1ZK1A

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
251
structure length
251
Chain Sequence
b'SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 100
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk1A00
3Q3CA 4GX1A 2YQ5A 3PGJA 4R5MA 1DDOA 3VZRA 5B4UA 1MXHA 3C24A 1N1EA 4YACA 5KWEA 4ZQHA 4RF3A 2W8ZA 4M49A 3JQFA 1ZK2A 4CM4B 2JFGA 1NFQA 4MKXA 5DBGA 4GX0A 2X1HA 3GFGA 3KYCA 4PLHA 3WTCA 1A72A 4P4LA 2IZ0A 2VZ9A 3PK0A 4IS3A 3O9ZA 2Y1DA 4J4BA 1U2DA 3C8MA 3SC6A 3GR6A 1XYGA 4BGIA 3QSGA 2X23A 2IZZA 1E1MA 4XYEA 5JO9A 1GQYA 1KVRA 2YW9A 5JDIA 1YH3A 5BNIA 4L0QA 4U5QA 1ZNQO 4BKOA 4RVUA 4K9DA 1ZXLA 1XQ1A 1BVRA 3GUYA 4IGEA 5HBRA 1DC6A 4QFDA 1XHLA 4U8GA 3AOGA 5JCXA 4LMRA 4HX5A 4A5OA 3EY4A 2PWZA 3TL3A 5K6AC 2JFHA 1A5ZA 1VRWA 3E18A 5I7VA 2DAPA 1QYDA 1R4NB 3E6AA 1E92A 4JX8A 2FN7A 1DC5A 3VDQA 2V6MA 1EE2A 3FSRA 4LVUA 2GF2A 4TVBA 3DWFA 3V1UA 3EVNA 3PHLA 4YJFB 3ZNNA 2AE1A 3RC1A 4CLOA 4WK6A 2O3QA 1P1HA 1ISMA 1CERA 4DBZA 1ZMOA 3JQEA 1JAXA 4N5NA 2DBVO 3CSDA 5JAQA 1ZK4A 4JBHA 3S2GA 4CUKA 1VLLA 5TT0A 1I3MA 4BNGA 1GAEO 1WZEA 3C1AA 2VWHA 2DFVA 2Y1OA 3QVWA 4LMPA 2HK8A 4UVHA 4AJNA 1DFIA 4XKJA 4GWKA 4D44A 1CF2O 3CKYA 1DLIA 1SB9A 3W4JA 2QZ9A 2BFMA 5L4SA 3HSKA 1B14A 4XEHA 1LSOA 2EEZA 1E5LA 4NJOA 2VWGA 2XF8A 5TGDA 5L7WA 5EINA 1KC3A 4L9RA 4ALKA 3TZQA 3FHLA 4E33A 1X13A 1D4FA 4G65A 1E7RA 3BMOA 3GF4A 4A26A 3FR7A 2Q4BA 3DC2A 4QECA 1DIRA 2C5AA 5EL0A 3VZSA 4B7UA 4BNJA 4HFNA 3DZGA 1TT5B 2BGLA 3UCEA 4RPHA 5KVSA 2WD7A 4PLVA 3VZPA 2IXBA 3CUKA 2O2SA 3PVZA 4CLHA 4E2XA 4HADA 2XOXA 2Y0CA 4L4RA 4IIVA 2G5CA 4J2HA 5HWSA 5DCUA 1NASA 3JQDA 4AICA 2B4RO 3OM9A 5K9ZA 2JFFA 4CMIA 4L75A 1ZMTA 1F8GA 3QP9A 4NK5A 3F5SA 1VSUA 2DU8A 4YAKA 4M8SA 5IXYA 1DOHA 3GGGA 1YDWA 1EFLA 5GZ3A 3NAQA 1HDOA 3INTA 4E13A 3GPDG 4P22A 3LYLA 3B6ZA 3M6IA 1GYQA 2IZ1A 4NZ9A 2A4KA 1LDGA 3DZHA 4TRJA 1GADO 1QV6A 2I5PO 4WE3A 1KS9A 3D5TA 1C0PA 4UUOA 1E6EA 4EBFA 3FPCA 3DAFA 2WYWA 3WGOA 1VC2A 1CDOA 4DIBA 1AHHA 2R00A 2AQ8A 2Y1EA 3C1OA 3DBRA 3WLEA 1PWXA 2EHDA 5T67A 3U62A 2GNAA 4B3IA 3I9KA 2YDXA 2HSDA 5A1TA 1MFZA 1NHGA 2NVUA 2BI8A 5CG1A 1GV1A 3G1UA 1EFKA 1AUPA 1VL0A 3PGXA 3QVTA 4M87A 3RUFA 2GD1O 3BMCB 3IJRA 4CR7A 1U4OA 2X4GA 2ZCVA 4NR0A 4IUYA 3DEYX 2VRCD 1I8TA 1BTOA 4AJLA 2Q1WA 1MV8A 5JBIA 1TT7A 2R6JA 3EC7A 3OHSX 3WGYA 5F1OA 4CQLB 1PGOA 3DDNA 4DPKA 4MP6A 3ZU4A 5DP2A 5ENDA 3FRJA 2VOEA 1PJQA 1T2DA 1Z6ZA 3WX0A 3DZFA 2GN4A 1DJQA 2C2XA 2O50A 1HWYA 3NT4A 4OKIA 1E3IA 1GU7A 2R2GA 3CTMA 3RU7A 1Q7GA 1EK5A 2NVWA 3JCZA 4YAGA 5K0ZA 2P4HX 4Q3DA 5EERA 3EMKA 2FPGA 4WECA 4CLRB 5T8KA 2ZB7A 4AG3A 2Q2WA 5H82A 3H3JA 3NEPX 4LVCA 1XU7A 3QWAA 4FFMA 3V1YA 3WR5A 4BNNA 2QRKA 1N7GA 2PKQP 4EYEA 3TOXA 3ONEA 5G4KA 1P1JA 3AUUA 2JKVA 5KJEA 4F6LA 4NBVA 1JVSA 3TL2A 3DAGA 4JIGA 1QKIA 1SC6A 1VI2A 2OUIA 1H5QA 5IAAA 4AJOA 1GZ4A 2IEBA 2ZQZA 4NBTA 1OMOA 5KIAA 4E5YA 5TT1A 1V6AA 2BFPA 1E5QA 3NTOA 4CMEA 1E6WA 1MA0A 3N74A 3RI3A 2EV9A 1DFHA 4BNLA 5F1PA 3IQDB 2HKIA 1HDGO 3JD4A 4K6FA 5LDHA 1N1GA 1TVEA 2JCVA 1DLJA 3AUAA 3U4IA 2VZ0A 2WD8A 3FNGA 3WQSB 3QWHA 3GNQA 1ONOA 2D8AA 1PS8A 1RYDA 1V35A 1GUYA 2JHGA 1PZHA 3ONDA 1U5CA 3KYCB 1FXSA 2XXBA 3L4BC 2GGSA 5A04A 2X22A 4NBUA 2VNSA 1Y7TA 3Q11A 3HWRA 2BD0A 4O0LA 4AVYA 2AEFA 4OSPA 5HTOA 4HNHA 3Q9UA 1XLTA 1HF3A 4L4SA 4XGNA 4EEZA 4R41A 4OXKA 1T2CA 3DXFA 3S1LA 5JFOA 5I7FA 3C7AA 3OICA 2ZJ0A 2YFHA 3BTOA 3A1NA 4YT8A 1P3DA 3ASUA 4BO2A 5IXSA 1GL3A 1U3WA 1V9LA 4FW8A 5JSFA 2D2IA 3LF2A 3JYPA 3NGLA 5I7SA 1CWUA 5CFZA 5L9AA 3AOEA 1R0KA 3NX4A 1IZ9A 5H83A 5I8WA 3EZYA 1AN9A 4OJNA 4IIUA 7MDHA 3TFOA 2Q1UA 4A2CA 1XR3A 4LW8A 4TRMA 4MVJH 3ANMA 5KKCA 3H9UA 2A35A 4CLOB 1PQWA 3DHEA 2DTDA 2J5QA 2Y1CA 3CINA 1QP8A 3K6JA 4IJVA 3O8QA 2PKQO 5G0SA 3K31A 3RUAA 2Q1SA 1HLDA 2WSBA 2DM6A 3MJEA 1Z74A 1SOVA 2FWMX 5KVQA 3QWFA 2BH9A 3ZI0A 1Y5RA 3H5NA 4RLHA 2YV3A 3F47A 5TS3A 1QYXA 4E2ZA 3JTMA 4MOWA 1BXZA 3HJAA 2C7GA 2WJPA 1N9GA 2DFDA 3RBXA 3M1LA 2D59A 4BNHA 4QSMA 1H2HA 1U28A 1K5HA 4FDAA 3FNFA 4GI2A 1HT0A 1NQAO 4MIOA 4OOEA 3JQ8A 2X0IA 3NKLA 4DQXA 4ZQBA 3QA9A 5CDTA 4BO6A 3AWDA 3LQFA 2DTXA 1M75A 4PLFA 2WD7B 2PTGA 3RKUA 5L4LA 1LXCA 2YQ4A 2YV2A 3BAZA 4I9NA 3RBZA 1G1AA 2EP7A 2J5RA 3G1TA 1E7QA 2H63A 1R16A 1I2BA 3ETGA 3TOZA 4EUEA 3OQ1A 4FGSA 3AUTA 2P91A 3HDQA 1JVBA 1K2WA 4PVDA 1XKQA 1BRMA 5ER6A 2AQHA 4CMIB 1ISHA 3RC7A 8ADHA 2OBNA 4AJPA 4PIVA 4EJ0A 1EK6A 1MC5A 2WTBA 5DN9A 3PHIA 4BL5A 1O89A 4W7HA 5HRUA 1BDMA 2CVZA 3H8VA 1BSVA 4PN3A 5JAIA 1G6KA 4JJGA 4J2OA 4DPMA 2EKPA 3PDJA 4Z6KA 1Q1NA 2HUNA 3WFIA 3JD2A 4KUEA 1U8XX 1D1SA 1WXDA 4QX6A 4FGWA 5DNAA 4B7XA 4MVJA 3GPIA 1PU2A 2VT2A 1B16A 1HYHA 4Q3AA 3T4XA 3DBRB 4A73A 1BG6A 2NSDA 1YO6A 4RQTA 3TNLA 1HDYA 5GMOA 4PG7A 5CAEA 1EBFA 1G0NA 5LC1A 4ZICA 3U3XA 3TRIA 5TIIA 2NVUB 1NHWA 1L7EA 3QV1A 4BV9A 1Z75A 3F6YA 4YJFA 1IPFA 2FPPA 3OJOA 3DTYA 1OFGA 5TRTA 2P5YA 3SJ7A 3D64A 5JNLA 5BSHA 3Q9NA 4AJ4A 3VVBA 1T4BA 4CM9A 3K9QO 4IXTA 4BB6A 3TZ6A 1HZJA 3V2UA 4IJWA 3AJRA 3ENKA 1ENZA 2NU9A 2HMVA 1HSOA 1VL8A 2UYYA 4I9UA 1X7GA 1J5PA 1GYPA 2J3IA 4IDGA 1K6XA 1LX6A 3LK7A 2IXAA 4JXKA 3WNVA 5JPIA 3P2OA 5CDUA 2QYSA 3FTPA 4HBGA 1QMGA 4J91A 3ZNPA 4DYDA 1A9YA 4J1NA 1UP7A 5CEJA 3ZW9A 4WNIA 2VUSA 3DFUA 4NMHA 5FYDA 2Y67A 5CPFA 1N5DA 4KP7A 1K6JA 3D1LA 4DA9A 3VPFA 1JA9A 4K1LA 4YB8A 2CUKA 2H9IA 1IY8A 3HQ4O 3ZV3A 5F21A 5IDYA 1DXYA 4IDBA 3F1KA 3AI2A 4FFNA 4N5LA 3ZV6A 5G4KB 4CMGA 2RHCA 3C3XA 1YBVA 3JQ9A 5TQVA 3FBTA 1I10A 3TZCA 3PJDA 1IHYA 4OL9A 3C7CB 3QVSA 2WM3A 4DGSA 5JC1A 5L45A 1VPDA 3EUWA 5J23A 1P74A 4D46A 3SBOA 4G2NA 3ZWWA 4RDIA 2GSDA 4INAA 1N8KA 3LT0A 3I9OA 3RC2A 1H9BA 3DR3A 2OL4A 3PTZA 1YGYA 4B4WA 3RSHA 3VPHA 3GAFA 4B7CA 1O5IA 3LLVA 3R3JA 4HY3A 1FF9A 3IC5A 3PJFA 4FD3A 3VAZA 4PG4A 2Y1FA 3KUXA 5HA5A 3G3EA 3R1IA 2HJSA 1C3VA 3GHYA 3VTZA 2CVOA 1DIHA 4J9VA 1JN0A 1X15A 2P9EA 3E03A 5EQFA 4BO0A 2VHWA 2V65A 1ML3A 1PGJA 3JYOA 4JP2A 2OP0A 3ORFA 2AMFA 3HFGA 1NQOA 3AY3A 2E48A 3WICA 1SNYA 3B1FA 3DTTA 4PRKA 4J90A 2OXIA 2EGGA 3OMLA 2ZTUA 1PGNA 4CR8A 1YWGO 2XAAA 4C4OA 1LQUA 4BMSA 1TB4A 4XA8A 3W6ZA 3RWBA 1L7DA 1RKXA 3VKUA 5I9NA 4G5HA 1A4IA 1SMKA 5IZCC 2W98A 4ZQFA 3UH1A 4Y9DA 2CSUA 2JD2A 4PRLA 3H5RA 2O3TA 1R37A 5FWNA 4IPTA 1E7MA 2RCYA 1KEWA 3PZBA 3UICA 5JYDA 1LRKA 2JCXA 4LSMA 1IULA 2ZYAA 3CXRA 1SAYA 2G82A 4E30A 1NVTA 5HM8A 4YT5A 2I66A 2ZTLA 3Q1LA 1MX3A 4H16A 5F5LA 3RVDA 4BV8A 1I5RA 3FF4A 4II3A 1BMDA 3DBHA 3DOOA 3GT0A 1SO8A 2D0IA 2GPTA 3O8QB 4WPGA 1NTOA 2JD0A 3KSDO 3ZWNA 2I3AA 2PFGA 3JYLA 1PJ4A 5TF4A 5DF1A 4Y6RA 4DREA 2NLOA 3W8FA 3QVOA 1HRDA 3EZLA 5CG2A 4GSKA 4E2WA 4AJIA 1MG0A 3WB9A 1N92A 3GAZA 2VYVD 4KQWA 4RVSA 2GZ1A 3AM5A 3BTSA 3GH3A 4F45A 3WYBA 1I24A 4KDFA 4CMHA 2C20A 4IDFA 1AXGA 5T64A 4HV4A 1OAAA 1N9GB 3FCOA 1IE3A 4XDYA 4CV0A 4GPD1 1LEHA 5A06A 1ARZA 3OFSA 3UCFA 3WOHA 1ZZEA 1XDWA 3A06A 1EUCA 4W99A 3WGIA 4E3ZA 1KEVA 3JQ8B 4PLZA 3BA1A 4NDNE 1DPGA 4MVJG 3DZIA 1C1DA 5FI3A 1KVTA 1XA0A 1S6YA 2DPGA 2O7SA 3W8DA 1NNUA 4YVFA 4A27A 2BLLA 1IZ0A 2X0JA 3AI1A 5EN4A 2H1SA 3BIOA 3G49A 4OH1A 4UAGA 2C54A 1YONA 4YQZA 4FS3A 1DRWA 2O23A 1EEHA 1WW8A 3F4LA 1GCUA 3SLKA 3VH3A 4BOYA 1E7SA 2IE0A 1H2BA 3R6DA 3ZWYA 1UXHA 4FJ0A 4MVJE 1OI7A 4TMFA 2AQKA 5B12A 1WDLA 1N2SA 1LSSA 2PGJA 3I9JA 5K6AA 4I5GA 5JDCC 3C7DB 2GYYA 2HJRA 2F00A 3HN7A 1V0JA 4FIZA 3QW2A 3KM0A 1HXHA 4KQXA 5ITVA 4BO4A 3DAPA 2UVDA 4NU5A 4Y6PA 5AYVA 4R69A 2W2LA 4NHEA 4CUJA 1HZZA 1GQQA 2DTEA 1HKUA 2Q3EA 4OXNA 4QUKA 1V8BA 1WZIA 1WDMA 4ITUA 4U6SA 5C37A 3D3WB 4A0SA 4BO3A 3I6QA 2GZ2A 3BXXA 2J8ZA 2UUOA 2HMSA 2PY6A 3NYWA 1HETA 1PJTA 5JLAA 4E5NA 3EK2A 1OOEA 4RLSA 4YA6A 1E1NA 1BXGA 1LDMA 1Y8RA 1UXKA 3HZZA 1P0FA 5L7YA 4ZQGA 4Z0TA 3MZ0A 2V6BA 4D3DA 5C3MA 3UXYA 1LDNA 1YRLA 2EKQA 3OEWA 4ND4A 1HE4A 2FMUA 3GNTA 4L74A 2ZK7A 1PJ3A 3K2BA 9LDBA 1Y81A 1H6CA 4RF4A 1U5AA 5BSGA 3PQDA 4I1IA 2D1YA 3DO5A 1DO8A 2OBYA 3VH1A 5T6BA 1E7YA 1JQBA 2IDZA 4MVJP 4MKRA 1LDYA 4XGKA 4D45A 4FCCA 3IJPA 2I99A 2PGLA 3L9WA 1VJ1A 3MCVA 1DRVA 2PLAA 2J6IA 1X1TA 5KJ6A 1PS0A 3UN1A 4BGVA 4WLVA 4D43A 4D3SA 3VPSA 4ZN6A 3P19A 4R5HA 3ST7A 1Y6JA 4EZBA 5C7LO 1Z7EA 2CDAA 2ZKLA 4ALNA 3HDYA 4Q3EA 1PX0A 1YB1A 3L77A 1ADFA 3ZWMA 4TZKA 1H93A 5A4DA 1DAPA 4TZTA 5CHEA 3RUDA 1BW9A 4MPDA 4YAJA 4II2A 5DBIA 1N7HA 4ALMA 4MVJD 2RHRA 5DP1A 1R66A 1U2GA 2Y1GA 1FDUA 5IDXA 2C29D 3D4NA 4J0FA 3RFVA 4F46A 4N18A 3GZNA 4LRTB 2BHLA 1B3RA 1IYZA 1U7HA 4ZD6A 1ISIA 1RM4A 2PV7A 4LRSB 4GVLA 2V7PA 4PLTA 5KVCA 4RQUA 2OP1A 4IBOA 1NFRA 1PJSA 3AM4A 3LC2O 4M86A 2WYUA 3PRJA 2C5EA 1QG6A 1XCBA 3PWZA 3ANLA 4YQYA 4KUHA 5GZ6A 5KJ1A 1W73A 4W4TA 4CM9D 3I9NA 4E0BA 3GMDA 4PG8A 3L0DA 4B3JA 5JC8A 3ZWVA 1FJHA 1KVUA 3VH2A 3OETA 3GZ4A 2YYYA 2ZB8A 3CH6A 4YRBA 3HHPA 2XPCA 4ZRNA 1DSSG 2W2KA 2GO1A 4LCEA 3V5NA 4ESOA 4UUPA 3MTGA 3NV9A 3WIDA 3KSZO 4B4UA 4QFCA 2ZATA 1ZCJA 3QRWA 2OFPA 3OIFA 3KETA 4XRRA 4HFRA 4P4NA 1DC4A 3ZN2A 3GY0A 1OC2A 2NTJA 3FWNA 3WSVA 4DIOA 3SVTA 5JAMA 3K30A 1IPEA 2NTVA 5A5EA 5ENVA 3GEDA 1M6HA 4WCDA 4FB5A 1H9AA 3RFTA 2PD3A 5JXWA 4A7PA 5DCYA 1RM0A 4BNXA 1NYTA 3MOIA 5JY6A 4RO0A 1PL6A 1AXEA 5IJZA 1K3TA 3JD1A 3WXBA 3UUWA 1H0KA 4U6QA 1AGNA 3P2YA 1UZMA 5AXAA 2JD1A 3F4BA 4XDZA 2NU6A 3GRPA 5B4TA 5IDQA 3DBHB 2JCYA 5BQFA 4IXWA 2NQ8A 3U4HA 4BQRA 1I3NA 4WCFC 3PWSA 2VT3A 3I23A 3QJ5A 4CMJA 3Q2IA 3PIIA 2AQIA 4ZQEA 4TKLA 4Z9YA 2V6GA 4GMFA 4I9HA 1D1TA 4XJTA 4GLOA 2EP5A 5LCXA 4EUFA 1X0XA 1DEHA 1I2ZA 4TVOA 4IJUA 4DMLA 2PD6A 3IOYA 4GQAA 4AFNA 3DQPA 1TEHA 3RBVA 4TRRA 2LDBA 1H94A 1NPTO 1PR3A 4HP8A 1E3WA 5A5FA 1U9JA 3TDKA 1O95A 3IP3A 2GASA 2BI7A 5ICSA 2UUPA 2VUTA 1MLDA 4XCVA 3BHIA 5AXDA 1V3UA 4I5EA 1P9LA 4JROA 1ISJA 4TRNA 2VWQA 3P5SA 4CM8A 1LC3A 3PQFA 4R9RA 1ENYA 1I2CA 2ILTA 3CEAA 4GKBA 3MJTA 1C1DB 1C0KA 4Y6SA 4YT4A 3L4BA 2AE2A 4ZHSA 4C7JA 3U4DA 2GDZA 3EVTA 3M2PA 3E82A 4DQUA 1JAYA 3RFXA 3JQBC 4JK3A 4R1NA 3O03A 4CL8A 3IKVA 2PH5A 2I67A 2RBEA 5DT9A 4CM3A 2P5UA 1UJMA 2P9CA 2Y05A 3WNQA 5DULA 1H6AA 4XRGA 2BKAA 3QY9A 1ENOA 2VHXA 4GWGA 1BXKA 3GLQA 1PJ2A 4WASA 1KY5A 2SCUA 1FK8A 1RPNA 1I3LA 4BNZA 1ULSA 4HUJA 5FFFA 4D7AA 1NFFA 3QWBA 3GOHA 2C2YA 3I9MA 1HDXA 4NJMA 3ZWXA 5A03A 4Q9NA 1KY4A 2X86A 3ITDA 2EW8A 2O2YA 3ZV4A 5JCJA 5ILOA 1LDEA 1DIBA 1T2EA 4YPOA 3EAGA 3JQ7A 1NPYA 4XIYA 1YDEA 3C85A 2CF6A 1R4MA 3R0IA 1KVSA 2IODA 3ZWOA 2FR1A 1KBZA 4QT0A 1P44A 1V3VA 1A4UA 4DXHA 1VKOA 2FZWA 3ZV5A 4BGEA 1GFSA 4KZPA 4XD2A 3PWKA 1LNQA 1BXGB 1Y8RB 1OZAA 4F6CA 4P8RA 1UZLA 1ISFA 3HNPA 1JDJA 1P1IA 3PEFA 5TNXA 3U09A 1UDBA 2BFOA 2B5WA 3Q0EA 5T57A 5A9SA 2A92A 1YL5A 1ZK0A 2PK3A 3NT5A 5KTKA 3ADOA 4YJHA 1B2LA 1HDCA 4PZDA 4XQGA 5KJFA 1UXGA 1XSEA 2GR9A 2VTDA 3ZHBA 2OGUA 3PQEA 3UF0A 3DZKA 3MEQA 2X9NA 3CZMA 3GUCA 3AU8A 2CF5A 4PLGA 1HYEA 5G0TA 5AXCA 3WJAA 4NU6A 2AG5A 4J4HA 4XWYA 3GEGA 1ZIDA 4W6ZA 3ZWBA 1TI7A 4MINA 1IL0A 1DHRA 4XYGA 3AM3A 5A9RA 2VUUA 1M66A 1OC4A 1QR6A 3DZJA 4B4OA 4CLDA 2X5JO 3R3SA 2B5VA 4JN6B 1JWAB 2IYOA 4EDFA 1B8VA 2J3JA 3TZHA 5TJHA 5L4NA 3X2EA 3VOSA 1LSJA 5ITWA 1PZEA 1C0IA 1GPJA 3ADPA 1BW9B 1PTJA 4JQCA 4E5MA 4PVCA 1TXGA 4OKNA 1VKNA 1P33A 5L7TA 1ZK1A 4Q3BA 3PJEA 2FR0A 1QRRA 3HADA 4B8WA 3JQGA 5DOZA 3DB2A 3GDFA 1IUKA 3GZNB 3D7LA 5B4VA 3VDRA 4ND5A 4OAQA 3E48A 1BGVA 4E2YA 4YWJA 3WGGA 5BR7A 1P1RA 3GGOA 3GDOA 4BNFA 5FF9A 1F17A 1UP6A 1Q7CA 4FC7A 4H7PA 3WBFA 3GC6A 3FD8A 4H3VA 3SEFA 2XXJA 1Q0QA 4NFHA 5AVOA 4LN1A 4W9NC 2B69A 4OQYA 4YAEA 3KV3O 2OMEA 3I4FA 4MP8A 3O38A 4J7UA 3JD0A 4CL3A 1GEEA 1E0DA 2BFAA 2Y93A 3ZHYA 3BYZA 4JGBA 4XB2A 4RORA 1DJNA 1EVYA 3L4SO 1KETA 1D3AA 2GN6A 3VPXA 3D3WA 1EE9A 2W2KB 3QHAA 5THKA 3WGHA 2GN9A 4XYBA 3OSUA 1E77A 1J4AA 4DMMA 1YL6A 3KO8A 3EGOA 1WMAA 1ZSYA 4RVDA 4QO7A 4GH5A 4NFYA 3PP8A 4U0JA 4IGFA 1I0ZA 2PNFA 3B1JA 4KUGA 2JAPA 3LC1O 4PG5A 4R9SA 2IRWA 2EGHA 3JD3A 1YQGA 2O3SA 1ORRA 2CDBA 5JE8A 2UV8A 1WDKA 2HMWA 4FFLA 1I33A 4XB1A 3RJ9A 1F12A 3QWIA 2HCTA 2B0JA 4GLLA 1VL6A 2CD9A 3KYDA 3CMCO 4YAIA 3G0OA 1LU9A 3PYMA 5I9MA 4BNTA 3T7EA 2I3GA 2QQ5A 3LVFO 3OQBA 1AHIA 4ZU3A 5IDWA 3RROA 1LQTA 4HFMA 4LCJA 2F1KA 2DQ4A 4CLXA 3LF1A 4CMAA 2NQTA 1M2WA 2G0TA 2LDXA 3ZNQA 1PJCA 1U3VA 1T2FA 4KTTE 4D0RA 4BMNA 1GR0A 5U9CA 3TQHA 2YJZA 4BO7A 3U9LA 1VE9A 4LISA 2DKNA 2FHSA 4YDRA 5I7EA 2VHYA 4AJHA 5JY1A 3TPCA 4RVGA 5ES3A 4BQPA 3NRCA 1IB6A 2GZ3A 1V3TA 1GD1O 1XG5A 3T4EA 5I9LA 3FR8A 4XZ3A 2JJYA 2JHFA 5B1YA 3GK3A 5JO0A 1Z7BA 2Q2QA 3WMXA 3FNEA 4RGBA 4IJKA 1E3WB 3M2TA 1R15A 3A4VA 4ILKA 4QEDA 1K0UA 3DMTC 2QYTA 1O6ZA 1EUZA 4Z3DA 3W1VA 5C5IA 1NQ5A 1G0OA 3EHEA 1R0LA 3ZWCA 4CM8B 3RQSA 4A03A 1CYDA 2TMGA 2VRCA 4J0EA 3S2FA 4GL4A 1X1EA 4XQEA 3ZDFA 1YKFA 3ZHZA 4YRDA 3DOJA 5G0UA 3VTFA 3VPGA 1VM6A 1C14A 4BMVA 1RYEA 5COQA 2HK9A 5BNTA 2HMTA 2B83A 3H7AA 1SEPA 3MWDB 4GKVA 3WG9A 1WWKA 1GZ6A 2GN8A 3E1KA 3GEMA 3JQAB 3ZHXA 3S2IA 4GGOA 3RIHA 5KCZA 2YDYA 3H9EO 3GFBA 3WMWA 4DIFA 5BNFA 1O94A 2GLXA 4R4JA 2OZPA 3GQVA 4GSLA 4ZA2A 3ASVA 1EZ4A 4J49A 4QXMA 4DVJA 4DLAA 2GCGA 5F3RA 3H3FA 1LDBA 5IZCA 3WQRA 3PHJA 4J3FA 4NJMB 5CDYA 1T2AA 2EJWA 2Q1TA 1PJLA 5C7OO 4D42A 3W8EA 5G0VA 3K8ZA 4GX5A 2DUUA 2OHXA 4WJZA 3KLMX 3HG7A 3JQ7B 1LTHR 3V2HA 2WDZA 1F06A 1LUAA 5HS4A 1R4MB 2EIHA 4CV2A 3BMQB 4EI2A 2IYPA 1NAIA 3GVCA 1KIFA 5AXBA 2GUGA 4KDEA 4BB5A 1GPDG 4E5PA 5L40A 3E9MA 4YRAA 4R68A 1U1IA 2PD4A 1VJ0A 3BMNB 3D4OA 1PZFA 4K6CA 4YBZA 4U7WA 4DPLA 7ADHA 2EW2A 4IINA 1H6DA 3AW9A 3IMFA 4L76A 3ICCA 3IP1A 1TLTA 1NVGA 2X5OA 3OECA 8LDHA 1KYQA 1SB8A 1KEUA 3I9LA 4GAEA 2YV1A 2UAGA 4UVIA 4WOKA 1P0CA 3WLFA 4DL9A 1QORA 3F5QA 3NTQA 3PLNA 3MWEB 1XIVA 2E6UX 1C1XA 5A9SB 1B8UA 1DRUA 4MKZA 4YJHB 1CEQA 4R3WA 4DQVA 3COSA 3GVIA 4WUVA 4XYLA 2P4QA 2VNAA 1T24A 3IUPA 5L3ZA 2G17A 2DUWA 1K6IA 4P4GA 3O4RA 5FI5A 4BS9A 2BF7A 4UREA 1F0YA 2X5KO 4U0KA 2HQ1A 4NG5A 4E12A 3V1TC 1W0CA 1ISGA 1LBEA 3GNSA 4I5FA 1JKFA 1E3LA 2QRLA 4B3HA 4Q3NA 4E21A 1ZJZA 4E4YA 2NU7A 1W6UA 5TC4A 1DFGA 1WPQA 1QV7A 4AJJA 2I6TA 3OJ0A 4BHTA 5ILGA 2QHXA 3FNHA 3RUCA 4EITA 3OA2A 5JCJD 2Y66A 2B4TO 1UDAA 1PJBA 2VQ3A 3OJFA 2VN8A 1JTVA 4IMPA 4TWRA 4B8ZA 3W4IA 2O3JA 5JDCA 3ON5A 3VZQA 4EJ6A 3SX2A 1LRJA 3JQGB 3MJSA 1EUDA 3CPSA 3OQ6A 1UDCA 2I76A 3M1AA 4BKRA 3TZKA 2O7QA 3H6KA 4PLPA 2WE8A 3TJRA 3CMMA 1HL3A 4YR9A 1H6BA 1PGQA 2PZJA 1Q0HA 2BGMA 2DBQA 1MG5A 5FEUA 1DHTA 2FP4A 3PYLA 5A3JA 1M76A 4Z3KA 5L95A 2VZ8A 3QVXA 2Q46A 4XJSA 1EDZA 1KOLA 1PSDA 4ALJA 1DIGA 4FOSA 1YVEI 2Q4EA 1T4DA 2Y99A 5IG2A 1ZSNA 3SJUA 4DBVO 2VYNA 2EWMA 3AU9A 3INRA 4YTEA 3VVCA 5BSEA 6ADHA 4CV1A 3DHYA 3IL2A 1U8FO 3LU1A 3FI9A 3JQFC 5ER9A 3KEOA 2FPIA 1HE2A 1PS9A 4H15A 3UGKA 4XIJA 2NADA 1U4SA 2NUAA 4PZCA 1X7HA 4IM7A 4EUHA 1Z82A 4FR5A 4UVDA 1E1LA 3PI7A 1GQ2A 2VCYA 1JKJA 4S3MA 5TSDA 4CM5A 4OIMA 4BNMA 1B0AA 1BVUA 3UOGA 3OH8A 4OM8A 2PA3A 2NVBA 2CZCA 1AE1A 2NTNA 5F5NA 5DOVA 2AW5A 2JAHA 4CM7A 5AQ1A 4ND1A 4NNJA 4R1TA 5JDIC 3KHUA 1ZBQA 3ITKA 5B37A 2FRDA 3KYDB 4BNKA 4DLLA 3QLJA 4O1MA 4UEOA 4D41A 4D3FA 4CV3A 4ZRMA 5CDSA 1PZGA 4X54A 3A28A 2C07A 2HRZA 1ADBA 4TQGA 3GG9A 4XQ9A 1Q0LA 1DIAA 2Y68A 1E1KA 2AEJA 3GVXA 1XELA 3PDUA 2DBRA 2CDCA 2E37A 4YEDA 4JJFA 2BMAA 1MXFA 3LT4A 3D3EA 1CQJA 3PPIA 4XR9A 1J49A 4DC0A 3HE3A 3I52A 2FY8A 1HSZA 1TA4A 2ZYGA 4BKPA 4BVAA 2Z95A 4E32A 2NWQA 5GZ1A 3ETEA 4AJ1A 4JBIA 3FPLA 4Z9FA 1NM5A 3RJ5A 4YJGA 1VSVA 4XGIA 3K2EA 3QIVA 3IUSA 5L51A 3GVPA 4WLUA 3AK4A 3LDHA 1SCUA 2DLDA 1C0LA 1NPDA 3U5TA 4WGGA 1LLDA 3JSAA 3VH4A 4BNYA 4NQZA 2P9GA 4XYMA 3ZWPA 1QXSA 4WLNA 4MDHA 3C1TA 3DZBA 2P2SA 3ZCXA 2Q2VA 2EG9A 3SC4A 3ZU3A 5BSFA 1GDHA 4RPLA 4RJTA 4D0SA 1S7CA 2A9FA 2DPHA 5LDGA 2E4AA 5JW6A 1B26A 3KLPX 4CQMA 1EVJA 4WLOA 3OIDA 1B7GO 2YUTA 4IDAA 3FBGA 1B3BA 5F1KA 3ROMA 4HKTA 4JP3A 2BELA 3NT2A 4ALLA 2PZLA 4CPDA 2ZJ1A 1YB5A 2NV6A 2P68A 3AUSA 4MP3A 4UUNA 4DUPA 2NACA 3QE3A 3KSUA 3PZRA 1M67A 3OEYA 4I5DA 3WSWA 2EKLA 4L8VA 3ICPA 3KZVA 5C7IO 4FC6A 1A7AA 1ADCA 5A05A 4PLYA 3G17A 4R3NA 2DT5A 3LLSA 3NUGA 4OYRA 3OBBA 1I36A 3S2EA 3GG2A 3ZZNA 1DBVO 4NI5A 4E31A 3MOGA 1Z73A 1WNTA 2J3KA 3MJVA 4WKGA 4FFOA 1KVQA 3WDSA 5TJ9A 3NDJA 2E82A 4MJLA 1DB3A 2AHRA 4TSKA 4CM6A 1YXMA 2EF1A 2PZKA 4R51A 4UEKA 2GERA 4Y8VA 5COAA 3HUDA 1IOLA 1BHSA 3IAHA 4GBJA 2YHIB 5COBA 4RPJA 2J5KA 3A14A 3H9JA 2D4AA 1LLUA 2D5AA 4PG6A 4RVFA 3S55A 3PFFA 5T5QA 4ONEA 4DRYA 5KVVA 4WCFA 4O6VA 4FBGA 1P31A 1Q7BA 3TF5A 1GY8A 1WLYA 4DWVA 3UFXA 4JBGA 3G79A 4ND3A 4EGFA 4R16A 3OJEA 2R00C 4J9UE 4E5KA 1WMBA 3KVOA 1Y9AA 1ZEJA 2RIRA 4J1QA 4JNKA 4LK3A 1I3KA 4UEJA 2FR8A 1C1XB 5IN4A 3U0BA 4Z9XA 1XEAA 1Q2XA 5THQA 3I3OA 4AJEA 4BGUA 4MVJM 1YBAA 3ANNA 4BO5A 1MUUA 3KBOA 1QLHA 3PHGA 5MGBA 1ENPA 4HWKA 3X2FA 2I65A 4DC1A 1NR7A 3NJ8A 4IZIA 1T25A 1GCOA 4C7KA 1O8CA 4I8XA 1SOWA 3PIDA 4CJXA 2C0CA 2Z5LA 2EXXA 3LSYA 3MTJA 3PXXA 1LA2A 4IMRA 4KWHA 1PQUA 1T26A 2Q45A 3JQBA 1GTMA 1UXIA 3IKTA 3D5QA 4M1QA 1RM5A 4RCVA 3H4VA 2B4QA 3ONFA 3I5MA 1NQTA 3DOCA 4KOAA 4DLBA 1T1SA 3WWYA 4BNVA 3INGA 2DVMA 3O26A 3ETDA 5JMWA 4NK4A 1UZNA 1YOVA 4RZIA 4YCAA 3RCBA 4CMCA 1SBYA 5JMPA 5EJ2A 3OIGA 1D8AA 4BIIA 1QYCA 3KYBA 5T8KC 3HB5X 3L6DA 3PHHA 1R0SA 2AEMA 1HTBA 3JQAA 3RUEA 4IDEA 4CR6A 3FTNA 3BHJA 4OOFA 2HMUA 3GN2A 1DC3A 4J16A 1GV0A 2PKRA 1FDTA 5TLSA 1Y1PA 4N7RA 1Y9EA 3W6UA 4FN4A 4JJIA 5CEEA 1SEVA 3H9QA 1CQIA 3I4CA 1J6UA 1SZJG 2I9PA 4UUMA 1P45A 2X0NA 1EBUA 4OHUA 2FSVA 1E3JA 4OO3A 3AI3A 1XGKA 4WNCA 3PFWO 3IDSA 4IQ8A 2WWRA 1E3EA 1NP3A 4PCVA 4XR4A 3STHA 4CMEC 1F8FA 4HNGA 3P7MA 3B1KA 4QO8A 4Z0HO 5GY7A 4RV9A 4IDDA 1HDRA 3ROKA 2HRBA 3ROQA 3DBLA 5IZ4A 5H81A 4ND2A 3E5RA 2VYVA 2J3HA 2HDHA 3IS3A 3K73O 1BDBA 3OA0A 4GGPA 2ZB3A 3RUHA 4N54A 3GRKA 3BMQA 1KEPA 4TKMA 3JV7A 5A3VA 1FDVA 1ZO8A 4R01A 4Q3CA 2X0RA 2ZQYA 1E3SA 1UUFA 4HXYA 3GHHA 1ZEMA 3HN2A 3PYXA 5EMHA 4CMBA 3BMNA 3GN1A 3U4CA 4CLEA 1XQ6A 4UVGA 4S1VA 4F3YA 2ZIZA 3KB6A 1PWZA 3UCXA 3GMSA 3UKOA 4WEQA 4FJ2A 2O3RA 2WMDA 1LLQA 3F1LA 4I08A 2JL1A 3DONA 4BNUA 4RZHA 2FOIA 3V8BA 4M54A 1PR9A 3AFNA 3WYCA 2H5LA 3JYQA 1HE5A 1SPXA 2ET6A 3FWZA 1YJ8A 1RM3A 4GX2A 2D5CA 4LGVA 5CDGA 4RL6A 3SXPA 2PR2A 4AJ2A 4BNIA 4Y67A 2X9VA 3ULKA 4GVXA 2YHUA 3K5PA 2CMDA 3B20A 2YY7A 2D3TA 2G76A 4XQCA 2WE7A 3H5AA 4URFA 2POQX 1UAYA 1OBFO 1YQDA 2HLPA 4BKQA 1T1RA 4N5MA 3RD5A 5EQDA 1KERA 3DFZA 1ADGA 2X7HA 1ZH8A 3S8MA 1DAOA 3AOEC 3B70A 4W82A 3ABIA 4NFSA 1Y8QA 3L07A 4MVJI 4UULA 4QQRA 4FPXA 1BWSA 1ID1A 2CVQA 5HS6A 1O0SA 2W2LD 4K26A 3CE6A 3IIEA 5AOVA 5TX7A 2O48X 3AFMA 4YJGB 3EYWA 4RF5A 4J43A 1GUZA 4J6FA 3UAGA 1HDZA 1U3TA 2VYND 4LSWA 4ROSA 3TN7A 4W9NA 2W90A 4HFJA 1RJWA 4P38A 1MGOA 3DL2A 1LSUA 1UXJA 4FFRA 1A71A 3WWZA 9LDTA 1GUFA 4Y98A 1ZSVA 4OSOA 1WP4A 2Z1MA 5BT9A 3BMOB 4FFPA 3N58A 4YYZA 4IQGA 1I30A 2B36A 5JS6A 2QX7A 5KKAA 1KC1A 2G1UA 4ZGWA 4CMKA 4YJDA 4MVJF 4CQMB 1I32A 1ZKMA 4CM4A 1A7KA 2C7VA 4GMGA 3ZGYA 3A9WA 4R54A 1MP0A 3H2SA 3NJ4A 1I01A 1R12A 3WS7A 1HE3A 3RKRA 4CM1A 3NGXA 4BO1A 1P1KA 2ZTVA 1VJTA 3K92A 2X6TA 4DTIA 1IHXA 4EW6A 2HAEA 5ADHA 4AL4A 2A94A 4Q39A 1A9ZA 5U1PA 2Y0EA 4WOJA 6LDHA 4EJMA 1GEGA 1LRLA 2GRAA 4JCOA 3EDMA 1EVIA 1NWCA 2NU8A 2FZEA 1ONPA 3E9NA 5IF3A 4D79A 3RUIA 2WEKA 3WGZA 1YBMA 3ZW8A 3Q6IA 2VRBA 3HB4X 1YL7A 3H9GA 3KEQA 4MIEA 4NBRA 3NDIA 5L53A 4PLCA 1R4NA 3MJ4A 1XWFA 3L6EA 1NWHA 4ZJUA 2IEDA 2C82A 1LJ8A 1F14A 1PIWA 3RASA 3D0OA 3ZU5A 1P77A 1WAMA 2AA3A 4OXYA 5CP8A 4PLWA 3WIEA 4WCFB 4CODB 4BO8A 3RC9A 1JKIA 4MIYA 3UVEA 3LT1A 4PFJA 1PQPA 3JQ6A 4NPCA 1U3UA 1QYVA 4FSHA 1B8PA 1NAHA 1A27A 2OORA 3NTRA 3LT2A 4J1SA 4IQ0A 3ROPA 1RWBA 1ZUD1 3F9IA 3WFJA 4CQMD 3W4KA 4EEXA 3I6IA 5MDHA 4QTZA 5JYEA 4FJ1A 1CRWG 4RDHA 1YS4A 3DMTA 3WYEA 2DC1A 4W7IA 3KRTA 1NX6A 2V6FA 2VWPA 3RAJA 5G4LA 1EQUA 1GYRA 4J7XA 2PZMA 2WYVA 2X8LA 1X14A 4NBWA 1MC4A 3TWOA 3WBBA 3PLRA 1JU9A 2E49A 4KWIA 4OGWA 1UR5A 3BTVA 2OOSA 3SLGA 3AY6A 3GVHA 3VKVA 1ULUA 3CZRA 3EW7A 1CIVA 1UP4A 1LLCA 1E6UA 3OF2A 4L73A 2B35A 5DCWA 3VHRA 1O9BA 1XU9A 3TSCA 1UAGA 5I8ZA 1FDSA 1FDWA 3WGQA 1UH5A 1LI4A 2CFCA 2BRUA 3ENNA 1HEUA 1CETA 2QG4A 5DDIP 1PGPA 1TT5A 4OQZA 4O63O 4BNWA 3I83A 4TROA 5EIOA 3I1JA 3UW3A 2O3UA 5A02A 4J4TA 1YOVB 4B79A 5JAZA 5KNLA 1MB4A 2UDPA 4O5OA 3WTBA 1Y5MA 4RVHA 1NVMB 1B15A 4O59O 2RH8A 1NR1A 1ONNA 4R1UA 4ALIA 5EPOA 4E6PA 4BUCA 4L4XA 1D7OA 1YE3A 1E7WA 2FSSA 3F3SA 3ZNOA 2CNBA 1ZJYA 2Q50A 2HU2A 3JQ9C 3BZUA 1K89A 1LC0A 1ZK3A 3LC7O 1NBOA 2VHVA 2Z1NA 1YQXA 3E5MA 3E8XA 3N7UA 4IZHA 1GZ3A 4PGFA 5ICMA 3L6OO 2VHZA 4AJKA 2EJVA 5DBFA 1W8DA 4NH4A 5A9TA 3DBLB 3LZ6A 2AXQA 2B37A 4YXFA 3WQQA 2HK7A 4KTVE 2YHIA 1WVGA 4UVEA 1QLJA 4WLFA 3UHAA 1U7TA 1JLLA 1MFPA 1X7DA 4XX0A 2ZB4A 1QYWA 3DBVO 3CIFA 3H65A 3HDHA 4FOOA 3E9QA 2ZCUA 4PZEA 5KJCA 3NDRA 2Q49A 3MJCA 3BTUA 1PL8A 5G2OA 3OJLA 4IS2A 4J1TA 2RAFA 5IN5A 2BGKA 2O4UX 3BMCA 3JQCA 4OMUA 1L1FA 1EQ2A 2C59A 2OO5A 3BHMA 5G0WA 2VOJA 1CJCA 3HFSA 4M89A 2AG8A 3QQPA 4BKUA 1JW9B 2ZYDA 3D4PA 3FN4A 2EERA 3L9XA 1Z45A 2X58A 2YFQA 3VC7A 3ZU2A 4CQLA 3H2ZA 3Q2KA 2NM0A 3F46A 2QIOA 2RH4A 2H6EA 4RF2A 4NIMA 4MO2A 2YZ7A 4DYVA 1X0VA 3GDGA 2CY0A 4YT2A 3JQAD 4J7CA 1EDOA 1NXQA 3PJGA 4CUZA 5CEFA 4R1SA 3GGPA 3JYNA 2O4CA 5EESA 5DZSA 4IDCA 4ID9A 1ZXBA 4M55A 5IFLA 1ZW1A 1M6WA 2QRJA 1QSGA 4B4VA 3U49A 2Q99A 4A10A 1EMDA 3WGTA 4CLRA 2TMDA 2X9GA 2PH3A 1ZFNA 4BO9A 1R6DA 3GA0A 2QW8A 1JWBB 4RPKA 1ZVMA 1Y8QB 1W4ZA 1YB4A 3OP4A 3AY7A 5KOIA 4IY1A 1HLPA 3DMYA 3KXDA 1HYGA 2QZZA 4WLEA 1PL7A 2DBZA 2PGDA 1EVZA 4KMSA 4FQ8A 1P1FA 4JLWA 5U4QA 2NNLD 3TFQA 2Y0DA 2W4QA 4ZVVA 2ZTMA 3HDJA 3KOUA 5CPBA 3K96A 2VTEA 4K28A 4G81A 2HO5A 1PEDA 3DHNA 3ZWAA 4Z0PA 3WJ7A 1FMCA 4WEOA 3T7CA 3ZH2A 1J0XO 4RPGA 1YJQA 3RU9A 3KTDA 3V2GA
chains in the Genus database with same CATH superfamily
4GX1A 2LW7A 2YQ5A 3B85A 3WLQA 1KWGA 2MYPA 1WABA 5B4UA 1MXHA 3C24A 1TDJA 2XUPA 3HCBA 1JTEA 1SCNE 2J46A 3WV5A 4AY2A 4LAFA 2O5EA 3JVUA 1NFQA 2A4MA 3P2JA 4RK0A 2VHJA 3PFGA 2FSIA 4GX0A 2X1HA 2TMYA 3RT1A 4L8YA 4PLHA 3F6RA 4EABA 1JMVA 1G5RA 3OCYA 1DT5A 4P6VF 4QOFA 2VUHB 2JFXA 3FX2A 2VZ9A 4NYMR 4TKVB 1TYEB 3SICE 2ZXUA 4P32A 1WPGA 3D2AA 1U2DA 4CIDA 4IWNA 2NZWA 1SKMA 4DQKA 2K2WA 4QGSA 3RTCA 1XYGA 3QSGA 4RELA 4F71A 5HVNA 3UPDA 3ESQA 4QVIA 1X1CA 1E1MA 1QO0A 4F85A 1GQYA 1O1YA 2V7EA 1SHLA 2O0JA 4MEAA 4NX2A 3AJEA 4JOBA 3TRHA 3UO8B 3EDYA 2GRJA 3A6HA 4UOEA 3E8SA 4H3KB 3L7BA 4WAUA 3NYQA 3B7PA 3WHKA 1L8OA 5HCIA 4DV5B 2VJAA 1DV1A 1ECBA 3IMKA 3P9QA 4GQIA 4IGEA 5HBRA 1R3UA 3K0BA 2ONYA 2PUFA 3C6ZA 4HX5A 3EY4A 4DSOA 4KR2A 2XHEA 2Y2VA 5DGIA 1TM2A 3W7BA 2Q7XA 1C4KA 4LI0A 1VRWA 2IY7A 3E18A 3ZJVA 1YCFA 4UATA 1R4NB 1KZHA 1JA1A 4HWOA 4LF5B 3Q88A 2FPRA 3GFTA 2H0RA 3RVLA 3WDKA 1EGHA 3SDSA 4Q37A 4U2CA 1RC8A 1FQOA 4GBGA 4KSBA 2HCBA 2XUQA 4K9SA 3FSRA 5EIWA 3TLBA 3ID6C 4PXAA 4TVBA 3RU3A 1WY5A 4ZOAA 1WZUA 3F6BX 3G2KA 1UWLA 5JZBA 3VSEA 1L4EA 1JHZA 3PEEA 4Z4IA 1IZZA 2UU9B 1RP1A 2HRCA 2J5BA 3CH7A 1I2DA 4LOHA 4ENQA 4CLOA 2O3QA 1P1HA 3OE4A 3P9ZA 1ZDMA 2PLNA 4DQDA 4YRPA 3I8OA 1D6SA 1CERA 1C9KA 2NUPB 4NEQA 4DBZA 1W94A 4F92B 1ZM2A 2JHPA 3CUVA 4N5NA 3LDAA 1XTVA 1LPSA 1WB5A 2H1FA 2ODTX 3OSZA 4BGDA 3KDSE 3THXB 4RYDA 2H7CA 1GCAA 1PEYA 4L27A 4ER5A 3GBPA 1NVFA 2DFVA 2Y1OA 2QD3A 1EVEA 1QIHA 1NNLA 1W96A 2CYAA 7REQA 3R6WA 4L9SA 4Q93A 3ORYA 2Q9UA 2HGSA 4O2AA 1DLIA 2H0AA 1C7JA 4JUDX 1Z0SA 4TTRA 1F0KA 3IPRA 5DM4A 5KSZA 1FTGA 3NAMA 2QZ9A 2BFMA 4YO8A 3DTVB 1MAUA 1B14A 4XEHA 5JS7A 4CEHB 1DEAA 1E5LA 3MINB 3AL2A 3VPDA 1AZTA 1Z38A 4OBEA 1V48A 5L7WA 3CH4B 1P5FA 4P31A 4ZIRB 3AHEA 4L9RA 4RE6A 5BP7A 1BFUA 3PFBA 1X13A 3R9KA 1KR5A 2D74A 2QU8A 3DC2A 4LXIA 5CBPB 1QC5B 4BNJA 1J5XA 4OQEA 2IHTA 4BJ5A 1CR4A 4G1EB 4HFNA 1MV5A 2AC7A 2QB5A 5KVSA 2GXAA 1ZCAA 1WXWA 3DJFA 3V8RA 3K70D 4PAWA 2IXBA 1AQUA 5TGTA 4B3XA 5I47A 1SZPA 3MCUA 2O2SA 4ZGGA 2ZS9A 3O8DA 1TM1E 2QTVA 1Z2DA 2XITA 3KD3A 4UTRA 1TZCA 1OKKA 1ACMA 2XOXA 2VO1A 1FRFS 2I8CA 3F67A 3IHTA 3ILVA 3OFNA 4HDNB 4AWBA 4IIVA 1XPRA 1M34A 3AF2A 3NHKA 4ZTZB 1SIBE 2G5CA 5HWSA 3K3PA 1SULA 1NASA 1ZJJA 2O1SA 2JEYA 3JQDA 3OM9A 4KK3A 4WADA 5DCUA 3KZKA 3OFKA 3ETCA 3IV6A 1CZNA 1Z3CA 4D99A 5IYZB 3CSSA 4GE3A 2G9RA 2BR5A 2DU8A 3PI6A 4COOA 3D6UA 4M8SA 2P6NA 2AJTA 5EOVA 5IXYA 3GNLA 1DOHA 3ELUA 1TJYA 4MTCA 4AKSA 1XD2A 1ZD3A 1CB7A 1LGYA 1G8PA 1HDOA 3AQIA 1W36B 4P22A 1IMJA 1QRSA 4EY7A 1YJAA 3M6IA 1GYQA 1SHUX 4TRJA 4MUEA 1OSNA 1U3GA 3ZE1B 4D56A 1IPHA 4IDHA 7YASA 3Q8MA 3HJCA 4QNRA 4LE2A 2O57A 3BIXA 3SR0A 4D4IA 3OMWA 3FPCA 2D1QA 2WYWA 4OGGA 3JR3A 1FFXA 2BMFA 2ZYVX 2FLKA 2NOAA 5AM5A 2C57A 2PNJA 4MRAA 4YUVA 4NEGA 2AQ8A 2LCIA 4HWGA 5A4JA 5LMUB 1R8JA 4GYJA 1ESNA 3B12A 1DUVG 3IBYA 3P9CA 3Q41A 1V9CA 5KYXB 2XE6A 4MPJA 1QZZA 4ND7A 2W43A 3CR8A 2P3QA 3I9KA 2HSDA 1VKJA 3WDMA 1MFZA 5EWJA 1V8ZA 3PIRA 1YMVA 3G1UA 2DFLA 3ZLUA 2DX7A 3RUFA 1P2UA 1T4GA 2NG1A 3BMCB 5K4GA 2EZUA 2O19A 1IRIA 3BA6A 3KOZA 1RXYA 2PSEA 1HFJA 2I4MA 3DEYX 3EWNA 4N0PA 4H0FA 1TMOA 3L7NA 3WL6A 3TGLA 1NNEA 4AJLA 2R8OA 2Q1WA 1MV8A 3DO8A 4YO7A 4F9EA 4O08A 1KKLA 2GLUA 2OO3A 1VGRA 4DPKA 3GJSA 1AKNA 3AVOA 3H16A 1FS4A 2GJAA 5E8JA 3STYA 4ZMSA 3L1HA 4FCTA 4U02A 5I4KA 1KJ8A 1M6VA 5H70A 3RT9A 3M5PA 3LP6A 1VHTA 3WX0A 2H85A 3VYVA 3G23A 1ZONA 1GSIA 3AEYA 4NV1A 4LQ4A 4KAAA 3HKCA 2A3NA 4Z8YA 1GU7A 3LUCA 2YIJA 1IBKB 2LKDA 3CX8A 4AP9A 1AQJA 3DLAA 3BEDA 1K6EA 3TX6A 2ORVA 2PL3A 3EMKA 4WECA 3QUTA 2KBFA 5GQSA 1Q0SA 4AYTA 1Z5PA 1V1RA 1P9NA 5ALWA 4B3GA 1Y9JA 3LT5A 1ABFA 1EYZA 3WR5A 1D1PA 3ESCA 2R6HA 2PKQP 3O3CA 4PIMA 2C7BA 2XYHA 2JGAA 3A9CA 3RABA 4C4AA 4YXWA 4D3ZA 1BX1A 1Y3CE 2JAUA 2XVMA 4PYNA 4NBVA 3TL2A 3LW7A 3L92A 3D54D 3PKJA 1G18A 1ONSA 2GPSA 1MEOA 5AUPB 4RULA 1MO6A 4MNTA 1GZ4A 2MTBA 2ZQZA 4NBTA 5EKXA 2H8GA 4LTDA 3GJXC 4IF6A 1FW8A 1P72A 3E0XA 3F6EX 4YJ2B 2EJCA 1Z4NA 2QUJA 3U7EB 3AVWA 4NF2A 3EQ8A 3KVVA 2DPLA 4BNLA 1IWBB 1LS1A 3N8KA 5C0OE 2O0HA 3FOEC 5JU6A 1XFDA 3KOYA 3ZDXB 4AM8A 4JLKA 1SUSA 4BAZA 4JLSA 2VJDA 2B3DA 2LRHA 4X7MA 3QG5A 5LDHA 1N1GA 3O92A 3RE1A 3FMGA 5LFAA 2OBBA 4F9FA 4JYAB 5BVHA 1FTWA 1R7RA 3QWHA 5CHYA 3N8GA 2D7JA 3LYAA 4UTZA 4K8RB 3PS9A 1NI4B 3H97A 2XXAA 1ONOA 1W5BA 3JWHA 1ZUIA 2XHZA 3BULA 1NE7A 1X80A 2QPAA 4NFLA 1ZJ4A 2ETXA 1U5CA 3PC4A 1COWD 1FVOA 2ADMA 2GFQA 2IZ7A 4KLCA 4TL6A 1FX1A 4XLZA 3OU2A 1RQ7A 3BXFA 5LZ4A 2EZ4A 3Q7SA 4EW2A 1XRMA 1Y7TA 2IYSA 3VYUB 1FTYA 1E69A 2C3MA 1VHDA 5BQXA 5HUHA 1R6BX 4OSPA 1T1IA 1NXOA 3NONA 2QAJA 4HNHA 5FB3A 1OA1A 4RXUA 3RV4A 4ZJYA 5AD1A 4L4SA 1A5SB 4N0QA 5D1NA 4EA9A 4BNDB 2M6RA 4OHMA 3PC8C 2A7QA 3AJ9A 1UBFA 1ZQ9A 4AULA 4MQUA 3IBGA 4E7PA 1T9KA 1GZ7A 2QVZX 1W0JD 2H2DA 2UKDA 4QLOA 1NF8A 3N8HA 1IHOA 4B40A 3EXG2 5IVIA 2XKJE 2YFHA 4Y0VA 5CURA 4RPCA 3DE1X 1P3DA 3ASUA 3KT3A 4N3NA 3C8HA 4PAOA 2DCUA 1RPAA 2X0KA 4FW8A 2YWCA 4OI2A 5AI5A 2ZSBA 1XLTC 2W2NA 3F4KA 3LF2A 4TLLB 4MH0R 3D7SA 2ZI9A 4HYQA 1A5AB 1GZHB 4QVGA 5L9AA 4QGFA 5EPEA 4C5CA 4ME6A 3WIVA 4C4XA 1B1AA 1RQGA 3DR5A 5CA0A 3ZHQA 4CIWA 4B6SA 3EZYA 3ZHTA 4F9TA 1PNQA 2H4WA 4IIUA 2RHJA 1YS1X 3UAXA 3R3VA 2Z83A 3RS9A 3BCRA 2B7LA 3H9UA 1IHUA 1ECPA 1SVSA 4PIPA 3SC2A 1J90A 2YXBA 2J5QA 4IJVA 1QP8A 1TZ2A 5HDQA 3NV7A 3O8QA 3GGCA 2H1WA 3TH5A 1PVDA 1YVDA 2PKQO 2UZ3A 2VA9A 3SHTA 3K31A 4GKJB 2QLTA 1CC1S 4JUCA 2JFNA 1HLDA 3A6KA 1P6UA 4IFTA 3TUJC 3WLHA 1UFOA 3HEBA 4DRXA 1FYFA 3FRIA 1QGOA 1D6JA 1CJMA 4RLHA 1I14A 1BMFD 1I7SB 3D6VA 2XMSA 2YV3A 1KGSA 2GJ4A 1HC7A 3O5AA 1XZEA 2CLFB 3OLYA 1WXQA 4O8ZA 2VHQA 4EFKA 5HRUA 1VI5A 3FMOB 2DFDA 1WEKA 3M9XA 3BIFA 1ZG3A 1KYIA 4NXMB 2XMDA 2PU7A 3P2KA 4QSMA 1H2HA 1HLGA 3IRVA 3OEED 2YWBA 3QOYA 4H7KA 4LZLA 4RKQA 5DLEA 1DADA 2A1UB 1NW8A 1QX4A 3C2QA 4FGKA 1C9JA 2P2YA 5TMDA 2VTBB 1JLSA 1V7CA 2ZT6A 1IU9A 1ORWA 4JQYA 2GOYA 4GIBA 1RXWA 4XPIB 1UK8A 2J67A 4Z2AA 2WSSA 1HGXA 4ZO4A 2FMXA 1L5KA 4PZ9A 5L4LA 4I9NA 4FMPA 5JCOA 3RBZA 3VR6H 3TLYA 3BGIA 3AG6A 1N77A 1YJ5A 3IOEA 4HUTA 3EISA 1M1NB 4MWZA 2G8NA 4OJTA 3OQ1A 2P91A 1OH5A 1X92A 3ML1A 1XZNA 3ZJUA 1QWSA 2YMLA 3HJHA 1DKNA 4W5WA 2BWJA 1MEJA 3I9V1 4M9QA 1YJBA 5T4EA 4KIGA 4CMIB 3RC7A 4WY2A 3ZE6A 5ALQA 2NQ2C 3OZVA 1SQSA 1IOVA 1G3RA 1T9DA 1SU7A 1G20A 4RKWA 3V4OA 3WKDA 3ZHRA 4BL5A 3BD8A 2CVZA 2AZXA 3R77A 3EXAA 4KN5A 4G5OA 3U3JA 1E3MA 3W9BA 4DPMA 2TRSB 1MTZA 1ZM3A 3SG0A 3RVBA 1GPBA 3PDJA 1KDYA 3R20A 2GSWA 2XB2A 1ZISA 2WT9A 4KUEA 1G291 1RIIA 2XNKA 2P9HA 1IM5A 1WXDA 2RGDA 1LBHA 1C4OA 1QZXA 3JZMA 4KIUA 2OQVA 4E6EA 2JAQA 2XODA 3CT4A 4TV9F 1TE2A 1XEFA 1B16A 4DLZA 5H1YA 1EP9A 1R5OA 1M74A 1KI1A 3DF7A 3T4XA 3A25A 3DBRB 3C74A 1BG6A 2CW5A 2FYTA 1X1AA 1G7RA 4V03A 2HA2A 3UJDA 4PG7A 2BL4A 4EJSC 2C9MA 3DEHA 3QFHA 1Y0BA 3TRIA 5F7XA 2NVUB 3QE2A 5AIBA 4CU2A 3K1JA 3AVXA 3TPFA 1YA6A 4YJFA 1OFGA 1S9HA 1JMYA 5CVCA 1THMA 2O9JA 4PZUA 4X64B 4XDHA 4JP1A 3LD9A 4OP1A 4X1OA 4BLWA 1V7PC 4X1KA 2RJ3A 3GIWA 2HYIC 1ENZA 1MH1A 2HMVA 1O5TA 3ZQ4A 1KO8A 3IUQA 1B6SA 4JKYA 1VMDA 1QP4A 5BSWA 1JX6A 1J5PA 4KRGA 4GZ5A 4GOOD 1VL5A 3UV6A 1U8CB 2RGEA 3LK7A 4W9MC 1T5IA 1RCFA 1Q20A 1T8PA 1FJ2A 3M89A 4V0ME 4Y9UA 3GB9A 3KK0A 4DHEA 2P5SA 3TLGB 4OLHA 4DYDA 2R48A 4CF7A 3T4UA 1CF9A 3LQ1A 4JEHA 4C07A 5D5QA 2QAGA 1IUOA 1T6YA 1Z0KA 1MOQA 3VPCA 2RC5A 5CPFA 4RJLA 1N5DA 3BCHA 5FR1A 1KQFA 2OFXA 4XXHA 4UQOA 3VPFA 4EPVA 3V4RA 4K1LA 4YB8A 5DTMA 2VZLA 2I1QA 4PSDA 5GADl 3N2EA 4WXMA 4J29A 2Y3IA 4IDBA 1Y6GA 4FFNA 1NYQA 4WKBA 2J32A 4WJLA 1JP7A 4KX5A 1Q7RA 3JQ9A 5TQVA 3B6MA 1BDJA 4B6PA 3W5DA 3PJDA 1AS3A 2ZBQA 3C7CB 4ZALA 5CB4B 3B52X 2BCEA 4Y2UA 1C5KA 4TXLA 3SBOA 3VYWA 3R7AA 4AZ0B 5KYYA 2Q2OA 2QZSA 4INAA 4PPNA 3RC2A 2FSUA 2HEIA 2OL4A 4K9MA 1TQ8A 4B4WA 3RSHA 3GAFA 1JT2A 3LQKA 3SGLA 4K0KB 4PZ0A 3FPJA 4G8DA 3ANYB 3D8RA 3LLVA 4V1CB 3JWPA 3IC5A 3PT5A 1FEZA 1GCIA 1RKBA 4PG4A 2Y1FA 3WK6A 3L0ZA 4NV0A 1KJYA 4I1UA 1C1HA 1D07A 4QG7A 3FPKA 4DSTA 4CN8A 3HGMA 1J0EA 1KXZA 3DWIA 5EQFA 2P9EA 1NXSA 1K8XB 2J4CA 1DJPA 1E9BA 4GOJA 4MV6A 5IHPA 4YDSA 3S1SA 4UQLA 3ICQB 1ML3A 1HQCA 2VAVA 3JYOA 1JZQA 3PNOA 1HDEA 2K7ZA 1Y1KE 3V80A 1X42A 2IVFA 1U0HC 3HFGA 4EHKA 3MS2A 3OKFA 3PHCA 4HX9A 2AOTA 3D8TA 3DTTA 3B1FA 4LV5B 1XI2A 5CCDA 3WICA 1Z5GA 1DUSA 1EWRA 1GVNB 3OMLA 2CC2A 4OHCA 4UKDA 3ZPXA 2PS9A 2ZUDA 2P7HA 4YMWA 1YWGO 1W4LA 5JRZA 3DNMA 3IBSA 3VZDA 3DCYA 1LQUA 1N5LA 3C70A 1QX3A 3M1YA 5CCBA 5E6RA 1DJOA 1YTUA 3PGMA 3STWA 1MDFA 4I2NA 1X7ZA 3W6ZA 1RKXA 5FI0B 3KUUA 2NUTA 5IM5A 4NENA 3HYNA 4DA8A 2ATIA 2ROQA 1A4IA 1SMKA 4Q01A 2FZGA 4ZQFA 3DV9A 3OQHA 2JD2A 3KKZA 3H5RA 4O33A 1R37A 3LHSA 3IEKA 4IPTA 5B64A 5FWNA 4YHHB 1V3QE 1QJCA 5B3AA 3UICA 5DI9A 5FORA 1DAGA 2EGUA 3E23A 4MW5A 1E8MA 1IULA 2IITA 3B89A 2D0OB 1C9EA 1GKKA 2PRIA 2AYYA 1NVTA 3GZTB 3Q3GE 4P7BA 4ZTUB 4Q1VA 2I66A 3RVKA 3MD0A 1MX3A 4I3FA 1L5YA 2QYOA 3KQSA 4PNHA 4QUDA 1UBOS 1XLVA 2CLDX 1BMDA 3DBHA 4FQ5A 1ZN2A 4U7JA 3GT0A 3IA7A 1SO8A 1YNSA 5E9WA 4IDOA 2FFAA 1C41A 3JVDA 1PSZA 5HTKA 4DIDA 2BGRA 3L7MA 1P75A 3KSDO 5I9TA 4LY6A 5FTLA 4LNUA 2PFGA 3A36A 1B6GA 2QRNA 3BGWA 3DEFA 1P2VA 1QCYA 2H4XA 4JWTA 2QMQA 5DF1A 5KU1A 2A5JA 4QATA 3TOCA 3DKPA 4MZXA 3EZLA 5E7QA 4ZCTA 1OJLA 4HN4B 4AY6A 1MG0A 2XA1A 2ZAOA 3HLYA 4L51A 1FFGA 4BFLA 2IDKA 1BEUB 3AM5A 3BTSA 4G0NA 4P36A 1I24A 2PYDA 3AXSA 4KDFA 4MCHA 5F4BA 3U7JA 2CEKA 5FWYA 3WFZA 3KQYA 1FTNA 1OAAA 1N9GB 1OX4A 2YWRA 4QGBA 1V11B 1Y48E 2HHJA 2FRXA 3CRZA 1JIIA 3ACCA 1IDN1 1ZZEA 2J07A 3COWA 3N7TA 4MS3B 3WOHA 3WGIA 1SRQA 4E3ZA 2G25A 5D85A 2ZSHA 4Y3UA 3THYB 3DYBA 5IAOA 1H0SA 2P5TB 3F7MA 2WIFA 3BA1A 3NXKA 4LC9A 4MVJG 3WAGA 1IWOA 3RYIA 5DHQA 5FI3A 2Q5QA 1KVTA 2IQ5A 4CFSA 2C4WA 4Z4QA 3ESYA 1XA0A 1W9MA 1ZYUA 4WBSA 2I7TA 2O7SA 1NNUA 2P7IA 2RGNA 3MB8A 1YOBA 1GA4A 5C5CA 3SVLA 3H5TA 1CR0A 1CQZA 1P2DA 3FIUA 3G49A 4OH1A 2R5NA 5DX0A 2C54A 4DSNA 1SQ5A 2BZGA 4LOKA 4FS3A 2O23A 1ZH4A 4TT3D 5FO1A 1WW8A 3GQBA 4WZAA 3VH3A 3X1ZA 3VYSB 5JOQA 3TLEA 4N12A 4EX7A 1UXHA 2IYTA 3OFJA 4TMFA 2ZJYA 3I64A 3G9XA 1N2SA 4ZT3A 1LSSA 3I9JA 4KDCA 1QH8A 4HEJA 2BOVA 3F3YA 2NO0A 4WSOA 1T5BA 3W2TA 2Z09A 4IVRA 4D8WA 1FFHA 3C7DB 2OE2A 5JDCC 2XT9A 3REQB 1NLZA 3R5XA 4I9FA 3FOZA 1VDMA 2QTZA 5ITVA 1Z2PX 2ZLBA 3HUTA 4BO4A 3D3NA 3A3YA 2ADFA 1FX0A 4KQEA 4DILA 1MAWA 4MWEA 4JLJA 1M10A 4DDWA 5AYVA 1CEYA 3E15A 4I1RA 4TKUB 5D2CA 4TS4A 1WBBA 4HDKA 1I3CA 4DCGA 1V8BA 1WDMA 2YXEA 4U6SA 1VIMA 4B6RA 3I6QA 1M8PA 1Z6TA 3A1EA 4ES6A 3TJZA 1U80A 4XFDA 2FVYA 3H6GA 3IXLA 3R8XA 2OLEA 1RJ9B 3FYCA 1OA0A 3UB2A 1O7JA 1YR2A 4E5NA 1PFYA 3C5CA 5CAEB 5IKEA 2OV1A 1JJBA 1FU8A 4OBBA 4QASA 1T15A 3KQNA 3EZNA 2X8WA 2ZIVB 1BXGA 4GF5A 2FXIA 2WWTA 1UXKA 2YXDA 3UV3A 2A5LA 1XT6A 1CNMA 1EB9A 2B1IA 2X13A 2ZBGA 2D00A 2V6BA 3MZ0A 4HHEA 4MHSA 3V55A 5C3MA 3UXYA 3JASA 1B1CA 1G5TA 5ALEA 3E70C 3URMA 3GNTA 1JHDA 3M3DA 3RSZA 2ZK7A 3VR5A 1CS4C 2I7VA 2X77A 1WU7A 5FOSA 4CI0B 1S2NA 3VJRA 3L04A 2QVXX 1EK2A 2QPLA 3LO8A 4OL0A 5DFAA 1NJ2A 4ZZIA 2RI1A 1GAWA 2EARA 2Q21A 5ADUS 3Q3HA 4LRUA 4OB7A 4QFMA 1FIUA 4H1TA 2PJUA 1JQBA 2IDZA 4UE2A 4AMUA 3IPYA 3MWGA 4QUIA 4XGKA 5A3QA 1WCIB 4KIJA 2I99A 4F4DA 1EDDA 2SHKA 3L9WA 3MCVA 4C4YA 4EKNB 2YVKA 3OHMA 4L85A 1E32A 4HNRA 5KJ6A 4RA9A 1W85B 3AY0A 2FRDC 3G2PA 4WLVA 1AKTA 3PV0A 2PYZA 1RHKA 3VPSA 1OLUA 4A82A 5CW1A 1CJKC 5EPUA 1XYVA 4EFDA 3ST7A 3UHPA 1NMXA 2NO6A 2RHHA 2W2TA 4EZBA 3KDPA 4KR0A 3CYFA 1QF9A 4ZAGA 1Z7EA 3PXEA 4ZK6A 3KLNA 4EDHA 3HDYA 2Q9AA 1PX0A 2XOKA 1JDZA 1F9AA 2WQZA 4MS4B 3I6BA 3QVUA 4F5EA 5FBVB 2FCAA 1H93A 5EVJA 1DAPA 4TZTA 5AHRA 4WX2B 3MTEA 3RUDA 3AZQA 4ARZA 1R8QA 1DVRA 2P69A 1UKAA 4G8JA 1OLSA 1XXHA 3WRXA 1N7HA 2CV1A 3CN9A 4BQOA 1FDUA 5JJLA 1FYVA 4U9HS 4LYHA 4N18A 2QWXA 3SCZA 4HTAA 4OGKA 3EIOA 2BHLA 4OG2A 5EXSA 3U3OA 3CW9A 2CXOA 2WWVD 4F1JA 1ISIA 1WKBA 2FMKA 3D59A 1XZQA 2QE6A 4H0NA 2PV7A 4LZZA 4AG6A 4GVLA 5IT0A 2VK4A 3CU5A 4C30A 3RSCA 1NM5C 2OR3A 4RQUA 5L8VA 1TIPA 2HREA 3BFKA 3LBAA 4UBMA 1J8MF 3T5PA 2OP1A 3T1YB 3TTYA 2BFCA 1UMCA 1PJSA 4M86A 2WYUA 4YQYA 3ROPA 3SOZA 1JBQA 3R7FA 2KW5A 1W73A 1EWYA 2HM7A 3LBHA 1FU7A 4BB0A 3I9NA 3C3DA 3WHIA 4E0BA 3HWSA 1VYTA 2V7GA 4HOYA 2WIAA 1RJGA 2A3RA 4YROA 2C94A 2ACVA 2IIBA 3BN3A 3L0DA 1KVUA 1PJ8A 3ZLJA 3VH2A 1S0UA 3H4MA 2IXGA 4XE5A 3GZ4A 2RC6A 4FQ7A 2I1VB 3N0XA 4MZDA 3L8EA 1JHUA 3CUYA 2GJSA 4ZPJA 5FAKA 2I80A 2QP9X 4YRBA 3KLOA 1NBMD 2GCOA 1SXHA 2ZBVA 1RZ3A 2NYRA 3GJ7A 3UK1A 4XUCA 5KX5A 3QVJA 2QTFA 3AYZB 4HXFB 4LCEA 4ESOA 5KTMA 2CMHA 3MTGA 2R6AA 2A1IA 2WG0A 1A9PA 3KQWA 3KSZO 1CUDA 2F1IA 4QFCA 4L0CA 4JOSA 2ZATA 2EVWX 4QDTA 5LWQA 3DTVD 3DB1A 5BR8B 2IK8A 1P9RA 7GPBA 1BOFA 2ZYSA 2FX3A 4K88A 4KNVA 2ZAIA 3CLSC 4EHDA 3I09A 3FWNA 3HK2A 1KXJA 1TZJA 3KOWA 4MKFA 4IUCS 1WULS 4KQIA 1JIKA 1PKEA 2PO5A 1Z08A 5ENVA 2UZAA 4MI9A 2CHEA 2DF8A 3P71T 1M6HA 3PUIA 5IVDA 5B6IA 2P9BA 5D5HA 1DRKA 5FL7A 2FOXA 2PRKA 1ZD9A 3GLUA 4P81A 1CUUA 2PD3A 1UBNA 5DCYA 5I9BA 3VI3B 1RM0A 4A7PA 4H4CA 4DBLC 3UA3A 2FZ4A 2YNMA 5DNWA 1M6EX 2MMCA 2RBKA 3KAKA 2HJGA 5DHTA 2SKCA 2J87A 1ZP6A 3LGAA 2F1RA 1J56A 2PUWA 5IJZA 1L8XA 2QTTA 3W6OA 4DG9A 2IHNA 2IP4A 3WXBA 1RQXA 3UUWA 2OC9A 2ADOA 1QFJA 5HRCA 1V5FA 3P2YA 1NR5A 3PRHA 5AXAA 3F4BA 4B75A 1HEIA 2NU6A 2CHUA 3OESA 4B48A 1U2EA 2GXUA 5B4TA 2CE2X 3C3YA 4L6AA 1M2KA 4BFSA 3DSRA 4QDOA 5ALRA 2GEVA 2ZRFA 2OY0A 5H3LA 3UAOA 2C84A 5AVTA 3A9UA 3F98A 4XFJA 3U4HA 4BQRA 4WCFC 1YASA 3PWSA 1NMSA 2PLRA 4CEJB 1QM5A 3Q2IA 4U00A 1TTQB 2AQIA 5G02A 1W36D 2VK8A 2V6GA 1ZNXA 1TLFA 2Q0QA 4A8JC 5JATA 2F64A 3GWZA 2BMEA 1X0XA 1YT5A 3D3KA 1DEHA 3K8QA 4TVOA 1N7IA 1F8UA 4LA4A 2PD6A 2BJHA 2IKQA 4ZZ0A 1TEHA 1SM4A 1XVAA 1A2KC 3E5HA 1W44A 2HA7A 3R74A 1QZUA 3A2KA 4ED9A 1GRCA 4IV8A 2BCGY 3BXGA 2GASA 3R3ZA 2ONZA 3DXZA 1FP1D 1UOQA 2VUTA 1GQFA 3K5HA 2X1LA 3B5IA 3LWZA 1P9LA 1OBVA 1PR6A 2QTBA 3FPFA 2PKYX 3BERA 1P29A 1V8FA 1LC3A 2FPSA 3PQFA 1EUCB 1ZN9A 4JL6A 4C78A 5AKIA 2C58A 2D1SA 1QFXA 2YOHA 1JRLA 5DBOA 4MRMB 2F3TA 1RXCA 5JMTA 1Z6QA 4WT7A 4Y1FA 4C7JA 1ICEA 2O2IA 5CXUA 2B8JA 2GDZA 4GICA 3EVTA 1E2JA 4FGLA 4G9GA 3MWDA 4KV7A 5K3AA 4AN0A 1J0CA 1O6CA 4X60A 5IJWA 2E3JA 1KOGA 1HRKA 4Z7OB 3QBEA 3RFXA 2IGTA 3L6BA 1EIWA 4JK3A 1NJ5A 4R1NA 1YUNA 3I2JA 4K6KA 3FWPA 5FTMA 2PH5A 1M9NA 1SC9A 2OQRA 4AROA 3LCCA 4CM3A 1UJMA 1RI3A 2PX0A 1Y6RA 2YFYA 1E6CA 1ZJWA 4BQEA 5DULA 4I1OA 4XRGA 4WVLA 1Y7HA 2J59A 2BKAA 1T0BA 2WP0A 3DKRA 5JJBA 4GWGA 3T1HB 2FWBA 4UNQA 4W1QA 2SCUA 4MQEA 3G7SA 5KNDH 1TEVA 2NNWB 5FWAA 2OQ2A 4BNZA 3Q8KA 1ULSA 2VS1A 5FFFA 4D7AA 5L6LB 1NFFA 1UC9A 2X2PA 3LSTA 2P2LA 1E0SA 1HDXA 2R7KA 2ORED 3A3PA 1UEXC 4Q9NA 4RD0A 3BGSA 5AKGA 3SIWA 1VKRA 3AERA 3ITDA 3Q10A 4U2BA 3QX8A 1KK1A 5E2IA 3V1NA 4EO7A 4LV8B 3CVXA 1EM8A 5T4BA 1DIBA 4YPOA 4X85A 5F73A 1TCUA 2Y4OA 4XIYA 5AM0A 1YDEA 3H17A 2LXNA 4KYTA 5E6SA 2M6LA 1P80A 2OXRA 2FR1A 1RWKA 3ETNA 1KBZA 4HSEA 5ALIA 1XMVA 4AF7A 4IZ6A 2IYXA 1AKMA 3LBYA 2R85A 3ZIUA 4LF4B 2VQEB 1A4UA 4QU9A 2ZYIA 1DMRA 3ITNA 2WLTA 3ZV5A 3B36A 3S28A 5K05A 4EHLA 2OV6A 2K2QB 1NLUA 1GPKA 2B2XA 1PRYA 1RT9A 4D8VA 4F6CA 4P8RA 1UINA 3QBVA 4HLUA 3F0TA 4ZO7A 3PNYA 1P1IA 5LU8A 4XVHA 1GDDA 2ZUUA 4LCBA 2NAPA 2BFOA 1H23A 4KXFB 5A9SA 1XDBA 1KO7A 1WO8A 1YL5A 3A7DA 4D9FA 2E4UA 4CTKA 5JD4A 5M7EA 4XD7D 1BU8A 4PZDA 2B8NA 2Y1KA 2J7KA 1ULTA 1JI0A 2VTDA 1IY0A 3ZHBA 3NETA 1KU6A 3TAUA 5JXJA 4K40A 2O8CB 3TBHA 2X9NA 3CZMA 1QGZA 3AU8A 1K98A 3QLVA 4FBMA 4PLGA 1E98A 4C2UA 1CT9A 4MUMA 2J9RA 4E88A 3OQVA 3UAWA 1QOPB 2DECA 1SPBS 2FOLA 1O2DA 1LNZA 3AKCA 1L7RA 1MQSA 1F4VA 1WMEA 2GF9A 1U5BB 3HP1A 3ORHA 4MINA 5JSKA 4Q7EA 3E1GA 4JYBA 3ADKA 2HPHA 1Z7WA 5A4IS 1KJ9A 4A0FA 3KT8A 2X5JO 3R3SA 5H4GA 1I4EB 2WSLA 1JWAB 2EFEB 2IYOA 4QAJA 5GINE 2EEPA 3TZHA 5K8VA 2FEAA 1AB6A 4NZNA 4YT4A 4ARCA 4CT4B 5ITWA 3R24A 2Z6QA 1L9KA 1KRXA 5BXQC 1BW9B 1SXIA 3IT3A 2HUPA 3FLAA 4MR8B 5EMJA 4PVCA 1TXGA 4QC2A 4BMDA 3VISA 1NQVA 1VKNA 2UZIR 1YCDA 3AHGA 3TLCA 3WK7A 5BVGB 1VSQA 3AUKA 1YR3A 5JG7A 4JQSA 1AQ6A 1Z6GA 2D62A 4KQMA 5DYTA 4ETNA 5HIAA 3GDFA 1IUKA 2XB6A 3GZNB 1SHTX 2QN3A 4TS3A 2XZPA 2PMEA 4QBHA 5HHTA 4MQMA 3E48A 5ALNA 1BGVA 1VRCA 5LLTA 3GGDA 3NEJA 3GGOA 5BR7A 4TOIA 2DCMA 1UP6A 5FF9A 1OTHA 4FC7A 4H7PA 4EF4A 3RGWS 4NFHA 3L8YA 3LNCA 4PZLA 2B69A 4YAEA 1Q74A 4O4LF 2CBZA 1R74A 3CWCA 4AX8A 1T5LA 5KNCH 1HTWA 1ETUA 5EP2A 4QYTA 1YE5A 4YIKA 1CUBA 4DF3A 2RHTA 1OILA 1V16A 3ETJA 3MJHA 3QLEA 3IH5A 2H51A 4O2LA 2Y93A 4CL3A 5A4FS 1G5IA 1R3DA 2CE7A 4XB2A 5IJAA 4RORA 4Q3LA 1UDWA 4D9KA 3L4SO 4C89A 4GL2A 2B78A 3U1VA 3L7YA 1R50A 5HJ5A 1X8KA 3BXOA 1H1LB 1J4AA 4DMMA 1N34B 3TD9A 3MMZA 1Y9DA 4FYXA 3EGOA 3SZ3A 1FSZA 3B9QA 3OCWA 4QO7A 2CXQA 3K20A 4ILEA 4IGFA 2HLDA 2WG2A 4R9SA 2JAPA 4KZKA 4QD3A 4QWWA 1RI4A 3F8TA 3THWB 2BY4A 1PT7A 4GZ6A 1AGYA 1Q0RA 4A15A 1E9CA 1WDKA 3ACBA 3LLUA 2F62A 4XB1A 5EHQA 3RJ9A 1ECCA 2MWMA 3QWIA 4M9CA 3VR3D 1BWQA 2R5WA 1H22A 4GLLA 4L95C 4YRKA 1X9GA 3HYSA 3K35A 1R4ZA 3VO8A 1JDBC 4M7RA 4ZVQA 3A9RA 3CMCO 5CX1A 4NHOA 1YCGA 3BL8A 1BCSB 4K6MA 2GN2A 1LU9A 3IT2A 3EIHA 3PYMA 3QEBZ 2DMRA 2KMLA 3D3JA 3PFKA 4A2QA 4L2IA 1DJMA 3QE9Y 3ZXUB 2FK8A 4P4SB 4Q82A 3CRW1 3QELB 4OHOA 3C5WP 2PGAA 2IVZA 3FCYA 2F1KA 2DQ4A 3A05A 5ESXA 1FNSA 4YQFA 1SUAA 4IMJB 2EQ5A 1M2WA 3JPWA 2HJVA 1OZFA 1R5JA 3UJ6A 2D2VA 3NYIA 5AVZA 4MQ6A 4R05A 4JAVC 3TEMA 5CFRA 1MABB 1DZ3A 1ZGZA 2PWAA 2QRQA 2YJZA 4UASA 3EEBA 3U9LA 5G1NA 3PX7A 1NUPA 2PXHA 4KO4S 3ZBPA 4BFWA 1EIZA 2OHFA 3STUA 1BCRA 4P0TA 5EP4A 3NRCA 2OSBA 2DEUA 3GJ8A 1WSAA 5I9LA 3T6KA 3WRYA 2JHFA 1WETA 3EXEA 4AKEA 3GMIA 4EK9A 2Q2QA 1RAGA 1B93A 3P0HA 5HQ3B 3TQTA 3OQNA 2D13A 1JDPA 2XV1A 3FNEA 3G6WA 4NWIA 3SVZA 3EVCA 4UTVA 4N0MA 3DMTC 3KG2A 3H04A 3UJBA 4FHCA 4Z3DA 5HJEA 1OYYA 1UQUA 1ZN8A 1G0OA 4FN5A 4Y9SA 4QG3A 5CR9A 1R0LA 3ZWCA 4YRMA 2HBZA 2IHVA 2LIPA 3QPUA 2GPWA 4HWSA 4A03A 2TMGA 4A91A 4RYLA 4JXZA 4F3CA 1IEXA 8GPBA 1X1EA 2BUBA 5DXFA 3WOVA 4YRDA 4JJAA 3RTGA 1NLYA 1AGXA 4TV8F 3CKLA 5JSZA 3PFCA 1C14A 3GMTA 2ID7A 1RYEA 3UHFA 2HK9A 2Q5EA 1PTKA 1FOEB 4YP6A 3D0QA 2RI6A 1JPNA 3H42B 1M54A 4M0UA 3C3AA 4KC0A 1XTZA 4DB4A 3KCNA 3OZCA 2ZYRA 2Y27A 1HYQA 3F78A 2BRUC 5CXXA 3ZHXA 5KCZA 3H9EO 1E96A 4KWTA 3WRVA 2YFKA 1S8OA 4PGMA 1IXKA 5BNFA 3ZDRA 3BUSA 1QANA 3A11A 2ZRCA 1LK5A 3K0EA 4ZYUA 4N3CA 2QD2A 4QYIA 1OB5A 2QV0A 1XVUA 3E8MA 3N5KA 5J2UF 4G0WA 3LYHA 3O4VA 2Z8YM 1AK9A 4ZI3A 4J3FA 1T2AA 4OBWA 5IUJC 1XTJA 2WPDA 1L4YA 4JU8A 2B4YA 3T5AA 2EG5A 4QJ5A 1FTSA 1Z25A 5B36A 1RWQA 4FCVA 3WYNA 2BGNA 5DW3A 1MHTA 1SWVA 2OHXA 2ZZKA 3SD7A 5EJFA 1N2CE 3D4LA 2B1JA 5JV5A 1R4MB 3BSSA 2EIHA 3G2IA 4QPJC 4EI2A 1NAIA 3QEMB 3D4IA 1KIFA 3I1FA 5AXBA 4E14A 2DHRA 2Z5VA 2NO7A 3EZXA 1ZA2A 1BGWA 5L40A 4UCXA 4WN9B 1U1IA 3BMNB 2A33A 3D4OA 4PFSA 1PZFA 4YBZA 1C8KA 7ADHA 2W22A 1YK1A 4IINA 3AW9A 2I54A 2Z4SA 3JAMA 4M0KA 2XSZD 3OECA 3AGPA 3O3OB 2XA9A 2GK4A 5LBUA 3TNJA 1OH6A 1SB8A 2X19A 3MWFA 4L5CA 4GMKA 5KYVA 2UAGA 2B8WA 1XF9A 1P0CA 3T3HA 2XD9A 4DL9A 1N2CB 2GQ0A 2PKCA 3D0RA 4G4JA 4WH0A 1QORA 1XIVA 2KBEA 2ZDHA 4ENTA 1DRUA 2CJXA 2L18A 4J03A 2JLBA 4FR2A 4J1TC 2ZI7A 3Q4GA 4Q4AA 1JALA 4XYLA 1WB9A 4BQFA 2P4QA 3JR7A 4MUAA 3V6LA 3BD7A 1L6IA 1T24A 2Q8QA 3IUPA 4BEJA 1GGHA 3DE6X 2ZRGA 4Q6BA 1FDIA 1G60A 1REQB 4KO8A 2O0MA 4Q4LA 3DKIA 4BS9A 3FPHA 2OLKA 2BF7A 4R8LA 4OK5A 5HX7A 1F0YA 2X5KO 4U0KA 3BFJA 4YMLA 1HKHA 4S05A 4NG5A 5BN5B 5CRIA 3G89A 3SQWA 5TXGA 1IC6A 4ZVUA 1JKFA 3AZOA 3LWDA 1BMTA 4BP8A 5JXGA 1EE1A 1L8QA 1JKMA 4OLAA 1C3OB 1E79A 2I7CA 2ZYWX 4HVLA 3N59A 4BVKA 4JC4A 2IXDA 3WWPA 1SXJA 2IEIA 2R4QA 5TC4A 3CF4G 3RFUA 1DFGA 5KQMA 2PAFA 4DNXA 2AV6A 3MMXA 4KU4A 1QV7A 2AR9A 5K99A 2JIZA 1UANA 1J1ZA 1Q21A 3L82B 4DZTA 3OJ0A 3L6CA 1KSGA 4E4TA