1ZK2A

Orthorhombic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
251
Chain Sequence
b'SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic resolution structures of R-specific alcohol dehydrogenase from Lactobacillus brevis provide the structural bases of its substrate and cosubstrate specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 98
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk2A00
3NDRA 4BNMA 4RF3A 2HK8A 1BG6A 1QV6A 4LVCA 4PRLA 2OOSA 1EBUA 1OMOA 4R1NA 2NLOA 1B16A 4J49A 2EV9A 3G49A 4BNGA 5C3MA 2ZK7A 4CMJA 4HBGA 1ZZEA 2UYYA 1HE3A 5IAAA 4R54A 2NTJA 4OJNA 4IQGA 4LVUA 4Q3BA 1GL3A 3OM9A 4ZD6A 1BXGA 1YS4A 1C3VA 2B37A 3F46A 4EGFA 3H2SA 8LDHA 2GYYA 1NQAO 1PJLA 5G0VA 3BHIA 2PZJA 5L40A 4K6FA 3ZWOA 5KOIA 1ADFA 2BGLA 5LDHA 1XWFA 3SC4A 3S55A 3RBVA 4AJ1A 4QTZA 3QLJA 1NPDA 5C7OO 4FFRA 1C0PA 2ZJ0A 4J4HA 1D8AA 4J7XA 4GGPA 2VOEA 4RVHA 2OXIA 1E77A 2ZQYA 1WPQA 3WQQA 4OO3A 5KTKA 3UN1A 2W8ZA 3G3EA 3Q6IA 1SOVA 3W6UA 3F6YA 3TJRA 2PGDA 4W6ZA 3RUIA 2GF2A 1GYQA 3HN7A 3LC2O 1A9ZA 4BNNA 5BNIA 1IL0A 1IUKA 1NAHA 2BD0A 4IUYA 5FI3A 5T64A 4CLDA 3HQ4O 1F0YA 3FWZA 2B4QA 3VHRA 3PYMA 2A9FA 1KY4A 1H6DA 1KVTA 5BR7A 4M87A 1UUFA 4A10A 1LLCA 1IYZA 2J5KA 1PGOA 1DRWA 2FN7A 1QYVA 4Z3DA 1M6WA 2NU7A 2PGJA 1W8DA 5T8KA 2VZ9A 3GG2A 4RF5A 1F12A 5JYDA 2GZ1A 5ES3A 3NGLA 3AK4A 3O03A 5IF3A 4HFNA 5FFFA 3WJ7A 4ZJUA 4YJFB 3EW7A 4XR9A 3ADPA 3E9NA 4CQLA 3JD0A 1TT5B 2GPTA 2NU8A 4Z9YA 2PGLA 3GLQA 1ZCJA 4TZKA 2CD9A 2YFQA 1V35A 3MWDB 4P38A 1AGNA 1UXHA 3RUDA 4R51A 4AJ4A 3KSUA 1DIBA 1H0KA 3GY0A 1AXGA 1PGNA 1E7MA 3G0OA 2QZ9A 4QO7A 3U4HA 1IZ0A 5IZ4A 1M67A 3DZBA 4FGSA 2VWPA 5EN4A 3PHHA 4OKNA 3KHUA 5A5FA 3PWKA 3EK2A 4JGBA 4URFA 2D8AA 3PXXA 1H6CA 2WD7A 3K2EA 4LISA 3KEQA 2GO1A 1WMAA 3QSGA 3BHJA 3H9GA 2C59A 4A2CA 5A04A 4WCFC 2EEZA 4UUMA 4DLAA 3RU9A 2FWMX 3BMNA 2AG5A 1UDBA 4GSKA 3RBZA 3DBHA 4XQEA 3KZVA 5AYVA 5AXDA 1Z82A 1IHYA 4L73A 4MIOA 1GYPA 4LGVA 2V7PA 2JKVA 5GZ6A 1LU9A 2NVUB 1K0UA 4XJSA 1SB8A 4BHTA 5BNTA 4EJ0A 4DLLA 3P19A 3DTYA 1I30A 4ZQEA 4KMSA 3LT0A 3ZWMA 3OBBA 4KP7A 4DPKA 2CNBA 2VTDA 1L7DA 1EVYA 4J7UA 3ZNNA 1FK8A 3SX2A 3D5QA 4XJTA 2W2KA 4TRRA 4OOFA 3IUPA 4O1MA 4FJ1A 5DCUA 2J3IA 4NIMA 4JNKA 4JQCA 3HE3A 3PGXA 4R4JA 3ROPA 3T7CA 3D3WA 3PYLA 4WEQA 2VZ8A 4OIMA 5BSHA 5JDCC 1XSEA 3TN7A 3NTRA 2D2IA 4FN4A 5KJEA 4OM8A 5T67A 1PTJA 1P0CA 3Q1LA 4ALIA 3ETGA 2Q2QA 3KSZO 3Q2KA 3NEPX 2O48X 3ASUA 1KVRA 2D5CA 2B4RO 4Q3AA 1M66A 5DOVA 3RROA 3LQFA 2ZQZA 4K26A 4R9SA 1GAEO 4Q3NA 3KLPX 1NHWA 2UUOA 1Q0LA 3IS3A 1ZSYA 5A3VA 4DMLA 2X7HA 5F1KA 3WYCA 1V0JA 5CEEA 2GZ2A 5HTOA 5B12A 2I9PA 3GUCA 4CJXA 3HFGA 2Z1MA 2PLAA 4UVHA 5TX7A 4B7UA 4CMIB 3GT0A 1ENPA 4I9HA 4K1LA 2O7SA 1WAMA 5JMWA 1X13A 4CMEA 3RI3A 3Q11A 4CV0A 3L6DA 2RBEA 2CDCA 3ROQA 4J1NA 3GAZA 4OMUA 2AE1A 1AXEA 3PFFA 4BB6A 4RF2A 1PJ3A 1GCUA 1LEHA 2G1UA 4AL4A 1SB9A 1EE2A 3D3EA 1KYQA 4FFMA 2WSBA 1RM4A 5TNXA 3QWAA 1IY8A 5CP8A 1I2CA 3LT1A 4PN3A 1J4AA 1UXJA 5T57A 2YV2A 4XD2A 1I01A 4JBIA 2X1HA 1HE5A 1UZNA 1QKIA 3A06A 4XIJA 4LSMA 1C1DB 4CV1A 5KKAA 2V6BA 2BI7A 1GTMA 2ILTA 3GNQA 4ZGWA 4Q3CA 1R4MB 5A9RA 4WUVA 3ZV3A 2JJYA 3UCFA 4QFCA 4I08A 1WLYA 2WEKA 3DMTC 4IPTA 4R1UA 4CMHA 2NM0A 4IDBA 3EAGA 2NU6A 4L74A 2CVZA 4J3FA 1VKOA 4HADA 5AVOA 2D59A 4G65A 2PZMA 3TFOA 1NYTA 4XIYA 3BYZA 2DTDA 5CPBA 3RJ5A 3RVDA 4GMFA 3DZIA 2VNAA 1OOEA 3H9UA 4B8ZA 4IDFA 2AQHA 4DREA 1YONA 5KCZA 3HDHA 1DRVA 5DCWA 2A92A 1D7OA 2CFCA 1DAOA 3Q9NA 3S1LA 3VH4A 4BKOA 1P1FA 3P5SA 2BLLA 1PWXA 3K96A 4I8XA 5I9MA 1T26A 4O6VA 1MFZA 3ZV6A 2D4AA 3X2EA 3JTMA 3MTJA 4ID9A 4M55A 4RLHA 4AJOA 4ZQBA 2HDHA 3ZWXA 5A1TA 1IB6A 1O8CA 2JFFA 3H3FA 1GYRA 3QIVA 1U3VA 4RPHA 5COQA 3WGQA 4PZCA 1A7KA 3JQBC 4YCAA 2YHUA 4S1VA 3JQ7B 1G0OA 4BNFA 4YJGB 1XEAA 3G79A 1WZIA 2GNAA 3UICA 3AI2A 4RO0A 3TNLA 1X0XA 4BMNA 4PGFA 3ZU4A 4ZQFA 1E3LA 1LDEA 2EIHA 2IZ1A 5THQA 3NT2A 1BGVA 2O3RA 3VC7A 1DC5A 4FD3A 4MVJP 2JD0A 2I66A 1C0KA 4RCVA 4BNZA 3GNSA 5GY7A 1ZXLA 4OGWA 4AJPA 4BO2A 2VWHA 1Y8RA 4QECA 3SXPA 5EESA 2VWQA 3ANLA 5LDGA 4ZN6A 3I83A 3I9MA 5EPOA 4IDAA 5JAQA 3ZHXA 5DF1A 2RH4A 3GPDG 4PLCA 2GN6A 5BT9A 4GWKA 1E3WA 2C20A 4HFMA 1MG5A 1PJTA 4TKLA 1CDOA 4J2HA 4CM9A 3PQEA 3PHGA 4GQAA 5L3ZA 5DP1A 1XHLA 4Y67A 4E5MA 3L4BC 2O50A 1Z7EA 4JX8A 1PIWA 5AXBA 2Y05A 2B35A 1WXDA 2ZIZA 3AUTA 4NBWA 3UXYA 1A71A 2EJVA 1GU7A 4JK3A 3CINA 1EFKA 1ZNQO 4Q39A 4R5MA 1SMKA 4WOKA 1ZJYA 5H82A 1XELA 3IOYA 4CM4B 3OA2A 1FDTA 3FBGA 3JYPA 4J1TA 1P0FA 3B1JA 3HN2A 4RQTA 5I8WA 1QXSA 2E6UX 2UUPA 2Y0DA 4U6QA 3TPCA 3D1LA 3DHYA 4KWIA 3RC9A 1PGPA 1HDGO 3OH8A 3G1UA 4GVLA 4ZICA 4D3SA 2BHLA 5HWSA 3I3OA 1CIVA 4BNVA 2Y0EA 3JQGB 3GHHA 5HS4A 2I67A 5KJCA 5JS6A 1YBMA 1FXSA 2NWQA 2Q46A 4CM5A 2HU2A 4GLLA 4XEHA 1YQGA 1ADGA 3DBVO 4KWHA 3WMXA 3CIFA 2BGMA 1NFRA 2QQ5A 1M2WA 4L4RA 3WGYA 5C37A 3E9MA 3GN1A 4J4BA 1YB5A 1BWSA 3R3JA 4QEDA 5T6BA 3ZV5A 3KV3O 1JKIA 1ZFNA 1IE3A 1JDJA 1DIHA 4IDCA 4IGFA 5F3RA 2FP4A 5I8ZA 3WBFA 2ZKLA 5HRUA 3U4DA 4BO9A 1A5ZA 8ADHA 2JL1A 2BH9A 4GBJA 4PLWA 3RC7A 4XB1A 1P74A 1BRMA 4IQ8A 3S2EA 1B8PA 1H9AA 3WGHA 3IKVA 1I24A 3JD4A 2FOIA 4H16A 1MV8A 3GC6A 4NBRA 4NU5A 1NNUA 1R12A 1PU2A 3KYCB 1H93A 1C0LA 5C7LO 1MGOA 1Q7GA 1YDWA 2J3JA 2GGSA 5IDQA 2GASA 3QVSA 4LK3A 1LLDA 2X4GA 1P1JA 5HS6A 2JAPA 3V1TC 4NI5A 4XQGA 1O95A 4XYMA 1I5RA 2B0JA 4N54A 3GH3A 1F17A 2P4HX 3HG7A 2O2YA 2Y1FA 1E7WA 4JIGA 1ZUD1 5IZCC 5L4LA 1DHRA 1ENOA 5I9NA 4WLNA 4CLRA 3ETEA 3I6IA 1N9GB 3WNQA 2VRCA 2F00A 1P45A 2Q3EA 2GZ3A 4I1IA 1GR0A 3BMOB 3F1KA 3RASA 4AJNA 4HFRA 4MKZA 3MJVA 2UDPA 3BMQA 4YACA 2YQ5A 2VYNA 4E2YA 3ZWWA 1HTBA 3KB6A 3GOHA 2Q99A 2GRAA 4EUHA 1XQ1A 5TC4A 3ANNA 2LDBA 4W82A 2FZEA 4D45A 4ZRNA 4Z9XA 4TZTA 4IXWA 4PG6A 3VKVA 3HWRA 3INTA 4FFOA 2CMDA 3OFSA 3WG9A 5ITVA 2XAAA 4BKQA 1JWBB 2UAGA 3CE6A 3PZRA 4JJFA 3IJRA 4O63O 4EUFA 1U8FO 2WE8A 3UFXA 1ZMTA 4O5OA 3JQ8B 2QRKA 4AJKA 3GHYA 1P1HA 1I3NA 3K92A 3OJ0A 3ROKA 2VHVA 2NUAA 4WPGA 2FSSA 4BO3A 2VT3A 3AI1A 2A4KA 4XRRA 1DIGA 4R68A 4PLVA 4I9NA 1T1SA 4UVEA 5H81A 3FNHA 3QHAA 3BTVA 4D79A 2B69A 4E5NA 1KOLA 2DFDA 3ROMA 4IJUA 3KBOA 3MZ0A 1KC3A 4FW8A 3H8VA 4NDNE 1YJQA 1KS9A 1B7GO 3PLNA 1HDZA 2AQIA 2Z1NA 1SCUA 3LT2A 4L8VA 4P4NA 4D42A 3OHSX 3DONA 4TVBA 2PV7A 1MUUA 5DDIP 1YGYA 1XDWA 2Q45A 2FPIA 5KJ6A 1DXYA 3F3SA 2ZJ1A 1O6ZA 1BVRA 1HDXA 1YQDA 4RGBA 1RPNA 1U3UA 4HUJA 3HHPA 4G2NA 2PK3A 3JQDA 4IIUA 5DOZA 4CM1A 4HWKA 3GZNA 4ZU3A 2IXBA 4Z0TA 4YWJA 4BMSA 1N1GA 2QRJA 3V2HA 4E32A 4MIYA 1L1FA 4BL5A 2OORA 2NSDA 2QHXA 4WEOA 1OAAA 4RZHA 3ZCXA 1PQUA 4IDDA 5JAIA 2DLDA 4IZHA 2AMFA 3B20A 3FWNA 3GGPA 4RVFA 1CETA 4IINA 4BNLA 4DGSA 4N18A 4PFJA 3H9QA 1A4UA 4UUOA 1LDGA 4CMGA 4RVDA 1U8XX 4WLVA 4C4OA 3FSRA 4DBZA 5JW6A 1SEPA 4AJEA 3TQHA 4OH1A 5JAMA 3KLMX 1HSOA 5AOVA 3M1LA 5DZSA 5L53A 4EW6A 4NHEA 3WSVA 1GPJA 3AM4A 3ZDFA 4RF4A 3EUWA 3W4IA 4A73A 1E1MA 2W2LA 3PJDA 4G5HA 1X1EA 2G17A 3DBLB 3FR8A 4FOOA 4IDEA 4L4SA 3AY3A 1J5PA 2AW5A 3GRKA 4DC1A 1W0CA 5AQ1A 3COSA 4CUKA 1KVQA 3GQVA 4NNJA 4B3HA 4XGNA 3ZW9A 1HLPA 1T25A 1YQXA 3ZNPA 3L77A 5B4UA 3ITKA 1DSSG 3SJUA 1NAIA 2E48A 1F14A 1HKUA 1QSGA 1YOVA 2Y67A 3LU1A 3M6IA 1GEEA 3LDHA 3VAZA 1MXHA 1T24A 1LSSA 4INAA 1H5QA 3AUAA 3DDNA 4GPD1 1UJMA 5C5IA 1P9LA 9LDTA 4PG8A 4YT2A 3NDIA 5KVCA 4AJLA 1QP8A 4RL6A 4BVAA 2I3AA 2PR2A 3ONDA 4HP8A 3GGGA 4NG5A 3JD2A 4P8RA 4I5EA 4JBGA 1A27A 2PD3A 4EUEA 1SOWA 3KTDA 1XA0A 2J6IA 3RIHA 2WDZA 1V8BA 5CDUA 1O94A 3ZNQA 3E03A 2HO5A 1MLDA 2VZ0A 4GKVA 2ZB3A 3ASVA 4NFSA 1H94A 4OYRA 4DQXA 4DTIA 2FY8A 2C5EA 3BTOA 2DBVO 1ULUA 1V3VA 4PLGA 3ZI0A 4EITA 2NNLD 1RM3A 1U4OA 4EI2A 2V6FA 2YV3A 3DZKA 2OUIA 3GVXA 2DKNA 3RUAA 4DA9A 2OP1A 4WECA 2NACA 3W8EA 4XB2A 4BV9A 4UEKA 3SEFA 5A9SA 2DPHA 2W98A 4AG3A 3O9ZA 3CUKA 3HUDA 3O4RA 4H15A 5FI5A 3WQRA 3B70A 3IMFA 4CMAA 5DT9A 2YDXA 2FZWA 4E6PA 3F5SA 4WNCA 1B0AA 4JCOA 1QLHA 4AVYA 3ZWPA 3X2FA 1UXGA 1HDYA 1LX6A 4IXTA 3WQSB 3K9QO 2BELA 4MVJG 1RM0A 4XGKA 3L0DA 1PZGA 1OZAA 3C1AA 1PJQA 2P4QA 5TLSA 3JQ9A 2RIRA 3C85A 2WJPA 3PDJA 2EKQA 4GVXA 4RPLA 3F47A 3VH3A 1ZEMA 4FFPA 4J2OA 1BXGB 5JFOA 3AUSA 4Z6KA 3RC2A 1KY5A 4E2WA 3D7LA 1YO6A 3AY6A 3W4KA 3N7UA 2Z5LA 4DMMA 2P91A 3VH2A 4RQUA 1H9BA 4FC7A 4HKTA 4EJMA 4MVJD 3ZU2A 4CODB 1D1TA 4YAKA 5CEJA 1ZEJA 1NHGA 3GFGA 1M75A 4M86A 4XR4A 4RVSA 5JXWA 1V9LA 2GSDA 2OFPA 1JKFA 4A0SA 4B8WA 1JWAB 2EERA 3DB2A 4TSKA 5G4KA 3C7AA 2RH8A 4XYLA 5TS3A 4FQ8A 1WDKA 1R0LA 4J1QA 3V1UA 1JQBA 1FDSA 3JQ6A 2JD1A 2LDXA 4XDYA 3KXDA 2NADA 2HLPA 3OP4A 4R16A 1FDWA 1KETA 3WDSA 3S2FA 3L6OO 3ULKA 1BVUA 4X54A 1A9YA 4BKUA 3IAHA 4XZ3A 1E7RA 3OIGA 1GDHA 4FJ0A 3SLKA 5IJZA 3DMTA 1NWHA 1ZK1A 5U1PA 3RFXA 4YR9A 1E5QA 4IBOA 4RDIA 3H4VA 1H2BA 1W4ZA 1ZJZA 2X5OA 3BTUA 2O4UX 1Q0QA 3AM5A 1D1SA 4UVIA 5L95A 3WWYA 1RYDA 1IHXA 2G0TA 3I1JA 3O8QA 4C7KA 4DXHA 3DBRA 1O0SA 2AXQA 3WFJA 2ZYDA 3HNPA 1GEGA 2PZLA 4FIZA 4BGEA 3HDJA 2IODA 3PQFA 4U0KA 4CQLB 1E6WA 4BNUA 4J90A 3K8ZA 4QSMA 1N7HA 1JAYA 1JTVA 3RFTA 3GFBA 5G0TA 2YHIA 3VKUA 3TOXA 1KVSA 4Q3DA 2C82A 1DRUA 4ND2A 1K3TA 2HQ1A 4WJZA 4EZBA 1LRLA 1U5CA 3C1TA 5IDXA 2X9GA 1HLDA 4D44A 4YT8A 3AOEC 1T2EA 3FN4A 2DT5A 3PIDA 3OECA 2EHDA 4WK6A 2WD7B 4TWRA 4CPDA 3OJOA 4FOSA 3GEMA 3WTCA 1ENYA 2RHCA 4D43A 3E5RA 2FR8A 2FSVA 3WXBA 2FPGA 3UHAA 1NWCA 2GUGA 2Y1EA 5IN4A 3GN2A 4JP2A 4LMRA 5EERA 3Q9UA 2BFOA 1HDOA 3BMNB 4YEDA 3H2ZA 1LNQA 3HDYA 3HADA 3QV1A 4E13A 1X7GA 3DBHB 1E7SA 1P1RA 4BKRA 1SAYA 4BO5A 1CEQA 1GQYA 1T2AA 3GDGA 5FF9A 4NR0A 4CQMA 2D5AA 1TB4A 1Y8QA 4NBTA 5KIAA 3VDRA 5CDSA 3NUGA 4D0SA 2PH5A 3GAFA 4MVJI 4WKGA 2ZB8A 2VHXA 3K30A 1AUPA 5TQVA 1NFQA 3H5RA 4YT4A 3OJFA 1Y1PA 1NBOA 3GA0A 2DBZA 5U9CA 2Q4EA 2WYUA 1Y9AA 3VTFA 5L7TA 3LC1O 3ZGYA 4Y6RA 2W2KB 3PGJA 3CXRA 2VTEA 4IQ0A 3I6QA 4IIVA 4DWVA 3D3WB 4IGEA 1P33A 1ZO8A 3CPSA 4J91A 1UH5A 3R1IA 1A7AA 1KEWA 4XYBA 4HNHA 4CV2A 5H83A 2WYWA 3MEQA 3ZU3A 2JD2A 4YQZA 3HJAA 2AEFA 4WLOA 5AXAA 1C1XA 5A05A 3GUYA 3INRA 3ANMA 4OOEA 3U9LA 3JSAA 2HMSA 3FPCA 3GVIA 3ORFA 1PX0A 3WGGA 4BB5A 5I7VA 4B7XA 5FEUA 4BNWA 1LDNA 2H1SA 2PFGA 3P2OA 1JAXA 1CJCA 2QG4A 1P44A 1B14A 3RKRA 4BO1A 5EQFA 1EZ4A 5A06A 3ON5A 1Z74A 2WYVA 2X5JO 3GVPA 1PL8A 5DULA 3RC1A 4ZQHA 4GSLA 4J4TA 4ROSA 4U7WA 5A3JA 4O59O 2Q50A 3C24A 3I9LA 2JFGA 3EHEA 4NBUA 2R00A 2Y68A 1GADO 1VJ0A 4WNIA 3I9JA 4A26A 1XCBA 1ZSNA 1JLLA 3WGZA 3MWEB 4IS2A 4N5MA 3DOJA 4MVJE 2J5QA 3NJ4A 1PL6A 2VYVD 4MINA 4GX1A 4PZDA 3DZFA 1DEHA 4BKPA 3VDQA 1AE1A 1ZK4A 2W4QA 3VVBA 2G76A 5BSEA 3L6EA 1Y7TA 3ONEA 3KUXA 3NT4A 1UXIA 4RZIA 2J3KA 1U1IA 1N7GA 3O38A 4W9NA 1UAGA 2EW2A 4FFNA 1SBYA 3I52A 5T8KC 5JDIC 1NP3A 5F21A 2O4CA 2J5RA 3D4PA 3QVXA 4BGUA 3B6ZA 3R0IA 2IZZA 4R5HA 4D41A 5JYEA 4PCVA 3NT5A 3T7EA 3CZMA 4PLPA 2Q2WA 4I5DA 5COBA 5A4DA 4CL8A 1RM5A 1SC6A 4E5PA 3PFWO 3PPIA 5LCXA 4UVGA 3C8MA 4N5LA 1JW9B 3LT4A 1PGJA 4N5NA 5KKCA 1TI7A 1GCOA 5DCYA 4QX6A 3DZGA 5GZ3A 1T1RA 1GV0A 3JYLA 1XLTA 3JQEA 3U4IA 5I7SA 1N8KA 4FC6A 4OXKA 1XG5A 4NPCA 1NM5A 4UEJA 4PIVA 5F5LA 3WNVA 5EINA 4YAGA 3P2YA 3RUFA 2ZB7A 4FR5A 4W7HA 4M54A 2VCYA 1EVZA 2X6TA 2DFVA 4Z0HO 1VJ1A 2PD4A 1BDBA 1ZXBA 2PNFA 4R1SA 1MA0A 2H9IA 3W1VA 4RPGA 4JJGA 3AOGA 3GR6A 2XXJA 1T2CA 2C2YA 2YYYA 4OQZA 1ZIDA 3STHA 1FMCA 4PVDA 1OBFO 5JC1A 1DIRA 1VSUA 3B1FA 3KSDO 1VSVA 3GVCA 2HAEA 3PHLA 4B7CA 2BRUA 1B26A 1RYEA 5GMOA 4BO6A 2GN8A 2AHRA 5F5NA 4LMPA 1NPYA 4YYZA 2PH3A 2TMDA 1Y8RB 1R4NA 1T4DA 1EMDA 2F1KA 3NYWA 4EEXA 4GWGA 4KOAA 1J6UA 3ZWVA 1K5HA 3LLSA 2PKQP 3OMLA 1E3WB 4JP3A 1YRLA 3OICA 3WGTA 4Q3EA 2IYOA 5L7WA 4CM8A 3PJEA 2VRBA 4D0RA 5G2OA 3BIOA 3MCVA 1CERA 1PSDA 4KTVE 2FR0A 3NGXA 3JV7A 3U09A 4GX5A 2G5CA 2P9EA 1PS9A 2ZCVA 5F1OA 2HSDA 4KUGA 3RD5A 1LXCA 4XQ9A 1H6BA 4B4VA 4AJJA 4QFDA 1DOHA 1RWBA 1VC2A 2XPCA 4YJHA 3VVCA 3E6AA 4E31A 4GH5A 2R6JA 3KYBA 1LSOA 4CV3A 2HJRA 2TMGA 1ISMA 3FNEA 4KDFA 5BSFA 2Q1WA 4KQWA 4TRMA 3VPGA 2X22A 4CM3A 3NJ8A 2VHZA 1E92A 1P3DA 3D64A 3OA0A 4CMEC 4OXYA 3CZRA 4CL3A 5JBIA 1NVMB 1G0NA 5JCJA 5CG1A 4OQYA 1NX6A 1NVTA 3C1OA 1WDLA 5JCXA 5JMPA 2XOXA 3ENNA 1SZJG 3DHEA 1SNYA 1HYHA 4R9RA 1DAPA 3L9XA 3S8MA 1ORRA 3GGOA 4BS9A 5ENVA 1DBVO 4LW8A 5IXSA 3KEOA 1EDZA 2Y1OA 4MVJF 3JQAA 1CYDA 3EMKA 3H7AA 4ALLA 4EEZA 3TSCA 1E3JA 3AI3A 2VNSA 3TL2A 1QMGA 1HL3A 4WLFA 1X0VA 1DFGA 1MXFA 1SO8A 2PKRA 2FPPA 5I7EA 4L4XA 3ZWYA 1BTOA 4PG7A 5HA5A 3N58A 3OEYA 2EP5A 3AFNA 4CMCA 5ENDA 3V5NA 3ZN2A 1ID1A 1IPFA 3LLVA 4QUKA 4BGIA 2OGUA 1XIVA 3WGOA 2HMUA 1ISFA 3QVWA 4R01A 3NRCA 4CR6A 1HDCA 3BTSA 4IS3A 2DAPA 3I9KA 1VI2A 1KBZA 4R41A 3C7DB 2CZCA 1F8FA 2O3SA 2AQKA 1DC3A 1ARZA 1KEVA 1WMBA 4Y6PA 2VN8A 9LDBA 1KVUA 3OJLA 1LI4A 4XWYA 4BQRA 2WE7A 4XQCA 3DZJA 3LSYA 1NR7A 4DBVO 3MJSA 5G4LA 2DC1A 1YBAA 1PS0A 3IP3A 1JKJA 3AUUA 1I2ZA 4JN6B 4CLRB 5KVVA 5TT0A 1Y5MA 2VUTA 4IJVA 1Y9EA 1JVBA 3ZWBA 3JQCA 4HFJA 1S7CA 3M2TA 3SLGA 1HYEA 3IDSA 3BMQB 5KVQA 1LRJA 3RUEA 1HWYA 1SEVA 5J23A 1HF3A 1HETA 1LUAA 1EVIA 1NVGA 3GZ4A 4IY1A 2C7VA 5ER9A 5EIOA 5TSDA 3U5TA 1O89A 1ISHA 1DLJA 4JXKA 5IXYA 4W4TA 1I36A 3VZRA 1IZ9A 3JQFC 4BO4A 2E37A 4B4UA 3TZKA 2A35A 3T4XA 2DPGA 2EGGA 2PY6A 4BOYA 4DC0A 2ET6A 1WNTA 1AHIA 1NQTA 2WTBA 4FSHA 2NV6A 2B5WA 5JSFA 4YRBA 1LLUA 2O3UA 4DYDA 1CRWG 3CKYA 3I9NA 1GPDG 2QZZA 5CDGA 4P4GA 1WDMA 4Y8VA 4TRNA 4BMVA 3WFIA 1HZJA 3RCBA 1PJCA 4A5OA 1QYWA 1ZK2A 2WWRA 1A72A 1EUDA 4F6CA 4J1SA 1ADBA 2QYTA 1N2SA 4E0BA 1PJSA 3QWBA 4ONEA 4NBVA 3WB9A 1UR5A 2NTVA 4BGVA 1MX3A 1KC1A 3DQPA 4ALNA 2HJSA 2B36A 4PRKA 4TVOA 2E82A 3F9IA 1FDVA 2Y66A 2EG9A 4FGWA 3WMWA 3BMCA 1HXHA 3OSUA 1DB3A 3TF5A 4L9RA 2PD6A 5KJFA 1BW9A 1DC6A 4JJIA 3A14A 4BV8A 4II3A 1K2WA 1R15A 1DIAA 2E4AA 2ZB4A 4NJMA 4RVGA 5CG2A 2X0JA 1J0XO 3NAQA 2YY7A 3Q3CA 4AFNA 1EUZA 1EQUA 5L4SA 4J0FA 3U62A 4RV9A 3VTZA 3FTNA 4ND1A 4PLFA 3IC5A 3PWZA 2XF8A 1UP4A 3GZNB 2EKLA 5I9LA 1LLQA 3D4NA 3UVEA 1QYCA 1N5DA 4B79A 1D4FA 5DBGA 1TEHA 2I65A 4GL4A 3ZHZA 2OZPA 1UP6A 3KYDA 2JAHA 3IUSA 3GEGA 1Z7BA 3GF4A 1DPGA 4JLWA 5CDTA 1PS8A 2YDYA 4R3WA 2O3TA 1JU9A 5A02A 5IDWA 1I2BA 4YPOA 3BA1A 4E21A 2PZKA 1Q7BA 2WM3A 2D3TA 1LA2A 2EF1A 5B1YA 4O0LA 4RPJA 1QRRA 2WMDA 4MDHA 3GNTA 1G6KA 1ZSVA 3UW3A 3B1KA 1MG0A 3H65A 2H6EA 1KEPA 1DHTA 1V6AA 4NK5A 3VZPA 4K28A 3PQDA 1X14A 4AJ2A 1PQWA 2AA3A 2GERA 2CUKA 3EDMA 3HSKA 1KEUA 4WCFA 4YBZA 4J43A 3GG9A 1ZW1A 2X0RA 1UDCA 3GMDA 1YOVB 4OXNA 2VUSA 3WICA 3R6DA 3QY9A 4CLOA 2P5YA 3FF4A 4UEOA 5EJ2A 1GD1O 2QX7A 4IMRA 4A7PA 3DTTA 3RFVA 2CY0A 2QRLA 3DR3A 2G82A 1NQOA 4G81A 2HK7A 1ONPA 5TJHA 4QT0A 1X7HA 4DQVA 4QXMA 4YAEA 3UAGA 4E5KA 4ND3A 3AU8A 3HB5X 3EYWA 5KJ1A 5L4NA 2X58A 2X8LA 3PEFA 5L7YA 4DPMA 1Z73A 3DC2A 4YB8A 4BNIA 4CR7A 1MC4A 1EK6A 4IJKA 2AQ8A 2HMWA 3RJ9A 3WYEA 1AHHA 1IPEA 1HE2A 1B8UA 4OAQA 4BNYA 3L9WA 3QVOA 1O9BA 4GLOA 1IULA 4PLHA 1I3MA 3VPFA 5JDCA 3LVFO 4YRDA 2X86A 2WD8A 2AG8A 5BNFA 4UUNA 2Y1DA 5ICMA 1GZ3A 4U0JA 5IFLA 1QLJA 1W73A 3CH6A 1E3IA 1VL8A 3A28A 4L75A 2BFPA 4GI2A 3LC7O 2YJZA 1BMDA 2Q4BA 3FTPA 5A9SB 3Q2IA 3SBOA 4DQUA 5JY6A 4NQZA 3OETA 3WLEA 1M6HA 1I33A 4ZRMA 4CLEA 1YKFA 2EW8A 4EDFA 4WASA 1HEUA 3DZHA 4BNXA 2YV1A 4MOWA 1E0DA 4IJWA 4J16A 5K6AC 2EXXA 1WVGA 3TZ6A 4R1TA 2D0IA 2HCTA 1L7EA 3UOGA 3RUCA 3FBTA 3ZNOA 2JCXA 4PLZA 4MIEA 2NQ8A 2Q49A 3MOIA 1U7HA 3ZWCA 5B4VA 2YW9A 5TJ9A 1Q1NA 2RCYA 1MP0A 4B4WA 1YJ8A 3S2IA 3CEAA 3PTZA 2NTNA 3PWSA 4YTEA 1QG6A 1U3TA 1PEDA 2CDBA 3PP8A 2JCVA 1ONOA 3CMCO 1EK5A 3DAFA 3ZZNA 1E6EA 3M1AA 1D3AA 4E33A 2ZTMA 4XYEA 3FD8A 1LC0A 1R16A 1VRWA 2C0CA 2HRZA 3DAGA 4EYEA 4F6LA 3FR7A 4NFYA 5G4KB 3PYXA 1WZEA 3CMMA 1WWKA 1MC5A 3NTOA 4YJFA 1E7QA 3QWIA 2VHWA 5JPIA 3U4CA 2NQTA 1I3KA 3K2BA 1TT5A 6ADHA 1YDEA 2IEDA 3BAZA 3JD1A 4OSPA 4UULA 3V2GA 4CUJA 4BO8A 2I3GA 1LRKA 1HRDA 1QYDA 3K73O 1P1IA 1Y81A 5FWNA 5JE8A 4A03A 1E3SA 5MGBA 3E82A 1G1AA 3U49A 1TXGA 3A1NA 5JDIA 1PZEA 2SCUA 1ISIA 2NVWA 2QW8A 5A9TA 5BQFA 1LSUA 3IQDB 1LDMA 1DFHA 2Q1TA 3WIDA 5JNLA 4J9UE 1VL0A 2OBNA 1BXKA 5ICSA 1PWZA 3EZYA 1EQ2A 4E3ZA 3UKOA 4B3IA 1I3LA 3OQ6A 3JQBA 3NTQA 3O8QB 1OC4A 1UXKA 3WBBA 3QA9A 2J8ZA 4HV4A 4DIOA 5CEFA 4FCCA 4M89A 2X5KO 3DBRB 2BMAA 5DBFA 4LSWA 4FPXA 4CM9D 1Y5RA 4BO7A 1V3TA 3H5AA 1IOLA 4M49A 2OMEA 4Z0PA 4EBFA 4XX0A 2NVUA 4TMFA 4IDGA 1NQ5A 2PWZA 4HXYA 2YHIB 1PZHA 3W8FA 4DRYA 4Y98A 4AICA 1K6JA 3F5QA 3LF2A 4ZHSA 7ADHA 1E1KA 1HE4A 4FJ2A 5CPFA 1JVSA 1OI7A 4PG5A 2CF6A 2EGHA 1T2DA 3QP9A 2CVQA 1U28A 1BSVA 1GUFA 2ZYAA 1TVEA 1GUYA 1DLIA 1ZMOA 2PKQO 1HZZA 5IDYA 3TFQA 1QR6A 3L4BA 3RQSA 3I4CA 2EP7A 3PJGA 1ZVMA 3GPIA 3ABIA 4CQMB 3WOHA 1DC4A 1Y8QB 1J49A 3PVZA 2PA3A 5CDYA 4MJLA 1RKXA 5ADHA 5EMHA 4R3NA 2B83A 3NKLA 5L9AA 4ALMA 1EBFA 3H5NA 3PHJA 3QWFA 3OQ1A 2P68A 3GDFA 1F8GA 1YL7A 5JCJD 2Y0CA 1B3BA 1PJ4A 2IXAA 3ZWAA 2BGKA 3Q0EA 4CMIA 1LTHR 3VPHA 3VH1A 4KUEA 4R69A 3QVTA 1H6AA 2GDZA 3AWDA 5G0WA 3K31A 5ER6A 4BNHA 2E49A 3LYLA 4PZEA 3TL3A 4CMBA 4DVJA 3D0OA 3JQ9C 4KZPA 1VJTA 2PTGA 3JQAD 1XU7A 5JY1A 2X0NA 5TGDA 2JHFA 4BUCA 4E30A 1BXZA 1C1XB 3DFZA 2DM6A 4MVJH 4LRTB 4BIIA 4KTTE 2P9GA 3OIDA 3JCZA 4YT5A 3V2UA 4P4LA 2V6GA 2X0IA 1LC3A 1NFFA 5FYDA 3ZU5A 1C1DA 2BI8A 5T5QA 2I6TA 4YAIA 3EY4A 4ALKA 1MFPA 4D7AA 4Z9FA 2IEBA 1M76A 1PZFA 3TZCA 2HUNA 1R4MA 1DJNA 4M8SA 5F1PA 1YL6A 3E48A 1U2GA 4BNTA 3MJEA 5K9ZA 2OHXA 3OEWA 1O5IA 3I4FA 1B15A 2VRCD 1DJQA 3KM0A 3EC7A 3LK7A 4NFHA 3ZV4A 2OP0A 1GZ6A 2HK9A 2VOJA 2VYND 3KO8A 4CR8A 2V65A 3A9WA 1FF9A 1GY8A 5ILGA 4UVDA 3QW2A 1GV1A 1UP7A 3PIIA 2IYPA 4XDZA 2VQ3A 4ND4A 5G0SA 4TQGA 4ITUA 2GN9A 2OBYA 3WLFA 1N92A 2W90A 3GVHA 4MVJA 5C7IO 4II2A 1DO8A 2EKPA 3MTGA 4MKXA 2QIOA 3VPSA 2POQX 2X9NA 4D3DA 1EDOA 2AEJA 4C7JA 4GX2A 2UVDA 1UDAA 4PLTA 5IZCA 1U7TA 4P22A 2OL4A 3UGKA 2Q1SA 4Y9DA 3JQ7A 4YJGA 3EVNA 3UF0A 3DO5A 2GN4A 3QQPA 4GX0A 1Z6ZA 3WWZA 4I5GA 1ISJA 1R37A 2Y1CA 3GRPA 4MO2A 4BO0A 2AEMA 4GKBA 3NV9A 2BF7A 4W7IA 5DBIA 2Y1GA 1WW8A 3HFSA 3WS7A 1U3WA 1X1TA 1KIFA 2EJWA 3RBXA 3UCEA 4FB5A 3DOCA 1HT0A 4BQPA 2O23A 3TZQA 3F4LA 1NPTO 2BFAA 2ZYGA 5AXCA 1E6UA 4WE3A 2DVMA 4F45A 2YZ7A 3UCXA 2DUWA 3H9JA 4YXFA 1C14A 4MKRA 1P31A 2JHGA 4B3JA 3WSWA 3KRTA 5JAZA 1VPDA 1XQ6A 4AJIA 2FHSA 4NZ9A 1UZMA 2J3HA 3G1TA 4I9UA 2GR9A 1B2LA 1S6YA 1Q0HA 1SPXA 1XKQA 3AJRA 1JN0A 3RAJA 1VKNA 3WIEA 3GK3A 1Z45A 3GMSA 3M2PA 1T2FA 2AE2A 5DN9A 3ETDA 1ZKMA 3JD3A 3N74A 3P7MA 2RAFA 2VUUA 3G17A 3IIEA 4LCJA 2ZTUA 3JQFA 4FBGA 4XCVA 1K89A 1I0ZA 1VM6A 4YJDA 5TT1A 1I8TA 4HY3A 3PK0A 1PQPA 1X7DA 4NMHA 4UUPA 3MJCA 4QQRA 2DTEA 3INGA 4J9VA 1CF2O 4F3YA 3I23A 1LQUA 2HRBA 4CM4A 1E5LA 2P5UA 4YAJA 3RSHA 4PLYA 3ITDA 4JROA 3WR5A 4DYVA 4E2ZA 2CF5A 3AY7A 5THKA 5HBRA 1R4NB 3TZHA 2ZCUA 1MB4A 3UH1A 2IE0A 4WLEA 5JC8A 2VT2A 3NDJA 2O3JA 1TA4A 4GMGA 1XGKA 4U6SA 3ZHBA 4K6CA 4DLBA 4DPLA 3PJFA 3RUHA 2W2LD 3DAPA 3JQGA 4L0QA 4DL9A 4NK4A 3FHLA 5EQDA 1TLTA 4H7PA 1CWUA 1NASA 4U8GA 5U4QA 1LSJA 5IG2A 3EZLA 3DFUA 4DIFA 4CM8B 3MOGA 2FRDA 3IKTA 1U9JA 4ESOA 3SVTA 1YL5A 5IN5A 1XYGA 3H6KA 3MJ4A 3ICPA 3QE3A 5L51A 1VL6A 1UZLA 3JYNA 1EEHA 3WTBA 1EVJA 3FCOA 2GCGA 4MP6A 2O7QA 4AJHA 4E4YA 2Y99A 1Q7CA 4KUHA 3F1LA 3F4BA 4RPKA 1QORA 4M1QA 4YJHB 2DTXA 3IJPA 3BZUA 3VZSA 1E1LA 3E5MA 2HKIA 2VWGA 1PJ2A 3D4OA 5JLAA 4BNJA 5I7FA 3DL2A 2R00C 2X9VA 4WCDA 3WYBA 3VZQA 4I5FA 1Z75A 4YVFA 1GFSA 1RJWA 2O3QA 3EVTA 1KERA 4ILKA 4MP3A 2CVOA 5TF4A 2GD1O 3KYCA 4RORA 2IRWA 3PZBA 4GAEA 1HSZA 4TROA 2IDZA 1PR3A 2ZTLA 4L76A 2D1YA 5BSGA 5ITWA 1EUCA 1V3UA 1E3EA 3DHNA 4KQXA 4IZIA 1HYGA 4N7RA 3AM3A 1FDUA 4YA6A 3JQAB 4XA8A 5JO0A 2A94A 4W9NC 1E7YA 1BDMA 5L45A 2I76A 3BHMA 1YXMA 3OQBA 5JO9A 4UREA 3SJ7A 1F06A 1N9GA 2YFHA 4DUPA 2OO5A 1K6XA 2I99A 4K9DA 3BMOA 3TRIA 4LRSB 1PJBA 4ZQGA 3U0BA 3W8DA 3L07A 2C7GA 1OC2A 5KWEA 2VYVA 3C3XA 2I5PO 1E1NA 4Q9NA 4CLXA 3FNFA 3QRWA 2B4TO 2Y93A 3WX0A 4J0EA 4D46A 4A27A 4U5QA 4KDEA 2BKAA 2DQ4A 3NX4A 4CM7A 3TOZA 3KVOA 5CHEA 1YB4A 1YH3A 1YE3A 2DU8A 4MPDA 3JQ8A 2UV8A 2O2SA 1AN9A 4YRAA 3K5PA 1B8VA 3T4EA 3JYOA 4ND5A 3O26A 5EL0A 1QYXA 2YQ4A 2JFHA 4YDRA 3TWOA 2P9CA 1PGQA 4UAGA 1TT7A 3ONFA 6LDHA 1YVEI 7MDHA 3AU9A 3OF2A 1T4BA 5TRTA 2HMTA 2H5LA 3LZ6A 3OJEA 3IL2A 1ZK0A 3H3JA 4WLUA 5COAA 1X15A 4IM7A 3ADOA 3ZW8A 4XGIA 4EJ6A 1YBVA 1ADCA 3HDQA 3DXFA 1R0KA 4HX5A 4FDAA 4XRGA 4NH4A 1VE9A 4PVCA 2VHYA 1P1KA 4ALJA 3MJTA 2IZ0A 1ULSA 2Q2VA 4OHUA 4PG4A 3GEDA 1R6DA 3RKUA 1U2DA 3ZWNA 3K6JA 1U5AA 4RLSA 3UUWA 4D3FA 1U4SA 3IP1A 1LDBA 1ZBQA 3PHIA 3E18A 3RU7A 4E5YA 5A03A 5KVSA 3U3XA 1R0SA 3DMYA 3ICCA 4RDHA 1CQJA 4RVUA 5K6AA 5B4TA 3WJAA 1K6IA 1W6UA 1EE9A 3FPLA 2NVBA 1YWGO 1LJ8A 3VPXA 3AFMA 4OL9A 4NJOA 3ST7A 4J6FA 3QJ5A 4WGGA 4NU6A 1A4IA 4FFLA 4LCEA 3V1YA 5GZ1A 1NXQA 5DP2A 4CUZA 4J7CA 1GQQA 3DWFA 4GGOA 4ZVVA 4RJTA 1Q2XA 5CAEA 1VLLA 2CDAA 4Y6SA 4E2XA 1ISGA 3RWBA 2XXBA 5MDHA 3BMCB 1GZ4A 3PLRA 3PI7A 4TKMA 1PR9A 4CM6A 4MVJM 3DOOA 1BW9B 2C2XA 2Q1UA 3FNGA 5B37A 4LN1A 3LF1A 1BHSA 3ZH2A 1B3RA 3OIFA 1CQIA 1LBEA 4NJMB 1ONNA 4YQYA 1HDRA 3DBLA 2RHRA 1N1EA 1YB1A 3KETA 2C5AA 3A4VA 3D5TA 1XR3A 1NR1A 3HB4X 4BNKA 1GUZA 1EFLA 3R3SA 4OKIA 3H9EO 3W4JA 5ILOA 1I10A 5LC1A 3FI9A 4Z3KA 1OFGA 1JA9A 1LQTA 2GLXA 4H3VA 3C7CB 3PRJA 3L4SO 1C0IA 1FJHA 4HNGA 2ZATA 3W6ZA 2P2SA 1LDYA 4XYGA 2C54A 3S2GA 3KYDB 2C29D 4CMKA 4MP8A 2FR1A 3I5MA 3JYQA 2DUUA 3WGIA 3QWHA 1GQ2A 5HM8A 3BXXA 3GDOA 4CQMD 3AW9A 1QV7A 4XKJA 4S3MA 4CLHA 4TRJA 1DDOA 3I9OA 4JBHA 2V6MA 2FMUA 2QYSA 4W99A 4ZA2A 5A5EA 2X23A 2EWMA 3AOEA 4DIBA 4E12A 3DEYX 2Z95A 3EGOA 3PDUA 1ML3A 3FRJA 4WOJA 2H63A 1R66A 3E9QA 1NTOA 1ZH8A 4IMPA 4WCFB 1PL7A 1DFIA 3CSDA 1ENZA 1XU9A 4B4OA 2NU9A 4FS3A 2ZTVA 2C07A 3E8XA 5G0UA 3V8BA 3SC6A 5TIIA 5KNLA 2HMVA 4OSOA 2B5VA 5DNAA 2YUTA 4QO8A 3ENKA 2JCYA 1I32A 2R2GA 3KOUA 4CLOB 1WP4A 3E1KA 5CFZA 2DBRA 1ZK3A 1H2HA 1Y6JA 5K0ZA 3TDKA 3ZHYA 3HZZA 3VOSA 3CTMA 4F46A 2BFMA 2DBQA 1P77A 2CSUA 1UAYA
chains in the Genus database with same CATH superfamily
2ZS9A 2HJGA 1XKLA 3CZ9A 3NDRA 3RS4A 1OGIA 2VP6A 3AERB 3HSSA 2J3EA 1TM5E 4UCQA 1TFRA 4CTMA 2C4HA 2OOSA 1OMOA 2O8CB 4LXIA 1EH5A 2NLOA 3ZXUB 1XZDA 2JIOA 3UJ9A 3G49A 1EPUA 2I55A 5HCUA 4TVKA 1MW9X 1C4WA 1LVHA 4GBMA 4TMTA 1YACA 4BFYA 5IAAA 3OI7A 5AI0A 1PDOA 1WABA 3NVAA 4OJNA 4Q3BA 2F43B 4KGXA 4PPQA 1MO4A 1QHIA 2J9GA 4BQFA 1XXHE 2RJOA 1DU4A 2FX2A 1ELOA 3PBKA 5I01A 3V4RA 1JWLA 2FI1A 4M3NA 1VMEA 3Q6MA 5J4YA 3JRWA 4QGFA 4EG5A 2RHHA 1NQAO 3HPRA 1QOQB 2GS9A 3BXGA 2PZJA 4KE8A 3BULA 1TPYA 3RIYA 1Z5VA 4K1XA 5J4LA 4K6FA 4MUGA 3RGWS 1OR8A 3TRKA 5BN3A 2FOLA 1T36A 4PHFA 3DOUA 4W1SA 1Z4IA 5IKXA 5LDHA 4WIAA 4L85A 2ZBVA 3DE0X 1XMIA 4DLNA 1ID8A 1XWFA 4MS4B 2UVPA 4BZWA 2QN9A 1NPDA 5C7OO 4J4HA 2Y71A 1DKNA 2EVWX 4M9XA 3W5CA 3K9BA 4N49A 2VOEA 3U60B 2MU1A 1E77A 4RGYA 1CIPA 1WPQA 3WI7A 4FB4A 1YE8A 2IBMA 4KPUA 2O6LA 3EYAA 3QX7A 2BYTA 3UG6A 1C29B 1G5RA 7REQB 4B3CA 1QHEA 1WEHA 3F6YA 4TM7A 1F0KA 4W6ZA 1T3HA 5L6LB 1DAHA 5BV8A 3MFQA 3VYRB 2CHEA 2BD0A 2PUWA 1E9FA 2RI6A 4IUYA 3M1YA 1A5TA 5T64A 3AESB 3HNRA 3HQ4O 3LQ2A 3DKRA 4CLDA 2NYAA 3T5AA 4DUYB 3FWZA 3VHRA 3REQB 5WRFA 3M4XA 2Z8ZA 1KVTA 1G60A 2CNWD 5BR7A 5FO1A 1RKVA 4B76A 4FNGA 5HKKA 2G7ZA 1PR1A 1V1RA 4ZVOA 1ZRMA 1DRWA 3RVNA 4F4CA 2WHRA 3E15A 2Q0HA 4Z49A 2NU7A 1J09A 2PGJA 2IDKA 5T8KA 3K5IA 621PA 5EMNA 1F12A 1N2BA 3TLKA 2EYQA 2ZETA 5ES3A 1OX5A 3O03A 2YIDA 4S1OA 5IF3A 4G5XA 4YJFB 5EIFA 2IUYA 3ADPA 4JODA 1Z39A 4RA9A 4RTQA 1TT5B 1VPEA 3URKA 5M5BA 5DGXA 1NBIA 3DMPA 3P94A 2D54A 3ESYA 3GLQA 2YFQA 4MKIA 3ROZA 4P38A 2PUTA 1AGNA 4NJEB 4RSMA 5E8JA 4BDTA 5JNTA 4J0JA 4AJ4A 10MHA 2AFVA 3C14C 3GY0A 4KNVA 4XGRA 4AZVA 1O03A 1PGNA 2JGIA 4QO7A 4EHIA 3U4HA 1IZ0A 5JG7A 3I73A 2VP0A 4F0JA 2CL7X 5LNK1 2JGNA 5LQJA 2Z2YA 3LRTA 3NASA 5CURA 1D1QA 2YN2A 4P5EA 3PWKA 4WZAB 5LJLA 1J23A 2BE7A 3EK2A 1SHKA 3O4GA 2VF4X 5LBTA 3TSAA 3O95A 2K87A 1K3FA 2PJUA 3GRZA 4NOLA 1PT6A 4OY3A 4URFA 3T5DA 1BD4A 4Y3UA 5DCLA 1YFLA 2JHPA 3MTDA 3QSGA 3BHJA 3ZY6A 2CW5A 2CCGA 4K9SA 3ZYCA 3ZZ1A 1RYHA 5SYMA 4HHEA 4WCFC 4DJEC 1G3RA 5K3FB 4Z2AA 4DLAA 4H27A 4BCDA 1Q0TA 4QUGA 4C3UA 4PC3A 3RBZA 3L0PA 1OWMA 2XTAA 1F2UB 2ZM6B 1GP2A 4Y2VA 2FMIA 3IAS6 3O92A 4F9GA 1IHYA 3W8NA 3D0QA 2BZGA 4C4ZA 4CEIB 2GQ0A 2GHTA 2I4IA 4FCWA 3FFBA 3HB0A 4HG2A 1CT9A 1LU9A 2IUTA 1J25A 4XJSA 1SB8A 1LWNA 4DV0B 5BNTA 4DR2B 2EKZA 2DHCA 3EOBI 5TQ2A 3P19A 4MQUA 4L2IB 4N3BA 3JATA 3O83A 4FMDF 3ENWA 2PRYA 3GW8A 2P2ZA 3P9IA 4S35A 3AP2A 2JJ2D 4DPKA 1UF9A 1XCJA 1L3IA 3LUDA 3ZD8A 1R50A 2QW1A 3E9RA 1FK8A 1GFIA 2GTIA 2ZI6A 4JJ4A 4P36A 4RVNA 4XJTA 4AF6A 4O1MA 1QYIA 4IIXA 1SXJC 4DDKA 4NIMA 4JNKA 1N8TA 3S2SA 3T7CA 2CMFA 3ROPA 3MWJA 3KT0A 3R41A 4IUDS 1HG1A 3S2UA 5HE8A 2E3JA 3VHQA 5KUTA 1W36C 1Z6TA 2QN7A 2IYTA 3C5EA 1WX1A 2H92A 1QFSA 4HXGA 4KEAA 1XV5A 4TV9B 4J0GA 1P0CA 1OLOA 5T67A 1S8AA 1T5OA 2Q6VA 4FQ7A 4LV5B 3DA8A 3ELDA 3M3PA 3MD9A 4N9WA 3KSZO 3P2JA 3Q2KA 1DG9A 3NEPX 4QUEA 5E95A 4A8JA 4JXZA 3NM6B 1KVRA 2D5CA 1PLKA 3HB1A 1VRVA 3ZCTA 3U26A 2OCXA 2OBXA 3RROA 5F3WB 1NNI1 3X2SA 1NHWA 1IG0A 3PE4A 2OGSA 3IS3A 4DM4A 3QPWA 2V1UA 4UD2A 4CL0A 3W8RA 4M9CA 5J43A 4DMLA 4KBFA 5B6IA 5ECWA 1P9OA 2GZ2A 3KDAA 1ZY2A 1HQCA 5B12A 5E4FA 1FP2A 4BX2A 2F8SA 5AUOB 2JA2A 2Z1MA 2PLAA 5CT9A 1C8BA 1YGPA 4GYYA 4MJXA 5ALTA 4ZREA 5BSWA 2D7DA 4KQ6A 3P0FA 4K1LA 4IIGA 1JBEA 4J16C 1EM8B 3ESXA 3MWEA 1PLLA 3SOPA 3ZWDA 4CMEA 5JMWA 3EC1A 4Z1MA 3RI3A 3RS0A 3L6DA 2ZRHA 2RBEA 2JBAB 5DIFA 5JJKA 2BKUA 4J1NA 1EP2B 4W6QA 5DPMA 3PFFA 1AXEA 4KXNA 4BB6A 2PA0A 4RF2A 1USWA 1OU0A 3DVRX 1C3EA 3W04A 1TDJA 2GYWA 1EE2A 4I2VA 4IHQA 5EMJA 2AZTA 2WMYA 2GBLC 2WSBA 4JL5A 4MI9A 4XIIA 4BX3A 4EG7A 4C0XA 4CI9A 2ZJ5A 1CR4A 1KHTA 2XMSA 4PN3A 3BERA 1Y4UA 1NNSA 4JBIA 2CNLA 5D01A 5JROA 2PUGA 2C61A 2X1HA 4IIBA 1QKIA 2A3RA 3NC4A 4XIJA 2F8LA 4ZEWA 3HB9A 2IPOA 2V6BA 1GTMA 2FG5A 2GAJA 4E5DA 4ZGWA 1R4MB 3K70D 3JR3A 5TPWB 6NULA 3UCFA 2DFNA 4X6UA 4I08A 3OAAA 2O1WA 4KNWA 2G4CA 4BLVA 4CMHA 4DR1B 1YVPA 4PBSA 2CVZA 1LLFA 3IODA 3RTCA 4UM5A 2PZMA 3AKDA 3LW8A 3TEFA 5HW0A 1EIZA 1NYTA 2HR1A 2DTDA 2ON6A 2X8JB 3AFHA 3HKDB 4I8IA 4IG9A 4Q4CA 3LK6A 3C3CA 4HOYA 1U02A 2C4WA 3PPVA 1OB5A 3A7DA 1OOEA 2WYHA 2YC2C 4CKEA 2VXBA 1Z2EA 1DRVA 3M5DA 4TMYA 5DCWA 1KYVA 1D7OA 2XYGA 4NVRA 1DAOA 3C3DA 1JFVA 1HOXA 1XVLA 1L5YA 3FPJA 3IUNA 1F9AA 4OQDA 2P30A 5BURA 3K9FC 2BLLA 3O31A 5LIPA 3FVRA 4IJ5A 1DV1A 3ZV6A 1NOJA 4PTYA 3NP7A 4ID9A 1E2DA 4AJOA 2FSFA 2ZU6A 2UXCB 4CQNA 4C0QC 5E8RA 4AMBA 3BS4A 2F6RA 3D0RA 1IB6A 4OMCA 3H3FA 3VX3A 5A1TA 1MOQA 1XTSA 1BE8A 3DE6X 2HBYA 3U1TA 4D8UA 1VP3A 5COQA 2Q3JA 3WGQA 3DOFA 1N0HA 4PZCA 1A7KA 4YCAA 5DSZA 1SN7A 3FTCA 3I5XA 2QIPA 1U94A 1AUVA 1OASA 3DYVA 3B1WA 2ID8A 2O57A 5EE3A 3R7WB 1UADA 3UICA 4DCUA 5K3EA 1NY6A 4G2TA 2VPXA 1FFXA 4EKDA 4ZCRA 3QIAA 1Z5OA 4WOPA 3R77A 5LN1A 3PUWA 3ZU4A 5JU6A 1E3LA 4KITB 5DXFA 4Y9SA 4AW9A 5K0BA 4DCSA 1U7OA 2EIHA 4L0CA 3PNOA 4F38A 2GM9A 4MB6A 3KPWA 4IHKA 2HHAA 5KWSA 1DC5A 1NKTA 3C3BA 1RAAA 1SG0A 2JGFA 4MVJP 2JD0A 2G1JA 4PZYA 2VP9A 2XKAA 4QXQA 4RCVA 1IN1A 2XOEA 3NJRA 3N8HA 4PBTA 4UNIA 4ML3A 1I3CA 3QEAZ 2ZYSA 1AOXA 4AJPA 2VWHA 4QECA 1Y4DE 3SXPA 4PWZA 3W9SA 1BCRA 3AETB 2OXFA 3BB1A 3I83A 3RT7A 3DV0B 5EPOA 2ZSBA 5DF1A 2E18A 2RH4A 3GPDG 2I29A 2GN6A 2VYFA 3MTAA 5LQUA 4RBNA 4R81A 1U3GA 1IONA 1E3WA 2AF3C 3IUMA 2BH2A 1EX7A 4N01A 2CMGA 2A5LA 2I80A 1PK9A 3C15C 5F2KA 2R1ZA 3T3IA 2BR3A 2UZ1A 1QBKC 1PJTA 4FYKA 4K81B 4ZO4A 3V3TA 4JIMA 1CDOA 1D2HA 3ABQB 3UKJA 3FB4A 3T4UA 4BQOA 4DLYA 2O2HA 4EFDA 2RARA 3O5AA 3DDWA 2FWNA 3QYFA 5DP1A 5L3ZA 3R76A 2K7FA 4S24A 2I91A 2GRUA 1EKXA 4TS9A 1ULHA 1Z3CA 1JNXX 1LK7A 1PIWA 4OM7A 1J2RA 1QPBA 2I7TA 3CCCA 4YMHA 2P3OA 1WXDA 4GW3A 3QZUA 2IPAB 2HLNA 4TTQA 3UXYA 1A71A 4L3VA 1GU7A 3AHEA 3I9V1 1IUPA 3IP6A 1EFKA 4JK3A 4Y2GA 4DNOA 1SMKA 4KHPB 4TS4A 1HBJA 1WUHS 2VDUE 2GPYA 1CE8A 2KLHA 3IAM6 3SHFA 4HMQA 1OBOA 1FDTA 1TU3A 3ND5A 4HH1A 1U8TA 4IILA 3DYBA 4D5GA 4EW3A 4BYGA 5JADA 5LOVA 1MX1A 4RQTA 1YQEA 3CO5A 4ZJZA 4V1CI 5I8WA 3GB9A 3KU4A 2IYWA 1JDBB 3LBIA 3WK5A 4CU2A 1PVOA 2BDEA 1N2JA 1X7XB 2EG5A 2GCNA 2NO1A 4MYSA 3UNXA 4EIWA 1Y6QA 1XVVA 4X6XA 2G5TA 2VH1A 3WYFA 4D3SA 2C2WA 5AHRA 4ZODA 1PKXA 1CIVA 1R3DA 2YHSA 3I3OA 2ID4A 4GR4A 4GZ3A 5KJCA 1KYZA 5JS6A 1LB1B 1OZFA 3G2LA 3PX3A 3L8FA 4X9XA 3RJTA 1WQ1R 4CM5A 5IBPA 5LU8A 3U6BA 1T9HA 4P5PA 4EO9A 3D2AA 2JIDA 4C08A 3FMPB 1ADGA 3CKKA 3WMXA 4G84A 3ZJVA 1D0VA 1NFRA 1P75A 2M98A 2ZQ5A 4ZI7A 5B6JA 3PXDA 5F2NA 3QEJA 3NBFA 3ASZA 3EPRA 3GN1A 4HI0E 4IOJA 5AVTA 2X2OA 1W0JD 1YB5A 4J4BA 4MUKA 1JU3A 2W93A 3G02A 3W79A 1RJ9A 1BWSA 4MWDA 3ZV5A 3KV3O 3QEMB 3L06A 1V7QA 1V8ZA 4M38A 1JDJA 1DIHA 1SBTA 1REQA 3K53A 1CR0A 4ETWA 3CLTD 2ZKLA 3CUTA 3U4DA 3AF0A 1FNDA 3U4QB 2RKWA 1NOIA 1KAHA 2VRNA 3EISA 1NVEA 2BH9A 3E3LA 3KB1A 4GBJA 3EFEA 4NARA 5AVRA 1GNVA 3QUTA 1UANA 1P74A 3A6GA 5DSXA 3W2TA 1N3LA 2FPKA 1N4AA 2GZDA 4W5TA 4IQ8A 4EHDA 4L5IA 1B8PA 1UJ4A 2DFPA 3GZJA 3RHSA 4BAGA 3GI1A 3VKFA 3ZYZA 4DE5A 1DQZA 3VGJA 4YPOA 3JD4A 2QP3A 3TKAA 3ZZMA 2GBPA 2I4RA 3E05A 2JI4A 4DF3A 2R6AA 4HEA1 3KYCB 3Q41A 1C0LA 1UJ6A 4RJIA 1LV8A 5C7LO 2W42A 1KR2A 3QJYA 4Y30A 4X62B 1UEXC 2B7CA 2CK3A 2GGSA 4B1FA 1C2YA 2QTCA 2HB6A 2VT6A 2QUBA 4BP1A 2X4GA 1P1JA 5HS6A 2YYZA 5KSZA 3BVPA 3FUVA 1EUCB 3ORSA 1LPSA 1S3GA 2VPYA 2YRFA 3BXFA 1ZYUA 2DWCA 2FW9A 2I7XA 2JLAA 1WHTA 3QMVA 4XQGA 4XYMA 1I5RA 3GEBA 3GH3A 3L46A 3ND9A 5DE3A 1ZN2A 4MPPA 4RSHA 5KOJB 1DBWA 1G4UR 3TNYA 3TIXB 1YIAA 5C18A 4JIGA 1P2GA 1ZUD1 5L4LA 5ALHA 5KYXB 5L3QB 4B6OA 1TM1E 1J33A 2GH1A 2HXGA 4YP9A 3I6IA 1A8IA 3HJHA 3KFVA 1YHZA 3WNQA 2DHRA 1UBKS 4ZCTA 5K0TA 1FP1D 1G8AA 4JZKA 2R97A 4HFRA 1YJAA 1MCZA 2UDPA 4M2LA 5JYBA 4E2YA 2VYNA 4N0MA 3ZWWA 3EPKA 2YS6A 5ALDA 1QPZA 1A5BB 1IQRA 2BISA 1RS0A 2GRAA 3DNPA 4M0LA 4BECA 4KPGA 5KWJA 1OCEA 1GQRA 2LDBA 1W6RA 2YHBA 4JI4B 2HNBA 2PIAA 1N9KA 4IXWA 4PG6A 1EXVA 1BE6A 1K8ZB 3ND6A 1JG2A 4FFOA 4CKWB 3WG9A 4X44A 1LJUA 3NC0C 4KIUA 5FUWA 1HY3A 3CE6A 3PZRA 4X1YB 5ALFA 1G9TA 1IPHA 3SS7X 3W5BA 3K0SA 1IC6A 4JYPA 4MW7A 5FNVB 2QRKA 3B2QA 3T1QA 4FD2A 3GHYA 4B6JA 2DJ5A 1FTQA 1U6KA 2AYYA 3K92A 2QRVA 2QZPA 3V1KA 1IQPA 2V7QD 2YHAA 4K86A 2HTFA 3AI1A 1JR3A 2QVCA 4V39A 4DAEA 1DIGA 2GM3A 5I4CA 1SHTX 4I9NA 2KM1A 3HVHA 4JFAA 1T1SA 4UHHA 4O4IA 3QHAA 2P0AA 2YY6A 3K8OE 3W1WA 4D79A 3WK6A 4E5NA 1OWPA 1IG3A 2FPRA 2ODWA 2QXUA 3BAFA 2MINB 2GXUA 3BSWA 3ROMA 2IDJA 2XWPA 1EWTA 3JVDA 1EGVB 3KBOA 4LYJA 5ULLA 4IZ6A 3VVMA 2JRLA 1LS6A 1YJQA 1NXTA 3CRVA 1ACJA 3AJ8A 3FPHA 3N2NA 4F3RA 1V43A 4E51A 2G0NA 3N3AC 5ALPA 4L8VA 4D42A 3OHSX 3ANTA 1VBFA 3DONA 2JLWA 3BBLA 1NIJA 2PCJA 4EJSA 3WL8A 1XDWA 3IUBA 4BNDA 3U7HB 5ANRB 1Z08A 5TQ0B 2UUCB 4F06A 1L5VA 5FWXA 3DLBA 4GYKA 2C8KA 1YR3A 5AKIA 1GAQA 4L51A 2DGDA 4MWGA 1BCSB 4F8EA 2AJTA 4GBGA 5BUZA 4B73A 1V4NA 1SKQA 2PK3A 1ZOIA 2Z5GA 4IVQA 4QYWA 5FPHA 2ZIWB 1NI4B 3EZ6A 3HZOA 4HWKA 1J2JA 2OCKA 3MW8A 3PVCA 5IM5A 1M1ZA 2JGRA 4GR9A 1Q7RA 2NSDA 4MIYA 4REQA 2WILA 1L1FA 4BL5A 1TADA 2VLBA 3ESQA 4JJEA 5ALWA 3VHXA 3FVVA 5ALSA 3CH4B 1XTIA 4RCZA 2IWHA 2VVTA 4R2LA 5D3KA 5AHKA 3ZCXA 5EJEA 3MAGA 7GPBA 5I8PA 3MMSA 1AK1A 2NO7A 1L4UA 3MMXA 1U7WA 4IZHA 4R3UC 1SD2A 1CETA 5CVJA 4DGSA 3M9XA 4QJ3A 5B7GA 5FBHA 3DVAA 1X6VA 5AW8A 2CYCA 16PKA 3H9QA 1EDBA 1LDGA 4AXXA 3BIWA 1VL5A 1U8XX 4WJKB 3TSWA 4UMDA 5IASA 4C4OA 4DKJA 4DBZA 2WJ4A 4AN1A 4DILA 3IPCA 1N2ZA 3KTFA 5K0LA 3W2IA 3CX4A 4XWTA 3TSYA 3DEJA 3OQPA 4MUIA 2DY1A 4OUDA 3B53X 1VIMA 1KOGA 4U2GA 4RF4A 3F8SA 3TQSA 4YRTA 3PTAA 4TYPA 1E1MA 2HWXA 3D6NB 4PLVA 3FR8A 1Q5PA 1G17A 4JZYA 3O93A 2GXQA 1GR1A 3PTLA 1J5PA 4L4SA 2QE6A 3VDMA 1W0CA 4CI0B 3COSA 3IQWA 1UWKA 1KH2A 3C48A 3G68A 3NWJA 1A04A 2G4VA 1CR1A 3DHVA 1R8XA 1G8YA 1T25A 1QTQA 3H2HA 3IV9A 3EZNA 1KP3A 3MQ4A 4ARAA 1ZGJA 5EAIA 4ZU6X 1XDUA 3ITKA 2Q3HA 4V0SA 4Q9KA 1QSGA 5CB4F 2JH8A 3M6IA 8AT1A 3RSFA 1GEEA 2CLIB 3AR5A 3L0IB 3O94A 1VYTA 1NUAA 1SBCA 3E84A 4PNPA 1V4VA 4OI0A 2BSQA 2PL1A 1L6IA 1KMMA 3G1WA 2I3AA 3ONDA 5E7MA 2P9TA 1Z5ZA 3GGGA 2FUNB 4N7MA 1N6NA 3VR1A 1ZR2A 2OCGA 3F5FA 1QP7A 2OO5C 1GU0A 1NW8A 3AVUA 4X64B 3RSQA 6Q21A 4JBGA 4X93A 3RIHA 3DPUA 1V8BA 5CDUA 4RHYA 3VO9A 3E03A 3IKLA 5FWAA 3E0QA 1H1LA 1MLDA 1YCDA 2HO5A 3BXEA 1E62A 1U3CA 3ASVA 4N3NA 1JG7A 5CB8A 4DTIA 3KUCA 1TJ3A 2PX0A 2C5EA 3DG9A 5L3VA 3JYHA 2FOXA 4OYHA 3BB4A 1TKAA 4Y2YA 3GLHA 5JSKA 1XZMA 2NU9B 1V3VA 1XI2A 3X1WA 3F3MA 3ZI0A 5FT9A 1G63A 2NNLD 3WA6A 4EITA 2WLTA 4DCVA 3R8FA 2ZUFA 4RHEA 3ZE2B 1GKKA 4B0PA 1U4OA 2HK6A 2Z8YM 4OXXA 2V6FA 2OUIA 2RB4A 3R9IA 3GVXA 2O59A 1PYGA 1IVNA 3EF3A 1UFRA 2NACA 2IV7A 1ZUWA 3RIXA 3W8EA 5GADl 5JWOA 1IM5A 2A33A 2DPHA 3QBTA 1UKZA 1U99A 4M21A 4H15A 3HKBB 4X95A 2Z3ZA 1N36B 2EBFX 5REQB 4OCZA 3IMFA 1M73E 3D9QX 2C94A 3WQRA 1YK1A 2YDXA 3IPYA 4IIFA 1N3IA 4I99A 2QZJA 4BFVA 4RPCA 1NVAA 3PI6A 2VPZA 3NIGB 2FLWA 1G20B 4WNCA 1IU9A 2C2OA 3IB3A 1DOZA 3ZWPA 3X2FA 4JCCA 4AVYA 3EPPA 4HWOA 5IM4A 4R84A 4Q9HA 2GZHA 1QS0B 2DOKA 1RM0A 2PQ0A 1EAYA 1Q83A 3QUSA 3RNLA 4B81A 5JZMA 1XQWA 5JANA 5J2TA 3FSGA 2YYAA 5JNUA 1L4MA 1RPJA 1D4OA 3ZCPA 1NP6A 4X5OA 1UKVY 2NQ2C 1LFDB 4GVXA 1L3BA 1WCIA 4TN5A 3MQFA 4J2OA 5DIZA 4IRMA 4RE6A 3QBDA 5LQDA 1KY5A 2Z4RA 1ICIA 1ZISA 2AJDA 3AY6A 2WUGA 4OUKX 4UHBA 1A2QA 2Z08A 1U2DC 3AHFA 4L28A 4MUXA 1E69A 3ZDRA 4DMMA 1VYHA 2B9EA 1NN1A 2O7VA 1QIJA 1ZH4A 2IC5A 3C6QA 4GD3Q 4RQUA 4V0ME 1IFXA 2GJ8A 1KBOA 2J9XB 2QUIA 4NAHA 4QGGA 3UV7A 4EI9A 4EJMA 4MVJD 4DCCA 4QE3A 3OCYA 1W52X 1Q6YA 1D1TA 1XXHA 4CODB 3HVUA 4GR5A 3X1XA 1U63A 1M75A 5JXWA 3DUWA 4WKBA 2GSDA 2WM9B 1GFWA 2JIPA 1JKFA 1KAGA 2CNOA 2VDPB 3AILA 1NW5A 1QZ3A 3FBWA 3QEKA 4JL8A 5DEOA 5EEHA 3L8MA 3DB2A 3LIPA 4LHZA 5G4KA 3STUA 2BR4A 3ZZTA 5MGNA 4KQGA 4BMPB 4C0BA 5TS3A 3I2IA 4BX9A 5JRZA 3TMYA 1ZAYA 1MTZA 1MAVA 1N5IA 4ECEA 1M2OB 1JQBA 5EIBC 2R66A 1GQOA 3K2IA 3N8NA 4XDYA 2JD1A 2AN1A 3ZQJA 5LA6B 2BMEA 5KDDA 2VJCA 2C8JA 3OP4A 1MV5A 3AHJA 5A0TA 1FDWA 4NBKA 2QG9A 3MTIA 1X38A 4AZTA 5ESDA 5JIBA 1GGMA 4RD0A 4BRUA 2JK1A 1DCKA 3OIGA 1V71A 3IQFA 4F3TA 4B3DA 2E85A 3CLKA 4D3YA 2R85A 4TMVA 4MAMA 3M34A 2HLHA 2P75A 2IYXA 3E7XA 1W4ZA 4MEJA 1I1NA 2GJ9A 4TMZA 2ADFA 4NCBA 3RAEC 3N0RA 4IEIA 1SBIA 4JKYA 1IHXA 1FVFA 1Z0FA 3CLHA 3L82B 4NMXB 5HGXA 2I2FA 2VAWA 2QMUA 3RKSA 4DV7B 1VXOA 2CJWB 4YRGA 4PEVA 4M1YA 3IEVA 5FL7A 3DBRA 1O0SA 4PE5B 5FFNA 2ZYDA 5J4KA 2R8PA 1ML4A 2PZLA 4P3NA 3HJGA 2HSJA 3OKPA 3O8DA 3WL3A 5CVEA 1Y4AE 3QITA 3MINB 3A9RA 3EUFA 2XX3A 4JP8A 3V7WA 4HDQB 1AGRA 1ONBA 2GEUA 3EN0A 3K8ZA 3EVGA 2ATEA 4DLPA 4QSMA 5J5AA 5C8VA 1BH6A 1E66A 1JTVA 1QFMA 2A9PA 1HG0A 4WZ6A 3WISA 4DSAA 3S81A 4RGVA 1BHJA 2VJNA 1KVSA 4LYGA 3H5VA 5IK2D 4BE7B 4L27A 2HQ1A 4I6JA 4EZBA 1OFUX 4GKJB 2HWKA 2XCIA 3C1TA 1X77A 2YICA 2G9NA 2XZOA 1CUYA 4YT8A 2FX5A 2RG1A 1W9HA 3I2FA 1P39A 3KQVA 3AOEC 3QI7A 1T2EA 1V6CA 1HR0B 1NN3A 1TVKB 3HL4A 1N6KA 4JLKA 3PIDA 2ZANA 4N5HX 4D25A 2F4VB 2WD7B 3FFTA 1N5JA 3I0NA 3KQMA 3ZE9A 4CPDA 3KAQA 3ZGXA 3WTCA 4E7PA 1ENYA 2FSVA 5CD9A 3FGZA 3QYPA 3U40A 1IY2A 4BN4A 4JP2A 1UFOA 5B1HA 4YEDA 3H2ZA 4URWR 1WUKS 4RD6A 5BXQC 4BKRA 1P1RA 5JHGB 4HXEB 2QM8A 4A0QA 5KNCD 1VMDA 1YZVA 3TQFA 1T2AA 3G5TA 4NR0A 4CQMA 4ED9A 2D5AA 3CLSC 3GJ0A 2IGTA 2D7JA 3ISVA 3SR3A 1TO1E 1VG8A 4I9GA 2BEUB 3ZIUA 4D0SA 4HR7A 3DCJA 3LBYA 2C2MA 4GZMA 5H3HA 4YJKA 1UZAA 1R0YA 1YAHA 2N47A 3PXUA 5TQVA 1MN6A 5K8LA 1KPIA 3UWDA 2XGGA 2DBZA 4NNOA 4NSNA 2WYUA 4DR5B 1PT8A 3AR9A 3SQMA 1VMAA 2ZDQA 3W1EA 3DT9A 3DCYA 1SD5A 1SUAA 1PEKE 3SR4A 4Z2YA 1DOAA 1XPOA 3B1VA 3D3NA 3K09C 4W7SA 1GGEA 3GDWA 3O4FA 3LUGA 4IEFB 2O6HA 4J91A 4B4KA 4D9HA 1UH5A 4DSOA 3R1IA 4XPIA 2EJBA 1KEWA 2P9HA 4HNHA 4QLBA 3TUJC 2WZCA 3JWEA 3U1BA 3MEQA 3WS7A 3HCOA 2WMOB 4YYEA 2H7YA 2WTEA 3U9LA 3GUYA 3EWNA 2XA1A 3FPCA 5ABPA 3WGGA 2WWIA 1VHDA 3BJEA 4N03A 4QICA 4ABYA 5EJ5A 4KJXA 2LNDA 3NHWA 3WWPA 1II9A 2WWHA 5GQSA 3LLUA 4BN5A 5GTDA 2QG4A 2QPTA 1QF9A 5EE0A 3QOFA 5LA6F 2V0CA 2YRWA 2ZS8A 1EBBA 4XJVA 5C35A 5F23A 2ZZMA 4EPVA 3RC1A 1RC8A 1SVIA 1CS4C 3M49A 2XWBF 1NL3A 1ZQ1A 4LQ4A 4U7WA 2I4MA 3F7OA 2PGAA 1KJ8A 3EHEA 2Y68A 1U7DA 3VOAA 1SZDA 3IO5A 1VJ0A 4DDMA 3D7KA 1U1DA 4NYJQ 4PXAA 4FZJA 2BEJA 4IS2A 4N5MA 2VXCA 5ALQA 5JXHA 1L5OA 2J5QA 3G2IA 4MVJE 2VYVD 1CUAA 3DLAA 3WKEA 3K9CA 4PZDA 4ACBA 3ODGA 4BKPA 1XN1A 2P7HA 4RVCA 3Q5DA 4D9EA 1DNPA 3JAWB 3TTWA 1AE1A 2W4QA 3DEHA 3II6X 1CR2A 5JJLA 2G76A 4LKRA 5BSEA 4KSYA 4FMBB 4R9NA 5FWYB 4FUTA 1Y7TA 1E2GA 3E81A 5FQNA 3EDOA 4QNMA 1MB2A 2VA9A 2I7DA 3P9RA 1ODSA 3ZUGA 1W48A 1VHQA 1MIHA 3E7DA 1IXRC 3HZRA 5BWOA 1SBYA 1SGWA 3RJMA 4AJ9A 5T8KC 1NP3A 1JHRA 1JEQA 2F9LA 1G16A 3ZGZA 4DR6B 5CX1A 3KR9A 2J5RA 3PXAA 3QVXA 3KTAA 2PG3A 3PIRA 5LUBA 2CXXA 4O1HA 4GUDA 5AJXA 4HMPA 1NVBA 3TIGA 1OZGA 4IXNA 4PCVA 2IP2A 3TD6A 3VO2A 2XBUA 3BSFA 3CZMA 3K0FA 4PLPA 2QSJA 4X20B 4C76A 5KEIA 4H1TA 4B3XA 1RM5A 2FN9A 1V7CA 1GVHA 1XZJA 2UVQA 3PFWO 4CL2A 1AQJA 2J0VA 3F96A 5EWJB 2V7TA 4F8YA 1YMQA 2CUTA 2OCYC 4LPSA 4XSGA 3JWIA 2BDTA 4Y7DA 2PX4A 1PUJA 2GPWA 4MULA 5GZ3A 1T1RA 1VI5A 2G9ZA 3D7MA 2YZNA 3EXFB 3NAMA 2C0QA 4YQFA 1Q6ZA 221PA 4OAOA 3PFBA 1KZ9A 2I34A 3LX6A 1N8KA 4OXKA 2QMEA 1JRLA 4HB0A 4PIVA 4YAGA 2P6RA 1AF7A 1JQEA 3RUFA 4Z4CA 1GNQA 2ZB7A 4NH0A 3GJ4A 4FR5A 4L78A 3K72B 5HFNA 1QFXA 4TLEA 5KS2A 2XUFA 1Z6GA 4GGMX 1DAFA 3DXXA 1N2EA 3L41A 3B6JA 2DFVA 5JZOA 2D2FA 3HXPA 1ZN9A 2BJWA 4KH1A 4LI3X 2RGYA 3W1VA 2ZIXA 3FHTA 2WTMA 4LRQA 2L19A 2ZSJA 3L1JA 3WYAA 3PFNA 4G5YA 4UNSA 1T2CA 2YYYA 5AI6A 2PSSA 5HK8A 2CXTA 2GM5A 4AZWA 1FMCA 4H3KB 1Y3FE 1OBFO 1PYDA 2R1VA 2PYIA 2VF7A 4K88A 5JC1A 4AIIA 2JATA 1VSVA 3GVCA 3MSXA 3EVDA 2A67A 4FYPA 3TKYA 1B26A 4L4ZA 4ZVRA 4BO6A 4PM4A 3A6FA 5F5NA 3IALA 1PFKA 1G4AE 2X13A 1CRLA 1GL9B 3JZMA 3FPGA 4K9QA 1B23P 3KOMA 2P5TB 1NPYA 4JUCA 4LMPA 4YYZA 3U7QB 2PH3A 5EC8A 4DTCA 4WBNA 1J07A 3K1AA 4B5KA 2FCRA 4ZT4A 1IOZA 1T9KA 3HCFA 4ER5A 1ZD4A 1ZUNA 3D54D 2H9AA 3Q9LA 4H08A 5DBOA 2WW8A 4UE6A 4F5ZA 1RLMA 1J6UA 1V5IA 1BEZA 3PG5A 4ZZ3A 1WL8A 3LLSA 1P91A 1ESNA 2DQZA 2PKQP 1ODFA 4AK9A 4ZFNA 5CFQA 4YMWA 1QGUB 4GP7A 4CDRA 4MI1A 4I4TB 1X7ZA 1I4OA 4KXYA 4B82A 1H9CA 3KR2A 4AXBA 1EX9A 1QTIA 1CUDA 3SHOA 5L7WA 4S05A 3QE9Y 3COJA 1XJQA 1RYYA 3QMPA 4X45A 4D0RA 1F7VA 1QAOA 2WAMA 3MCVA 1KI3A 4A8JC 1MOZA 3FWPA 2P5SA 3JVUA 4GX5A 2G5CA 3LIIA 2XMBA 1PS9A 1TZ2A 3LCMA 2WIFA 3R23A 1J0DA 4TSFD 3LCVB 3KKNA 3F6CA 3L0YA 2O8BB 1XCLA 4AJJA 4QFDA 4C4AA 3PFIA 2OK8A 1G55A 1WBJB 2Z58A 1VC2A 4EWLA 2C7OA 1FW8A 1PD0A 4CWAA 2JH3A 2Z2KA 2I4LA 1ZINA 3F2VA 1P2BA 3DGEC 5ED4A 3JARB 2HJRA 2BTQA 2TMGA 3MJDA 1N5MA 1J7KA 2D1RA 3D6UA 3GLSA 3NZEA 8OHMA 1FOEB 4FEEA 3OO1A 3GJQA 5A7HA 2JF0A 1JKMA 4JUAA 3DNFA 2GF9A 1YIOA 2R7MA 2O20A 4NL4H 2X22A 3TR5A 4XD7D 4CM3A 4CMEC 3D64A 3CUSA 3GJ5A 3BGSA 4LF5B 4CL3A 2EFDB 3GXBA 2FZ4A 5JBIA 1NVMB 1JQKA 2KE5A 1JHUA 4IVRA 2H1CA 2ZE7A 4LDRA 1ZMRA 1R0XA 5JARA 4U9UA 3KSAC 3V7NA 1LWOA 2F2TA 3NWBA 4I3HA 2PX3A 4MRAA 4YUYA 3ENNA 1HYHA 1U8EA 4L5CA 1Q44A 3L9XA 4O4LF 3GGOA 4BS9A 1DBVO 4LW8A 2OM2A 1NKSA 1ESMA 1KS2A 2Y1OA 2AYXA 3LRPA 2D1SA 1CVLA 4MW6A 3AYXB 1JPVA 4DA8A 3SSOA 1ZGHA 5JJCA 1JQ3A 1R8JA 1QMGA 1EX1A 1W87A 4BRWA 4RDXA 5MN6A 4WLFA 3NH6A 1SUPA 1X0VA 2A1IA 2ZUUA 5CW1A 5H16A 4DMCA 5D84A 5K0GA 1B43A 2PH7A 2DB3A 5HA5A 1UJ2A 3ICWA 3N58A 1T9GR 1E0KA 2DQKA 2Z09A 4G67A 4Z53A 1BHQ1 5ENDA 3ZGLA 5JQGA 4Q4JB 4DJ5X 1T10A 1XIVA 2CMHA 2CE2X 2HA5A 2ORVA 1JZSA 3DW3X 4W8OA 5A71A 4EZIA 3A32A 1CLEA 1GPBA 3NRCA 4U2CA 1XCOA 3NW9A 5ARCA 4CR6A 4R0NA 4P3XA 2WWTA 3K6RA 4P7BA 2DAPA 1OT3A 2J3MA 3ZKWB 4R41A 2OKGA 3UFBA 2I33A 1EJBA 1RAHA 3BH6A 2DQSA 5E0OA 2BPOA 5M04A 1J9GA 2JAWA 1CKEA 2QRMA 2HYDA 4L5YA 5BUQA 3OQNA 2MSCB 3EQ8A 1NY5A 4MV1A 1HT2E 1PNOA 3PGLA 4JI8B 1H1TA 3OTHA 3OJLA 1N5KA 1KIAA 1IK4A 2OVBA 3ZCUA 4XQCA 4BQRA 1P0MA 3N2GA 2WFAA 3CO0S 1G21B 4I6GA 2D8MA 1TU0A 3OZCA 1KE2A 3BFXA 1R6AA 2EBWA 2ZVPX 3IP3A 5ALZA 2I4OA 2OYCA 3ROXA 1E9VA 1GL6A 2BP7A 2ZULA 1CPYA 1QK4A 2I4TA 1KGSA 5KVVA 2PUFA 4IJVA 1WBBA 4MVCA 2FH5B 3ZWBA 4HFJA 3R0QA 1F5NA 2P0EA 1EHYA 4EGJA 4F1JA 2GXSA 3F3KA 3CNLA 5KYWA 1H3NA 1G8PA 1E2KA 5FNZA 2QLBA 1D8TA 1LRJA 4G8DA 5HHTA 4AI6A 1SEVA 4UOZA 3F73A 1LUAA 2HLDD 1EVIA 2ARKA 2IYLD 4JLVA 4LRYA 5EWLB 1Z0JA 2ZBUA 3N5CA 4PICA 5K51A 1DLJA 5FDFA 1JU4A 2VBCA 3D2BA 1XQ9A 3EG9B 3O3CA 4Q9JA 4MKGA 5B7QA 1YS9A 2DKFA 1WU8A 2QW0X 4AYTA 1BDJA 4I4TF 4WRRA 3TLJA 3JQFC 3DLIA 1M2JA 3OLZA 2IJGX 2D13A 3NM5A 5LVAA 5FORA 4R2WA 3ZD6A 1C2TA 1J2TA 4FSXA 3CJQA 5DNVA 2QGFA 1WNTA 1NONA 1NQTA 2WTBA 4OL0A 1ISPA 4GMXA 2B5WA 3SF8A 1WUTA 1L7VC 2QP4A 1FRQA 3H2KA 3DE2X 2I6QA 2O3UA 4N6NA 1U4NA 4DYDA 3OLWA 4M0DA 1R18A 3MGAA 4PNEA 2B98A 4KE6A 4LJSA 4P4GA 1WDMA 2IEAA 4D82A 5LWQA 2W6CX 1JBQA 2FGJA 3AFGA 3NATA 1PG5A 3KFLA 4R6WA 3WFIA 1TK2A 3W5SA 4RTLA 2WQZA 1E4OA 1IRXA 1PJCA 1JDBC 1JH9A 4BLQA 1QYWA 1ZK2A 4GECA 2WABA 1HFWA 1EUDA 2WWRA 4GS5A 4F6CA 1JR6A 1E1QD 1ADBA 2QYTA 3TJMA 2JFNA 4ONEA 1JI3A 3CRW1 1W88B 3ANYB 1FUKA 1UR5A 4UBIA 4W5JA 3VMFA 1MX3A 1X8XA 3WB9A 4BGVA 1BA2A 3PFKA 5IM4F 2ZRPA 1QWOA 3ABSB 4LSZA 2WAOA 2Y1KA 5LPNA 2EG9A 4GMKA 2YL2A 3L0CA 3DZ8A 5HRAA 3SVLA 3OSUA 1MRNA 3QU2A 4Q1EA 1PV2A 4B31A 5K7SA 3D6HA 3BKXA 1DC6A 1Q22A 3LPCA 4R98A 4II3A 1Z68A 2NZUG 2MSDB 3ZHTA 1DIAA 2E4AA 2ZB4A 3WAKA 4RVGA 5CG2A 1R5NA 5J1SB 4CTKA 3NAQA 1J0XO 1USIA 4GPEA 3EAFA 1EQUA 2NZXA 2NUPB 1Q92A 1V6SA 2VATA 5CNKA 4QOGA 2JGKA 3FTNA 4PLFA 5AI4A 4B85A 1UP4A 4DKXA 2VSXA 3GZNB 4WXEA 1JYFA 4O4HF 3T9CA 5F7OA 2OG2A 5JNRA 3OEHD 4L8FA 5DHQA 1QRSA 3EAQA 1HUQA 3L7KA 3FCXA 2AOUA 3M82A 1E1DA 2OZPA 3E4DA 3PF9A 4M9UA 1BVYF 1BMTA 1JEAA 2CZGA 4M0CA 1D2CA 2J3DA 4DNXA 3OOEA 5C81A 3WV5A 4D02A 3B5JA 2A4MA 4R3WA 1JU9A 3DMNA 1VE7A 5A02A 1KP2A 4KPEC</