1ZK2A

Orthorhombic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of R-specific alcohol dehydrogenase from Lactobacillus brevis provide the structural bases of its substrate and cosubstrate specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
molecule keywords R-specific alcohol dehydrogenase
total genus 98
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk2A00
2I99A 3GVPA 2Q2QA 4DUPA 1R4MB 2OO5A 1LSOA 3C7AA 1BWSA 5K6AC 2RCYA 1D4FA 3H2ZA 1YOVA 2XF8A 3K31A 2O3SA 3ENNA 3QSGA 3QWFA 1YB1A 2BD0A 4NNJA 2YQ4A 4NZ9A 1I3LA 4RCVA 2J8ZA 4A73A 1DLJA 1ONOA 3BYZA 4PLCA 7ADHA 9LDTA 3L6DA 3LF2A 4ND4A 3WXBA 1J49A 3P19A 5T8KC 4CLOB 5KVVA 1QLHA 4PLZA 4AJHA 2EF1A 3AOEC 3NDJA 3SBOA 2YV1A 4GMGA 4Z9YA 1Z45A 3QWAA 3OMLA 4OSOA 1KC3A 1W8DA 2Y66A 4PLTA 4WJZA 1LDEA 2ZB3A 4DYDA 1D7OA 4EYEA 2FN7A 1QG6A 3QA9A 4R54A 4W6ZA 2PD3A 1HLDA 3BMNA 5L4LA 2IODA 3ROMA 3RBZA 4EBFA 4J2HA 1C0IA 4BS9A 1DLIA 3OEYA 1EE9A 5JSFA 3JSAA 4E5NA 1EZ4A 4J1QA 3NYWA 3COSA 3UGKA 4RGBA 3GN2A 1X1EA 3DZIA 4DYVA 3B1KA 3V2UA 5KVCA 4YT5A 5JFOA 1GYQA 3UVEA 2WWRA 2JCYA 3ANNA 3Q6IA 3QVSA 1HDZA 3N7UA 3LYLA 1PZGA 3ADPA 5DDIP 2A35A 3B6ZA 4EI2A 4HV4A 2LDXA 1K6IA 4AVYA 3LLSA 4HFJA 4U6QA 3MJEA 3WTBA 4TRJA 4CMEA 1BDBA 4B8ZA 4BNLA 4AJOA 1YE3A 1IZ9A 3ASUA 5IFLA 3DZHA 4XD2A 2EGGA 4MINA 3AK4A 4PLWA 4QO7A 5IJZA 3RBVA 3DB2A 2DPHA 3RKRA 1LDMA 4WPGA 2PTGA 2TMGA 3ULKA 3OECA 3VH4A 3F4BA 4GX0A 4JGBA 1ML3A 3HNPA 1FDSA 4AJ4A 4F46A 5AXBA 3V1TC 3QWHA 1GZ6A 4WCFC 1VSVA 1E6EA 3NDIA 1HETA 4OAQA 2PK3A 4L74A 5KNLA 3ZWWA 1Y5MA 4CODB 1FF9A 4LK3A 4CUZA 1VL8A 4Z9XA 3RFTA 4IMRA 4MO2A 4RPGA 1P3DA 2Y05A 1BW9B 3AI3A 3ZWMA 3FBTA 5L7WA 2H1SA 5TRTA 3WYCA 3QQPA 2SCUA 3U4CA 5I9NA 1LEHA 1VLLA 1PJCA 3JQFC 4RV9A 3ZWNA 1ZK3A 1O95A 3BHJA 1UZLA 1YJ8A 4RF4A 4K9DA 4BQRA 2OXIA 4FCCA 5JO9A 2P4QA 5F1PA 3TJRA 3GF4A 2X0JA 2Q1TA 3VPGA 4Y6SA 5DCWA 3GN1A 4E6PA 1IY8A 3ZW9A 3L9XA 4L0QA 1IOLA 4BVAA 3GVXA 3Q2IA 4I5FA 1BXKA 4J7XA 3AY3A 1ISIA 5L51A 4P4GA 4RO0A 1CDOA 5H82A 1V35A 1FDUA 1R66A 2RIRA 4LCEA 4PLVA 4ZQHA 5F3RA 8ADHA 1GUFA 4PG6A 4HNGA 2VRCD 3NEPX 2EKLA 2YDYA 1U2GA 3KSDO 3JD1A 3NV9A 1TT5B 1PQPA 1ZKMA 3O8QB 1GU7A 3AY6A 3RUAA 3GQVA 1E1KA 5CG2A 2F1KA 2EIHA 4NDNE 4U5QA 2O4CA 4I9HA 1NPDA 2JFFA 2V6FA 1RM3A 4D44A 1YL5A 3H6KA 4J0FA 1E1NA 2C5AA 2C07A 2GZ1A 2UVDA 3C24A 1KEWA 1UDAA 1WVGA 3FTNA 4JBHA 2XOXA 1DBVO 2AW5A 4N5LA 3ETEA 3NTOA 1GY8A 3FBGA 3C8MA 1O5IA 2IXAA 4MPDA 1IULA 1QV6A 2QX7A 4RVSA 5CEEA 1SB8A 2GN9A 2JFHA 2Z5LA 5JY1A 3KSZO 3BA1A 1NAHA 4JLWA 3LSYA 1I30A 3SJUA 5IZ4A 2HJRA 4D42A 1UXIA 1ZFNA 4MVJD 4CMCA 5L53A 3I9LA 4OXKA 4E2ZA 4R69A 1N1GA 1KVUA 5CPBA 3TQHA 1XYGA 1R6DA 2OHXA 4RLSA 3TL2A 3VZSA 1B0AA 2I66A 1GD1O 3DOJA 2Q50A 4GAEA 3INTA 4TZTA 1S6YA 3H3JA 4ALMA 1B2LA 1E3EA 3F5QA 1LNQA 4GVLA 1P44A 2J6IA 1ZJYA 4K28A 4J2OA 4FN4A 3EVTA 4UVEA 1LLCA 4TZKA 5BNTA 5A9SB 3NJ8A 1WPQA 3RFXA 1LBEA 3KYCB 4GBJA 4CM4A 4R5HA 1Q1NA 3AOGA 4R9RA 4PZEA 3AU8A 4ALIA 3PWKA 6LDHA 1E1LA 1HDGO 3DC2A 2X22A 3GT0A 3TFQA 3TF5A 1PJ3A 4CM1A 4WEOA 1Y8RB 2A9FA 2D3TA 4B7XA 3FNGA 3TNLA 3JQAD 3QP9A 3DQPA 1EQUA 4YCAA 4BO7A 1E5LA 1SB9A 2Y1FA 1H9AA 5TIIA 1YO6A 5DN9A 4UVGA 4OHUA 1I01A 5IDXA 5C7IO 3GGPA 2OP1A 3UCXA 2CDCA 5F5LA 2ZJ1A 4BGUA 3DBHB 1PL8A 1CWUA 1V0JA 3U3XA 1Q7GA 4WUVA 3OBBA 3ZHXA 3V2HA 1AXGA 3WQQA 3CXRA 4GI2A 4BMNA 2IE0A 4AJ2A 1A7AA 2NWQA 4Q3BA 3ROPA 3VTFA 3N58A 4CMIB 3RD5A 4DQVA 3OM9A 1LLDA 1O6ZA 3O38A 4A5OA 4D3FA 1E0DA 4PG5A 4CL3A 4FFPA 1H6CA 2AQ8A 5JCJD 3CMCO 3BHMA 1P45A 1MB4A 3QW2A 4MVJE 4RQTA 4IMPA 3R0IA 3I4FA 5BT9A 4DGSA 2Q45A 3TWOA 2UDPA 3KYCA 4ZD6A 4DC0A 1M76A 4PRLA 3PHHA 4IDCA 4JROA 5FEUA 5JPIA 1I2BA 1P33A 1DIRA 5G0VA 4WCDA 3ZW8A 1XU9A 3WB9A 1OC2A 4PG4A 3W6ZA 3G3EA 3DZGA 1JTVA 1CERA 4RVHA 2C54A 4R41A 5KTKA 1ZO8A 3BMQA 4RVUA 2YHIB 1XLTA 4QECA 4BKUA 3ONDA 2PKQO 1PWZA 1LSJA 4KUGA 1B7GO 1YBMA 3K9QO 4CM4B 1Q7BA 5IZCA 1YL7A 1DAOA 3O8QA 4FFOA 5JCXA 1PS8A 2BI8A 5FYDA 2P5YA 1DB3A 1GTMA 5AQ1A 3UICA 2OOSA 1DO8A 5DZSA 2X9GA 3HWRA 1SEVA 2P91A 3NJ4A 5L45A 3U4DA 4E30A 5IDWA 3ZV5A 5L4NA 3B20A 4D41A 5A5FA 5CDSA 4R01A 5J23A 3EMKA 4E5KA 2B83A 3HZZA 3TOXA 3WLEA 4GSKA 4N5NA 3GVHA 1QLJA 1PZEA 1U8FO 1Z73A 2HK7A 4IZIA 4LMPA 5A5EA 1PJTA 3LT0A 3B70A 2VNSA 4XA8A 3BMCB 4YAJA 4R16A 3WMWA 1GQYA 2AHRA 1J6UA 2HJSA 2OL4A 2JL1A 1P0FA 4IM7A 4MKXA 4U0JA 4IDDA 3U4HA 2FZWA 3PTZA 1OAAA 1R0SA 1UH5A 4FGWA 2AQIA 4BKRA 3DZFA 3DAPA 1GQ2A 1D1SA 4TKLA 2G82A 3CTMA 4CMEC 4DQXA 4ALKA 2ET6A 4IJVA 5JDIA 3JQAB 4MJLA 4WK6A 1PJQA 1OZAA 1K5HA 3D4PA 4UUNA 2VWGA 4HBGA 4FR5A 2O2SA 4IS3A 2PD4A 2EJWA 4KDEA 3DOCA 1BXGA 3AUTA 3FNHA 4YQYA 4BNKA 3DZKA 1EK5A 2VRBA 4FFMA 1UR5A 4ID9A 4DL9A 3CKYA 3KLPX 1NXQA 1BVRA 5DULA 1EE2A 1UZNA 1JLLA 3DR3A 4GPD1 4HUJA 3PZRA 1RM0A 2PFGA 5IN5A 4DIBA 1Z74A 4HY3A 2QZZA 1GAEO 4GGOA 1ADBA 1VKOA 1I8TA 1E7WA 2O7QA 4J4TA 2AA3A 4H16A 4R1NA 4PRKA 5T57A 3WTCA 3KB6A 2PGJA 1WP4A 2QW8A 2GRAA 1GEEA 1SNYA 4B4WA 4QEDA 4XYGA 1LSSA 2B37A 2DC1A 5DCYA 3QV1A 4B4VA 1YVEI 1E7MA 1E1MA 2D8AA 1VSUA 3Q3CA 1U3UA 5ER6A 2EXXA 4R1TA 4HFMA 3Q9UA 2NQTA 2VHYA 4JXKA 4KUEA 4M55A 4RJTA 5TT0A 3GGOA 2C2YA 1DC3A 4BNGA 3AM5A 3F47A 2QIOA 1KC1A 4IQ8A 4FS3A 3EYWA 3GRPA 1XDWA 5K6AA 4DLBA 1LDGA 3NGXA 5G4LA 2X5JO 1WDLA 2VWPA 3DTYA 4JBGA 1BW9A 1DJQA 1WAMA 1ISMA 2AEJA 3NT4A 3SC4A 1NFRA 1DC4A 4BGEA 3VDQA 4BQPA 3HN7A 5BNIA 4D7AA 5L95A 2D5AA 4XJTA 4BIIA 3DAGA 4ZICA 1GV0A 4OM8A 3AOEA 5KIAA 1JWAB 3OJFA 5JMPA 5GZ1A 4U6SA 4MDHA 2E37A 2C29D 5COQA 3TRIA 1HTBA 1MFZA 1YQGA 3D0OA 2NU9A 3RUFA 3E9MA 4IDGA 4CM8B 3VPXA 5JAIA 4XDZA 2D1YA 4ND2A 2R00A 2BRUA 1ISHA 1FXSA 3EDMA 4F6LA 1U8XX 2J5KA 1ZUD1 3IUSA 4BO4A 4NBWA 4M89A 4IIVA 2VYVD 1EUCA 1G0OA 3GZNA 5ENVA 5AXDA 1UP6A 1PZFA 1GV1A 1GL3A 1HF3A 4H3VA 4HNHA 2HMUA 4P8RA 3X2FA 5EMHA 4WNIA 4DRYA 2POQX 1H9BA 4TVOA 5CPFA 4CQLB 5HS4A 3R1IA 4RPKA 1ADGA 3B1JA 4CLXA 3WGZA 2X0IA 4WE3A 5TGDA 2CVZA 1R4NA 3DHEA 4FW8A 2C7GA 4WASA 1YBVA 1N92A 3ZV3A 1K6XA 3L4BC 3WICA 2GPTA 1UZMA 3DZJA 2AE1A 1XEAA 2DKNA 4P4LA 4DXHA 3QRWA 1WNTA 3BZUA 4CR8A 4TQGA 4EUFA 5A4DA 4R1UA 3OIGA 1PJ4A 3DMYA 2W2LD 3Q1LA 4Z0TA 1Y9EA 3JQ8B 4K1LA 1E6WA 1XU7A 5THQA 2W8ZA 1KYQA 4O6VA 1DRUA 5ER9A 4CPDA 4BV9A 1NPTO 3GNQA 3DFUA 1EBUA 2BFPA 2WE7A 1NP3A 3GMDA 3H8VA 4UVDA 2E82A 3H4VA 3F6YA 1DHTA 1HYHA 3IDSA 5KVQA 5A04A 1P1FA 2BF7A 3GNSA 2YYYA 4DLLA 4BMSA 1I3MA 3OP4A 1X15A 1YWGO 3MOGA 4HP8A 4UEJA 4FFRA 3OIDA 4TRRA 3WG9A 1AN9A 5G2OA 2BGMA 4FOSA 3WNVA 3IC5A 3UW3A 3FNFA 4Z6KA 4WEQA 2HQ1A 4OXNA 4G2NA 3JQDA 1ISFA 2E6UX 3WLFA 4EJ0A 5LDHA 3DHNA 2NQ8A 1J4AA 1BVUA 4NBUA 5FF9A 1YL6A 1T4BA 5JYDA 2EW8A 3GVIA 2WE8A 2WD8A 2FR0A 3CZRA 4LMRA 2DQ4A 3AM3A 1CYDA 2CVOA 2X5KO 4EGFA 2BLLA 5CDYA 4Y6PA 4EEZA 1PQUA 3TDKA 2CNBA 1F12A 3PHLA 4Q3DA 2HCTA 2PH3A 5GMOA 3WWZA 2P2SA 2FHSA 2O3UA 2O4UX 5IG2A 4AJEA 3ZWAA 3PHIA 3HADA 4CQLA 4B3JA 3GG9A 1C14A 1R15A 3GMSA 1CF2O 4UVIA 3TSCA 3CUKA 4ZHSA 3ICCA 4PZDA 1L7EA 1BHSA 1Y9AA 2AQHA 4NU6A 5TQVA 3RROA 1PSDA 4A2CA 4E2WA 1ZVMA 1XIVA 1O9BA 3BMOA 1EVYA 3FCOA 1N7HA 3PLRA 2JCXA 3EZLA 2EERA 1W6UA 3WGTA 5LC1A 1KEVA 3PQEA 3S2EA 2Q4EA 4WNCA 3I5MA 5AXCA 1CIVA 1XCBA 3NTQA 4S3MA 3T7EA 2OFPA 3GUYA 3WS7A 1MC4A 3RUCA 3CSDA 5HBRA 5TJHA 2P68A 1JN0A 2Q4BA 2PD6A 3ITKA 4PVDA 3EHEA 3VAZA 1PTJA 4BB6A 1LX6A 3GRKA 3JV7A 4XQCA 1JW9B 1VRWA 1TVEA 4KDFA 4PIVA 1Q0HA 5DBGA 4ZQGA 3PRJA 5I7SA 3L0DA 4QO8A 1T25A 3AFMA 2NTNA 4XJSA 2CF6A 4PLYA 1QYDA 5F1OA 1HYEA 1W4ZA 2A92A 1R4MA 1Z75A 1IUKA 3B1FA 3WJAA 4YAGA 1I3KA 4RZIA 1XWFA 1XKQA 2V7PA 3RJ9A 4S1VA 3JD4A 2C82A 4NH4A 4CM8A 4E32A 4URFA 5A06A 4M54A 2ILTA 1IYZA 3VTZA 4RPHA 5T6BA 1ZK4A 3I9KA 2VZ0A 1C1DA 5EERA 1JVSA 4AJPA 1X0VA 1OMOA 1PJBA 3CH6A 5DOZA 2FPIA 1RKXA 2DFDA 4XYMA 1SCUA 3ORFA 1J0XO 3FWZA 4G81A 4CM9A 1HE5A 2JAHA 4IUYA 1P9LA 3LU1A 5HS6A 2FWMX 4OMUA 3AI1A 4RDIA 5HRUA 2HMVA 3RC7A 3WNQA 4YA6A 4AJLA 3L6OO 1KIFA 1VL0A 3NUGA 4YDRA 2VZ8A 4LVUA 4FD3A 1E5QA 1SMKA 1OFGA 3WFJA 1ONNA 3A06A 1HDXA 1CQIA 1HE4A 2DAPA 1Q0QA 3PIDA 2PH5A 4MVJF 4A26A 3HG7A 5I7VA 4XGIA 1I36A 2EGHA 2V6BA 4IDEA 3L77A 4IXWA 4CQMA 3BTUA 2EWMA 2O3RA 1T4DA 3PJDA 4UUMA 2HRZA 2PA3A 5IDYA 3L9WA 2WD7B 2ZTVA 3DBRA 3I4CA 2DUWA 2WM3A 4RQUA 3QE3A 3S55A 2YW9A 3QVTA 4DBVO 3K2EA 4DVJA 1C0LA 2HAEA 4BNMA 3LT2A 2ZJ0A 1VKNA 1X7HA 3E18A 1ZH8A 3TZKA 4RLHA 5KWEA 2QQ5A 3C7DB 4IIUA 1CETA 2GN8A 3WMXA 1V3VA 1BSVA 1DPGA 3RUDA 2FSVA 2FPGA 4HKTA 3SEFA 4ZRMA 3HDQA 1ZZEA 4XYBA 2X86A 3JYQA 3AY7A 3TPCA 5HWSA 1H6BA 5I9LA 2NU7A 3W6UA 4CLOA 2GN6A 2VUTA 1A71A 1RPNA 1M75A 3LC2O 3M1LA 2OBNA 2AE2A 4YT2A 1H6DA 1KVRA 1M67A 2DT5A 4N18A 1LTHR 3LT1A 2ZK7A 3IUPA 3QY9A 2YV2A 1B15A 3C85A 3GC6A 2NVWA 1VM6A 4BNXA 3GZ4A 3IJRA 5C7LO 5CEFA 1WW8A 1Y7TA 2NADA 3TFOA 2GF2A 3VZQA 1NBOA 5A05A 4CR7A 3H7AA 3WSVA 2YY7A 1HDOA 2JHFA 3W4KA 2CUKA 3IKVA 3WYBA 1HE3A 3Q9NA 1GCOA 1R12A 3INRA 1BDMA 4PVCA 4ZN6A 5KVSA 1A9YA 3K96A 3PJGA 4IQ0A 1JU9A 3ETGA 3T4EA 5BR7A 5G0WA 2OMEA 1NQAO 2WMDA 3FNEA 4Q3CA 4YXFA 1EDZA 2YHUA 4ZGWA 2YDXA 4I5DA 4FJ2A 2W90A 1IL0A 2H9IA 5JAZA 2RBEA 1MX3A 1R37A 3OJ0A 4R3NA 3D64A 4IY1A 4CMIA 4IQGA 2EKPA 2B4RO 3UCEA 4GSLA 4RF5A 2BFMA 2WEKA 3ONEA 3UHAA 2QG4A 3D3WB 4I9NA 4QFDA 4QTZA 2WYUA 4RVDA 1EUZA 1I2ZA 4J91A 3U62A 4NBTA 2W2LA 2VYNA 1DRWA 5HTOA 4UEKA 4YJFB 2BH9A 2O3QA 4E33A 1CEQA 2O7SA 1F8FA 4WLOA 5EQDA 5CG1A 5JCJA 2Q99A 4DIOA 4UREA 3EVNA 2H63A 2VOEA 4PLGA 2P4HX 3H2SA 5U9CA 3FI9A 3JQAA 3JQBA 1NHGA 1KY4A 1LQTA 1NR1A 3EY4A 3GNTA 3F1LA 4JJFA 4R4JA 3VKUA 5EINA 3JQ9C 4W4TA 3GOHA 3FPCA 3H5RA 3IS3A 1Q0LA 4N54A 4PN3A 3UH1A 8LDHA 3GR6A 5BQFA 2ZQYA 1QSGA 1NQ5A 4QFCA 2PV7A 1HDRA 1YDEA 5A9TA 3GEMA 1FJHA 1T2FA 1LXCA 1KEPA 1ZBQA 3E03A 2B0JA 4FJ0A 1UUFA 1U7HA 4B4OA 4PCVA 1UAGA 4GKVA 1MG5A 1U2DA 2X8LA 2DBQA 1GUYA 1EFLA 3U4IA 5GZ6A 1SZJG 5F1KA 4BNUA 3LT4A 2CDBA 2Y0CA 4YJDA 2IEDA 3P2OA 4E5MA 2JKVA 1YS4A 3MTGA 1H2BA 4RPLA 3ST7A 3M2PA 4TROA 2GYYA 4J49A 3DAFA 2BFAA 3PJFA 5ILGA 4L75A 4Q3EA 2EV9A 1ENYA 3VPFA 1VE9A 4EITA 9LDBA 2NLOA 2ZIZA 4FDAA 5I8WA 2P5UA 4WLFA 4L73A 4HX5A 4BKQA 4YJHA 4XIJA 5CDGA 5COBA 1N5DA 2B36A 3SLGA 1TT7A 2YHIA 4F3YA 3PK0A 1U28A 2QYTA 3KOUA 2CZCA 4OKIA 4ILKA 1CQJA 3OICA 4PLFA 4AJ1A 1N9GB 5JE8A 2VZ9A 4IZHA 2IZ0A 3RU9A 1VJ0A 4BNWA 3V1UA 2ZB8A 2NVUA 2Y67A 3K73O 4J1SA 2AG8A 4NR0A 4RVGA 5H81A 3OA0A 1NWHA 7MDHA 1EDOA 1BTOA 4HXYA 5K9ZA 2ZCVA 5JMWA 2C59A 3PP8A 3WBFA 3JD3A 4AICA 4BNHA 4NU5A 3V2GA 1HSZA 3ZHZA 4GVXA 5C3MA 4E5YA 5CEJA 3U09A 2AG5A 5EIOA 3DOOA 1ORRA 1YGYA 1LLQA 3GDGA 4RORA 1KY5A 1OC4A 2DBVO 1PGJA 4NBRA 4B7UA 1NQTA 2GSDA 3GPDG 2YUTA 5FWNA 3JQGB 4CLHA 4EUEA 5BSHA 4JN6B 4B8WA 3ZNQA 4E4YA 2YFQA 4B3IA 1HRDA 4R3WA 4XQGA 3FD8A 3GPIA 1DC6A 3EC7A 3R6DA 3DHYA 3WYEA 4LVCA 3PDUA 5CHEA 1VC2A 2X7HA 2DBZA 1A4UA 2CVQA 2WDZA 4MIYA 2V65A 2E48A 3TL3A 2HDHA 1DFIA 1XGKA 1J5PA 4CMJA 4J6FA 1DIHA 1M6WA 2GN4A 4BNZA 1G6KA 3I9JA 4L9RA 4M87A 1N9GA 1D8AA 5A9RA 4ZA2A 5FI3A 4DPKA 2OZPA 4MKRA 3TZ6A 1LDBA 4ONEA 1NAIA 1QRRA 1H93A 5A3JA 4XZ3A 3MJCA 2H6EA 2EKQA 3DMTC 4Z3DA 2D59A 2W2KB 5IAAA 3AWDA 2VWQA 2GERA 1MLDA 1NFQA 4I5EA 1M6HA 3TZHA 1PGNA 1MP0A 4OQYA 4DA9A 4RF2A 1B8VA 2JAPA 3IIEA 3OF2A 4E5PA 1BGVA 3D3WA 4ITUA 2HUNA 3GEDA 4R9SA 4DC1A 4DPMA 2RH8A 1YBAA 2VT2A 2X23A 3H65A 2OBYA 2I6TA 1MUUA 1X13A 4B4UA 2ZTMA 4BL5A 1XA0A 5L7YA 5JY6A 1VJTA 3GK3A 3D7LA 4QT0A 4DBZA 1K0UA 4D3SA 4P38A 2DLDA 1Q7CA 3RUIA 2HLPA 3V8BA 1HDCA 1NWCA 1PU2A 1RYDA 2GD1O 5DF1A 5JDCC 2VQ3A 3WQRA 5DNAA 4J7CA 2YJZA 5MGBA 4A7PA 2EW2A 4IDFA 1C1XB 4I1IA 2GGSA 4KQXA 1A7KA 1ADFA 1C3VA 4XYEA 2X4GA 3GVCA 2DBRA 4FSHA 3FF4A 1I32A 3IKTA 3S2IA 4RL6A 1ZSNA 3PYMA 4BO1A 3GG2A 2BKAA 1GDHA 1E6UA 1ZJZA 5EQFA 2GNAA 4LW8A 2HMTA 4WKGA 3VPHA 2HRBA 1KOLA 3UAGA 1FDVA 2RH4A 5T8KA 3ZH2A 4Z9FA 3GHHA 3KYDB 1EUDA 1IHXA 5A3VA 2Y1OA 3JYNA 1T1SA 5GZ3A 2PZMA 3BMQB 3GH3A 1V9LA 2FRDA 2I9PA 3C7CB 1HXHA 2QYSA 5JNLA 5CDUA 3PGJA 3QIVA 5KJFA 2P9EA 2AMFA 1KERA 2JJYA 4U0KA 3DZBA 4XYLA 1E7YA 4A10A 1WLYA 2AXQA 4CM6A 3ETDA 3JD2A 2BELA 1QXSA 4MP6A 5KJCA 3KHUA 3QWIA 4ALLA 3RUEA 2DVMA 2Y0EA 2Z1MA 1UDBA 4XGNA 1DSSG 3W1VA 1LA2A 4DREA 4FPXA 2HK8A 5DCUA 2JCVA 4CV3A 2WTBA 1LC0A 1TB4A 4DIFA 4MVJH 3VHRA 4UAGA 3OIFA 3PI7A 2ZB4A 3RJ5A 2VTEA 4UUOA 4DLAA 1LRKA 1DJNA 1WXDA 1HE2A 2ZB7A 3HDJA 3G0OA 4GH5A 3WOHA 1E3JA 1LRJA 2W4QA 3D5QA 5TNXA 4GX1A 5G4KB 3U5TA 1U4OA 4FJ1A 4AJKA 1E3WA 1AXEA 2IXBA 2PKQP 1EMDA 2R2GA 3GAFA 3E5MA 3HE3A 4G5HA 1PIWA 1DFGA 3WIDA 1AHIA 5U1PA 3OEWA 3VC7A 3OQBA 2ZATA 1NPYA 3UKOA 1Y8QA 1R0KA 1H94A 1T2DA 2WYWA 3EK2A 1GYRA 4NI5A 4KQWA 2W98A 3FWNA 3LF1A 3Q0EA 5C37A 5EPOA 4XQ9A 3MWDB 2XXJA 1JAYA 1XQ6A 4FGSA 1E7RA 1E92A 1U5CA 4J4HA 3SC6A 3SXPA 1AUPA 2Q3EA 4MKZA 1P1KA 4NJMB 2BHLA 4PLHA 5AXAA 4TMFA 5TLSA 1QR6A 1T26A 3GEGA 3ASVA 5KKCA 4BO3A 4R5MA 1MV8A 1F17A 3HQ4O 4Q9NA 3WJ7A 2X0NA 4NK4A 3UXYA 3WWYA 4ALJA 1NR7A 5FI5A 4JQCA 5T67A 3VZPA 3BXXA 4BNJA 1U3TA 2PKRA 5C7OO 2DU8A 3LC7O 5B4VA 3ANMA 3CPSA 1HSOA 1N7GA 3EUWA 4J1TA 1DXYA 1E3SA 3FTPA 2AQKA 4FOOA 4W9NC 2V6GA 2YV3A 5G4KA 1K2WA 2W2KA 3ON5A 1QKIA 4YJGB 4ZJUA 2EP5A 3JYPA 3DL2A 3K92A 4YWJA 3E9NA 2ZQZA 4QX6A 5ITVA 4D46A 2PNFA 1ZXLA 3SLKA 4YJHB 2ZCUA 2VHXA 3W4IA 4CV2A 4CM5A 1K3TA 4RZHA 1YH3A 3UUWA 4CUJA 5JW6A 4JCOA 1VPDA 4BB5A 4EZBA 4F45A 1H5QA 1Z82A 3DWFA 4RVFA 3WSWA 1KETA 2E4AA 2OUIA 2RHRA 2Q2VA 3PEFA 1GUZA 3S2FA 1NM5A 4JP3A 3U9LA 1I2CA 3D1LA 3O26A 3PQDA 3ZWYA 1UP4A 3OJLA 4NK5A 4NMHA 2IEBA 2PR2A 4BGVA 4MVJP 4OSPA 1GQQA 4WCFB 1YJQA 1QORA 5I7EA 3G79A 1VI2A 1G0NA 4PGFA 2P9CA 2A94A 2ZTLA 4LISA 1MC5A 2BGLA 1NTOA 2I3GA 5BSGA 1P77A 2CMDA 5B1YA 5A1TA 3KRTA 5CP8A 3JCZA 3EAGA 4IJUA 2UAGA 1QV7A 3AU9A 4KTVE 3QVWA 4WECA 2RHCA 3NKLA 4WOKA 3QWBA 1TI7A 3S2GA 2Z1NA 1VL6A 1CRWG 1MGOA 4M1QA 3F1KA 3D5TA 5T5QA 4YB8A 4O0LA 4UEOA 1RYEA 1DAPA 2Y68A 3ZHYA 3UN1A 1X14A 4WLEA 3W8FA 3RAJA 2YZ7A 1EK6A 1ENZA 1A5ZA 4H7PA 1IB6A 1LUAA 1DC5A 1PL6A 3DMTA 2HO5A 3VVBA 4XX0A 4UUPA 1B16A 2O50A 1OBFO 2NU8A 5TF4A 4BV8A 4HFRA 4BMVA 3PHJA 5TJ9A 2G5CA 5CFZA 4BHTA 3PLNA 4DTIA 2NU6A 4D45A 4CJXA 3CMMA 3MJSA 1UXKA 4H15A 4XR9A 3KZVA 1B3RA 1GEGA 4EDFA 3RC2A 3C1OA 5DBFA 1Y1PA 5B4UA 2NUAA 4CMAA 4A0SA 2NTJA 3W8DA 2O2YA 5AYVA 3PWSA 3CE6A 4XDYA 1TXGA 2C7VA 4GL4A 5DBIA 3JQ9A 2DFVA 3GA0A 1N2SA 1T2AA 4A03A 4E3ZA 4OOEA 1C0PA 1GCUA 4YYZA 1E3IA 4FFNA 2X9NA 4J9UE 3W8EA 1DIAA 2ZYAA 1KVTA 4XR4A 3HUDA 4KUHA 1Z7EA 3PVZA 4C7KA 3BMNB 2CSUA 1EFKA 5B12A 3HB4X 1ENOA 2IDZA 3NX4A 2P9GA 2BI7A 4NJOA 3VH3A 4J1NA 5MDHA 3AUSA 3S8MA 5ITWA 3WBBA 1LLUA 3DBVO 4GX2A 1H6AA 2G0TA 2WYVA 4I8XA 5DOVA 4UULA 2I5PO 3GDFA 4ZU3A 1MA0A 1B8PA 2O3TA 4ZQEA 5JAMA 4JP2A 1XR3A 4CMBA 1ENPA 3KYDA 5JAQA 1ZW1A 2C20A 4YJFA 2VWHA 2BGKA 3GDOA 3VPSA 4EJ6A 4GWGA 3RWBA 5A9SA 3OETA 2XPCA 2GLXA 1WDKA 3VOSA 2C0CA 1NNUA 5ILOA 3HB5X 1SOWA 3PFWO 1IE3A 4RDHA 5CAEA 4TKMA 1LDYA 1DHRA 1RM5A 2GUGA 2I76A 1U4SA 3BTOA 3LK7A 4XWYA 1E77A 1W73A 5DP2A 4YAIA 3T7CA 4GLOA 1RWBA 3GFBA 2OGUA 3ZWPA 3JQEA 5JDIC 1RM4A 3I9OA 4NBVA 1V6AA 3ZNOA 4BO9A 5L7TA 1F06A 5JBIA 2X0RA 5BSEA 3INGA 4YACA 2GASA 3DXFA 4I9UA 3ZGYA 3ZNPA 4WLUA 3M2TA 2GO1A 4HFNA 4CMGA 2VRCA 3PGXA 4UVHA 1I33A 2J5QA 2FMUA 1PGQA 4YEDA 5U4QA 3L07A 4CUKA 4XIYA 4CLRB 1XSEA 4TRNA 1O89A 1O94A 1KBZA 1UXGA 4QSMA 4Y98A 5EN4A 2XAAA 1PGPA 2EG9A 3EGOA 4P22A 2G17A 5TSDA 4YAEA 2D5CA 4MP8A 3WX0A 1K89A 3FR7A 1C1XA 2EHDA 3ZU2A 5BNFA 3IAHA 1Y81A 4BNYA 4D43A 2Q2WA 3I6IA 1XELA 4Y6RA 4C7JA 4J0EA 3K5PA 3H3FA 5KOIA 3RASA 4BUCA 5JC8A 3BTVA 3S1LA 2NSDA 1O0SA 2X9VA 3OSUA 4IBOA 1C1DB 2PLAA 4FB5A 3ITDA 3A14A 4M49A 3WFIA 2FOIA 4MVJI 2I3AA 3AJRA 2DTDA 1SEPA 2VN8A 3I6QA 3ZNNA 1ZK0A 2YFHA 2FY8A 3L4SO 3I3OA 1EQ2A 5KJEA 1C0KA 2VT3A 3LLVA 3RCBA 3NAQA 1PJLA 1HZZA 2PGDA 1JDJA 1JKJA 3D3EA 4II3A 2GZ2A 4Z0PA 3E9QA 3HFGA 1UP7A 1ZNQO 3GAZA 4BNTA 2X1HA 1I24A 3P5SA 3D4OA 4BOYA 5KJ1A 4GMFA 4U8GA 3LVFO 1B26A 5G0SA 3O03A 2HKIA 4N7RA 4W99A 1B3BA 4OQZA 5DT9A 1MG0A 3G49A 4ND3A 3RI3A 1TA4A 4KP7A 4YRBA 1P1RA 3MWEB 4A27A 5IXYA 4XQEA 1A27A 1H0KA 4J3FA 5JS6A 3CINA 1U9JA 3OJEA 2H5LA 1FMCA 4G65A 1JWBB 2QRJA 3GUCA 3HDYA 3ROKA 4JBIA 2R00C 3U49A 2Y1CA 2Q1WA 5BSFA 2D2IA 2A4KA 4ALNA 4JX8A 3RBXA 4Y67A 1LI4A 5F21A 3WGHA 3BTSA 1V3TA 1YQXA 4U7WA 2NV6A 3I1JA 1AE1A 3JYOA 3CIFA 3K8ZA 2VYND 3DBLA 4OGWA 3M1AA 3ZU4A 1JVBA 2B5VA 4BGIA 1VJ1A 3D4NA 1AHHA 2DTXA 2B4TO 1ZEMA 4W9NA 1GPJA 2NTVA 3C3XA 2CD9A 1NASA 2UV8A 4C4OA 3HJAA 3R3JA 1H2HA 2PWZA 3CEAA 3JD0A 3RUHA 3L4BA 4YR9A 2J3JA 1DOHA 5L9AA 4Y9DA 3PZBA 1T24A 2PGLA 5LCXA 4IINA 1UXHA 2Y99A 3VZRA 2VUSA 5JC1A 1Z7BA 4CV1A 5A02A 2NM0A 3E1KA 4JJGA 4KWHA 5ES3A 4KWIA 4LCJA 4K6FA 3NT5A 4I5GA 3WGQA 4DMMA 3ZN2A 4Z0HO 4M86A 3JYLA 3KEQA 1SBYA 3PQFA 1E7QA 1P74A 5AVOA 1Y8RA 4KZPA 2LDBA 1WZIA 5F5NA 4BKPA 4NFHA 1PJSA 4LGVA 4YJGA 4J9VA 3K2BA 3FHLA 2HMSA 4L76A 2PZJA 5L3ZA 2J3KA 4EUHA 1IPEA 1E3LA 1X7DA 2NACA 3VH2A 1PZHA 5DP1A 3NGLA 1Z6ZA 3L6EA 4NG5A 2GR9A 4O1MA 3MJVA 4NHEA 3LQFA 4BO0A 3KETA 1QYXA 1DFHA 1UXJA 1JQBA 2AEMA 4XEHA 4B7CA 2X58A 2FR1A 2IZZA 3F46A 3KV3O 4XB1A 1U7TA 1A72A 4QXMA 4MP3A 1HDYA 3MOIA 1LQUA 2WSBA 4CMKA 3E5RA 4LSMA 4YRDA 5IZCC 1KS9A 1SAYA 3K30A 2GDZA 4BO8A 1A4IA 3UOGA 2VOJA 1GZ3A 4GX5A 3VDRA 1P1JA 4LN1A 1R0LA 3WQSB 1LC3A 2AEFA 2GZ3A 3P7MA 4BNIA 1QYWA 2DUUA 4FC7A 2VHVA 2VUUA 4PG8A 4OJNA 3KBOA 4CLRA 1IHYA 3DTTA 4PG7A 4E2YA 1ZK2A 2ZYGA 4IGFA 4BNNA 3KTDA 5ICMA 2IRWA 3KSUA 4Y8VA 2JD1A 1HL3A 5THKA 2Q1SA 2JHGA 2Z95A 3ZHBA 3IMFA 3QVXA 1NVGA 1ULSA 3SX2A 1ISGA 1PGOA 3T4XA 4GQAA 3I52A 5KCZA 4CQMB 5ADHA 4W7HA 4IJWA 4X54A 1YB5A 3UCFA 3JTMA 3H9EO 2DTEA 1YONA 5G0TA 5G0UA 1HEUA 2OP0A 3GZNB 1IPFA 4ZQFA 3WGYA 4E31A 2C5EA 4XRRA 2X5OA 2HMWA 2Q49A 3BIOA 4KTTE 4PLPA 3TZQA 4D3DA 1PR9A 1IZ0A 2WJPA 1U1IA 4OH1A 1E3WB 3ZWOA 3K6JA 4NQZA 2VNAA 1XHLA 4GLLA 3OFSA 1W0CA 3JQ6A 3MJ4A 3P2YA 1P31A 1YKFA 3PYLA 1X1TA 5IN4A 4KOAA 1BRMA 2QZ9A 3DONA 4OKNA 1EEHA 4IDAA 1Y6JA 4JNKA 4CQMD 3BMCA 1DEHA 1YRLA 2JD0A 1QYVA 4YT8A 1HYGA 2GCGA 1QYCA 2J3HA 3PFFA 1MXFA 2Q46A 4AFNA 4O5OA 1SC6A 1SOVA 3F5SA 4WCFA 5IDQA 1NQOA 3BMOB 1YB4A 1DRVA 4BKOA 1GYPA 3U0BA 2BMAA 2IYPA 1HLPA 4MVJA 2CF5A 4R51A 5AOVA 1JAXA 3FSRA 4Q3NA 4CM3A 1T2EA 3IJPA 3JQFA 5C5IA 1ZCJA 3IOYA 1LRLA 3AFNA 1V8BA 3PHGA 1ZK1A 1T2CA 2CY0A 2Y93A 3MCVA 3QJ5A 4N5MA 3V1YA 1ISJA 5GY7A 5B37A 1HZJA 3DFZA 1M66A 4LSWA 2UUOA 5JDCA 5HA5A 3H9GA 1BMDA 3F9IA 1KVQA 4NIMA 1L7DA 5LDGA 2HK9A 4EEXA 3QHAA 4E2XA 3G17A 4CLDA 2F00A 4ZRNA 5KKAA 3KUXA 1ADCA 1LDNA 1LU9A 1R16A 3EW7A 3HFSA 1RJWA 3OH8A 2J3IA 3DBHA 3HN2A 4IPTA 3RU7A 4BO5A 3OA2A 4CMHA 1X7GA 4FIZA 4YT4A 4J4BA 1M2WA 1GADO 2X6TA 1KEUA 5I8ZA 1UAYA 4DQUA 1G1AA 4TRMA 3ICPA 3SJ7A 4D0RA 5I7FA 1R4NB 1N1EA 4DMLA 3IP3A 4OO3A 4YAKA 3ZI0A 1P1IA 3IP1A 3AI2A 5TC4A 2PZLA 3EZYA 3I23A 3N74A 4Q39A 4INAA 5ENDA 3OQ6A 4WLVA 1ZMTA 1ZIDA 3H5AA 2D4AA 4ESOA 4XKJA 1TLTA 1TT5A 2Y0DA 4YVFA 1I5RA 1PWXA 3RQSA 4AG3A 1NHWA 1K6JA 3ZWBA 4FFLA 2FP4A 3LDHA 3E82A 4E12A 4FBGA 2VHWA 4IJKA 4OXYA 3UF0A 2NVUB 4OIMA 1AGNA 2E49A 1JKIA 1D1TA 1OOEA 3HSKA 5H83A 3RVDA 1X0XA 2HU2A 4NFSA 3TZCA 5TT1A 4CM9D 4DWVA 1B8UA 4J43A 1EBFA 4J16A 1E7SA 4J90A 1MFPA 4D0SA 1Y5RA 3BHIA 3FN4A 3STHA 1QP8A 5CDTA 1U5AA 2EJVA 4YPOA 4GKBA 2PZKA 1BXGB 2RAFA 1SPXA 3HDHA 5ICSA 2NNLD 5B4TA 3ONFA 1PR3A 1BG6A 2R6JA 5IXSA 5JXWA 1F8GA 1ZXBA 3MEQA 2HSDA 5T64A 1P0CA 4K26A 1LJ8A 3KVOA 2DM6A 4BNVA 1ONPA 3A28A 2CDAA 2VHZA 1ARZA 4W82A 1D3AA 4F6CA 3QLJA 2JFGA 1GPDG 1OI7A 4YRAA 3OQ1A 4AJNA 4E21A 3KEOA 1ID1A 3PXXA 5TS3A 5EL0A 1YXMA 4IDBA 1ZMOA 3C1TA 1NVTA 6ADHA 3O4RA 1U3WA 2BFOA 1UJMA 4MIOA 2FPPA 2O48X 4QQRA 4D79A 4OOFA 3JQ7B 1JKFA 3E8XA 3F3SA 3RSHA 1FK8A 2VCYA 3GHYA 4IS2A 4CLEA 3M6IA 3WGGA 3NTRA 2O3JA 1Q2XA 5HM8A 2Y1GA 1FDTA 3ANLA 4K6CA 3A1NA 3ENKA 1JA9A 2IZ1A 2G76A 3RC9A 3IL2A 4BO6A 2QHXA 4BNFA 3ZV4A 1YDWA 1WWKA 1GR0A 1YOVB 3AUUA 3WDSA 2XXBA 5JLAA 4EJMA 5JO0A 3R3SA 3VKVA 4GGPA 1XG5A 2FZEA 1DIGA 3FPLA 3HHPA 3RC1A 2I67A 1I0ZA 2VTDA 3CZMA 4JK3A 4B3HA 5L4SA 3I9MA 1DIBA 3OJOA 1ZSYA 3MZ0A 4II2A 4WOJA 5EESA 3ABIA 3ROQA 4CV0A 3DBRB 3C1AA 3PIIA 3Q2KA 2ZTUA 3DBLB 4B79A 1BXZA 3QVOA 4EW6A 3E6AA 3NT2A 4QUKA 4RF3A 3JQCA 1NX6A 3I9NA 1A9ZA 3ZWCA 4NFYA 1UDCA 4ROSA 3RKUA 3WGOA 2J5RA 1Y8QB 1ZEJA 4TWRA 3A9WA 4OL9A 1WDMA 2V6MA 1NVMB 3GY0A 4MVJM 3DEYX 3PDJA 4TVBA 3GGGA 4MOWA 3GFGA 3VH1A 2Y1DA 3A4VA 2EEZA 5TX7A 1P1HA 4L4SA 4XRGA 4AJJA 4W7IA 1DDOA 3V5NA 1LSUA 3ZZNA 2YQ5A 3JQBC 3PJEA 4JIGA 5COAA 2UYYA 3ZCXA 3ZU3A 3AW9A 1XQ1A 1F14A 4RPJA 4FC6A 1PEDA 5IF3A 4J7UA 4I08A 3W4JA 4WGGA 1EVIA 3DDNA 1PS0A 4HWKA 3F4LA 3LC1O 1U3VA 1PS9A 3KLMX 4JJIA 4DPLA 5JYEA 1HT0A 2DPGA 5L40A 1MXHA 1PQWA 4O59O 1HWYA 1L1FA 1QMGA 3H9UA 3I83A 3G1TA 4XB2A 4YBZA 1F0YA 4CL8A 1PJ2A 4YTEA 3PPIA 2JD2A 4PFJA 1PL7A 1I10A 2WD7A 3AUAA 4GWKA 2B69A 2B5WA 1FDWA 1T1RA 4TSKA 3ZDFA 4R1SA 4NPCA 4E13A 4Z3KA 3KXDA 3X2EA 2C2XA 3BAZA 3WGIA 3KYBA 2PY6A 2CFCA 5I9MA 5EJ2A 4L8VA 3FRJA 1GFSA 1NYTA 4LRTB 1KVSA 3Q11A 2O23A 3LZ6A 4M8SA 2VYVA 4BO2A 3TN7A 1N8KA 3WIEA 3AM4A 3VVCA 1HKUA 1YQDA 3FR8A 4P4NA 5KJ6A 2FR8A 4IGEA 3O9ZA 4FQ8A 4R68A 3H9QA 4XCVA 3MTJA 3NDRA 1GZ4A 3WR5A 3ZU5A 2B4QA 4ND5A 1ZSVA 4KMSA 4PZCA 4XGKA 3MJTA 5K0ZA 4MIEA 2FSSA 3ADOA 4AL4A 3KM0A 4NJMA 4Q3AA 2OORA 3H5NA 2QRKA 4ZVVA 1SO8A 2QRLA 3RFVA 2B35A 4IXTA 2I65A 2TMDA 4E0BA 3ZV6A 2ZYDA 2EP7A 3ZWVA 2IYOA 2G1UA 3ZWXA 3E48A 1WMAA 2Y1EA 4ZQBA 3RIHA 1CJCA 3PWZA 3JQ8A 1TEHA 2ZKLA 1O8CA 1WMBA 2D0IA 2NVBA 3G1UA 3PYXA 4LRSB 4CM7A 1EVJA 1NFFA 4HADA 4CR6A 3SVTA 4AJIA 1B14A 5A03A 1ULUA 3DO5A 3OHSX 2Q1UA 3GLQA 3IQDB 1V3UA 3H9JA 4WLNA 3NRCA 1EVZA 2UUPA 3JQGA 5FFFA 3KO8A 3TOZA 4L4XA 4ND1A 3JQ7A 4YQZA 4O63O 3UFXA 4L4RA 1S7CA 1WZEA 4OYRA 1I3NA 4MVJG 1PX0A
chains in the Genus database with same CATH superfamily
4UM9D 4PPFA 1QHXA 5D5QA 1KYVA 2Q2QA 1QPBA 5EP4A 2QUBA 4CIBA 1BWSA 5K6AC 1NXOA 4YNBA 2RCYA 3S5JA 4JGGA 3LX4A 3P9NA 5JISA 4YMVA 2CUZA 3OIUA 4DQ0A 2O3SA 2W6JD 1MAAA 2CK3D 3ENNA 4U5XA 4OX9Y 3DF9A 4NTZA 3BCHA 4NZ9A 1IJEA 2AJBA 3A1TA 3ZLTA 7ADHA 3BYZA 4MCIA 2IUEA 1VJGA 1P5ZB 3L6DA 4I4TF 4E5UA 3T1OA 5LOVB 4DA4A 2BR4A 3Q98A 3CG4A 4GYKA 1SKMA 5FA8A 5FLYA 1A88A 2EF1A 2JI9A 1CYEA 2I80A 5LBUA 5ULLA 1Z45A 3QWAA 4G23A 3OWOA 4OSOA 1KC3A 3HMQA 2MCFA 1HQYE 1SKUA 2BBTA 2CXHA 2O7RA 4PLTA 1C8BA 2ZB3A 2ZI9A 3D6NB 4UDXX 3LIPA 4WT7A 3ZCSA 4DYDA 4C2TA 5CM8B 3WLAA 3OU6A 2CL5A 4W6ZA 3ZY2A 2PS3A 3E9RA 1N3LA 4BRWA 3ROMA 5DGDA 3SSMA 4OAPA 3A2KA 3RBZA 1QX4A 1C0IA 1A5SB 1P7ZA 3LP6A 3UB2A 5JSFA 1Z63A 1JG3A 5SYMA 3VHLB 3NYWA 4YO7A 5A7FA 4L02A 1YK1A 2O59A 3REOA 3V1NA 4HNVA 4DYVA 3B1KA 1PKXA 1T3GA 5KVCA 1NL3A 4WI1A 5E95A 3DPIA 4FT4A 1NJ1A 2WWRA 3ANNA 1LZKA 3N6VA 3QMMA 1XDSA 1HDZA 3C4QA 3M1IA 2JANA 3QVSA 4NDAA 2VEOA 3F4KA 3N28A 3Q9LA 3X44A 1PLLA 3O8DA 3ADPA 1MZVA 1U90A 4AVYA 4C1NA 1O6CA 5C34B 3U16A 4Q4DA 4EG1A 2H0RA 1L7NA 1AF4A 3WO1A 3MJEA 1GPMA 4D4HA 4TRJA 3OIWA 1BDBA 1EGVB 3RYFA 3VMMA 1HOXA 4HX2A 2FVXA 1YE3A 1R1DA 4L5AA 1R4AA 1KY3A 4LNUA 4A0HA 4C3UA 2A1TS 1Z5OA 2PXCA 3O2QB 1RBQA 5DU2A 4R83A 3VBEA 3VC3A 2VKTA 2I6SA 1CUBA 2V7VA 3D9QX 3EF0A 4MB0A 2DSTA 1SIOA 2DJ5A 3GT4A 2PTGA 4URZR 2BBOA 4QU9A 1LWNA 3F9RA 1KOGA 2K7ZA 3BD9A 1XNQB 3CSSA 1FDSA 5B6JA 3OZXA 1GQRA 3V1TC 3I32A 4UHDA 5DW3A 2NOAA 3CX4A 4LQCA 1MMFB 5JZOA 1TF5A 2OO3A 4WNAA 2PK3A 4L74A 3NHSA 2NG1A 3T38A 3ROTA 3LECA 1O6BA 1Y5MA 2O8BA 4DCJA 3EC1A 1ANKA 1VL8A 4KQGA 1PFWA 4IMRA 4C06A 3OKCA 5CW1A 4LI3X 2R4QA 4PNZA 5CHYA 3PTLA 5FAXA 3FMVA 2W5UA 5CH5A 3UA4A 2BW0A 4X1KA 3WYCA 3K70C 2C7QA 1UQUA 2R68A 4ESHA 2YYZA 3QLTA 1PJCA 2E4XA 1V1MB 1ZD2P 4YLEA 1YDHA 2J4CA 2A0KA 2FWJA 3KQQA 2WUDA 4R7GA 5KC9A 4Z4FA 2PUFA 4ECEA 5JO9A 1OXVA 2CHUA 2A5LA 2P4QA 3GF4A 3H13A 4FUQA 3GN1A 2VDNB 1IY8A 3RDPA 1MT3A 4B2IA 1V16B 3Q2IA 5DB4A 3QXSA 1SFRA 4J7XA 3AY3A 3O2JA 5ESXA 4TTVA 3A2MA 1G7CA 4K2HA 4ZEXA 1KE2A 4GP7A 4F4FA 3UQYS 1LVUA 5L51A 4I3HA 3ABQB 1J2YA 5DHRA 3VNRA 1VRVA 3OCCA 1C3OA 5AM1A 3V48A 1Z2PX 4IOLA 2WJHA 5IK2A 4ZQHA 4K9OA 1JHAA 5ALXA 2OXCA 3TINA 4PG6A 2ALJA 3EXIA 1G21B 3A7DA 3H1BA 1ZP6A 2F8LA 3KDAA 4HNGA 4OP2A 5CXXA 3NEPX 5ALNA 4YIHA 5F9FA 4KQCA 4JLBA 2Q3JA 3KSDO 4CBVA 1QS0A 2YWCA 3G82C 1OFHA 1JPNA 1QHNA 3MAGA 3DEAA 1RLTA 2IHVA 2VF4X 3MJRA 4UU0A 5FBZA 3ICOA 1GU7A 3MQ4A 1C8LA 5DFAA 2JGRA 4N9QA 4D4MA 3IXQA 1PD0A 2VNJA 4Q4HB 1AMNA 2HPVA 4XGRA 2M32A 2XRYA 4DV3B 1JAIA 1DEOA 1AGRA 2VSFA 2G7MC 1KO5A 3IEPA 2X4IA 4XSVA 5PNTA 1YL5A 3OX2A 4IG9A 4RJLA 5IYZA 1IDOA 4GI5A 2WKSA 3T3NA 1YI1A 1U7DA 2BFEA 2IOHA 1T0PA 2QS9A 3AI7A 4JUAA 1KEWA 1M1ZA 1FX0A 3CUYA 1J0DA 1WVGA 1OGJA 3F97A 3FYHA 3LWNA 3SSAA 5C5EA 3TGLA 4PW0A 2AFIA 2HZBA 2W71A 1K08A 1DKPA 1ZWKA 1DTWA 1C7JA 3EWSA 4IIEA 3NTOA 3I6MA 3F5MA 3HGMA 2IXAA 4MPDA 2YVQA 4RVSA 2BJWA 4RFSA 2Z5LA 2V0NA 4JEHA 3IRVA 3LSYA 3UMGA 4D9KA 3UMJA 5IZ4A 3WK4A 1ZFNA 4CMCA 4JLDA 4D42A 4GP6A 1JIIA 3DMHA 3AY0A 4JXJA 1E99A 4IIBA 3TQHA 1ORTA 2V45A 4RADA 2PS1A 2ZJ2A 1B0UA 2ORWA 4I50F 5DSTA 3ZS8A 1GD1O 1HRKA 1OI2A 2EZ8A 3U60B 2Q50A 3ND7A 1CUGA 2JGKA 1A82A 3INTA 2FMHA 3LBNA 3QI2A 4ALMA 4BE9A 3GP5A 1WPXA 2GYVA 1DC8A 1T3SA 2VS1A 3PC6A 1I14A 3BB3A 4DNXA 3LQ1A 2HLHA 1E2JA 1W6RA 1KMNA 2V96A 4GVLA 3E8MA 2CUNA 4FYJA 1PD1A 2R1TB 3D3QA 2VHTA 3DWIA 4J2OA 5C4GB 1BCRA 1H2FA 4NSNA 5JSUA 3KQNA 3EDRA 3ZYZA 4TGLA 4DM4A 2DEUA 3C3YA 1YZUA 3FUTA 2GCNA 4CM4A 3J80A 2PO7A 3M82A 4R5HA 2IYFA 4JVLA 4R9RA 3GPLA 1G42A 2VK8A 4PZEA 1G9SA 4ALIA 3HBJA 1E1LA 4QGBA 3THOA 2F4VB 1JLRA 3WNZA 1KGSA 3GT0A 3TFQA 4QLBA 3TF5A 2KPOA 5EIAA 3GJ7A 1YR3A 3A25A 4A2WA 1WXQA 1N2JA 2D3TA 2IZOA 4B7XA 3QP9A 3AVQA 4Q1FA 1KI9A 1SVIA 5SY4A 3UOWA 1Z8DA 1T5BA 3HEBA 1IM5A 1ECCA 2OAEA 1YO6A 3IPRA 3OQOA 5DN9A 4R0MA 3BL8A 4HLUA 1DQYA 4ZWNA 4F97A 1HLGA 2E21A 4IGIA 5HFJA 1MZPA 3AV3A 1JI0A 1RZ3A 2YINC 3JARB 4QNNA 3I1FA 5KTSA 1OAOC 3OFKA 4INPA 4ZI7B 1DAIA 1NNI1 5GONA 3DMNA 3L7NA 2NWQA 4OI2A 4Q3BA 2WNHA 2RKBA 3FDZA 1TO1E 4C3OB 2EZ9A 2XMBA 4J29A 3MELA 4CMIB 4DQVA 5AW5A 3ICWA 1F51E 3K16A 3KKZA 1LLDA 1O6ZA 3OM9A 1W49A 4HNAA 1EZZA 1E0DA 4P5PA 4BX9A 2GHRA 4FFPA 4CL3A 5IXJA 2ODEA 5IDVA 1RAEA 3BHMA 3HJUA 4X94A 5GOTA 1P60A 1XLWA 3QW2A 3H1FA 2QRVB 2VHUA 1FVOA 3N2GA 4IMPA 4LYYA 4RQTA 5CB4A 3D3JA 2CDNA 5BT9A 2VATA 4L6IA 3QMVA 5H9WA 1FUKA 3QVVA 3LJKA 4D4LA 4KNYA 1SUSA 2IIPA 1RXCA 2YMMA 3B5IA 3S6JA 1G5QA 4N8SA 4BFVA 4YUZA 4RHYA 5JPIA 4F04A 1I5OA 1E1QA 1JEJA 2VPPA 4TS3A 1DIRA 5G0VA 5F1YA 5BYKA 5HTKA 3UJ7A 1XRNA 4JI3B 4DVGA 1TE2A 3ZW8A 2QT0A 1XU9A 3OCWA 5ITZA 3EA0A 2Q8QA 1X7XB 1SUFA 2MINB 4P92A 4TLDA 2JFXA 4HI0E 5IH3A 1D2RA 2CN1A 1CERA 4G1CA 2DCUA 2CV1A 2BZ0A 3BWMA 2WB4A 3PXAA 1TMYA 2DHEA 3BMQA 5C5CA 4OQEA 4PC6A 4J8PA 1B23P 3WL6A 2BM8A 5BWCA 3ONDA 4IMJB 3EGEA 1SQ0A 4H7IA 4KVZA 2PKQO 3SYRA 3AG5A 1LSJA 1UL1X 4KUGA 3IURA 1Q7BA 2H7YA 4OG2A 1SCQA 1T0BA 1L5LA 3ER8A 1IQPA 3IEXA 1ZPDA 2BI8A 4FFOA 3PSHA 3QV2A 2VPQA 5DHTA 1JIUA 2KX7A 4ZI7A 5BN5A 1Q2UA 2PRYA 5DM60 2FN4A 2Z3VA 3UICA 5AQ1A 2OOSA 1SELA 5IVIA 1RRCA 1A9OA 1NULA 2EGUA 1X38A 3EZNA 3HWRA 5L45A 5BVGB 3IEVA 4MRVA 3KJZA 4D41A 5CDSA 1II8B 4K88A 1VE5A 3EMKA 4PHFA 2BFEB 3EIWA 1YR9A 4GSKA 2I34A 1YA8A 2WG2A 4P82A 1QLJA 4JYMA 2AT1A 1AKQA 4RD2A 1PZEA 1U8FO 1GZUA 1Z73A 2QK4A 3R77A 1NJ6A 4ARIA 5A5EA 2R6AA 4RMHA 2X0DA 1ZRSA 2PLNA 3P20A 4BKMA 1U1GA 3UGQA 3O1HB 4H1TA 3AZQA 2PGNA 1Q95A 1UCFA 4RAQA 1MJ5A 4YRLA 2JLCA 3NAZA 4ZCPA 2PKXA 3RJTA 1NXPA 1VKHA 1GQYA 3GRRA 1A8IA 1XVTA 2OL4A 2B4KA 3E53A 1ORWA 3IESA 2BISA 1P0FA 1VOTA 2EAUA 2JIMA 5BVHB 5KOHA 5JTTA 4DR3B 1GILA 1SRQA 3VO2A 1UH5A 3D54D 4JT8A 2R8XA 4DV1B 4RCYA 1T3LA 3K6RA 3JVVA 3DZFA 1WZ2A 2VPTA 2GHQA 1GQ2A 3B1VA 1Z4KA 3ORRA 5K01A 3CTMA 1CUAA 4D9CA 3V7WA 5G41A 3U5ZB 1TUIA 3DVQX 2FLVA 3FYUC 3I9FA 3Q88A 3JQAB 3ZQJA 1CR1A 3WGUA 3K5WA 4DDHA 2Z2IA 4UUNA 4HBGA 1PQ4A 3GYGA 2CXSA 1Y1QA 2O1SA 3I01M 4C5AA 4AZ0B 3GROA 4Z2YA 3MA0A 5EIFA 3AUTA 4HBZA 4F1WA 1IWOA 3FNHA 4HQLA 1GUBA 4ROTA 2OA0A 2VRBA 5CBPA 3HXOA 1UR5A 3B38A 5IP5A 4ID9A 2HHHB 1A04A 1FE8A 4E1VA 5C51B 3KLPX 1NXQA 5DULA 4BPRA 1EE2A 3DR3A 2W6OA 2Z57A 4PPNA 3G6WA 3PZRA 3RVLA 1RVDA 2JJ8A 2JPDA 4DIBA 1WULS 3UYLA 4IZOA 3CISA 5JS2A 3WGMA 3IAM6 2QZZA 5FYQA 4GGOA 1VKOA 2WM8A 4RJJA 1L4MA 4EYOA 3CM0A 2AYZA 3FHOA 2AA3A 2XA1A 1CCWA 2FPLA 3LPLA 3MWLA 1J07A 3CW2A 3WTCA 4UTNA 1Q21A 1U1EA 4IHJB 4GYYA 1GEEA 4GOMD 4MR7B 1SNYA 4EVQA 2ASVA 3PX2A 2B20A 4GR5A 2IJGX 4IYRA 1VJCA 1BDIA 3X3HA 1LSSA 2Q07A 3M49A 2B37A 3R5TA 5EE1A 1GNPA 3TIFA 3F6SA 2YWEA 4WKPA 1P2UA 1L0BA 2W6QA 1EYZA 3BF7A 4ZK2A 3GMIA 1E1MA 2O8NA 3PA6A 1IDN1 1QC5A 2X7JA 2FZVA 2L18A 4K9NA 2LW7A 2EXXA 4PSUA 4FHFA 2NQTA 5AKHA 4RJTA 1C30B 2XQKA 4YRSA 2C2YA 1DC3A 5AJWA 3AM5A 3F47A 3K9NA 3DV0B 2QIOA 1YZHA 3B85A 5HQJA 3OX1A 4IIHA 1SD2A 1TM1E 2J9GA 2WAMA 3EYWA 3GRPA 4QYTA 2LIVA 4XASA 5KNBH 2IU4A 4XJVA 4C4XA 2CXNA 2L82A 1EFPA 2B6HA 3DTYA 4QPDA 5TVGA 1DJQA 1WZCA 1I9GA 4R1OA 3SVZA 3NT4A 1PN3A 4QWMA 1Y6QA 1OROA 3KJIA 3SC4A 4EPTA 3IAAA 4YHBA 3CWCA 1QGOA 2D7JA 2X8JB 3D2BA 3FRHA 3DE4X 3HP4A 4XJTA 4F5WA 2J67A 3DAGA 4ZICA 1FPMA 1OZHA 4I1YA 4GMDA 1Y3CE 4OM8A 4XVUA 1N2CE 3L0CA 5JMPA 2P4UA 1HPLA 3EMDA 4MDHA 3HCWA 2E37A 4N40A 4NBSA 5THXA 2XTNA 5CT6A 3TRIA 5ILQA 1HTBA 3OHMA 3T3EA 3I1YA 2Q9UA 1UADA 2R8EA 5T41A 2NU9A 4H35A 5CAEA 3HTXA 4O3FA 1ZZGA 1LS6A 3C3JA 4IDGA 4CM8B 4DAEA 1GVNB 5CFRA 3I2YX 3PNPA 5LIPA 3VDMA 2D1YA 4ND2A 2BRUA 5CVVA 1U8XX 2J5KA 3ADDA 3ADKA 2GETA 4BO4A 3VV3A 3P27A 4NBWA 1KMHB 2F3UA 4M89A 2VYVD 3IUBA 3VPCA 1YQEA 3CR8A 5HK8A 3DM5A 4L15A 3WY9A 3GZNA 4AUKA 1UP6A 2QP4A 3IVRA 3FW1A 3GELA 2COEA 1OWOA 2D2XA 2HMUA 3DDUA 3X1YA 4LSGA 4MWGA 3ZIAA 4CQLB 1G8JA 2BTQB 3GWZA 4TVOA 4FR2A 3UUGA 1ADGA 5ESDA 4WJLA 4IXDA 2QN2A 1D7AA 4AN4A 4TYNA 4YLGA 2X0IA 4ZP1A 1ITZA 4OXIA 3PFBA 3DHEA 5MGNA 4FW8A 4JOCA 1L9XA 1ZUNA 2NV2B 4Y7DA 5EUQB 4F9EA 4QKQA 2BFCB 1U3FA 1E89A 1M54A 4G3XA 2IY7A 4FGUA 2DUJA 4EG7A 2GPTA 1DZIA 5BSKA 5FUVA 3DZJA 2KS6A 1O77A 2WC1A 5I9BA 4X1IB 1DDGA 3AR7A 3PQ4A 3QRWA 3OLVA 3BZUA 2PHZA 5TEWA 3U26A 4PSDA 5A4DA 1KOFA 5AVSA 3AHIA 4TV9B 1C9JA 4G4JA 1XRMA 3HI6A 2HGZA 3NYRA 5H9VA 2PMKA 1J00A 3K9CA 3R41A 3QPCA 4ZPJA 1XU7A 5THQA 1DTSA 2FP4B 5ER9A 3ZG6A 3JAKA 3KQWA 3PEWA 2C3YA 4PXSA 3SJBA 3DXZA 5KSZA 2E82A 8OHMA 3NASA 2CFTA 4NCAA 3H4VA 3IDSA 1HE8B 1W5TA 2YYYA 3G8DA 1F7UA 2ZBUA 5MN5A 1DG9A 1VE6A 4MH0R 1SXIA 2VNHA 4E7PA 3UENA 2OQVA 2P9QA 1OBHA 2PZEA 3OIDA 1VHTA 2HUPA 2A9PA 2WFLB 4YUYA 1CBUA 4TKZA 4WHMA 4ZIRB 5J4KA 5KTYA 4LF5B 2ECFA 3A6HA 3WNVA 4QOFA 4RA6B 4ETMA 3IC5A 1KMQA 2EDAA 2VPIA 2VH1A 4G2NA 3ETHA 1ISFA 2QM3A 2C9DA 3MBOA 3DHNA 1G59A 2NQ8A 3I64A 4HH0A 1DQRA 5G3ZA 3RSCA 1G19A 3DMGA 4DUGA 3CC8A 4YRPA 4FYPA 2WU3A 4YJ3B 1JMYA 1WE2A 2NZVG 2AR9A 3EFBA 3GVIA 1YMQA 2WD8A 3QENA 1OLOA 2YY5A 1FP1D 1I7SB 5LQSA 1Z5PA 3KOXA 4O2BA 3TLYA 3TXAA 4EGFA 1Z8HA 1QWOA 3TQIA 1Z08A 1J8QA 3LYAA 4YXWA 2XXAA 4AO6A 3IA7A 2VLIA 5CYOA 5LZ9A 1O87A 5SICE 4C4AA 1NTRA 3G8BA 2J0QA 2OGZA 3F2IA 2FKAA 1YJAA 3HZOA 1XLUA 4ER7A 2IDJA 3M3PA 3OQNA 1P75A 1V5GA 2O3UA 4MS1B 3DAYA 2GM4A 3ZWAA 2HF2A 3Q8XB 1G6HA 1AK9A 2YWJA 4D4JA 2XWQA 4FZRA 5BSRA 1F5SA 1K92A 3B3GA 3ZYCA 2WU4A 4ZHSA 1KGDA 1MJNA 4Q9IA 4ERXA 2RGGA 5TQVA 2JI8A 5LMNB 3KUCA 3H2GA 4AYXA 1OX5A 1ZVMA 2OLKA 2PMCA 3OUZA 4BJ6A 2QE7A 3BMOA 3EXFB 5DGCA 3ETLA 5AFSA 2OHJA 2A9RA 3I8XA 3EZLA 1ZBDA 4TV8A 3IXLA 4UHKA 4ACAA 1SRRA 3PQEA 4QBIA 1KI6A 3PUVA 5T4HA 3LT5A 2NW6A 2GESA 3T7EA 5F2NA 3MHTA 2FWNA 4NLLA 4LJLA 1XVUA 2ZRGA 3A26A 3WS7A 1E2EA 3HVIA 3JYHA 4BCDA 1G17A 1MC4A 2ZSJA 3GFFA 4W5HA 2ZITA 3CSDA 5DHAA 5HBRA 3SI7A 2WT8A 2Q4BA 1D2AA 3K5HA 1EM6A 5DYGA 1D2HA 3YASA 1JGTA 4N8DA 4QLOA 2ZVDA 5E3JA 1USKA 4JI6B 3U39A 1RLOA 4BB6A 4G1BA 2PJDA 3GRKA 1RP7A 2A9VA 1RAIA 4J2TA 4OHWA 5LJLA 4FYIA 2G70A 2W2PA 4BN4A 2CBGA 4FBMA 4PIVA 4K46A 3ANYB 2J9ZB 2ZJFA 2YZMA 2ZWPA 1CY2A 1GLNA 3F90A 1ZM3A 4XJSA 2CF6A 3FYCA 5ECWA 5HKBA 3DL7A 1Z4JA 2SECE 4FYMA 1R4MA 3B1FA 3WJAA 1H23A 1U0NA 4D99A 1ZRMA 5LP6A 1XKQA 2IOFK 5D87A 5BSUA 1XO1A 1A98A 1M2NA 4G1EB 2NU9B 3RJ9A 3V9AA 5A4JA 3SD7A 3JD4A 1PV4A 4NH4A 1FTWA 4CM8A 1JDBB 2H0QA 4E32A 1DE0A 1I4EB 4MS1A 4URFA 2MDTA 2ILTA 2Q9AA 3VTZA 3MTDA 4BFCA 2DSNA 1Z4OA 1D2GA 2ZEJA 5E1OA 5J43A 1TTHA 5TGTA 2NQ2C 5KYWB 3ZD6A 3U7QA 5FORA 3BILA 5FP0A 3VUFA 4M1KA 1RTKA 1JVSA 4IIJB 4AJPA 1OWNA 2DWOA 5FDFA 2CHQA 2R47A 3DMRA 3ESRA 5DOZA 2M6KA 3WMGA 5C8YF 2HSJA 1PFGA 5BOSB 1CQPA 1RKXA 5AIBA 1UT5A 1YJBA 2J33A 4MS4B 3IT1A 3IAFA 3R0XA 3RHZA 3GJ8A 1J0XO 4N01A 3RRYA 2B9EA 2UZ4A 4NMMA 5HS6A 2FWMX 1KF0A 3AI1A 3CHYA 4OMUA 4RDIA 4X1KB 3GLTA 4B4KA 3FPJA 1SKBA 3WNQA 1F3OA 4Q7KA 4YA6A 3NUGA 4L5YA 4YDRA 4QRIA 4LYGA 3H97A 4YP5A 4MB2A 3AR6A 5JZSA 1OFGA 5BN5B 3V7UA 2J7KA 4YCJA 1MV5A 5J3JA 1HE4A 1QV9A 4MVJF 4A26A 4M1SA 1YVDA 3HG7A 3WLJA 5J2UA 3W7BA 2HBQA 4QNMA 3UB4A 1EVKA 3QXJA 1GARA 1V26A 4IDEA 3KL2A 4L8GA 1WMDA 2H00A 2IYYA 3O8NA 5DX8A 3EN0A 1QBGA 1X1SA 4OHYA 4JHLA 4O4JF 2PA3A 2WAYA 4NZZA 1EH5A 4JI2B 2EFEB 1HUQA 2WD7B 3IHTA 3DBRA 2RJOA 2OFWA 4TX1A 2ZBDA 3S44A 3O74A 1HT2E 4IYJA 3RGGA 3V32A 3K2EA 1OHHD 4RD1A 4WJKB 4BV3A 4DVJA 2R48A 3N0RA 1WXEA 4BNMA 1Z5ZA 1ZHHA 2GEFA 3ZGXA 1VKNA 1X7HA 4MUMA 1ZH8A 3TZKA 3S7ZA 1V4VA 4QTTB 4ENSA 5KWEA 5HW0A 3WGLA 1TL7C 2HD4A 2RHHA 1CETA 4A2PA 4FZ3A 1V3VA 2QTVA 2JS7A 4CIWA 2A9QA 2XWSA 2ZR8A 3B1YA 4TMWA 4B9EA 1CFJA 4BLSA 3WYGA 5KOHB 4LV6A 4ER0A 3OP1A 3L7KA 4GOJA 2HF8A 3HDQA 3KUDA 1COWD 2A4MA 1MB3A 3LH5A 1S8AA 3AJ8A 1L9KA 4B6PA 3PFHA 3AP3A 3AY7A 4MRMA 4Q4JB 3RH0A 1E2QA 3TR0A 5HWSA 1H6BA 1YAHA 1P2SA 2QP9X 1F0NA 2ZT6A 3BVPA 2AI3A 4MQ4A 4BBJA 4CYMA 3L4KA 3AVTA 3ETNA 1TF7A 4HTFA 2ONZA 4IFTA 2RGXA 4BFYA 2P2YA 4X0EA 1RPNA 1OFVA 4RMNA 4DR7B 4MQBA 1TYZA 3KXPA 3I37X 4WFIA 5FEMA 1YZGA 1H6DA 4Q4AB 2FB9A 2DT5A 4PTZA 2BJVA 4V0NA 2XSZD 2BM9A 3MS4A 4G4SO 4PZ0A 1B15A 3OT1B 5DJ5A 1K7FB 3EEFA 2WU8A 3UC9A 3KD3A 2GF2A 4L7VA 4WKBA 3VZQA 1NBOA 5A05A 2Q7XA 4MYDA 3MCZA 3TLMA 1MABA 5A5VA 2YY7A 1HDOA 4OSEA 1R7RA 221PA 3IKVA 4F91B 4LC1A 1HE3A 3E35A 4ZVKA 1LFAA 3INRA 3TMAA 4ZN6A 1UMKA 3EXG2 1F1BA 1PVDA 2AFRA 1A9YA 4WZAE 3K96A 5J59A 1FQJA 2WI8A 1JU9A 3ETGA 3M5DA 4RY0A 5BR7A 5G0WA 2OMEA 2IV2X 1QGUB 1K7EB 1M0EA 3IMGA 1WCYA 3AKEA 2JATA 4N0EA 3ZI7A 3USZA 1E0JA 3GJYA 2W90A 1IL0A 3OESA 3QVKA 2RBEA 7GPBA 4N7JA 4I19A 1UWLA 1CQIB 3P45A 5E3HA 3IUYA 1VBMA 2WTNA 2OV4A 3H6HA 4R3NA 4TV8B 1KI6B 1XPRA 5AKGA 1Y6ZA 2B4RO 2IITA 1GRQA 3CVOA 3ELDA 3D0KA 4RF5A 5REQA 5DO9A 3UMFA 3UHAA 4NCIA 4WZAB 4QTZA 1M2JA 2WYUA 2PT9A 4PZZA 3URKA 3PF9A 4GEKA 1RCFA 3OOSA 3DV0A 5JASA 4PX9A 1NI3A 3U62A 3SSOA 4EKEA 3OZRA 3T5TA 3UT0A 5HTOA 3UZUA 1LW6E 1XXHA 2BH9A 4UXHA 2QG9A 1QRAA 3M4ZA 4MB6A 1GJRA 4G9BA 2O7SA 4KWTA 3CURA 4KE6A 5EQDA 3ELBA 4DIOA 1EFRA 1QRTA 2VBFA 3EVNA 1NVWQ 2H63A 4AUNA 2VOEA 4DDVA 2P4HX 4DZRA 4DIDA 5EE0A 5JALA 5F9HA 3IDFA 3QBEA 4OM7A 2AOUB 2BTOA 1JEDA 3T06B 3DLAA 3EY4A 5JECA 4JXZA 3DLTA 1VGVA 4GD3Q 1WV0A 1MJGA 4S1PA 3H5RA 1C9NA 3EGCA 5D3MB 4CCYA 4KBFA 1Q0LA 4K6GA 5FQNA 3F74A 3WK5A 4YN3A 1FRZA 3IV7A 1M6VB 2XMCA 3ZGLA 1U0TA 3HJNA 1Z88A 4RNDB 1QSGA 2ZRHA 4QFCA 1XJ5A 4DJJA 2QN1A 5AICA 3QFCA 4Q7MB 4UDYX 2A1IA 5EXEA 2NZJA 2RG1A 1V8DA 4AQYB 3AEXA 1FJHA 4ZU6X 3SXUB 2QTGA 3ZOZA 1LXCA 2H7VA 4UFOA 2B0JA 2F2TA 2PA0A 1UUFA 2D5IA 4B3XA 1N6LA 3VR6A 4HGZA 5K0BA 3N8DA 4A6PA 4K9SA 3NHZA 3FOCA 4ND6A 3CLVA 1IXYA 5KBYA 4Y2GA 3DL0A 3MTEA 4U2GA 4TMXA 1OI4A 1XZPA 1GUYA 4D9JA 2PKWA 1NG1A 3U4IA 1DT3A 1BQEA 1I6KA 1RSZA 3FPGA 5GZ6A 2CDBA 2Y0CA 4TKVA 2FEWB 3EVEA 5IKEA 1XEWX 4KIUA 4YJDA 3CW9A 3SMVA 3P2OA 4E5MA 4QQKA 4QXQA 1FCJA 2WJJA 5BSMA 3ST7A 5BSWA 2FZGA 2G40A 1D8TA 1YZYA 3OUUA 4WDRA 3UOAB 2IHUA 1SKAA 3G5TA 3W8NA 4M9QA 4RESA 4LRQA 1QVVA 3PJFA 2H08A 2YV5A 3WYDA 3U6BA 1AKVA 1ENYA 3VPFA 1VE9A 1YMVA 5EOVA 4L2IA 4EITA 3RYFB 4XM2A 1Z0AA 4KSCA 2GKOA 1UBHS 2DGDA 1JEOA 1WPGA 1AUQA 1TKRA 2UZ1A 2X9QA 4LDQA 4A16A 3GUVA 2FX3A 5FOTA 1UT8A 4NDZA 3KJFA 3V8MA 1KPIA 1YDFA 1GA6A 3GDHA 4MWOA 3OBIA 1ACLA 1W0KD 4OHCA 1IVNA 4R1QA 3OLXA 1MOPA 5AW3A 4HG2A 5EWMB 5TE9A 1JIQA 2QYTA 3KOUA 5EEHA 2H3EA 4OKIA 1CNFA 4PGAA 4PLFA 4PYRA 3Q7QA 1SIWA 4F2DA 4HJXA 5J5VA 5KTRA 1Q7EA 3DXYA 2BE9A 2CYBA 4K0RA 3TIXB 7MHTA 1ZX1A 2IOQA 3HU1A 4Y18A 2IY9A 4TQAA 5C1BA 2GKGA 3MM4A 4R1MA 1HFJA 3A6GA 4KO1S 1INLA 1QE5A 3IBCA 1US8B 3WL7A 4ZYVA 2LGJA 7MDHA 2BGWA 3IBFA 3EVAA 3AV0B 5F33A 3FPHA 1SHZA 1ZI6A 3BUSA 3BRSA 4QEZA 3JD3A 1YULA 4ZOBA 3NS7A 3A2NA 3BRWA 3EIFA 4ZYYA 2V1UA 1WXWA 3H8JA 2BLNA 3FJOA 1G3IA 4E5YA 2IUFA 1YNOA 2AG5A 1C9EA 1QFMA 1XDUA 5CB4F 2ZYRA 1KP3A 3FFAA 4BJ3A 5KDOA 3B48A 1OC4A 2A67A 2H7XA 4B82A 2HT1A 1PGJA 4RETA 3QIAA 5EJ4A 2UZIR 3WFZA 1B0PA 2YUTA 3JQGB 2ONCA 5BSHA 4JN6B 1VLQA 4Q9HA 4B8WA 5B7QA 3DOIA 4E4YA 4FFVA 3DGEC 3MC1A 1X2BA 4XQGA 3RYIB 3C15C 1ODTC 1T9BA 3GPIA 5AIAA 3TR5A 1Y6FA 4DABA 5HX7A 4CETA 1BKSB 1VC2A 2CHVA 3ONVA 5JG7A 3FHTA 2Z6UA 5BNZA 3LGSA 4LF7B 4AY3A 4F4HA 3PXDA 4MIYA 3VR0A 2V65A 2E48A 3TL3A 1Y8ZA 1YKSA 2XB8A 3O82A 4RHUA 3SEAA 4AMVA 1VIAA 4J0JA 3SYKA 3WYAA 1DRJA 4J6FA 1NW7A 2RKOA 1EINA 2Z08A 3TL6A 4BNZA 3I9JA 4YRGA 2XKKA 4PCLA 4M87A 4RVNA 4RDXA 1KP2A 5E9AA 3D3NA 4ONEA 4BAGA 4EI7A 1QGAA 1QRRA 1ZQ9A 5EMNA 2GT1A 3ZE0B 3JX9A 5J40A 4XZ3A 2R5WA 3MJCA 2JI4A 2XLCA 3Q87B 3QYPA 2BSQA 3NVKI 1GCIA 3EEYA 5ALDA 3THWB 5C46F 1MOQA 2IU6A 4TXJA 3KUUA 5SYAA 5CLGA 3B82A 5TQ2A 2EYUA 1NJ5A 1SUDA 2GERA 2H2AA 1NFQA 2PWBA 1M6HA 4I5EA 1PGNA 3EHDA 4H6XA 5GGXA 3FUVA 3UM9A 2B99A 1MP0A 4OQYA 4YJKA 3RQSA 2EBHX 1CK4A 4HPXB 2P9JA 3KQMA 4OGLA 1YRWA 3A4LA 4X44A 3LBFA 3U80A 4C7VA 4E5PA 4Q0MA 5FWAA 3MFQA 3VR5A 3PC4A 4UBOA 2JF0A 1RQXA 2B3DA 4XOIA 1RXWA 3OZIA 3VPDA 3HCDA 4MJ3A 4R9SA 2RH8A 1X94A 3QEMB 2IC5A 2NAPA 2OBYA 3EXHC 4B4UA 4FE4A 2V9CA 4FE3A 5IWAB 3BWCA 3GJ6A 3KPWA 2WKPA 1Z16A 1Z83A 5L7YA 3AZPA 5JY6A 4EH1A 3U7IA 1JILA 4P3NA 4QT0A 2J09A 1K0UA 3ESDA 1FTSA 4D3SA 2WDPA 1TTQB 4Z4GA 2DLDA 4HWRA 4M76B 3T1TA 4HSGA 5IJ0B 5CDHA 5CFPA 2ZT7A 2VQ3A 3K4PA 3MSXA 4PZ9A 3WQRA 2ZSHA 5DNAA 1ECFA 4IDFA 3AERA 2GGSA 2PAAA 3ZWBA 2ZRAA 5FJIA 1XTVA 3FF4A 1I32A 1JS1X 4NV0A 5AQEA 2HIMA 3S2IA 4PYKA 4RL6A 3C97A 4TPKA 5LU9A 1E6UA 1S3IA 3HCRA 4KR0A 1TD9A 1HYBA 4P1ZA 2HEIA 2MYPA 3UAGA 3Q7IA 1I51A 2NYRA 2P6MA 1YVUA 2PFKA 1JDNA 1V25A 1JSXA 2BDEA 3AFHA 3KLNA 3KYDB 4FDTA 4JUCA 5DNVA 5IM4F 5C1DA 3NO4A 4OYYA 2FG5A 2JFYA 3ROGA 1A8PA 2FRDA 1MB9A 1HXHA 2QYSA 3EQ8A 3EBOA 2QVYX 2PSEA 5CDUA 1E9BA 3LTNC 3GBVA 2P9EA 4P36A 2IP2A 3AIOA 4UOZA 4X84A 1KERA 4UCWA 1OXSC 1UWCA 2XMPA 3DZBA 1UOOA 3E58A 4LC0A 5B2FA 3NUZA 3AVVA 4CM6A 2CL0X 3EAFA 2R96A 1KMHA 2AK2A 2PX6A 2JRCA 4RKYA 3NEAA 1P3Y1 4YYEA 4CKXA 1ECGA 2OZLB 2WAAA 2HSZA 2JGLA 3C4JA 3QWIA 3RUEA 1EGQA 2DVMA 4G24A 2Z1MA 3FYSA 1KZ7B 1DSSG 1MQAA 3W1VA 2D06A 3GIDA 4FPXA 2IYZA 1QGZA 4DREA 2HK8A 1DAFA 4DMKA 1IM8A 1CUHA 2YY6A 3G2KA 4G0QA 1TB4A 3HU3A 1U65A 1XRLA 3LX6A 3N2EA 2OPHA 1RPZA 3NALA 2REXB 1IQRA 1WXHA 3PI7A 3WLQA 2P79A 4XVHA 4N12A 3RJ5A 4DLAA 3C16C 2ZB7A 2FPUA 1WXDA 1HE2A 4FDLA 3PHCA 4KCGA 1E3JA 3D5QA 1RHJA 2H1CA 5G4KB 1UBOS 1JP7A 4UTVA 3B9PA 3C6BA 1E3WA 1JQEA 4QPPA 2Y77A 3T35A 1BC5A 2IXBA 2PKQP 3GAFA 5E4FA 5AKIA 4P2GA 4V38A 3SS8A 4YRNA 1DFGA 2PT7A 2OHHA 1AHIA 3OEWA 4QGAA 3H7IA 2H0AA 5K3FA 1P4GA 2I6QA 1XMJA 2ZATA 3RWOA 2J41A 2IV3A 4YJ2F 5AD1A 4BYMA 2C7RA 5HUHA 3ZVKA 2HC9A 2Z8ZA 3LF1A 4C4SA 1SCUB 5EPOA 2OSVA 2R11A 4TS4A 4DMUB 2WUFA 2JCBA 2ISQA 4W1RA 2OHVA 1GKUB 4ENPA 1E7RA 1E92A 1IN7A 2B1RA 2EJUA 2ERXA 2FYTA 4ML3A 3SC6A 3ZH9B 2EWWA 3UMSA 2BHLA 4TMFA 1TCCA 2J9XB 4GKAA 2PN1A 3TLCA 1TJ4A 3VO9A 1I4TD 2B2CA 3ASVA 1QO9A 3WISA 1OW3B 1MV8A 4BO3A 4MEAA 3WWYA 4B2PA 2RK4A 1G7SA 1PO7A 1RI4A 4B34A 3QLVA 2EVWX 4X64B 1P7WA 3ZXUB 1ODFA 2IZ6A 2QLJA 4BNJA 1E5TA 4LJYA 2AMLA 3LTEA 4O4HB 3ANMA 3V7FA 1HSOA 4L95C 1BOOA 3RFCA 3OFVA 2RHJA 3A32A 4RY2A 2D0OB 4GECA 3GA5A 2ZVQX 4G1UC 5AK6A 1GZ5A 4YP7A 1DXYA 1E3SA 3FTPA 3DJYA 2V6GA 2IKSA 1P5RA 3HCFA 5G4KA 4KITB 2FZ5A 2INGX 5KOJA 5CM9C 1W93A 4HDQB 4RFVA 4QVIA 3BN3A 3D7NA 3SDBA 2YVAA 3E9NA 3GXOA 1YR1A 1DV2A 4I46A 2FPRA 4JKYA 4QX6A 4B6SA 3Q41A 4ECAA 5ITVA 5LXTA 4MUHA 1J8DA 5HF6A 1T8UA 2GZAA 4HRYA 3P9XA 2ZCUA 3RJMA 4B81A 1QCCA 3W4IA 4KREA 4CM5A 4DR2B 4EPXA 1R4ZA 2OV2A 2ZI7A 3JR7A 3QQ5A 3BFVA 3BCRA 3UUWA 4CKBA 1MC8A 3RSQA 4DUYB 5IBQA 4DT1B 2FRDC 1NNEA 4IHQA 1JAHA 2PZFA 4XDHA 3WSWA 3PEFA 3QU7A 2GJ4A 3MUFA 1OZGA 4RM3A 1Q84A 5F98A 4DB2A 4OUDA 5DEIA 2ZCJA 2EBWA 5CVJA 3PQDA 1Z4LA 3QX7A 3ZWYA 1UJ6A 1E8DA 4D56A 4JJAA 4QDUA 4NMHA 2HY7A 2ZYWX 2PR2A 4DARA 3L8MA 3MIZA 4S2UA 3IMKA 3LW7A 4RJKA 3WK9A 1IHUA 3DBIA 4FYWA 5DBEX 721PA 1JNYA 1SBQA 3MS7A 4PGFA 1G0NA 3H11A 5C9ZA 1NBME 5KWVA 1ZD8A 2A94A 2ZTLA 2CXOA 4LISA 1ZCZA 4HVAA 5BSGA 1P77A 5SZHB 2D5LA 2NSHA 1Q6YA 3PNBA 1H4TA 1Y48E 3IUQA 3ZE2B 2QRMA 4YRZA 1Q50A 4RHXA 3KRTA 4WOPA 4B35A 4RTQA 3CN7A 3G0DA 3DV2A 3JCZA 1KSGA 1VLZA 1GSHA 1K5DA 3Q3IA 2UAGA 3QTBA 5FXMA 2BEUB 2IV7A 3A9CA 2RHCA 2EFDB 3PFNA 1M1XB 3NKLA 2GK4A 4V0QA 3WE7A 1TI7A 3B9QA 2R6HA 1XZDA 1G8FA 1JXMA 4V03A 3C43A 2R1VB 1WPRA 3UJHA 1BRTA 3K2QA 3D5TA 5I8PA 3KXKA 4UEOA 2ZJOA 1DAPA 2UXCB 2UXBB 3HKBA 1X14A 2AL7A 4WLEA 4IDPA 3RAJA 3COWA 1B00A 3T7JA 1XALA 5BQ3A 4H7PA 1IB6A 1V2HE 3LG2A 1XD9A 1T2UA 4PRYA 1PEYA 1EXVA 3VVBA 3HK2A 2HV8A 4XX0A 1YZ3A 4ESEA 2O50A 1OBFO 3MVEA 4MV9A 4CF3A 1X1RA 5CRIA 1MGPA 1VG0B 2ACVA 4X45A 4HFRA 5TF4A 3HDTA 3PHJA 2BEWA 3M5CA 5TJ9A 2G5CA 4L0DA 1AOXA 4G0NA 3KSMA 2QENA 3A9SA 3BJRA 4ZJZA 1HNNA 4N6OA 3TPFA 1XI2A 2P3OA 4CJXA 3FLEA 3FTCA 1W9HA