54A 1YH3A 5CEJA 4G5HA 1ISGA 3I6QA 4YRAA 5TLSA 1KY4A 1KYQA 3GC6A 3I9NA 3HDQA 2CDCA 2HKIA 1R4MB 4ITUA 4CPDA 3KYDA 1BMDA 1WW8A 1ZUD1 2CDBA 2EKPA 3GA0A 1YL6A 4AFNA 3GG9A 2VRCA 2WM3A 1Z74A 3ITDA 3EYWA 3GVHA 4KOAA 3UCXA 2FZEA 1ZFNA 1E77A 3NGXA 2Y1DA 3JQ6A 2YFHA 4QXMA 3WG9A 4JBHA 2NV6A 1DC6A 1M67A 5TNXA 2O3UA 1PJLA 3TN7A 4CUKA 1QYWA 2NU6A 4FQ8A 1PR9A 2DT5A 4BL5A 4JX8A 3DMTC 2QIOA 3PDJA 1HLPA 4WLUA 1I36A 1P0CA 1MX3A 1PX0A 2C2YA 2JCVA 5KVVA 5CDYA 2OP1A 2QRKA 3JQ8A 5IZ4A 4M55A 1A4UA 1U9JA 1E5QA 1P1HA 3L6EA 2ZIZA 1H93A 5FYDA 4YAJA 3TRIA 1H9BA 3TZQA 4GKBA 3OJ0A 1B3RA 3CZRA 4YDRA 3CIFA 2DLDA 2B4QA 1JAXA 1HF3A 1KVQA 3JQGB 4DLLA 1MXHA 4LISA 4MKZA 3KZVA 3NT2A 4GX5A 4NFSA 3ZNPA 3WBFA 2O3SA 4AJLA 2EXXA 1BW9A 4FSHA 1SAYA 5EPOA 4QO8A 4FPXA 3SJ7A 1MG5A 1QYCA 1WZEA 1DJQA 1P9LA 2LDXA 1KIFA 1OAAA 3GAFA 5DBIA 1NAIA 3QVOA 2IXBA 4YR9A 1SEPA 5TRTA 3MWDB 4RL6A 2OMEA 1L7DA 3RCBA 3OECA 1G0NA 1H94A 2PGJA 4N5LA 1HDCA 1Y9EA 1VL6A 5IN5A 2A9FA 4UUNA 4CMKA 1JKFA 4UUOA 3ENKA 1PJBA 4D44A 4CUJA 2O3JA 4HUJA 4J0EA 1A7AA 4XQGA 1X14A 5FEUA 3OEWA 3WGGA 1LC3A 3RI3A 3WX0A 2I65A 3ZWCA 3JYLA 2DTEA 4EEXA 1FDSA 1MFPA 1V3UA 2GYYA 4K26A 1P1RA 4QX6A 2VYVD 3VPXA 3WOHA 3DTYA 3EHEA 4B7UA 2HRBA 4OGWA 4YAKA 3Q3CA 2X9GA 2ZYGA 4XCVA 4LW8A 4R3WA 4B7CA 3GAZA 4D3FA 1GYPA 5JSFA 3WQRA 1PJ2A 4Z0TA 3C7DB 3E9QA 2X58A 3K2EA 5JYDA 1PGNA 4OXKA 4MVJI 3QVWA 3K73O 1HSZA 3DBHB 4KUGA 2NACA 1BGVA 5HWSA 4TMFA 4NU5A 2Z5LA 4F46A 5CG1A 5JLAA 1LUAA 3K31A 2AXQA 1E6WA 2EEZA 3L4SO 1C0PA 3K96A 3VH2A 3ZWXA 3UFXA 2IE0A 3PHGA 4ZQHA 4PVDA 1Y9AA 3WWYA 3PDUA 2D5CA 3WJAA 4KDFA 2NU7A 4BS9A 1EQUA 1C1XA 1RWBA 2NNLD 1GDHA 2B83A 3D3WA 5TS3A 3LT4A 2C0CA 4Y8VA 1MV8A 4MOWA 9LDBA 2Q2VA 3PGJA 3EC7A 3VC7A 1N9GA 5B1YA 2QRJA 2WD7A 5BSEA 2HCTA 3WB9A 3RC9A 4B7XA 1KVSA 2Q2QA 1P3DA 3BTOA 3PK0A 4L9RA 1VSUA 4Z3DA 1D8AA 2CF5A 2I5PO 2VRBA 3FR8A 5I8ZA 1UUFA 4I9UA 3ZU2A 1YBVA 3UOGA 7ADHA 4KWIA 1GCOA 5H81A 2NU9A 2X8LA 3CMMA 3JQBA 4LSMA 4Z0HO 4WNCA 4ND1A 3LLSA 1LQUA 1NP3A 2JFHA 1A71A 1EE9A 1MFZA 1PJTA 2BFOA 1EE2A 2BD0A 2GZ3A 3CUKA 4RPHA 3CTMA 2FZWA 1ZSVA 3CKYA 2JL1A 1L1FA 5FI3A 4AJIA 3FNFA 3MEQA 5EL0A 3TSCA 2V65A 1PS8A 4MINA 4EJ6A 3DQPA 3HJAA 1H0KA 3GFBA 3MJTA 4GVXA 5B4TA 5BSFA 5A1TA 4YJHB 4MO2A 3GZNB 3F9IA 1A4IA 1OC2A 5T57A 1B16A 3ZU3A 4ZICA 2JAHA 4MJLA 2WE7A 3HFSA 2YUTA 1UH5A 1V3TA 5CDTA 1CF2O 3RBZA 4D7AA 4UREA 4OMUA 4F6CA 4RVDA 4HBGA 5JE8A 4JNKA 1XLTA 5EN4A 1R0LA 1HEUA 5IAAA 5JNLA 4WK6A 2P5UA 3H6KA 4BIIA 5K0ZA 4W7IA 3LC1O 1BXZA 1YKFA 4A03A 2OP0A 1O6ZA 3PHJA 3KM0A 4M49A 1GEGA 1A9ZA 3AWDA 1YQGA 3TL3A 4B3IA 1ZJZA 3QV1A 2HRZA 1EVZA 1YJQA 1MG0A 2DTDA 4BNWA 3U9LA 2D8AA 4J4TA 3LF1A 3GVIA 4BNTA 2C2XA 1ZK4A 2PR2A 2PNFA 4GLLA 3QWFA 3ETDA 2Q1TA 3W1VA 4IQ0A 5KJFA 5COAA 3HDHA 5ER6A 4R9SA 4IJKA 4IJWA 4YJGA 4BV8A 4CLRA 1R37A 1E3WA 3PLNA 1ZXLA 3NKLA 1Y81A 4OAQA 3KO8A 3RU7A 2X9VA 4KWHA 1HDRA 3O8QA 4GH5A 4OOFA 1YONA 1I3NA 1RM3A 4JQCA 3VZPA 2YHIA 1U4SA 5JDIC 1WXDA 5DOZA 5J23A 4ZD6A 4FIZA 1V8BA 4AJ1A 4BKOA 5L40A 3U4HA 2J3KA 2C20A 3KRTA 4TROA 2Y1OA 2W2KA 4IZHA 1KEPA 3OICA 3C1OA 3IC5A 1R0SA 3DTTA 4CMIB 2DBQA 4D3SA 1GUYA 2AE1A 5L4NA 1UZLA 4L4RA 3AUTA 1U5CA 3D5QA 3OMLA 3BMCB 1GAEO 3KLPX 3O9ZA 4R69A 4I5FA 5DP1A 4K6CA 4KTTE 4R1NA 3OIGA 1GYRA 4A10A 4UULA 1EEHA 4MP6A 4HNGA 1T26A 2VZ8A 1LLUA 2OGUA 2BI8A 4QT0A 4ALMA 3MTGA 1PR3A 1PJCA 4KQXA 5HRUA 5T64A 3C7CB 1O9BA 1HL3A 4AG3A 1NR7A 3ONFA 4JJGA 4UUMA 3FD8A 1ZBQA 3WWZA 2DAPA 4RO0A 4GX0A 4L73A 5IFLA 1PEDA 3WNVA 4EZBA 2DPHA 2EJVA 4OJNA 3GOHA 4IGFA 3V5NA 1V6AA 4NJMB 4M86A 4NI5A 5C7IO 3UVEA 1WMBA 3PHHA 5KVQA 3BXXA 3ZWBA 4RF5A 3H5RA 2B37A 3LT0A 4EITA 3DEYX 1LSJA 1UDAA 1LRJA 5JDCC 3QQPA 1I5RA 4R3NA 1TT5A 4TSKA 3D7LA 2D5AA 3E9MA 2VZ9A 3F4LA 4DQXA 5A05A 2Y0DA 1XSEA 4OQYA 1VJ1A 4CM9A 1Z73A 4XJTA 5TGDA 5EQDA 3GLQA 1WDMA 1LQTA 1HSOA 4PLGA 2DBZA 4S3MA 1WLYA 3MTJA 4TZKA 3RFTA 3VOSA 4WOJA 4NIMA 3CZMA 3LT2A 1UXGA 5L3ZA 4EGFA 5KOIA 3V2GA 3EAGA 1YXMA 3VZRA 2JD2A 4PVCA 4N18A 5IDWA 2X6TA 1UDBA 1XQ6A 4NH4A 2O50A 4Y6RA 3LF2A 2X9NA 1GY8A 2A35A 1IYZA 1YWGO 2P4QA 4FFLA 4TRNA 5ICMA 5HTOA 1E92A 4RCVA 3PJFA 1YQXA 2VYVA 2YQ4A 2VRCD 1QRRA 3RUIA 3JQAB 3C1AA 3LC2O 1WNTA 4R1UA 1HE3A 4IPTA 4OH1A 1E3SA 1VL0A 1PTJA 2ZQZA 1X15A 3M2PA 4YTEA 1LA2A 3RQSA 2O4UX 3H5AA 4O63O 1NVTA 4BO2A 4BQPA 3GVXA 1I3KA 4URFA 4LN1A 1YB1A 2DTXA 3TDKA 5L7TA 1P77A 5KKAA 1B26A 1OFGA 1FDTA 2C07A 3ORFA 3I83A 1H6BA 1GQ2A 1M75A 1TI7A 3BMQA 4CLXA 3V2UA 2W90A 2WMDA 4I5GA 3ZDFA 1T1SA 1UZMA 3GRPA 5L53A 4WLEA 1SBYA 3IJPA 5TT1A 4BMNA 2E4AA 4BUCA 3AJRA 1VI2A 1WZIA 2BFMA 4XYMA 1M6WA 3LYLA 3F5SA 1BDBA 3GH3A 1ADGA 3KTDA 4P4LA 5CFZA 1VSVA 3PEFA 3DFUA 1Y7TA 4RPKA 1T4DA 5I7SA 5CG2A 3PLRA 4PLZA 4RF2A 1DFGA 1NR1A 4GSLA 4Q3AA 4UEKA 2GASA 3JD3A 4PFJA 2H1SA 1PJSA 1LNQA 4YT4A 4IJUA 3V8BA 1I24A 1JVBA 5I7FA 2TMGA 4R9RA 2GD1O 3KETA 1PIWA 1PZFA 3JQ9C 4E33A 3G49A 2B4RO 3TFOA 3AFNA 3E82A 2AMFA 3PYXA 2OOSA 2QYSA 4FC7A 3ZGYA 1Y8RB 4M8SA 1RM5A 4J7UA 4BNXA 4C7KA 1PJ3A 4TVOA 5I9MA 2AQKA 3D4NA 3RUEA 3RC1A 4CQLA 4J7XA 1M76A 5JDIA 3JQGA 3B6ZA 4CMAA 3RD5A 3WTCA 3OSUA 3COSA 4I8XA 2ZB3A 4BO3A 4B3JA 2YYYA 1Z45A 4UVIA 2CF6A 2JJYA 3WGZA 3FBGA 4BMSA 5TIIA 1ZEJA 3HFGA 4D43A 5MGBA 4OO3A 1VRWA 3RUDA 4W4TA 2J3HA 1GADO 3JYQA 1FJHA 3OHSX 3BYZA 3OEYA 3TZ6A 1QG6A 5DBFA 3W8DA 2XXJA 2OO5A 3H7AA 3U5TA 2RIRA 3ZN2A 2NVUA 1B2LA 4NFHA 4B8WA 4HFRA 4E0BA 5CEEA 4YRBA 1SMKA 4KZPA 4ND4A 3VAZA 4L8VA 2CNBA 3SLKA 4BNIA 1U7HA 4II2A 5ITWA 3STHA 1B8UA 1ONOA 3AOEC 1HDGO 1Q0LA 4RQTA 3NV9A 1V0JA 1H5QA 1TB4A 4AJNA 4CMGA 4B4VA 4PG4A 1GZ3A 1G6KA 4MVJG 3WFJA 3ZI0A 5DDIP 3LU1A 1PZHA 4R51A 3S2EA 2D59A 3CPSA 1U1IA 3X2FA 1FDWA 1OMOA 3GPDG 2GLXA 4Q3CA 5JMWA 4DLBA 3TPCA 1PZGA 3KYCA 4WNIA 4XGKA 1E3EA 4IDDA 4EJ0A 4J49A 2CVZA 3GDFA 2V6BA 1LSSA 3DB2A 4MKRA 5IN4A 1FDVA 4WECA 5JDCA 1EK5A 1C0LA 2DM6A 2HQ1A 2VWPA 5L4LA 1GV1A 1SB8A 2EKLA 2EWMA 2GSDA 2IYPA 4HXYA 4WCFA 5COQA 3AY7A 4BKUA 4DREA 1QLHA 1K5HA 1EZ4A 2B35A 2GN4A 2FP4A 4R1SA 3ONDA 1VL8A 2YV3A 2PKQP 4HV4A 4J90A 3S8MA 1KVRA 5LC1A 2Y0EA 3IL2A 3WGIA 4CMEC 3GQVA 4D79A 3PTZA 3RJ5A 1JVSA 4IIVA 4YT2A 1GPDG 1HYHA 1PJQA 2AEFA 2P5YA 2UYYA 3GEGA 4OXNA 3RFVA 2YHUA 3E9NA 2VWGA 4M87A 4E5PA 2VHVA 2W4QA 4WEQA 2QW8A 5TJHA 2VYNA 2C7GA 2O7QA 3CEAA 3NX4A 5EQFA 3JQ7A 4PLWA 1YOVB 1PU2A 3BMOA 4BO7A 4ND3A 3VH1A 3FN4A 4CLEA
chains in the Genus database with same CATH superfamily
1TA9A 3HZZA 1RU3A 3EMKA 1RHJA 1CETA 2AVDA 1NOJA 1TYEB 5B5SA 2WOJA 4Z7OB 1CY1A 1B0PA 3EJWA 2XQGA 4OHKA 4FFDA 1JTFA 5GQSA 5JO0A 4U7PB 1CDDA 2BUAA 4BFWA 4KH0A 4X71A 1YFLA 2QN1A 3RANA 3TKLA 3T7CA 1U0OC 2AX4A 3HRHA 2OV1A 4LDQA 3UAYA 2IVZA 1REQA 2QZ9A 3BGOS 2AWOA 4GP6A 6AT1A 1H9AA 4JXXA 4ZOCA 5EJMA 3KVNA 3BHMA 4Q1FA 1QIFA 1SQGA 1WB6A 3JQFA 2OUKA 5BN1A 1WB4A 3T5AA 2GNOA 3P8ZA 2WWIA 3FUTA 4FP9A 1UXKA 1Z2OX 4F9EA 1XL0A 2CL5A 1MB9A 2HTEA 4QGAA 1T9ZA 2C9CA 4P7KA 4ZANA 3TW8A 3UMSA 3UMRA 1XZPA 3UXEA 1NF8A 4PHTA 1HT1E 2NUBA 2B3DA 4JGGA 4Q9AA 2H4XA 1XRMA 3ME5A 4I7EA 3FVTA 3JSAA 4F4HA 4LQ4A 4MHSA 3FYUC 3K8OE 3LC0A 3N1UA 3QLTA 4RHCA 1TZBA 4MVWA 4D9FA 4HWGA 3U6BA 4Y2HA 4Y9RA 2WNIA 4U9UA 4MR8A 1SK9A 1JA1A 1F4LA 3LKBA 3OLWA 2AG1A 1NMYA 2QR2A 3GZNA 1XTUA 1XA3A 3AEZA 3VR3A 4KR3A 1SJ9A 3QVGB 5BYBA 3BXEA 5J4LA 2AUNA 3QELA 4IIGA 3M1YA 4Y6SA 2AIRA 4DBVO 3S0JA 3WMXA 4F92B 2G82A 5DT9A 4G0WA 4AECA 1LDGA 3ZE0B 3H86A 1E2LA 3EGWA 3NLLA 3O4GA 2ZYAA 4OHVA 1PGQA 4DV0B 1KAGA 2RE8A 2Q29A 1IJBA 1B7GO 1H22A 1ONNA 3PVSA 4LJ7A 1DJOA 3F2IA 3W2HA 4CKZA 3QWIA 1B0ZA 5J43A 3U7QB 5E3JA 5JIBA 3QWAA 1CEYA 4G0QA 3G3EA 2WM8A 1VXRA 2H1OA 1NVMB 1CUXA 4CIBA 4V0MA 1H2HA 1FNSA 3K6KA 5AI9A 5KAMA 5EIEA 3DWGA 3W4JA 2QHXA 7AT1A 3K0CA 3AYXB 2YN4A 2X2EA 4BQQA 4MRNA 1N7GA 4JYBA 4QQ8A 4W1PA 1UMCA 3ZLTA 4E51A 1TF5A 3NWEA 1QGZA 2XUZA 3LZDA 2ZUWA 4ZQBA 1J5XA 3Q1KA 4DMUB 1Y9ZA 1J6UA 1TZMA 4QGGA 5K8CA 2ZE7A 1FYEA 2G83A 3NYRA 1D2RA 4AX8A 5IJZA 2XMPA 3IPRA 4DIBA 4GBMA 1Z4LA 1YF3A 3BAFA 5F76A 1QZXA 4JLWA 1L4GA 1WDWB 2VNSA 2YXLA 1LBSA 1TQ8A 1CS0B 2HT6A 3ELDA 4EHLA 3IUQA 2H29A 3KU1A 2GKSA 3KJHA 1FBTA 2GO7A 2SECE 2GN0A 4UJ5A 5CBPB 5JI3E 1OT3A 1T9DA 2JLRA 3O5AA 1SOWA 4IEFB 4I6EA 3WDKA 1OVMA 1JE1A 2LE0A 3NBYC 4PZZA 4A4DA 1T2CA 5TQ2A 2PV7A 2HMAA 4N5NA 3LMKA 2UZ1A 4FEYA 2EQ5A 3X1XA 4JI4B 2XEXA 3TIXB 4FNMA 2E4XA 2YRXA 1ZSYA 1N6RA 2Q41A 2VG8A 3A1FA 5EKTA 4XWAA 3JVIA 3MVEA 2I87A 3GRUA 4DMRA 1B41A 3A2LA 2XE4A 4GE3A 2V59A 3LDHA 3NW9A 5FUMA 1AQUA 4UU8A 4LXTA 4X1KA 3B1FA 1KSJA 1IVNA 1N2XA 1QO7A 3QPAA 2X76A 4G1FA 4GAEA 4LNHA 2ZROA 4JWKA 1Y6JA 1SC6A 1XTIA 4J07A 3O7MA 1KZ1A 3PT9A 3E7PA 1Y6GA 2IEDA 1BYUA 3GPIA 4M9SA 3RRYA 5AOAA 4C5AA 1AKMA 5BSHA 4HPJB 5K20A 4ON9A 3JTMA 2H9IA 5DGCA 5KU1A 1YIDA 1PCXA 1U7UA 1XCLA 1NXOA 2NUAA 4MV5A 2HREA 5THKA 3TSZA 1F4PA 1TC2A 1BD3A 1XXHA 4G5OA 1ULSA 2X5KO 3SG0A 3WGKA 3L41A 4KU4A 1RYYA 4IGEA 1QIIA 2RK4A 1G2PA 4M0DA 3A9CA 1JPNA 2B1JA 3DBRB 1CDOA 3FPKA 3W5BA 3PFHA 4AY5A 4RXMA 4YACA 1P5FA 4EHAA 1QP4A 1K88A 1JRLA 4CM9D 1WB5A 1VB3A 2V5UA 3A6KA 2D1TA 4CT0A 1SEVA 1U2TA 1G3MA 3EXG2 3RFUA 4HMOA 1C3VA 1E9SA 1G63A 2WI8A 3PNOA 2TMKA 3LO8A 4LBWA 4M0CA 4MWCA 5C5EA 4L5IA 4B3DA 5T8KC 1T24A 1Z33A 4MNTA 4ACAA 4FGUA 5ICGA 3JD1A 4LFAB 3M1AA 4LPKA 4H6VA 3UUGA 3OQPA 4KVFA 3V7FA 5JXJA 3CR7A 1YGPA 4GMXA 5CH8A 4AJOA 5IULC 3G2PA 1AXEA 4QE3A 5ERGB 2WJPA 5G41A 1ADBA 4ZV7A 3KR1A 3DYIA 1SBQA 1YD7A 3EZGA 2CXSA 4ZEOA 4BZXA 1O3YA 2ZYWX 5AI5A 1FSPA 3TJRA 5HK9A 3AESA 1YDHA 4TRRA 1BC5A 3OLZA 5HSGA 3F7TA 3KJIA 2Q3FA 4XWGA 3DYBA 1UBEA 2JANA 4C1NA 3JARB 4AZ3B 2WTUA 5K3FB 3Q8XB 1XAJA 3TNJA 3B1YA 5BR7A 2FPKA 5KCZA 2VHTA 3R3JA 1K7FB 4H31A 2QW1A 2WMNB 1EBBA 1HPLA 3KFXA 4JXKA 4XB6B 1PTKA 4RDCA 1Z18A 1PQPA 3TZKA 5AK3A 3KB1A 2JHPA 4R31A 3ZU5A 5AKXA 2EFHB 4KXXA 5DNDA 2CLLB 5ECDA 3CZ4A 2BTEA 3WRYC 3N8HA 4H18A 1NAHA 4LRWA 3CJTA 5CXXA 1YCFA 5H82A 3ZXYA 3RRJA 1UPAA 1XU9A 2D00A 3EIUA 4WCDA 3L04A 2PMKA 2RHRA 4DMKA 1R6VA 2QVBA 4EW6A 1FMLA 1R4NB 1QDLB 1IMJA 2UZIR 2YOHA 4INAA 5JR3A 4TZTA 4ATNA 4EW1A 3C7TA 3G2OA 1BCRA 1JEQA 1X38A 2XWBF 2H1FA 4RFSA 4MDYA 1CLEA 3EBLA 3B89A 1IBKB 2YW2A 3HUUA 3SR4A 4HVLA 2ETVA 4EB0A 4EEKA 5DI3A 1C3LA 1NBEA 3DFIA 1WVIA 3G7NA 3HDJA 3PWZA 3AY3A 4EELA 3IKVA 1G3UA 3DB1A 2RMKA 1Z4MA 3MLAA 2ZJ1A 4J4BA 1GGEA 1KDZA 3HCOA 3KXKA 1EWYA 3BL6A 4WXRA 1OBVA 4QULA 5L6LB 1S9DA 3TOVA 3WRWA 1X87A 3PFWO 3UTCA 4D8WA 5LOVF 4B34A 5ESRA 4F04A 4CL8A 1U3TA 1SUPA 2FP3A 3I2IA 1KAHA 1CUDA 1T1RA 1U7PA 2DVMA 2V97A 2C59A 3KAPA 3NRJA 4UNPA 3P97A 1GZ7A 3T7TA 1FYDA 2PPLA 3C70A 2FB9A 4FFNA 3D43A 1GNTA 3SXUA 3WJ1A 2JFVA 4R8LA 2Z83A 4QYMA 2IY7A 1G7SA 3VV2A 5IBCA 2FLVA 1VKOA 1J24A 1L3CA 1QIEA 2QJTA 1XR3A 5BR1A 3FJOA 4QQNA 5HDQA 1NUTA 3UMBA 3KSBC 2JIPA 3PC4A 4XUCA 4YP6A 1FFEA 2I6XA 3K9QO 4PX9A 4KLAA 1AIPA 2RHWA 1ZYUA 2RG7A 3GJ0A 4B47A 2ET6A 2IEYA 3OX2A 5E7MA 4EG6A 4BO0A 2ZITA 3IOEA 2FSSA 4I6GA 3O8BA 2YTZA 1W4ZA 4CIXA 3AFHA 1JQJC 4J1TA 1LBEA 1GARA 3E7FA 2CY0A 3OIYA 4Y6OA 3UHJA 4PYRA 2EQAA 4MW6A 4G07A 4R0VA 1SXHA 5AKLA 3CF6R 1R6BX 2ORIA 2DPXA 1G55A 2UVDA 3HEAA 3Q3IA 4RQTA 3VX4A 5ALVA 4QPJC 3BZUA 3O3MB 1MO2A 2IP2A 1TZ2A 3GWGA 3BICA 1VC2A 1O7JA 3AQ4A 2OGWA 4NBLA 2BAGA 1HYGA 5CD9A 1J5EB 5GM2A 3PUHA 2F43B 4ALIA 3LE8A 3MGAA 4KKVA 4GOKA 5ALHA 5DWQA 1N3IA 4NOMA 2DB3A 5FLXA 4ZXFA 3MD9A 1EVQA 4H3VA 1J0CA 3LKVA 4QG7A 6LDHA 2ZSIA 1FZTA 4HWKA 4WLNA 1M2VB 5LZ5A 4I14A 1DKOA 5JNWA 3PA8A 3ELYA 4G97A 1DIRA 2P9FA 4M21A 1FFXB 1ORDA 2VJBA 4ROSA 4LF4B 5D5QA 4PW0A 1WY5A 3JATB 3AKZA 5DJ5A 5AVWA 2OAEA 1DAHA 1C0IA 1T5OA 1G60A 1KMCA 2XVZA 1J0XO 4MRMA 4CCYB 4YCNA 4MHOA 1EB9A 5EHQA 4FN4A 5JANA 2AW3A 1XNJA 3ZWOA 1QP8A 3TWOA 3GLGE 1UBKS 1FC0A 4E2WA 5DHFA 3VSDA 5EMHA 1JUDA 1OI3A 1TQDA 4UUAA 2H16A 1TD9A 2NW6A 3IT0A 3ONWA 5AR1A 3SZUA 3ZS9A 4FFSA 2VT7A 1HFJA 3W7BA 5C8VA 5AIBA 3IAS6 1I2MA 3SF8B 3R7DA 4CGYA 3MGBA 2PUCA 4RD1A 1J0DA 1W6RA 1Y80A 3NJ4A 4LYHA 4EA9A 2C4NA 5B3JA 2FG5A 3USZA 4YXFA 1K06A 2OCDA 5LDHA 3CGWA 1GKLA 1DC8A 4D25A 1J2JA 1P4JA 3BL8A 3KJQA 5BMVB 1U7TA 3VYWA 4BKMA 1MIHA 4EFLA 1DDGA 3IPXA 4ZPJA 3I39X 3OH8A 3MWKA 3D6TB 4MARA 4QL3A 3HZHA 2P27A 1VE3A 4JBYA 4ZGWA 2BJWA 2FWAA 4HQNA 5JJIA 4TQUS 1YR1A 2G0TA 5KHLB 2Q4OA 2VFAA 3QKSB 2XBMA 1RWKA 2W2LA 2PGXA 4HS4A 4QXAA 4U6QA 3LWBA 3LHDA 3K0KA 2QI9F 4C4TA 1IMOA 3ACDA 4N03A 3E22A 3FZNA 3E0XA 5JD6A 3Q98A 4A0FA 4JUAA 2OOKA 5IKMA 1QANA 2IODA 5JMOA 5F5XA 2A84A 2G4CA 2Q0XA 1NP6A 3AW9A 3FPEA 3CUEF 3H18A 5TXGA 4DA9A 4JDPA 4DWJA 1X2EA 5IXYA 3PUJA 4KV9A 4ZHSA 4IJQA 1CUBA 4HTFB 3ZY6A 1TVKB 3P0FA 3ETLA 4ZVKA 4CV2A 4O3MA 1RP7A 3O75A 2BFEB 3B7WA 4CNQA 1AKEA 3WQHA 1I01A 3OZWA 1W87A 3REFA 4MCAA 4FFMA 4FN5A 3VPHA 4L2IB 2WF6A 4NYMQ 3RV3A 4IICA 2OB2A 3F6CA 1MDBA 1P0QA 2IP4A 2JZOA 3GMSA 2AZDA 1U2GA 2F9LA 1CU1A 1JG1A 1QJ4A 1G2IA 1W9MA 2PL5A 2V7PA 3GJ6A 2YJNA 5B4UA 3C3KA 3QHQA 1D8TA 1VDZA 1T9CA 2QN2A 5EPUA 4CLHA 3CE6A 4KZKA 5A4MS 5CP8A 2WIFA 5KMGB 1CPYA 1QV7A 4E5KA 1DV2A 5K0NA 5HJ7A 1HDZA 2I66A 2YQ5A 3G17A 4ZYXA 2QMQA 2WTXA 3GBVA 4TZ6A 5L95A 3G0HA 3ZQ6A 4JLSA 4IJ6A 5EOVA 4S12A 3X1DA 2CFRA 2C31A 1LV7A 1CIPA 1YMUA 1YOVA 4UD2A 3EMVA 1HFWA 2KQUA 3QWHA 1DVRA 3FRIA 3L0ZA 3OLQA 4GSYA 1YB4A 4LY6A 1VJTA 5DH9A 5HF9A 5IBPA 4EUEA 2HPHA 2Z2KA 1GJRA 3IKJA 1QHXA 3A58B 5CVTA 4V02A 2GM9A 5DLYA 3VPGA 1OF1A 4QOJA 1YRQA 1LPAB 1AGNA 4H3SA 4DLXA 1Q17A 2FTKE 1O9HA 5KS2A 4M3NA 5KQMA 4K9KA 5T7BA 2OKCA 5EKUA 2I91A 5AK6A 2R62A 2C1ZA 1U7XA 2AC2A 2YV4A 3U9SA 1UDRA 3WC4A 1PFVA 1GNLA 2M6RA 2I99A 3HUEA 4ESVA 2XNJA 2QUBA 3GJ5A 3TZBA 4RA6A 2QTFA 1VLHA 1EVYA 1Z2DA 3JCZA 3WRVA 2PYIA 2GBCA 3GBPA 3QZUA 3WWPA 4EHHA 4EX6A 3V4LA 3JAMA 5IH7A 2JLSA 5IU6A 3RIXA 5KDDA 2WYIA 1OXXK 4G86A 1N5LA 1IQRA 3PVZA 4IM7A 4RJIA 1C8VB 4YBZA 4H7IA 5F21A 1FOEB 3VKVA 4YI5A 1R4AA 4UDOA 3SQLA 2BR5A 1DOHA 3GCWA 4RTNA 1GPLA 1K8RA 3EFHA 3EFOB 2NYRA 1RIIA 1JLRA 2VQDA 3NFYA 3QLJA 4BE9A 5CPFA 2GX6A 4PYKA 3T0IA 3WYFA 3I6YA 2OHOA 4GL4A 3RK1A 5FBHA 2GKOA 1T6YA 2OZEA 5FV7A 3CH7A 1NY5A 2RGGA 2GI4A 3MCVA 3SJAA 3AHHA 1DBRA 1TJPB 1U0GA 3CZCA 4E22A 4HNQA 4MZXA 2ORWA 2I3DA 3TKYA 1MLDA 3K8YA 3LGAA 1IU9A 4K7JA 3S7TA 4C6RA 4BVLA 2X7HA 3A3PA 4MJ3A 4PANA 3NRCA 5GOTA 2A9KA 3ROTA 2WBLC 1J8FA 2VTBA 5IJ0A 3ES9A 4GZMA 2CLEB 5I47A 2J5KA 3NVMB 1LVHA 4ADSG 3P4UA 3EIXA 3W2EA 1T9AA 3OPYA 1Q3KA 4IUDS 2AEEA 1PT5A 4CHTA 1EHIA 4LOIA 5GGXA 4CI0B 4EKYA 1NNUA 2P1DA 3K5PA 4HOYA 3UH1A 4A3SA 4D3ZA 4DT1A 3FSGD 1A8SA 3NASA 3MRXA 2OFWA 4LI3X 4XUDA 3KOYA 5D3ZA 5ESDA 3W4IA 4D82A 2BISA 4H59A 4PAMA 3WGNA 1XPUA 4KUHA 5CAEB 2VDJA 5FNZA 4AAYA 3ER9A 5KX5A 1VE7A 1SG6A 2FWRA 3TR0A 2CXTA 1CZNA 3E9EA 2A0UA 3L1KA 1EEXB 1QDEA 2JEZA 4OSOA 1U0BB 2I6TA 1Z6YA 3TRDA 2XXAB 2J9YB 1V7PC 1ZU4A 3NHLA 4Q7LA 5AQ1A 4BB9A 2V0GA 3SJCA 1Q7CA 2YW9A 4G1VA 3DCNA 3RUHA 4DQKA 4D8VA 2ENUA 1IN5A 2ZSHA 3ZHUA 4BTEA 1EFLA 2O0KA 3LTNC 2GFQA 5F7OA 4MRAA 3CR8A 3O1JC 4DLSA 5FADA 4ZCRA 3CKKA 1JR2A 3RYCA 5AW0A 2J3MA 2YUIA 5FT9A 2X3YA 2BE9A 2JI6A 1ZVMA 4B75A 2FZLA 3VHQA 2P4EA 3QMVA 3CUWA 1E0AA 3OJXA 2IV2X 2B5OA 5HIKA 1DC3A 3QQ5A 4QNMA 3TD9A 2HU7A 1OXKB 3Q7TA 4ZI2A 4S0XA 1E2MA 4NXNB 3U7GA 2H6EA 3QKIA 2YZGA 3NJ8A 3Q0IA 4MWZA 5K6TA 4G0OA 3WB1A 3U2QA 3IALA 4D9EA 1Z9BA 3LK6A 1X13A 2GCOA 5IEBA 2IPOA 3V1MA 1JV2B 3TBKA 3QMMA 4UNIA 1LZLA 5E38A 2COEA 1P74A 4C7JA 1ZD3A 2EHDA 3Q7EA 2ZRCA 2OORC 2FV8A 1QZ3A 1WZNA 1Y4UA 3P27A 4RJKA 3V1LA 3ETCA 2GSWA 1ZEMA 4MWBA 1CG6A 1VLJA 2A1UA 2ZYVX 1ZN7A 3PWTA 4NC9A 4X44A 3SXJA 4EY5A 2X2OA 4EHBA 3OETA 1P17A 4GMKA 4NG4A 3U62A 3VNAA 3WLOA 2YWDA 3N2KB 1AVTA 2VK8A 2WWWA 3OM1A 5KWSA 2AC4A 4TV8A 3MOGA 3AF6A 1JR6A 3COWA 4XYEA 4XW2A 2F59A 3SR3A 2XEDA 2GUWA 3FMPB 4NAHA 1DAIA 2ZQYA 5LQDA 1QF9A 2VHZA 2VWQA 2Z8YM 3GOQA 3D81A 3IQGX 3RYFA 1ENPA 1KDTA 4HI0E 2IKQA 2BZ0A 1S3GA 2XCTB 5JXGA 2NPFA 1FQWA 2PUFA 1RJ9A 1M2WA 1K68A 1PD0A 2G63A 4K46A 4ARCA 1KMQA 1VRVA 1RBMA 1Z4JA 3IT3A 2BZSA 4MV8A 1QM5A 1B93A 4DDUA 1PK9A 2HNKA 1RPTA 4AJHA 4IDEA 3AETA 3NEYA 1BS2A 3HWX1 3JQAD 2FZKA 3OE4A 3PL1A 3HLYA 1E0DA 4I55B 1GU0A 4JVMA 4MJ7A 4QSMA 4X61A 3RPEA 4F45A 1SXJB 4JKOA 4XIYA 4K1LA 2W0SA 3TZEA 1IXSB 1UINA 3KBOA 3ZVRA 3FXAA 4EGSA 2UVQA 1JTVA 4CLRB 3MUOA 3K71B 1Z2CA 2ZTSA 1LBTA 1ZGCA 1PV1A 1S2LA 3MJSA 1XALA 3CEHA 5KTKA 3VU9A 1BSVA 3N5KA 3IOMA 1Q15A 2PKRA 4PZDA 1WCYA 2OM6A 3H97A 4CKBB 3L5KA 3Q2OA 1HKUA 1B3BA 4P1ZA 2R1UA 5F78A 1DRUA 3VHXA 1J22A 1IQUA 1DRJA 1VBKA 2FFJA 3AXTA 2PUAA 4RMNA 4I1YA 3U7IA 2ZXFA 4WKCA 4NE7A 1BHSA 4C6SA 1A50B 2CNDA 1Q1ZA 1NJ8A 2B2CA 5C1PA 5BP7A 3INYA 2JBAB 5KTPA 1OH5A 5ESXA 2VHUA 1PNTA 3MT9A 3FF4A 3GGPA 3I0NA 3L46A 2WK1A 2P9EA 3GX1A 4P38A 5CPBA 4TMXA 1JXOA 3K15A 1MJGA 4N1AA 3VC2A 1BDIA 3VGJA 4KIFA 3ICOA 2B78A 2M6LA 4G1BA 4FB5A 5GVRA 4AQ7A 1T9GR 4RVUA 4ME6A 1FE8A 4C0WA 5AUNB 3MCWA 2I6QA 4BFSA 2ZEJA 1ULTA 4H7FA 1ISSA 2R7NA 5F3DA 4DZZA 2QOEA 2WFLA 4XJXA 4BFCA 2RDMA 4G24A 5KTNA 2XRMA 2WUVA 5E2AA 5BUCA 1DIBA 1EP9A 1COWA 3EC1A 1QTQA 4R2WA 4NZMA 5KX5F 2C8KA 3I9KA 4DARA 4BX9A 1WP9A 2IDJA 2VJNA 1V16B 1OLXB 3F3KA 5F7JA 4DR7B 2HWUA 1CVIA 1XEWY 2QT9A 4Q1AA 4ZPXA 4KV7A 5KINB 1P1BA 2VDNB 3E9RA 1ZW6A 1H6AA 4P5EA 3VBEA 1DIOB 2IUSA 2H2GA 2G70A 3L8DA 4DLRA 3DL7A 3ETEA 5IABA 3A70A 3QI7A 4FMPA 2B36A 1SQ5A 3WGQA 5ANRB 3H5VA 4MV0A 5CTJA 4IILA 1KK2A 4YAWA 3E9ZA 2NPOA 1YMVA 4AI6A 3FLEA 3ENNA 1N2OA 3LPCA 1M9NA 3ENVA 5CNKA 3FNEA 5FWYB 2W2QA 4OXIA 2P7IA 1KMMA 5JS1A 3GFPA 2EBHX 4EL5A 4XASA 3V48A 5A5FA 1DG1G 3BWXA 1TT5B 2WR8A 5EZYB 4MR7B 1YA8A 1R8XA 2EYQA 4FUQA 4K6HA 4QJBA 2H52A 3F2VA 1K6MA 2QVGA 3ULKA 4CV0A 1J8YF 5AM0A 4EYEA 4K0KB 1GVNB 5H68A 2VR1A 3EWIA 3F47A 3LVQE 2D7JA 2QZZA 2ZAOA 3S99A 2EG5A 1G98A 3EARA 5LLSA 1NF9A 1Y1LA 2VBIA 5IF3A 4UJ3A 1BE0A 1K8YB 2WYUA 2ZBQA 3K8ZA 4K40A 4MUAA 2PD3A 1XMOB 1LTQA 4QBGB 2N3ZA 1U3WA 3I04M 2QLLA 3S3TA 4QICA 4V0KA 3A37A 3DZBA 3U3RA 1G5RA 3A1DA 3DG9A 1TKAA 2BR3A 3OE5A 4MPTA 4XB1A 3VTKA 4B4WA 1XPOA 2WC1A 4M60A 2CJPA 4NDNE 5K6RA 1Q92A 2CVQA 1XQ1A 3AVTA 1QWSA 2PUJA 4PSVA 4QFCA 3ZZTA 4F86A 4XPIB 2Y2VA 1NN5A 1NN0A 4JELA 2XDYA 3K92A 2YQZA 4IQ8A 5AXDA 1ICEA 4Q02A 4GBED 4JHXA 10MHA 1KH2A 3BERA 4DMMA 5LUAA 3INRA 3EX7C 4UVEA 3AF0A 3OSZA 1DT3A 2XTAA 2DE0X 4Z6KA 5AW6A 2J4FA 2HV8A 2ZSAA 3VH3A 3WI7A 3UJ6A 5AK4A 2J5QA 4XWOA 1UOQA 4FW8A 3SKVA 3A6PC 3HDGA 1I0IA 5JT1A 2C2KA 3WK9A 2R8YA 4RKRA 3IQEA 4LVCA 1OFIA 4Q0MA 4D9HA 2GNAA 4P32A 4C07A 3LY5A 5CD1A 3MF4A 2BKUA 5CJ2A 4ARBA 1WIWA 5LP6A 4UHBA 2OEPA 3CINA 2VYQA 2GF0A 4EHFA 1H0SA 1SQ0A 3SC3A 1XCMA 3BDAA 1H2WA 4WE3A 3UUFA 3RRZA 4RZXA 1R8SA 4EVRA 1UKYA 3PHIA 3PD7A 5GPBA 4PRKA 5GOZA 4MS4A 4OFWA 4D97A 4TTRA 1BFDA 1NVWQ 3HP4A 3M6AA 2O2DA 4BAUA 5DASA 1ND6A 2O0JA 2CJFA 3L7YA 2WUEA 4WBNF 1QQBA 4EPYA 1XWFA 5H59A 3SC2A 3X1ZA 1HE4A 4NCAA 1XZ8A 2QPTA 1PWXA 3HCNA 3VPBA 2QJOA 1RAHA 3C87A 3HXMA 1XZAA 2G76A 4FKZA 2VRNA 1HG0A 1CUVA 4QGFA 4BGVA 3HYCA 4P4GA 3RVOA 2CBXA 3VOTA 5C4IA 2G9NA 2CHEA 5DHUA 2JCGA 5LQUA 4P4SA 2AQHA 3I53A 3RVNA 3MWYW 4EHKA 1LW7A 2IGTA 4BVKA 4Z7JA 3CWZA 2Q50A 4ENTA 3RHSA 3W6PA 3U3JA 1EHYA 4N54A 4YT5A 2PRJA 4EY4A 1DQNA 3PX2A 2XITA 5BPHA 3IUJA 4FR0A 3UKDA 4YRKA 2NSHA 4RHEA 2MYTA 2JDID 2IUTA 1KIAA 4WA8A 2FUG6 1I7PA 3E03A 5A7HA 3DDNA 1IRIA 1DLIA 4BV3A 4MHTA 1PLLA 3ZD8A 4OHZA 3EQ2A 1NF2A 5KJ1A 3NUQA 1L5SA 2ZXEA 2Q5OA 3DT6A 1R00A 4JIGA 2DQYA 4M1ZA 4NONA 4Z9FA 3N7UA 4YPOA 3IEKA 1U6JA 4NBTA 3A1EA 3NWBA 5DNUA 4ALJA 1RZ3A 2WMOB 3GNQA 1CC1S 1Y5RA 1THTA 2FPGB 1WBJB 3LK7A 1RTTA 4IDHA 1XQXA 2QMHA 4HB2A 4J0CA 4LOHA 4NJMA 1J33A 4RX1A 3L06A 1A5AB 4KQ2A 4WKPA 2CDAA 3OLCX 5KHAA 3U17A 5DPMA 3MB5A 1CX9B 1TXGA 3H1EA 4RORA 2GR9A 1KZ9A 4YJDA 2DR0A 3OKCA 1TK3A 1X7DA 2XPCA 3HP1A 1Z07A 2JI8A 3W5JA 4XD7D 4TTTS 4TTQA 4LDNA 1FXUA 3CF2A 1Y7HA 3ODGA 3AHGA 3HA3A 3PWKA 4I1PA 1C8LA 1H8HA 2NVUB 5EP4A 5INTA 2RGNA 5IT9A 1XHFA 3PG5A 2G72A 4OMDA 3WLLA 2FN4A 1U9ZA 2CEAA 5BW8A 2WKPA 2XA1A 1UODA 2X40A 2JATA 1U0EA 3IOCA 4RKEA 4RGBA 2ANCA 4AUMA 2RHOA 3D4OA 4PGGA 5FFFA 4LC1A 4OL0A 2ZJ2A 5K05A 3K0BA 1QQ6A 1E89A 4U2DA 2HIMA 1WV0A 4YONB 1W5BA 2ETXA 4OQDA 5CB8A 1PT8A 1VQ1A 1BRMA 4MUBA 2WABA 7REQB 5GINE 3OVMA 4R8KA 2WJ6A 4G1MB 3RVDA 4BHTA 1SU6A 4G63A 2JPDA 1RABA 1E3DA 4H1UA 4X7BA 3P9XA 4C30A 2RB5A 1QFXA 1S3SA 3A9WA 3AIMA 3EEYA 4GPZA 2I7TA 2R65A 4HYTA 5DSZA 3TZLA 4IFEA 3TOXA 2G9UA 5EIXA 1MC1A 1U8YA 3KAJA 1BGWA 3H1TA 1F2VA 1EI9A 3EW7A 1JIIA 2G9VA 1QE0A 3NP7A 3QYFA 4GIBA 3IV7A 4IEEA 4Z9YA 2I80A 2JLUA 4CTOA 2PKCA 4G5XA 4Q00A 3AU9A 4D6XA 1WG8A 1W75A 4WZBA 4R54A 4W1QA 4QECA 5AUOB 3ZZ1A 5DT2A 1XU4A 2EFYA 1HNZB 5FRDA 1UPFA 1UBFA 3THYB 3B85A 4G0VA 4LFBB 3B8EA 3IEVA 1C7IA 4RAQA 1XKTA 2Q6OA 4MKXA 1NQ5A 5AICA 4PE5B 5JPDA 5KYTA 5LQMA 3IR6A 3TECE 2PGDA 1N36B 3UEOA 2CWDA 4HJXA 2FSVA 4OU5A 5DO9A 1GL9B 3RM3A 4QUHA 1R5NA 3FGOA 4YUZA 4PYMA 2I8CA 3WWCA 1UK9A 2GM3A 3CYFA 4XJSA 4JKYA 4X95A 4CM1A 1ILEA 3HVUA 4GLBA 5F23A 1CW2B 2M9MA 2VP9A 4OFXA 1MC4A 4CKWB 5IG2A 3PIRA 2QBYA 4WASA 1ZK2A 3PTLA 4EF5A 4L57A 4D8UA 2YVQA 4OJYA 2PZKA 2X0DA 2R1VB 2WFAA 5HKOA 3IVMA 2FPIA 4J0FA 1EXDA 3BFKA 7MHTA 4OHXA 5HF5A 5J2UF 1KI6B 3AM5A 4ZOQI 1SUFA 2AJDA 2GVNA 4RUKA 3MA0A 5A6SB 5I7VA 1Z4QA 4L51A 1XZIA 4NSNA 1JXAA 5CYOA 4A16A 2WVJA 4YXWD 1NVBA 1PWZA 2H4YA 1WPRA 3MD0A 4JBLA 1L5HA 2QSJA 4F2GA 4NP6A 3ZZNA 1QO0D 4A9AA 4HB4A 3VM6A 2XWJI 2ZU0C 3REGA 5IYZA 1ORIA 5A4DA 2C5GA 5EGNA 2PCLA 4C5BA 2OFOA 2O7NA 1NUAA 2H4JA 4BB5A 2FWBA 3CEJA 4N40A 4OBWA 5G02A 3UCEA 4AW9A 3QLVC 3IS3A 4F85A 2REQA 1XYYA 4NEHB 5ALXA 1QHEA 3I5XA 2B9VA 3GDGA 1P8AA 1U9CA 3I2YX 1YBAA 4O4LA 5FPQA 5AT1A 2Q4EA 1MOPA 2CXRA 3LA8A 1AS0A 3FCXA 5D00A 4XFKA 5LXTA 5IJWA 1NHWA 2VHQA 4O59O 1UXOA 1KI8A 4ZDIA 2QT1A 5D3QA 4B9EA 2ZRNA 2IXTA 4LJ5A 4M8NE 5AVJA 3MMZA 4PG5A 3GPLA 2CNLA 4Y2XA 4O02B 5E2BA 2NO1A 4WAUA 3IQFA 4C5CA 3MHTA 2GERA 4FXPA 4H2DA 4EA8A 3R74A 4D74A 5C8XA 1PSWA 4OCZA 3DLHA 3GZ4A 1P19A 6ADHA 3DLAA 1MA0A 4HNHA 4WXHA 1UXIA 3PXAA 4E2XA 5C5IA 1YS7A 1XIVA 2YMQA 2Z98A 2DX7A 4WZAB 2A9OA 2W7TA 1IY9A 2IEAA 3HYRA 3I12A 4ML3A 1XNRB 4KR2A 4FBGA 1GCAA 4OLFA 2XB9A 5H1YA 2E89A 4URZR 4F2DA 4HHEA 1PR5A 4BLOA 1JDTA 3OPMA 1BTOA 4P8RA 2AYZA 3VPAA 5AW4A 5MN6A 2VUIB 4PC3A 1M2JA 1ZD2P 5H9WA 2ZE6A 3W6ZA 2YZ2A 3QE2A 1XTRA 3N86A 1EHCA 4TUYA 1QB8A 1NUUA 1UPCA 1XD2B 4ZZIA 1P73A 2IE8A 3FWPA 2IXEA 4JNCA 3CV3A 4QPDA 2PUBA 2ZVDA 4GC9A 4PPYA 2H1RA 4O29A 3W9UA 3BEOA 4IIFA 2PGAA 5M04A 5H80A 1USWA 2VJLA 3SSNA 1Q2XA 5BYAA 2BRUA 2P9CA 2HDHA 4M1KA 2R4UA 5IAEA 3RVSA 4NBRA 5KKCA 4OU4A 3G2IA 5TPWB 5BR8B 1SHTX 2PWAA 2C4KA 2XDQB 4MCHA 4YO7A 1M1XB 3R75A 2ZRHA 3G2HA 4MA0A 3U49A 3WR5A 2Q7OE 3TZHA 1H4SA 4YCDA 5BWOA 1TYBE 2NO9A 4MKFA 1QLJA 3OPVA 1E79D 4U8HA 3BPSA 2OYRA 1E1MA 1YB2A 1VI6A 1ZNXA 1TVEA 2VHYA 1M54A 2MMCA 1CIJA 3KHTA 3AW8A 4HLUC 3HK2A 1BJTA 3ODPA 3D5EA 1F0NA 1J8VA 4P08A 3P9ZA 1XMPA 3C4QA 5J5CA 3RYHB 4KX5A 4RLFA 3D8NA 4EG8A 3DOUA 2VUSA 5KPDA 3H3XA 4PICA 3KC2A 1AGRA 4R2LA 2B69A 3MTAA 1NFFA 4TKUB 1Q19A 2QAGA 4UFOA 4CDNA 2XJ9A 4BWFB 1EXVA 3G02A 3CF4G 1QKKA 4BXOA 2VAPA 3I8SA 5BPFA 3CRZA 3DUFB 1E2IA 3HCRA 2IYLD 3KR0A 4CU5A 3GJQA 1ZLXA 1LPSA 5REQB 3U31A 2B82A 3T7EA 3GN1A 1T2NA 5K8UA 3AM1A 4J9UE 2HHLA 2OILA 3NPAA 3CUYA 1E4EA 1W4BA 2FPSA 4QDTA 4MVJM 3R7WA 2H8GA 2O1EA 2PGNA 3FVRA 4GS5A 4DV4B 2VJOA 3IFSA 3GCZA 4HUQB 2AFRA 1VTKA 4JU8A 4RDIA 3U4GA 1CNMA 2GPBA 3QW2A 3VHLB 1IM5A 1XTTA 2X22A 4K1XA 2XHZA 3PCTA 3ZWWA 1I3LA 2Z1MA 1HLDA 3K2QA 2QDXA 4Q4JB 4Z9AA 2IFTA 3TZCA 3ZVNA 1MAHA 3KVRA 3ADPA 5F3RA 3DR3A 5CK4A 3WNQA 4FZ3A 4G4JA 5C32A 1UK6A 4TWBA 1YACA 2LVBA 2Z09A 3ZJYA 1WU7A 4PTLA 4L75A 2NVWA 2QPOA 1A4XA 3ETNA 3QY9A 4RM3A 2DYKA 4N8SA 3IUSA 4BVBA 4BYGA 5KOJB 3DUWA 4QBFA 4DSNA 1QFJA 2BGNA 3FFXA 1QS0B 3SS8A 2A4MA 1YNOA 4BQIA 2MWMA 3GJSA 3LDGA 4Y2SA 1THGA 3IVCA 4YCJA 1C3XA 3PRHA 3U1TA 1A9PA 2Q49A 1AN0A 1KO1A 3R3HA 4JB0A 4N7RA 3ON5A 5F7XA 3CPJB 4GNRA 2GLUA 1PJ8A 3F1LA 4KLCA 3BEDA 4MA4A 1EFAA 1Z08A 1ST3A 6NULA 4E6EA 1VCOA 1FNBA 3I4FA 2EP7A 3SZGA 1P5RA 2ECPA 5KTRA 1KBZA 3W8RA 3UAWA 3BVPA 2D0IA 1UK7A 5EESA 4NYIQ 2BKEA 2AKAB 2QL7A 1MVNA 2OBYA 2IXGA 4PXAA 4OUDA 3IAEA 3E4DA 1BVHA 3K5HA 1FP1D 3ER6A 4MDHA 2NWQA 3LZ6A 3THXB 2CBGA 1L4MA 1PG0A 4XAQA 4YFVA 2FR1A 4O4LF 5AUQA 3AL2A 5EY5B 3AIOA 1JHPA 1DELA 5J4HA 1XEFA 1A2OA 4NDAA 4NHEA 5T6BA 3G5UA 4O3FA 3O4JA 5HZKA 3OLYA 5BY2A 4ZC1A 3PJEA 2QM3A 3H2BA 1J1ZA 3KZKA 4Q05A 2KLBA 1UOOA 2R5WA 5KB3A 4F97A 3X2EA 1L7QA 2IP1A 3HXPA 1ZKMA 3VOAA 4EY8A 5JS2A 1FX1A 2X3UA 3WGMA 1NUPA 3KZ1E 3GARA 5I9TA 3ZNNA 4BBAA 3FTQA 3RVLA 1E99A 3KUKA 1GQFA 5JYEA 1C9EA 5BN4A 1JE0A 2C5BA 2WB4A 4NABA 2JFWA 4RGVA 1VIYA 1FRNA 1X1QA 1P7WA 2J4DA 3BCUA 3H5NA 3L7DA 4G01B 2OCBA 2NU7B 4RH1A 1O5IA 3BTSA 4HZGA 2QZJA 2ZBEA 1JF8A 3OT5A 4TL9A 1QOZA 5EE0A 2BBSA 3UK0A 1D3AA 1ZGJA 3LBAA 4EK9A 3HCPA 1ZISA 1Y48E 3G8CA 1PJ4A 2IYZA 1DC4A 1FVXA 2WHEA 3DDUA 4S0ZA 2ZUCA 1WEKA 3L7NA 3BGSA 4E7OA 2WD7B 3JQFC 4YJFB 2RJOA 2X8WA 3DDCA 4RD2A 3TIVA 3YASA 3U3XA 4L3WA 4AJKA 4IV8A 4WKOA 5HQTA 2QN3A 3KKEA 1Q7GA 4EUSA 3R6LA 2XLBA 5ALFA 5AP9A 4YN3A 4C4XA 3PNVA 5KIAA 1N1DA 3OESA 2WVAA 1CY7A 1ZITA 3DW3X 3R3ZA 3TOZA 3ADDA 2X8BA 3AVUA 4YYZA 1NU6A 4GO1A 2XNSA 4WDQA 2HSJA 3QGMA 2QE7D 3WYBA 4DQUA 2CNOA 2PUTA 4PNPA 4B09A 4C0BA 1YI8A 4OIMA 3AF3A 1GPKA 1UOEA 2I22A 5IDYA 4KOEC 1E1LA 9GPBA 1IAVA 3E35A 3W06A 2WG2A 1O77A 3FUCA 2ZQ5A 4JQZA 1KGDA 2F1JA 2Y1XA 4N82A 5KI6A 2W5UA 4EI7A 4C78A 2DHCA 3DYVA 5JFOA 4J0GA 4LYYA 3DS8A 5DK6A 2XDAA 4EJMA 4RVHA 4EBFA 1IAQA 1SHJA 4YAFA 2AGVA 2ZPTX 3OFJA 1WPXA 5F77A 1TX4B 4GICA 3C15C 4BNKA 4XSGA 1TJ5A 4ENQA 5ICEA 2IIPA 1BXRB 4XR4A 5EFOA 3ABZA 3T9BA 4DDHA 1GSHA 3KWMA 4WPGA 5M7EA 3ZLBA 2WJGA 1Z0FA 2Z5FA 3NDJA 4YJ2F 5AKIA 1BHQ1 4AZTA 3F0TA 4Y6LA 4ASUD 3OQMA 1M1YE 2W2MA 3R77A 4XGNA 1W93A 5HS6A 5IP5A 3TBHA 3K6SA 3T94A 1NQXA 2EL7A 2O9JA 2XE8A 1GKIA 1ZPDA 2A57A 3FSJX 4DDMA 5CX1B 2DHQA 4R98A 2AG0A 1NW3A 5K5EA 5KYKA 4PHHA 4IJ5A 3W4KA 4BJ5A 5JAHA 1ZW1A 5AKKA 1X7YB 5EP3A 2NZXA 4EF6A 2CT8A 4JR1A 2PFGA 1DOAA 2X14A 3GDHA 4JA2A 2PAFA 2VQEB 3D8HA 4KR7A 2IPLA 3L0DA 4J7AA 4JFAA 2EJTA 1B6GA 4EUKA 1C7QA 2FUG1 2J08A 1VPTA 4IX1A 5TB5A 1ZNQO 1EAMA 1K8QA 2XUFA