1ZK1A

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 100
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk1A00
5IDXA 2GD1O 1KETA 2HMUA 3C1AA 3E9MA 4CV3A 2PH3A 1AHHA 3WGTA 4E5KA 3C1OA 2RAFA 4YJFB 4DRYA 1SCUA 1VSVA 1EE9A 5L40A 2YFHA 4IJKA 3EUWA 1E1LA 4BO1A 1IOLA 1B8PA 1Q0HA 3S2EA 4ZU3A 4A0SA 3JQDA 4IJUA 2OL4A 4LSMA 4HWKA 5G4KA 4H15A 1ENZA 4TMFA 1RJWA 1PJTA 3HUDA 4FFOA 2FZEA 1I2ZA 3W6ZA 3BMCB 1GUZA 1I24A 4CMEC 1LI4A 1LU9A 3HN7A 1U5AA 2GLXA 3Q2IA 3KV3O 4BNZA 1FMCA 2DAPA 1YQXA 2O4UX 2J5RA 3N7UA 3ORFA 3I3OA 4ZICA 1KEUA 1R0LA 5DBGA 1IYZA 1U2GA 3MZ0A 1EE2A 2IRWA 1LRKA 3I9KA 4IDDA 2EG9A 1JLLA 5HA5A 1Q0QA 3AY6A 1AXGA 4J90A 1SPXA 1UP6A 1VE9A 1Y5MA 3LT4A 5C3MA 2HJRA 4BO9A 3QVWA 3VPHA 1I10A 3COSA 4IINA 4N54A 1E92A 1X13A 4NH4A 3A06A 3QWAA 4WCFB 2QX7A 2ZTVA 2CZCA 5I7FA 4HX5A 3PJGA 3O9ZA 4J2HA 5A5FA 3GNTA 4WASA 2W2KB 3P19A 4PLFA 3D5QA 3SC6A 4Z0PA 1UAGA 4XGNA 1H6AA 3BTSA 2J5QA 4CM7A 2VRBA 1N92A 1P1FA 5CP8A 3WWZA 4EJ0A 1CYDA 3OJFA 4W99A 1VL8A 3WGHA 4IGFA 3U09A 1SC6A 2BELA 3JV7A 3NTOA 5F3RA 3BYZA 3L77A 4MPDA 2Y93A 3UGKA 3M6IA 4K1LA 2AQIA 4YT4A 2D5CA 1ZZEA 1PGQA 1CETA 4YBZA 3VPSA 3QVSA 3TZKA 2DC1A 5JDIC 4CM4A 2ZTMA 1ADFA 1MFZA 2NV6A 1GR0A 1U4OA 2JKVA 5ITVA 2W4QA 1WW8A 3VZQA 4CM1A 3A14A 1R12A 5COAA 1E3SA 3GFGA 5I8WA 2HRZA 3T7EA 3GEDA 1B3RA 1K89A 3CPSA 3GA0A 4PG5A 4YACA 2P9CA 1T2DA 4YTEA 3OA2A 5CDTA 3PGJA 3ZV3A 3CTMA 3ANNA 4IM7A 5KOIA 3X2FA 3OA0A 4XX0A 4EI2A 4KMSA 3G17A 3I9OA 4Z9YA 1DOHA 1B16A 3BZUA 1YRLA 4IY1A 4I9UA 1T4DA 5EPOA 3X2EA 1KYQA 3JQBA 3PHJA 2HK9A 1Z7BA 2X58A 3FR7A 4QFCA 1PWZA 4BKRA 1E3JA 3IJPA 2I3AA 1NQ5A 4GMGA 3Q9UA 1UDAA 2GZ2A 3S2IA 2EGGA 2JHFA 3UKOA 5BSFA 3GVPA 1LLUA 4BNTA 2FPIA 3PXXA 4NJMB 2OHXA 1PS0A 3TL3A 1DRWA 1PZEA 1KERA 3PQEA 4WCFC 1A7KA 5FWNA 1T2CA 2EJWA 4MIEA 4Y8VA 3FHLA 3GH3A 4IS2A 4BS9A 3OQBA 4NBWA 1DJNA 5A3VA 3W4KA 1BW9A 1N1GA 4GLOA 3JQ8A 4J1NA 4JBGA 1GY8A 1T25A 3A1NA 3QY9A 4DPLA 5G0WA 5ENDA 4YA6A 4PVDA 4M89A 1G1AA 2LDBA 2P4QA 4J9VA 2GYYA 4HFMA 1E3WB 5DCUA 2P4HX 1HDCA 1I3NA 3PZRA 2TMGA 3VH4A 1BRMA 4L73A 1JW9B 3F5QA 2VWHA 1N5DA 3FCOA 1DC4A 3ZHZA 4J0FA 2WSBA 4MVJA 4TRJA 4AJIA 2O23A 3H3FA 1WDLA 3B70A 3NV9A 3NDJA 4ZGWA 5CFZA 4BGUA 4CMCA 1HEUA 3L4SO 2RHRA 4FJ1A 2YQ4A 3H3JA 2NU6A 3VZPA 4I5GA 5G4KB 5GMOA 1YB4A 4CPDA 1DRUA 1UDBA 1I30A 4MVJD 4MVJF 4W9NC 4EBFA 3WMWA 3P5SA 5TT1A 4Q39A 1MX3A 1H6DA 5DULA 1VLLA 3JQGB 3PQDA 2OOSA 4HP8A 4J16A 1PGOA 4L0QA 3RQSA 4BGEA 3ZCXA 3RU7A 4J3FA 2EERA 1D7OA 1HWYA 2J8ZA 3AM4A 3NUGA 3ZV5A 2HMWA 1LQTA 1E1MA 1LLQA 2HMVA 3I1JA 2R00C 4JJGA 3DBLA 3FF4A 1LRLA 4WOJA 3K6JA 3JD3A 2O3UA 5FF9A 4E5NA 5ILGA 3H9UA 2EKQA 2YZ7A 3AI1A 1XU7A 3MCVA 1HTBA 3DBVO 4FW8A 3HDJA 4D0RA 4DLAA 3PLRA 4DMMA 4KZPA 3W4IA 3W4JA 3L6EA 3T7CA 1GAEO 3ZU3A 5HM8A 5AVOA 1QP8A 2WJPA 4NIMA 4XA8A 3AWDA 1U3VA 2ZB4A 3PZBA 1I32A 1T2EA 4N5LA 4P38A 1HDRA 4AJKA 2YFQA 4ALJA 1U8XX 2NU9A 2VZ8A 1EEHA 1CJCA 5I7SA 1BDBA 3EMKA 1XELA 3R3SA 5JYDA 4PZCA 3CIFA 5DF1A 4BMNA 1RPNA 2Q1TA 5BNFA 1SEVA 3LF2A 3JD0A 4J6FA 5ADHA 3ZV6A 4LGVA 1Z73A 1EK6A 1U4SA 1O9BA 2CSUA 4CM4B 2WD7B 3MJEA 3ETGA 2QW8A 1NX6A 3FNGA 3FTNA 2JAPA 4RVFA 4TSKA 1ZJZA 3WGZA 4DC0A 3NEPX 2ZTUA 3I4CA 1GZ4A 2HMSA 3JQ7A 4AVYA 3OM9A 3Q9NA 3K5PA 4WUVA 1MG0A 1TT5B 4B7UA 2B5VA 3INRA 5FI3A 1K2WA 4P4GA 1IPFA 1IPEA 4GAEA 5LCXA 3U3XA 4D45A 1OZAA 4MVJH 2XOXA 2IZ1A 4GH5A 5TC4A 2W8ZA 1JVSA 3I9JA 4CV0A 1PR9A 5JS6A 5JYEA 4Z9FA 3EW7A 2Q2QA 1E7MA 1ZEMA 4GWKA 3AUUA 1PR3A 1TA4A 2FPGA 3WYCA 4FSHA 3PHHA 1E3IA 2YHIA 2GRAA 1OOEA 4Q3DA 5TQVA 3V2GA 3QWBA 4PLCA 1NWCA 3H4VA 3WICA 5G0TA 1KC3A 2WYUA 2EKLA 2ILTA 4TZTA 3CUKA 3F4BA 3GMDA 4N5NA 4UVIA 2ZJ0A 3QJ5A 1EVIA 2DU8A 4BNWA 2ZTLA 4XB1A 1BXKA 3NX4A 4I1IA 3RKRA 3WGGA 1BW9B 3JQ8B 1E7SA 4M54A 3DOOA 4R1NA 5DCYA 4HXYA 1ML3A 2BF7A 1O95A 1E6WA 5I9MA 1UXGA 5JXWA 2PZMA 2CFCA 5EQFA 4J7XA 4JLWA 2YYYA 3WNQA 3AM5A 5JBIA 4MO2A 2LDXA 4S3MA 2AMFA 5B37A 1L1FA 1YVEI 3DTYA 1RM0A 2HKIA 2VQ3A 2UVDA 3DMTC 4AG3A 4CUKA 4O5OA 1DLIA 5HS4A 5CG1A 3S1LA 3WTCA 2TMDA 4NBTA 1KVTA 3EK2A 2CVZA 1HSOA 4TROA 2QZZA 3UVEA 1EBUA 3DO5A 4MOWA 1GU7A 3VVCA 4XYEA 4PG7A 2BKAA 2P9EA 2Y1DA 3WSVA 1R0KA 4MVJG 4EITA 4Q9NA 3GN2A 4Q3NA 2C82A 4OAQA 2AG5A 3TFQA 2Q49A 4PLPA 3VKVA 2PK3A 4NDNE 4DIFA 4G5HA 7ADHA 2VYNA 5U1PA 2V6FA 3HHPA 1ADCA 1GPJA 1NBOA 1CEQA 4XYLA 3AY3A 3JQBC 1AHIA 3OJ0A 5EERA 1WMBA 2QYTA 1W0CA 3DBLB 2P91A 2FOIA 2X0JA 4JNKA 1X7GA 2Y0EA 3MWDB 2P68A 4YAEA 3WJAA 1UP7A 1UXHA 1PJ2A 1BG6A 2PGDA 3ENNA 3LQFA 2VYND 3JYQA 1MLDA 2ZJ1A 4EGFA 1PJSA 1GQQA 4XQGA 3KETA 4Z3DA 1EK5A 1V35A 1ZFNA 2CDBA 1WNTA 4F45A 4RLSA 5MDHA 3HQ4O 3ZHBA 2Y68A 4NK5A 1WLYA 1I5RA 2GZ3A 4ND3A 4IDEA 4XDZA 1ONOA 1KVQA 5A9RA 3I83A 3L07A 4HNHA 5A3JA 4GWGA 3LLSA 4YJDA 1H5QA 3ASVA 5A9SA 4JP2A 1AN9A 3PWKA 1V9LA 3H9JA 1BSVA 3HDHA 3DFUA 5JPIA 4CMEA 2C0CA 3O4RA 2VZ9A 5KVQA 5JFOA 3ZWYA 3DZGA 5GZ1A 4RVUA 4D3SA 3DHEA 1PJLA 2NSDA 3GHHA 3GGGA 4LMRA 2D8AA 1HLPA 5IJZA 1NM5A 4XZ3A 5T64A 5DBIA 5IN4A 2O3RA 4YDRA 4YT5A 2I3GA 1SAYA 2UAGA 3JQ7B 3OFSA 4DUPA 3E6AA 4IQ8A 5HTOA 2Y1EA 1PJCA 1Q7BA 4CM3A 4OXKA 1QXSA 1ZW1A 2H63A 1B14A 2QIOA 4OXNA 4RF3A 4YVFA 2O2YA 2E37A 4H3VA 1UXKA 3RSHA 3ZWXA 3FTPA 4RF4A 5JY1A 3Q11A 1GCUA 4PFJA 2VUTA 3NTQA 3GVCA 3P2YA 3RC2A 2VRCA 4B3HA 4BMSA 1EFLA 3WIDA 3NKLA 5F21A 2X5JO 1E7WA 2X9GA 4RGBA 2A94A 5DN9A 4IS3A 4RO0A 2GERA 2YHIB 2OXIA 1GYPA 1P33A 1P0CA 1C0KA 1YQGA 3AFNA 3HG7A 1HYHA 3IP1A 3LC1O 4R69A 5EQDA 5JC8A 4EUFA 1VC2A 2VRCD 1F0YA 4IXWA 4PLWA 5EMHA 2YV2A 1HZJA 3ZU2A 1H9AA 5IDWA 3K8ZA 1R4NA 4II2A 3AY7A 4U0JA 4BB6A 3LF1A 2PZLA 1LEHA 1Z6ZA 2GGSA 3OJOA 1X1EA 3FPCA 3RUAA 5JDIA 5COQA 2G76A 4HFJA 4L8VA 5KCZA 3LT2A 3FD8A 2O7QA 2DLDA 3ZZNA 2YV3A 3DBRA 3EZYA 4JN6B 1LLCA 3M1AA 4EJMA 3DZJA 3DZFA 4JK3A 5L53A 1DO8A 5KJ6A 3KB6A 2RCYA 1GZ3A 3JCZA 1ONPA 2I99A 1W4ZA 1JAXA 1YH3A 4O0LA 2CNBA 3EGOA 2RH8A 2P5YA 1ZNQO 4YAIA 1QSGA 3DAPA 2HAEA 4RDIA 1W73A 1QKIA 4FC7A 3GUCA 1HE3A 5JE8A 1QMGA 3NDIA 3CZMA 3PWZA 1V6AA 2D3TA 5FYDA 5G0UA 3VOSA 3PPIA 1VKNA 3ZWOA 1F8FA 3ADPA 3PFWO 3WYBA 3OHSX 2V6MA 5HRUA 3VTFA 5TJ9A 1E3EA 3C85A 4JP3A 1F06A 3NGXA 4YRDA 4P22A 4DTIA 2GN4A 4KDEA 2B4RO 4TKLA 3ZWPA 3KLMX 3OIFA 3NT2A 5A06A 5F1OA 4FFNA 4WLVA 4ZJUA 1ZH8A 2BGKA 5K0ZA 3F3SA 2QRKA 1QV7A 2YHUA 3U9LA 2CMDA 4A7PA 1UZLA 4BV9A 4FGSA 4IDBA 2EF1A 4YXFA 2ZB7A 4YAJA 4HUJA 1GUYA 1UXJA 3GGPA 1GCOA 1ISJA 2B37A 3WTBA 3PYLA 5CEEA 3GT0A 1V8BA 1YBMA 2ZYGA 4AJOA 2P5UA 1B3BA 1M66A 1IL0A 1YOVA 3C1TA 3Q6IA 3RKUA 2EV9A 1ARZA 1O94A 3KRTA 4ND4A 3JD4A 4NNJA 1DLJA 1B0AA 1K3TA 2VT2A 3AOEA 3ON5A 4R01A 4XR4A 3TOZA 1FDUA 3SXPA 3WGIA 4J1TA 5A9SB 4DREA 3ZGYA 3O26A 2JFFA 4PRKA 4DYDA 5I7EA 2BFAA 1H0KA 1BTOA 1Q7GA 4URFA 1I8TA 1NAIA 4OHUA 2AQHA 3H5NA 3K96A 3F47A 4J1QA 5ER9A 2AE1A 3D4OA 2UUPA 3FRJA 4NG5A 1DBVO 5JAIA 2Q2VA 4BO8A 1U7TA 1GTMA 3OEWA 2Y0CA 4CMIA 2HUNA 4RPJA 3L0DA 4N18A 3OBBA 2J5KA 4UVDA 2RIRA 1MB4A 3H5AA 3ONFA 4IJWA 4QECA 2AQ8A 2O3TA 1NPYA 1F12A 3PTZA 3V5NA 4E6PA 1YO6A 2DTXA 5IZ4A 4XQ9A 3RUDA 1GYQA 1KEPA 4UAGA 3K92A 2VT3A 1PGNA 2FMUA 1XG5A 4L75A 4OQZA 4WLEA 1QR6A 2OORA 3RUEA 3ZNNA 3Q2KA 2R6JA 5I9LA 3RC7A 4WLFA 1D4FA 4ND5A 4TKMA 4AJHA 3B1JA 2X7HA 5THKA 3ROQA 3ULKA 1ZSNA 1OC4A 2VOJA 1R4NB 2OGUA 4M86A 1T4BA 4WPGA 4K28A 4KUEA 1I01A 1LRJA 3OJEA 4CQMD 5CAEA 3ZV4A 2JD2A 1ZIDA 1QYDA 3K2BA 4R54A 4XD2A 3DBRB 4F6CA 1WZEA 3M2TA 3ZNPA 3D1LA 4E12A 2JD1A 5KKAA 4BKQA 3PJDA 3BMOA 3TF5A 3VPFA 2XXJA 4YQYA 1W6UA 1L7DA 1UAYA 4WLOA 2ZK7A 1C1DA 2CDCA 2ZB8A 1JU9A 1N9GA 4Z0TA 4CL8A 4YRAA 3VZSA 3O03A 4UEJA 3V8BA 3JQEA 4KOAA 2VN8A 1SZJG 3BHIA 2ZATA 3PIDA 1UH5A 2OBNA 2XPCA 3VKUA 4R1UA 1R15A 2NTVA 3MJVA 2BI7A 2H1SA 3VPGA 4Z6KA 2BFMA 4DC1A 4BKOA 1YJ8A 4BNMA 2VUSA 4DLLA 3MJTA 1NP3A 1ISFA 4ZQHA 3PDJA 1M76A 2HDHA 4ILKA 4K26A 4NBRA 4J49A 3AUSA 2JCVA 3GZNA 4TRNA 2CVQA 3GK3A 5KVSA 4OQYA 2Z95A 4O59O 2QYSA 3PEFA 1QG6A 5EINA 1X14A 3P7MA 4X54A 3M2PA 3KXDA 4LMPA 4BIIA 1P31A 1XLTA 3I4FA 4B3IA 3PIIA 4CLXA 1PQUA 1R16A 4PG4A 5B1YA 2X5KO 4M55A 2AQKA 4ROSA 1BVUA 3SJ7A 1Z75A 5THQA 3GC6A 4F3YA 4WLNA 3DMTA 1G0NA 5B4UA 3EC7A 3CSDA 2ZIZA 4R51A 2VUUA 1XSEA 3AU8A 4O63O 3CINA 2HJSA 1SNYA 3G3EA 2GPTA 1B15A 1YOVB 4M49A 4ALIA 3B6ZA 2UUOA 3KVOA 4MVJM 3PHGA 2FPPA 1XQ1A 1YB1A 3I23A 2OP1A 3S55A 4Y6PA 4Z9XA 4L4SA 2FP4A 3VDQA 2I5PO 1EZ4A 1DHTA 3BMQA 3CE6A 1JTVA 1VI2A 3QLJA 1NASA 4TVOA 5JSFA 1UR5A 2IEBA 4D3DA 4BNHA 1LQUA 1JDJA 3ROKA 3JTMA 3UICA 1N7GA 3C8MA 1CRWG 2OBYA 4B7XA 4FJ2A 1CERA 4BVAA 4XRGA 1IE3A 2Q3EA 5T8KC 1IHXA 1MXFA 3E18A 5JMPA 4J9UE 1W8DA 4NJOA 5AXCA 4E4YA 1PQWA 4NQZA 4R5MA 1EMDA 4CL3A 1HDYA 5ES3A 4J91A 1DRVA 4CMIB 3C24A 4W7HA 2JL1A 2PZJA 4R16A 4P4NA 4K6FA 3W8DA 1H94A 4W7IA 1MC4A 4HY3A 1YGYA 3FBTA 1QLJA 4D42A 1EUCA 1NXQA 4IQ0A 4ALKA 3LT0A 3R6DA 4QO8A 5KKCA 1YE3A 2PKQO 3TQHA 1ISMA 1GADO 3DTTA 1HL3A 5TX7A 2HK8A 1HDXA 4NMHA 4U7WA 3K31A 2OMEA 4AJJA 4UVEA 5TGDA 2BGLA 2HSDA 4U5QA 3TZ6A 4KTTE 4RQTA 2YJZA 1I3LA 1ISIA 4BKUA 2I65A 3ZDFA 1MG5A 1R66A 1LUAA 1ZKMA 3R1IA 3FNHA 3VH3A 4CMBA 3F9IA 2PKQP 3SC4A 4BNLA 5L7TA 4OSPA 3DEYX 3UW3A 4FD3A 1KY5A 1QORA 3F5SA 1U2DA 3GGOA 1VL0A 2JHGA 1YL6A 3AOEC 3E8XA 1E6UA 2ZB3A 4Q3BA 2ZQZA 1N1EA 3CMMA 3BMOB 4E5PA 3LDHA 3LK7A 1E3LA 1HF3A 5JC1A 1DIAA 1OFGA 5BNIA 1Z74A 4GGPA 1J0XO 1N9GB 1MV8A 4J7CA 3JD1A 2DBZA 3FWNA 3IS3A 4G2NA 5KJFA 3CZRA 1JWBB 1KIFA 2O4CA 2AA3A 1X0VA 2EGHA 1DC3A 4IMRA 4I08A 4OKNA 1Q2XA 4DA9A 1E7QA 1J4AA 1NFRA 2DBVO 1Y8RA 1CWUA 3H9QA 4M1QA 4A10A 5TS3A 4BOYA 1B7GO 1T24A 5A04A 3ST7A 2FR1A 1O6ZA 2FSSA 3MTJA 3F46A 3S2FA 4IIUA 4RLHA 4YQZA 4WOKA 4CV1A 3E5MA 3GZNB 3FSRA 4BL5A 2PD4A 4I5FA 4EW6A 4DYVA 4ALLA 1CQJA 4CUZA 3H9EO 2VTDA 5JNLA 2C59A 4PRLA 1NVGA 2O50A 3GHYA 4LISA 1B26A 3AOGA 3PFFA 3RAJA 2Z1NA 5JAMA 3W8EA 4GI2A 1ZMOA 3ZNQA 4YT8A 4I9NA 3RJ5A 3RUFA 3M1LA 4QSMA 3GVHA 3RFVA 2JCYA 4PLHA 1PJQA 2NU7A 1GYRA 3AM3A 5TRTA 1DIBA 3IUSA 3ZI0A 2C7GA 3C7CB 4MKXA 1NHGA 4O6VA 4QX6A 2P2SA 4I5DA 4G65A 4MDHA 3IP3A 1QRRA 3AI3A 1HYGA 3KSUA 4BO3A 5FEUA 1ISHA 3MTGA 4YRBA 1DEHA 4DIBA 1OI7A 3LLVA 3RASA 2CF6A 1C1XA 4HBGA 4C7KA 4AJ2A 4WECA 2GN9A 1YBAA 3GNSA 5CEFA 3IJRA 1OBFO 3BMQB 3PQFA 4IIVA 2CF5A 3JYLA 4BNJA 1ZXBA 4ND2A 3OIGA 3HSKA 4NI5A 3AW9A 1WDMA 2AEFA 4YJGA 3LVFO 4XQCA 3D3EA 3E03A 1NPDA 4UUMA 1JA9A 2PGLA 4JIGA 3UOGA 1HXHA 1P9LA 3O8QA 4BNIA 1U3TA 4DPKA 1Q1NA 4U8GA 4ZQGA 1K6XA 5ITWA 4YB8A 5IAAA 1NNUA 4D43A 3DL2A 4BNYA 5A5EA 3Q1LA 1K0UA 1QYWA 4RF2A 4PG8A 5C37A 2NVUA 3G1TA 4LK3A 2NADA 1D1SA 2ZCUA 3WSWA 1H93A 1NPTO 3H7AA 3U4DA 4IDCA 1M75A 5F1PA 2Y0DA 1V0JA 3NJ8A 5L9AA 3JYOA 1FDSA 2FHSA 1IY8A 4AJLA 3VH1A 4E31A 1YS4A 3NRCA 2O3JA 1PIWA 1LDNA 3R0IA 3JQFC 1YL5A 4BNKA 3WX0A 3DB2A 1LDMA 3U4CA 1MFPA 1ZK2A 4Y6SA 3DZBA 4R1TA 2Q46A 3PI7A 3GN1A 3LT1A 3I9NA 2YW9A 3NDRA 4IUYA 1YB5A 4ZRNA 3I52A 4BO4A 3BMNA 4DQUA 4TRRA 2C5AA 4F46A 4R9RA 1VPDA 4ZD6A 1HDGO 2W90A 5BT9A 1PWXA 3STHA 4BNUA 4HNGA 2FY8A 5CPBA 1HDOA 1EVJA 3MJ4A 2DVMA 1DSSG 4RVSA 1DAOA 4IDAA 1DXYA 3NT5A 4U6SA 3ANMA 4B4UA 2PFGA 1P1KA 1U5CA 2JAHA 2Q4BA 5G2OA 3UXYA 1ZVMA 3WLEA 4D79A 4MKRA 5LDGA 1GZ6A 3EDMA 3LYLA 1SOVA 1KOLA 1H2BA 3HB4X 2EW8A 3PDUA 1D8AA 4PLZA 4Y98A 2A9FA 2PY6A 2EP5A 2WM3A 2DQ4A 5AXAA 4EEXA 1UUFA 3F4LA 1KC1A 3PRJA 1Z7EA 2D0IA 1IHYA 2H6EA 1DB3A 3U62A 1FXSA 3W8FA 3ZH2A 2RH4A 3PVZA 4UVHA 3RBVA 4IJVA 4R1SA 3OQ6A 5EN4A 3KBOA 5BSGA 4R3NA 1EQ2A 1R37A 4UUPA 5GY7A 3WMXA 3WDSA 3E9NA 2JD0A 1ORRA 3PJFA 1GEEA 4WNIA 3QV1A 4Z3KA 1VKOA 5BSHA 4OMUA 1BMDA 4D44A 1O89A 3H2SA 5ENVA 2X5OA 1ZK0A 1JWAB 5KNLA 2YQ5A 2IEDA 3WR5A 4L4XA 3PHIA 2VYVD 2WMDA 2GN8A 4TRMA 4EYEA 2AEMA 4RDHA 3HWRA 5C5IA 1LSSA 4LW8A 1XYGA 5A03A 4S1VA 4P8RA 4GMFA 1P1IA 4GVLA 4IGEA 4WEQA 3U0BA 1NYTA 3RIHA 1NR1A 4BO7A 4MJLA 2RBEA 3AJRA 2FR0A 1YDEA 1ZK4A 1ZJYA 2YY7A 3FN4A 1BHSA 2OZPA 1QLHA 1G6KA 4ZHSA 2J3KA 3AUTA 4NFHA 1XGKA 2J3JA 4UUNA 3UN1A 1KBZA 1ZO8A 1HYEA 1ZSVA 4KTVE 4CLOA 1C1XB 3T4EA 8ADHA 1KVSA 3I5MA 4OO3A 1MA0A 3SJUA 3BTOA 5JY6A 3DC2A 4HKTA 5JAZA 1EUZA 2A4KA 2W2LA 5BR7A 5L4LA 5G0SA 1LC3A 5TLSA 1BWSA 2OP0A 3QRWA 1LBEA 3GG2A 3OICA 3W1VA 1PS8A 2HK7A 1A4UA 2HRBA 4GPD1 3DWFA 5IZCC 4FFMA 1I3KA 3WQSB 4C7JA 2GDZA 3GPIA 1DFGA 4TWRA 3JQAA 4YJGB 1T2AA 2X4GA 2NACA 3SLKA 4GGOA 5CDSA 3HZZA 4BQPA 2C54A 3O8QB 4PGFA 2W2LD 3D64A 5U4QA 5H81A 2PR2A 4J4HA 5F1KA 3FNFA 4QO7A 3DR3A 4PN3A 3JQAD 3DZKA 2NVUB 1O5IA 1BXZA 3JYNA 1C3VA 3EHEA 1SOWA 4AFNA 1M6WA 3E82A 3D4NA 4A5OA 5JO0A 2DPGA 5BNTA 3MEQA 5DZSA 3VZRA 2B0JA 1YL7A 2O3SA 2HO5A 2WTBA 4OYRA 4C4OA 5ICMA 3FNEA 1YWGO 2B35A 4OJNA 1I36A 4AJEA 1DDOA 2VHYA 1E7YA 2BLLA 2I67A 4RL6A 3RC9A 3OF2A 2WE7A 3F6YA 4FR5A 1E7RA 3CEAA 2SCUA 2ZCVA 5TT0A 4YJFA 1YBVA 3BMNB 5K6AC 3QVOA 2IZ0A 3DZIA 4CQLA 5IF3A 1M6HA 4ND1A 4CMHA 2E48A 3O38A 4Y6RA 5T8KA 1PL7A 3UF0A 4KQWA 4BNVA 2D2IA 4LRSB 2D1YA 2BGMA 4RPGA 3INTA 2G5CA 1EUDA 4J4BA 2O7SA 2F00A 3FWZA 1QV6A 3ETEA 3OECA 3ASUA 4BGVA 1IUKA 1C0LA 1EQUA 2IXAA 2VHVA 3DAFA 3N74A 5JW6A 1WMAA 2OUIA 3DHYA 1YONA 3L6DA 1EFKA 3NYWA 4OH1A 3DXFA 3QWIA 3GVIA 4XYGA 1PEDA 2GR9A 1EBFA 2I9PA 1ONNA 2UDPA 1X7DA 4MVJI 1ADGA 4WGGA 1ZK1A 5J23A 4D0SA 3D5TA 4XEHA 3KO8A 1EDZA 1PU2A 1X0XA 2AE2A 2Y67A 1QYVA 2VTEA 2V6BA 2XXBA 5CPFA 5JMWA 1P0FA 1JKIA 3F1KA 3IMFA 3KOUA 1HDZA 2XAAA 1RYDA 2GZ1A 2B36A 2FZWA 3JQCA 4JJFA 4MVJP 4AL4A 2Q99A 2DBQA 5HWSA 3TNLA 1XKQA 1JKJA 3KYDA 5DT9A 4A03A 3OIDA 5ER6A 3TSCA 1LX6A 1OC2A 3RU9A 3TWOA 1HE4A 3VDRA 2NM0A 4FC6A 4TZKA 1DPGA 5B12A 3DDNA 4CUJA 1E5LA 1DFIA 5IFLA 4IXTA 4RVHA 4ZQEA 5DOVA 3HB5X 5C7LO 4OXYA 3TZQA 1XA0A 3BHJA 2GUGA 4XGIA 5GZ3A 2H5LA 1LJ8A 3I9LA 4DQXA 1M67A 4NBUA 5T57A 3WYEA 2Q1SA 3CH6A 4R3WA 3RC1A 5I8ZA 1E1NA 1A4IA 1SB8A 4UUOA 3T4XA 1U7HA 3VVBA 2XF8A 3DHNA 3QIVA 5L4NA 3ITKA 2NUAA 1KEWA 2DFDA 3ZWAA 2X6TA 1PX0A 1Z45A 3AK4A 5G0VA 2PLAA 1Y8QA 2GASA 3QW2A 4OKIA 3WXBA 1F8GA 3DFZA 1YKFA 4FPXA 3Q3CA 5TNXA 2WYVA 2NWQA 2YUTA 2IXBA 3VPXA 3L4BC 5T5QA 3BTUA 3GOHA 1LDEA 2QRJA 3JQAB 2O2SA 1MGOA 4XJTA 2CD9A 3UCXA 1IZ0A 4A73A 3RD5A 3V1TC 2D5AA 1WWKA 1XIVA 1T26A 4CQMA 1JQBA 1M2WA 2R2GA 4NJMA 1TXGA 2GNAA 1N8KA 3IKVA 1ISGA 4P4LA 1ZMTA 2C7VA 1P3DA 1DJQA 3ZHXA 1I2BA 2QG4A 4B4VA 2C20A 1ZBQA 5C7IO 2CUKA 1R6DA 3MWEB 5U9CA 1Z82A 2BHLA 1E6EA 5IN5A 2Y1FA 2F1KA 4EUHA 4ZVVA 4B8WA 1GD1O 4GX0A 1LDYA 2DM6A 3D7LA 3G0OA 1GL3A 1HE5A 3D0OA 2BD0A 3JYPA 1SO8A 3GRKA 4GX5A 5KWEA 4RPHA 4Q3EA 1LNQA 2A92A 1IULA 1DIGA 2QHXA 4RJTA 3AI2A 4J7UA 4E32A 1QYXA 5L51A 4E13A 1MP0A 1UDCA 1Q0LA 3DMYA 3G79A 5KJCA 3I6QA 3IOYA 4E33A 3SLGA 5F5LA 3BAZA 1SEPA 1JAYA 4B7CA 4WKGA 3IIEA 4CQLB 2DPHA 3RUIA 2CDAA 2P9GA 3OMLA 3VAZA 2HU2A 2ZYAA 1T1SA 3CMCO 3VH2A 1IB6A 1JVBA 1K5HA 4MIOA 2NU8A 1LSUA 2PTGA 3QWHA 4AJ4A 4DVJA 2ZQYA 1DC5A 4ZA2A 3EAGA 2C07A 4BKPA 3L6OO 1GQ2A 3UUWA 3JQGA 4L74A 3QQPA 4BNFA 4IQGA 2PWZA 3ZWCA 4WLUA 1VM6A 3PK0A 3WGYA 1PJ3A 3OJLA 4LN1A 2ZKLA 3UCEA 5H83A 4MIYA 4E5YA 3UH1A 4I5EA 2AXQA 1B8VA 1C14A 3GZ4A 1LDGA 1P77A 1J6UA 3DBHA 2JFHA 5EL0A 3WQRA 1U1IA 3GR6A 3S2GA 2V6GA 4LCJA 1Y1PA 1ZXLA 2PV7A 4ONEA 5GZ6A 4BO5A 4CR7A 2B69A 2BI8A 4GKVA 3UHAA 3JQFA 2Z1MA 1XWFA 3JQ9A 2W98A 3AUAA 3KYCA 4XIJA 2AG8A 3DOJA 4YAKA 3GY0A 5KJ1A 1A27A 4BB5A 4L4RA 4RVGA 3KYDB 4AJPA 4EJ6A 1J5PA 1HLDA 3HFSA 4O1MA 4XGKA 3WNVA 4E30A 1T2FA 4B4WA 3LU1A 3UFXA 4BV8A 2C29D 4E21A 3GRPA 5A1TA 3ZW9A 1RM3A 4WE3A 1EVZA 2HCTA 2Q1UA 4GLLA 4FGWA 4IDFA 4CM9A 3L9WA 4DL9A 3PGXA 4INAA 3ADOA 4E2WA 1KEVA 2VNSA 1I2CA 1E0DA 3EVNA 1H6BA 3LC2O 3QHAA 4D3FA 4KUHA 2WD7A 2I66A 2BMAA 2DTEA 2WYWA 4JBHA 4ESOA 1BDMA 5G4LA 5L4SA 4YAGA 9LDTA 2VZ0A 3ZWNA 4CM9D 3K9QO 1JKFA 2VHWA 2G0TA 4KP7A 3GVXA 1TT5A 3V1UA 3WQQA 2IZZA 1Y8QB 5H82A 1RWBA 1HETA 3ENKA 3GDOA 3VHRA 3WFIA 1DC6A 5FFFA 2I6TA 1LDBA 2EIHA 1U8FO 3RWBA 1OAAA 2HMTA 4NU5A 4CV2A 1GV0A 3VTZA 4BUCA 4RZIA 1AXEA 2ET6A 4II3A 1HT0A 4OGWA 3NJ4A 3DOCA 4R4JA 3B1FA 4R9SA 2DBRA 4UEKA 1Y5RA 3ZWBA 1SB9A 3RBXA 3E1KA 5ILOA 4CLRA 2VWQA 3EZLA 4CQMB 4KUGA 4RF5A 1UXIA 3ZU4A 1A9ZA 2A35A 4QTZA 3INGA 1I3MA 2FN7A 4JX8A 4H16A 4W82A 3ICCA 1LXCA 4F6LA 2GF2A 5B4TA 1ZEJA 3PYXA 4QQRA 4LSWA 2PKRA 4N5MA 3KSZO 4DBVO 5KIAA 3SX2A 2IODA 4K9DA 7MDHA 4Y67A 4FS3A 1P1JA 4HFNA 4I9HA 3TOXA 5AXDA 2X23A 1BXGA 4A27A 4GKBA 2NTNA 2PZKA 2X9NA 4W6ZA 5DP2A 3WJ7A 4EUEA 4XWYA 1FJHA 3L9XA 4Q3AA 4IZIA 2JFGA 1LSJA 5JCJA 3ZWVA 1C1DB 2X1HA 1I33A 1TEHA 4XB2A 5CG2A 2C2YA 4XCVA 3B20A 4W4TA 4RORA 3JD2A 3GEGA 1PJ4A 5IZCA 3BIOA 4RVDA 3WOHA 1PL8A 2C5EA 2VCYA 4CLEA 2VWPA 1Y7TA 2JCXA 4GQAA 1XQ6A 1NQOA 5JCJD 5JLAA 3BA1A 4FJ0A 2PD6A 1LTHR 1XCBA 2AEJA 2E82A 4GVXA 2NQ8A 3GAFA 2DUUA 3RUHA 2GCGA 4WNCA 1ZUD1 4XRRA 4JGBA 3GDFA 2B4TO 2EJVA 1NAHA 3K30A 3NGLA 4QUKA 5LC1A 2PNFA 3WS7A 2EXXA 3PP8A 2FRDA 1MUUA 3W6UA 3KUXA 1TT7A 1J49A 4PVCA 4B8ZA 4HFRA 5DDIP 3IQDB 3DBHB 3KZVA 3ONDA 4RQUA 5KVCA 4ALNA 2FWMX 4I8XA 3WBBA 4A26A 4BQRA 5CDGA 3PJEA 1UZMA 3E9QA 3I6IA 5JO9A 2EW2A 4YT2A 1FDVA 1NQAO 3KYCB 4FCCA 3AFMA 1AE1A 2CY0A 4M8SA 6LDHA 1DAPA 1G0OA 3OEYA 4DXHA 2G82A 1VJ0A 3TPCA 5K6AA 4OOEA 3WFJA 1ULUA 3ROMA 4DLBA 3GFBA 4LCEA 1CF2O 1Y9AA 3A4VA 3GMSA 2POQX 1PJBA 4NFYA 4ZRMA 2Q2WA 1A5ZA 4CR8A 2E6UX 5DP1A 4PCVA 3PLNA 2BH9A 4AJNA 2Y1CA 3WLFA 3RI3A 4LRTB 1PZGA 3ICPA 1F14A 3G1UA 5KJEA 2NVWA 1R4MA 3I9MA 4QEDA 2FR8A 2J3HA 4D46A 1VSUA 4E2XA 4GL4A 5CDUA 1WPQA 1C0IA 5T67A 2OFPA 1GPDG 4NFSA 2GO1A 3ZHYA 2C2XA 2WEKA 3HDYA 3NT4A 1WP4A 4OSOA 1ADBA 4PLTA 2Q50A 4N7RA 1LC0A 3IKTA 3U49A 4LVUA 2BFPA 1RM4A 3Q0EA 3H9GA 1AUPA 1NFQA 3TZHA 5TSDA 4FN4A 4YEDA 2B4QA 3JQ6A 1U3UA 4IZHA 3TDKA 4NU6A 4M87A 4B79A 5EJ2A 5JAQA 4R41A 1MXHA 4ALMA 4XQEA 3RVDA 3V1YA 3ZNOA 6ADHA 2EWMA 4BO2A 1ULSA 5IG2A 1N2SA 4CLRB 3PYMA 1V3UA 1H2HA 1O0SA 1PGPA 2AW5A 1JN0A 2IYPA 3HE3A 5TJHA 1XEAA 3WGOA 1ZSYA 4QFDA 5I7VA 5K9ZA 1GQYA 4J0EA 4ZN6A 3PWSA 4WCDA 3DONA 2WWRA 3JQ9C 4B3JA 4PZDA 1FDWA 3F1LA 3WBFA 3WGQA 1MC5A 4DPMA 2Q4EA 3PHLA 3GPDG 4YR9A 2WD8A 1GV1A 4RPLA 1H9BA 1KVUA 2Y99A 3IL2A 3BTVA 5AXBA 4L9RA 4E0BA 1BXGB 3KHUA 5L95A 4MKZA 1HSZA 4BNGA 5A4DA 5I9NA 4CLDA 3TJRA 2WE8A 3D4PA 4B4OA 5DCWA 4FBGA 1ENYA 3G49A 3MJCA 4LVCA 3RROA 2HLPA 2NLOA 2D59A 4BMVA 2Y66A 3GEMA 4CMAA 1PZFA 3H65A 4R68A 1NWHA 4ITUA 1NHWA 2PH5A 2VHXA 3L4BA 3TZCA 1UJMA 3GQVA 1O8CA 2G1UA 4XYMA 1BVRA 1IZ9A 1RYEA 3HFGA 4U6QA 5JDCA 1X15A 3B1KA 3EYWA 1Y8RB 3ANLA 3LSYA 3TRIA 3V2UA 1TI7A 2O48X 3QA9A 4A2CA 2FSVA 4GX2A 3RUCA 2X86A 1ZK3A 3ZWWA 5AQ1A 2EKPA 4JBIA 4XDYA 4OOFA 3ITDA 4CM8A 4YPOA 2VYVA 3D3WA 4FIZA 1EDOA 4NHEA 3JSAA 3OP4A 1PTJA 4FOSA 4UREA 3QWFA 4WK6A 4CMKA 1NTOA 1X1TA 5AYVA 1KS9A 1XHLA 4R5HA 4YJHA 3OH8A 1Y6JA 5IXSA 1TB4A 4D41A 1PSDA 4TVBA 2NTJA 1A72A 4WJZA 3DAGA 1RKXA 5HBRA 2NQTA 1YJQA 3ABIA 4WEOA 4CM6A 1LA2A 3QP9A 1ID1A 3OETA 3FI9A 1PL6A 2DFVA 2V65A 2CVOA 4CMJA 2DUWA 1Y81A 3N58A 3H6KA 4FDAA 4OL9A 2Q45A 3TL2A 1VJTA 4KWHA 4Z0HO 5TF4A 2J3IA 3NTRA 5F5NA 2OO5A 5L3ZA 1NVMB 2IDZA 4RV9A 4UULA 3KEQA 4BO0A 3OQ1A 3MOGA 1UZNA 2B83A 3ROPA 4YCAA 4K6CA 4NZ9A 4KWIA 4ZQFA 4DWVA 4CR6A 3KYBA 4PG6A 2DT5A 1R4MB 4HV4A 3K73O 3GDGA 3SBOA 1P1HA 1PQPA 2WDZA 3GAZA 3BXXA 3DQPA 1GFSA 4XR9A 2V7PA 4XIYA 1HE2A 2HQ1A 1S6YA 4PLYA 1TLTA 1R0SA 4PLVA 3HDQA 3U4IA 3BHMA 4IMPA 4YWJA 4EDFA 2Z5LA 4AICA 4AJ1A 5EESA 5FI5A 5HS6A 5KTKA 4MP3A 4GBJA 5LDHA 3U4HA 3MJSA 1HRDA 2BRUA 3QVTA 4BGIA 1P45A 3H2ZA 2E49A 1UP4A 4PZEA 1KVRA 3U5TA 2GSDA 4NK4A 1PS9A 3KLPX 3GG9A 1FK8A 3SVTA 4MINA 4IPTA 2I76A 2H9IA 4J2OA 5EIOA 4L76A 5BSEA 4D7AA 1YXMA 5CHEA 2X0NA 4OIMA 2X0RA 1U3WA 4Y9DA 1E1KA 1YDWA 1VL6A 4JQCA 4JJIA 2Q1WA 4FB5A 1VJ1A 2GN6A 4FQ8A 3FBGA 4DMLA 2X0IA 4NR0A 4XJSA 1N7HA 4RCVA 5C7OO 3NAQA 1VRWA 2IE0A 3A9WA 1CIVA 1LSOA 1U9JA 2EP7A 4XKJA 1XR3A 5DNAA 3WIEA 3ZWMA 4TQGA 4RZHA 3HN2A 1XU9A 3QSGA 4G81A 2PA3A 5BQFA 3GUYA 1DHRA 3GNQA 2YV1A 4DGSA 3WWYA 1S7CA 1V3TA 2VOEA 3BMCA 3FR8A 2AHRA 4E2ZA 5JCXA 1GEGA 2B5WA 3ZU5A 1KY4A 5CEJA 1WZIA 1A7AA 1SBYA 4U0KA 4J1SA 3C7DB 4FFRA 1YQDA 1XDWA 3KEOA 5DBFA 2EEZA 1ENPA 1P1RA 1V3VA 2O3QA 4CODB 1P74A 1DFHA 1WDKA 3UCFA 3DZHA 3S8MA 1K6JA 4PIVA 1AGNA 1OMOA 4DIOA 3WB9A 1BGVA 3ZW8A 4J43A 1Q7CA 4WCFA 4CM8B 2X9VA 3E5RA 3D3WB 3HJAA 4CMGA 3SEFA 5IDYA 3QVXA 5A02A 4QT0A 2E4AA 1K6IA 5TIIA 2W2KA 1I0ZA 2ZYDA 4JROA 3ZN2A 2Y1OA 2VNAA 3KM0A 2UV8A 4DQVA 5CDYA 5L45A 3CKYA 1H6CA 4FOOA 2DTDA 1P44A 1TVEA 1GUFA 4QXMA 3HNPA 3V2HA 4GSKA 2J6IA 1ZCJA 4YJHB 4E2YA 4UVGA 1B2LA 1CDOA 3C3XA 2PGJA 3RFXA 5L7YA 4YYZA 1FDTA 3C7AA 4NPCA 3OSUA 3GF4A 3CXRA 3LC7O 4GSLA 1A9YA 3ONEA 3IC5A 3UAGA 1GDHA 2PD3A 1Y9EA 3EVTA 1QYCA 3AU9A 1X7HA 2D4AA 3GLQA 4IDGA 3A28A 5IDQA 1E77A 1C0PA 4OM8A 1WXDA 3H5RA 2JJYA 3TFOA 1F17A 1LLDA 4KQXA 4KDFA 5AOVA 1WVGA 2QQ5A 1B8UA 4IBOA 4JCOA 5T6BA 4DBZA 1RM5A 1T1RA 4ZQBA 4CM5A 1HZZA 2IYOA 1DIHA 4CLOB 4GX1A 5L7WA 3RFTA 5B4VA 4FFPA 4J4TA 4EZBA 4W9NA 1CQIA 1U28A 1L7EA 1NR7A 3K2EA 3RJ9A 4BO6A 3R3JA 2VHZA 3VC7A 2X8LA 4CLHA 3QE3A 1DIRA 1PGJA 3IAHA 4JXKA 2DKNA 9LDBA 4BHTA 2Y05A 1PZHA 2G17A 1E5QA 2NNLD 2YDYA 5JDCC 1EVYA 1NVTA 2R00A 3LZ6A 2Y1GA 5COBA 4EEZA 3RCBA 3H8VA 3KTDA 3IDSA 3EY4A 1WAMA 5A05A 2YDXA 2BFOA 3E48A 4XYBA 1A71A 4Q3CA 3IUPA 3TN7A 4E5MA 4BNXA 5MGBA 4MP6A 5ICSA 2X22A 4MP8A 4CJXA 4HADA 3ETDA 5KVVA 3FPLA 4ID9A 3HADA 2RHCA 4FFLA 1ENOA 2VWGA 8LDHA 2QRLA 1NQTA 1FF9A 2EHDA 3RBZA 4BNNA 3KSDO 3MOIA 5DOZA 4UEOA 3WG9A 1E3WA 4NBVA 2QZ9A 4E3ZA 3P2OA 2UYYA 1SMKA 1D3AA 1D1TA 1NFFA 2NVBA 4MVJE 4H7PA 1HKUA 4RPKA 4PLGA 5IXYA 5A9TA
chains in the Genus database with same CATH superfamily
4HR7A 5IDXA 1KETA 2HMUA 2CLLB 2WNSA 2Q5CA 2RK3A 3C1AA 1LV7A 3EE6A 3R7DA 4BJ6A 4C76A 4CV3A 3WGTA 1AHHA 5KSWB 2XZLA 1QF9A 3C1OA 2RAFA 2WMNB 1YACA 3FYSA 3F7TA 4C08A 2BYTA 4NBNA 4DEVA 1ATZA 1EE9A 4DV1B 1TJYA 4MPTA 5EE0A 2WDPA 2OC9A 2WZBA 1E1LA 1Q1ZA 2CVPA 1B8PA 3H9CA 1Q0HA 1GDTA 3NXSA 4IJUA 5C5CA 1DT3A 2OL4A 2V7BA 4M0EA 5G4KA 4C0KA 2FPSA 1ENZA 2HIGA 1PT9A 4Y2VA 3SIPA 4CDRA 4M0KA 5LQRA 3QV2A 3TBKA 1I2ZA 3HNRA 2WT8A 3BEOA 2GJSA 4MV6A 4EFKA 1MO3A 1I24A 1QRUA 1LI4A 3Q2IA 4PZUA 1NTRA 1XVIA 4GZLA 3ZE0B 3HXPA 6NULA 1OFIA 2VUIB 3A58B 1DQSA 1PYOA 5ALUA 2H1HA 3ORFA 4JSRA 1IYZA 3LUAA 1R74A 1QOPB 2VH1A 5E8RA 3I9KA 1QIEA 2NX2A 3KU4A 3V8EA 4ATNA 2H16A 5DTIA 3JALB 4PGAA 4OHBA 4QPDA 3WGNA 4UU8A 4A8HA 1CCWA 1SPXA 1UP6A 1ODTC 1Z2AA 4JYPA 3SSOA 4CF6A 1VE9A 3EAFA 3K0AB 3KUDA 4QBIA 5HUJA 1L3CA 2P0AA 3HV0A 5LMZA 4B6EA 3VO9A 5C3MA 1VKZA 2HJRA 1FBTA 4Z53A 2HI0A 3VPHA 1I10A 1E92A 4FNOA 1PD1A 3QWAA 4QPJC 5JHGB 5A7HA 3C1UA 4HWPA 5EZQA 3WWDA 1C81A 1NMZA 2C77A 3Q88A 3PJGA 4J2HA 1GXSB 2OEPA 1G5HA 1X70A 4CT4B 2NP6A 3WGVA 1VB3A 3MW8A 3P19A 1S1CA 2XUAA 1CLUA 5A5GA 4FGUA 3NYIA 3LOQA 5FWYA 1H6AA 2J5QA 2H5EA 2WNIA 2VRBA 1N92A 1QIHA 3C6QA 3GCWA 3QF4B 4YRZA 3FCXA 1P0PA 4LDQA 1VP9A 3CRRA 4F5WA 4ZT6A 4Z5XA 3CPHA 5C1IA 1DG1G 1MX9A 1SC6A 1VOTA 1WPGA 1DT5A 3JV7A 3ZUPA 2PH7A 3NTOA 4IHJA 3T0GA 1EYZA 3ZWQA 2ZTHA 2Y93A 2V98A 2G0NA 3W5IA 1UPUA 5HK9A 1CUVA 1R0ZA 4K1LA 4UDYX 1ZZEA 1PGQA 4TV8A 3PD0A 1ZCZA 5AKGA 2IOHA 3RAGA 1A1VA 1PL0A 4MXDA 4CM4A 1GG9A 2ZTMA 3H87A 2X15A 4PQEA 3G7SA 2N1BA 4LBVA 2W4QA 3DG9A 5I8WA 5COAA 1E3SA 4PZ0A 4CL3A 2R6DA 2HRZA 4WACA 1YRWA 3EEFA 3CPSA 4L07A 1UKZA 4M1ZA 3HCFA 4XOUA 4Z4FA 3R4VA 1K7CA 3EARA 4TV8F 1YUNA 3BK7A 2O5RA 4DR7B 4YACA 2IOQA 4YTEA 5BV0A 3CIOA 4FW9A 3CTMA 4OHKA 3E61A 2GKOA 5KOIA 3X2FA 4EO9A 4AS1A 3KTOA 4GG1A 4XX0A 2E4UA 4ZT5A 2YQZA 1N1DA 4RXTA 5BQOA 4HNQA 1RLJA 3F8SA 5LQDA 1ZOOA 3EVZA 4IY1A 1E99A 2VYFA 3RFFA 4CT5A 1AKNA 2A3NA 5EPOA 5JCPA 1KYQA 2CL0X 3JQBA 3PHJA 1Z7BA 2ORYA 3LRTA 3VZBA 2XKAA 3ET5A 5DRTA 3PCTA 4PV7A 3ZW7A 2G36A 3LPCA 3DDOA 1TUGA 4P7BA 3W5UA 3ZDRA 5K4HA 1F2DA 3CO5A 1V3QE 2FQYA 1QANA 2VJBA 4G3XA 4JXJA 3UKOA 2PYIA 3PXXA 1GPH1 5DCWA 3RR2A 4B3GA 4OHZA 2HZBA 3CJQA 4HS4A 4WCFC 3IO5A 4TV9A 5FWNA 4AKSA 2ATIA 4JEHA 1T2CA 1H65A 2EJWA 1D2AA 2XNDA 2JRLA 3BJRA 2JRCA 3PSAA 1WCIA 4Y8VA 5KOYA 3V34A 3I01M 3C3AA 4DJFC 3K4PA 4KV7A 1FTGA 1AB6A 2FWIA 3ANXA 5A3VA 4RHXA 5GGYA 3KAJA 1SIWA 3K9NA 1N1GA 1ZI8A 4GLOA 2QL6A 1N2OA 3EQZA 3JQ8A 5LB4A 1JEQA 1BO6A 3NHWA 4D4HA 1KQ3A 3IUEA 3PGA1 1FJ2A 1F51E 2XE4A 1II9A 3F97A 3NIBA 5E9AA 4OFZA 5ENDA 2A1UB 4OXXA 5HG0A 3N3AC 2YWFA 3IQIX 3KFVA 4HFMA 3FJOA 1Z4PX 4BRUA 1YZKA 4TYNA 4GPEA 4YP7A 3UJCA 3VH4A 1UOOA 4QAQA 4MRPA 3WWOA 1AQJA 2J5XA 4U5XA 3NNNA 1N5DA 4LZWA 1MNAA 3GRUA 3E1GA 3ZHZA 4Q21A 1KMCA 5CD9A 5K0CA 4MVJA 2QQEA 5HPYB 4TRJA 4ZOLB 1JIUA 4XPIB 3K70C 3H3FA 4ZGWA 3NV9A 5F7JA 3TG2A 2H2IA 2W11A 3ZGOA 1P62B 2RHRA 1UC4B 1Z5NA 4IRUB 4K46A 2BGRA 2CNOA 2QTZA 5IUKC 3A1SA 4TL7A 5GMOA 4UCFA 1YB4A 4J1TC 5K6RA 2Z2ZA 5JANA 3N0TA 1Y80A 4NKRA 2Z6UA 4MVJF 3DVAB 3MHPA 3WMWA 2XT0A 2I7VA 1AO3A 1VLLA 4TTAA 2XRZA 2OOSA 1TKBA 1ZR4A 1SD5A 5FA6A 4QYXA 4N0QA 5D8DA 2GDJA 2AF3C 5AUOB 3NH6A 4IDOA 1TGYA 2B6NA 1UZAA 1WHSA 2ON6A 1P4AA 2JAUA 4G0YA 4L4YA 3T3MB 3NUGA 3BH7A 1RWVA 1JLLB 2D1RA 3U16A 2B9VA 1LQTA 1LLQA 3EGDB 5HKAA 1H8ED 1DC7A 2HN9A 1KPGA 3CR7A 4OMDA 5DV9A 1TQ4A 2MYUA 2VDQB 3JD3A 4LKRA 4F72A 5BW4A 5ILGA 2XUGA 3DUFA 3BIXA 1RBYA 3IQXA 3UUGA 3MCVA 2PT5A 2ZEJA 4BZZA 1DTEA 4N4AA 4E4TA 4ND8B 1LTQA 1ZD1A 1FSGA 3HDJA 4FP9A 4NRDA 5HZKA 3F8TA 4OHVA 4KZPA 3W4JA 2MDTA 1OVGA 1L5ZA 1KJ8A 1UADA 3M1IA 3IAAA 1QHEA 3RYFA 4CF3A 2PQ6A 3TM4A 5E9JA 2JBAA 2ZB4A 4CRWB 3S1AB 1GG2A 1HNNA 2Q5OA 1HDRA 2FUNB 4AJKA 3GJQA 4U9HS 2YIDA 1X9HA 4IRXA 1OHHA 1ECFA 1X7ZA 2HWKA 4KR3A 1EESA 2NU9A 1EEHA 4FWBA 3U6BA 3THWA 2FPMA 3IX7A 4MGHA 4G1BA 5KYUA 2O7NA 4V39A 5I7SA 2Q3DA 3SDBA 1YRYE 1GGVA 1S2LA 3STYA 2BTQB 5KQLA 2V7UA 2AOXA 1RPNA 2JIMA 2Q1TA 2P2CA 1F20A 2VSXA 3IDZA 3H2BA 3JD0A 4J6FA 5BNFA 4LJLA 3ZKWB 3ZV6A 1C7JA 4DN6A 2XXAB 3MGKA 1FQOA 1Z73A 2A86A 3W8RA 3SJZA 4HAUA 1M0WA 3R3HA 5DLYA 2E55A 2QLLA 3ETGA 2WU8A 1EAYA 4QL3A 5ED4A 1NX6A 1CHNA 2FSGA 2PUHA 3GQBA 3O4FA 5DFAA 1ZJZA 2O0LA 4CTKA 1GNRA 4FHEA 4PGGA 3I4CA 4ZGGA 1GZVA 4YQEA 1GPAA 3ND9A 3OM9A 3U2QA 2PL3A 1MQAA 1ITZA 1SWWA 1OJ7A 2ZJ2A 3DKIA 4WUVA 4IL5A 1TT5B 5DHPA 2GXQA 1E5TA 1W4BA 4P4GA 5G3YA 4BLSA 1RRFA 3VR3A 5IVKA 1TCBA 1CB7A 5LCXA 4QOGA 4RFSA 1MPTA 5JASA 2WVAA 4RMNA 5TGZA 4WBNA 1B41A 1OGJA 1O6GA 3QU7A 2Q6IA 4TMZA 3X2SA 4F6RB 2NXEA 2Q2QA 3OQIB 2ZYTX 4MWTA 3OQVA 5IVDA 1WW2A 1YFZA 5JCOC 1OFTA 3NTVA 2ZJZA 4NG4A 2OTCA 3C6XA 2GPSA 3NAMA 3OD5A 4MSUA 4F5EA 4WK2B 4JYZA 1OOEA 2J7KA 3A27A 5IWCA 1KJWA 2FPIB 4V1CB 2O2IA 2J87A 3ME5A 2F8SA 4NFLA 3D8HA 1CIJA 3WICA 5EZ5A 4WBNF 4S0XA 1H8HD 4IIJB 4WA8A 1D6JA 1MOSA 5F3DA 2ILTA 3SR0A 3ZHVA 1Z33A 4TZTA 3CUKA 3F4BA 3GMDA 2ZJ5A 3QE4A 1P2TA 3K1AB 3QJ5A 4E09A 2DU8A 2OXCA 4MV5A 4F2PA 4JOSA 3NX4A 3I5UA 2RMKA 3RKRA 1K7EB 1F1JA 1E7SA 2UYQA 5DCYA 3DBIA 1JEOA 2QRNA 4NL4H 2MMCA 3BB3A 2REOA 5K20A 3K0EA 2WSIA 2BF7A 3ZXSA 5B5SA 3CVUA 1HKHA 2GEVA 3GRCA 3R41A 1XXHB 1HX7A 221PA 2XUDA 2YASA 4GLFA 4O8CA 3NCHA 1ZD9A 1IHPA 4W8GA 4F04A 2C58A 1NONA 1RTTA 1RM0A 1N3BA 2ANCA 1P18A 2HKIA 1YHYA 4KH0A 1G4AE 1OKKD 4RPCA 4EZIA 4AG3A 2VT7A 1TJ3A 2QGFA 2XA2A 3MWKA 1N2CA 1PNQA 1U7PA 3ZCSA 2TMDA 2PSEA 3NIWA 4G5GA 3I34X 1Q21A 3CUTA 1Q0TA 2WWVD 1H69A 3UJ7A 4H2DA 1T4CB 3L3BA 3DDHA 3DO5A 3DZDA 3VKGA 3C4JA 3S68A 2FZ4A 5MN4A 1KKMA 2YRXA 3QKRB 2P9EA 3V7UA 4IWXA 3WJ1A 1U1EA 4EF5A 2UVPA 1KS2A 1DNPA 3UXEA 4Q9NA 1XJCA 2A7QA 3GN2A 4KGXA 3BWMA 4DSOA 1Z0IA 4OAQA 1XTBA 3AC0A 4YGYA 4FHGA 5TDHA 4EJSC 3TFQA 2RCNA 1BEEA 2BFFA 4G8DA 3T5BA 3ZIAD 1EM6A 2GK7A 3T7IA 1P2UA 4DIFA 4G5HA 4MR8B 2DP4E 4OUDB 2VYNA 2V6FA 2PXAA 1GPJA 4OY3A 1WEHA 5ALQA 5K09A 1NJ1A 2QQ0A 1AHIA 3ECSA 5B1IA 1G7SA 4BFUA 1SU8A 5FHQA 3OQHA 4CEIA 2COEA 4F3NA 1JI0A 1EFRD 1CP3A 1T5TA 1D6NA 2ENWA 2X0JA 3H17A 1X7GA 5JSZB 4YAEA 2B82A 3T1TA 3ENNA 4MROA 9MHTA 1UBEA 3BF8A 1GQQA 4MUJA 4OAOA 3FB4A 5CNMA 4MGEA 1N0VC 1WXHA 1EK5A 1V35A 3GFSA 4H17A 4L02A 4L5JA 3ZI7A 2PO5A 4AIIA 2FETA 4L7QA 3VR2A 1L5GB 1RS0A 3H0EA 3KQQA 3D0QA 4CKBB 1XZBA 2KLHA 4M9ZA 3NATA 1A98A 4LZZA 3ITEA 3PUIA 5FOVA 5BV1A 3L7JA 4IDEA 4O2BB 3AQ4A 3NS7A 2QTLA 4XDZA 1ZUWA 3I83A 1Q84A 2OY0A 3R09A 1LJUA 4H18A 1KFBB 3EDCA 2ZM5A 3LLSA 3D8SA 5JH7A 1H5QA 1R3UA 2IYQA 3FG9A 1ZLYA 4MYDA 3U7RA 2FWRA 2XCRB 2BH2A 2JHPA 2MTBA 1U9IA 1HURA 3KKQA 3CC8A 4HK4A 3O4RA 2O6LA 4F2WA 1VRCA 1RE0A 1T29A 2ZS7A 4ESEA 4RVUA 5CD1A 1MORA 1L5YA 1E2GA 2NSDA 3GGGA 4C5CA 8MHTA 1HLPA 1MH1A 5IJZA 4URWR 5EY5B 1OPXA 5JH7F 3F6EX 4JKYA 3U40A 4YY3B 4D9KA 4FOPA 5IEJA 1VFPA 2I3GA 1Z07A 3P20A 2W4IA 5E38A 3RVKA 4V0OA 5JJIA 3OFSA 4I8IA 2IHZA 1G5IA 3OX3A 4IQ8A 4L85A 4YLGA 3VNQA 1SOUA 4IDPA 2C4UA 4JLMA 3KIPA 2QIOA 1Q1AA 4RF3A 2XA9A 1ONSA 2O2YA 4Q93A 1ZJ5A 2VPPA 2YY6A 3FGZA 4H3VA 3ZK8A 1JHZA 3L0OA 1MAWA 4BFCA 2X6RA 3RSHA 2O19A 3OLZA 4TTIA 1DBWA 1K3FA 2Q0XA 3FPHA 5T4FA 2VUTA 3P2YA 3GVCA 2VNJA 4F5ZA 4DADA 3B7PA 5HQ3B 4B2IA 1DUIA 3NKLA 3WRXA 1HG1A 1E7WA 5EGSA 2IW1A 2DQZA 3D8UA 4COOA 2EFEB 5C3UA 1OWOA 4IS3A 4UD6A 3LWNA 4NS1A 5ALXA 4ESVA 2D0OB 1GYPA 5H4HA 3RJTA 1DAMA 1WXEA 4OYLA 2CHUA 1P0CA 3LC1O 4KN9S 5AVXA 1HYHA 4HDNB 4LGMA 5JC8A 5B53A 1VE5A 4YJ3A 4DA6A 5F2KA 2Q9BA 2Z9CA 2E1PA 1SJ9A 1T1JA 3AW8A 2FHPA 4FT2A 4JUCA 4JZYA 3IEXA 1Z29A 1RW4A 5IDWA 2UZ1A 4JENA 2I0FA 4II2A 1MD9A 4U0JA 3LHIA 4CKCA 3ET4A 4BP1A 1UMBA 2C2HA 2PJDA 2PZLA 1Z6ZA 4M8IA 3UJHA 5MHTA 1RLIA 4EEKA 5JDIA 3ECCA 2C94A 2G76A 3CSUA 2PPLA 2X3YA 2DLDA 4G26A 4MNTA 2WTAA 4YJ3F 1E1CA 1VG0B 3DOFA 1LLCA 2ASEA 5EXPA 3M1AA 3PC7A 1YULA 1N7JA 3C5EA 1T9BA 1FUEA 1SA0B 1M2EA 2GEJA 3G2KA 3O73A 2FCAA 4JVNA 1W1WA 1DBSA 5JTUA 1NSYA 1GZ3A 3JCZA 3WYGA 3WL4A 2IOFA 5CIYA 1YH3A 3OURA 4MQ5A 1FQJA 4MPJA 1QQ6A 3EGOA 2P5YA 3IPXA 3MCAA 1V41E 2PL1A 3I8SA 4XIGS 1OLUA 4OJMX 1T8SA 1W73A 3O8NA 4PHHA 3HBAA 3TLJA 4UZEA 1Z4QA 1N0UA 2C98A 3OZDA 1T3LA 2DHQA 2FN4A 2XCTB 5IC6A 4CEJA 3R5HA 1Y7LA 3QFFA 5G0UA 3VOSA 2JEOA 4BPBA 5J2UB 1ZP6A 4JWKA 2KWIA 3P0HA 3OOYA 2C7PA 1NYLA 3WLQA 1QZUA 2V6MA 1C7FA 2JJ1A 3GMIA 3KKLA 1O4WA 4LI3X 5GVSA 4D9NA 2I22A 4Y6OA 4DQDA 1OVMA 2RIPA 1Q74A 4JP3A 1OWMA 2GZAA 4ZCIA 4P22A 4PBTA 4DMGA 4JC8A 2B92A 3IE1A 1MABA 2WAOA 5JNRA 4HXEB 2X1VA 4NZOA 5CT6A 2UXDB 4DTCA 3LYUA 2DSTA 1OX4B 2XNJA 3BWYA 1AU9A 2A9QA 1E9DA 1WKBA 1WD7A 3A6KA 4WLVA 3WKCA 4ZJUA 1RZRA 4OQPA 2OVBA 3W1WA 4IH1A 2BGKA 3GT7A 1R8JA 3E1SA 3TFWA 5GTDA 2J45A 1E0JA 3FUVA 5LMCA 4ZV4A 1E2DA 1Y3CE 1PNTA 1ZESA 5DX0A 2FJUA 4MVYA 4HUJA 1GUYA 3A10A 1UXJA 3AF0A 3CZCA 3IESA 4LHWA 3SIWA 3HVKA 1GCOA 4HRVA 5C53B 2WIDA 3O5AA 4YV2A 2BBSA 3HXLA 4MUHA 4L7VA 3CBGA 2DULA 3FUXA 3R7WB 1OXUA 1V8BA 3B60A 4QFBA 2ZYGA 1QHHA 1YFKA 1KSGA 1NKSA 1B3BA 1M66A 1V39A 2FEWB 5BYKA 1IL0A 5JD3A 6AT1A 4AKHA 1YOVA 3C1TA 5D5HA 4RC9A 3PNLA 3QGMA 1WL8A 2RHBA 2WJWA 1LPMA 3RU3A 3LY7A 1W2HA 1FDUA 3WGIA 2AN9A 4EO7A 3WHLA 4MTCA 4ARBA 2DETA 1V16B 2C92A 1I9GA 1QO0A 2CJWA 4PSCA 4MR7B 2V3WA 1G5QA 4HWSA 4U2CA 4UOEA 4L5YA 2G6BA 4TL6A 4JNCA 3VDNB 1H0KA 1G7TA 1RMTA 5KWSA 1SGWA 5KTRA 5MN5A 1NAIA 5AW7A 1BGWA 2AQHA 3DGFC 3QELA 1WCXA 2I3ZA 3I6MA 3NFRA 3RAFC 1P0QA 2AE1A 2M1ZA 4U7DA 5B7PA 1B6GA 3D1JA 3FYUB 4FMBB 2E21A 1KYVA 5EAIA 1FQKA 1NI4A 1Z38A 4DYHA 1VE6A 2CLHB 4NG5A 2VDNB 5JAIA 5ALKA 4D9FA 4JJ6A 4Q34A 4BO8A 1EK2A 2XMRA 2X6QA 3GLFE 3NR2A 2Y0CA 2ZXFA 3QM1A 4L95C 3MS7A 2R79A 5JECA 1FJGB 1KBOA 1PSZA 2QSYA 4N18A 5IT5A 4E22A 3O84A 4IJWA 5JISA 3TDMA 2DB3A 4Y3UA 4B2PA 1F12A 2HSGA 3RRJA 3ICWA 4E6PA 4HYEA 5IZ4A 4TWAA 4EW3A 4XQ9A 2I78A 5IDVA 4MMXB 3SZOA 1L4LA 3G5AA 1KEPA 2GJKA 3KZCA 4UAGA 3TINA 4CCWA 2VT3A 1UJ2A 4WLEA 2O2XA 1VGVA 2IHUA 2ZE6A 3ZNNA 2PG3A 3FE2A 3Q2KA 4RV5A 1DV1A 4V0MA 4JLJA 2OAEA 3VR4H 5BR8B 1YJAA 1JTEA 4DSZA 2P3SA 2X7HA 1G55A 4PQYA 3L7BA 4RY9A 4C07A 1FU4A 4LQDA 4ZANA 3S0JA 1P2GA 1LY1A 2O0HA 2OGUA 2ZUBA 3QLTA 3J81A 1R0XA 3HJCA 2YR0A 4M86A 4NC9A 3O31A 4QOIA 3WK4A 3IIMA 4WPGA 1EINA 4PZLA 1YI8A 3KJXA 3OZBA 4K28A 1I01A 3OJEA 5H3CA 4ARZA 5CAEA 3S2UA 1OAKA 2EFHB 1EWKA 2D2VA 2EVWX 4LJYA 1ZIDA 4UDXX 5DYTA 2XYHA 3ZV4A 5ALPA 3LWDA 3UQZA 1GZDA 3CF6R 4OQMA 2GCPA 4F6CA 1JDTA 3AIKA 4OIFA 4XH9B 1E2PA 4YCSA 3UENA 4EZEA 4PZZA 5K01A 3KJQA 1AGRA 3PJDA 2NV0A 1HEIA 3TF5A 3V2IA 4YQYA 4AROA 1W6UA 2P11A 3CRW1 4TXHA 1GSAA 1UAYA 2QF7A 3DSRA 1ECLA 2JGFA 5BRAA 3AR4A 1C1DA 2CDCA 1XVLA 3N2KA 1B23P 1L5VA 4Z0TA 4YRAA 4RULA 3NFYA 3LRPA 4IIBA 3O03A 1Y42X 3VYTB 5HKOA 3GJYA 2HA2A 4KOAA 1L5FA 4MQFB 4N3AA 1EWYA 3JYHA 2VAVA 3OESA 4UE3S 1W2WB 1X92A 2O2EA 1N0HA 2OBNA 2DF8A 3CX4A 4LC0A 4U1RA 4R1UA 3VPGA 5LYJB 1VE3A 3EQ8A 2VI5A 1MBZA 3AUXA 4QDZA 5CURA 4Z6KA 2PSSA 2WYHA 3UBMA 4W5NA 3GU3A 1TQ2A 4BWFB 4F96A 5C51B 4BU0A 1HMPA 4TTRA 1H2AS 3ZHRA 1A8UA 1PFVA 4RCYA 4PO8A 3EGXA 3G13A 1ISFA 5AKEA 1QNLA 4DHEA 2FQWA 1TEXA 1ND6A 2RC6A 3OAAA 4ZQHA 1U7DA 3LPMA 1HEYA 1QONA 1V5GA 4FE7A 1N57A 4X1YA 3TZEA 1KSHA 2DWPA 1W35A 4J49A 3GZNA 5E4TA 5G02A 2Z95A 2YS6A 1PF7E 1XZIA 4LXHA 3P7MA 2EAUA 4L6IA 3AKYA 1NW9B 2RJ3A 3P9ZA 1Q77A 4UZFA 3PIIA 5E9QA 3PRYA 4WFJA 3UY4A 2IBTA 1AS2A 4CLXA 1K27A 1GN9A 3C6YA 1R16A 2QMEA 3HYNA 3OO1A 1KAHA 3R3YA 1KI6A 3ZE6A 4PIPA 4C87A 1NRIA 5CXQA 3RHSA 1J0BA 5CYGA 1DGQA 4HAZA 2QTGA 4ROSA 1JDBC 3ZE8A 4MV9A 4Y9UA 1GQFA 1CQZA 2PKEA 1E9BA 1FLVA 3GC6A 1ODCA 3PNOA 4PO9A 5CHYA 2A4MA 1UMKA 3EC7A 4FZRA 1TCAA 3U4MA 1JI3A 2NUTA 2PAAA 4UTRA 2XB2A 2IKSA 4O5AA 2HU8A 4R51A 5FBQB 4KXXA 3K70B 3AU8A 4O63O 4BEWA 4GPZA 4HGPA 3ND6A 4M0DA 2HJSA 4MJ3A 1WBDA 2GPTA 2FZLA 1B15A 1ESMA 1PFWA 4K9LA 4ALIA 2UUOA 1JR3E 1Q14A 1TPZA 3GRRA 3BORA 4M8LA 4Q5IA 2HBZA 3BCHA 1M6NA 1K8ZB 3KVNA 5BORA 2AUMA 2FPPA 2M9MA 1EG2A 1IY9A 4Z3OA 3I23A 3LQ2A 4RY8A 1IN1A 2I5PO 2Y4NA 1DHTA 2R6R1 4PYQA 2IFTA 3CE6A 1U8CB 3LLUA 4C7OA 3L1UA 3BD8A 1JXMA 2D6FA 1NVVQ 3RVMA 5A0TA 1A9QA 2YZGA 1JDJA 3T9FA 1RWKA 1NJ2A 3JTMA 3P9NA 3EVAA 2VF7A 3SSMA 3OTIA 3UICA 3V8NA 5KSZA 5LQKA 1EHCA 4WV3A 1Z34A 2FW6A 3A0RB 1HDIA 4CGYA 1NZFA 2AZMA 2PT6A 2Q3EA 1IXRC 3LUHA 2R84A 3TMKA 5AFSA 4M1EA 4J9UE 5LXTA 2LIVA 5AXCA 3KZMA 4NQZA 2JAOA 1Z2CA 3I0MA 4R5MA 1HDYA 4J91A 3EZ6A 5JZSA 3H5OA 4CMIB 1QVVA 2XSZD 2VYQA 1KTVA 1N5OX 3C24A 3FOAA 3HA7A 3LNTA 4W7HA 1RYBA 4K6FA 5C8XA 4I1VA 3GZJA 4RIEA 1N9KA 2ZRHA 1HMYA 3OJWA 2PJRA 1Q22A 3NH9A 4IQ0A 5LXTF 1UOEA 3LT0A 3OCXA 4B34A 4JQOA 3QW4B 4AK9A 4TKVA 1TIBA 4LPSA 4YUZA 3M9WA 4YRCA 4YCMA 4QULA 5B3AA 4MS1A 5AUQA 2C3MA 2HK8A 4NMHA 4EHAA 4BTEA 5FCDA 2ZWIA 5DE3A 2C2WA 2YIMA 4ZVKA 2BGLA 1KHTA 3EWSA 2OAGA 4WKOA 1U98A 4LQ4A 4BE7B 3B1YA 4KTTE 2Z2YA 4MGYR 5EJMA 3WC4A 5KU7A 5ADVA 4Z99A 2I65A 1JBKA 3O94A 2O1EA 4BKUA 5LN1A 1NYQA 1XP5A 5K3OA 5T4EA 3UMJA 3I1FA 5FTNA 1CJVC 1EX6A 5I4CA 4DWOA 2P3OA 3FNHA 3RVNA 4C88A 3TW6A 1BA2A 3ND8A 1VJRA 1YZVA 5L7TA 2TECE 4TOIA 3UV6A 2AZXA 1TD9A 3I45A 1J8DA 1PNVA 3F5SA 3OTQA 1Y6ZA 3B48A 1F0PA 2FUG1 4GDFA 3OOHA 2FN8A 3D2CA 3ZBTA 2J7PD 3AOEC 4D0LB 1SQSA 3ZCRA 4YMGA 3IUQA 3B13B 5LBUA 5KX5B 2CFSA 1PLLA 4GNKA 5CVJA 3LDHA 4KE7A 1RRMA 4FFBA 4JL6A 5P8WA 1P60A 2C7OA 2ZQ5A 3IR5A 3O8DA 5BNIA 4UXJA 1GO2A 2NUBA 4GGPA 1J0XO 1N9GB 1MV8A 3UK0A 1KMMA 2EL9A 3JD1A 5M5BA 3BPSA 1JR4A 3OCYA 3FWNA 5KJFA 1R64A 3TG8A 1D6MA 2BMFA 1W8IA 2Z3WA 2EZ4A 3BDIA 3R8CA 3CZRA 1Y82A 2AFRA 2O4CA 3CZ4A 3I2FA 3WB1A 1X0VA 4N47A 4ZYZA 2Q6OA 1DC3A 3NHUA 4IMRA 3NM4A 1P2BA 4I08A 3TI9A 4OKNA 3ZQUA 1DKRA 2C9OA 2QNBA 3OCJA 4RWEA 1J4AA 4YIKA 4BN5A 3AKCA 4KRXA 3L05A 5IJ0A 2OSVA 1Y8RA 3L0CA 5DHUA 1KPHA 1V7PC 1THZA 1ZX1A 1EVLA 1K98A 1XHEA 5CM8B 4R2JA 3AB8A 1T24A 4QG3A 4RESA 1LBIA 5HF5A 3ESAA 3EBPA 5KQPA 4NZZA 1SUFA 2HEGA 3LZDA 4RLHA 3UBTA 1LPNA 3LG2A 3BSWA 3MIIA 5CK5A 1JA1A 1FNSA 2NYUA 5JS1A 4I5FA 1F6WA 2QX9A 1ZIXA 4PONA 4C0SA 5JZVA 5DX8A 4A8JC 1CQJA 1Z7GA 3CBQA 2G1KA 4WXRA 3SLRA 1QDLB 5TQ0B 5IW8A 2C59A 3WL3A 4F7WA 4L4UA 4YRMA 5J4HA 2O50A 2P5TB 5BVGA 3PFFA 3RAJA 2Z1NA 3HUFA 1JEDA 1QIGA 1YR1A 2VDJA 4TS9A 5B1SA 4I9NA 3CF4A 1F3OA 4QSMA 3M89A 4XM2A 4BLTA 3R5TA 1PVVA 3ER8A 4PLHA 2NU7A 3SQNA 5EWJB 3TBHA 3J7TA 3QVMA 3SK0A 3MN1A 2WJ4A 1XJWA 1JNYA 2R6HA 3IP5A 3O2QB 5A4AA 3EH2A 1RQ7A 3ORHA 2ZUEA 4MUIA 3OHPA 4WKBA 5LP6C 2OGZA 3RS0A 2E3JA 1SBCA 1ZBDA 4LHSA 5C18A 2F3TA 3VOTA 1A69A 3CVOA 3AI3A 3ZJ4A 3F67A 1HYGA 3RK1A 2VH2A 5F2OA 2WWTA 3TIIA 4R6XA 3UNXA 3MTGA 5FEUA 2D54A 4YRBA 2AZ4A 5YASA 4DIBA 5CB0A 1DAGA 3UOWA 3M9LA 3LHKA 4I81A 1EVQA 3EIXA 5DNDA 1HY3A 2Q5IA 4AMVA 2PWAA 5CEFA 5H8WA 3IJRA 3GL9A 1P72A 3PGMA 4EJSB 2ZWOA 1T8TA 2Z08A 3TKLA 2HNKA 1Y9JA 4ND2A 3OIGA 4M0LA 3A04A 3RRMA 2XZDA 5MGNA 1SCBA 2EYQA 1DQZA 2GVNA 1D1QA 3H3XA 4Y9RA 5EZYA 4CVNA 4CXMA 2PUAA 3A4IA 2XB4A 5B30A 2VJPA 1C8VB 5DBEX 1G5FA 3UOGA 4DY6A 5B7NA 1FJXA 1U3TA 3C5CA 1IN7A 1PUJA 2VDRB 3R77A 5DGHA 4K6GA 4ETWA 3G8CA 1NNUA 1X1SA 4BNYA 3SR4A 3AHGA 1QO7A 3QVUA 4N6OA 4D57A 5AKYA 4GOOD 4AECA 1Y4ZA 1WKVA 5C37A 3HP4A 4ZOCA 2G5GX 4TTTS 3VJKA 2NVUA 3G1TA 4I4NA 4NEQA 1N6PA 3WSWA 2JBHA 3DP7A 2ZBEA 1M75A 4FFVA 3A05A 2QYHA 3NAGA 4Q24A 5DI3B 1N36B 2NQ2C 3THYB 3B3JA 3V8BA 3EJ6A 3VMFA 1RZUA 3KJIA 3UB3A 1BAPA 3ER6A 4IVRA 5IANA 5EMJA 4AJLA 2J3QA 3VH1A 5CDFA 5AW8A 3MWYW 4IVQA 5FUYA 3WLKX 1PIWA 3O74A 4UOQA 3CWCA 3WX0A 2A9JA 3DB2A 1ZRHA 3DLTA 3U4CA 1MN6A 1DX9A 1ZK2A 3DZBA 4R1TA 3KU1A 1D4OA 3EDRA 4EL0A 3M0EA 4KFSA 1USKA 2XWPA 4Q7JB 4AAYA 3ZJUA 2P3LA 1PR4A 3LP6A 1QV9A 3C3BA 3DDZX 4HDCA 4DQUA 3QE0A 1JALA 1O54A 2X4LA 3OT1B 3S3TA 4V3BA 4YJ2F 4OLBA 2NU6B 3DDCA 1PWXA 1JTFA 1A8SA 2WF7A 1MAHA 1QIIA 2EEPA 3M82A 1HDOA 1K9VF 3A32A 1X1AA 4PTZA 1QFZA 3FCCA 1DAOA 1IBSA 3R7FA 3NT5A 5K2OA 3I05A 2ZJOA 1XD9A 2JAHA 4DSAA 2IPLA 3FHJA 2ERYA 1PZXA 4N12A 5G2OA 1CLEA 3G8AA 3UXYA 3B9BA 3DLHA 5BQXA 3CR3C 3STVA 2XYQA 4IW3B 3ZLTA 4F4JA 3BDAA 1P19A 3L06A 4QOJA 1D8AA 4PLZA 1OIWA 4L8LA 2WWWA 4YREA 5JS7A 4EIWA 2ZSEA 3PRJA 3VNVA 4EKDA 3QBJA 3D8BA 3PC3A 5DHSA 2D0IA 3T3OA 5EMMA 1UPTA 3ZH2A 1EX9A 2RH4A 3E53A 3HJNA 5AVKA 3UWMA 2E87A 1GPMA 2GZSA 5FBRB 2ECKA 5LWQA 1SBQA 3GDHA 5DM4A 3KBOA 3STWA 3TVDA 4AWAA 4DNOA 5B57C 4UUPA 1ABBA 3VXKA 3RIXA 3VX3A 3T3EA 1WKCA 1EFAA 3E9NA 1XL0A 2YHSA 4KGZA 3M9XA 3THXB 4DA0A 1N2IA 5DHTA 4J6EA 2VDWB 2C9ZA 1T5BA 1XZJA 3GV0A 1BMDA 3MERA 5DX1A 3OY2A 3HEMA 5JTTA 1TVKB 3TOVA 3G5LA 4ARVA 1BS9A 1VL5A 1FDIA 4ZO4A 4G41A 3AB7A 4ASUA 5EIBD 4Z4QA 1J8MF 4RMJA 2TRSB 4U2DA 3QJGA 2VPYA 3WR5A 1YDFA 1Y4DE 1LVGA 2VYVD 2YOFA 4R84A 1GSHA 2VSQA 1YHNA 2WMDA 2O8VA 1XKLA 1U8TA 1WMSA 2IQ5A 2O2GA 1QTNA 3QVLA 1SIOA 3QPUA 3HWRA 3AB3A 1Q7RA 2PQ2A 1EVKA 1LSSA 5KDLA 4S1VA 4P8RA 5EJ9A 3LKVA 3UMYA 1ZMXA 4PY2A 4OI2A 3LY9A 2Z5FA 3M3DA 1OIVA 3ZDDA 4TKVB 2YJTD 3OPYB 3CHYA 4YRQA 4BO7A 4Q9IA 2RBEA 4WVFA 1GA6A 1YVDA 5BURA 1RXVA 1KFJB 3I92A 3AJRA 5FH9A 3OE4A 3EOZA 4P82A 1BHSA 3CLTD 4PZYA 4KW7A 5HE9A 3VJLA 4CETA 4JASB 3N8HA 4IVPA 3L1KA 1ZICA 4UUNA 4O2RA 3U3MA 4HZUA 4HRXA 1NJ8A 3G82C 1HYEA 2G1AA 2OZLB 3KEGA 3QX3A 1D07A 3I04A 2OCIA 1CP2A 4B40A 4OO3A 1AZWA 5JY6A 3KZXA 3QUSA 1CPYA 4HKTA 4TQAA 5JAZA 2O8CB 3FPGA 4WESA 2XCIA 4CKWA 2GX6A 5EP4A 3LKZA 4EOGA 1KHHA 3RUPA 2FF7A 2MINA 2I62A 3OICA 3QRWA 3W1VA 1PS8A 4YV1A 3JASB 3FOFC 1MT0A 1OILA 1T8RA 2F62A 2YOHA 3DWFA 4UKDA 3GA5A 3WQSB 5M2QA 2GETA 2X13A 2ZXEA 3D6AA 3G68A 3JQAA 4YJGB 5CFPA 3T1VA 5LQUA 5DBHX 1X7WA 2FZKA 2H2GA 3G8BA 4PYRA 4YRSA 5LM3A 1A9XA 3LZCA 1ZVVA 1EP2B 3ZTYA 3D64A 5GP1A 3FGPA 1RIFA 3IEUA 3L8EA 4ZJYA 2H9AA 1TYEB 4KJXA 3CTPA 2IH5A 5F1KA 5JAPA 4QBHA 4O33A 3KKOA 1EX1A 2IX3A 1IQUA 2BFEB 4G89A 3B8HA 3CCFA 3QEJA 2AXNA 4CFYA 2VRNA 3DZKA 3L7DA 2WBLC 2PRJA 1O5IA 2IZ5A 1GG5A 4IDHA 3EIHA 3GWZA 4BP8A 1KSFX 1Y8AA 3EHEA 1SOWA 4P3OA 4LKOA 2V5AA 5JBQA 4XVCA 3BL5A 2H0AA 5JVDF 2CHGA 2CUZA 1YL7A 1FY2A 3UXMA 5JI2E 4ZDKA 1CR0A 3E22A 3IVCA 3ETHA 4JYMA 4WIAA 2B35A 1U0BB 3A3KA 4H0FA 3OM1A 1V43A 5FJIA 2QVLA 1E7YA 1OA0A 5CVUA 2PE5A 4L50A 2RSLA 4MS4A 3RC9A 4BC0A 3HRKA 1RHRA 2WE7A 3OKCA 3ZS8A 3FHTA 3X3HA 5IMBA 4RK1A 1I6WA 4KITB 2WZCA 2FN9A 2JFOA 1IBCA 2HTFA 4UBKA 3VZCA 4HAOA 2XBMA 5K7SA 4CIXA 5K6AC 2H07A 3BMNB 5J1TB 3M4XA 3DLBA 1DMRA 2IZ0A 3DZIA 1QS0A 2NZXA 2YXEA 3IQWA 4RS4A 1NULA 3OEEA 2E48A 3Q7QA 2PQ0A 5HEKA 3AJ9A 4CG0A 1PL7A 1DBRA 1QH1A 3IAUA 4JFAA 2EJTA 3EUAA 4KAJA 4BNVA 2D1YA 2BGMA 1WG8A 3CUYA 4BJ1A 3Q40A 1G8SA 3ASUA 4BGVA 5FADA 2WTUA 1C0LA 1IPHA 5CVDA 4B5LA 1OLSB 1EQUA 2BHNA 3DAFA 2AGVA 5ALJA 1AS0A 2EBFX 3H75A 1NY6A 4LYJA 5C4MA 1WMAA 2OUIA 3ZR4B 2YVLA 2IDMA 2PS0A 4PNPA 4EY5A 4FZVA 2UYGA 4DKXA 1FYVA 1PEDA 1DBQA 1S4MA 3QHQA 3O83A 3R0VA 1ONNA 2UDPA 2HDWA 5K3AA 4BQQA 1F7UA 3SQXA 2XB8A 4TMYA 1QC5A 3C4VA 4YMIA 3K0AA 3KO8A 1SVWA 1FFHA 2VPTA 1TAUA 1Z3IX 1X0XA 1ORHA 2JK0A 1FZTA 2C9DA 5JMWA 1V4BA 4RTRA 1GL6A 4H3SA 5AESA 5E0OA 3F1KA 3IMFA 3OFVA 5KBYA 3ZXUB 1A2BA 2QTCA 2XAAA 5DWVA 1ZLXA 3BZWA 1YRBA 4N82A 4MVJP 2KBEA 1PQYA 4AL4A 5B6JA 2DBQA 5FPQA 2MOKA 2C1EA 3TNLA 1S2GA 1RYNA 3KYDA 3SQLA 3MJHA 1RHJA 3OIDA 2P7IA 4JEIA 7YASA 1KQGA 1GRQA 5ER6A 1ZQ9A 1T5LA 4RY2A 5HCNA 3RU9A 3SYTA 3Q3GE 1NG9A 2NM0A 4WW0A 4TZKA 4OHOA 3EZ7A 1OXTA 5KMGA 3K0BA 3ZVKA 1ID8A 1E5LA 3QI2A 4QICA 1W5AA 4RVHA 3QVJA 3TNFA 5DOVA 2H0RA 1FSPA 3FHCB 3WK6A 2FX2A 4OXYA 3AM1A 1FFSA 3TZQA 3BHJA 3MILA 1DG3A 2GUGA 4XGIA 2IYLD 4JI3B 2DR3A 2OHVA 3X1YA 1N2JA 1NX9A 3O4VA 4HT3B 5SICE 1F1BA 5KO2A 3I9LA 1FFGA 3RU2A 5HRAA 2LKCA 3KOWA 2V54A 1OASA 1TU0A 4JJKA 1CJUC 2VDMB 3AETB 4QVKA 2NZYA 4R3WA 2ZAMA 4ZU1X 3FTQA 3GRYA 4JBLA 4MQLA 1FU7A 4ESHA 1RZ3A 1HG0A 2K6GA 2QUAA 2XF8A 3CRVA 1FRVA 2OO3A 3DHNA