1ZK2A

Orthorhombic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of R-specific alcohol dehydrogenase from Lactobacillus brevis provide the structural bases of its substrate and cosubstrate specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
molecule keywords R-specific alcohol dehydrogenase
total genus 98
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk2A00
4UUMA 3JYNA 4PVDA 4QECA 2VNSA 3WYCA 3RROA 1H5QA 3VPSA 4J9UE 2IZZA 4RGBA 2I6TA 3CSDA 1WDMA 3S1LA 3DAPA 1I24A 3W4JA 1HDRA 1HDXA 1R37A 3W8EA 3KYCA 4DIFA 3Q3CA 3SX2A 4G2NA 3FHLA 4E5NA 5JY6A 1SB8A 1YVEI 4MVJD 5JLAA 1E1MA 2V6GA 5J23A 2B5WA 4FQ8A 4XD2A 3ROPA 3BMOA 5BSGA 2YYYA 4Y8VA 2D0IA 1HRDA 4ZQGA 2CD9A 4Y98A 5AQ1A 2JL1A 1FF9A 2B83A 4YAKA 1TXGA 4AJJA 3DBLB 1IHXA 2OZPA 4QT0A 3TL2A 4BUCA 1YXMA 5A02A 3E5MA 1E5QA 1B2LA 1BXKA 1GYPA 1PR9A 2G82A 3N74A 4RDIA 2Y66A 3ANLA 5AXDA 4KDFA 3ZWBA 1NR7A 1M6HA 4OAQA 3KV3O 3LC7O 3RUEA 3WB9A 1IE3A 4ZQEA 4NFSA 4UUNA 3GNQA 1KVTA 4PG4A 1U4SA 4J43A 3VTZA 1D4FA 5I7FA 3NTQA 2Q45A 3WMWA 4P4GA 4BV9A 4BO3A 4JJFA 2QW8A 1YDWA 3AUTA 3CZRA 3R1IA 4Q3CA 4BOYA 3RIHA 1R0SA 4J2HA 2JFGA 1MV8A 3E18A 1U7TA 4WCFC 4CM6A 3RC7A 1YBVA 2YV2A 3G79A 1ZVMA 1I2CA 1GYQA 4CR7A 3GMDA 4D0SA 4DLBA 3L6OO 4WLOA 4NFYA 3CKYA 1PWXA 4CLHA 1NXQA 3KBOA 3HDJA 1IPEA 2GD1O 2P9GA 3H5NA 3OIDA 2NU9A 3B20A 3GNTA 1XQ6A 1YH3A 4XWYA 3ZU2A 4MVJM 4OXKA 1GZ6A 1ENZA 2ZIZA 3OJLA 3HDQA 1R4MB 2O23A 4XYGA 1MFPA 4B4VA 4BQPA 3INRA 5F1PA 3LT0A 1ADGA 1FDUA 1Q0LA 1DAPA 3GZNB 3PYMA 5DBGA 5JDIC 2P4QA 3FRJA 1ZK2A 4EJ6A 1B8VA 2WYUA 4U7WA 4MKXA 4XQCA 1QYCA 4CV2A 2X22A 4GX5A 4II2A 4L75A 2NTVA 4XRRA 3BZUA 5BSHA 1DLJA 4XDZA 2UV8A 3ST7A 2CVOA 4NI5A 1DIAA 4A5OA 4E2YA 1K2WA 4ZRNA 1QV6A 1R0LA 3E9MA 2JFFA 3PHHA 5C5IA 1ZEMA 2ZJ0A 1Z75A 3EC7A 4YQYA 7ADHA 1ZK0A 2YDXA 5DOZA 1KS9A 4OSOA 2EP7A 4R5MA 1CEQA 2DLDA 4M8SA 3ETGA 3QJ5A 5DCWA 4WLFA 2NM0A 3WGGA 4AJIA 5KJEA 2VYVD 3GY0A 1T2AA 3BAZA 3DHYA 6LDHA 3B1KA 3WWZA 2DFVA 3L07A 5KJ1A 3NJ8A 4HWKA 4BO2A 2BFMA 1VL0A 2GZ2A 1LRJA 5JDCC 4BNZA 4JNKA 1B14A 3UVEA 1GR0A 3VOSA 1U5AA 5C3MA 1UAYA 1NAIA 3RC9A 4PG5A 3ENKA 1NPTO 3PGXA 5A4DA 4CUZA 3W4IA 1PJ3A 5T8KC 2J3JA 2JD2A 1MG0A 3T4XA 1Q1NA 4H15A 3NGXA 4WCFB 1OFGA 4XCVA 4XDYA 1HYHA 2PFGA 2YHIA 5I7EA 3ZU4A 4BKOA 3GA0A 3F5QA 2FP4A 4MVJP 3UH1A 4Q3AA 5L7WA 1M2WA 1R0KA 2EP5A 5B4VA 4FC6A 3PYXA 1HETA 1NQ5A 3TOXA 4U5QA 3JQGA 3QHAA 1HLDA 2AMFA 4BNMA 2R6JA 1VL6A 3CZMA 3OFSA 4E5KA 2DPGA 3S2GA 5CHEA 5IZ4A 5EIOA 2J3IA 3GEGA 3H7AA 4GH5A 1T2FA 1JVBA 2NADA 5BQFA 5L3ZA 4JP3A 4YACA 4QQRA 1UXIA 4J90A 3W8FA 3KO8A 2NU8A 2ET6A 2PKQO 3AM5A 3AI3A 3U49A 1C0PA 2GYYA 4E6PA 1PQPA 1M75A 1YQGA 3QVSA 3RAJA 1U4OA 1PJLA 2VRBA 3TFQA 5I9NA 4AJEA 1C1XA 3L77A 3NGLA 4GPD1 3SJUA 4CODB 2P5UA 4OQZA 2BH9A 2C5EA 3ONFA 1WPQA 4W4TA 1U3TA 3FNEA 1N8KA 2PGLA 3KEOA 3CUKA 1PS9A 5L4LA 1GV0A 1PL6A 4OIMA 3GEDA 1U3WA 4I5EA 1LRLA 2O7SA 3HDHA 4FFRA 3EZLA 4RV9A 1GZ3A 3M2TA 1EZ4A 4YB8A 1XG5A 3E6AA 3OQ6A 5JCJA 5MDHA 1HZZA 1OI7A 4CLDA 3O8QB 1HDGO 1C3VA 1T4BA 3L4BA 1UP7A 3GPIA 2VQ3A 5HRUA 4NPCA 4A03A 2C5AA 1A4UA 4U0JA 1Y81A 2ZYDA 2YJZA 1K5HA 2EV9A 4HV4A 1V3TA 2VRCD 5KTKA 2EKLA 2J5QA 1E1NA 5TRTA 1YL7A 1ENOA 1PEDA 5LCXA 3U9LA 1Y9EA 2IZ1A 4INAA 4IQGA 2LDXA 1DRUA 2VUSA 4HFNA 2Y1OA 2ZYAA 2Y1FA 1I33A 1S6YA 4HNHA 4E32A 3WBBA 4HXYA 1NBOA 3WIEA 2NVUA 4FS3A 3OEWA 2I3GA 1LNQA 2JAPA 5ER6A 5AXBA 3FWNA 1T1SA 3JD0A 4NBWA 1QR6A 4XZ3A 1GUFA 2B4QA 4HFRA 1GADO 5JAZA 1F14A 1GY8A 3TN7A 3I52A 1VC2A 5IF3A 1I5RA 3C8MA 3OJ0A 4U8GA 4XJSA 4CM8B 4CMIA 5A3JA 4JGBA 2CVQA 3VHRA 1DFIA 4IUYA 4YPOA 1GEEA 3DAFA 5ILGA 1X15A 2E49A 5G0UA 1QV7A 4GLOA 4IQ8A 3VDQA 2AA3A 2DM6A 4ZN6A 2AG5A 5A03A 2W2KB 4IXWA 1MUUA 2D4AA 1W4ZA 2X0JA 3NRCA 4WEQA 2J3KA 4A2CA 3RU7A 1A72A 1ZXLA 2AEMA 4FR5A 3ITDA 4MIEA 3BMOB 1PGQA 3LSYA 4BNTA 4TRJA 4D41A 3PLRA 4X54A 3AUUA 5A9RA 3ZHZA 1PJ4A 3RI3A 2WSBA 5A9SA 1FXSA 2ZTUA 4M54A 4NDNE 2VWHA 3GRKA 5G0SA 3WNVA 4BGEA 1SPXA 4EJ0A 1DAOA 2WM3A 5DBFA 4ZQBA 1TB4A 4ZGWA 5FYDA 3R3JA 1ADCA 1C1DB 1HE2A 3H8VA 4HFJA 4J4TA 3AWDA 4O6VA 3PWKA 4AJ1A 5IZCA 3IUSA 3OICA 4E4YA 4M86A 3I6IA 3X2EA 4AL4A 1A9YA 3I5MA 2I99A 1IUKA 1KIFA 1ENYA 4BNXA 2NTNA 1CERA 3ZWXA 3V1YA 4FFLA 3BTOA 1Y9AA 2HMSA 2W2KA 2XXJA 3AI1A 4TWRA 4CPDA 1T2DA 3MJCA 1Y6JA 4IQ0A 1DIRA 3KB6A 4Q3EA 5G2OA 5JAQA 2VHZA 5KJ6A 1X13A 2PWZA 5KWEA 3JYOA 4UVGA 2GN4A 3WTCA 1P0CA 4KWIA 1TA4A 5A9TA 3VDRA 3C1OA 2XXBA 4FSHA 2O3UA 1ZBQA 3B70A 3MEQA 3W1VA 5HA5A 1OC4A 5CEJA 3RVDA 2CDCA 3UHAA 3RUFA 4K1LA 5JCXA 1UDCA 3SXPA 4AJOA 1Q2XA 3IUPA 1MX3A 2HK9A 3ORFA 4IJWA 2QG4A 4LSWA 1RM4A 4XQGA 4E5YA 4F45A 2C54A 2EJVA 3IDSA 2HSDA 2I9PA 4AJLA 3PQDA 4AFNA 3OQ1A 2WD7B 3UCEA 4DLLA 3DMYA 5ITVA 4ZD6A 1QMGA 4P38A 3RASA 2I5PO 4A73A 3N58A 4MVJI 4JXKA 3FSRA 4R1SA 1O8CA 1X7HA 1HE3A 2J5RA 3NYWA 4BGIA 1EQ2A 5TJHA 3DBRA 4OOFA 4YAJA 1A4IA 4YRAA 2DPHA 4WCFA 2FY8A 4RLSA 4B7UA 4M89A 1T24A 3BIOA 4JJIA 5CEFA 5L51A 4CUKA 1T4DA 2C20A 3ZV4A 4RF2A 2VN8A 4PLFA 2O3RA 1JKIA 1NVGA 2P9EA 1KBZA 1BMDA 2YUTA 3TQHA 3JQAB 4DQVA 5AXAA 4DQUA 4ONEA 2FSSA 5FF9A 4AJ4A 5ICSA 1BGVA 2DAPA 2I67A 5IAAA 3KYDA 1PJCA 1XKQA 3KHUA 1Y5MA 4H16A 4PLCA 3VZQA 3ZU5A 1YBMA 4IM7A 4HBGA 1XLTA 1PU2A 1X14A 1XU7A 4XA8A 3CIFA 1V3UA 1F0YA 4KUEA 1B0AA 3NDIA 1BRMA 4JROA 5DP2A 5DULA 3E48A 3PHLA 4JLWA 3RUHA 1NNUA 2YDYA 4WLUA 5JAIA 3PTZA 3WNQA 3ITKA 3UFXA 1VPDA 2OHXA 1WDLA 4K26A 3C24A 2WTBA 5HBRA 2H63A 2G0TA 3GAZA 1E3EA 4R1TA 1EUDA 1U8FO 1FDTA 2H1SA 4R3NA 5TX7A 2PK3A 1UUFA 1N7HA 3DC2A 1YB5A 1QYVA 5L7YA 4PLPA 1C0LA 2D59A 3TJRA 1HEUA 4LK3A 4DMMA 4TZTA 3PRJA 1LQTA 1ONOA 2JFHA 3ZV3A 4GX0A 4BNIA 3NT2A 3EK2A 3UUWA 4CUJA 2VUUA 3WBFA 2X0IA 2PKRA 3FBTA 1J4AA 2Z1MA 1DC6A 4CLOA 1JKFA 1Y8QA 5L45A 3VAZA 4J4HA 1Y8RA 4QXMA 3I83A 2PGDA 1L7EA 4I5GA 4RZIA 3RUAA 5T57A 1YOVB 5JBIA 1HDYA 3PI7A 1KYQA 3K73O 4KTTE 3TZHA 2GUGA 3O8QA 4W7HA 4YQZA 1DJNA 3DMTC 1F8FA 4L8VA 1V6AA 5HTOA 5KVQA 1R4MA 1I36A 1P1JA 1CRWG 2HMTA 3JD2A 5TT1A 4NJOA 1QYDA 3OIFA 3WYBA 4YT2A 1OOEA 3KOUA 3W6ZA 3TNLA 3GG2A 3U4CA 3COSA 3KYDB 4BMNA 1GUZA 4BNJA 2YFQA 2AW5A 2HRBA 4IDEA 1A9ZA 2AXQA 1UDBA 2GN9A 2G5CA 4AJHA 4CMEC 1ISIA 1GL3A 2WYWA 3D7LA 4OHUA 3PJFA 3TSCA 1DIBA 3IKVA 4UVIA 3JQ9A 2IYOA 1F8GA 1VJ1A 1A7KA 2G1UA 3INGA 1QSGA 3JQFC 4MIOA 4LMRA 1LDNA 3KEQA 3VPHA 4DXHA 1KEUA 3NX4A 2JHGA 4A0SA 2WYVA 4FCCA 3QWFA 3F9IA 1QYWA 1WMAA 3VH3A 3JQFA 1LRKA 4IDAA 3VPXA 3HHPA 2IXBA 2CNBA 2PKQP 3CEAA 4F6CA 2PZKA 2IEDA 3LF2A 1SB9A 4MO2A 1VKOA 3IJPA 1ZMOA 4ND5A 4MVJA 3HFSA 2A4KA 4Q3BA 1I0ZA 4D3SA 4UUPA 2V6FA 1K3TA 4HADA 4IDBA 2CFCA 1H6BA 4OYRA 4PFJA 4ZVVA 3ENNA 1QRRA 4EYEA 4LRSB 5KJCA 1D1TA 4D45A 4M49A 5LDGA 4BIIA 4PZEA 1RYEA 4CLOB 4WOKA 3ANNA 1YQXA 3DBHB 4IXTA 1JU9A 3ZW8A 5I9LA 1C1DA 3OECA 1U9JA 3TOZA 2QZZA 1Q0HA 2XPCA 2YHUA 3IS3A 2QYTA 4QFCA 5BNTA 4I9HA 1PWZA 3AM3A 3ZWPA 2Q1WA 1HL3A 2IEBA 2V65A 1PX0A 4GX1A 4GQAA 3JTMA 5IDQA 4ZICA 3HDYA 3MTGA 3ZHYA 1X1EA 2EEZA 1JAYA 5B1YA 3DZHA 4EI2A 3TPCA 4LSMA 4O0LA 3RC2A 1XELA 2BLLA 1DIGA 8LDHA 4RPJA 4ILKA 1RPNA 3WGTA 2CDAA 5ENVA 2BGMA 1E7SA 4PN3A 1P1IA 3PZRA 3JCZA 4ND4A 4UUOA 1XDWA 1KY4A 3VZRA 2ZCVA 5TJ9A 3AY3A 2PLAA 3VTFA 2XF8A 3JQBA 4KZPA 3HG7A 3OMLA 3KSZO 3I9NA 1IZ9A 1NASA 5F1OA 2EXXA 3S8MA 1BW9A 4A27A 3OH8A 1X7DA 4RZHA 3WQQA 1VE9A 4IDFA 3WICA 1BG6A 1P33A 3I4CA 4FJ2A 1EEHA 4FOSA 3V5NA 5IDWA 3AK4A 4RJTA 1YRLA 3LF1A 5KIAA 2R00A 3LT2A 1XSEA 2EGHA 4UEOA 4D79A 5U4QA 5A1TA 1J5PA 1PJBA 4NMHA 4R16A 1Z7EA 2B35A 4P4NA 3D4PA 1LU9A 1SC6A 1U3VA 5AXCA 4KUGA 1ZO8A 4MKZA 4XRGA 5TLSA 1PR3A 1L1FA 1DEHA 4NJMA 4RQTA 1PJTA 3WDSA 3DZBA 5EINA 1RM3A 1N9GB 1GYRA 5TT0A 4BKQA 4BNLA 1RM5A 2OBNA 4BMSA 5IN5A 1O5IA 1QYXA 1SAYA 4R1UA 1YO6A 4ALLA 4EGFA 4DREA 3UF0A 2CF6A 2Q2VA 4I1IA 4RORA 4ALMA 1VI2A 1MXHA 4FFMA 4PG7A 5F5NA 4XJTA 1I3NA 1Q7GA 5LDHA 5L53A 4S3MA 2Y1CA 2DFDA 2JCXA 3W4KA 1VM6A 3IJRA 3RC1A 3CE6A 4LCEA 3RUDA 3ON5A 2VT2A 4TZKA 2PD6A 3UOGA 4YT8A 2UYYA 3C3XA 2GNAA 3JQAA 4OXNA 3STHA 2ZCUA 1E77A 3PJGA 5K6AA 4FBGA 1MLDA 3QWBA 3CPSA 4QFDA 1V3VA 3ETEA 4YTEA 3UAGA 3HNPA 3JQ8B 3WG9A 1DIHA 4J0EA 2HKIA 4Z6KA 3ABIA 3BMQA 4Y6RA 1V9LA 4IMRA 3V2UA 5KVSA 3I9MA 3HN2A 3G1TA 3JD3A 3W6UA 3D5TA 1G6KA 3F1LA 3N7UA 1KEPA 4I9UA 4IPTA 1B16A 3P7MA 1NQAO 5C37A 5T6BA 2AEFA 1DFGA 2P2SA 4RDHA 4GAEA 1TVEA 3KVOA 1P77A 2FSVA 3UICA 1E1LA 4WJZA 4YJFA 3D5QA 3TFOA 4MP8A 1T2EA 3DZFA 1PTJA 3H65A 3PHJA 1XCBA 2VHVA 1JLLA 1H6DA 4JQCA 4YJHB 5IZCC 1AHIA 1LSUA 4R41A 3IAHA 3MWEB 4PG6A 5ILOA 4R69A 4YBZA 2GO1A 1IZ0A 2GRAA 1N9GA 3DONA 4J6FA 4FD3A 5JMPA 3WFJA 4EJMA 1LSSA 2YZ7A 3ZN2A 1EVZA 1LUAA 3GT0A 2B36A 5CPFA 1NHGA 3DHEA 4URFA 1UZLA 3I9KA 5COAA 4I5FA 4MKRA 3JYQA 3E03A 1VSVA 4XQEA 1XEAA 1PJQA 4GMFA 1GFSA 1LQUA 3QWHA 4R3WA 3E9QA 5EMHA 1LDYA 3AOEA 3UW3A 2BI7A 2O48X 3GZNA 3WLFA 4CQMD 5HS4A 3AFNA 4GWKA 4K28A 2PD3A 3PDUA 1QP8A 3R3SA 4EEZA 1SCUA 3WOHA 2VTDA 3I9LA 3B1JA 3PP8A 4M1QA 1NTOA 4XGIA 1V35A 5KNLA 1EDOA 2D5CA 3H9EO 4DWVA 1B8UA 2X0NA 3WWYA 3NKLA 3SJ7A 3BMQB 4J49A 1E0DA 1UJMA 3FR8A 1AXEA 3AY7A 4BO6A 1GAEO 7MDHA 4R51A 1HT0A 1PJ2A 2X1HA 5BSEA 3VZPA 1UXJA 2WE7A 3E5RA 5BR7A 3ZU3A 3NEPX 4B8WA 4E5PA 3R6DA 4N5NA 5L4SA 3C1TA 2DU8A 2XAAA 4UEJA 4TMFA 5T67A 5HM8A 4QX6A 4FB5A 1NFFA 2NU6A 3I9JA 2HJSA 1UXHA 4W9NA 5EQFA 3W8DA 4TRMA 3GAFA 2FR0A 4C7JA 3ZNQA 3H2ZA 2RIRA 2WD8A 2HDHA 4B4UA 4XYMA 5JCJD 3KSDO 1WZEA 1I3KA 1I01A 3WS7A 3BHJA 3LT1A 3V2HA 4CJXA 3FTPA 3QVWA 3GGPA 4LRTB 2VYND 3JD1A 4UULA 2VWPA 5TGDA 4LMPA 2GERA 1P3DA 4HP8A 3PQFA 1CWUA 1PGPA 4IGFA 4W82A 3RBXA 3BTUA 3KUXA 1QG6A 5DN9A 4KDEA 1PIWA 1IL0A 1VJTA 1RWBA 2Q46A 4J0FA 1U1IA 3VPGA 1J49A 4YA6A 2B4TO 1HTBA 4KMSA 3RFVA 5C7IO 3FBGA 4EDFA 5I7VA 1Y7TA 3LLSA 1QLJA 4R01A 2Y0DA 4Y6SA 4J1QA 2E48A 1H0KA 5L40A 3GVCA 5F3RA 1EK6A 1GD1O 3GDGA 2C2XA 2I65A 4IJUA 4IZIA 4YRDA 2EG9A 3BA1A 1PGNA 1Q7BA 4CM8A 4CMIB 5KKCA 4OM8A 1H9BA 1U2GA 4RLHA 4LGVA 3VH2A 2Q99A 3ZI0A 3MZ0A 3VPFA 5FI5A 5DBIA 3HSKA 1A27A 4XIJA 2Y0EA 1U8XX 1YWGO 2TMGA 2ZQZA 1GQQA 2F00A 2JD1A 4DVJA 5KJFA 3JQ7A 2POQX 3RKUA 1BDMA 3HZZA 2AE2A 2HRZA 3GHYA 4DTIA 2B69A 4HY3A 4BO1A 2ZYGA 1JWBB 1DPGA 2DKNA 3NAQA 5KKAA 4H3VA 1HYGA 1WLYA 3LQFA 4YJDA 5JYDA 1U5CA 4CR6A 1O9BA 5JYEA 4KWHA 3OM9A 2UAGA 1NFRA 1RM0A 4DQXA 2AQIA 2OXIA 2UVDA 1SEPA 1XYGA 2Q2WA 3CINA 3S2IA 4CQMB 2AQ8A 5T8KA 2GLXA 2ZATA 4K6FA 3OJOA 4YT5A 5BNFA 2J5KA 2BELA 2DBVO 3MJEA 1TI7A 3X2FA 2ZB3A 2NV6A 4Z3KA 4J7UA 2ZTVA 1LI4A 1PZGA 5JDCA 1SOWA 2AHRA 4W6ZA 4XIYA 4PRKA 4RVSA 2NWQA 4D43A 1TT5A 2D1YA 2ZK7A 2EW2A 2BRUA 3E9NA 5A05A 1J0XO 1PZHA 1X0VA 4GI2A 1E3IA 4BNFA 4MPDA 4NHEA 2EJWA 4W7IA 1U7HA 3ZWYA 3L9WA 2OP1A 4CMGA 1M66A 2WWRA 3GRPA 1M67A 4DC0A 3TZKA 2R2GA 4DRYA 2NQTA 1AGNA 4WKGA 3WGQA 5LC1A 2HLPA 4OOEA 1UH5A 3NT5A 1R4NA 4OO3A 1K0UA 4CM3A 2OOSA 3A4VA 4CMHA 3ANMA 2GASA 2Z5LA 5TIIA 4Z0HO 4FOOA 2BGLA 4DPMA 3Q9UA 3D64A 4R9RA 1NVMB 4GVLA 4QO7A 1BVUA 3WSWA 4J91A 2W90A 3GMSA 3HQ4O 3ZWWA 1BSVA 1YS4A 1CF2O 1ARZA 3EW7A 3PHIA 4CMBA 2JD0A 5THQA 4YXFA 1QXSA 2VOEA 3GZ4A 4JN6B 3QVXA 2VHXA 4ALNA 3ZNOA 3O4RA 4GLLA 5A5EA 1N1GA 2I66A 1Z82A 1Z7BA 5JXWA 1BHSA 3CH6A 4AG3A 2YHIB 2X86A 1Y8RB 4UEKA 3ROMA 2O4UX 4CR8A 3GG9A 4YJFB 3WXBA 4BKUA 1JVSA 4L9RA 3ULKA 1LDMA 4D0RA 3S55A 4CQLA 1GZ4A 5JS6A 5F21A 1NYTA 3AY6A 1E7YA 4ND1A 3ZW9A 2AQHA 2GGSA 3RJ5A 4KTVE 1EE9A 4KQWA 1R4NB 1WWKA 2AQKA 4N5LA 1TT5B 2B37A 2JKVA 5JPIA 1GV1A 2Y99A 3PPIA 1GQ2A 3GH3A 4EUFA 3E1KA 3M1LA 4NK5A 4XB1A 4J4BA 3WYEA 5TC4A 1SBYA 3ZV5A 4NBRA 3DBLA 1E3WA 3H9UA 2J6IA 1AN9A 4JBIA 4MVJE 1JWAB 1PS0A 4KQXA 1EBUA 3JQEA 3VKVA 1XHLA 4CM4B 1ZW1A 4IDCA 1IY8A 1NQOA 3Q1LA 4R1NA 1ML3A 4FW8A 4JP2A 3P19A 2PY6A 1YONA 1CDOA 1LLUA 1R15A 2FOIA 3H6KA 4TVOA 2OUIA 5EESA 2FRDA 1E6WA 4E13A 3O38A 5U9CA 4CM9A 3LVFO 1GCUA 4JX8A 5HWSA 5FI3A 3RKRA 3ZWAA 2QRLA 3L4SO 1U3UA 4L4RA 4TROA 3L0DA 4L4SA 4Z3DA 3ZNPA 4DC1A 1GEGA 3GVHA 3UGKA 3Q9NA 1KVRA 4IIUA 4RQUA 1C0KA 4CV3A 3R0IA 1MG5A 2GR9A 2HMUA 2ZKLA 1PQWA 1FDWA 4BNHA 5KVCA 3H5RA 4N7RA 5DDIP 5JO9A 3UKOA 5CDTA 3NUGA 5EPOA 1HKUA 1LC0A 2J3HA 4IY1A 4YAGA 3DOJA 1LLQA 3Q2KA 3VH4A 3HUDA 4HUJA 4MVJH 3UCFA 3OBBA 4RPLA 4IIVA 3WGYA 2IDZA 2OBYA 3EZYA 4AJ2A 3AJRA 4D46A 3MOIA 4L76A 4GWGA 3RD5A 2DUUA 3DEYX 5CDYA 2D8AA 5BNIA 3HN7A 1YJQA 1DRWA 3RFTA 1BXZA 1E6UA 3OA2A 3QIVA 4BO9A 3GN2A 1MC4A 3RSHA 5AYVA 3PJEA 3U0BA 3JQCA 5JC1A 4CM1A 4M87A 3JQ6A 2EKPA 1PZFA 5H81A 1SO8A 2Q49A 1MP0A 3BHMA 4NBVA 3VVBA 1NVTA 3CTMA 3DDNA 4ALJA 5CEEA 3INTA 3WJ7A 3WQRA 2VRCA 2EIHA 2GN8A 3JQ9C 3FD8A 4L4XA 1KY5A 3U4DA 1RJWA 4CMEA 4FFPA 1DC3A 3FNFA 2PNFA 1U2DA 5G0TA 4R5HA 4E2WA 3D3WA 1HDCA 1P1HA 5DZSA 4BV8A 5A9SB 3G0OA 1O6ZA 3F6YA 9LDBA 3GR6A 3E82A 3LT4A 1DXYA 2EGGA 3M1AA 1HE5A 3DMTA 4S1VA 4WUVA 4OKNA 1NR1A 1ORRA 4CM4A 3DTTA 1PJSA 1IB6A 3EYWA 2HO5A 1UR5A 1Q0QA 3DOCA 3EAGA 2OP0A 5TF4A 1DJQA 4HKTA 2PA3A 4BB5A 4ID9A 1E5LA 1ZUD1 2Q4BA 5DNAA 3ONDA 1LJ8A 2GSDA 5FWNA 2VZ9A 2C7VA 2Z95A 3GFGA 3D4NA 5THKA 5U1PA 2OO5A 3ZZNA 4Q3NA 1SOVA 1C14A 4PLVA 3GVXA 3CMMA 1E7MA 3C7DB 5GZ3A 5DT9A 5JW6A 1OBFO 3QV1A 4ZU3A 3LU1A 4PGFA 4TRNA 4OGWA 4RF4A 5HS6A 2VYNA 1Y5RA 3KM0A 4EBFA 2PZJA 4ALKA 1YE3A 4UVEA 4PIVA 1R66A 1YDEA 3Q11A 3I6QA 1K89A 4CM7A 3H9JA 3PIIA 2X6TA 1KVUA 2NACA 2YFHA 5H82A 3RBZA 1WNTA 3JQGB 4MVJG 4RCVA 1XA0A 3FR7A 2QRKA 3FPCA 5G4KB 4DIOA 4CLRA 5TS3A 1O89A 3ZWMA 3LC1O 5F5LA 1UP4A 2BFPA 4WLEA 3IOYA 3OQBA 3PLNA 3JD4A 5JE8A 3RWBA 4P22A 1LEHA 4NFHA 1P0FA 3PZBA 4BKPA 4U0KA 4YT4A 3ZWVA 3RUCA 3M6IA 3WR5A 1K6XA 2FZEA 5AVOA 5DCYA 3TRIA 5CG1A 1HWYA 2D5AA 3VH1A 5G4LA 4CV1A 3HFGA 2ZQYA 2ZB8A 3FPLA 4J1TA 3QE3A 4II3A 2X5JO 4DYDA 2P5YA 2G76A 1H9AA 1YL5A 5ITWA 1GPJA 4BGVA 1F17A 1AXGA 2JCVA 4BO0A 3K31A 4OJNA 5GZ1A 2HK7A 4WK6A 1ID1A 5CP8A 4BS9A 2E6UX 2X5OA 2NVWA 2F1KA 2NTJA 1ENPA 2BGKA 5T5QA 3KYBA 3GPDG 2C0CA 3S2FA 3P5SA 1CJCA 2O3TA 4YVFA 2FZWA 2X9NA 1JN0A 2VZ0A 5CDUA 2E82A 4GGOA 4WEOA 3WX0A 3DZKA 1NM5A 5IN4A 3SVTA 3OP4A 4CL8A 3TZCA 1D8AA 1ADBA 1RKXA 3H4VA 1EVIA 4PG8A 2O2SA 4MOWA 2Y1DA 1ZXBA 1ZSYA 1JKJA 4R9SA 1DC4A 4U6QA 1GUYA 4MP3A 3DZIA 1ZIDA 1B3BA 4E12A 4Z0TA 2P68A 4CLRB 2DBZA 4BNNA 5BT9A 2BFOA 1B26A 1O95A 1HSOA 2FPPA 2Y68A 4B3JA 2RHRA 3KTDA 4O59O 3WTBA 4CLEA 4DPKA 5B4TA 4FDAA 2Y1GA 3ZDFA 5TSDA 4MIYA 2ZJ1A 1HXHA 2NSDA 1PGOA 4FGWA 3OSUA 3D4OA 3OJFA 4WASA 2QRJA 3RBVA 2HCTA 5GMOA 2DBQA 5DCUA 3IP1A 3GNSA 2RCYA 2DUWA 3NJ4A 4DUPA 3PWZA 4E33A 3DAGA 3T4EA 4NH4A 4YJGA 1NFQA 4LW8A 1B15A 3SEFA 1NPDA 4O63O 4QSMA 4FN4A 1EK5A 4YR9A 4CQMA 1IYZA 3DOOA 3AI2A 1E3SA 4R4JA 1N2SA 3PWSA 4CMCA 4BKRA 2CSUA 2ZB4A 5JSFA 2CVZA 1Z6ZA 3TZ6A 2VYVA 3A9WA 4N5MA 5G0VA 5CG2A 2JCYA 2DTXA 2IYPA 2VT3A 2D3TA 1OMOA 3DFZA 1LDEA 3SC4A 1M76A 4XR9A 1QLHA 1EVJA 2X9GA 4KP7A 1P31A 4BO7A 1PGJA 2B5VA 1XU9A 3EVNA 5KOIA 3ADPA 4RL6A 1K6IA 3FTNA 3OHSX 1A71A 3BMCA 4GVXA 3ZCXA 1T2CA 5B37A 3DHNA 4MDHA 4CL3A 1V8BA 5C7OO 2BFAA 3I1JA 1G1AA 4UVDA 3DZGA 4R54A 1ISJA 1HDZA 2AE1A 2X0RA 1LSOA 3AFMA 4WGGA 4GKVA 3GDOA 5I9MA 5B12A 2DTDA 2YQ5A 3M2PA 4PLWA 4NBTA 5G0WA 2RH4A 4E2ZA 4NQZA 2V6MA 4D7AA 3JQ8A 1ULSA 2BHLA 4LCJA 5DP1A 1EUCA 1W0CA 4RO0A 4Y67A 1T1RA 4QUKA 1I30A 2VUTA 3VKUA 4AICA 2VCYA 2X23A 3H5AA 3IMFA 4Y6PA 4OXYA 4E31A 5JFOA 1EDZA 1PS8A 1BWSA 2P4HX 3BMNB 5COBA 4CMAA 1ZKMA 2X7HA 4YJGB 4P8RA 1A5ZA 3DXFA 1CYDA 1LA2A 2WDZA 3G3EA 4F3YA 2DVMA 4GSLA 3KLPX 4L0QA 4WPGA 1FMCA 3DFUA 4M55A 4Q39A 5BSFA 1P45A 2O7QA 3QA9A 1BXGB 3WGHA 1P1RA 2X58A 3KZVA 4BO8A 5C7LO 4XQ9A 3QSGA 4FFOA 3LYLA 3D3WB 1ZSVA 2O2YA 5DF1A 2Y67A 4PLGA 2UUOA 5COQA 2B4RO 3SLGA 3KXDA 1SEVA 3D3EA 1WDKA 3ICPA 2VHYA 4TKLA 4FIZA 4WECA 3QP9A 4FFNA 1TT7A 3L4BC 1DB3A 1ONNA 2WD7A 4QTZA 5A3VA 1D1SA 1D7OA 3AUAA 4Z9YA 4B8ZA 1E3LA 1GPDG 1HDOA 2VTEA 2X9VA 2YV3A 4OMUA 1BTOA 1LBEA 3EHEA 2NVUB 3WQSB 2NNLD 4TKMA 1B3RA 3LZ6A 4LISA 4PVCA 2YY7A 2PH5A 4DYVA 5MGBA 5CDSA 2O3QA 1ZK3A 4XYEA 1XIVA 1JQBA 2Q2QA 2OGUA 3L9XA 4DA9A 4YAIA 4DGSA 1N92A 3K2BA 3WIDA 3MJTA 3I4FA 1KOLA 4QO8A 4A26A 1LDBA 3WFIA 1XWFA 1VL8A 3JV7A 1ZZEA 1O94A 4J2OA 4N18A 3ZV6A 3BYZA 3PK0A 1HLPA 1Z74A 4IBOA 3QWAA 3C1AA 1VLLA 2Y05A 3V1TC 3OA0A 3ZH2A 1DHTA 5I8WA 4JBGA 2VOJA 4C7KA 5H83A 2Q1UA 4E2XA 2H5LA 4BNWA 1LTHR 4PRLA 1EFKA 4WOJA 5GY7A 5TQVA 4EW6A 4LVUA 3P2YA 1F06A 5L4NA 2CUKA 4CLXA 4O1MA 2GZ3A 4BGUA 1KERA 1E6EA 2WJPA 2GPTA 2Y0CA 1I3LA 1NP3A 2OFPA 3B6ZA 3TWOA 1P1KA 1G0NA 2FPIA 1ISMA 3GGOA 4PLHA 1UXKA 2QHXA 3PFWO 4H7PA 3U09A 1G0OA 4D42A 3MCVA 4IJKA 5I8ZA 1E7RA 1UZMA 2SCUA 1WXDA 3EGOA 1Z45A 1MFZA 4EITA 1HE4A 3GN1A 1ISFA 5JMWA 3A28A 4A10A 2GN6A 3NV9A 2E4AA 1KC3A 3RUIA 1X1TA 1WAMA 5B4UA 4J1SA 1WVGA 2QQ5A 4NZ9A 2CF5A 4G65A 4ND2A 3F47A 1OZAA 3GLQA 1K6JA 1I3MA 3PEFA 3JQ7B 4PZDA 4DIBA 5JC8A 4AJKA 4PLZA 2B0JA 3DBVO 2HUNA 3E8XA 3PHGA 1NX6A 4KOAA 5K6AC 1A7AA 2AG8A 2FWMX 3H9GA 4NIMA 3U4HA 5K0ZA 3PDJA 1JTVA 4K9DA 4Q3DA 3U4IA 2A9FA 4IS3A 5JDIA 1C0IA 2Z1NA 3DO5A 1SZJG 3OJEA 2HJRA 4B7XA 1YB1A 3DZJA 1PZEA 8ADHA 4OQYA 4XYBA 4FGSA 4YYZA 2Q1SA 4NBUA 4JCOA 4ROSA 4JIGA 2C82A 2IXAA 1ZK4A 1KC1A 1KVQA 2QYSA 2V7PA 2W2LD 4JK3A 4W99A 1ADFA 3A1NA 3G1UA 1VRWA 4YDRA 1GU7A 5L9AA 3K6JA 4WNCA 1NHWA 3QRWA 1WMBA 1LC3A 4PZCA 4A7PA 4DMLA 3HB5X 2CDBA 4E5MA 1H2HA 1UDAA 1GCOA 1P9LA 3IP3A 2NU7A 4DBVO 4XEHA 4RPHA 3ROQA 1C1XB 4BL5A 1LLDA 3WJAA 3ZWCA 3QW2A 3UN1A 3CXRA 4J7CA 4RVFA 4RPKA 3SC6A 3AOGA 1I10A 3H9QA 4XGKA 4CMKA 4FJ1A 4Z9FA 4ZHSA 1Q7CA 3DBRB 1E1KA 1CQIA 3ICCA 4BQRA 4E21A 4D3FA 2UUPA 2FR8A 4XGNA 1KVSA 1YQDA 2W98A 3WGZA 1BVRA 1RYDA 1XQ1A 2Y93A 2QX7A 3ONEA 3GHHA 3HJAA 1R12A 4NK4A 3DWFA 1LXCA 3JSAA 1HSZA 1IPFA 3BTSA 1IOLA 3RQSA 4BNKA 4I8XA 4AJNA 2GDZA 3LK7A 2ZTMA 5CDGA 1UAGA 3JQBC 1H93A 3QWIA 3IKTA 5K9ZA 3GC6A 3U62A 5F1KA 1EQUA 5A04A 3ZGYA 3I23A 1J6UA 4BNVA 3I3OA 1R6DA 2NQ8A 2FPGA 3GUCA 4MJLA 4E0BA 1X7GA 1WP4A 4FJ0A 3K96A 4WNIA 3PIDA 1FDSA 1SNYA 4F6LA 3EDMA 3ETDA 1R16A 3SLKA 3UCXA 1I8TA 4J16A 1H6AA 3F3SA 3D1LA 3MJ4A 4YAEA 3C85A 1JA9A 3NDRA 1CQJA 2BI8A 4NU6A 2O4CA 3PXXA 4IMPA 3GVIA 4CQLB 2PGJA 3LDHA 4ITUA 1BXGA 4K6CA 2IODA 4HFMA 1S7CA 4J3FA 2J8ZA 4WLNA 4D3DA 1NPYA 3A06A 2ILTA 2QZ9A 3KSUA 3ZNNA 5IDYA 5A5FA 3O9ZA 4NNJA 1N7GA 1EFLA 3AM4A 3FF4A 2TMDA 1Y8QB 1ZH8A 2VWQA 2C2YA 1E7QA 1SMKA 2HU2A 3P2OA 4XX0A 1DBVO 1U28A 1JDJA 4XKJA 3ZHXA 1YOVA 3AU8A 5EQDA 1YKFA 3K8ZA 3GGGA 2EKQA 3WLEA 2Q1TA 4I5DA 4P4LA 1DRVA 5JNLA 3ASVA 5IFLA 4ZRMA 2YQ4A 3TL3A 3O26A 2FMUA 1GQYA 2DQ4A 3D0OA 3RCBA 2X5KO 3B1FA 1PQUA 1CETA 4XR4A 4B4OA 3IQDB 2PD4A 3FNGA 2JAHA 3C7AA 4W9NC 5CFZA 1E3JA 1GTMA 3BTVA 3HB4X 3HADA 3QY9A 5EL0A 3ADOA 4L73A 4MINA 5CAEA 2EWMA 3Q2IA 3L6DA 2UDPA 2BKAA 3OETA 3ZWOA 3RFXA 1EE2A 4UVHA 2BD0A 3GFBA 4ZQHA 4BNYA 1MGOA 1ZFNA 2QIOA 4ZA2A 1DC5A 5G4KA 1T25A 4CMJA 4PCVA 1HYEA 3QQPA 5CPBA 2DBRA 1ULUA 4IGEA 4Z9XA 2A94A 4DPLA 3WMXA 2DTEA 3WSVA 4CM5A 4IDDA 4R68A 4ESOA 1VJ0A 4IJVA 4LN1A 4GMGA 1BDBA 1LDGA 3AOEC 4TRRA 3F46A 2OMEA 1ZSNA 3MOGA 1DLIA 3ROKA 4BVAA 5ADHA 1W6UA 1UZNA 3QVOA 3AU9A 4C4OA 3MWDB 3FN4A 2VZ8A 2IE0A 3HE3A 3OEYA 4IS2A 2BF7A 3DBHA 4J1NA 3WGOA 1KEWA 3TF5A 3EY4A 4Q9NA 5FEUA 3DB2A 2Q3EA 1T26A 3F1KA 2C59A 4GGPA 2RBEA 3U3XA 3ZWNA 3OF2A 5A06A 2EHDA 4BB6A 3K92A 5ICMA 4F46A 5JAMA 2P9CA 3K9QO 2VWGA 4IINA 2RHCA 1DHRA 4RVGA 2PH3A 5IDXA 1VSUA 4EZBA 3DQPA 4ALIA 4O5OA 4MVJF 2FHSA 3NT4A 2WE8A 1ZNQO 2A92A 3TDKA 1DOHA 4N54A 1I2ZA 2VNAA 2WEKA 3JQDA 4ZJUA 4EUHA 2XOXA 1NAHA 1YB4A 1FK8A 3GEMA 5L7TA 3K2EA 3F4LA 4RVHA 3OIGA 3UXYA 3BMNA 2PTGA 2PZMA 1P74A 3DTYA 5ES3A 5TNXA 2W2LA 1LLCA 3HWRA 5JY1A 3MJVA 2NUAA 3NDJA 1E92A 6ADHA 2CZCA 2NVBA 1EMDA 2C29D 3V1UA 1YJ8A 1W8DA 2V6BA 2LDBA 3BHIA 3EUWA 4BNUA 2C7GA 1GDHA 4FC7A 4ZQFA 2I76A 4OL9A 1H2BA 4BO4A 5EERA 1ZJYA 1F12A 3H3JA 4B7CA 4RPGA 3GVPA 4D44A 3ZHBA 3GOHA 4Y9DA 3EMKA 5ER9A 1AUPA 3IIEA 3JQAD 1VKNA 2W8ZA 5IG2A 1EBFA 2EF1A 3L6EA 1ZCJA 3MTJA 2HMVA 1CIVA 1LSJA 3DR3A 3MJSA 4G81A 2GZ1A 1H94A 3IL2A 1YL6A 4TVBA 4NG5A 1ZK1A 2EW8A 3G49A 4L74A 1ISHA 4EUEA 1B8PA 2CMDA 1WZIA 2OL4A 4GSKA 1I32A 4RVUA 1FDVA 1PL8A 1JAXA 2AEJA 2Y1EA 2JHFA 1HF3A 2H9IA 3T7EA 2GF2A 2R00C 1OAAA 4E30A 4DLAA 3KRTA 1UP6A 2IRWA 1P44A 3DL2A 4YEDA 3GQVA 1YGYA 2YW9A 3GF4A 3QLJA 2CY0A 3EVTA 3U5TA 3S2EA 1OC2A 1LX6A 2O3SA 3TZQA 5ENDA 2GCGA 3H3FA 4G5HA 3H2SA 1V0JA 1QORA 4IZHA 4BMVA 4J9VA 3JYLA 4BHTA 4LVCA 3NTOA 5L95A 4YRBA 3FCOA 2HMWA 4YWJA 3T7CA 3PFFA 5FFFA 4GL4A 5KCZA 1MXFA 2FR1A 4B79A 2YV1A 1DO8A 3V8BA 1DSSG 1X0XA 2PZLA 1XR3A 4QEDA 3PJDA 2RH8A 4JJGA 3SBOA 1L7DA 4I08A 3PQEA 2WMDA 1DDOA 1AHHA 1KEVA 2X8LA 4HNGA 2O3JA 5T64A 4AJPA 5IXSA 1O0SA 1QKIA 2C07A 1IHYA 2E37A 4TSKA 4YCAA 4IDGA 4MP6A 5EN4A 3VZSA 4CM9D 2Q50A 3C7CB 4GKBA 5I7SA 2IZ0A 4B4WA 3QVTA 4U6SA 2BMAA 4YJHA 4Z0PA 3AUSA 2HK8A 5GZ6A 1M6WA 1UXGA 3BXXA 1WW8A 2OORA 2PV7A 1EVYA 3PGJA 3LC2O 3IC5A 4EEXA 1NWCA 2ZTLA 3VVCA 3CMCO 2VHWA 4PLYA 3BMCB 1YBAA 4CV0A 1XGKA 2A35A 4OKIA 1I2BA 4OH1A 1ZMTA 3PVZA 5JO0A 2X4GA 3WGIA 4AVYA 4XB2A 3Q0EA 2Q4EA 2FN7A 1KETA 4HX5A 3G17A 1IULA 3KETA 4I9NA 4JBHA 2HQ1A 3I9OA 3PYLA 3KLMX 4WLVA 1N5DA 1W73A 5EJ2A 1FJHA 2HAEA 5DOVA 4WE3A 1ISGA 4UREA 9LDTA 3LLVA 4DBZA 4E3ZA 4J7XA 4NU5A 2ZB7A 3FNHA 5IXYA 1TEHA 3F4BA 3GDFA 3KYCB 3GK3A 3VC7A 1P1FA 2RAFA 4GX2A 1BW9B 2EERA 1E7WA 1MA0A 3K5PA 4DL9A 2G17A 1JW9B 5KVVA 1ONPA 2JJYA 3NTRA 4WCDA 3GUYA 1Y1PA 3K30A 2DC1A 3FWZA 3ASUA 3RU9A 4BO5A 4TQGA 4RF5A 1EUZA 2O50A 2NLOA 1PSDA 1TLTA 3FI9A 1MC5A 3Q6IA 4BNGA 4PLTA 1D3AA 4XYLA 4B3IA 1ZEJA 3AW9A 1NWHA 3F5SA 1DFHA 4UAGA 4GBJA 1H6CA 2DT5A 3V2GA 1B7GO 4OSPA 4NJMB 2PR2A 1HZJA 1NQTA 1N1EA 4ND3A 4KUHA 2P91A 3A14A 3JYPA 1MB4A 5IJZA 2D2IA 4RVDA 4B3HA 1E3WB 1ZJZA 1Z73A 3RJ9A 4FPXA 2H6EA 4NR0A 2W4QA 1PL7A 2I3AA 4RF3A 1AE1A 3O03A 5AOVA
chains in the Genus database with same CATH superfamily
2CCJA 2R5NA 3OPVA 1J1ZA 4FGLA 2H1OA 2RB4A 4CKEA 1OFHA 3VPSA 3STTA 3PFKA 2ZYVX 3CVYA 1UKVY 1TC2A 4RGBA 5A2GA 1SCBA 2WWGA 4M53A 3BZWA 3F67A 3WK9A 5DWQA 4M1YA 5FQNA 1L7PA 5KYYA 1HDRA 3W8EA 1MQAA 4DIFA 2Y6UA 3KYCA 3U44A 4E5NA 2GWRA 4KVGA 3DVAA 1NJ8A 3G9QA 3K4HA 1E1MA 1P4GA 2V6GA 3G88A 1CT9A 4W5HA 3FZGA 1MN6A 4X6UA 4XD2A 8ATCA 5AKLA 4PEVA 2QW0X 1D6JA 3QI2A 2QQFA 1OV6A 4Y98A 4Q93A 2C4HA 2H2GA 3U80A 3Q9LA 3F6CA 2B83A 4NMWA 4D9EA 2R1TA 5DNEA 1QZTA 4AO8A 1Q6ZA 2AYZA 5AI9A 3Q85A 4BUCA 3E5MA 4L5BA 3O4VA 1YR8A 3GDHA 3VZCA 3C3PA 1PR9A 2QD3A 2WJAA 3IX7A 5ED4A 5AXDA 1VXRA 4D4GA 2CBZA 4I4IA 4C89A 3KV3O 1RACA 4AUEA 2XCLA 1JLSA 3GJ6A 4IG9A 2RHGB 4ZQEA 3ACBA 4V3BA 1ZXXA 3C3MA 4PG4A 2JA2A 2WUDA 1ETHA 4YECA 3F73A 1D4FA 4MTCA 1U1DA 4JXJA 2MOKA 3I30X 4YO7A 3T8YA 4LUCA 2W2OA 3T34A 1Z4KA 2QW8A 2MSDB 1KDZA 1V7PC 2JAWA 4W9RA 1NMYA 3ZOKA 4BOYA 3PF9A 5HJ5A 2HW8A 3RIHA 4WVFA 1KI2A 1BZYA 1Q17A 1R9GA 4IOMA 2JFGA 4LRYA 1WDWB 3V8VA 4ZMRA 3ZWQA 2DBYA 2ESRA 4WCFC 5BUCA 1BOOA 3AHCA 4MI9A 4CM6A 3RC7A 3SM3A 2YV2A 3QK7A 1DJLA 2OKGA 4CR7A 3ZZMA 4C14A 4DLBA 4NCNA 1C9KA 4CLHA 5B3JC 3P26A 3NBYC 4FCVA 4UNIA 1SKMA 3IVCA 2Q5HA 4DMFA 1JR6A 2C5BA 2NU9A 1J39A 3IIIA 1UBOS 4MWDA 1LLFA 4UU0A 2P2YA 5DTQA 4RNCA 2ONJA 4MVJM 5CCEA 1SZDA 1ENZA 4MZDA 2FP4B 2Q7XA 1RP1A 1UBRS 2Y0PA 5H02A 4B85A 1FRNA 5AM5A 4ADSG 4CT5A 5IKMA 1DTSA 4DKJA 1OH7A 1A9RA 3HACA 3I0ZA 1Q0LA 5AH0A 5EWJB 2WTUA 1KKUA 4G5OA 2WRZA 3PYMA 2NAPA 2GEBA 2PX3A 2RH5A 4GE3A 5DBGA 3W6NA 2I2DA 3OOWA 4G5YA 1QYCA 3BIFA 3ES9A 2E5LB 1L5FA 2X22A 4G89A 4II2A 2DEUA 4QU0A 2DFKB 3A3PA 4XRRA 2N9UA 4X7RA 1CR1A 5ALFA 1VP3A 5D86A 1Y1SA 3UENA 5BSHA 1B1CA 2ZYRA 3D6HA 2CVOA 2HBZA 2UV8A 1SCJA 4NI5A 4RHTA 3H4IA 1CLEA 4A5OA 1K2WA 5CBPB 3E9MA 4JYPA 1E4OA 3H0CA 3PV0A 3EC7A 2R2AA 2VFAA 3HS3A 5FBQB 1HK7A 1NOJA 1ZM2A 5B3KA 5LBTA 2EP7A 3D4IA 1CEQA 3UA4A 4AJIA 2QR5A 3LO8A 2MMGA 1M2OB 3GY0A 4MB2A 5K8UA 1WETA 2IY8A 3B1KA 5FBHA 1J2JA 2GEJA 4BRZA 4R2KA 5KJ1A 4P98A 2KBFA 1JTEA 1GR0A 3CNBA 1TC1A 1ICEA 2AJTA 2D00A 4I66A 4DEYA 2P30A 1UAYA 3MW8A 5JRZA 3LBIA 1QVRA 2V9CA 2VHJA 1W9MA 3K6KA 3UUEA 2UUCB 1L5MA 1RRCA 3PGXA 4EMBA 1ZW6A 2ZITA 1PK9A 2QD2A 3P71T 4PBRA 4QULA 1UMDA 1CBUA 3G9ZA 2IPMA 4B8YA 4BWYA 2CNLA 4XFJA 2AOUA 2OBFA 1SXJE 3ZQ4A 4ZDIA 3LWDA 2CMHA 5J2UA 3K32A 3HXTA 3OJCA 5I8PA 1G5IA 2C03A 2A5GA 2G5GX 2EP5A 4RZXA 3WK4A 4ER5A 5B4VA 4MRSA 1NQ5A 3TIXB 2O2EA 1VPVA 4U5QA 3JQGA 3L7DA 3TOXA 2AMFA 4BNMA 3FYUC 1HEIA 2JFBA 3B8HA 3U7QB 4MW6A 4N5IX 4FHZA 5CHEA 3TVDA 3MUOA 2SKEA 3ANYB 4Q6BA 3CRNA 5JALA 4JSYA 1JH8A 4E5SA 3KOMA 4OFWA 2NADA 4C4SA 1B0UA 1FU8A 4RYDA 5JHHB 1WXWA 2CVHA 2XDWA 1E9DA 2ZIAA 4DQKA 3W8FA 1A5SB 3RYCB 2EFYA 2ZUBA 3FDXA 1VGRA 4KRXA 3U49A 2BCGY 3KWJA 1C0PA 2GYYA 3QVSA 1M75A 3VSBA 3V46A 2LCQA 3TFQA 4UEWA 4DADA 3EC2A 1SUDA 2ZSHA 3H2HA 3HU2A 2XOKD 3L77A 1GPLA 4KQ1A 5I9NA 1RRMA 1XYVA 1VMIA 2ZYIA 1P2FA 3SJUA 5DHTA 3V4PB 1BMFD 2BH9A 4N39A 5EJIA 3ONFA 3DOIA 3T9DA 5LQKA 3KQKA 2J1LA 4H3KB 1X9IA 1N8KA 3HP1A 3MB5A 4UTVA 5JD6A 1GLNA 3CUKA 1PS9A 2R87A 1GV0A 1PL6A 3DM5A 4JLAA 4JLVA 5JHGB 1U3WA 4M0DA 4G0QA 2XEXA 1LRLA 1TJ5A 3EZLA 1C29B 3OC6A 4JYCA 1U8YA 3TQCA 3M2TA 5ALGA 1E99A 4UOEA 2CKDA 3GUHA 5FNVF 1HZZA 4YR7A 3ZE0B 3LKDA 4CLDA 1MVOA 3HB1A 2V5AA 3GPIA 4JIMA 4KACA 5HRUA 2VQDA 4A03A 4CKXA 2C5AA 2WSSD 3FLEA 3I1YA 4U0JA 4YNBA 4CU2A 2Z43A 1XDBA 5F35A 3TPZA 5TE9A 5KTKA 1ZH0A 3T5BA 3MTAA 2YZMA 1VBKA 3K7EA 3VPCA 2QD4A 5H5JA 4H1VA 5TRTA 3MXTA 1PEDA 5LCXA 4IEFB 1XU4A 2VAPA 4I3FA 5E4YA 3IA2A 1YTUA 1A2BA 1AZTA 2AV6A 1XJWA 3Q8KA 2L42A 3QF7A 4X0EA 3SICE 3VPBA 3C4QA 2E5WA 3T5MA 2Y1OA 4OUDA 4A1FA 1IVSA 5JATA 1IHDA 1J2EA 1D2CA 3NWOA 1M8KA 1JKJB 3L0BA 3N53A 5D01A 3WBBA 4E32A 4HXYA 1QGZA 1PI3A 3KPVA 1SULA 3PLAE 3A9UA 2X77A 4O4HA 4WBNB 1YZNA 4LDNA 4NBWA 4N8DA 3SJBA 5LJIA 2A1TR 3RIMA 1GUFA 3OJXA 2V4MA 3F9CA 1CRZA 2A6PA 4X1IB 2A9RA 5AVYA 1T5OA 1I5RA 2CNWA 3ZGOA 3OJ0A 5A6VA 1DX9A 2C98A 5KC9A 1SCKA 4IUYA 1KJ9A 1IZYA 1UC4B 2BFFB 2QORA 1DAFA 2PUGA 1VTKA 4IHJF 3DAFA 5K5EA 2IYXA 2JC3A 2VH2A 5G0UA 3BB4A 2VKTA 1E2NA 5H70A 3C15C 2EDAA 2DM6A 1YVRA 3P32A 3RVLA 4DRXA 2ZIGA 2ZW9A 4UATA 2W2KB 4IUCS 5BR4A 1MUUA 1OPXA 2AG0A 1TM5E 1ORWA 2HLDD 2Z6UA 4O4LA 1LJLA 1SFRA 4OQXA 1E4EA 5HYVA 4NECA 1JFSA 2OESA 1E9EA 3RU7A 4R0MA 1ZXLA 2AEMA 3M9LA 5B3AA 4AZ3A 1EYZA 3GPCA 3IJEB 4MIEA 5K8LA 1YS1X 1TUBA 1JQLB 3E4DA 4WXYB 3JQPA 1PLLA 1TYCA 1JPUA 1Q16A 3ZBPA 3ZHZA 5A9RA 3NYQA 1PJ4A 4C4AA 3SNHA 1G8PA 2FEPA 2J59A 2KW5A 2ZTUA 4INZA 4NDNE 3W8RA 2QQ0A 3GRKA 4X92A 2QNBA 4Z1MA 4YALA 1NJSA 3HYTA 1PR6A 2QVLA 4EJ0A 1DAOA 5JWOA 1IIBA 4F4DA 4TVSA 2PBLA 4LQCA 1D09A 3IV9A 1KJ8A 5CCBA 5FOSA 5FYDA 1U8CB 3HKEB 5H16A 1WBBA 3CWZA 1P2SA 1HE2A 3O2JA 4JOBA 1FXWF 3REQB 4EECA 1XWIA 1P9WA 1QHFA 1S3GA 3D6AA 3T9AA 5IZCA 1FNMA 2XWQA 1G21B 4U9HS 1FBNA 1G7CA 4A0GA 1E2EA 4IXDA 3RIEA 1A9YA 5A3RA 5CW2A 2Z98A 5IKOA 3I5MA 2VCEA 3Q7IA 4U2KA 3ORHA 4ER3A 1C1YA 3A6LA 3O74A 1EXWA 2NTNA 2PRZA 4L16A 4FFLA 4YH1A 4BE7B 3W5CA 2LVBA 1J23A 1MU0A 3CWCA 2P8SA 2DPLA 2ZBPA 3OCCA 3LFUA 3D6MA 1IEQA 2BJHA 1U3CA 2CNOA 2XXJA 1T9GS 2FUEA 4ZT5A 1I7QB 1NF9A 2ZR9A 3OUZA 1Z2PX 3I6BA 4IQ0A 2NUPB 1DIRA 1W2HA 2EJTA 3KZNA 4LX0A 1PR0A 2VHZA 4B6QA 2VL7A 3F3YA 1N2HA 1QGAA 3WTCA 4AAYA 2HNBA 4GP9A 1P0CA 4KWIA 3RRFA 3U81A 4B46A 2YJGA 2Q6LA 5AIAA 1TA4A 4AKSA 3GOQA 3C1OA 1W6RA 2D62A 2RB5A 1JFRA 3MEQA 5IK2D 1P29A 3PGA1 2O59A 4HQNA 3OSZA 2DR2A 5CEJA 1U0FA 4OXXA 5GONF 4QRDA 2FJUA 4MGKR 2CDCA 3S1AB 4DXAA 2OG2A 2GM9A 1UDCA 3H3XA 3NTLA 3SXPA 3UV6A 5BWLA 5JSZA 3AZOA 1Q2XA 5K6TA 4Q01A 4XQGA 4NFLA 4HDSA 1NYRA 4JHXA 1QDUA 3ZY4A 1CJKC 1QDEA 3UT0A 3VZDA 1WXXA 4GWLA 2BN4A 2W2PA 1J22A 4AJLA 5H3CA 1G3MA 3RANA 1ORIA 2Z08A 3TW4A 2OCXA 1V4NA 3AF3A 4XUCA 5HE9A 5IHPA 4B1FA 4AF8A 4IDPA 4P38A 1GNLA 3RE1A 5BMVF 3RASA 5JVDA 3A27A 4B4KA 1S96A 2EFCB 4JXKA 4MVJI 4R1SA 1E1RD 1MDFA 1QIFA 1OA0A 3MUFA 1G7SA 1HE3A 2YVAA 3IBFA 1D0SA 3NZEA 1G5FA 1EQ2A 3OT1A 1DKRA 1QM5A 2XTNA 2OSBA 4NS4A 3X1KA 3N2KA 2NV2B 2F3UA 4WCFA 2FSFA 2E3JA 2FY8A 4M89A 3BIOA 4GYWA 3FF1A 4OYHA 2XA2A 2HCBA 2TYSB 2VKQA 3JASB 4WN9A 4DWOA 4X66B 1CQZA 3G0CA 5E0KB 1FX0B 5J2TF 4KXLA 4JT4A 1U7XA 1M2JA 1KBZA 1BMDA 1JG7A 4L72A 4D8TA 5AXAA 4DQUA 2I22A 3IVMA 2P1DA 4IOJA 1M8GA 1RLOA 3QX9A 3EEOA 1TM2A 2DAPA 3OEHA 4KAAA 4R7TA 1XZQA 4RSHA 5CXSA 1E2PA 2EQAA 1YVUA 2P69A 3IE2A 3KYDA 5BNWA 4PLCA 3ZU5A 1T0PA 1XQYA 2GVDC 2I1WA 1AK2A 5HCNA 4LJSA 3FOCA 4BZWA 1IPHA 1X14A 1XU7A 4QGFA 3CIFA 2FI1A 1NBAA 2GPYA 2PSDA 3PT9A 4F2DA 3NDIA 3GJ7A 1VJRA 2BZ0A 4WESB 3UJNA 2CLOB 1WY7A 3U3KA 1ESCA 5DP2A 4U00A 4U7HA 5K6RA 2O1XA 3OD5A 3ZHOA 3B13B 3G2QA 1J2YA 3LPMA 3RARA 3REGA 1NNUA 3B12A 3PCTA 4LRXA 3RUHA 4B6EA 3ITKA 1BCSB 2OHXA 3QE2A 1JF8A 3VISA 2IHYA 3NRJA 1G5RA 1ZUHA 3C24A 2WTBA 1E62A 1EWKA 2G0TA 2P27A 2QY9A 3DVLA 3GAZA 3PXDA 3WGMA 4B84A 2ZRLA 1RXUA 2C1XA 3CLTD 3L8MA 3UUFA 3NPMA 4V0LA 2Q4RA 2QL9A 4AYWA 3ZEAA 3EDRA 3CW2A 1L5KA 2KLBA 3S29A 2YH2A 3M49A 1UUFA 2W00A 1TK3A 4M1ZA 3M4JA 3NP9A 1YB5A 4I2NA 3RUPA 3N0WA 3S27A 3HVRA 3AZPA 3BXEA 4DMMA 4PIPA 5BN1A 4XAQA 5KYTA 4TZTA 2YKGA 1N6PA 3EUAA 3IDFA 1ONOA 3P2IA 3TLZA 3TLYA 4S1OA 3ZV3A 2PX4A 4PXSA 5FPPA 3D4LA 2X0IA 3TM5A 1SCDA 2HA6A 3HCBA 3OCJA 3CCCA 1AKQA 3K8QA 2Z1MA 1U2RA 2CNWD 4WAUA 2PA0A 1JKFA 1KO8A 4J4HA 4PHFA 4LE2A 5CJPA 4BLPA 4QXMA 1E5VA 2A9VA 4I5GA 3ROZA 3DPUA 2QM0A 1YOVB 3GP3A 4MJ7A 4QPZA 3QNUA 3STYA 2GCIA 4DEXA 4NU8X 3D8BA 1X39A 1CEXA 3PI7A 2GUGA 4W7HA 4YQZA 1X70A 3GRCA 1ZC4A 5CRIA 1KFBB 2J5BA 3DMTC 3HY3A 2JLRA 1AG9A 4FWIB 1N7JA 1QYIA 5KVQA 4CT4B 3SWWA 2VJMA 1KQGA 1CRWG 3ZK9A 2AS0A 2HMTA 3BG5A 2FPSA 1J24A 3GRYA 4NJOA 4YT2A 1ZJ5A 1KK3A 4ZZIA 4BX0A 5E1BA 1IEVA 1ZKDA 1MOPA 3COSA 1D6MA 2ECQA 3SZRA 4MW1A 2VJCA 2DECA 1BWRA 1VJCA 1ZIPA 5JAMA 1WKBA 2YFQA 1QO7A 2BMEA 3PKIA 4BAZA 5AIBA 2XB2A 3DPIA 3WIBA 4CMEC 1ELOA 2QL6A 5BXYA 3Q3HA 2CEAA 4H1UA 4YRLA 2I62A 5KUTA 5DWDA 2IYOA 4RZQA 4YLYA 1VJ1A 1A7KA 2GKOA 3INGA 1IWPB 1C9NA 2JANA 4LMRA 5FUQA 3F4KA 5ALMA 3R6WA 1YRBA 2F3PA 1OFVA 2WYVA 1GPUA 3PPVA 3FWPA 4PO1A 4AB1A 5B57C 4QOSA 4U7TB 4I1VA 5DCLA 4Y2PA 1KQ3A 1LRKA 1KI8A 2I55A 2IEYA 2IXBA 3VC1A 1QFYA 1SXIA 2PKQP 3TIIA 4F6CA 2Y1KA 1Q77A 2C0QA 2PZKA 4Z4EA 3N2YA 3QLVC 1CULC 1G63A 2HN9A 2QRVA 3FSEA 4B71A 3IJPA 3R3YA 4Z53A 4MMYB 4RMNA 2ZYUX 4FXOA 3CF2A 4QUHA 5DMHA 5ALLA 4U02A 3HYNA 3V48A 3T9CA 2PZFA 4C6TB 2A4KA 1Q44A 1JU3A 1I0ZA 1IHPA 4D3SA 1R9JA 4UUPA 4UHFA 3NHMA 4DIDA 3ZVMA 3WNCA 3DTVD 1W581 2HCJB 4G1CA 4IDBA 5CD9A 2VJLA 3BX1A 3V97A 1C8LA 3HU3A 4ZVVA 1P80A 3NR2A 4G6ZA 2QX9A 3TIFA 4JB0A 1ZX1A 3D59A 4BFCA 1XZ8A 3HEAA 4GXRA 5DI9A 3IVAA 3ZY3A 2XF2A 4Q34A 1RYEA 4TKZA 1NXXA 4WOKA 2QPLA 3DBHB 2PU7A 2YY6A 3C7KA 1PT6A 2HNKA 5TQJA 1ZAKA 2C94A 2GESA 3BXOA 3ZW8A 1U9JA 4H0NA 3SVLA 4YROA 4HDMA 1Q0HA 4Q1EA 2YHUA 5SZIA 3UT5A 1XRQA 3OKPA 2OZKA 2GZRA 1NE7A 1IN7A 3QXJA 3E2IA 3BORA 3HV0A 3K9FC 4P1ZA 2VQSA 4QG3A 1N2JA 1XXLA 2OHIA 3A6DA 4KE6A 3EPJA 2N46A 4GQAA 1OXKB 2IYLD 2PX6A 4BP8A 4YCLA 4L50A 4ZICA 1JWLA 3EZXA 3HDYA 1AVTA 1RBQA 1AQLA 1X1EA 4MLZA 4PQFA 4XTRA 4J16C 3LUHA 5EIXA 2ZPUA 3UBTA 2AOWA 4FYHA 2JLVA 3MILA 1SC1A 4LSMA 5K8TA 1W36D 1TIPA 4O29A 1OAOC 3KEFA 1XXHE 3CNHA 4UHDA 3SFTA 2W2QA 3VAAA 2PS0A 2XGJA 4ILKA 2Z2YA 3HZHA 3PQ2A 3G1WA 1QS0A 1AB6A 3IUNA 3W2GA 3FTFA 2Q6VA 3DMPA 2AL7A 4ZVPA 4PN3A 4GM4A 1DBSA 3N8HA 3N39C 4FZJA 1DE0A 3G5MA 1XDWA 3VZRA 3ZGZA 5IW8A 4FT4A 4WTOA 3AY3A 1RBZA 3VTFA 1V8PA 1BX3A 3UWDA 5FBZA 1W93A 2V5VA 5FLKA 1EXNA 3G2JA 3KSZO 3I9NA 4NYIQ 1ZMRA 2HTEA 2XX3A 4JFAA 1X19A 2JDIA 3A58B 8AT1A 3WV5A 4V1CB 4Q4CA 1REQB 1ZRNA 2ZULA 3BD6A 3EG9B 3WB2A 1AMOA 3A1WA 3RTGA 4CHTA 1VE9A 1CUWA 3EOBI 2LGJA 3GIWA 3K9HA 4FOSA 3V5NA 2PSSA 2C3UA 2WUEA 1EGMB 4Z3OA 4RJTA 3M5CA 5KIAA 2R00A 1KMHB 1FFGA 1PG5A 2WSIA 4UEOA 3B51X 3OLQA 4OQLA 8MHTA 5U4QA 1J5PA 1OLUB 4RIFA 2GZSA 4UOQA 2VYCA 3PGVA 3PNSA 1FDRA 3KXKA 3ZCRA 4P4NA 3ZDCA 1LU9A 5K0CA 5KYVA 5AXCA 4XRGA 1AGRA 3BRWD 1HDIA 1IXRC 1VZ2A 2FKNA 4JB2A 1PJTA 4JLKA 4NJMA 5ARDA 4BE9A 5FPKA 2R6GA 3UPUA 5TT0A 1FW6A 4BNLA 3OKCA 2PMCA 1TQ2A 2DQYA 2DQSA 5DSXA 1V1JA 2OBNA 1GG8A 1K7FB 1DKOA 4PX2A 1PLKA 3OX3A 4DM3A 2OT3B 4XH9B 4TXJA 1W1WA 4DREA 4TV8A 2PSFA 2Q2VA 5AKHA 2R6ZA 4F7WA 2ZBDA 4NY1A 3RVQA 4FFMA 1RCFA 1EK1A 1F5SA 1SVKA 5F5NA 4XJTA 3CZCA 1I3NA 4EYQA 5BWMA 3MELA 3U4MA 2P6RA 4PCAA 4K87A 3RFUA 1ORDA 4MULA 2D54A 2OILA 4YAOA 3RAPR 1VM6A 4KGZA 1GTSA 1J8FA 2QV0A 3RC1A 4LCEA 4Q47A 2VT2A 2GILA 3ROFA 5IC4A 4KR7A 3H17A 4MAMA 3ZCTA 2HV9A 3CHYA 2RIPA 1T3SA 4I1PA 2AI1A 3PJGA 1E77A 2AVDA 4I0WB 2H7VA 2RDMA 4RD3A 4FFSA 4POOA 1PLJA 2MCFA 2I8AA 2VSOA 3CPSA 5BW5A 3HJFA 3ETEA 1YE8A 1A88A 3VHXA 3JQ8B 3WG9A 1JZTA 3IQZA 4F12A 5DVZA 3BMQA 3Q7PA 4PRYA 4Y6RA 2IHUA 5FO0A 4BYMA 3FUTA 4L9SA 5KVSA 1XTTA 2AWNA 4C07A 4MRMB 2CXNA 3LC0A 3JD3A 2BDTA 3D5TA 5CDFE 3D3NA 4FW9A 2GN2A 2CMFA 1USGA 2PT7A 1NQAO 3UWPA 3Q0TA 1WB5A 5T6BA 4EY4A 5C37A 1DFGA 1N7IA 1VE1A 5FOWA 3U0VA 1TVEA 1FS6A 3N87A 4I4TF 3CISA 3OLYA 3UICA 4IMIB 3BRWA 2P1ZA 4YJFA 3D5QA 4E88A 5HXAA 4PRZA 4DKXA 4L15A 5LKRA 1PTJA 3PHJA 1E8MA 1R3UA 1UMBB 5LQCA 3H9BA 1U0EA 2QN3A 4MYSA 3FJ1A 4YJHB 4DMGA 5IZCC 3U17A 3O82A 4IVRA 1ZAYA 4PX9A 2PUAA 1KSHA 4R41A 2FUG1 1KQOA 3IAHA 3MWEB 5LUBA 4AS2A 4B3FX 2BLNA 1JNXX 4GLJA 3WFJA 5JMPA 4UNSA 2YZ7A 1X38A 4IEEA 3IAM1 2QMEA 3TMKA 1LUAA 4JOQA 5CPFA 5GOTA 2OLJA 4B43A 2OCGA 1U0TA 1EG2A 2M6RA 3DHEA 4MWBA 3AJ9A 1Y9DA 2GXSA 3F98A 3RW9A 1BGXT 2Z09A 2FF5A 4LNHA 5ESDA 1WPRA 2XGSA 4BJ6A 5DMXA 2WU1A 3OURA 1XEAA 2HJGA 1L5LA 1W5SA 2I80A 2F1JA 2WIJA 3FG9A 4JQOA 3AWIA 1JBKA 1E9SA 3E9QA 2OGTA 3FHOA 5EPUA 1RJGA 3AOEA 4QIHA 1X1QA 3UA3A 3GZNA 4JBXA 5E2IA 2UZ1A 3BF8A 2OEPA 4EHIA 1SCUA 2GJ8A 3L02A 3I5XA 1DV1A 2EYQA 2BZSA 1CUIA 4FFBB 4LBWA 1NTOA 2RFLA 4XGIA 3GU3A 4BVEA 5KNLA 1L4LA 2D5CA 4KXWA 1YDFA 1EUYA 4A16A 2X0NA 1BEZA 5T7BA 5HVNA 4ABTA 5HMLA 1YZVA 3X1XA 1GSIA 2FXVA 4C76A 5BYJA 3TLJA 3JQRA 4BO6A 3T7DA 4B2LA 1Z4QA 1HT0A 2X1HA 2ZBRA 3TLXA 1A77A 3E5RA 1VHJA 3W2HA 2HHHB 3ZU3A 4B8WA 1EFPA 3B48A 3C1TA 1UBCA 2DU8A 4HR7A 2XAAA 4UEJA 5FWXA 1CR0A 3FCXA 1GT91 3ZZTA 5HM8A 3DMNA 3H0KA 1TD9A 4JI4B 1BVHA 2G1PA 1DU4A 2ODQA 2OPBA 1X1BA 2HJSA 1G20E 1A82A 4KQEA 4ZYWA 1Z4NA 3RS4A 1FFEA 3DO6A 3TS1A 2FR0A 3ZNQA 3H2ZA 3FPGA 2RIRA 4JITA 2F62A 4PAMA 4QFBA 1RWWA 1S3SA 1DCFA 3DVSX 1HR0B 2AZXA 2X4DA 4R1PA 3IKMB 1U7DA 3EZ7A 5M3BA 1EAYA 3WS7A 2PSHA 4B6JA 1I7SB 3RRMA 1IDOA 3QVWA 1P0QA 3MBIA 3GGPA 4LRTB 2VYND 1XALA 4G9GA 3EWAA 4DNOA 4LMPA 5I7HA 3FFAA 4RIIA 3DJFA 3OX2A 3PQFA 3WWPA 1E1RA 3MS2A 2DKOA 5E6SB 5EFZA 3T3IA 1VSQA 1VA4A 3GFVA 3SQMA 3T7TA 1QG6A 4ZALA 1IU9A 4HAXA 4PAOA 3VC2A 4X00A 2B8WA 4DGQA 3TIGA 4A82A 4GU5A 4YP7A 3TJMA 1OLSA 2ZJ4A 4BEVA 4J0FA 1PUIA 4ZI7A 4PNZA 2D0OB 1ZPDA 2YWBA 1AT1A 3SF8B 2RJNA 2XGGA 3EQ2A 3ZVLA 3QPUA 2PANA 4QHSA 4Y6SA 3ESAA 1QHGA 5FXMA 4W1PA 5L40A 3MTEA 4DUYB 2P75A 2W2VA 2YVQA 1YR9A 1GD1O 3N9IA 4S1PA 4OHWA 3TLCA 3TVYA 5C1BA 1JLRA 2W6MA 4YRDA 1I1HA 3F9RA 2R0QC 1UBLS 3MRTA 3G5AA 1STOA 1YE5A 1PGNA 1TFUA 1U98A 3F6PA 4CM8A 2BJWA 5J1TB 1W36C 4OM8A 4RK4A 1XCGB 1NMZA 2GMWA 5KMGB 1U2GA 3KZ1E 3QXCA 5BQPA 2FPKA 2UVPB 3RIXA 3VH2A 3T3NA 4QDZA 3V1NA 2Q99A 3ZI0A 1FP4B 2CJWB 2SECE 3MZ0A 4QXOA 3VPFA 5LP6C 3VGJA 3HSKA 4XIJA 1G66A 2PWBA 2QTNA 4F2PA 1Z22A 1NJ6A 3N5KA 1YWGO 1UJ6A 2BR4A 1I51A 4KAXA 4LQDA 4B3TB 1RPJA 3MQFA 1AUOA 1JEAA 1NUAA 1P8JA 1WKVA 1Z5ZA 2XUOA 4L27A 5D5QA 2UZAA 5FTMA 3T5DA 3JQ7A 3RKUA 2O9JA 3GHYA 2VK2A 2ZYGA 1JWBB 3DYBA 4Y0NA 1C7IA 5ALYA 1W75A 1JR2A 1B76A 4MUGA 1ZISA 3MOSA 3NAQA 3OTQA 4DLKA 4NMXB 4QNMA 1KDRA 2SICE 4L5YA 5JYDA 1P7CA 4D4KA 1Z56C 3GPLA 3FETA 1YZQA 1MZVA 1V1MB 1RMYA 4MWEA 3X2SA 2F1RA 1O9BA 3P0HA 2UAGA 3NWPA 3T1VA 3TRFA 2AQIA 2GYWA 4LHZA 2UVDA 1FMFA 2AQ8A 1IAVA 3HGQA 2GLXA 4EVQA 3HJNA 3QJGA 2VAVA 3L5OA 2ZATA 4K6FA 2IYNA 2WYIA 1XZLA 2AK3A 1Y1QA 3M6AA 2AOXA 2V7BA 3HWWA 2FAXA 4BV3A 5J47A 3MJEA 4DV6B 4KREA 1Z6AA 4FP9A 4ZKEA 1YD7A 2I9KA 1NI4A 5EP1A 2MSCB 4MQEB 5ALRA 2A86A 5E3JA 2GD6A 3G2IA 5EWLB 2WIKA 2XNDD 1Q5PA 1KDTA 1X94A 1ZD8A 4IKOA 2NWQA 2IYQA 3VI3B 3ZZ1A 3I01A 2EW2A 2ZK7A 4MH0R 4AZ0A 4UFPA 1J5EB 1PZHA 2ZKIA 1X0VA 3BHNA 5E1OA 3H04A 4G5SA 2EJWA 2WU0A 2BM9A 3GXOA 4W7IA 4E94A 3QKTA 2PTHA 2QP4A 2OP1A 2YY5A 3OLXA 3PUZA 3OZCA 3QIAA 4D8WA 4E07A 2WWRA 3VNAA 4YMHA 1Z6TA 3WSTA 4DC0A 1RPTA 1XTVA 2BFCA 3C3JA 2YCBA 2P9HA 3HKCB 3P96A 1AGNA 5SY9A 3QE9Y 1KYZA 4NDAA 1DOZA 2AG6A 3NT5A 4OO3A 1IY0A 5FPYA 5CVUA 1U8ZA 1YIDA 2OOSA 1QH1B 2QYOA 3D31A 4OUKX 3MTBA 4CMHA 1CQWA 4WXRA 3FRIA 1PJRA 1UFKA 4Z0HO 1XJQA 1GCIA 1SKBA 2ZR0A 4RJJA 4HEA1 1VIVA 2WWTA 1NSFA 1X9HA 2BTOA 1L1EA 2GM4A 4GEKA 1V41E 3K9WA 2W90A 4EHDA 1YS4A 3LXXA 3IEPA 3P9RA 2NMVA 3EW7A 3RVKA 3P9YA 3PUYA 5BUQA 4RHUA 4RE5A 1QXSA 1GCGA 1YMQA 1U7WA 2B4KA 4G97A 3LX4A 4X1OA 3FKSA 2IHKA 3JVVA 4JN6B 1M5RA 4TT3D 3I1IA 3AFOA 2XSZD 4ASUD 2H3HA 3AF1A 4OB6A 5IDVA 1Y82A 5E7MA 5ED0A 4OH7A 2WP0A 5JXJA 1KAQA 1N1GA 4OBXA 2IE8A 1Z7BA 3DUFB 3I0NA 4V0RA 2YHIB 3GAMA 4LBYA 5EKDA 1CUGA 1I6LA 5CGQB 2WG2A 3QG5A 2D1FA 5B1EA 1Y8RB 2VPQA 4UEKA 2O4UX 5DFAA 1XLUA 3ROMA 4DSOA 1M2EA 3GG9A 1L3BA 4YJFB 3U7EB 3HDGA 5KYWB 3ESXA 2OCAA 1M74A 3NBXX 4CQLA 3KJIA 2FG5A 1NYTA 5F21A 2RK6A 3RRJA 1Y4SA 3M82A 4BWVA 2JIOA 4DZZA 2XMQA 4D9IA 4PHGA 3KE9A 1BDHA 2FE1A 2Z3ZA 3OZFA 1EE9A 4CEJB 1M3SA 4RANA 1RJFA 3U7HB 1V1RB 2AQKA 1HFKA 4URWR 5AVVA 3GQBB 2JKVA 2R1ZA 1Y42X 1OLXB 4P3XA 3PNLA 3V33A 4KITB 1BE8A 2B20A 2QRQA 1YTLA 3GH3A 1N0VC 4GOLD 5A5VA 3IOCA 3KP1A 5MN4A 3DOHA 4BFVA 1N2OA 2RKOA 3R8FA 3WYEA 4JV5B 2Z6VA 4OXIA 3DBLA 1JDBB 1M1XB 2XMCA 3GGSA 3T4PA 4BWFB 3OE7D 2QX4A 1GA1A 1L3CA 1N5JA 1IBCA 2ZBVA 1YQQA 3ZKWB 3NPAA 2LWIA 1E2GA 3TUZC 4EHKA 1ZW1A 3AESB 3SCZA 1JBEA 4QHTA 1CUVA 4F1WA 5KBYA 2QE7D 4R1NA 4I4LA 1EFTA 1E89A 3WAGA 1OAOA 4YRPA 3EA0A 3OF3A 1HFJA 3GLKA 2VHEA 3T3DA 5EI5A 4XVHA 3WL7A 1KE1A 1FP7A 2FRDA 3F3KA 1E6WA 2BY4A 4K46A 5KX5B 2K2QB 2CD7A 2GJSA 2OKCA 2XH8A 1G3RA 3D54D 4JWKA 5U9CA 4HAWA 1T43A 1LK5A 1GCUA 3UMFA 3LZDA 3OQHA 4D82A 5LQRA 5A62A 4NZNA 1P5ZB 2QPOA 3BE8A 1RI3A 1K68A 1ZIOA 4PAQA 3V32A 1K3FA 3P5BA 4TROA 1VMDA 2C5HA 1DUIA 3VSEA 2MHCA 3FMVA 4AQYB 4RQUA 1N9ZA 3DW3X 3EZFA 1C0KA 3NONA 4CV3A 1EIWA 1G3UA 1JDBC 2WB4A 2R1TB 1MG5A 2J5XA 5CBKA 2V0CA 4V0SA 1WUHS 3BSWA 3D6UA 1C9YA 2LUOA 3GT7A 4KJXA 4WZBA 5DASA 2GYUA 3MC1A 1Y4ZA 2IDMA 4CHGA 1COZA 3H5RA 1YQUA 1IM2A 1NF8A 3EDCA 4KW7A 4UM8B 1II8B 4Y1RA 3F3MA 2XMRA 5EPOA 1DQSA 2PZAA 1LC0A 2J3HA 2P90A 2PSEA 3QKSB 4RV5A 5AKGA 1KKMA 3OFNA 4V03A 4F86A 3HUDA 2A1UA 5CM8B 2CT8A 4ZYYA 1ODKA 3I2GA 4IIVA 4C2TA 1Z12A 3KJEA 2QGNA 3EZYA 3FOBA 2P0EA 1ND6A 2J0UB 3OMWA 3RBAA 4L76A 4GWGA 4WN3A 4NZYA 1THGA 5CDYA 1JHXA 1HFEL 2AI2A 4HGZA 4MQ4A 2EIXA 2NTYC 4A92A 3U48A 4B3CA 1UBJS 1DRWA 1E6UA 3NBKA 3AG5A 3GN2A 5C46F 2K5UA 4LF9B 3EDOA 1BH2A 3LKVA 3M81A 2YNMA 5AJTA 4H7FA 5AYVA 2CV0A 2HZ7A 2LR0A 2DETA 3B7WA 4YP1A 2XZLA 1OREA 4PPNA 3NWJA 1W35A 2EKPA 3TTTA 4TYPA 3LTNC 3GRAA 3EARA 2GVZC 3BC1A 3VVBA 1U65A 3CTMA 3DDNA 4P5EA 2AXPA 1F6DA 1PBTA 4H3SA 4RJIA 3PKZA 2AZTA 3OO0A 1H4QA 3WJ7A 1S9DA 2VRCA 2EIHA 2YNMC 3A9CA 3JQ9C 2VF5X 4DSNA 3JATA 4L4XA 4XLTA 4WOCA 2BYTA 3QXXA 4DUGD 3CGGA 1FFDA 4CMEA 3TSYA 4U63A 3FNFA 4FT2A 4TMYA 3TD2A 1EDDA 1VKZA 2HSGA 3NC4A 4QJBA 1C3XA 2O8CA 4KQJA 3UTDA 2JRLA 1ZD2P 3J81A 3NORA 3G0OA 1PKXA 1Z37A 1I80A 4ES6A 2OG1A 5T3YA 3MCAA 1VP9A 2GKSA 3L4EA 1MRZA 3E82A 3LT4A 4KLCA 5EMJA 1UBFA 2EGGA 1U8UA 3GLRA 4CCSA 4II7A 3DMTA 3HCOA 1P7PA 3O8CA 4S1VA 5DNVA 5I5EA 2Q8PA 2VBCA 1NR1A 2BR5A 1R0WA 4Z1OA 3ACCA 4R9UC 4J29A 4CM4A 1V6SA 3DTTA 9MHTA 3VNSA 1W29A 4GE0A 2G4LA 4R3UC 3LK6A 1IB6A 3F78A 1YC5A 1W59A 2YZGA 1FYEA 3C6ZA 3EAGA 1W5TA 1DAHA 3KPWA 4XB1A 2OP0A 4W5TA 1DJQA 3SZ3A 3AHHA 4ER0A 3BGDA 2AD5A 4M6WB 3H1FA 4P84A 2O8BB 2NO1A 2X0KA 5DNAA 3S8YA 3OY7A 1PZNA 2JGRA 2R85A 3Q4GA 3WGKA 3WO0A 5U1PA 5CJJA 3OFJA 4O1HA 3I04M 1CQPA 1C14A 2FRDC 3GVXA 3CMMA 1DX4A 1CCWA 5LWQA 1VDZA 3NHWA 5JW6A 4D3ZA 4NYMQ 4PGFA 5DXFA 2J31A 5F9HA 3C3EA 4PGGA 4EA7A 3FFTA 5TPZA 1XB2A 5HS6A 2VYNA 2IW3A 3MD0A 2V4UA 2PZJA 2V97A 1MIHA 1TIKA 1R66A 1YDEA 2BFDA 3CS3A 1HC7A 3SR3A 4CM7A 2CJXA 4LDZA 4YJ3A 1TF5A 2YFHA 2NACA 1XZBA 5GM2A 1E18A 3MF4A 1SGWA 1SY7A 4F9GA 2FKAA 3JQGB 4GMKA 5ALWA 2HIMA 3AKYA 3I09A 2ICAA 2GCOB 2FDXA 1HV8A 2EL7A 1PFGA 1FYDA 2VDLB 3KDPA 4RA6B 4TVKA 2R7MA 3WXMA 3O8OA 3LC1O 3RWMB 5F5LA 2BFPA 4M9XA 1DOAA 2H4JA 2YMQA 4JODA 4WLEA 2FLKA 3O21A 3UEOA 2MDTA 3E0QA 5FLYA 3EUFA 3U40A 4PHTA 3X1WA 1JE0A 1B43A 3OQBA 2GRUA 2WJHA 4QDXA 4U2GA 4TM8A 3A8TA 4EQ6B 3FMPB 1N57A 1PVVA 2XB9A 4P22A 5JISA 1YFZA 1LEHA 1UM8A 4NFHA 4EUSA 2VBFA 421PA 1QR2A 2J9ZB 3S1AA 1MRNA 1C7FA 5B7PA 3RUCA 3E7PA 5JZMA 3M6IA 5AVOA 2D1SA 2FZEA 3A04A 3TRIA 5CG1A 5HG0A 3O3CA 3LL7A 5PGMA 1RDFA 2I1LA 2YYZA 2FX2A 2J9XB 2O1EA 3GJZA 5AK3A 5E8RA 1DKLA 1AKUA 1X92A 2D0DA 4G3XA 1WMFA 2X5JO 4MDYA 2G76A 1LFAA 1YL5A 4M9RA 3OHPA 4UAUA 4TL9A 3FVWA 4EVIA 1F17A 3CY6A 2D1QA 5KNCH 2M98A 4C87A 1MGPA 4BO0A 3TTUA 1ZGBA 3RRZA 1BJRE 5GZ1A 2NT4A 1XXHB 2HK7A 2ZEJA 3CJRA 4OP3A 2JPDA 5CP8A 4BS9A 1P7ZA 3TW6A 2EQ5A 3OQIB 3UWOA 2P5SA 1ENPA 5T5QA 5A4MS 1JQ5A 4J1TC 2JCSA 3PUXA 3P5SA 2WZBA 2CXOA 1W4AA 2FZWA 4R81A 1KSJA 5CM9C 3ASYA 1GQSA 3ZG6A 2BONA 2E82A 3R5FA 4PYOA 1N3LA 4FCTA 2IOFA 3WX0A 4C5CA 5IN4A 3SVTA 4Q9HA 3OP4A 2QX8A 4CL8A 2C4VA 3N2GA 1KEKA 1JEOA 3H1AA 1N6LA 3QMWA 1RKXA 2W11A 2VSFA 2JA1A 2VC2B 4Z4IA 4MOWA 2Y1DA 1JKJA 1EFVA 1BA3A 3KSRA 4G85A 4CF6A 2QTBA 1ZIDA 3V4VB 3R9WA 1KI1A 5AI0A 5EIHA 3TZLA 4PO8A 2XA9A 5BT9A 1QU2A 2QQEA 1JEQB 3GELA 3BL5A 3REOA 1U7PA 1HSOA 3EXHC 5LQNA 2G40A