1ZK1A

Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nad
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 100
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk1A00
2VYNA 1UZMA 2ZJ0A 3VAZA 5A9SB 2BFPA 4ZQBA 5JBIA 3JQ7A 2D2IA 5COAA 3VH3A 3FF4A 2ZB3A 4IM7A 3AM5A 1P3DA 2Y1FA 1E3SA 1DAPA 1I36A 2DUWA 3D3WA 4OKIA 3BHIA 1P1RA 4ALIA 4D46A 2DLDA 2NVUA 2I99A 3JQ6A 2VTEA 4NR0A 2PD4A 4A5OA 4WE3A 2ZYGA 4YAEA 3GNTA 5KWEA 4RZIA 2GR9A 3GFGA 1YRLA 4W99A 4FC6A 2QX7A 2HMWA 1C1DA 1GUZA 1B7GO 4N5NA 2HUNA 2B5WA 3QVTA 4GL4A 2X5JO 1LBEA 1LRLA 1LSJA 3GC6A 3AW9A 3CTMA 3WBFA 3LYLA 3EK2A 1DJNA 4AJOA 1YDWA 3I9MA 1Y81A 3HDYA 3UFXA 3KYDB 4OSOA 5TSDA 3ABIA 3H9UA 3K2EA 3MWEB 4RF3A 2GASA 2H9IA 4LCEA 2BH9A 2VOJA 4BV9A 3AUUA 3RC7A 5DULA 3M1AA 5JSFA 1WDKA 3LZ6A 5GZ6A 2JHGA 3DZBA 2J3KA 1UAYA 1D3AA 4DPLA 2XXJA 3OBBA 3KYBA 5IXSA 2YDXA 3L4SO 3ZWWA 4GX1A 1PQPA 4EI2A 3VPHA 3PPIA 5JCXA 3O38A 4OH1A 3D4NA 3JQ8B 1PGOA 4N54A 2IXAA 1KBZA 3H9JA 3JQ9A 4LISA 1ZMOA 3UXYA 1Z74A 1Y9EA 5L3ZA 1XU9A 2QYTA 4JJFA 1E6UA 5AXBA 2OHXA 1J0XO 3JQAB 1ZSNA 4R9SA 2HCTA 4MIYA 4BGVA 3A4VA 1Q7GA 3PZBA 4LN1A 4HUJA 2YFHA 4J2HA 1NASA 1J5PA 4MVJA 2YHUA 2B4TO 1ZKMA 1QV6A 3TZ6A 3Q2KA 4BO5A 1U5AA 1MG0A 2W8ZA 1AXEA 4S1VA 4OXNA 7MDHA 1DC5A 4CMIA 5L7YA 3ZWCA 2RHCA 3ZHYA 4J16A 4FJ2A 3LU1A 1ZJYA 5ENDA 5ER6A 2JHFA 4NBVA 1N7HA 1V3TA 1MFPA 3HSKA 3SEFA 1MLDA 1I33A 1Z6ZA 3DBRA 4E0BA 5CEFA 5KOIA 1LUAA 3FR7A 4JP3A 3WYCA 1VSVA 4MVJH 1AGNA 4KTTE 2AXQA 3E9MA 4ILKA 4FD3A 4WKGA 3LT4A 1VSUA 3ONEA 1B0AA 1ZCJA 2WE8A 3CUKA 3DBHA 4XEHA 4UVDA 1ZJZA 4NQZA 3U9LA 4WNIA 3RIHA 3TOZA 3KBOA 1AHHA 3C1TA 4L4SA 1T4BA 4D42A 4LSWA 4FGWA 4N5LA 1IY8A 4OGWA 4TKMA 1H6DA 1E7SA 4LRTB 1IZ0A 1K6IA 4UEJA 4UVGA 1VLLA 3Q0EA 3ZNOA 4O1MA 1UH5A 4O63O 4PZEA 4CM5A 3TF5A 2VHXA 3WJAA 1DBVO 4B4UA 5BR7A 4N18A 4II2A 2BFOA 2V6MA 2YY7A 2NQ8A 3GZ4A 5JAZA 3MTGA 3GVCA 4HFMA 1H9BA 3BMOA 1F0YA 5F1KA 5IZCA 1VL8A 1UP6A 2FHSA 4F3YA 2RAFA 1C0IA 3VC7A 1DRVA 2LDXA 2E82A 4E21A 3PWSA 3B20A 5HM8A 1SZJG 5CDTA 4AJ2A 3I3OA 3RD5A 3DFUA 4IXWA 1C1XB 1IZ9A 3LLVA 2BFAA 3HHPA 1VJTA 3QVXA 1DC3A 1UXHA 3F1LA 4WEOA 3I6IA 4WECA 3JQBC 1DHTA 1ONPA 5A3VA 3AFNA 1ULSA 3CMCO 2VHYA 3BA1A 2DFVA 3QA9A 1XR3A 4QX6A 1EBFA 1H2BA 4Y6RA 2ZB4A 2NTJA 2UUOA 3D3EA 1CETA 5C7IO 3QWBA 4OXYA 4CQMB 4J1TA 3ITKA 5COQA 5KTKA 1PL8A 4LK3A 1X7GA 5KJ1A 3G49A 2EXXA 3ANMA 4R69A 1QG6A 1ZO8A 1RYEA 1WPQA 4ZQGA 4JNKA 3NDRA 4H7PA 3H5RA 3NAQA 2X58A 5ES3A 3HZZA 4YJHB 1MP0A 3BMQB 3IKTA 3O8QB 5DP2A 4BGUA 3DAGA 2ZTLA 4QQRA 1KETA 5BSEA 5TF4A 4I9HA 4J2OA 4A73A 3G17A 1ONOA 4DLAA 4RGBA 2C5AA 2CDAA 2CDCA 3ZW8A 3GEMA 4J1NA 3INTA 4U6SA 1MXFA 5F5LA 5K6AA 1CQIA 3W8FA 4B3HA 2DUUA 3UH1A 4ZQFA 3RUIA 1SB9A 2VWQA 4XIYA 4PVDA 1YOVB 4WLVA 1EUCA 2JD1A 3CEAA 3RKUA 3F5QA 2B36A 4QTZA 1YJ8A 4YYZA 1HT0A 1KEUA 5A06A 2QZ9A 3PP8A 4IIVA 3G3EA 2D3TA 3PFFA 2GERA 3CXRA 1OAAA 4GMFA 3RU9A 2B0JA 2OBYA 2ZATA 5IAAA 1TLTA 1BDMA 4C7JA 3D0OA 1OZAA 5JDIC 1Y8QB 4XQGA 1XDWA 5G0VA 3H2SA 4YAJA 1KVUA 5BSFA 3GUCA 4TRNA 2G0TA 4FPXA 4ZQEA 5KJFA 1GQQA 3OA0A 1JAYA 4DQXA 1R0KA 4I5FA 1XELA 4G5HA 4WCFA 4J0FA 3RFXA 3AUTA 3VDRA 4CMGA 3PI7A 4M1QA 4MO2A 1HL3A 2NV6A 2DAPA 4B7UA 4IQ8A 5HTOA 5CEEA 4RL6A 5EL0A 1J6UA 3JQGB 1XHLA 2ZB8A 2YV1A 4A2CA 3GVPA 3UICA 3E82A 3KLMX 4BNLA 4A10A 3GK3A 4UUNA 1WW8A 1UZNA 1ZVMA 3HWRA 1A9ZA 3I52A 4WLUA 5ITVA 3CE6A 3UUWA 3OJOA 3TWOA 5TQVA 5I7FA 1HYGA 1G0NA 3GAZA 5IFLA 1ENYA 1ZEMA 3FBGA 3AI3A 4WGGA 5FF9A 2O50A 2IYPA 5C37A 1LI4A 4E5MA 1GCOA 2YDYA 1ZW1A 2YQ5A 2HO5A 2O3JA 1K2WA 4N7RA 4E33A 4FC7A 3RUFA 1ZXLA 4TRMA 2F1KA 2VCYA 1AXGA 2DKNA 2G82A 4NIMA 5JY6A 1R37A 5JMPA 1OI7A 3SBOA 3V2HA 1VKNA 5GMOA 3W6UA 4IGEA 2FSSA 1T2AA 3L6DA 3LLSA 3UVEA 1DHRA 3VPXA 4YDRA 4Y6PA 5AOVA 5F21A 3RUDA 5KKAA 3EUWA 1PJLA 5CG2A 4AFNA 4XDZA 3OH8A 2OMEA 1SC6A 1I3NA 4IY1A 2Q1SA 1A71A 4BNNA 4DPKA 1PJ2A 1V9LA 5JFOA 1O9BA 3CZRA 1KC3A 2J3HA 1E5QA 5DDIP 4TRRA 3U4CA 3SX2A 3EGOA 4IUYA 4AG3A 2NTVA 3JD4A 1K3TA 3WGOA 4MVJE 5HBRA 3I9NA 4WLEA 3H5AA 4BNGA 3FCOA 1N2SA 2GPTA 2O7QA 4XD2A 1ENOA 1GL3A 4A03A 5HRUA 3NEPX 3PGJA 1PR9A 5A9RA 1B8VA 1CF2O 4MINA 3VVCA 4BO1A 2X86A 3B70A 1M67A 1P0CA 1MXHA 3BHJA 3PTZA 5A1TA 5T64A 4E5KA 1NQ5A 3PQEA 2O3RA 2VYVD 3MWDB 1NFQA 2IRWA 3RUEA 4G81A 1T1RA 3GG2A 3MCVA 3D7LA 3K73O 3K30A 5FI3A 5CEJA 2Q2WA 3DZHA 3JQAD 4FOSA 1KVTA 2ILTA 1H93A 3DONA 4FFNA 3MOGA 1TI7A 4RLHA 4WEQA 2FZWA 2G5CA 3ZNPA 4DA9A 5IF3A 4E2XA 2VHWA 1NPDA 3RJ5A 1KEPA 1YQXA 4BO3A 2I65A 3EVTA 4RLSA 4CPDA 4J6FA 4HX5A 3MJVA 4KP7A 4G65A 3GPDG 1HSOA 3PQDA 2OXIA 5JPIA 3DZIA 4CR7A 5DOVA 1I0ZA 2A4KA 1E3LA 3FN4A 3ZV4A 2PH3A 1U7HA 2RBEA 2W2LD 4GI2A 2Z1MA 2F00A 3GGOA 1JW9B 4AL4A 4MVJF 5JS6A 4RCVA 5MGBA 3P7MA 3ZCXA 3ULKA 4JBHA 4FFRA 5U1PA 4DYDA 1HDRA 1WWKA 3A14A 3WGYA 2PTGA 2W2LA 1EVJA 3DZGA 1H6BA 1E1MA 3IOYA 4DLBA 3MJEA 1ZXBA 4HP8A 2QYSA 2FSVA 2HRZA 1E3EA 3VKUA 1M76A 1LDMA 1E7YA 2BI7A 4CM6A 3HFGA 4GKVA 3AY6A 4JP2A 2JFFA 1JN0A 4XYLA 2AHRA 3VTZA 2I3AA 2W2KB 3V5NA 3WSVA 4E2ZA 1K0UA 1E5LA 1KEWA 5L53A 1EDOA 2C59A 4RORA 3RFTA 2ZQYA 3IAHA 3KXDA 1FK8A 3SXPA 4CM4B 3WTBA 1OC2A 3DZKA 1NWCA 3DL2A 4YJFB 2NACA 3NJ8A 2DT5A 4XX0A 4IS2A 3ADPA 4YVFA 1NWHA 2HLPA 2FMUA 3Q2IA 1G0OA 2AEMA 3Q3CA 4B3IA 3O03A 3KTDA 5KNLA 1GZ4A 4TZKA 5TNXA 4BO2A 2VWHA 1N7GA 5LCXA 4GX5A 4YR9A 3E6AA 2VUTA 4YRAA 2BHLA 3DHNA 4XZ3A 4XR9A 3TNLA 4NBTA 4AVYA 1OC4A 1GZ3A 4BUCA 2X5KO 2E49A 4CQMD 3TFOA 3H2ZA 3C85A 3L6OO 3RC1A 5CDGA 4NBRA 3RUAA 1DFGA 4HV4A 3L4BA 2GO1A 4O59O 3SJUA 3MEQA 5CPBA 1BXKA 1M6HA 4AJNA 4AJLA 2JD0A 3PYMA 3PHGA 4CQMA 3FR8A 2Q1WA 3U62A 4J91A 3DAPA 1B26A 3DBVO 3S2IA 3UHAA 1D1TA 3N74A 4CL3A 1XU7A 3W8EA 3L77A 2EKLA 5JCJA 4XQCA 1O94A 1YS4A 2DBQA 4E32A 1NVTA 1Z75A 3ENKA 5ICMA 4CLRA 1A4IA 3KLPX 4D44A 5LDHA 1NX6A 3ANNA 4YJHA 4AJPA 3BHMA 2A94A 1LA2A 3U4IA 3GA0A 1ZEJA 3O8QA 4RVFA 2QQ5A 3MOIA 2ZIZA 4JJGA 1YDEA 5BSHA 2HAEA 2Q49A 3O9ZA 4JBGA 2WYVA 5DF1A 4CR6A 5HA5A 2PD3A 2O23A 3BMCA 2C2YA 4P38A 3KUXA 4GGOA 4FGSA 4BHTA 4ALLA 2VRBA 2O3TA 1U8XX 4XYBA 3UCFA 4BKRA 2E6UX 3R3JA 1GAEO 3IUPA 2EERA 2Q1UA 1KVSA 3JQEA 4QECA 1NNUA 2Q46A 1YOVA 1JWAB 1MG5A 3NKLA 3HDHA 2H5LA 3WBBA 2C0CA 2WD8A 1LDGA 1K5HA 5G0WA 2O3QA 2C20A 1QSGA 2GUGA 4FOOA 5EMHA 4WUVA 3TZHA 2H6EA 1T1SA 4EGFA 1GUYA 2CNBA 1ISJA 2AMFA 4J0EA 3RASA 4I08A 4PLGA 1FXSA 3BMNB 4ND4A 4QFCA 4YA6A 5AVOA 3GMDA 2WYUA 3QWAA 1GTMA 1EVYA 2D8AA 2ZYAA 2Q4BA 1Y8QA 3KYCB 3WMWA 1BGVA 1GU7A 5F3RA 3KM0A 4DXHA 1AUPA 4GMGA 9LDBA 1RM5A 1BVRA 1U3VA 2IDZA 4J43A 1R4MA 1C0LA 4TSKA 4KDFA 2RHRA 5LC1A 4ZD6A 5EQDA 1GCUA 1KVRA 3FNEA 1BXGA 5TT1A 4J1SA 4KZPA 4YJDA 3KSUA 2JAHA 1DEHA 3JYOA 1QP8A 4HY3A 1LLDA 1MGOA 1K6XA 4MIOA 5KVCA 2DQ4A 1ZK0A 3JQGA 1EK5A 1YB4A 4W4TA 3FI9A 4L0QA 4CLXA 3DOCA 1E3WA 4CLDA 2DU8A 4DREA 3ZU5A 3GNQA 3W8DA 1TT5B 4BIIA 4B3JA 1DIHA 5JC8A 4R1NA 5TC4A 1Q7CA 1A72A 3EC7A 3F4BA 1HEUA 4J4TA 3QQPA 2I76A 3I9LA 1DC4A 1PGPA 4D3FA 2IE0A 3D1LA 2CVQA 3OIFA 3FTPA 1T2FA 3F9IA 1Q0LA 2DBRA 4EUEA 1IPFA 2FRDA 4DC1A 4LRSB 3O26A 3K92A 1M6WA 3HQ4O 3Q9NA 4CMEA 4MPDA 2EG9A 5HS6A 4RPKA 3KV3O 4JIGA 3D5TA 4E5NA 3RWBA 1ARZA 2Q2VA 4J4BA 4WOKA 2EP5A 4BMVA 4INAA 2PGJA 1QRRA 4ALKA 3VTFA 1YWGO 1CRWG 2D4AA 2RCYA 4GX2A 3LQFA 3KRTA 3MTJA 4CMJA 5TLSA 3FNHA 4ALMA 4MVJP 1EUZA 1FDWA 1BSVA 3EY4A 4IJKA 4CMBA 1EFKA 1EBUA 1IHYA 3IKVA 3CINA 5ILOA 3WSWA 2OBNA 1ZZEA 2B69A 3HN2A 1X7DA 1YL6A 3I23A 1XIVA 2A92A 2EWMA 1P77A 5A5FA 3IC5A 1HDXA 4XYMA 3E03A 4UUMA 3ZI0A 4HFNA 3M6IA 1DB3A 1I8TA 2J5QA 4FBGA 3HJAA 1BG6A 3H3JA 4GAEA 4KWIA 4OSPA 4IDFA 3E48A 1DIRA 4JGBA 4IXTA 4XYEA 1PZGA 3GG9A 1P74A 2G1UA 1TB4A 4CM9D 2IODA 4II3A 4PLTA 5THQA 4DIBA 3VH1A 2UV8A 4BO8A 4EDFA 5C7LO 2DTDA 2Y0EA 4E2WA 3OECA 3V1TC 3ZDFA 1VKOA 2X5OA 5BSGA 2GF2A 1E3JA 1SO8A 3PZRA 3JQ9C 2D5CA 4J4HA 2BGMA 4EEXA 1E0DA 1EVIA 3ZGYA 3E9QA 1X14A 4CM9A 4DWVA 4I5EA 3SC4A 1MC5A 4PZCA 2VN8A 4DQUA 4M8SA 3P19A 3TQHA 3WR5A 5DCWA 4D3DA 2X7HA 2Q99A 1F17A 1PS0A 2FP4A 3TZCA 3ROPA 1WDLA 2QG4A 4GBJA 3UN1A 2AQ8A 2WYWA 4YT5A 4BKOA 2GRAA 3C24A 1MV8A 5JAQA 3V8BA 1NAIA 2HJSA 4UUPA 3OICA 5IDYA 2VHZA 3V2GA 4DQVA 2JD2A 1TT7A 2VHVA 3ZV5A 5KIAA 1D8AA 1Q7BA 3JYLA 2ZB7A 1GEEA 4MP6A 2WE7A 3WYBA 1L7EA 3BZUA 4EITA 2YQ4A 1O8CA 2PD6A 4RZHA 3AM3A 4IINA 1IUKA 2GNAA 2HMTA 1F12A 1H5QA 5G4KA 4BO4A 1X0VA 2QRLA 4FFPA 4HXYA 4TMFA 4IMPA 4BS9A 2G17A 3DOJA 4WNCA 2PKQO 2Z5LA 4JN6B 2GN4A 3TL3A 1NHGA 3CH6A 3GZNB 4BNHA 1O89A 3PVZA 3QWHA 4DUPA 2GDZA 1QORA 2X1HA 1UXKA 3DMTA 3DXFA 3O4RA 4R4JA 1OOEA 2DBVO 3K9QO 3I4FA 4I1IA 3WWZA 3PYXA 4QEDA 2BGKA 3NT2A 4RPJA 4DIFA 4YTEA 4YWJA 4EW6A 3JQFC 4K9DA 5G2OA 3VPSA 1HTBA 1PGNA 1PJSA 4B8ZA 1LLQA 1PGQA 4MP3A 1UP4A 5JW6A 2ZKLA 1C14A 4OO3A 2VQ3A 3JQFA 3WMXA 1T25A 2FPGA 2HKIA 4W7IA 3RC2A 5IZCC 4NDNE 3OEWA 2OFPA 2NWQA 4R5MA 4CM4A 4ALJA 4NI5A 2B37A 2BI8A 1UR5A 3ROKA 3WWYA 1NVMB 4LMRA 1WXDA 4QUKA 1Y9AA 3PLNA 4J9VA 3UKOA 1XSEA 1L1FA 4DLLA 3PHLA 4AJ1A 3HADA 2AA3A 1Q0QA 2FZEA 3DOOA 3H8VA 5A04A 3KZVA 4D43A 3A9WA 1IULA 3I9JA 1B14A 1ML3A 4PRKA 5TGDA 1HDOA 4R68A 4Y6SA 2OUIA 2PY6A 3AOEA 3NT4A 4QO8A 1A4UA 1ZBQA 3M2TA 3VVBA 1H9AA 3F1KA 1N9GA 2JCXA 1VC2A 2PKQP 4CM8A 4BNJA 5DT9A 3OM9A 2OGUA 4R54A 4PLCA 4MDHA 3QIVA 3IQDB 4PIVA 4BVAA 2PV7A 1EE9A 1Q1NA 5B4VA 5KVQA 5I7VA 1LJ8A 1H2HA 4WK6A 4ZRMA 1EUDA 3AM4A 4BB6A 4KQXA 4FJ1A 3STHA 3VH2A 3GVIA 1YO6A 5TRTA 4XJTA 4Z3DA 1Z73A 5T8KA 1RJWA 3DR3A 4KMSA 3VDQA 4A27A 5GZ3A 3C3XA 4JQCA 1GR0A 1R0SA 3S55A 1SOVA 3DDNA 3GNSA 5K6AC 1T2CA 1H6CA 1XG5A 4YACA 1U5CA 2NADA 3ZU2A 3DAFA 4OMUA 3BTVA 3VPFA 5L4SA 3MJ4A 2AE2A 2EEZA 3OIGA 5EINA 1XCBA 1H0KA 2CMDA 4HFRA 3PGXA 4PN3A 3ROMA 4E6PA 4BL5A 2VZ0A 4GPD1 2X9GA 5EPOA 2HK7A 4EJ0A 5K0ZA 1V6AA 5F1PA 5CFZA 5DBGA 3GT0A 2YYYA 3E8XA 3MJCA 2BKAA 3MJTA 1QYVA 5EERA 4MKRA 4Q9NA 5FYDA 1E1KA 3GDGA 3H7AA 4D41A 2I5PO 1LDNA 1Q0HA 1DIAA 2WMDA 1DPGA 1YE3A 5C5IA 4NH4A 3BMNA 2C54A 2CF5A 4PCVA 1P1JA 1L7DA 3KYCA 2YJZA 5G0SA 1BW9B 4WCFC 3GN1A 3BYZA 3TOXA 1HE4A 1NR7A 1FDSA 1R66A 4FR5A 1YBMA 2EV9A 4PG6A 2BRUA 2HU2A 3TZQA 1ENZA 3PDJA 4NJMB 1U28A 4GSKA 3WS7A 1NM5A 2Y0CA 4D3SA 4BV8A 3K96A 1GZ6A 3R1IA 3PJGA 1N1EA 3BTUA 3HFSA 1KIFA 2X9VA 3AI2A 2B4QA 4LGVA 1EK6A 1ADCA 3TRIA 1MA0A 1KVQA 4Z6KA 1A7KA 1SMKA 3DWFA 3WG9A 5JE8A 3FD8A 4XRGA 4YRBA 4UVHA 3OF2A 2X23A 3OJLA 3AUSA 4BOYA 1HZZA 2XOXA 3JSAA 5EIOA 3KB6A 2J5RA 4YJGA 4XA8A 4CLOA 1KY4A 1P0FA 1PJQA 1VI2A 3RVDA 3F47A 3GEDA 4M49A 3ORFA 1U2GA 4MOWA 3ZHBA 3JD3A 3U5TA 2BMAA 5AXAA 3G1TA 1E7MA 4CM3A 4MKZA 5T67A 1DLIA 2AG8A 1GQ2A 5DN9A 2HMSA 3PHJA 4RQTA 2WD7B 1CJCA 1B2LA 2D1YA 2H1SA 3DQPA 2X8LA 1FJHA 5A9SA 1E77A 1LX6A 4YCAA 1DFHA 3QP9A 2PKRA 2DTXA 4GVXA 2EIHA 1UXIA 4NU6A 2VNAA 3UF0A 3ROQA 3WNQA 1JVBA 2GLXA 2I3GA 2NU9A 1JKJA 4K6CA 4TVBA 1K89A 3DTYA 9LDTA 3EDMA 1LTHR 3AWDA 1SB8A 3LF1A 5B37A 3K31A 1PU2A 3EAGA 1NXQA 3F6YA 4XCVA 3PIDA 2Z1NA 4R41A 2PFGA 1VPDA 1X15A 4EBFA 4DVJA 5T5QA 1BTOA 3HG7A 5JO0A 4BNIA 1PWZA 1DRWA 4GKBA 4GQAA 2DTEA 3SC6A 4J49A 2Q1TA 1V3VA 3JQ7B 4WLOA 3EVNA 2ZQZA 4Q3NA 2DPHA 1PL7A 4E4YA 3WOHA 4L73A 3D3WB 4CR8A 2HMUA 4XB1A 3DFZA 3WGQA 3KYDA 2NVUB 2DM6A 3PLRA 3R6DA 1LDEA 1GYPA 2UYYA 1B15A 1O0SA 3A1NA 3A06A 2AW5A 3ON5A 3I9KA 2DPGA 1PX0A 1N92A 1C1DB 3GQVA 4WCDA 2AQHA 4CODB 3UCEA 1PJ4A 4K6FA 1WZEA 2AQIA 1V35A 5ADHA 1KERA 2AQKA 4IDGA 3OIDA 5G4LA 5JC1A 2O3UA 1B8UA 2UDPA 4WJZA 3BTSA 4CMCA 1YB5A 2HSDA 4Q3DA 5JYEA 3JQ8A 5I9LA 2PLAA 4ZA2A 3NGXA 2VYVA 4E2YA 3B1KA 4Q3BA 5JYDA 3JYNA 1ADBA 4YAIA 4ONEA 2D59A 1P31A 5JY1A 3PWZA 4A7PA 3GHYA 3JQAA 3IS3A 1G6KA 3JV7A 5TX7A 5KVSA 2CD9A 2Y68A 1Y7TA 2Y1OA 2ZTMA 3JQCA 5EN4A 5I9MA 2X6TA 2AE1A 3ZU3A 3V2UA 5AXDA 1HWYA 2I67A 1UP7A 3QV1A 3L9WA 1WMBA 1E3IA 5L4LA 1A7AA 2Q45A 1IHXA 5GY7A 4XR4A 2EGGA 1GUFA 1Y5RA 1CERA 1QYWA 2X4GA 3GLQA 3NTOA 2GD1O 3E5MA 1LQUA 4FFMA 4NZ9A 4ROSA 5H82A 4WASA 1W8DA 3WQRA 2YHIB 1ISGA 1JDJA 2Z95A 2ZTUA 3WX0A 3RI3A 1Q2XA 3IDSA 4MIEA 3UW3A 1RWBA 2WTBA 3D4PA 4F6LA 2CSUA 1ZMTA 4DPMA 4FSHA 4ND1A 4NHEA 3KETA 5FFFA 4J7CA 3GEGA 2Y66A 3KO8A 2EW2A 3L9XA 4Z9FA 3IL2A 4EUHA 4XDYA 4NFSA 3GDOA 4NK5A 5JLAA 4ZRNA 5B4UA 5TJ9A 3P5SA 3SJ7A 3X2FA 1UXJA 5IZ4A 4UULA 5L40A 4RF2A 2CUKA 4RPLA 2NVBA 3DBRB 5G0TA 1LEHA 4MJLA 3ZV6A 2NM0A 2PZLA 3H4VA 3LT1A 1HDGO 3E18A 3PJDA 4YXFA 1NFFA 4U0KA 1ZK1A 3AY7A 4HFJA 3DBHB 1F14A 3OEYA 3S8MA 4F46A 3WIEA 2J3JA 4BNFA 5I8WA 1Y5MA 2VNSA 3WLEA 8LDHA 4A26A 2P4QA 4PLVA 4DRYA 2TMDA 4XWYA 1KY5A 3ZWNA 3DTTA 3T4XA 2WJPA 3FRJA 1N8KA 3H9GA 3H9EO 3Q9UA 4LW8A 3MZ0A 1V8BA 5FI5A 1GPJA 5I7SA 3L4BC 1C1XA 1JVSA 2VZ8A 1EMDA 3C1AA 1QXSA 2B4RO 4GWKA 3D4OA 3JCZA 1GADO 1HYEA 1VE9A 3HB5X 3DHEA 3LT0A 3BMOB 3FNGA 1CWUA 1LLUA 3TSCA 1DAOA 1DLJA 1ONNA 4BKPA 3GY0A 4B7XA 4J90A 4U0JA 3AK4A 4Q3AA 5I9NA 3FWZA 2VT3A 3ENNA 1ZSVA 4PLWA 1R0LA 1RM3A 2JCVA 4WPGA 1FMCA 4IDEA 4FJ0A 2FWMX 4OXKA 4NNJA 3WGTA 3G0OA 3ETDA 1T24A 5IN5A 4NPCA 1RYDA 4B8WA 3OETA 2VUUA 1WZIA 4FS3A 2VWPA 4XJSA 2IEBA 3FHLA 3PFWO 5U9CA 3GMSA 4PG4A 3AJRA 1UAGA 2ZYDA 3DBLB 1HKUA 2Y1GA 3BMQA 1U7TA 2V6FA 3TFQA 2FR1A 2VZ9A 5L4NA 1U4SA 2XXBA 4Q3CA 4XQEA 3C7DB 1BDBA 5IJZA 1Y6JA 3G1UA 2HMVA 4DL9A 4J3FA 2YUTA 3ST7A 2A35A 1ULUA 2QRKA 4Z0TA 3WGHA 2EP7A 2NLOA 4IDDA 4E3ZA 2X9NA 3WDSA 5CDYA 5TJHA 3PEFA 3RBVA 4OIMA 3EZLA 2NU6A 4OAQA 4CV1A 4H15A 2C5EA 4GLOA 1E7RA 4FQ8A 4TRJA 3PK0A 1RM4A 3QHAA 3ONDA 1E7QA 1P44A 4CMKA 4KDEA 4IDAA 3TDKA 1YGYA 2GCGA 3M1LA 4E13A 3GR6A 4P4GA 4NU5A 1YVEI 5DP1A 3PDUA 2P4HX 3HN7A 3PYLA 2QHXA 1BW9A 1HDCA 4R1SA 1W6UA 5KCZA 1YKFA 1TEHA 3L0DA 3B6ZA 3DC2A 4DMMA 1NFRA 2PK3A 1N5DA 3BAZA 5ER9A 5G0UA 2OOSA 4UEOA 3S1LA 5L51A 1UDAA 1W4ZA 4IZHA 1ISHA 1M66A 2OP0A 4HWKA 4B4VA 4RF5A 3SLKA 4JK3A 4BO7A 5CDUA 3HB4X 3PJFA 3U09A 3SVTA 5A9TA 3RSHA 3UGKA 3WGZA 2EKPA 4CQLB 5A5EA 5IDQA 1O5IA 2R00A 1HSZA 4IDCA 1X1TA 3JD2A 1HZJA 4IQ0A 3NJ4A 1P9LA 4OHUA 3RQSA 3I4CA 4R51A 1BXZA 1Z45A 3ZWAA 5HWSA 4WCFB 1A9YA 1I2BA 3WLFA 3ADOA 3TL2A 2PH5A 3CPSA 3L07A 1O6ZA 4KQWA 1IPEA 4CLHA 4CMEC 4QXMA 3P2YA 3RKRA 1D7OA 2AG5A 4BQRA 4K28A 1LRJA 1R6DA 3E1KA 1MX3A 1W0CA 1JKFA 2CFCA 4U8GA 4ZN6A 2RH4A 4XGIA 1PGJA 4NJOA 4IS3A 1X1EA 4R9RA 3RROA 3PHIA 2HRBA 1NPTO 3U3XA 1ID1A 4D7AA 1ISFA 2SCUA 4CV2A 2NUAA 2PZKA 2PZJA 3H6KA 2Q50A 5IDXA 1DC6A 1MB4A 1P1HA 2WDZA 2VYND 2W98A 2EKQA 3WQSB 3JYPA 4EZBA 3JTMA 2P91A 3TN7A 2R2GA 3MJSA 1KS9A 1FDTA 4L75A 4PRLA 3QRWA 4BNTA 4YAGA 2HK9A 1YXMA 2OL4A 2C7GA 4B4OA 4W9NA 3KHUA 2GN6A 3KVOA 4L8VA 4PLPA 4EJ6A 5BQFA 1C0PA 1PJBA 3GDFA 3ICCA 3ZH2A 1KYQA 3OHSX 3D5QA 3OMLA 2XF8A 1LC0A 1X0XA 3LC1O 2C29D 4ZQHA 1EQUA 3ZWMA 4OOEA 1GV0A 3T4EA 4PVCA 5AXCA 4B7CA 2VUSA 4YQZA 3E9NA 2JKVA 2O4UX 4Z3KA 3OP4A 4TQGA 3GGPA 3FSRA 4GSLA 1X13A 3V1UA 2IEDA 1A5ZA 1WP4A 4I5DA 4OL9A 1YL7A 2A9FA 2GYYA 1YB1A 1QR6A 4IDBA 4MKXA 1JQBA 3PRJA 4OYRA 4O0LA 2CVOA 2ET6A 4MP8A 1A27A 5TS3A 1I10A 3FTNA 3UAGA 4P22A 4BMSA 3TJRA 3EYWA 3R3SA 4GLLA 3NUGA 1WVGA 5TIIA 1NR1A 2Q4EA 1NTOA 3T7CA 2ZJ1A 4JBIA 4P8RA 1ENPA 5DBFA 3RU7A 4DBVO 1T2DA 4DMLA 4Y67A 4RF4A 4JROA 5DOZA 5L7TA 4XYGA 2CVZA 3PIIA 1B3BA 5I8ZA 1Z82A 2PGDA 3FBTA 3WQQA 4YAKA 1EFLA 1WDMA 3HUDA 2EGHA 4DIOA 5ILGA 4J7UA 5EJ2A 1XWFA 1HYHA 2LDBA 2X0NA 4I9UA 1UDBA 2ZCVA 1P1KA 4ALNA 2ZCUA 3COSA 4MVJD 3W4JA 1B8PA 2J8ZA 1JTVA 3DMTC 1Z7BA 4KUHA 5FEUA 1ZFNA 1E6EA 3VH4A 3VZPA 2V6GA 4LMPA 4TVOA 1CQJA 5H83A 2YHIA 2PNFA 3H65A 2PA3A 3OFSA 4YBZA 4BNWA 5F5NA 1OMOA 2I9PA 1PZEA 2D0IA 4RVUA 1HDZA 5B4TA 2DFDA 5JAIA 3NTQA 3I5MA 1VM6A 4BNXA 2JL1A 1XGKA 1R12A 2FPPA 1PR3A 2EF1A 5AQ1A 3IJRA 3NT5A 4M55A 1F8GA 4KOAA 4B79A 1YJQA 4IGFA 4YEDA 1SEVA 1FF9A 1V3UA 4CJXA 3I6QA 3QWFA 4M89A 3NX4A 2B35A 3HDJA 3BIOA 1ZIDA 3ZZNA 1SEPA 2BELA 2IXBA 2P5UA 4ZGWA 1R4NB 2W4QA 3LT2A 2W2KA 4WLFA 3AU8A 3F3SA 2OORA 1IE3A 1VL6A 4DBZA 4D79A 3ONFA 3K5PA 4RVGA 1RKXA 1IL0A 2E37A 3I1JA 2GZ1A 4Z9YA 3WGIA 2GZ2A 4BO9A 2NNLD 1NP3A 3OQ6A 2IYOA 3GRKA 4YJFA 3ZN2A 1NPYA 4AJIA 1LSUA 3VPGA 4FDAA 3JD0A 4GX0A 3AUAA 4RPHA 3FNFA 3GFBA 3AOEC 2XAAA 3OSUA 3DZJA 5F1OA 5CG1A 1C0KA 3N7UA 3LK7A 2EJWA 4L4XA 4FFLA 2O48X 2O2YA 4I9NA 1NBOA 4Y98A 1XKQA 1LXCA 4WOJA 4P4LA 4BNKA 4S3MA 5JMWA 1LU9A 4OOFA 1SPXA 1HE5A 1DXYA 4U7WA 3WGGA 1JWBB 3WTCA 3ZHZA 1Y1PA 2O2SA 4BNVA 4IQGA 1U2DA 1PQWA 3RC9A 1VJ1A 4X54A 5ITWA 3ASVA 4OKNA 3GGGA 3GRPA 5T8KC 3VZQA 3CMMA 5CP8A 2CF6A 1CYDA 4FFOA 4GH5A 4CM1A 3IP1A 3R0IA 2IZZA 1JLLA 2HJRA 4MVJI 5CDSA 4TWRA 4CMHA 4TZTA 1YH3A 4DTIA 3QVOA 4CMAA 4BKQA 3S2FA 1QLHA 5EESA 4PLZA 3DBLA 2QW8A 1RPNA 3WFIA 2FN7A 1HRDA 4YT2A 1HE3A 5JAMA 3Q1LA 4NMHA 1JKIA 2VOEA 3JD1A 4IBOA 1UZLA 2HDHA 1EQ2A 3EMKA 5L9AA 3JQBA 4Q3EA 2PGLA 2NVWA 4BMNA 4D0SA 5KJEA 1AHIA 3QJ5A 1F8FA 3PQFA 3IJPA 4NG5A 4BNMA 4JCOA 4C4OA 1BWSA 4CLRB 1I5RA 2OZPA 2YFQA 2ZK7A 3GUYA 6ADHA 1T26A 1ZSYA 2Y1CA 1GPDG 1QYXA 3IUSA 4K26A 3NTRA 1JU9A 4FW8A 4YPOA 2JJYA 3PWKA 1LNQA 4CL8A 2CZCA 4RDIA 1G1AA 1H94A 1MC4A 2TMGA 4HNGA 4CUKA 1WAMA 3BMCB 5COBA 4NFYA 1TXGA 3D64A 4YB8A 4CUZA 3W4KA 4PG5A 2YW9A 5KVVA 4LCJA 3NV9A 2NQTA 2C82A 1HETA 4J9UE 3WB9A 1QMGA 1XQ6A 1E7WA 1W73A 3RUHA 1GY8A 3WFJA 4ESOA 5THKA 1Z7EA 4UREA 2YV3A 1LRKA 4RO0A 1NHWA 2BLLA 4D0RA 4ZU3A 3GAFA 1XEAA 1NQOA 4XIJA 2IZ1A 4BKUA 4ZICA 1YL5A 5L7WA 2HQ1A 3DB2A 1PSDA 2V6BA 2X0IA 1BVUA 3RJ9A 4HKTA 2GSDA 4RVHA 3RBXA 1Y8RB 4PLHA 4CQLA 1P33A 4OQZA 1JAXA 3WIDA 2C7VA 2E48A 4PG8A 4CUJA 1T2EA 1QV7A 4DGSA 4R1TA 1R16A 1ZH8A 3EHEA 1R4MB 4KUGA 1TT5A 4LVCA 1ZUD1 4YQYA 5JDIA 3W1VA 2OO5A 3QVWA 1DRUA 3P2OA 1SOWA 4BNZA 1BXGB 4G2NA 3LC2O 1HDYA 3M2PA 1KEVA 4U6QA 4XRRA 1DJQA 5T6BA 3OQBA 3U4HA 1SAYA 2JFHA 2YV2A 1FDVA 3JYQA 1PS8A 1M75A 3QW2A 5FWNA 3ZNNA 1E1NA 1PEDA 4J7XA 5T57A 4IIUA 4PFJA 4H3VA 1U3WA 5H81A 4RQUA 2IZ0A 1ORRA 1WLYA 1E3WB 5KJCA 3U0BA 1PL6A 4FCCA 3RFVA 1M2WA 4ITUA 5B12A 1I01A 5DBIA 3TPCA 2DBZA 4BB5A 5JXWA 3C8MA 4I5GA 2P5YA 5CAEA 4QFDA 5JNLA 3ZWYA 2DC1A 2Y99A 3C7CB 3F4LA 3ZV3A 3NDJA 4XQ9A 6LDHA 2CY0A 4RVDA 2VTDA 4W82A 8ADHA 3VZSA 2X0RA 2P9EA 3PHHA 4L74A 1IB6A 1JA9A 1DIGA 3LC7O 1DDOA 3DMYA 1GD1O 2UVDA 3H9QA 1PZFA 1DFIA 1QKIA 4XB2A 4IZIA 3WNVA 4IJWA 1J4AA 1S7CA 2YZ7A 4Y9DA 5BNFA 3T7EA 2FR8A 1CEQA 2O7SA 4ND3A 1ADGA 2WWRA 3KSDO 1DOHA 4I8XA 4Y8VA 1YQDA 2J3IA 2OP1A 4P4NA 2CDBA 1X7HA 4XGKA 4ZVVA 1I30A 2Y0DA 3I83A 2EJVA 4MVJG 3VKVA 4PG7A 5U4QA 1SBYA 1T4DA 1I2CA 3F46A 4RDHA 3ZWBA 3BTOA 2J6IA 3F5SA 5MDHA 4HBGA 5CHEA 2PZMA 5BT9A 4R5HA 2W90A 1ISMA 1YONA 1E92A 2EHDA 3FPCA 1QYCA 3TZKA 2AEJA 1VJ0A 2V7PA 2BD0A 4XKJA 3V1YA 1NYTA 3K8ZA 3I9OA 5JO9A 4JX8A 1PJCA 1U9JA 3UCXA 1PZHA 3L6EA 2X22A 4YT8A 5KJ6A 2JFGA 4XGNA 3LF2A 3LVFO 4ZHSA 1U1IA 4DC0A 4PGFA 4IMRA 1NQTA 1OFGA 3IMFA 1ZNQO 4IPTA 4M54A 4R3NA 1EZ4A 5GZ1A 4HADA 5BNIA 3OA2A 3JQDA 3GN2A 2WEKA 4TKLA 1NQAO 2AEFA 2NU8A 3KEQA 1B16A 1GV1A 2FOIA 5JDCC 1AN9A 4YRDA 3QWIA 4E5PA 1EE2A 3IP3A 3AU9A 4Z0HO 4ZJUA 1QLJA 4QT0A 2Y1DA 1XA0A 1V0JA 5KKCA 2RIRA 2EW8A 5DCYA 5JDCA 1GFSA 4U5QA 3GZNA 3RUCA 5A03A 2VWGA 4UVEA 1I24A 4URFA 1U8FO 3KOUA 3W4IA 2Y05A 3AI1A 5EQFA 2V65A 5HS4A 1SCUA 4RJTA 1HLPA 1TA4A 2P9GA 4UAGA 2PR2A 3OJFA 3Q6IA 4B4WA 1F06A 4AJJA 3QE3A 3NGLA 4CMIB 4Q39A 2J5KA 5G4KB 1WMAA 4TROA 1FDUA 2Y93A 3WYEA 1S6YA 2G76A 1LQTA 3GVXA 1P1FA 4O5OA 1IOLA 2E4AA 2WSBA 3DHYA 2BF7A 1LC3A 3NYWA 3U4DA 1PTJA 4AJHA 4M87A 1R4NA 1YQGA 3CSDA 3GF4A 2QIOA 2NSDA 2VRCD 4FIZA 3QY9A 4DYVA 3E5RA 1U4OA 3GH3A 3WXBA 1GYQA 1PJ3A 4Z9XA 5K9ZA 1D1SA 4LSMA 2DVMA 4BNUA 1EDZA 3GPIA 4W6ZA 4AJEA 2BGLA 5DZSA 1DIBA 4PLFA 1I3LA 1GDHA 2VRCA 3BXXA 3PXXA 2I6TA 3EZYA 3RBZA 3VZRA 4CV0A 3HDQA 1XQ1A 1GEGA 1CDOA 1UDCA 2GZ3A 2Y1EA 3K2BA 1ZK3A 3QLJA 4W7HA 3VHRA 4BO6A 4UVIA 4ID9A 3ZW9A 1MFZA 3DEYX 3CIFA 1LDYA 1EVZA 1I3KA 1I2ZA 3KEOA 3FPLA 1YBAA 5IN4A 3CKYA 3AOGA 3OJEA 1LSSA 3LDHA 1QYDA 1PS9A 2P2SA 4UEKA 1TVEA 1B3RA 1D4FA 2Q2QA 3ZWXA 4AICA 4EYEA 4BGEA 4QSMA 4LVUA 3NRCA 5ICSA 1ZK4A 4R16A 3GHHA 3QSGA 4EEZA 4O6VA 1C3VA 4IJUA 1DSSG 4J1QA 4MVJM 3S2GA 2GGSA 1ZK2A 5I7EA 4R01A 4H16A 3B1JA 3H3FA 3ZU4A 3CZMA 4OQYA 3ZNQA 5A02A 3GOHA 3IIEA 5ENVA 1EEHA 3HNPA 5IDWA 2VT2A 4JXKA 4EUFA 2UAGA 1N9GB 4GWGA 4F6CA 4C7KA 4CM8B 1LLCA 1E6WA 1UXGA 5JCJD 1GQYA 3Q11A 4R3WA 4KWHA 2GN8A 4YT4A 4RVSA 2FR0A 2HK8A 4KTVE 4L9RA 2I66A 3WICA 3GVHA 2FY8A 1GYRA 4RV9A 4CLEA 4BNYA 1BRMA 1BHSA 3ETEA 3ZWOA 1UUFA 2Y67A 1H6AA 4IJVA 1HE2A 5TT0A 4QO7A 3ZWPA 2C07A 1U3UA 2H63A 4ND5A 4NFHA 1NAHA 5A4DA 2X0JA 1I32A 1KC1A 2NTNA 1K6JA 2O4CA 3U49A 1YBVA 4BGIA 1IYZA 2QZZA 3ASUA 2JCYA 4GGPA 3RAJA 3INRA 4GVLA 3RCBA 2PWZA 2JAPA 5LDGA 2FPIA 3B1FA 2ZTVA 3ITDA 1CIVA 3K6JA 3OQ1A 3C1OA 4HNHA 5B1YA 1O95A 2P9CA 4A0SA 2P68A 4PZDA 4NK4A 3AY3A 4D45A 2BFMA 3ZWVA 1XLTA 3OJ0A 5DNAA 4E31A 2C2XA 4FB5A 1XYGA 2WM3A 4NJMA 2R00C 3ICPA 4L76A 1R15A 1UJMA 4ND2A 4UUOA 3DO5A 5A3JA 3INGA 5J23A 4BQPA 3WJ7A 3LSYA 4Z0PA 4RPGA 1SNYA 1Y8RA 7ADHA 2RH8A 1KOLA 1RM0A 3N58A 4KUEA 4OM8A 4E5YA 4OJNA 3UOGA 1P1IA 4AJKA 4CV3A 1U3TA 5AYVA 3KSZO 2GN9A 1E1LA 1PIWA 1PJTA 3DZFA 3H5NA 2R6JA 3A28A 4NBUA 3X2EA 1ADFA 1DO8A 4N5MA 3W6ZA 4AJ4A 1P45A 4JLWA 4PLYA 2QRJA 2D5AA 1OBFO 1HLDA 1LDBA 2XPCA 1N1GA 3PJEA 3QVSA 1AE1A 3G79A 4EJMA 3FWNA 5A05A 2NU7A 2POQX 3VOSA 1I3MA 1PWXA 3ZHXA 2B83A 5L45A 1PQUA 2WD7A 3S2EA 1J49A 3AFMA 2O3SA 1LSOA 3ETGA 1HF3A 1NVGA 4YJGB 4CLOB 5IG2A 5L95A 3EW7A 1ISIA 4M86A 1MUUA 2B5VA 4BO0A 3ANLA 1HXHA 5DCUA 3C7AA 2UUPA 3SLGA 4W9NC 5BNTA 4CM7A 3HE3A 1WNTA 1VL0A 4JJIA 5CPFA 4E12A 4R1UA 4FN4A 4E30A 5C7OO 2Q3EA 5C3MA 4WLNA 5IXYA 4K1LA 3NDIA 4F45A 4L4RA 1BMDA 1VRWA 4NBWA
chains in the Genus database with same CATH superfamily
2VYNA 3TLJA 5A9SB 2ORED 3HVIA 2C96A 1DJPA 4ETMA 5JBIA 1CUXA 1NNEA 1QIFA 2EFDB 1C9YA 4PSUA 3T7JA 5PNTA 4IM7A 4EY5A 2Y1FA 1DAPA 3BRSA 4RY9A 3QKIA 4K6OA 2JGKA 2DUWA 4C3UA 2FN3A 3BHIA 3G2OA 2ZLBA 3ZDZB 3SE0A 3UT0A 4D46A 4Y9TA 3H2KA 4PYRA 2QM8A 4KQ9A 1QDLB 1JIQA 1G3IA 1P5JA 1ZKDA 2PD4A 2ZYGA 1JX6A 5AJWA 4A5OA 4EVQA 2V8OA 1LV8A 1M1XB 2GR9A 4GM1A 4W99A 4FC6A 3KBBA 1OXVA 5BWMA 3V00A 5EWMB 2HUNA 1KQOA 3OTHA 1R18A 2X5JO 3BZWA 2XT9A 3ZHSA 4CV0A 1LRLA 3RAEC 4ZEWA 4DR1B 4M3NA 2BMEA 3D6NB 3WBFA 2AJBA 3RAGA 1C1HA 2QE6A 2DETA 5CLHA 1NLYA 3HDYA 1N6NA 3NWPA 3KYDB 1EP3B 1YFZA 3RLFA 4N8EA 3BQNB 1QH8A 4F06A 2FX2A 1BGWA 1E2BA 4RF3A 4RKRA 2AV6A 2H9IA 2WA1A 3NHZA 4TN1A 2A5FA 1KP2A 1Y4ZA 5CA1B 5BORA 5EPEA 2EDCA 5DULA 2JPDA 3LGSA 4IX9A 5KNDD 3E81A 5CB8A 2IU6A 1D3AA 3AX6A 2XXJA 3ESBA 3RIXA 4C2BA 3QOWA 4CVNA 3WLLA 4GX1A 4DJTA 1WNFA 5HF9A 3TQTA 4EI2A 5JSZA 2WVHA 2IP1A 3PCTA 2QMEA 4MLZA 2F48A 4N54A 3A9RA 2A58A 2IXAA 1D0IA 1Z0AA 2B1QA 3IQGX 3UXYA 2P40A 5FORA 4DRXB 2WT4A 1XU9A 3CWZA 2P6OA 3DVRX 2REQB 4YFVA 4JJFA 1E6UA 2QD5A 5AXBA 4BP8A 1E61A 2L2QA 3BIWA 2HCTA 3HBJA 1FW8A 4MIYA 3ZX4A 3A4VA 3PZBA 3ODGA 4LN1A 3GPLA 4HUJA 1OXXK 2YFHA 1JB1A 4UTNA 4QDTA 4YAUA 3BG5A 2B4TO 3W5BA 1VHTA 1BD3A 1ZKMA 1QV6A 4Y2TA 3K0SA 1QFSA 3E3AA 2VTVA 3Q2KA 4TL9A 1U5AA 4B3DA 1NV9A 2C4NA 4S1VA 4NONA 7MDHA 1A2QA 1PBTA 4DR7B 1W85B 1DJOA 3KFXA 4MDFA 1CZLA 1G4HA 4E03A 1VPTA 3KVNA 5DNDA 3VC3A 2WLSA 3OWHA 2OORC 1NI4B 2PUTA 3DLPX 1RXCA 3BCRA 3NHSA 5AK0A 1ZJYA 4OK3A 2D7DA 1PV2A 1YQQA 1HE1C 4R2KA 1N2CB 5BSKA 2YWGA 6GPBA 4MARA 1GGJA 2C4UA 2GPWA 4Q7KA 3VOAA 4E0BA 2W58A 4DARA 3WYCA 1T9KA 3FR7A 4JP3A 3U4AA 3L7DA 1AGNA 3TW0A 4EW1A 2AXQA 2O05A 1SD5A 2QN6A 5IKXA 4WKGA 3ELBA 4GYKA 1IN5A 4L0DA 3NKFA 4W8HA 4HEA1 3FRIA 3ONEA 4KRGA 3DUFB 4CMCA 3LPDA 2AVNA 2EATA 3IOMA 3W0LB 3UMVA 1H4QA 1CZHA 4PAMA 3FCXA 2ISQA 3KBOA 1AHHA 2X2FA 3W5UA 4D42A 4DV2B 2VJDA 5E0KB 4GKKB 3C45A 3D7NA 2H85A 3HBMA 1J8YF 3GW8A 4OGWA 4TKMA 2GRJA 1EWQA 1HEYA 2I7XA 1CVIA 1E7SA 3WMFA 4FXOA 1IZ0A 1I9CA 1VI5A 4UVGA 3J81k 1Z5PA 2VXYA 3BERA 3GCXA 5LWQA 4FYWA 5DWDA 1UH5A 1L6IA 3B36A 2HUPA 1TMGE 2QLBA 4GKAA 4TM8A 2VHXA 2QJWA 1SZPA 3PX3A 1DBVO 1APBA 3BEOA 1Y9ZA 1X1SA 4RH0A 1RPZA 5HILA 3G5LA 2AN1A 1M0SA 3N8KA 3VPAA 5AM3A 1BQ3A 4G56A 4J0QA 5JAZA 1W2HA 4HFMA 5KYVA 4YPVA 5F33A 2POCA 5DX0A 3TO5A 1UP6A 1T8SA 1UKAA 3O3CA 1C0IA 4KLAA 5F77A 4MH0R 4D5EA 4F3YA 1DRVA 1YDHA 2J3MA 1P91A 4BFXA 4QRDA 5JH7A 3QY0A 1NF9A 1U1FA 2BKLA 4UBMA 1R64A 3MJRA 5C81A 2P4SA 3B20A 3N2EA 4DBLE 1TQ2A 3KKEA 3Q3EA 4ETNA 3V7UA 1GM5A 3AFHA 4X8HA 2R62A 3EEFA 5BW6B 1C1XB 4C0HA 4D4IA 1R0XA 3Q5DA 4L9WA 2BFAA 1JZSA 2IYZA 4LXYA 1KJZA 2X41A 5CVCA 4D0NA 4PPQA 5F9HA 5E9QA 1VJTA 4A9AA 1PL0A 4HGOA 3C0KA 4HK4A 1M2NA 3VMFA 3CNBA 3A4NA 4DIUA 3JQBC 4O4LF 2XYGA 1A9OA 5A3VA 5HF5A 1RCFA 3CKMA 5BN4B 3CMCO 2VA8A 2VHYA 3AHGA 3PGVA 3QA9A 4PPNA 4TXJA 5IYZA 1S02A 3IQZA 3AF5A 3TIGA 3COZA 5ESXA 2ZB4A 2NTJA 3DL0A 3D3EA 1CETA 2MHCA 1C50A 1JIXA 3HKEA 4N0PA 4EG7A 3K8OE 3DMDA 1DWPA 2CHVA 4UFOA 3RANA 1F51E 4FKZA 1HMYA 5KJ1A 1P2BA 3FOCA 1PR6A 2EXXA 2NSLA 3Q98A 2PYDA 1NA5A 2OY0A 4ZQGA 2P2LA 4BB0A 3NDRA 5BOSA 5K8UA 1KJWA 3M89A 1LPNA 4A15A 3HZZA 2PJZA 4IXNA 1MP0A 2BC9A 2GPNA 4LVOA 1MO6A 2DWCA 2OQ2A 1A8HA 4Q15A 3O8QB 2C8LA 4BGUA 3AKDA 4M37A 4AB1A 4YY3B 5BQ5A 5TF4A 3DKKA 5E3JA 2JBAB 4G5YA 5AI4A 2CE2X 1E99A 2SHKA 2SECE 2QL7A 2VDWA 3W2HA 1OX6A 1UPBA 4DLAA 5B36A 4Q4LA 2C5AA 2CDAA 2CDCA 1MABA 3M6LA 4R7ZA 3Q3VA 4MGZR 2EYQA 5F5LA 4NCNA 4PW0A 3L4KA 2L17A 1CQIA 3IXLA 3W8FA 3U4QB 4JLKA 1NOJA 2DUUA 4GR9A 4PAWA 3GT4A 4ZOLA 1YQEA 2FNAA 4JHXA 5FTWA 2QLNA 4XIYA 4WLVA 1RZUA 1TK9A 4EJSC 3RKUA 3TSOA 1FIUA 1RYFA 4AY3A 2G6BA 2XUQA 2B36A 2C04A 2LP4Y 4QTZA 4YP6A 1KMQA 4DR4B 4C0KA 4XARA 3WKAA 2B8NA 1XLVA 4MVCA 3STWA 3K1TA 2AL7A 3ZGNA 3OQPA 3PFFA 2GERA 3CXRA 1OAAA 4KFRA 2C2WA 2B0JA 1TM5E 2OBYA 4FFSA 3RNLA 3RU9A 2HN9A 4X66B 4FGUA 3TIXB 3ZZ1A 3IDAA 4OP2A 3IBFA 2J3DA 1TLTA 4C7JA 3TAHA 2JAQA 2XZOA 4MMYB 1T1GA 5DNCA 4R05A 3STUA 4WXRA 2YXBA 4PZZA 4PX2A 5G0VA 3AJ9A 3H2SA 3OPYB 3LE8A 4DOMA 1Y3DE 4L07A 3UMJA 3MS2A 2G5PA 4FPXA 1L8XA 2OCPA 4ZQEA 3H0CA 3IB6A 4X0EA 3OA0A 1JAYA 2H4XA 2W4MA 4QGBA 1KHHA 1S96A 3RG2A 4FNGA 4B85A 4CFZA 4DQXA 2OBFA 2QQFA 4MQEB 4AF8A 1HT1E 2PMFA 1MIOA 4HTFB 3AUTA 3HZOA 2H31A 1ODSA 2ZG6A 1CV2A 4M1QA 3QSYA 4HQ6A 2WKPA 1A82A 1HL3A 1U2EA 1U0GA 4HAVA 3HY3A 4HVCA 1ZGAA 1MJGA 1ETUA 4ZT2A 1H2AS 5GJCA 2PUEA 2B61A 2C5SA 2QVCA 1UKBA 2W48A 2YV1A 4K6HA 3RIEA 1Z2NX 3UICA 1NZDA 2C92A 4BNLA 5AM1A 3GK3A 2H59A 2XUIA 3CG4A 5J2TA 1GA6A 1FRNA 2Q8NA 3VSDA 3E05A 1A9SA 2CHGA 4I14A 4BFVA 1JPUA 1P7VA 4KQJA 4QUAA 3USES 4A8JC 4BJ3A 3OJOA 4ZJYA 4TXLA 5T4FA 2PUWA 5CVJA 1M34E 3TWOA 5TQVA 3FW1A 3ROEA 5DYNA 3BXGA 4LTDA 3WQBA 3QXCA 3GAZA 3PC8C 4XWWA 2P9YA 4C5AA 1G6HA 2FR8C 1ZEMA 1Y5NA 2PT6A 1GNPA 1VIDA 3NO4A 3R0XA 3AI3A 4I3FA 4WGGA 1XZFA 5FF9A 5FA6A 4ARVA 1NY6A 5CXXA 2FVYA 2O50A 3L2OB 1KK3A 2Z8YA 4KXLA 4AUKA 3DHWC 1CX9B 1MAWA 2ZRJA 3QEJA 1V3QE 3HU2A 4FEYA 4LWOA 4E5MA 2YDYA 2YQ5A 3NH6A 1WQ4A 2CFIA 2HO5A 4JYMA 5E6SB 4ENRA 3G2LA 4TM7A 4OQQA 4E33A 4FC7A 3X1XA 3X0DA 1N75A 2ZSFA 2UUAB 2P2ZA 3PL1A 3RS0A 4GRIA 2BTEA 2GAJA 1L1RA 2G82A 1OHHA 1RLUA 2EYUA 4NIMA 5JY6A 2OOKA 1F6BA 1OI7A 4OHBA 3SBOA 5K01A 2G5GX 1W30A 4IGEA 1BC5A 3IBSA 1VMEA 4L8LA 4G8JA 1E9SA 4NZOA 1T2AA 1ZONA 2DX7A 4Q02A 5ALRA 4YCCA 3UYKA 1DHRA 3MRTA 4XPZA 5KBYA 4RJIA 5AOVA 2QL6A 4CDGA 4UDOA 2CJXA 4L2IB 1PJLA 1Z5ZA 3QPAA 5CG2A 1I80A 2OVBA 4K9LA 4XDZA 4DC9A 4RM3A 2VHEA 2VDKB 2OMEA 4B31A 1C7IA 5CBPB 2GPBA 2XDQB 4IY1A 4DPKA 2VTBA 1G8PA 1PJ2A 2CD7A 4YROA 2J3HA 3ZVMA 4HDRA 1WBJB 1RI5A 5KWIA 3U4CA 3EGOA 4FCTA 3AC0A 2DLCX 1Z6QA 4IUYA 3CEJA 4AG3A 3WGOA 4LUCA 5JZVA 4Y2UA 4ZVSA 1GGHA 2EQ5A 4X41A 1SC4A 4QU5A 1ORDA 1UMBA 3AKYA 1N2SA 5HIIA 2CWDA 1PKXA 3O6VA 2I55A 3UBTA 5LN1A 1NMYA 1Q1GA 1N0UA 3OFKA 5A9RA 5CCEA 2WI8A 3HJNA 1CF2O 3IDZA 4BO1A 5B3KA 5K0FA 1LVUA 1TF7A 2X86A 4F5DA 3KLNA 1NVXQ 1ZVJA 2H7VA 3UJPA 2YFKA 3PTZA 1C9MA 1Z0JA 3VC1A 2GA9A 4EK9A 1B0ZA 5A1TA 2V7BA 4E5KA 1HQDA 5TR9A 1D2RA 2ZVQX 4C03A 5HZMA 2JVIA 2WU0A 1HM5A 4XGKA 1IH8A 3SFZA 4EVIA 4IIFA 4F72A 3KQWA 5LIPA 3K71B 3ANTA 4RIHA 5J4HA 3M6UA 1BMTA 3KQSA 3G2QA 5JSYA 4G4SP 1EFRD 1KVTA 1KY2A 1V7ZA 1H93A 1VMKA 2B5OA 2ILTA 2XB4A 3D8BA 3DONA 3BWYA 3T9BA 5BWNA 1QAMA 2H7CA 3OAAA 4TWAA 1GAXA 4WEQA 2FZWA 3R9WA 3UV3A 2PX2A 2QLTA 2QS9A 4A6EA 3K0FB 1BVHA 2QN3A 2DG2A 2B82A 2VHWA 1VP3A 2I4IA 3BMXA 3ER6A 3NWOA 3QXGA 4HNSA 2V3CC 1KEPA 3G2MA 1YQXA 3HVUA 4EFNA 1K3FA 1QDUA 4RLSA 4YAFA 2XXAA 1IRIA 1WG8A 3HJUA 3AQ4A 4BLWA 3MJVA 4KP7A 1C3EA 1US8A 3GPDG 3PCXA 5B5SA 4NBLA 3FTEA 3DE3X 4RQBA 1JMVA 1DV1A 2ZRNA 1ZC3A 1JHRA 2KHZA 3JVIA 5BVHB 4MRSA 3CC8A 2AI2A 5E4JA 3J81A 2PH3A 3MGBA 4H3SA 3RRYA 1NI5A 4TVSA 1QQ7A 2W2LD 3BUSA 1P5RA 1FVFA 1RABA 1QPBA 1X77A 3ZGXA 2XJ9A 3ZG6A 2R7MA 2IWRA 5JECA 2I8CA 4JBHA 4FFRA 4BCDA 4DYDA 1WWKA 1U6IA 2AKYA 3A14A 3FSGD 4GZ5A 3P4XA 1EVJA 2BGTA 3DULA 4H4EA 5DYIA 1YB7A 4HB2A 1H65A 2FFQA 5EYPB 3HB1A 4OHOA 3OEEA 4US0R 3TCKA 4EB6A 3CJRA 2CT8A 3BXZA 1H2XA 3HCOA 1I7NA 1JDVA 1C29B 2CXUA 3VKUA 2VDJA 2FJUA 3HHEA 2DSNA 4I81A 3AY6A 4MZXA 4JP2A 2P0YA 2PV0A 5E8JA 4BMCA 4D9CA 4O8ZA 3RF6A 2JI4A 2AHRA 1AQYA 2HQOA 3V97A 4UXHA 2Z2XA 4OQLA 1K0UA 2A9VA 3THOA 4O3FA 1DTWB 1AV7A 4AX4A 3IAHA 1A9RA 3NTXA 5CT9A 3DEIA 3NM4A 1DVRA 4V0ME 3SXPA 3WTBA 2ZDQA 4DMGA 3A9CA 1SFRA 4AX8A 3R3ZA 1VDZA 1NWCA 3BWEA 4OSEA 1ODIA 2DT5A 3MPOA 1Q6YA 2GDJA 4E3WA 4FW9A 1NV8A 4IS2A 4YVFA 1UBFA 1NWHA 4QTXA 2NXWA 3Q2IA 2YN2A 4UASA 3OCXA 2AEMA 4G0XA 3UK7A 1F48A 3ZIDA 1XRNA 4B3IA 2PLFA 2QRVB 2FRVA 2BN4A 3DPUA 1U5BB 1IIRA 3FMPB 1HV8A 2ODAA 4LJKA 1URPA 4BN0A 2DHQA 2ABWA 3A3OA 2VWHA 1N7GA 3EQ2A 3K9WA 5E6RA 1BCSA 3DXYA 3L8YA 2DCUA 3DMFA 1SZDA 3IQWA 4XZ3A 3TNLA 3DZCA 3E9YA 4NXNB 1Q7RA 3SSOA 4AVYA 1DAGA 4L27A 3PT9A 3K6SA 5DPMA 1UBOS 1VBMA 2XMBA 4MR7B 3NQ41 4NBRA 3ZKAA 1DFGA 1KDRA 3G9XA 1JEDA 2GO1A 3R24A 5GP1A 3UMCA 4BXOB 4TZ0A 2FMTA 3MEQA 4MUAA 4Z4EA 4YI3A 4AJNA 5H9VA 4AJLA 2HK6A 1Q16A 2HT6A 3E3LA 3PYMA 4M7WA 4PO9A 2W2XA 2XWBF 4S04A 1VGRA 3BHNA 5D51S 3U62A 3DAPA 3RU2A 2NT3A 5K45A 2IZ6A 2AHOA 1M0WA 4H1VA 4EA6A 5A71A 3T99A 3N74A 4CL3A 1XU7A 3FBWA 4LIPD 3ESQA 4KAAA 4XQCA 2DBQA 1YS4A 4LQ4A 1VKJA 1Z75A 3SDSA 4DBLC 2PUAA 3ENKA 1QH0A 1X7ZA 1A4IA 1RJGA 3GFQA 3KLPX 4DJAA 2F4NA 2W9XA 3T5PA 1SHUX 1R8YA 2A94A 1LA2A 3GLTA 3V6MA 3VV3A 1WXXA 3KG2A 5EIWA 5LB2A 4C4PA 3MOIA 1EWTA 3U3DA 1R0WA 1U11A 1Y3HA 3VO8A 4F9TA 4I50A 4CN8A 1U7PA 2G1JA 2Q49A 1LKZA 1KKMA 1P0MA 1SVIA 2G0NA 3HYLA 4IKEA 3FCYA 1J2TA 5CJJA 1ACMA 3U9SA 1DAMA 4OIFA 4I4IA 4ZDWA 3KUXA 1QNLA 3O91A 1WB9A 4M0DA 2UYCA 1J5XA 2Q3JA 3V4RA 3K05A 1U8XX 5DSXA 1FUUA 2EZ4A 1J7KA 1MW9X 4WDQA 4TYWA 1R9NA 4UMEA 3RIYA 1XLTC 5HIKA 5BNWA 3H0KA 4QECA 4QJ3A 4TTAA 1MG5A 4BAUA 3C3PA 3NKLA 3F74A 4YV1A 5IBPA 4TKZA 3BZBA 1C7JA 1LDGA 4F8JA 1BU5A 2ES4A 2ZP1A 2E5WA 4B0OA 2C20A 1Z0FA 1OXBB 1FYVA 1QSGA 3TZHA 4N9WA 3JSXA 5EJAA 5LU9A 2BCJQ 3BWVA 4EGFA 5JATA 2CNBA 1R8JA 2AMFA 2K2WA 1E3QA 2RHHA 2YVUA 3BGSA 2LPMA 2WJ4A 3A32A 4PLGA 4R9VA 4HEQA 4C6TA 4ER5A 2VQEB 1K7CA 4ND4A 4CIDA 4EABA 4DNXA 2B1RA 4QWWA 1MVOA 4OBWA 5EP1A 1MO2A 3FCCA 3PT5A 1RP7A 4KGVA 1W2WB 1ESNA 1B0PA 3GT3A 1ECPA 9LDBA 1AMUA 1RM5A 1BVRA 1F8YA 4WACA 2IDZA 3FLMA 3R0JA 3DS8A 1E8MA 1C0LA 2O06A 3KS9A 4TSKA 2Y1LA 4I55A 1MPTA 3DFIA 4JI4B 2YOFA 1KVRA 2ADFA 3KR0A 3FLBA 3QUCA 1WE2A 3WLIA 4PANA 4ZYUA 4UD6A 3G9ZA 5M3BA 1W96A 2Z83A 1SR8A 1XMSA 4YJDA 2XYPA 2Q5FA 3KSUA 3L92A 1F6DA 1DELA 1DEHA 5DMXA 1QP8A 4PO8A 2XVYA 1KP9A 1T9GS 3KE8A 3SHTA 5JZMA 5KREA 1T9BA 4P35A 4B6JA 1PK9A 2DQ4A 1ZK0A 1Q83A 4HMOA 2VC2B 4W4TA 3FI9A 3GB9A 2CYBA 2PMKA 4B3RB 1E3WA 1X6VA 2IHUA 4GPEA 1X38A 4HDKA 4R1LA 4WMLA 4WKPA 1TT5B 4HDNB 1C1YA 2C8KA 3LX6A 4PHCA 2ISCA 4U2KA 3EC7A 3DO8A 3Q7TA 1YMQA 3HCCA 3QQPA 2I76A 1DC4A 4RK1A 4D8XA 1H22A 1JG2A 3CRQA 2WT9A 1KGSA 3NHPA 3FTPA 3E7XA 3P9YA 5FD8A 3S7ZA 4CE6A 3UAXA 1BE1A 2O2XA 2I1QA 1K66A 2FFBA 3I53A 4UQPA 1IPFA 2FRDA 3FYSA 4DC1A 3W8RA 4EUEA 5ADVA 3TJMA 3AR7A 3O26A 7AT1A 3K92A 3DDSA 1VIAA 2R1VB 1EK1A 1FC0A 2ZDGA 3EVDA 4CMEA 4M1KA 1Z2CA 4HAUA 2D2FA 5ALHA 2C1ZA 2XCQA 1V11A 2VAMA 3EGIA 1LV7A 2GMWA 2QVZX 3IERA 3RWBA 3MUEA 2X3UA 2Q2VA 1T36A 2QI9F 2RBGA 4BWYA 3GBPA 3WO1A 3ZCTA 1B6RA 4G8BA 4ALKA 3VTFA 3VSEA 3TI9A 2RCYA 4X64B 4ZCMA 4MIKA 5HRAA 3SEZA 4YJ3B 1YDFA 2BFBB 1J8QA 3MTJA 4IKPA 4NAHA 5TLSA 4PPYA 3UIEA 1XF9A 5KZMB 4HH0A 1P0QA 3DEJA 5BVGA 1BMQA 3OLYA 4MVJP 2PJUA 5DWQA 2PUCA 1EUZA 1FDWA 4V03A 1B42A 1U04A 2B7LA 2V45A 4IJKA 1T4MA 4N40A 3EOBI 1EBUA 3IKVA 1N6OA 1SCBA 3DEAA 2OBNA 1ZZEA 4PGHA 1MC1A 4URUR 5GGXA 3N6XA 1REQA 3NEAA 1LQ2A 1BXRB 2HL6A 5K8IA 3H6HA 1HDXA 3IC5A 1XZIA 1XTUA 1PEKE 2DOKA 2QX6A 3E03A 3QVUA 4G36A 4N12A 1T6ZA 1FYDA 3AESA 4L5JA 4UE6A 3X3HA 3ZLUA 4YRLA 1DB3A 1FZQA 5KCMA 2V7GA 3F3YA 4GAEA 5TV2A 4BU0A 1NE7A 2BWJA 2ZJBA 1HEIA 2FW9A 2WOJA 3ET5A 2PRIA 3IT0A 1DIRA 1F4LA 3JVDA 5I7RA 1H1DA 4G86A 2C3PA 1P4HA 3DVAA 4XYEA 4YUVA 2D6FA 3T3HA 1VLMA 3L7BA 2B99A 2P2NA 2UV8A 4FYXA 3TDNA 2CL5A 2F8LA 2IDJA 2IH4A 2PYIA 3BORA 3ZGZA 4E2WA 3SSMA 1G38A 2E0IA 2PUVA 1GXSA 2JI7A 5FB3A 3V1TC 1I1HA 2W7TA 2X5OA 3B3GA 1G4AE 3F71A 2HJHA 3N2GA 3EXG2 4QGGA 5FNVA 3UB3A 1SQ6A 1SU6A 2HWWA 4R2XA 2VQSA 4XFKA 4AUMA 2F62A 1EM8B 1ODLA 1ZD5A 1M54A 3OZCA 3OM1A 3QFSA 4G97A 3EIUA 2BM9A 1QGUB 4OGFA 3K70D 3A10A 2BZ0A 1G8SA 1GTJ1 4C0AC 1CK4A 1NOKA 3K1YA 5DCWA 2Q99A 4O0MA 1UL1X 1V1RA 4L4YA 5CA1F 1GTSA 5IULC 1LWOA 2CKDA 1ETHA 4YT5A 3U7QA 4BKOA 1XDBA 3I61A 5JAQA 2JHPA 4RTNA 1UFRA 2HJSA 3RR2A 1NE2A 4BBZA 2VHZA 2VJMA 4DQVA 2VPWA 2G07A 5BRNA 2VHVA 4RHUA 3TRHA 5CU7A 3V8RA 2R2AA 3ZV5A 1D8AA 4GRDA 3JYLA 6PFKA 4YV0A 1RHMA 4DILA 1MB3A 2PSDA 3MTAA 3ESXA 1RI2A 2WM8A 2NZYA 1CUYA 4D80A 1L7EA 4RSRA 1SUCA 1G20A 2VLIA 2YQ4A 3AR3A 2BFDB 2HXGA 1O8CA 4JNCA 4CCWA 4FI3C 1YIDA 2O8BB 2EFYA 3Q0IA 4MK4A 2VRWA 1IUKA 3K53A 4Q47A 2A9OA 4AM8A 1NBWB 3ED5A 5G4KA 4LI0A 4BO4A 3CZ4A 5KNBD 3TQOA 4TMFA 2CUZA 5KTSA 4HXEB 4RTJA 4BPBA 1V5IA 1BFKA 3DOJA 3OSZA 4JLVA 4WNCA 2Z5LA 2VDVE 3EBPA 2FPWA 4Y9SA 5JS1A 2O1WA 4XX1A 3ZC3A 1ZGCA 3B7PA 3TL3A 2WF6A 3CLRC 4GYJA 1LJUA 4YRPA 2VQDA 4M9XA 4JEMA 5IKMA 1Z9BA 2CCJA 4NAUA 4AWXA 4DUPA 4RY8A 1CUJA 1O7JA 5E4YA 5GONB 2X1HA 3LPMA 1PVOA 2CJYA 2AYYA 3FMVA 1IUOA 1EFVA 3HCFA 4R4JA 2Q7OE 3THSA 2DBVO 1L7QA 3F2VA 3K9QO 2OFFA 3WWDA 3ZJ5A 4C76A 4CNBA 3CVJA 4LV6A 1JAIA 2CJWA 2N1MA 4I1IA 4RSHA 2OCBA 4RJLA 2XNJA 4EVRA 1I9GA 3HA3A 4TLDA 1W5FA 2W37A 4O5AA 1MF7A 1RBZA 1NSTA 1MB0A 1GWNA 4YWJA 4M8KA 1CUDA 2ZZMA 2R751 3FG9A 1KH3A 2SICE 2QJRA 2AOTB 1HTBA 3H1GA 4ZEMA 1LLQA 1IIBA 1PGQA 1WL8A 2ZKLA 2WOOA 2IU4A 3DT9A 2AI3A 2EJUA 1FRVA 2YJNA 1Z18A 2QJOA 3PVCA 2HKIA 1A98A 2C2BA 2JVJA 1R5NA 2OENG 3CKLA 3GLKA 4C0QC 5IZCC 3OEWA 1QF6A 1YS6A 1Z2EA 4M9SA 4HNAA 3G85A 3RARA 4ZT7A 1FFXA 1VE5A 1FFAA 4LY3A 2ZIUB 1NVMB 3OESA 1UK6A 5IBRA 5EEHA 4K0KB 3OZVA 1NX9A 1J2UA 2VFAA 5EUMA 2XNKA 1EH5A 4EX6A 2LCIA 1UM8A 2MSCB 3UKOA 3UXEA 4N7JA 2B98A 2BZGA 1GNSA 3PHLA 3AUKA 3F98A 1GZ7A 1KMHA 1OWMA 2V3WA 3HADA 2AA3A 3O94A 2D7JA 3L8CA 3R5TA 5EKSA 1F0KA 3MELA 4EARA 1WXFA 5KTYA 1MIHA 4DR6B 3A9WA 3C6XA 3I9JA 1B14A 1NJ5A 1JXMA 4FQ7A 5KUTA 2IS2A 4E70A 4R68A 5EZYA 4HDMA 1EK0A 3NT4A 3SEQA 4CI0B 1UC5B 2Q4TA 2PT5A 2Q07A 2WJGA 5E1MA 3ZE6A 1A4UA 3TW8B 4BBAA 4QG3A 1ZR2A 2AXEA 4M0UA 4J1TC 3W9YA 1ZRHA 2ONYA 3UMYA 1E1RA 1XA4A 3BWXA 4IIHA 5M5BA 4CM8A 3TNFA 3E15A 4G3XA 5I5EA 5IHPA 4B6EA 4ZMBA 1EESA 3QIVA 1KXZA 2Q7DA 1BWQA 3IEUA 1CEYA 3PEYA 1N4AA 1MQSA 3I30X 3C43A 3UAOA 5KVQA 1PWHA 2BFCA 2XTNA 5I7VA 5HPYB 1H2HA 3NCHA 3LBAA 3VR2D 5EMLA 4B2LA 3AM4A 4KQXA 2YWCA 4TLMB 2OXFA 4I8DA 3CNQS 4MEBA 3H99A 5TRTA 5TF0A 3HJHA 4PYJA 3CONA 4HNRA 4XJTA 1EXDA 2DJIA 2X6QA 4NICA 2OHVA 2GN1A 2RK4A 1UEXC 1Y8CA 1FFBA 1YR9A 2MINB 4PV7A 1ZJWA 1TTQB 2XGOA 3AR2A 3DDNA 3NASA 5K6AC 4B44A 5IW8A 3TSWA 5B7QA 2ZRPA 1T3TA 5H3HA 1XEWY 1N7JA 2OZEA 1IU9A 3LWDA 1E5DA 2FUG1 3VPFA 3L1UA 2WHRA 2IIQA 1O5TA 1M1YA 3WXMA 5EINA 2PUJA 3QPUA 3K0KA 1H0KA 4PCAA 3HEAA 1R6TA 4MO9A 4NMLA 2CVPA 4RMIA 1D2CA 5JISA 5FWXB 3EBLA 1CS0A 3FUCA 4F92B 1IDOA 2X9GA 5EPOA 2NXJA 2Y27A 2YNMA 1UMCB 4CEHB 2NV0A 3GU3A 4EJ0A 5IBCA 5K0ZA 2B4KA 5IP5A 2HHJA 3GT0A 4U9UA 3V8MA 2NU6B 3MJCA 3U5ZB 2YYZA 1T8YA 1DQZA 1Q21A 1ZGZA 2AXPA 1UKCA 4LJ4A 4GGMX 1TD1A 3GFPA 4HJRA 4MKRA 4CGYA 3U7FB 3UJ3X 1UPTA 1Q0HA 2WSSA 2DF8A 5I4IA 4KJXA 1PG0A 2IS6A 4GP9A 4DV3B 4NTZA 4ECAA 3RODA 4ERXA 3F7MA 3TSZA 2H92A 4EY4A 4NV3A 3HY4A 3QYAA 5FJIA 5EWJA 1W34A 2L18A 1P1JA 3EIWA 1E98A 4YAWA 3KYCA 2YJZA 2ZSUA 1K1EA 4WCFC 3KKZA 3REOA 1C0EA 3TOXA 2H8KA 3HXLA 1NR7A 1ZA1A 1KZGB 2QR5A 5BYJA 4AMZA 3DE5X 1GRCA 1R66A 2BRUA 1QIGA 2GRUA 4M0KA 1AKRA 5FRDA 3TZQA 1E64A 1TUEA 4HB0A 4C88A 5FL7D 5IRCD 4BBPA 2RHLA 4NE2A 5DTRA 3D1VA 2JGNA 3NPAA 2WHEA 4DT1B 4BV8A 2XIQA 3K96A 1UK7A 1BCRA 1GZ6A 5ICGA 3U3MA 2A1IA 1Z3CA 1F9AA 5H70A 5CDGA 2X9VA 2LW7A 2B4QA 1ADCA 3FWKA 1N6HA 5SZKB 1KVQA 2Q0XA 3AHJA 1J39A 5EIAA 5CURA 3AV3A 5JE8A 4UVHA 2E5LB 1KL7A 3OJLA 2WTMA 4KWEA 5ALXA 3VHLB 3SN6A 4EAQA 5FOXA 4EIWA 2J5RA 5EZSA 1QIEA 3F6RA 5HKKA 4HATA 5IC4A 5CR9A 1PJQA 1IM8A 4KH1A 1DNPA 2BJWA 2X8WA 2YRWA 3AYZB 3F47A 3GEDA 3I34X 4M49A 4ZT4A 3ZHBA 2V5AA 4EB8A 4EQ6B 3V7FA 1Y9DA 4CM3A 2QRPA 4AN4A 4MKGA 3NBFA 4RNDB 3IP9A 5A4AA 4QOJA 1DLIA 1K8YB 1Z35A 2ZR9A 2FQ1A 2QKYA 1DOZA 2C5FA 4OY3A 2AOUA 2WMYA 3TUIC 1OGJA 5DI3B 4JI7B 1SXJD 2JFUA 1B2LA 3R3UA 2X8LA 4G0OA 4DDKA 1FJHA 1Z7WA 2OGSA 2C2MA 4HGNA 4B73A 4YCAA 1DFHA 1E1QD 1Y6RA 4IX1A 1CNFA 3CF2A 4K86A 2JIZD 1FZTA 1BH6A 3MMSA 3UF0A 3L1HA 2BKEA 3ROQA 3WNQA 4MW9A 2NU9A 4LRXA 3GLIE 1K89A 3DTYA 2JGIA 3NHJA 9LDTA 5KHOC 1CJKC 2OBXA 3ILYA 3AR4A 3BULA 1LTHR 1UBSB 3AWDA 4QXRA 1SB8A 1DZ3A 2EL7A 1VLVA 1C7QA 5B37A 1FQKA 4FXPA 3EAGA 2AFHB 2Q6IA 3K3PA 3ZZUA 4YCLA 1JFRA 3K9NA 4IIYA 1VPDA 1X15A 3DGEC 4CF7A 4N5DA 1AUOA 1WD7A 1I5OA 2NZJA 2OMKA 1BTOA 1UPCA 3C98A 3DOUA 1PWZA 3KJEA 3FZQA 1EFDN 3IUBA 1ZX1A 4URZR 2IEZA 2DTEA 4GQAA 3RH0A 1J33A 3SBDA 1BHQ1 4OD0A 4ED9A 5JI2E 1JHZA 4EENA 4ZI7A 2VJOA 4WLOA 3EVNA 3ZHRA 5UKDA 2ZQZA 1TO2E 2DPHA 2Y76A 3CW8X 4Q3NA 5AJYA 4I3HA 2X8JA 3Q8XB 1KR2A 1U6JA 4CR8A 3H87A 4EHBA 2ODBA 2RGDA 1DGQA 2FEPA 3AEXA 3VKHA 2NVUB 4M88A 4R31A 4UUQA 4YCSA 1QKJA 2DM6A 3R6DA 3KT3A 1LDEA 1GYPA 2ZJ4A 4D3YA 1YNOA 1RAHA 4WGFA 4W63A 3A06A 2XUHA 4JLSA 1NLZA 2Q8PA 1JQDA 2ASEA 3LDUA 1C1DB 3L6RA 3GQVA 2AQHA 3CN7A 2QN8A 4CODB 3EPKA 3UCEA 1NVKA 1PJ4A 4K6FA 4ROTA 1PCXA 3Q12A 2UXDB 1M2OA 1FQWA 1XAIA 5BRJA 3PKZA 1IAQA 2XLCA 4ZRDA 1G41A 1QVWA 2AQKA 2JI9A 2W6MA 3OIDA 1V71A 3W2TA 5G4LA 4K46A 4B3XA 5FWDA 4WJZA 1E79A 2ZJAA 1R8XA 2HSDA 3R3VA 4Q3DA 3ZZ0A 3JQ8A 2WM9B 4F5YA 5CUQA 3QPWA 5TY0A 3ELUA 4E2YA 3AETA 4J0CA 3VHXB 3NEYA 4BLOA 1ADBA 3UA4A 1FVXA 1QF9A 3EGEA 3O1JC 4PZAA 1P31A 1QK3A 3BF8A 3O4VA 2P9BA 4A7PA 2XZPA 1XJ5A 1EE1A 2D13A 3GHYA 4M9CA 3JV7A 2BSQA 1X86B 10MHA 5FLEX 4JI3B 3MB5A 1LK5A 1Y7TA 3JQCA 5AOCA 3LWNA 3ZU3A 2RJNA 2VKTA 3QYPA 1UWKA 1M1NA 3COYA 3QV1A 1E3IA 1FLAA 1LB1B 1SRRA 2ZJZA 2Q45A 5GY7A 4PAGA 1YTUA 3BWMA 2ZREA 4X9XA 4QOFA 1QYWA 1EJ2A 4JVOA 4R8LA 3HVHA 3EJ6A 1KZ9A 4AK9A 2GD1O 3E5MA 1LQUA 3TEJA 3EW9A 4ROSA 3I72A 4U7DA 2XEXA 5KTOA 4WASA 3EZXA 5ITZB 1G21E 1TK3A 2FCRA 2XI4A 3OPXA 2WKWA 1W8IA 2VH1A 2Z95A 4O2RA 1XK7A 2GB4A 1AKTA 3WKCA 3CF4A 3TR5A 4IOLA 3IDSA 121PA 1X92A 4MIEA 4U2FA 3RI3A 2ZE7A 1TJ3A 1Z5OA 2FSVC 3QITA 1PNVA 2Q3CA 5IUNC 4F6LA 2IHZA 4B1FA 1ZMTA 3LL7A 1B0UA 3T34A 2V7QD 1J1ZA 3FHJA 5EKTA 1QHHB 1RNLA 5LFAA 4J7CA 1FJ2A 1D5CA 3GEGA 2EW2A 3GUUA 1WMEA 3IAEA 4GPTA 1CIJA 4MRMB 4OB7A 4C4YA 4UTRA 2ORWA 4NFSA 4TSFD 4FDLA 3PUKA 4GWLA 5JLAA 9GPBA 3VR4D 4Z7QB 2VDUE 4QUHA 1KQNA 5LQUA 1IXRC 4KSCA 4I2NA 1JL3A 1UXJA 2WMNB 4MYTA 1D1QA 4N8DA 5L40A 1WCWA 1QU3A 2NVBA 1BD4A 5B2EA 3DBRB 3WLAA 3OMWA 1B41A 3B6JA 1D09A 1ZPDA 4MJLA 3W3ZB 1U0BB 5I45A 3MYRA 2WU1A 3ISTA 5ECWA 3E18A 4KGXA 1R5OA 3FPKA 4D92A 4R6WA 3OX1A 1KS2A 4U0KA 1ZK1A 4O2AB 4OYYA 5GVRA 3V46A 3RYCA 1VA4A 1SD1A 2FW0A 2UVPB 3MHPA 1JSXA 3OEYA 4G0UA 5KSWB 4AZ3A 1AKNA 2WQZA 1D2AA 1JDTA 3LYUA 1I94B 1CRQA 1U1EA 1Y5MA 5FPTA 5DLEA 8LDHA 1CB7A 4PLVA 3DV9A 2XMZA 3F7TA 3DKIA 3H5VA 3DOIA 5F1YA 5B6PA 1ODKA 2XX3A 2QY9A 4C05A 1WY7A 3S6JA 4DDUA 4YMGA 3GFVA 1F1JA 1N8KA 1P29A 2RHBA 2ZE5A 3H9GA 3UWOA 3VPDA 2G4VA 3OX4A 1OLSB 1KMNA 4LW8A 3TZBA 5J4YA 2NQ2C 1GPJA 1A5SB 5FI5A 1WMDA 1Z68A 5LQAA 1R4AA 1UK9A 3VDNB 1JVSA 5AHKA 5KTPA 1EMDA 2UVQA 2HWKA 2B4RO 2V9PA 3JW8A 5FP0A 1OI2A 2FKNA 3HTXA 3VVMA 1U3FA 3RPEA 1TYEB 1VE9A 2HJVA 1T43A 3LT0A 4JHLA 3FNGA 4Y6QA 1QWSA 4AU1A 4X92A 2QU7A 4JB8A 3F6PA 1DAOA 1IXZA 4BKPA 3T4UA 3GLGB 5LZ8A 3MUNA 2VXOA 4FYPA 4U0JA 1G7CA 5FBRB 1Q17A 3OIYA 5T41A 1SCDA 1RRPA 3ENNA 2C2GA 5E1DA 1R0LA 2JCVA 2GBIA 1ESMA 3QUTA 1FMCA 1SCKA 2FWMX 2J07A 2O8NA 1QGDA 3CN9A 3HWX1 3IEKA 4CTMA 4G5GA 3KXLA 1HNZB 4Z4IA 3GGCA 4KXVA 5E2BA 2WU4A 5KPJA 1IHUA 2NW6A 4B8WA 3L18A 3I9V6 3OETA 2VUUA 3HB0A 2AMVA 5GOZA 5DNEA 5BSVA 5A3QA 3UQYS 4AYWA 3PUWA 5KQLA 2V7WA 1HKUA 4HHEA 3RDPA 3O31A 4B75A 4YNBA 1DJLA 2IYUA 3ZXYA 2CJPA 5J43A 2V6FA 4BFWA 1M10A 4QYXA 1CQWA 3H1FA 1K7EB 4XASA 1TF2A 5LYYA 3TSAA 4CEIB 3JARB 4TWZA 5FR2A 3L8GA 2BMDA 3NVAA 3P0FA 3RS3A 5B1IA 3UC5A 4B6PA 1WHSA 5DHRA 4S0XA 4YLGA 3A1SA 4YRNA 5DU2A 4JXZA 1H2FA 1F38A 2EP7A 2ORVA 2V5UA 3DZDA 2FK7A 1F60A 1UBCA 1YBHA 3FROA 3KVYA 5DRYA 5GV8A 3RBVA 1B2RA 3A4MA 3AF2A 4FHEA 3ZX5A 4F2WA 3EISA 3MWGA 2CJFA 5HBGA 3Q8MA 1ZIXA 4CFYA 5KQGA 4OAQA 4CV1A 1O95D 4GLOA 4XFDA 4YDHB 3WIVA 4G9GA 2AUTA 3LTEA 2OR3A 1E4EA 4Q9DA 2QYO