1ZK2A

Orthorhombic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of R-specific alcohol dehydrogenase from Lactobacillus brevis provide the structural bases of its substrate and cosubstrate specificity
pubmed doi rcsb
molecule keywords R-specific alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Lactobacillus brevis
total genus 98
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk2A00
2NNLD 1UP6A 1U4OA 3I4CA 5AQ1A 2DM6A 1AN9A 4FGSA 2PV7A 1GUFA 2GSDA 2QZZA 4CODB 1U1IA 3WX0A 2QQ5A 4ALKA 1U2GA 4LSMA 5T64A 1Q1NA 5IG2A 3VHRA 4QQRA 4ID9A 3ZW8A 1HKUA 5JCJD 4GPD1 5TGDA 1N7HA 2PGLA 3ZV6A 2VN8A 1Y6JA 2X23A 4L4RA 4ZA2A 1PL7A 1A7AA 2EIHA 4PLYA 3U4HA 4DPMA 4RL6A 3QHAA 4NJOA 3I6IA 1XHLA 1O0SA 3DTTA 1NP3A 3QVOA 4GL4A 4MOWA 2Q99A 4Q3DA 7MDHA 4GSLA 4CMAA 2D8AA 1LJ8A 2WYUA 3UICA 3H9GA 5COAA 3FPCA 1JU9A 4WLEA 1P1IA 3ROMA 3ZWAA 4GWKA 5TS3A 4KTTE 3W4KA 2AW5A 3F3SA 4YJHA 4M86A 1EK5A 4BKQA 2XXBA 1ZXLA 5CG2A 5JPIA 1H5QA 4CUZA 5A9SB 3BA1A 1P3DA 4HADA 5AXDA 4FC7A 4UVIA 2YJZA 1U8FO 1U7TA 4BO8A 2HQ1A 4QFDA 4BNXA 3JYPA 1PQUA 2QZ9A 3L4BA 4YPOA 3Q0EA 3PLNA 5JYDA 3ZW9A 5JC8A 3LF2A 1KS9A 1HDOA 1EBFA 3OA0A 3K73O 1BGVA 3VPSA 3R1IA 1R4MA 5JY1A 4RLSA 4FJ0A 4IXTA 4QO7A 1DIGA 1HDRA 4D46A 1GU7A 3PWZA 1QLHA 4ZHSA 2G17A 1T25A 3F5SA 4M55A 1KVQA 5JLAA 4CUKA 1UUFA 4S1VA 5H82A 3G79A 1EUDA 3DFUA 3E1KA 3E6AA 3IJRA 1UDAA 2FP4A 4TZTA 4Y9DA 1H93A 1J4AA 2GASA 4F45A 1K2WA 1DHRA 4FBGA 1CRWG 3C1AA 4ZQGA 2I76A 3NUGA 1JKJA 1SZJG 2AMFA 2ZQYA 1DIHA 1I3LA 3RCBA 3RSHA 4JJGA 4HX5A 3ZWBA 3FNFA 4DC1A 5G4LA 1WDMA 4JROA 1F0YA 3S2IA 4RVUA 2VRBA 1LLDA 2GGSA 4CMIA 2HDHA 4R5HA 1ZJZA 2X9VA 4GX5A 4CR7A 1WZEA 3ZWOA 4ZICA 2IRWA 2DUUA 3HFSA 3GZNA 2VYNA 4FOSA 1Y9AA 1GAEO 3BMOA 5ENVA 4BNJA 2Y0EA 1CF2O 2UAGA 3PHIA 1ADCA 2X0NA 3ROQA 1N2SA 2BHLA 2HCTA 3WYBA 4O5OA 4YJFB 2YDYA 4Z0PA 2UV8A 5IJZA 3OIFA 1E7YA 1LRJA 5JMWA 2NV6A 4JP3A 4HWKA 2BGKA 2P9GA 4P38A 1I36A 3K8ZA 5L4LA 3STHA 1HDYA 3VH2A 4BNNA 1KBZA 4J3FA 4RV9A 1WZIA 3BMNA 1Z7BA 1Z82A 3E48A 4O0LA 1LX6A 1V8BA 3G17A 4IY1A 4P4LA 4YYZA 1ZVMA 1V3VA 3QY9A 5L40A 4PG5A 3OHSX 3A9WA 1D3AA 3L4SO 1SPXA 5C7IO 1Y1PA 3ZWVA 4FIZA 2QYTA 3OIGA 1T2AA 3DZJA 5DOVA 2CF5A 4TRRA 5CPBA 4DMLA 3CPSA 4J1TA 2NUAA 3D3EA 1GYQA 3WB9A 1LDBA 2R00A 1R12A 3O26A 1H2HA 1Y81A 3I23A 2Q46A 1UJMA 3N58A 4YAKA 5KJEA 2NLOA 2I3GA 3AW9A 4BNZA 3E5MA 1PZEA 1VRWA 4OO3A 1KVUA 3H9JA 2FR8A 3KB6A 4RCVA 3B6ZA 1DAOA 3I5MA 3W6UA 2B36A 2W2KB 1NHWA 1GZ4A 1XQ1A 1FF9A 4RQUA 4B8WA 4B3HA 2VCYA 3RC9A 3LLVA 5G2OA 3EGOA 4LISA 5JS6A 1NFQA 2WD7A 4ILKA 4L9RA 1VL0A 4G5HA 1SOWA 2BELA 2Q1TA 1XCBA 3RAJA 3AFMA 5EERA 1U3VA 4XYLA 3TFOA 4DMMA 5H83A 4IGEA 3GZ4A 1YB5A 1DLIA 1S6YA 1PZFA 5CDYA 1C1DB 2BH9A 3IJPA 1PJLA 4DPKA 4FGWA 1QV6A 4BGVA 4ND2A 4R54A 1MXHA 1JQBA 3LDHA 3CMMA 4WASA 3RUIA 2GZ1A 4KUEA 5ES3A 2CVOA 2IODA 3UCFA 5IDXA 1QYVA 1IYZA 1L7DA 5EJ2A 1U8XX 2AE2A 3B1FA 4LCEA 3U0BA 3G0OA 4CM4B 4HV4A 3BMQA 3I9JA 1YO6A 3PIDA 2E6UX 2BI7A 5L7YA 1LA2A 4ZQEA 4TKLA 5I8WA 1ZW1A 4GLLA 2EGGA 1E1LA 1KEWA 1C1XB 4A7PA 4MVJG 4B3JA 2QX7A 2YY7A 1PS8A 4J91A 2PNFA 1VPDA 3FR8A 1I5RA 1BW9A 2Q45A 2X9GA 1UR5A 3KXDA 2DUWA 2DPGA 5ADHA 3U4IA 3ZNNA 2I67A 3ZN2A 3LT4A 4DPLA 1TVEA 3AY6A 4IDAA 4L75A 1DC3A 4Y6RA 4BNGA 4TRMA 2JCXA 2X0JA 1PQWA 5I7EA 1YQXA 2OGUA 1U3UA 4U0JA 2WJPA 1LDNA 2VHZA 3C7DB 3VH3A 3GFGA 3QWHA 1YL5A 3V5NA 1HSOA 1I0ZA 2RCYA 3JYQA 3OP4A 3QWBA 4W82A 4EW6A 3V2HA 3PYMA 4CR8A 1B8PA 2WE8A 3ULKA 2FMUA 4GAEA 3WNQA 1NQOA 5DF1A 3NT2A 3JQAD 4NH4A 4JJFA 2HMSA 1E3WA 2FR0A 6ADHA 1P44A 3OJEA 1HTBA 2HU2A 1E1KA 1E1NA 1EBUA 2HO5A 2WD8A 4HY3A 3G3EA 2PK3A 2VOJA 5L53A 3AM4A 1GV1A 4KOAA 4LGVA 1O6ZA 3WFJA 2I3AA 2EG9A 5G4KA 3BYZA 3GT0A 3KRTA 1YOVB 4NBVA 3QRWA 4KDEA 1LUAA 4J0EA 2Y05A 2ZCVA 2HSDA 1IHYA 3OQ6A 4PVCA 4XQ9A 2GD1O 5AYVA 4XDZA 4DWVA 1HE4A 4RVGA 1TXGA 1F12A 3OJFA 2D5AA 4L76A 5COQA 5C3MA 2QRLA 4XYEA 2Y1DA 2OO5A 3K2BA 3UGKA 3BIOA 1ZK0A 4Z3KA 3GR6A 2YHIB 1B7GO 3NEPX 5T8KA 3S2GA 3PEFA 4WEQA 1Y8QB 3HB5X 4MIEA 1WDLA 3AM3A 1PGQA 1X7DA 2V7PA 3KYCB 1ZJYA 4YXFA 4BL5A 5G0TA 5JCXA 1U7HA 1U9JA 1YJQA 4BNHA 4CMKA 3ASUA 1GQQA 4PRLA 1R16A 4BB5A 3ENKA 3KEQA 1YB1A 2P91A 3NX4A 1V0JA 5B12A 1P0CA 2D59A 1WP4A 3JQGB 3EZYA 3GK3A 1DFGA 4RF4A 1AGNA 2V65A 1O8CA 3DMYA 3DZKA 3O8QB 1NVGA 5KJ6A 4MP6A 4M8SA 3U3XA 4BKPA 4Z9XA 2WSBA 2AEMA 3DZHA 1DC5A 3EMKA 5IF3A 4CLOB 3NT4A 1G1AA 3OH8A 1HE3A 5KVCA 5DBGA 2FPGA 3WQSB 4E32A 3HN2A 3WSVA 1GPJA 2W8ZA 4NK4A 3RUDA 5F1OA 2WTBA 1RM0A 2J8ZA 3HB4X 3ZH2A 3WGHA 1VM6A 4LMPA 4CM1A 3EYWA 4H7PA 3KO8A 4JLWA 4CLHA 3W6ZA 3COSA 4AJPA 1OBFO 1EFLA 4EUHA 5DT9A 3GNTA 3UFXA 1I32A 1MFZA 2O7QA 4IXWA 3AI1A 3UXYA 2ZB7A 3WGZA 3DBHB 1YVEI 2NVWA 1Q0HA 2JD0A 4W6ZA 3WXBA 4CMGA 1UXJA 2XOXA 3MCVA 1YGYA 1PSDA 2EKLA 3OEWA 3CINA 4J9VA 5U1PA 3KBOA 2F00A 3PTZA 1YH3A 3GOHA 2OP0A 4FN4A 2IXBA 4R4JA 2Q4BA 4PZDA 3ENNA 2C2XA 1RJWA 3CUKA 3FN4A 2Q4EA 3PZBA 2EXXA 2Z1NA 4EJ6A 2VUUA 3CSDA 2P68A 5HM8A 1Q7CA 5G0UA 1D8AA 1K89A 2JFGA 3M1LA 1HZZA 2AEJA 4D43A 3K92A 4WCDA 1Y9EA 2X58A 1VL6A 4E31A 1NTOA 1O95A 1HE2A 1PTJA 2VZ8A 3IC5A 1GZ6A 4GH5A 3OQBA 1YKFA 3ANLA 4CJXA 2EJVA 3R3SA 5TNXA 1HT0A 1X14A 4UREA 1A71A 4ZN6A 4CM8B 3JSAA 4RPLA 4AG3A 1EFKA 2BFMA 4B7UA 3KOUA 4I08A 1RPNA 3AK4A 1DIBA 4FQ8A 3F1LA 3T7EA 3UCXA 3WBBA 3FD8A 1ADBA 4Q3NA 1T4BA 5JY6A 3P7MA 1WVGA 3AU9A 4M49A 4LMRA 4A73A 3JQDA 3ZZNA 4TMFA 3D1LA 4I5FA 1DPGA 4GKVA 3GVCA 2DQ4A 1I3MA 2ZYAA 1MG0A 5T5QA 1MV8A 3IP3A 1GZ3A 3EAGA 3C24A 2G82A 3QW2A 1W4ZA 4GVLA 4CLEA 4CV3A 4J9UE 3WG9A 4RVFA 3QVSA 4Y8VA 3JD2A 4OSPA 4W9NC 1F06A 5JO0A 3AOEC 4CR6A 4E4YA 2YW9A 3AFNA 4CMCA 2V6MA 2VUTA 5KJFA 3I1JA 2GZ3A 1DRVA 2C54A 1EUCA 3I9OA 1DJQA 2NQTA 3MWEB 4LN1A 4WLNA 3R3JA 3Q3CA 3JQBC 1NBOA 3I9LA 4G65A 3T4XA 2I6TA 1Z45A 2Q49A 1OAAA 3SJUA 2YV1A 4NJMB 4BIIA 3F9IA 3DHYA 4J7XA 1B8VA 2IZZA 3NRCA 4RQTA 2O4CA 6LDHA 3E18A 4R68A 1BXGB 4J7CA 2A4KA 4MP3A 1I2CA 3VH4A 4K6FA 4U5QA 3TWOA 3IDSA 3DBLB 4CMEC 3JV7A 4S3MA 2X0RA 1SEVA 3RBZA 1ID1A 4IDGA 1X0VA 3EC7A 3OA2A 1BVRA 4RF5A 1QSGA 1P1KA 1CEQA 1TT5B 4YVFA 4BKOA 5FWNA 3QWFA 1P1HA 4FFRA 4E33A 4CUJA 2D2IA 3QQPA 1JAYA 1HDGO 4PRKA 1PJ4A 5AXAA 3PHHA 2DVMA 1VLLA 1U2DA 3OBBA 1T4DA 4WNIA 4RVHA 2ILTA 3ZWYA 5MDHA 4IIVA 3ANMA 4D3DA 4AICA 1KETA 4I9UA 3HNPA 2DBVO 2ZB4A 3N74A 4JBIA 4EEZA 3U49A 5CG1A 2WDZA 3DAPA 3D3WB 2DLDA 2POQX 3PQEA 1QP8A 4J90A 1GY8A 1Z74A 2HLPA 4RZIA 1O94A 2Q50A 2EW8A 3NKLA 3V2GA 4AFNA 3ITDA 3VOSA 3WQQA 1WDKA 2X8LA 3GGGA 3B1JA 4YAGA 1N92A 3TRIA 1WAMA 3GN2A 4MVJF 1P45A 1PGNA 4ZGWA 1U5AA 3GY0A 1IPFA 4YCAA 1Y5MA 1P74A 3MWDB 2PD4A 2WEKA 1EUZA 3GA0A 4LCJA 3U9LA 5COBA 3M2TA 3A14A 2B37A 4WCFB 1FMCA 1PWXA 3BHIA 4G81A 3ZNQA 7ADHA 4YRDA 3VPGA 1CYDA 4FW8A 5DCWA 3KLPX 1ZMOA 1ZEJA 1T2EA 3WFIA 3ZV3A 4DA9A 1ISMA 5TF4A 4KDFA 4WLVA 4QO8A 3DOJA 3INTA 3VTZA 3WOHA 4CMHA 3R6DA 1E6UA 5CDTA 3IKVA 2A35A 4YAJA 1PL6A 3PPIA 4INAA 3PVZA 5C5IA 3NDIA 3GLQA 1NR7A 1PQPA 3HDYA 4Y67A 2BMAA 4CM7A 4FPXA 3MJCA 5EQDA 1Y8RA 1F14A 2PZJA 1ZFNA 3HSKA 3KM0A 3PYLA 3LT0A 5GY7A 3V2UA 4Z0HO 3Q9UA 1NNUA 4Z0TA 3JYNA 4DLBA 4EEXA 2YQ5A 9LDTA 1ZZEA 2VHVA 3GNQA 5EINA 3PDUA 4P8RA 3WMXA 4ND1A 1ZUD1 4IDFA 2GDZA 4H16A 3RUHA 4YJGB 2LDBA 3ZWPA 4BB6A 4BQRA 1JWAB 1WLYA 1NFFA 2O2YA 3QE3A 4QSMA 4HNGA 2O23A 4B3IA 1B8UA 3VC7A 4XR9A 4QEDA 3I83A 4ZRMA 5K6AC 4AJEA 3ZHYA 3D7LA 2JCVA 1DDOA 2BFOA 1RYDA 4YJFA 3VZSA 1DFHA 1H6BA 2TMDA 1YE3A 5BNIA 1YJ8A 3AU8A 4Q3EA 3MJTA 3OETA 1H6CA 3NDJA 1NPDA 1N9GB 4N5NA 3ROKA 4MP8A 4R9SA 4E6PA 4II3A 2VT3A 4OQZA 2D3TA 4ITUA 1XYGA 2W4QA 4XEHA 2JAPA 2VHXA 1ZK2A 4R51A 2HAEA 3FBGA 4YB8A 4WK6A 2X5OA 5TLSA 4L74A 1Z73A 1CIVA 1ZNQO 3T4EA 1IL0A 3MJSA 2OP1A 4E5KA 3IUSA 3TZKA 1UXIA 1VKNA 1YBAA 4CMBA 1BG6A 4XWYA 2C7GA 1G0NA 2NWQA 2C59A 3HG7A 1GYPA 2HMUA 3NT5A 3TL3A 1GUZA 3JD1A 3WBFA 2HK9A 1M2WA 4DIBA 4OMUA 4NR0A 4OJNA 4OOFA 4W9NA 5ER6A 2LDXA 4GLOA 5F1KA 1UH5A 2JFHA 1HXHA 3AOEA 4CL3A 4OM8A 3DBRB 2Q2WA 4FD3A 2D4AA 3ETEA 3QIVA 4XYBA 1ZSNA 2O48X 5FFFA 1CDOA 1Z6ZA 2W2KA 1HE5A 3ZWMA 2QW8A 3QVTA 2WWRA 4KZPA 4XR4A 3PJGA 4XYGA 5JDCC 1DAPA 2VRCA 4O1MA 4WEOA 4OSOA 3JQBA 5THQA 4N54A 5F3RA 4R9RA 3U62A 4EGFA 5CEFA 2X4GA 4IDBA 1X0XA 3GPIA 2NU8A 1PZHA 1NASA 3INGA 4JQCA 3I6QA 2VTDA 2FZWA 1T26A 4GGPA 3D0OA 4XD2A 1UXKA 3ZU5A 1C1DA 4LRTB 4AVYA 3IS3A 4AL4A 4I8XA 4BQPA 1TB4A 4CQMA 2FWMX 1DBVO 4AJNA 1YBMA 1TT7A 4BO4A 4NHEA 3H9EO 4CMEA 2Q1UA 5GZ6A 3NTQA 1JTVA 1ML3A 1ISJA 1T2DA 2GN6A 3TZHA 3VDQA 3GMSA 4R16A 4YRBA 1EVJA 4NU6A 1E7WA 3WS7A 1PR3A 5GMOA 2CNBA 3RI3A 2PGDA 5KVQA 2NVUB 4MKZA 2IEBA 4H3VA 3DC2A 4NU5A 4BO5A 1QYCA 1QR6A 1C1XA 3QVXA 2B4TO 5JXWA 1BDBA 5TSDA 5HA5A 5C37A 3GAZA 4OKIA 1IY8A 1DIRA 1F17A 1I01A 2ZB8A 4XQEA 4ALLA 1A7KA 1M6WA 1AHHA 1KYQA 2YHUA 1TI7A 3ZNPA 5GZ3A 1QLJA 3S55A 2DTDA 1MX3A 3OF2A 4IGFA 1IULA 1EQ2A 2Y99A 4AJ2A 1VJ1A 1PJ2A 3EDMA 4J0FA 1L7EA 1RWBA 4PLHA 5AOVA 5DNAA 5IDYA 2Y1GA 2Z95A 2GUGA 4DIFA 1SBYA 4B8ZA 3KUXA 3HZZA 5KKCA 5FI5A 4CM9A 1EVIA 5IZCA 1E6WA 4BMSA 4CLRA 2DC1A 4IDEA 4XQCA 1IPEA 1FDWA 2HJSA 3QA9A 3WGYA 2NM0A 2PH3A 3LVFO 3WSWA 1R37A 3QSGA 4QFCA 3NDRA 4YT8A 3V8BA 4UEKA 5CEEA 4NDNE 3NJ8A 4TQGA 3LQFA 5F1PA 1ZXBA 5TT1A 5CDSA 3JQEA 1B15A 1FDVA 1VC2A 4X54A 3OMLA 4RVSA 4GX2A 5IDWA 3O9ZA 2JFFA 2GPTA 3KV3O 1K6JA 3A1NA 5L4NA 3GN1A 1KIFA 1NQ5A 2GZ2A 4OAQA 5L7WA 1P9LA 4W99A 4GX1A 1YDEA 1KERA 3Q1LA 4P4NA 4YJHB 3AOGA 1BTOA 4JP2A 3EUWA 3TNLA 4B4VA 3K9QO 5F21A 1SEPA 3RUCA 5ITWA 3RUAA 3SLKA 3B70A 1WWKA 4JX8A 4KMSA 4KWIA 1Y8QA 1QMGA 3A28A 3DDNA 5JDIA 3JQ7A 4XJSA 1T1SA 1R66A 3EY4A 4R1TA 4OGWA 5L51A 1MFPA 1TLTA 2D0IA 4TWRA 3TL2A 3TSCA 3HDQA 2UUOA 1C0IA 3PGJA 3RC1A 4BO7A 1EVYA 2TMGA 3QJ5A 1U4SA 4OYRA 5I9MA 3TZ6A 3ADPA 2DTEA 3U4CA 3PIIA 4RPGA 5BQFA 1ZH8A 4LVUA 3JQGA 4ZJUA 4BOYA 4RJTA 4Y98A 4IM7A 4DVJA 2NSDA 4NI5A 1ENOA 5CHEA 4OXKA 1JA9A 4TZKA 4FDAA 5AVOA 2PFGA 1N8KA 3WQRA 4WKGA 2IZ1A 4CQMD 2A92A 3Q2KA 1CQIA 1PJTA 1DXYA 4HFJA 4BO0A 3WJAA 1OC4A 3RROA 2VTEA 3VTFA 4WCFC 3WGQA 1PR9A 4E21A 8LDHA 3ONFA 1YS4A 3KYDA 4YQZA 3GVIA 4FOOA 5CDGA 1ZSYA 3LC7O 3QWIA 1GADO 2B69A 3RBVA 1E7MA 1ISHA 1C14A 3ETGA 1HZJA 1I10A 1A72A 4ND4A 1IHXA 4E5YA 1ENYA 2A9FA 4QTZA 2DKNA 4J4TA 2VYND 1E5QA 1HSZA 4RDIA 4XZ3A 3GZNB 4MINA 1NVMB 4PLZA 1NYTA 2XAAA 2Q1WA 3BMOB 3JQFC 4BO3A 5I9NA 5MGBA 3AUSA 3S2EA 3DO5A 5EMHA 1V6AA 3LLSA 3IMFA 4OXYA 1F8FA 5BT9A 2FPIA 3DMTC 3RQSA 2PLAA 4YT5A 3ORFA 5DDIP 3FI9A 3INRA 3ZI0A 4BV9A 2VHYA 3WLFA 4C7JA 1P33A 3BTUA 3BHJA 3JQ8A 3G1TA 1QV7A 1ONPA 1LDYA 3JQAB 3GDGA 5DCYA 5JDCA 2GF2A 2IXAA 5A02A 1OI7A 2RIRA 2EJWA 3HJAA 4FFNA 3IKTA 3BTSA 3LK7A 3DAGA 4R1NA 4MVJM 3T7CA 2JD1A 3HWRA 3VPFA 1T1RA 1CJCA 4JJIA 4E0BA 5A9RA 4LVCA 1SO8A 5BSHA 5EQFA 2R2GA 4NFSA 4MIOA 4PN3A 1LLQA 3CTMA 1PEDA 2Z1MA 4JN6B 1LSOA 2UDPA 3GMDA 1WMAA 2DPHA 4IMRA 2EERA 3ITKA 4IQ0A 5JAMA 4CM8A 3CIFA 2GN9A 1LI4A 4R1UA 4EYEA 3MEQA 4BGIA 3W8DA 2EHDA 2ET6A 3I9NA 4PGFA 5H81A 1A9ZA 1HDCA 4BNWA 3L0DA 1E3LA 3I4FA 3ST7A 4MIYA 4BNLA 3PJFA 4CM5A 2BKAA 4I5GA 4XIYA 5K0ZA 2AA3A 1ORRA 3GGOA 3K6JA 1PIWA 4L4SA 5HTOA 4MPDA 4IINA 5A05A 4DTIA 5IAAA 1LDMA 2CSUA 3QVWA 1X1TA 2VYVA 2DT5A 5KIAA 1KEVA 1JVSA 4PZEA 3WYCA 2Q1SA 4DIOA 3JD3A 2EP7A 5DBFA 2VHWA 2FR1A 1E0DA 4B4UA 4E13A 3E03A 1FJHA 3ZU2A 1V9LA 1TA4A 2QIOA 4IDCA 3WIEA 2JCYA 2XPCA 4FR5A 3TN7A 2YZ7A 2FOIA 4XRRA 3NGLA 1OOEA 3PI7A 5CEJA 4XQGA 1IE3A 4HFNA 4AJ4A 5LDGA 1HYGA 1F8GA 3W8FA 1B3RA 3E5RA 2OUIA 4UEJA 2QG4A 2CDCA 2GO1A 3DWFA 1HDXA 3KZVA 4ZQFA 2O3RA 2UVDA 3R0IA 4LK3A 3VZRA 2P9EA 1E7QA 1GEGA 1GCOA 4PVDA 4BO9A 1JAXA 3DHEA 1ZKMA 3PFFA 1CERA 4DL9A 5CP8A 3RC7A 2ZTVA 3ETDA 3GVPA 1H94A 1I2ZA 4DYVA 3WWZA 1QYWA 2RHCA 3OICA 3GVXA 1DIAA 4JCOA 3BMCA 4MVJI 4NMHA 2NTVA 4KP7A 4B7CA 5IN4A 1R4NA 1NAHA 2HMTA 5EL0A 3VAZA 4OHUA 4BMVA 2ZCUA 3IP1A 3WIDA 1BXKA 1HRDA 1DB3A 1PJQA 1JWBB 4EUEA 1TT5A 1GD1O 4ZQBA 2VOEA 3ZDFA 4HP8A 1MC5A 3H6KA 1VSVA 1A9YA 1YB4A 1DOHA 1K0UA 1DC4A 1WXDA 2J5RA 3NTOA 4NIMA 3UKOA 2V6FA 5HBRA 5IDQA 1E3IA 4FJ1A 2H9IA 4PLGA 1EVZA 2ZYGA 3HN7A 3KSUA 4M89A 4KQXA 4YT2A 3WMWA 2JAHA 1BMDA 1GQYA 2Y0DA 4WOKA 2GRAA 4YJDA 2J5KA 2NU6A 5IFLA 2C07A 3GUCA 5I7VA 1WW8A 3FNGA 4R41A 1PS0A 4IJUA 4PLTA 2I99A 3D3WA 2VNSA 1E3WB 1NPYA 5KNLA 2OZPA 1QKIA 2AHRA 2ZB3A 3LT1A 4DC0A 4W7IA 3ZHXA 4K6CA 4FC6A 4NBWA 4EDFA 1UP4A 4EZBA 2QRJA 3HDHA 1SB8A 3LF1A 1NX6A 3H8VA 1T2CA 3VH1A 4BS9A 5G4KB 4BO1A 1MB4A 3LZ6A 3GUYA 4DLAA 1B2LA 5JSFA 4PLPA 4U6SA 4D3FA 4CM6A 1XELA 1U5CA 2OOSA 4K9DA 4Q3CA 3MOIA 5TC4A 2JKVA 2DFVA 5HRUA 2O50A 2J5QA 1I24A 4UUMA 4BHTA 2PKRA 3PWKA 1I3NA 2YUTA 3K96A 4WCFA 3ZGYA 1Y7TA 3JQ9C 3CH6A 3RUEA 1A4IA 2NTJA 4MVJH 5IXYA 1JKIA 3U09A 4ALIA 5JNLA 1ZO8A 3CEAA 4YQYA 1E77A 1ULSA 3VPXA 4CPDA 2G76A 4PG4A 2HMWA 3IUPA 3RFVA 1E7RA 2FY8A 4JNKA 3WGOA 3GDFA 4YEDA 1UDCA 2FHSA 2YFHA 1GYRA 1XWFA 3JQFA 3Q9NA 4ZD6A 1SB9A 3GQVA 4IZIA 2G5CA 3KHUA 2VT2A 1GL3A 1GTMA 3SVTA 1VE9A 2GYYA 4EBFA 3DMTA 5EN4A 1XKQA 5B4VA 3O4RA 4JK3A 3AWDA 4ALMA 1DEHA 3WR5A 3K31A 3L4BC 5A04A 4PLVA 2X7HA 3DZBA 1LQUA 2CDAA 4UVDA 4YJGA 1HYEA 4WUVA 3ABIA 4YDRA 1SCUA 2HK8A 3BZUA 1AUPA 3W4IA 4E3ZA 4BNFA 4K26A 3TF5A 3RD5A 4AJJA 4B7XA 2HJRA 1ZK4A 1D7OA 1N7GA 1CETA 2DBZA 2IE0A 2DFDA 3AY3A 1E3JA 2BRUA 2ZTUA 3JQCA 3N7UA 1BDMA 1EMDA 3RFTA 5L45A 2RHRA 2WMDA 4EI2A 2YV2A 3GVHA 3SXPA 1XEAA 4BGEA 5JCJA 4WLFA 1I33A 3DR3A 1NWCA 4MKRA 4GMFA 1UZLA 5A06A 1NXQA 4ESOA 2EEZA 5KCZA 1NWHA 1KEUA 2PZLA 3KSDO 4F3YA 3DAFA 5ER9A 4E30A 5LC1A 3BHMA 4YACA 4W7HA 2J3KA 4E2YA 1BRMA 3FWNA 3K5PA 3RU9A 4XGKA 4DUPA 3UOGA 5A9SA 3CZMA 3F4BA 2O3SA 3FPLA 1MC4A 3KEOA 3M1AA 2IEDA 2PZKA 4ND3A 3HE3A 1V3TA 3F46A 3PP8A 5JAIA 3DBRA 4XRGA 4CMJA 1KEPA 3H9UA 3MJEA 4BNKA 3TQHA 3PDJA 1H2BA 3FWZA 3WGTA 4FFPA 1MG5A 4KWHA 2NADA 4R01A 3SX2A 3KLMX 3OJOA 4DGSA 2ZTMA 1IZ0A 5T57A 5BSEA 3D4PA 4GMGA 2QYSA 3SEFA 4AJKA 4OXNA 2VUSA 1WPQA 3S2FA 4AJHA 3ZV4A 1R0KA 2AQHA 3AY7A 3H3FA 4I9NA 3VVCA 2VWHA 4ZU3A 2JHFA 4KUGA 2BLLA 3ICPA 1I2BA 1KVSA 4GSKA 4U8GA 3OJ0A 3S1LA 5TIIA 2HRBA 1J49A 4UUOA 1LLUA 2BF7A 3H5NA 3V1YA 4O63O 1E5LA 1KVRA 3D5QA 3WGGA 3LU1A 3H2ZA 2RAFA 1KY5A 2CY0A 4K1LA 4EITA 3AUUA 2G1UA 4ALJA 1GR0A 3P19A 3P2OA 5B37A 1G6KA 3L6EA 2GERA 3NJ4A 2JD2A 3VVBA 1EDZA 5G0WA 1YDWA 1L1FA 3ONEA 4Y6PA 3H5AA 4IMPA 2NVUA 1NHGA 3JD4A 4XGIA 1LRLA 1UDBA 1QYDA 4BNVA 1P1FA 3I52A 4CV2A 2OHXA 5EESA 5T67A 5I7SA 1VI2A 4BO6A 2WYWA 5JBIA 1FDUA 4RZHA 4MVJE 1KVTA 3CKYA 1R6DA 4LSWA 3WLEA 2X22A 5U9CA 1B16A 3P5SA 1YL7A 3D64A 4D79A 3ZWXA 1B3BA 2VZ9A 3MZ0A 4N7RA 4A27A 4C4OA 1PGJA 1R0SA 4DQUA 1NM5A 3ZU4A 1PJSA 1ISIA 3GH3A 2IYOA 5KWEA 5F5NA 2OFPA 4MVJA 1H0KA 3L6DA 1LRKA 1B26A 2P5UA 3DBVO 1A4UA 3OQ1A 4AJIA 1DRWA 1XQ6A 4DREA 2NVBA 3D4OA 2BFAA 2E4AA 3JQ9A 3LT2A 1SMKA 4DXHA 3VZPA 4L0QA 3C8MA 3OJLA 4URFA 3SC4A 1S7CA 1XR3A 3PFWO 2H1SA 3QWAA 1LLCA 4DLLA 4DRYA 5L95A 1ZCJA 1C0PA 1U3WA 3DQPA 2PZMA 3UN1A 3UVEA 4JGBA 3MJ4A 4RPHA 1RKXA 4AJOA 1BWSA 3O03A 4BVAA 3E9MA 3ZWCA 3ZV5A 1AXEA 1OC2A 2CMDA 5CAEA 3AJRA 4H15A 4IS2A 1PWZA 1JLLA 1MA0A 4FJ2A 2Q2VA 3LC1O 3UCEA 4EJ0A 1Q0QA 3Q6IA 1GEEA 3GHHA 1DO8A 1R15A 2ZJ0A 4JIGA 1ADFA 2AXQA 1K6XA 2NU9A 3FNEA 1UAYA 3HQ4O 3PXXA 4L73A 5FYDA 4HFMA 2FN7A 1HDZA 2RH8A 4U0KA 5G0VA 4WJZA 2EWMA 3RBXA 4AJLA 1LC3A 2H5LA 5JO9A 4FB5A 3DB2A 2FSSA 3W1VA 1ZK1A 2C7VA 3WWYA 1YBVA 2CDBA 3F1KA 4PG7A 5F5LA 4CQLB 1IUKA 2FZEA 2GNAA 4A2CA 1W0CA 5CFZA 1K3TA 4HBGA 4RF2A 3KETA 4D42A 1EDOA 3E82A 1DHTA 4XIJA 1P1RA 1YRLA 4YT4A 1MXFA 3E9NA 1N1EA 3DEYX 3KTDA 4XJTA 4NFYA 4OOEA 2P4HX 5AXCA 3LC2O 1JVBA 3OEYA 5TT0A 4CM4A 2Y1FA 4XDYA 4M87A 2FSVA 3DZGA 1BSVA 1M66A 2I65A 1VJTA 5KVSA 4RF3A 1H6AA 1I30A 3I3OA 5A1TA 2X1HA 4BNUA 2HKIA 4GI2A 4O59O 1GCUA 3WJ7A 4JBGA 5T8KC 4UAGA 4A5OA 2C5EA 1Y8RB 2C82A 2DBRA 4JXKA 4E2XA 2CVQA 3C7AA 1VJ0A 2E82A 1SC6A 3OECA 2XXJA 4BKRA 4BV8A 5LDHA 5B4UA 1PZGA 3FBTA 3DFZA 3VPHA 3X2FA 2Y1OA 4E5NA 1LSUA 3OFSA 2WM3A 4XX0A 4QUKA 4UVGA 2Y93A 5I8ZA 3FR7A 4WLOA 3ANNA 4ZRNA 1OZAA 3PRJA 1ZBQA 2AQ8A 2Y1CA 3FF4A 3JYOA 4YRAA 2F1KA 4RPJA 4GQAA 3I9MA 4Q3BA 3GPDG 2CF6A 3LSYA 1ZK3A 1Z75A 3FTPA 2AEFA 1BHSA 1ZMTA 4Q9NA 2C5AA 2EF1A 3D5TA 4B4OA 3EW7A 2OBNA 1P0FA 2Q3EA 3G1UA 2NU7A 3GHYA 3OM9A 2FRDA 3Q2IA 5ICMA 4A26A 4Z3DA 1X1EA 1E1MA 1UZMA 3JQAA 1C0KA 4KTVE 1UAGA 4WNCA 1DLJA 4ZQHA 2W98A 4MVJD 4D44A 2WYVA 3FTNA 3Q11A 1YOVA 4XCVA 1A5ZA 4CLXA 4R5MA 4OQYA 2VNAA 3H9QA 4R3WA 4DYDA 3PJDA 3TPCA 4J7UA 3KSZO 2I66A 4PLWA 3TDKA 2Y1EA 1GV0A 2W2LA 2Z5LA 4W4TA 1GPDG 1HL3A 5K9ZA 4NBRA 5DOZA 4PIVA 2YHIA 3GAFA 3NAQA 2R6JA 4E12A 4IZHA 2E48A 5A3VA 5A3JA 1ZIDA 3F47A 1PGOA 5CPFA 2C2YA 3KYCA 1JN0A 5HWSA 4N5MA 1UP7A 5TJHA 3WTBA 2B83A 4BUCA 1PX0A 4NZ9A 3W8EA 2I5PO 2CD9A 1I8TA 1NVTA 2VRCD 5EPOA 1D4FA 3CMCO 1J0XO 1R4MB 5K6AA 3RWBA 5I7FA 5L4SA 1P1JA 4R3NA 1N1GA 4XA8A 2B4QA 2DBQA 1EQUA 4D3SA 1KC1A 3TFQA 3O8QA 5ILGA 2BGMA 3WDSA 1ZSVA 3EVTA 5JMPA 4CV0A 4NNJA 3JTMA 2OXIA 3GEMA 3ZHZA 3GC6A 4Q39A 1D1SA 3VZQA 3PWSA 3PQFA 4YR9A 1H9BA 4UVEA 4ZVVA 4CQMB 1Q7GA 4E2ZA 3PYXA 3TJRA 4CLOA 3DZIA 1NQTA 2B4RO 2PKQO 4XGNA 5TJ9A 5IN5A 3FCOA 1QORA 3TZCA 3H4VA 2B0JA 3K30A 3WICA 1P77A 1M75A 1XLTA 2DTXA 3TOXA 4E2WA 5JFOA 5KVVA 3CE6A 4NPCA 1LXCA 1ISFA 1KC3A 4CMIB 3QV1A 2H6EA 4IPTA 4PCVA 2O4UX 2HK7A 2UYYA 1LNQA 4CL8A 3HHPA 1HETA 1FDTA 1XU9A 3M2PA 3QLJA 4IJWA 1AHIA 2P9CA 5IZ4A 1ISGA 3UHAA 4I5DA 3DBHA 4GBJA 3F5QA 4J4HA 5FI3A 3ZHBA 5KOIA 1SOVA 4J1QA 5BNFA 4UUNA 2PD6A 4MKXA 2AE1A 4II2A 3OSUA 1VL8A 2BFPA 3HUDA 3BXXA 4G2NA 3FSRA 3ZNOA 1Q7BA 1E6EA 4J1NA 4NG5A 4BNIA 3SBOA 1ONNA 2E37A 1W73A 2VWQA 3BMNB 1QXSA 1RYEA 4I5EA 4CM9D 1HEUA 2YV3A 4HFRA 3O38A 3MOGA 1XDWA 2O3TA 5BR7A 2ZIZA 3H65A 3PLRA 4UEOA 5L7TA 3L6OO 1IOLA 1JDJA 4NBTA 1ADGA 3UW3A 4CLRB 2HRZA 2C20A 2J6IA 9LDBA 2RBEA 4Z9FA 4WECA 3BTOA 1RM3A 4RVDA 4IDDA 5T6BA 2Y0CA 4CM3A 2ZK7A 2Y66A 2I9PA 2ZTLA 3RVDA 2IZ0A 3TZQA 2DAPA 3UF0A 2J3HA 2EP5A 1HLPA 4FFLA 1AE1A 1GUYA 2J3JA 4GKBA 1LQTA 3EHEA 4MVJP 1ONOA 4J43A 1EK6A 3RC2A 3E8XA 3JQ6A 4J49A 1OMOA 2W2LD 2C0CA 2IDZA 3ZU3A 2X6TA 3MTGA 3V1UA 1QG6A 3S8MA 3W4JA 2E49A 4O6VA 2YFQA 3CXRA 3A06A 4HUJA 2SCUA 3GGPA 4A10A 1JKFA 2WD7B 4TSKA 1EEHA 5THKA 2ZATA 5HS4A 3FRJA 2D1YA 3JQ7B 1VSUA 3EVNA 4MO2A 2EV9A 4HNHA 4B4WA 1DFIA 2GN4A 5DN9A 4DBVO 1M67A 1LEHA 4RORA 1ENZA 1V35A 2GCGA 5JAZA 3GRKA 2X0IA 1NPTO 1C0LA 3RFXA 3FNHA 3GG2A 3UAGA 1NR1A 4ONEA 1BXZA 1X7GA 4TRNA 3H5RA 4P4GA 2X9NA 1EE9A 1MLDA 3HDJA 2IYPA 3JCZA 1HF3A 2EKPA 4GX0A 4E5PA 1GDHA 1XG5A 2B5VA 1E3SA 3K2EA 1YQDA 2D5CA 4ROSA 5ILOA 3RUFA 1PJBA 1DSSG 4MDHA 4J6FA 5L3ZA 5A5EA 3VKVA 2PR2A 3BMQB 2VWPA 4NJMA 4I1IA 2NACA 1TEHA 4D45A 5KJ1A 4NK5A 1KOLA 2EGHA 4QXMA 1BXGA 3GG9A 4TVBA 4D7AA 2XF8A 1XA0A 2UUPA 2O3UA 1QRRA 5DP1A 2EKQA 3KYDB 4XKJA 1P31A 3DBLA 5DP2A 4J2HA 1MGOA 4EJMA 3B20A 4OL9A 4BNYA 3TOZA 1T2FA 1H9AA 5I9LA 1ZEMA 2GN8A 5TRTA 1M6HA 2YYYA 3PZRA 1BW9B 1U28A 3IOYA 4RDHA 1N5DA 2OORA 5J23A 4WOJA 4ALNA 5A5FA 4XYMA 1FK8A 1PJCA 1Z7EA 1IZ9A 2OMEA 5GZ1A 3E9QA 2CVZA 4L8VA 2G0TA 4BKUA 4OIMA 1LC0A 5ITVA 4UVHA 1EZ4A 3P2YA 1JW9B 4XB2A 1XIVA 4OH1A 3LYLA 3ZWNA 1T24A 4WE3A 1VKOA 4R1SA 1E3EA 2VZ0A 4QX6A 3RU7A 1RM4A 4HXYA 3PK0A 2GR9A 2Q2QA 3SJ7A 5BSGA 3JQ8B 8ADHA 2O7SA 3DOCA 1PGPA 3IL2A 5FF9A 3GNSA 1J5PA 5JW6A 2QHXA 2FPPA 5L9AA 1E7SA 4UUPA 1BVUA 2GLXA 1LSSA 2AG5A 3MTJA 2P5YA 2CUKA 2A94A 4IJKA 4IJVA 1DRUA 5DZSA 3RJ9A 2O3QA 4F6CA 1QYXA 3GRPA 5HS6A 2J3IA 5TQVA 1V3UA 3VDRA 5JC1A 1NQAO 1EE2A 3FHLA 5JAQA 3WYEA 2P4QA 4M1QA 4GVXA 2ZJ1A 3AI2A 4GGOA 2X5KO 4U6QA 4OKNA 4CV1A 4Z6KA 3ZCXA 1Q2XA 1CWUA 2B35A 3AM5A 3ROPA 2P2SA 4TRJA 3OIDA 2ZKLA 3PHJA 1X7HA 3F6YA 4FSHA 5U4QA 5B1YA 3GF4A 3AUTA 1R0LA 4FCCA 2W90A 3RKUA 4YWJA 3AI3A 3B1KA 4YBZA 4Z9YA 1Y5RA 2PKQP 3EZLA 3C3XA 2PTGA 4IQGA 1HLDA 1GQ2A 1HWYA 3PJEA 3HADA 3MJVA 3I9KA 2VYVD 3H2SA 4ND5A 4BNTA 5ICSA 4IS3A 4WPGA 3SC6A 4NBUA 2VWGA 4N18A 2ZYDA 4TVOA 2AQKA 4EUFA 3DXFA 1O9BA 3PGXA 1LU9A 4TROA 1Q0LA 3RASA 4GWGA 4Q3AA 1CQJA 1I3KA 1PL8A 1SAYA 4RGBA 3ICCA 1K6IA 2BI8A 3NYWA 2NQ8A 3PHGA 3ZWWA 4BO2A 3L9WA 4PG6A 4TKMA 4BGUA 2PGJA 2BD0A 3AUAA 4BMNA 1ULUA 2O3JA 1YQGA 3CZRA 4I9HA 3UH1A 3WNVA 2NTNA 5TX7A 5EIOA 3GDOA 3PHLA 1YL6A 1DC6A 2HUNA 2PA3A 1YONA 4PZCA 5DCUA 2PH5A 5DULA 1WNTA 4RPKA 4JBHA 3VKUA 5BSFA 4R69A 1N9GA 1A27A 3KVOA 5FEUA 4Y6SA 3GEGA 1UXGA 2RH4A 2AQIA 3BMCB 3H7AA 1R4NB 4CLDA 2HMVA 4HKTA 4PFJA 4DQVA 4RLHA 3RJ5A 5C7OO 3DTYA 5ENDA 2VQ3A 4KQWA 2JL1A 3PQDA 4YTEA 1XGKA 1O5IA 2PWZA 4FS3A 1GFSA 3DHNA 3BAZA 2B5WA 3DZFA 4D41A 5B4TA 1WMBA 3DONA 4L4XA 1E92A 3IQDB 2ZQZA 4D0RA 1D1TA 1X13A 5G0SA 4P22A 2YDXA 3L9XA 1J6UA 1NAIA 2PY6A 1W6UA 1PU2A 1H6DA 1LBEA 5C7LO 1G0OA 4E5MA 5A9TA 5KTKA 3RIHA 2Y67A 3L07A 3ADOA 4DQXA 4IUYA 2WE7A 2O2SA 2JHGA 2YQ4A 3C85A 1LTHR 5A03A 3GEDA 5DBIA 5AXBA 3WGIA 2OL4A 4PLFA 5BNTA 5KJCA 4IIUA 4J1SA 4LRSB 3L77A 4M54A 2X5JO 2CZCA 1FXSA 5LCXA 5JE8A 2V6GA 2Y68A 2DU8A 4A03A 1KY4A 1FDSA 3C1TA 4MJLA 4N5LA 4U7WA 1LDGA 4YA6A 5IZCC 1UXHA 1YWGO 3NV9A 1RM5A 4A0SA 4J4BA 2JJYA 3SLGA 2QRKA 4QECA 4B79A 1UZNA 4PG8A 3HFGA 3BTVA 4CQLA 1AXGA 1B14A 1ARZA 3ASVA 4J2OA 2R00C 3U4DA 4YAEA 4WLUA 3EK2A 1X15A 3A4VA 2AG8A 3IAHA 1ENPA 1O89A 3JD0A 3QP9A 5A4DA 3D4NA 3IIEA 5KKAA 4F46A 3M6IA 3H3JA 4RO0A 3F4LA 3UUWA 3X2EA 4IBOA 1PJ3A 1LDEA 1MUUA 1DJNA 2V6BA 4FFMA 3NTRA 3KYBA 5IXSA 5JYEA 4IQ8A 3NGXA 3RKRA 4UULA 1LSJA 5CDUA 4J16A 1YXMA 2CFCA 1OFGA 1C3VA 1B0AA 1NFRA 4WGGA 4LW8A 1K5HA 3C7CB 2BGLA 4C7KA 4F6LA 4YAIA 4XB1A 5JDIC 1XU7A 4QT0A 2C29D 3ON5A 3C1OA 4PLCA 4NFHA 1HYHA 1IB6A 3U5TA 1U3TA 3GFBA 3DOOA 4FFOA 4AJ1A 1MP0A 1W8DA 3V1TC 1M76A 3WTCA 4D0SA 2EW2A 3JYLA 3ONDA 2H63A 3G49A 1XSEA 2X86A 4NQZA 4DBZA 2OBYA 4BNMA 4KUHA 1SNYA 4K28A 1PS9A 3DL2A 2PD3A
chains in the Genus database with same CATH superfamily
1CIPA 2CHQA 2XDYA 3PHCA 5JS2A 2WYIA 2ZIGA 5EKTA 1AN9A 3M81A 4BQFA 3UIEA 1GTSA 1Z37A 3WX0A 4F6LA 1MJGM 2ZSHA 3K6SA 3EC1A 1EVQA 2BDUA 5T64A 2I29A 4H6VA 1JHYA 2GJKA 4V2UA 5IG2A 1G8YA 3OFND 4QQRA 2C98A 4ID9A 5TQ2A 3ZY2A 4YRQA 3BZBA 3DV0A 1LB1B 3N2GA 3NIBA 1ECPA 4Y2GA 5TGDA 3ZV6A 4KVAA 3ZI7A 4ZA2A 4DPMA 1A7AA 4GI3A 4PLYA 3AYZB 1A9QA 3BH7A 2QMEA 3F8WA 3I73A 4I3GA 2ONKA 4DBLE 1BH2A 4ICIA 3I6IA 5LXTF 2XKBA 4BPBA 3UHOA 1TAHA 2DERA 4QXQA 3VM6A 4KBFA 3UICA 5KNBA 3GW8A 2CXXA 3C43A 5JAUA 3ZJVA 3H9GA 4OHVA 4PAMA 4W8GA 3F8SA 2HJWA 3F0TA 1BCRB 3G5LA 4HB3A 2AW5A 3F3SA 1MOSA 3JY6A 3NI2A 5DB4A 2XUQA 3V8PA 1EK5A 3EDCA 1IM8A 3OTOB 1X9GA 2YH2A 4A8JA 1ZXLA 4H3SA 2V5UA 2QVLA 1N9KA 4M1TA 1RI1A 1F5NA 3THRA 3KB8A 4KXVA 1WCIB 3X1XA 3SZMA 4AF7A 1F20A 4UVIA 3RVOA 3RDPA 1HE1C 1NJ5A 1SBIA 2H4ZA 3W5VA 1Y6GA 3ZBUA 1J2UA 2QZ9A 1OB2A 1WSWA 2IHUA 2RGUA 4OA8A 3Q0IA 5JYDA 1S4QA 2F1IA 3FE2A 3LF2A 4XWOA 2GJ9A 3T7SA 3K73O 4XTCS 3RK0A 1F8UA 2CHVA 2HOQA 3R1IA 5JY1A 1UMKA 2FPOA 3QKWA 1Y7IA 1TNDA 2VPYA 1HDRA 3N7TA 3BJRA 1PWEA 1D1PA 2CXQA 1Z6AA 4KX3A 4ZHSA 1DG9A 4DJTA 2H16A 2G17A 3NPMA 3ZGXA 3NOOA 4S1VA 5H82A 3G79A 3E6AA 1R8QA 3IJRA 1UDAA 2GAFA 4MNTA 2AI2A 4TZTA 2ZDHA 2GASA 4G5OA 4OK5A 1ADJA 1DHRA 4FBGA 2PVSA 4AZ3B 2R7LA 2A0WA 3F6SA 4Y9RA 3RS0A 3O90A 2XH8A 2PJDA 4N82A 2IYLD 5EP1A 3RTGA 3OZSA 2OG1A 4RX1A 3AVXA 1I3LA 3RSHA 2WIFA 5KOHA 1JG4A 3QGMA 2QNRA 2HJHA 1Z12A 4HX5A 3ZWBA 5GJBA 3JAWB 4DC1A 5F9MA 3W6NA 1ESMA 4V0MA 1DC8A 1F0YA 1M10A 4B6RA 2GGSA 2YWXA 3IHWA 3E70C 2HDHA 4DQ0A 2WNIA 2ZRBA 5KTPA 4JJKA 5A62A 2HF2A 4Y0VA 5E1BA 4CR7A 1WZEA 3A8TA 3N6XA 4FCTA 3ZWOA 3JAMA 2G63A 1GRQA 4N76A 3OVMA 4W1SA 1H8HD 2DUUA 3HFSA 1H2WA 2ONZA 2YQZA 3ICOA 2Y2VA 3FFBA 3AXSA 3GZNA 3X44A 4EB8A 4RTMA 1E60A 1ZR4A 1Y9AA 3N2EA 2J9XB 3OLVA 5H4HA 2UAGA 4GQBA 4HGQA 4QDUA 3R3ZA 1A69A 1RWMA 4MULA 3ROQA 5IEJA 2BHLA 3B1ZA 3AZPA 4PZPA 3WYBA 2OYSA 2YDYA 5IJZA 3B9BA 3WLIA 3T7JA 1E7YA 1AZSC 2ECQA 2P9TA 4FX5A 5T4HA 3DVSX 2FZ5A 1ITZA 3D8NA 3PR2B 2P9GA 2RHWA 1I36A 3K8ZA 1Z28A 4RE5A 5ARDA 4BNNA 4C7BA 1W2GA 5DLDA 5IYZB 3FFTA 4JAVC 4S1PA 4RHYA 2VTKA 1JAZA 4O0LA 3F6PA 3VGPA 3G17A 2B99A 4YYZA 2B25A 2AVDA 3Q3EA 1W5BA 1RZ3A 3RYIA 3FLEA 4YJ3B 1GOTA 4FILA 1RBZA 4XSVA 1IWPB 3QYFA 7AT1A 1P5FA 3LUGA 3KVVA 2ZUVA 3CNBA 3Q9LA 1Y1PA 5JIBA 3ZWVA 2XODA 3DLBA 1IXRC 1I7LA 3DVLA 4MGEA 4J0IA 4CDGA 4TRRA 5CPBA 4DMLA 4HTAA 3CBQA 3NIGB 3PDCA 4IOKA 4J1TA 5JAHA 5KX5F 4HAXA 5FHRA 2ZW9A 3WB9A 4NYIR 2VQ6A 5H70A 4OI1A 4H59A 1Y1TA 1Y81A 4CFSA 3N58A 3TRDA 1KSGA 3GJYA 1PEYA 1OH7A 4M0UA 3IAXA 3RTDA 3QF4B 4DOMA 3COZA 1OBHA 5FUVA 2CL0X 2GFHA 1PZEA 3E5MA 4MUNA 4R1MA 4DANA 4JYZA 4ZQCB 2XQJA 2FR8A 1EDDA 1FUUA 3P5BA 3KB6A 2IWRA 4D4KA 4RCVA 4IFBA 1O4WA 3ZD6A 3IEUA 2JCBA 2ZUCA 3LM8A 3TRFA 4F9GA 5K3BA 4AIIA 1V41E 3AL3A 4MKGA 3KQLA 1N3IA 2W2KB 1NHWA 1GZ4A 1YJBA 3QYPA 1XQ1A 2J5BA 4ZCMA 1FF9A 3HCAA 4C0HA 1RCUA 1F51E 5K2MA 2WJGA 4M0FA 3PNQA 5G1OA 4BZZA 4UOZA 5I3ZA 4JGIA 4KPGA 1TU4A 2J7KA 2P40A 1EXNA 4LISA 4WXYB 4YMWA 4YP6A 4ILKA 2HDOA 2NXJA 4G2TA 3AFMA 1CSEE 2WG1A 1U3VA 3U40A 2NU8B 4B4KA 3DMPA 2CKMA 4XYLA 4A6EA 5LWQA 3L0BA 1QG0A 2FEWB 1YB5A 5LD2C 3PL1A 3PE4A 2BH9A 2QVZX 4OL0A 1F60A 4DPKA 5LOVB 1VP3A 4XWGA 1MXHA 1JQBA 2QLMA 2Z43A 2XUFA 5A0VA 1JG6A 1OGYA 5HUJA 1VZ2A 3RUIA 4L7VA 2O8FB 1VGVA 2CVOA 1S01A 4JP5A 5DX0A 3WBKA 1N2CA 1QYVA 3DVRX 1IYZA 3HCFA 2W0SA 4HAZA 1XHFA 2RKOA 2W2TA 5EJ2A 3CPHA 4AY2A 3G23A 3TRKA 3B1FA 3MAJA 4LCEA 1L5NA 5LMZA 3LXRA 3ZPXA 1T6ZA 1YO6A 2QBYB 5ECGC 1K27A 5L7YA 1LA2A 4ZQEA 1OXKB 4TKLA 4GLLA 2WF7A 1E1LA 1KEWA 3MYRA 2D2VA 2H4JA 3L04A 1T3SA 1XZBA 1PT7A 2ORIA 3DUFA 3WMFA 2YY7A 4AZ0A 5C80A 4A23A 1MRNA 2QN3A 4ARIA 4J91A 1RMTA 4HXGA 4D9CA 2HA7A 4ZI7A 2PNFA 4G0UA 2LE0A 2VI5A 4GOOD 3NHLA 1XPRA 1R88A 5C2JB 5F9HA 3LW7A 3TUIC 1ABEA 4V0LA 4UHFA 3KXDA 3KJFA 3TX2A 4D1YA 3ZCPA 2I2CA 2XWBF 1NA5A 1USVA 4DPLA 5KYYA 3R5HA 1AUXA 3N8NA 3WWOA 2G08A 3AY6A 3O8NA 1DC3A 2PL1A 3GNLA 3RIEA 1A98A 3IQHX 3DDHA 1WMDA 1U3UA 4U0JA 2WJPA 1YZLA 2VHZA 3C7DB 2WLTA 4GIBA 4LE0A 2H4FA 1MV5A 3VH3A 2WWGA 4V0NA 2RCYA 2E0IA 3V5NA 4BX3A 2OR3A 2ZRMA 3QWBA 3G89A 3SG0A 2FGJA 4F21A 4D4IA 4CR8A 2PVPA 1BEEA 3GQBA 1M7BA 1B8PA 4Q1FA 3ULKA 5EMNA 4ZVNA 3TZEA 1MW9X 3EASA 1BVHA 1FBTA 4JJFA 1KGSA 1E3WA 3V7WA 1SUCA 4MYDA 6ADHA 1M7GA 5IBQA 3VPBA 1E1KA 1EBUA 1E1NA 2HO5A 2RAUA 3LQRA 4IWXA 4V3CA 3G3EA 5B2ZA 1E94E 2VOJA 3AM4A 2A7QA 5EIEA 3CX6A 1P0IA 4LGVA 3GP3A 4QGGA 4CDNA 4WKOA 1OAKA 4ZXPA 3WFJA 5JXGA 5DT2A 3U26A 3BYZA 1UMDB 3KRTA 3ND9A 1GFWA 1R9JA 1F2VA 3QRWA 2F67A 4JXJA 4JFAA 1LUAA 3SY8A 3MMSA 3K4HA 4G0XA 1HI9A 2I6FA 2FJ0A 3D7NA 4E3WA 5AYVA 4MMXB 4RVGA 2IYZA 3N7AA 2ZS7A 1Z36A 2D5AA 4L76A 5COQA 2OFFA 1MO4A 3SHOA 3FCSB 5KYWA 3W90A 5C18A 2QRLA 4D9MA 2ZSJA 1THTA 3C15C 3CRMA 4FYYA 3UJPA 7REQB 3BIOA 1ZK0A 2RJNA 2A2ZA 1TVCA 3NEPX 5T8KA 3HCEA 4B09A 4DG5A 5JSQA 1KYYA 2NZVG 4K9MA 3K4QA 1KZ6A 3AM3A 3NB0A 1ZY2A 2ZIVB 2EFCB 1NJ6A 2QMQA 3Q87B 4QGFA 3V7FA 4EG6A 4YQFA 1G20A 1ZJYA 2EBWA 2ZBVA 1AKRA 1U7HA 1IY9A 3PNPA 3SF0A 5D3ZA 3LUDA 4PO9A 5LYJA 2Q2OA 4BNHA 4CMKA 3WL4A 4EY7A 5JSHA 4X45A 2DLNA 1GQQA 1OPXA 4MQEB 1JX6A 1NMXA 3BWVA 1VLJA 4G9BA 3TW4A 4RFSB 1P0CA 1Z2PX 1WP4A 3AKYA 1XDBA 2WAYA 3CH7A 3EXHB 3EZYA 1DFGA 3HJBA 4RF4A 1P39A 4G1CA 4B80A 1Y9DA 1OD6A 2ZAGA 1E96A 5BSUA 5FD8A 1O54A 3HEBA 1M8PA 2B82A 3DMYA 2CB9A 2R1VA 3ZX4A 1T15A 4EVRA 4QBFA 1FP1D 1P4RA 5I7AA 3NRJA 2HEIA 4M8SA 1WZ2A 4DJDC 2BGWA 3O1JC 3HCCA 1R6BX 2Q3JA 2V7GA 2DX7A 3UOWA 2YJ5A 1M2HA 1VMKA 2Z9DA 1QQ6A 1QZ3A 2QEQA 2GESA 1LFAA 1ILEA 3PF8A 3UT5B 4CLOB 5JALA 3NT4A 2G3YA 3CZ9A 3OH8A 3F73A 4YMVA 1P9NA 1IN5A 1U0NA 4MS4B 4BLQA 4KK4A 3EARA 4LOKA 4BCDA 4JUAA 5ALLA 3LHDA 4CN8A 2R2AA 1BDJA 5EKDA 1J0AA 1GPJA 1N6RA 2GCOB 1OA1A 3C4QA 2WINI 2J8ZA 3SMQA 5F73A 3DTVD 4H1TA 9MHTA 4C2TA 2E3JA 2DWOA 4NRDA 2FSUA 2VSNA 4H7PA 1S3IA 4N0PA 3W6ZA 2JJQA 2RBGA 5K01A 2Z6VA 4RK6A 1TCAA 4EUHA 4FFVA 1V9CA 3GNTA 4H4DA 5KAPA 3UFXA 2O7QA 4IXWA 1S2LA 4LY9A 4AK9A 1YVEI 4MQFB 3FSJX 5AVTA 1LS6A 3QEKA 4XW2A 2XOXA 3LKVA 3MCVA 2XCSB 2EKLA 5I4KA 4IJQA 2M6SA 5U1PA 1K92A 4F7WA 4EG7A 3KBOA 1AVTA 1VE1A 1YH3A 4YONB 4UNSA 5DGIA 1JLKA 4C5BA 3PXAA 3FWKA 1O4VA 2Q4BA 4PZDA 1XMIA 2C2XA 3OLZA 1MCZA 4MRRA 1P7VA 4U39A 1R9NA 3BULA 3I8OA 1QS0B 4RTQA 1GZ5A 3T5MA 1DQRA 1W75A 2EXXA 3IUQA 5FWYB 4EJ6A 3AERB 1RLJA 1ZAKA 4TMWA 5TPWB 3X1WA 4AMYA 2WJWA 4LDAA 4ZZ3A 3RIXA 2VDWA 4ZAWA 2YVAA 1N8TA 4NYIQ 3PNOA 2AEJA 5FL7A 3K92A 4WCDA 3K9BA 4ZYYA 4D6YA 1FW6A 1PTJA 3IDQA 3PD7A 3TINA 2AEEA 1GZ6A 2WA1A 1EJBA 4CJXA 4FLEA 2XVZA 5KNDH 1X14A 4EB3A 1A71A 3D6JA 3GJRA 1IVNA 4RKWA 4AG3A 1DAGA 3TQFA 3TDMA 1SKYE 4HMPA 3FYHA 1JIKA 1RLMA 3QKRB 3PNLA 4I08A 3SBDA 1W47A 1P5RA 2YXBA 3AK4A 3JWHA 2ZUTA 4RULA 4FQ8A 4YMLA 4MZDA 2JI7A 2JEZA 1GILA 3EQ8A 1Y6ZA 3IP9A 3MNFA 2BONA 4OGLA 4E08A 4URXR 1U6IA 4MLPA 4CIVA 5JY6A 4H4CA 2F43A 4U9UA 3RHSA 1QO7A 1X77A 1QIFA 4M49A 4LMRA 3QE4A 3JQDA 2YS7A 3PHBE 3K1ZA 4CKCB 3OAAD 3D1LA 1FXWA 2F1RA 3OO0A 1EGAA 4XVUA 4ID3A 3IDZA 4LKRA 4D9EA 1G6HA 3AB8A 4ZVRA 5T5QA 7GPBA 1QC5B 3H97A 1MV8A 3WGVA 5ICGA 2IA5A 5I5GA 3UY4A 1E9EA 2H29A 3QVSA 3I05A 4U02A 2YCBA 5AK3A 3OPNA 2J7PA 3LX8A 4E4YA 4FMDF 1RAAA 2V6MA 1IXSB 3GP5A 5H3LA 3QUTA 3H4IA 5A3RA 4BWGA 5AKXA 1I94B 5E2AA 4IUBS 3N2LA 3CZAA 2BAGA 2C54A 1STOA 3I9OA 4ER6A 1S96A 3V4ZA 3QKSA 4C0XA 3GRUA 5JPDA 3MWEB 4LN1A 5IVKA 3VKWA 1AV6A 3I9LA 1L5HA 3KQWA 3IPXA 3DTNA 4FOTA 2GXUA 5ESXA 2YIJA 3DNFA 4ZMRA 5C52B 3OZBA 3NRCA 4B85A 3E18A 2A3NA 2AW3A 2VHCA 1QPZA 1T9DA 4I55A 2PGXA 2A4KA 3VDMA 3OWHA 4TN1A 1T4GA 2ZSIA 1JIIA 4QBGB 5GIOE 2YRWA 4K6FA 4ZKEA 4PYJA 4R9UC 4ZREA 3GAMA 1TFUA 1Q7TA 2W11A 3IDSA 3ZGOA 4S3MA 4CMEC 1RFLA 1SEVA 1ID1A 3N8HA 1EUYA 3M4ZA 3OA2A 4K87A 4H7HA 2D1TA 3GD5A 2WT8A 2ENUA 3TG2A 1GG5A 1ORWA 2QMZA 1P1KA 1TT5B 4RF5A 4YVFA 4BKOA 5FWNA 5KNCA 1L7QA 1T29A 2FU5C 4E33A 1D9ZA 3QQPA 1JAYA 1A88A 3KWLA 4WK2B 3OEHA 4BE4A 4QULA 3R7FA 5CB0A 2H1IA 2A1UA 1VLLA 3FF1A 1AKVA 2X1MA 5B4TA 5EJ7A 1T4DA 2DOKA 1MGPA 3OE7A 4OY3A 1DCKA 2EF0A 2ZSBA 5LMUB 1K7SN 3FYDA 2XF2A 4MAMA 1CVRA 1WTAA 3HBLA 4X92A 3ANMA 4EVIA 5MDHA 4V0QA 1YQ9A 2GF9A 2OBFA 4ARSA 1AKWA 1SUBA 1R5JA 4MROA 3EYAA 3LUBA 2MINB 3A6KA 1LPBB 1DBWA 3G1WA 3V8MA 1GQOA 4HLQB 4EEZA 3U49A 4HUTA 2H2HA 3OJWA 4N3GA 5CA0B 3D3WB 2I7DA 4RS4A 1KTIA 3T3PB 1MTZA 5H59A 4L51A 2QP4A 1W4RA 1J90A 2QM8A 3O93A 4G36A 4LYYA 4KR9A 2XD9A 2H3HA 2Y1LA 5AI6A 3V2GA 4AFNA 5LPNA 2W22A 1VGRA 2JG3A 4NS4A 4TXLA 2EL7A 4Q1BA 5HKBA 5ERYA 3LFUA 5B7QA 1NBIA 2AOTB 3KPUA 5IM5A 3I04M 3SF8A 2JFUA 1I5EA 1DXQA 2B98A 4MVJF 1NQXA 2P9ZA 1X8XA 4ZGWA 1FEZA 3GY0A 2IHNA 5J47A 4PYRA 2BKVA 1JDTA 2WEKA 2N1MA 4JD5A 1F8XA 1R8SA 2WUDA 1FMCA 4DLUA 4G81A 1QIEA 2TMKA 4RBNA 2EBHX 1WB9A 3FFXA 2GM3A 3CRZA 2PMBA 3Q6MA 3UUEA 3NVDA 1FYVA 1XYYA 3AHEA 3PENA 5DX8A 5AMXA 1T2EA 1U5BB 3VR6A 2F2TA 2IYVA 3IUMA 4EUKA 2XNDA 3RO7A 2QL9A 1FYFA 4DA9A 4P3OA 3C6ZA 2PSHA 4KDFA 1ODFA 1Z2AA 2KI5A 2WF5A 2V7EA 3TTVA 4CEHA 5ALWA 1ULAA 2WFMA 4I9GA 1ECGA 4OLJA 5K0GA 1G7TA 2QQEA 2V4ZA 3E1SA 4XVQA 5C8VA 2VXCA 3RT7A 4F9TA 3BICA 2VYCA 3HRHA 1RAEA 3W3AH 5B30A 5J4HA 3ICQB 4GFDA 4INAA 5AJYA 4MS1A 3WA6A 5C5IA 2QR5A 3VC2A 1Z4QA 2ANCA 4MVXA 3QHPA 3D1JA 4Y67A 3DKKA 4CIDA 1GCGA 4CM7A 4D9GA 4D80A 1ML4A 1EFUA 4DADA 5ED4A 2EFDB 2PZJA 1ZFNA 4HGYA 3MFYA 4UHHA 3LT0A 1NW3A 3EIQA 16PKA 4R2XA 1NNUA 5BO5A 4DLBA 2KWIA 4O4LF 3WLMA 4CIAA 3TTTA 2B2XA 3GNQA 4KNVA 5EE1A 5FKJA 3TD9A 2PPLA 4KYIB 5AO9A 2YFKA 3L8EA 4BMPB 2GDZA 3RUHA 3ZWPA 2LDBA 2AV6A 4XUDA 1AK2A 1FP2A 1Y7PA 1WLYA 5K3SA 5LA6F 3OUTA 2XWQA 1X94A 3P71T 4UBKA 1EYZA 1JQEA 2Y4NA 3RVKA 3IP7A 4BQQA 4B3IA 4KOEC 3V8QA 5C1DA 1B8UA 1Z33A 3NHWA 1HKHA 1G9XA 5DCLA 3Q9SA 1UFQA 4CQNA 4NTZA 1RYDA 3DW3X 3EOZA 3JRXA 3WO0A 3D8SA 5HK8A 1YJ8A 4GS5A 1ORDA 4Q3EA 3OM0A 3VR0A 3OETA 4MRVA 1MZPA 4QT4A 1Z5PA 4EYOA 1NL3A 3GJ0A 1K5PA 5E6RA 4MP8A 2OCBA 2V6JA 4R84A 1R5BA 1CR2A 1LBQA 1OILA 1L4LA 1PFQA 3JALA 2V0GA 4ERNA 1G7CA 1CNMA 2D3TA 2FW1A 2GH1A 1FP6A 2JGAA 3TSYA 1X39A 4OQMA 4EI8A 5AVYA 2RC6A 4LSGA 5HFAA 2ZT7A 3HY4A 3LIIA 4Z9BA 4Q02A 4WK6A 1IEQA 2FRXA 2UZ1A 1JJ7A 1JZSA 4BEJA 2IVZA 4L74A 3UMCA 3JATB 1ZNQO 3HC7A 4DA6A 5BORA 1LLFA 3IAUA 3KC2A 2OP1A 3WGUA 3PQ6A 4M9QA 1VKNA 3W2FA 2FEPA 3BJEA 1E2JA 3WBFA 2MMGA 1FFAA 5DM60 1AZTA 4W9NA 2LDXA 1MOZA 5ALUA 5FTWA 4CL3A 4OM8A 3DBRB 1MENA 2WVHA 3LRTA 1NUSA 4N7MA 1S8FA 3U7FB 2D4AA 3QIVA 4XYBA 1GU0A 2H07A 1CDOA 2X4IA 2ZUSA 4DCPA 2QW8A 4ON9A 1FTSA 2K6GA 1BAPA 1HOXA 1YR6A 2F9LA 2JGLA 4HVTA 4XR4A 1DAPA 1FNCA 3GJZA 3GRCA 4XYGA 5JDCC 5KYGA 2OC4A 4JEMA 5EG5A 1E8MA 2BLNA 4H35A 5I48A 2MR5A 5FOTA 5BXYA 3HSYA 4HOYA 4YCJA 1OBCA 3A6FA 2ES4A 1YZ3A 2PT7A 3H1FA 3WJ1A 4EGFA 5HIJA 3K4PA 3M83A 2DT8A 1RYHA 1PZHA 4GHWA 1IH8A 1XZIA 5EUMA 2UVPA 4EJSB 3INGA 4BBZA 1NNEA 1GKIA 2VTDA 1OH8A 2XEXA 3H8JA 4YV1A 4QEZA 5FNVA 4AVYA 5ADVA 1ZR2A 4UTNA 4AL4A 4G5YA 4II7A 1TB4A 1ZOSA 3AQ4A 4NZPA 4C78A 1KWGA 1IQUA 2JEOA 1RAIA 1NVWQ 1TT7A 1XU4A 3H9EO 3OX2A 2ADOA 1POXA 2XUOA 3B9RA 4Q19A 5A71A 4FXOA 4IVPA 1ML3A 4G0WA 2O5CA 4PTLA 5DTEA 3T35A 3P20A 3VDQA 1TYBE 3DNMA 3GMSA 1MH9A 2A30A 2ZRAA 3EQ7A 1OZGA 1O5OA 3IMGA 3L7BA 2Z6AA 2CXHA 4ASUD 2AGVA 3GRVA 5IJ0A 1T1EA 2XMZA 2XA9A 2HLNA 3RI3A 4XCQA 3HUTA 1XPUA 1EWTA 2OAQ1 2NVUB 1D4AA 4ETMA 3B2QA 3DC2A 4M0DA 4UQOA 3I5YA 4BO5A 3R5JA 1IDOA 3QVXA 4OHOA 2I4RA 4GL2A 3L0CA 3LOQA 3AESA 1BE1A 1KH1A 2BFCA 1U2EA 2VPIA 5HA5A 1QE3A 4L4ZA 4NV0A 1L7MA 2I80A 3E3AA 2ZB8A 1PNTA 4ADSG 3VR4A 1AHHA 1ODSA 2YHUA 2NSHA 1EG2A 3OPQA 4UZEA 3BD8A 1FFWA 1QLJA 3RWOA 3TEJA 2DTDA 1ZDMA 3QVGA 1GXSB 4IH9A 4UU7A 3QMWA 4IGFA 5C1PA 3K6SB 1MVLA 2Y99A 3IPCA 1AURA 2ECFA 1VJ1A 4NJEB 2G9VA 3A9UA 3P1JA 3NLLA 3EDMA 4BVJA 1MAWA 4QQKA 3VNAA 1L7EA 2CLIB 2VJNA 1G5RA 4PV7A 4N0QA 1YFJA 5AOVA 3RWMB 2Z95A 1A96A 1PRYA 2C8KA 4GOJA 4RY0A 4DIFA 1UKEA 4DQDA 3D6HA 4RSGA 5H3CA 2NV2B 4B8ZA 4DAEA 4TZ6A 4C0SA 4EG0A 2J3QA 1ZX1A 3KUXA 2XSZA 4LMBA 1UBHS 1K7YA 5KKCA 2FW7A 1ZGHA 1OWLA 3F97A 2IELA 5IZCA 2LNDA 1TEZA 1BDHA 4GDFA 1NDQA 4I2VA 4XI9A 2XTAA 1Z06A 4D6XA 2FSIA 1FDWA 3P0IA 1C7JA 1GGFA 4GLFA 3QA9A 4QA9A 5CM2Z 1LZLA 1R37A 1RQGA 3QEOA 4G24A 2B8JA 3QSGA 4QJIA 2ODTX 4UXHA 2BEUB 1L1EA 3V8BA 4UEKA 5CEEA 4NDNE 3NJ8A 1QGED 3ZKAA 3TK1A 3KQMA 5CMLA 5F1PA 1ZXBA 5CDSA 1FVHA 2ZIUB 2XT6A 3JWPA 3JQEA 1B15A 4OQPA 1VC2A 2ADMA 3I0ZA 3E3NA 1FNBA 4M0KA 4GPTA 5L3VA 2GPTA 1FSGA 2JA1A 1T1GA 4POOA 4MYHA 1NUUA 1U9YA 3GJ6A 2QI9F 3LA8A 2IHYA 1QDEA 4Z4QA 2OORC 3WL6A 2GK3A 1KIFA 3L41A 3IEPA 1U8AA 3IP5A 4LCBA 5LBIA 1JL3A 2VO1A 4HDNB 5CXUA 1YDEA 1KAQA 4U7FA 4UPEA 5H68A 5K0FA 1XKXA 4Q05A 1YI8A 1XBTA 3CKKA 3UMRA 2W58A 3G2JA 4TYMA 3AHCA 4MUEA 3M34A 4LDQA 4TS9A 2NU9B 4KWIA 1FNNA 3U19A 1G5TA 1JF8A 1Y8QA 1QMGA 3DMFA 5JDIA 5HG0A 1T1SA 5AM3A 2HADA 3VKGA 3DXZA 2XCIA 1EXWA 1II9A 4OGWA 5BSWA 2FH5B 4QSHA 5L51A 1I2MA 3DM9B 3HDQA 2UUOA 3PGJA 5LBUA 3RC1A 1CJMA 3QJ5A 4FDLA 4OYRA 2BYTA 3EDYA 2VSXA 3MSXA 2B30A 4I4IA 4LDNA 2EYQA 5CBKA 3OTGA 3A58B 4UTOA 3C5CA 5BQFA 4R8KA 1RWKA 1A8QA 1AKYA 1SQ0A 1HURA 2D00A 3ICVA 4JBYA 4MR9B 4CNQA 5JYBA 4ZJUA 2C2BA 4YCDA 4BOYA 4ZDIA 3EGIA 4Y98A 3OFKA 5TS2A 2R1TA 4ZU6X 3EQ2A 2DHRA 3M6FA 3MK31 3RJTA 5K0TA 721PA 5CHEA 3UJDA 4ZIRA 5IANA 1P18A 3EUEA 4G1FA 4LNAA 5EHIA 3EY9A 1IB0A 1EUDB 1FOEB 1SUEA 2BGIA 4O5AA 2IZ1A 4CQMD 1NSYA 1QHIA 4QVIA 2QT1A 1PV2A 3VQTA 1YIDA 3VC1A 1JZQA 4HFJA 3ZEAA 4C88A 1CEYA 4QDOA 1RNLA 3PXEA 1BCSA 1PR4A 2WKRA 4FT2A 3RROA 3STTA 3C0KA 5LP6C 3VTFA 3WGQA 4BQIA 2I91A 4E21A 1OX4A 3FPBA 4INPA 1UADA 4L78A 3WADA 3KYDA 5GOZA 2YKGA 2XDWA 4ZAGA 4N5HX 1T8RA 3CLTD 3LC7O 5F64A 1X19A 3DDZX 3PFCA 3W04A 2CLEB 4OQQA 2HX1A 1SPBS 1NXSA 3RBVA 1MD9A 1ZGJA 4JGGA 3ETGA 4KR6A 1A72A 4ZAVA 4E5YA 4JI8B 4MWOA 1ODJA 2X42A 3AG5A 2PG3A 4J4TA 1E5QA 1HSZA 3B3QA 4RDIA 4IDNA 5DWDA 5E6UB 4XZ3A 2OGZA 3P52A 1NVMB 3NBYC 1AKTA 5B3KA 1VMIA 1XALA 2OCLA 2VS1A 2V45A 4KSCA 5BQOA 2I1QA 5JH7A 4PRZA 5MGBA 3KCQA 4MYUA 2O8NA 5CYFA 5LMNB 1IJBA 3JVVA 2RMKA 4QRIA 2ZJ2A 2R1UA 1K7XB 3DO5A 3S2EA 4BFXA 1AKUA 3LCVB 2HY7A 3IMFA 2XZPA 1K63A 1Z29A 1CQXA 3B6IA 1ORIA 1X1CA 4OXYA 4P08A 2P6PA 2PLAA 4R9NA 4YT5A 1X74A 4ZC8A 4D02A 3K5HA 3HZRA 4RTPA 1NONA 1Y0BA 1UJ6A 3QPBA 1V43A 2G5GX 4O2AA 3ROEA 3WLFA 3WLLA 4OQNA 2H9YA 2Z4SA 2A9OA 1QV7A 3ZLTA 1ONPA 2PZFA 4CW7A 4ZVTA 5LKRA 3VHLB 1FYWA 2RIRA 4S0XA 1YA4A 3CNEA 3HJAA 3VAAA 4AZVA 4QTYA 3IKTA 4N3AA 1XHEA 3T7CA 4MVJM 1ST3A 2JD1A 4P5EA 3VPFA 4N7BA 1T1RA 1YBFA 2VJCA 1U31A 4GXTA 2HWKA 5BSHA 3ONVA 4FR0A 1YCDA 3P2IA 4MJ7A 1A50B 3G9UA 5K3AA 5HF5A 2HDWA 4LDZA 4C0JA 4E15A 1B2RA 3FDIA 3BWXA 3F5DA 3PNYA 1SXHA 4AURA 2O8DA 1XTIA 3F6CA 4GZ6A 3L0OA 3SE7A 3W3AD 1VE3A 3CIFA 2GN9A 4LZAA 3GX1A 3QE9Y 1XN4A 2ET6A 1VIDA 3I9NA 4PGFA 5H81A 4FT4A 4IO1A 1A9ZA 3TIIA 1HDCA 2PUAA 1ZMXA 3IB3A 3KKPA 4FBLA 5CFLA 2QB5A 1BQEA 3M6XA 3C98A 3OTQA 4I4LA 1AO0A 4LZLA 1T3HA 1UPXA 2VPPA 1JQDA 4LJKA 3KD3A 1N2JA 1W4AA 2C5BA 2GPSA 4LZJA 4B3SB 3E8SA 3LIPA 4Q21A 3OTWA 1FS6A 3EMBA 5IAAA 2GHRA 5K3CA 1E1CB 1HUQA 5CK4A 1X1TA 5ALRA 2IH5A 1IOVA 1P5JA 5KIAA 5ELLA 4EY6A 1VYUA 3FVWA 4PHCA 5MN5A 2X7JA 3O21A 1CJUC 5AUQA 2PEZA 4DIOA 2OSVA 2WZQA 2Z6QA 2HSJA 2AT1A 2PX5A 3PNVA 2W6JD 3IOBA 4MV1A 1RXIA 3LPNA 1UK7A 2PX6A 1QV9A 1JQAA 3C2QA 1KDZA 1VSTA 5HZHA 4EBBA 3ZU2A 2CBXA 4HWOA 1V9LA 2PL5A 2QIOA 4KV7A 4O0MA 4IDCA 5E6SB 4FR5A 2XPCA 5LZ5A 3TN7A 2NZUG 2A5YB 3EDOA 3PGKA 4M1EA 4TLCA 5TVGA 3NGLA 3C3YA 3KELA 3A1VA 1XMSA 4O2RA 2AKAB 4UM7A 2OCYC 4EKYA 5KCMA 4QNNA 2IPNA 3DP9A 1ZH4A 1M83A 1SU4A 1SVUA 3MSCA 2OUIA 3ELBA 3KR2A 3OQVA 3RS3A 4ANFA 2CDCA 3AFGA 2KLBA 3A27A 2HYDA 3N8IA 4PC3A 4MVCA 2FX2A 4BN0A 3USCS 4L0DA 2O3RA 4Q9DA 4GICA 5C8YF 5LP1A 1EK2A 3DEIA 4BO9A 1NUTA 5AVJA 2VP5A 1JAXA 3A3OA 1WW2A 1ZKMA 5B3AA 4BU1A 1JR2A 2TECE 3PRHA 2RHBA 5DHUA 2ZTVA 4A0FA 4IGAA 3ETDA 4ARBA 4PC6A 3HYLA 1QZZA 5IF9A 4OX9Y 5KQLA 1V4NA 3G85A 3CY6A 5D85A 3UV3A 3KJZA 3E7DA 3M82A 2BCEA 3LXXA 1DIAA 3OICA 1NJFA 5EMJA 2NTVA 3HXTA 3HP4A 4KP7A 4JYPA 5BWCA 1XQWA 1L3BA 1G16A 3VAZA 4YS6A 2IZ7A 1EWYA 2ZCUA 3VPAA 4HLUA 1BXKA 1O08A 5KSYA 1EPUA 1N34B 3IV9A 2H92A 1SHLA 3ZDFA 4DUGD 3HHEA 2XX3A 1SHTX 1FFCA 1VSVA 4JMPA 5TPZA 3W8NA 1TQ6A 1DC4A 2BWJA 2J5RA 2QR2A 3NTOA 4NIMA 1PZNA 4G4SP 3ADBA 1E3IA 3A1EA 4FJ1A 4J0DA 1J5XA 1LH0A 3HN7A 4M89A 1ZS9A 2I1WA 2H1HA 3VAYA 4LI0A 3FNQA 2I9KA 3IAFA 2IUEA 4N3NA 2JAHA 1BMDA 1ZITA 4Q7MB 4EMTA 2Q6VA 4J16C 3BDIA 5JAPA 4RL4A 4U9IS 2J5KA 2BZ1A 3M6LA 2C07A 5IFLA 5KVAA 1QHSA 4LHYA 3UGJA 1HH4A 2TS1A 1NG1A 3G5TA 3R3VA 2Y9MB 2RB4A 3QU7A 5AW8A 4YN3A 2V9ZA 3TLYA 2I99A 3BXGA 4BQSA 1VL2A 2B8TA 2INGX 4Q5IA 4CVNA 1NPYA 1E2DA 5B7NA 1QKIA 2W00A 2ZB3A 3W5UA 2H4WA 1WV0A 4W7IA 4LV8B 3ORQA 5CVEA 4K6CA 4FC6A 3KZKA 4RDCA 2QN1A 1K9SA 3OE1A 3HDHA 1F2DA 5D1NA 4YP1A 2PXXA 3OFJA 1RMQA 2PWAA 4NPAA 3ZY5A 4AS1A 3U48A 3K70C 3LZ6A 3GUYA 1JDBB 2IOQA 1CUWA 4L07A 1CLUA 2C03A 4J6EA 4PLPA 2F1OA 3U4GA 4F72A 5K8IA 1XCPA 4S04A 3R9XB 3ZHZA 3TAXA 3C87A 1UKVY 5EI5A 1L5VA 1IN1A 4X1YA 3SM9A 2GXAA 1U2GC 3N5CA 3DKVA 1XZNA 2C5FA 2J67A 2V7BA 2AB0A 2YUTA 1HR0B 1Y7TA 1ZOOA 1TQDA 4Q4DA 1N2HA 4MVJH 4RKQA 1B42A 2V4UA 4Q03A 5KHAA 5JNLA 4DQLA 1C9YA 4YQYA 2AX3A 4WSOA 3EAQA 1G4HA 1IIBA 2B4KA 2YZNA 3A4LA 2HMWA 521PA 2Y4OA 3HSSA 4QE3A 4DKJA 4OB8A 3E9EA 3OZCA 2I6GA 2QRUA 3BSSA 3PGMA 2VRNA 1G5QA 1WX1A 2HIHA 1JR6A 3QUCA 2YFHA 1T8TA 3B60A 1FVXA 3IOMA 3JQFA 4N12A 3ZJTA 1GVHA 3EH1A 1D7AA 4ZD6A 3GQVA 4MWSA 4W5RA 2QUIA 2JI9A 3TQIA 2VT2A 4OU4A 2ACKA 3DPSA 3UXHA 4LFCB 1MEEA 1H3NA 4EBFA 1RI5A 1TTTA 1XKQA 4YC7A 3KK0A 2DQYA 2XCOA 4YO7A 3U7QB 3TUZC 2G1JA 2VAVA 3SQMA 1UM8A 2KW5A 4Q7LA 5D00A 2PSDA 4FHZA 2VDNB 2GBIA 2QTWB 3L4BC 2X7HA 3IHTA 2HREA 4UVDA 1R6AA 1BFDA 2KSQA 3ETHA 3VR2D 2O6LA 3EBLA 3ABIA 1EG7A 1XAJA 2BJHA 2HK8A 4NHOA 3EBPA 4BNFA 4K26A 3V34A 1S2IA 2WHYA 2RGXA 4AJJA 1FFSA 3CEHA 3O8BA 4BYGA 2JLZA 2HXGA 3QOXA 1ZK4A 2G9UA 2O2XA 2V8OA 1U90A 4C4SA 2B0CA 1KFCB 3MWFA 1YUMA 1D2NA 4UUAA 3GA5A 1DAFA 2XD4A 4PONA 2FSVC 5BSRA 3ZCTA 5L4LA 5CJJA 2HQSA 2RHRA 5FO1A 8ABPA 2QTGA 3FKSA 3GVHA 1UCFA 2E1RA 3O91A 3M5WA 4OIFA 2GBGA 2JJ8A 3DF7A 3FX2A 1Z17A 5EFZA 1U2SA 3P27A 3COPA 1EJ6A 3CQ9A 4Z1MD 3OURA 3TMYA 4F6RA 2OK7A 3NM4A 3F8TA 1E99A 4BFYA 2NX2A 3IQGX 1B76A 4KIFA 4RTNA 2H5EA 1CUYA 2PEYA 5A06A 4MEBA 4OUKX 4BNYA 5BUSA 4ESOA 2EEZA 3B7PA 4F8EA 5J5VA 3HFJA 5INTA 4F2GA 1W35A 4EX7A 4HVCA 3KSDO 1G6Q1 4QWMA 2AYXA 2P5TB 3DAFA 3H11A 1VL1A 2QTLA 4ZVOA 3TLGB 2XZDA 3T41A 3EF1A 3FRIA 1GTVA 1C41A 4F92B 4IIBA 2QQFA 2WHPB 5E2BA 5AW0A 1E8DA 2HTEA 2J3KA 3K5IA 3K5PA 3IKMB 4DUPA 3F4BA 4AB1A 1Z4NA 2O3SA 3AF5A 3FPLA 1YZQA 1XV5A 3KEOA 3KS9A 3P9YA 2C4WA 4I81A 2PZKA 4TLEA 2PL9A 3EEFA 1IJKA 4WFJA 3O2QB 1VI6A 3KBBA 1BMQA 1J8MF 4XRGA 1KEPA 3E3MA 4GMKA 2P2GA 4UNQA 5DKFA 1ZW6A 4RD2A 4Y6LA 2CFRA 2WNHA 4JVNA 3VNQA 1QWOA 4D97A 1T6BY 2FRDC 1W36C 3UK1A 1GPH1 2NADA 2Q9CA 2OWEA 4R01A 4A3SA 2YNMD 3KLMX 3OJOA 1Q92A 4AT1A 1TVKB 1GNPA 4DMHA 2C8JA 2O2ZA 3SIRA 5BSEA 3SEFA 2QYSA 1O96B 1YRAA 4AJKA 5CLHA 3THXB 3AO0B 1WPQA 1E9VA 1SQFA 2YXPX 3K0KA 3S2FA 4Y1EA 4YIHA 3NU1A 2IBTA 3H3FA 4HF7A 1RAHA 2VWHA 1I6WA 4OP3A 4YUVA 2H65A 1GR1A 2QTTA 1I9GA 1TM7E 3GLVA 1I2BA 1KVSA 1R0YA 3KT8A 3CO0S 3EXIA 3OJ0A 4GG1A 3EQZA 4U8GA 5K0NA 2PUEA 5TIIA 1RJ9B 4KX5A 3MT0A 1J49A 4RM3A 1N2EA 2K87A 3LY5A 4REMA 3DWEX 4L3WA 1XZJA 1ZIYA 1Y4DE 1U8UA 3D5QA 3LU1A 3SP1A 2RAFA 2D0PB 2X2OA 1BXRA 3VTAA 4ZO8A 1KY5A 1X3LA 4WRRA 2CLKB 3IO3A 3L8FA 3AUUA 2VCHA 3PFBA 2JAWA 2RGEA 4L85A 3RARA 1JIQA 5LZ4A 3KB2A 5JAOA 1A4RA 4Z4FA 5KEIA 4PPFA 2R62A 2PRKA 3EH2A 4QJ4A 5LLDA 3AP1A 2PKYX 4JEIA 2GERA 3GFSA 3NEJA 5G0WA 3KJIA