1ZK3A

Triclinic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITDRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
molecule keywords R-specific alcohol dehydrogenase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk3A00
1GR0A 2GN6A 1IZ0A 1B14A 1Y8QA 1WZEA 4RL6A 3E8XA 4BIIA 1TT5B 1K0UA 3RBXA 2Y67A 1GUZA 3TFOA 2AEJA 3E1KA 4FB5A 4Q9NA 4ZQHA 5B4TA 3K9QO 4RPKA 2X0IA 4MJLA 1M67A 4UVHA 3STHA 1H6CA 2FPIA 3EAGA 3C1AA 5KWEA 1ZMTA 3HSKA 3WLEA 1PR3A 2CD9A 3EZLA 4AJJA 3NKLA 2FR0A 3JQ6A 1V35A 5K0ZA 3E5MA 2B69A 4L76A 2V6MA 2WDZA 3TOXA 4BOYA 1KVQA 2P2SA 4IINA 1K6XA 2UUPA 2Y1FA 1CWUA 4M1QA 3DFUA 4U0JA 4NG5A 1N2SA 1OBFO 1KBZA 2SCUA 3M6IA 4W4TA 2WTBA 3P7MA 3EZYA 1B15A 4B7CA 4J49A 2POQX 4L75A 2BRUA 1LRKA 3QP9A 3FNHA 4R4JA 1PTJA 4LW8A 1D7OA 1T4DA 5TIIA 3DDNA 1DC5A 5B37A 3F9IA 5DCUA 2ZK7A 3S2FA 4N5LA 4WNIA 3TSCA 1Z6ZA 5CDYA 3AM4A 4FGWA 1B8PA 3FTPA 1LSSA 1NNUA 4RZHA 1UP6A 1YB1A 2B4RO 3GUYA 3S1LA 2FN7A 3WGZA 4KUGA 2UYYA 3D4OA 4UVIA 1LTHR 1Y5MA 4U0KA 4ALJA 3CZMA 5H81A 2BFOA 5TJHA 3KYBA 5A5EA 4OHUA 5C7OO 3BMQB 3EY4A 2GUGA 4PLYA 1R0LA 2DPGA 3I9LA 1KVSA 1A9ZA 2PZLA 3HFGA 4OQZA 3D3WB 4QUKA 2IZ0A 1KOLA 3WYBA 3D3WA 4ZA2A 4Y6SA 1SPXA 5IN4A 4KWHA 5DF1A 1ZJYA 1DAOA 2O3RA 5IDQA 1HETA 2PD4A 2PLAA 4YRDA 4WCFC 3ONFA 1M2WA 3PRJA 1LRJA 1Q2XA 3DHEA 1L7DA 1PJ2A 3ANNA 4Q3EA 4NBUA 2Z1NA 3V5NA 4I5DA 1P1HA 1B7GO 1JAYA 3JQ9C 1KYQA 3NT5A 3BYZA 1ISIA 3U4CA 3K92A 3WGOA 1ML3A 3ZV5A 2CUKA 4ROSA 4IIVA 4IY1A 4EUFA 2W90A 4KOAA 1PS9A 1G6KA 3TZKA 2FR1A 5EQFA 3DOJA 2XXJA 1XG5A 1IY8A 1DIHA 3QVWA 4BGUA 5C37A 1O8CA 4XWYA 1CF2O 4AFNA 3IKTA 2X8LA 4E3ZA 1R15A 3MJTA 1RKXA 3ZZNA 3UKOA 3LU1A 4PLHA 4QQRA 3GDFA 1UJMA 1HE4A 4BNWA 4II2A 1B8VA 1PQUA 3B6ZA 4YAEA 4BO1A 1PJQA 3F3SA 3I6QA 4FC6A 2O2SA 1T1SA 4OL9A 3AFMA 3GNSA 2QZZA 3DZKA 4BKOA 1CIVA 1FF9A 2FHSA 3PJDA 3JCZA 3ZNOA 1Y9AA 2YQ5A 5GMOA 4YJDA 2JKVA 4G2NA 5F21A 1KERA 1UDBA 2YJZA 1O9BA 4BKUA 3DZFA 2GPTA 5GZ6A 3O4RA 5CFZA 2QQ5A 1MV8A 1I30A 2NU7A 3OECA 1F8FA 5J23A 2JHFA 1LDBA 2X5JO 3BMOA 3JQAB 1CYDA 1M66A 4IQ0A 3WWZA 4BNJA 2ZB7A 5FI5A 4DLBA 4B4UA 5JC8A 1WMAA 2DC1A 3BMNB 1P1KA 3PHHA 5K9ZA 3ZWBA 5TT1A 3HN7A 4I8XA 1M75A 2D3TA 4ITUA 1PQPA 4OXNA 1NWHA 3QJ5A 3EYWA 4PLVA 3AOEA 2BF7A 4CR7A 3QWFA 4HUJA 1Z75A 4PZEA 5IFLA 4Z9FA 3IUSA 3TZ6A 1AN9A 4DQXA 4NFYA 3F5QA 1GAEO 5BNTA 1VSVA 2CDAA 1OZAA 4KWIA 4ALMA 5A3VA 4PLZA 2E82A 3G17A 2HU2A 2GLXA 1YBAA 2NM0A 3F46A 2P4QA 1VRWA 4QX6A 2RH8A 3WQSB 3JQ9A 1DXYA 4FGSA 1P45A 3OSUA 5MDHA 3LVFO 3VKVA 1U3UA 3C7AA 2I6TA 1SZJG 2PZKA 4YJHA 3GVCA 3WTBA 3KB6A 3P5SA 3RASA 4JCOA 4ALKA 4W9NA 2WD7A 3L9WA 3PGJA 2NTVA 3LLVA 5JY6A 2JJYA 3ZV3A 1GTMA 5IF3A 2HMWA 1TLTA 2VWQA 4PZDA 4KQXA 5A05A 1LQTA 1A4IA 3OJOA 2P9GA 3A4VA 2ZKLA 3ZNPA 3QHAA 3W8FA 2WM3A 3DOOA 3UCEA 4CMIB 3KBOA 4P8RA 2ZQZA 3OIFA 2Q2QA 2EV9A 4NJMA 1U3WA 4UUOA 4OMUA 3U5TA 2E49A 1HTBA 1WDMA 4RCVA 2B37A 4LCJA 4AJKA 3D7LA 1PU2A 3BHJA 2I99A 2Y93A 3QWIA 5THKA 2H63A 2W2KA 3UCXA 3QQPA 3ETGA 3DZGA 2HMUA 4CLRA 4WLNA 3LT1A 2EGHA 1YJQA 3AY6A 1GDHA 3P19A 4PLWA 4M49A 4AJ1A 1GEGA 3GAFA 3NGXA 3MWDB 2Y1GA 1U8FO 5BSHA 5I7FA 3COSA 4FFOA 5DDIP 2X86A 1H0KA 1NHWA 1GQ2A 2A94A 3RU9A 4R68A 1VPDA 4XA8A 4AJ2A 1LDEA 3K73O 2BMAA 4HWKA 1Y8RB 1R6DA 3ULKA 5JPIA 4G5HA 5JO9A 3W8EA 1ENOA 3ANLA 3ZV6A 2ZTMA 3GEMA 3PYMA 4LN1A 1A27A 3I6IA 5KTKA 4HXYA 1PS0A 2AMFA 1X15A 1HYEA 3JD4A 4JJIA 5DBFA 3RUFA 3HN2A 5IJZA 5CAEA 5AYVA 3TWOA 3DBLB 3BA1A 3DHNA 2FP4A 5CDTA 4GL4A 1ONNA 4GVXA 1KC3A 1BG6A 3I5MA 4J7CA 3TJRA 1RJWA 2IODA 2B5WA 2VN8A 5IDXA 2FMUA 2JD2A 2PGDA 4W7IA 5DNAA 1QKIA 1J0XO 1XR3A 2PGLA 2YHIA 5C7LO 2B4TO 1GV0A 4MOWA 1MGOA 3GGGA 2C82A 3AU9A 1YH3A 1K3TA 3ZWPA 4BO6A 4QFCA 3KSUA 4JJGA 1DIAA 1MC5A 3UH1A 4HKTA 1SB9A 2V6FA 3AFNA 4CV3A 4W6ZA 3HHPA 2HQ1A 1ZSYA 2DM6A 9LDTA 3KUXA 1I2BA 1QYWA 3E18A 2ZTLA 2J3IA 1E7MA 4R69A 1ZW1A 4CV1A 2I65A 1B3BA 3TOZA 3KOUA 4J91A 5CDUA 1Y1PA 2FPPA 4NIMA 3PQDA 2X0JA 3CEAA 4UUMA 1DEHA 1UXKA 2G82A 3P2OA 5FYDA 4RLHA 4NDNE 4XDZA 2HUNA 4Y67A 2VTDA 1NX6A 1PJCA 3RUDA 5FF9A 3UAGA 1L7EA 1E3IA 3WQQA 3D64A 3AOEC 3KO8A 5JYDA 4QT0A 3TRIA 3HE3A 3H5NA 3D4PA 1KC1A 4MVJD 5EESA 3UGKA 4C7KA 3R0IA 3SXPA 1PZHA 5KJFA 1XSEA 4NH4A 2Y0CA 2D1YA 4PN3A 5JAQA 4Z0PA 4B7XA 3K6JA 4F46A 4ZHSA 3RFTA 5HRUA 4DPMA 2D5CA 4MIOA 3FD8A 4BNGA 2AQ8A 1RYDA 4DUPA 2P5UA 1NTOA 2NU9A 4RO0A 4XYMA 4PLTA 2NU6A 4Z0HO 3BIOA 1FDSA 3U4IA 1UAGA 4OSPA 3IUPA 4LRSB 4ZN6A 4XQ9A 4P4LA 4FD3A 5ICSA 1I3MA 1U3VA 1Q1NA 4A2CA 2YZ7A 2V7PA 3GRKA 1X1TA 1I8TA 3VTFA 3E5RA 2W2LD 1U9JA 2DTXA 2FZEA 2GASA 3ROQA 2O48X 4YAJA 3VVBA 5KIAA 1YS4A 1ADBA 4FPXA 4L73A 2GZ1A 4IDDA 2Q1SA 3WG9A 1Z82A 1NAHA 3RKRA 4CMEC 8LDHA 1GUYA 5CDGA 2Y68A 1I3LA 2CVOA 4Q3CA 1LEHA 5JO0A 3JV7A 3WSWA 3HDYA 3T4EA 1XCBA 5HTOA 4JXKA 1C3VA 2B0JA 2BD0A 3PQFA 3BTOA 4PLCA 3WIDA 1N8KA 3VTZA 5DBGA 1WMBA 4FFRA 3KM0A 3O38A 2VWHA 3PZRA 1JKIA 4FOOA 5U4QA 4GX0A 1BWSA 1FDWA 2YFQA 4NBVA 4PLGA 1I33A 4EW6A 1WZIA 4A10A 4M55A 2DUWA 3WNQA 2AQIA 1EBUA 2CSUA 3BMNA 3ON5A 3ZWVA 1BXZA 2XF8A 3HB5X 4BNVA 3CE6A 5AOVA 3DO5A 1T2DA 2C07A 3GR6A 2BKAA 3WR5A 2OHXA 4QEDA 3R6DA 3ZHYA 2RCYA 1FDVA 3B70A 3V2GA 1HSZA 3INRA 4B4OA 1BVRA 1E7SA 1G0OA 5KCZA 1ZEMA 2C2XA 4PG6A 1Q0LA 3B1JA 4UEKA 3KYDA 4R1SA 4I5FA 4BO5A 1ADGA 3LF2A 2P9EA 4RVDA 4LVUA 6LDHA 4RF5A 2DVMA 4B8ZA 3W6ZA 3AUUA 1WP4A 2P5YA 1C1DA 1JN0A 3INGA 1Y7TA 2BGLA 4CLHA 2O23A 3L4BA 3NT4A 5EINA 4OKIA 4OIMA 1U1IA 3A28A 3UF0A 2CDBA 3MTJA 3TNLA 3G1TA 4NFHA 1E3EA 1T26A 3HJAA 2JCVA 1XU7A 4XYEA 2QIOA 3C3XA 2A4KA 4K1LA 1U5CA 3Q2KA 5KVSA 4CMCA 2J3HA 1U2GA 1BTOA 2X9GA 4I08A 4NNJA 1U5AA 1YOVA 4HNHA 2VNSA 1S6YA 1IHXA 3L07A 5I8ZA 3SEFA 1F12A 3L77A 4TWRA 1OFGA 5G4KA 3RUEA 4R54A 1Y9EA 2PZMA 2RAFA 4R9SA 5ILGA 2C7GA 5IXSA 4ONEA 3DMTC 1SBYA 3EC7A 1DOHA 1UXJA 1HDGO 5COBA 1JTVA 1EVIA 3H3FA 4BO7A 4YT8A 4AJLA 2GDZA 4AJHA 1JW9B 3PLNA 1NPTO 1NVGA 1NR7A 4E13A 1BHSA 2Q4EA 4BS9A 3GUCA 1SAYA 4Y8VA 5F5LA 1YRLA 2NLOA 2WE7A 2PTGA 3SX2A 1QYVA 5HS4A 1ZXBA 1E1KA 4U8GA 4XX0A 4BV8A 3VVCA 4IIUA 4NBRA 5AXCA 2Q1WA 3NYWA 3GAZA 5JLAA 2OXIA 3QVTA 4I9NA 2VZ8A 1ZCJA 3PYLA 4DQUA 3QWBA 1I2CA 2B35A 2RBEA 4HFRA 4RPJA 5GZ3A 2JD0A 3JQ7A 1U7HA 1B2LA 3Q3CA 4MDHA 3G79A 4II3A 1EVJA 1M6WA 3DOCA 3SC6A 2VQ3A 3HG7A 2WEKA 4LCEA 3DONA 4J43A 3JQGA 5BR7A 5CEEA 5FI3A 4S1VA 4TVOA 7ADHA 4PG4A 1GCUA 1F06A 3KEOA 4WOJA 2CY0A 4XKJA 3I9MA 3AJRA 1VL8A 2Y0EA 1QYCA 4YB8A 3FWNA 4IS3A 4RVUA 4P22A 1JWBB 2Q3EA 3DHYA 3PDJA 3A06A 4H7PA 1GYQA 3WX0A 1NPDA 4L9RA 1NQAO 5L7TA 3IP1A 3C85A 3OA0A 5ITWA 4C4OA 1ZSVA 5L4NA 5AXDA 3CPSA 1E7QA 4EZBA 3H9GA 1CERA 1UDCA 2OO5A 2Q4BA 3H7AA 3WDSA 1ADCA 2Y66A 3ZU3A 4D44A 4LSWA 1KVTA 1NFFA 4NR0A 4CM4A 2P91A 4YCAA 4E4YA 1LU9A 3FR7A 1D8AA 1HYHA 1EVZA 2D5AA 4PVDA 1U8XX 1X1EA 4WASA 4AL4A 3K96A 3C7DB 1Y5RA 2HSDA 1T25A 1QYXA 1A9YA 5TS3A 2VHZA 5EQDA 1UUFA 3NTQA 1PS8A 4BKQA 1PR9A 1PL6A 1DRUA 2C2YA 4BMSA 3WIEA 4R3NA 3AM5A 2JL1A 2R2GA 1ZFNA 1VL6A 4XB1A 4XRRA 2OL4A 5L45A 4A03A 1A71A 3GH3A 4E30A 1ADFA 3ANMA 3MCVA 1GADO 3F4BA 2NUAA 4MKZA 1NQTA 2Q49A 1LDNA 1CDOA 3HDJA 3RFVA 3UN1A 3ZW9A 4DWVA 2G0TA 4RV9A 3V1YA 4YAIA 5ER9A 1Q0HA 2E4AA 6ADHA 4KUHA 4H15A 4OAQA 3ZU2A 4DYDA 1HZJA 3RC7A 1JA9A 1WPQA 1KEVA 4X54A 4WLOA 3JYNA 1JQBA 3G1UA 3QA9A 4ZQGA 3AOGA 5F1PA 3DB2A 4FQ8A 2X6TA 2B4QA 4TMFA 3TL3A 4JIGA 1PIWA 3M2PA 3DZBA 1VKOA 3ZWAA 4GLLA 2GYYA 4BNFA 2FPGA 2IEBA 4OM8A 5I9NA 5K6AC 1F17A 2IYPA 1OC4A 2NNLD 4PLFA 1KEUA 1SOVA 3TDKA 4ALNA 4D45A 2VUUA 3Q2IA 1E6UA 1DJQA 4WCFA 3SJUA 1OC2A 4E2ZA 4CV0A 1X7HA 4B79A 1UAYA 2QZ9A 4MO2A 1GL3A 4FS3A 1H9BA 4RF4A 4S3MA 5L3ZA 3GLQA 5I7SA 4YJHB 5BQFA 1Y8RA 2AQHA 2Y1CA 5ER6A 4DC1A 4LVCA 5HS6A 1DPGA 4C7JA 1HRDA 2GD1O 5G4KB 4BNYA 3RJ5A 2Q46A 3H9JA 3ZV4A 4R41A 3W4JA 3PP8A 1W0CA 5ES3A 5COQA 1PEDA 3RQSA 2VRCA 1JDJA 2GR9A 3OEWA 1TA4A 3DBLA 2OBNA 4RDIA 5CPFA 3E6AA 4NMHA 4BO2A 4BO8A 4QTZA 1CEQA 4BNUA 3WGGA 5KVCA 4AJ4A 3DC2A 2C59A 3ADPA 4CLRB 2B83A 5EERA 1DC4A 4J1TA 4CMEA 3E82A 1BXGB 5JS6A 5L53A 4Q39A 3LC2O 2GGSA 1Z73A 1YGYA 4ZU3A 5ENDA 4UUNA 5CEJA 1KEWA 1P74A 3ZWCA 3CH6A 2J5KA 5ADHA 3OETA 4IGFA 1MFZA 3VPHA 5KJEA 2X5KO 3MOGA 4B3HA 3WLFA 4D3DA 1KEPA 1WDLA 4PG5A 2RH4A 3F5SA 3P2YA 2VHVA 1FDUA 5EPOA 3C1TA 1KY4A 2EKLA 1PZFA 4INAA 2VT2A 1MG5A 2O3QA 4GPD1 1HL3A 4PLPA 2O3JA 3ZWXA 5FWNA 1O5IA 1C1XA 4MKXA 4ZRMA 1E3JA 4RVGA 1R12A 1GEEA 4D3FA 4RDHA 1EUCA 2NACA 1PL8A 2AEMA 5G2OA 4WECA 5CHEA 1MB4A 1QLHA 4U5QA 4ZRNA 4R01A 3SJ7A 3HNPA 3U4HA 3ZWNA 4DRYA 1A7AA 4OYRA 5TX7A 1TI7A 3CINA 2W2LA 1D1TA 3GY0A 3K30A 2BH9A 3EMKA 4A7PA 4BNKA 4P4GA 2ZTUA 2BGKA 3BTSA 4Y6PA 4XYBA 2JFHA 4DREA 4UEOA 1HLPA 1C0PA 2WSBA 1LXCA 1Y6JA 1F8GA 3GDGA 4DIFA 5L4SA 2LDXA 1T2EA 4M89A 1ZXLA 3F1LA 3OQ6A 4N7RA 1NVTA 5C7IO 4FW8A 4CM4B 2NVWA 3GG9A 4E5NA 1C0IA 3ZH2A 1NQ5A 3GVIA 3RU7A 1DB3A 3JQBA 4GWKA 1ZNQO 5A9RA 1PGOA 4KZPA 5JNLA 3DZHA 3JYLA 1V0JA 1EQUA 4IXWA 1LC0A 4CQLA 5L4LA 1QV6A 1PGPA 1EVYA 2BLLA 3NTOA 5EL0A 5A03A 1QMGA 2H5LA 2QW8A 3PDUA 5T57A 3RIHA 1HE3A 3TF5A 4IPTA 4HP8A 3I9NA 4I9HA 1Z7BA 3UVEA 4NZ9A 3A9WA 3K31A 4UVDA 5JFOA 1W4ZA 1Q0QA 3Q9UA 1C1XB 2EF1A 2IRWA 3D3EA 4YRBA 5B4VA 2HLPA 5IN5A 1K6IA 4CMIA 3K2EA 4NHEA 3IQDB 3NV9A 4MIYA 4KDFA 1PGJA 2OOSA 3GG2A 1S7CA 4CMGA 1ZMOA 4BNZA 4XZ3A 4JQCA 3CUKA 4Y9DA 3IS3A 1GPJA 1I5RA 1HDOA 3VZQA 3AM3A 1RM3A 1BGVA 1YL5A 3SC4A 2ZIZA 2Q99A 3GK3A 1E3LA 2O3TA 2Q2VA 1I3KA 3FN4A 3KLPX 4FR5A 1MUUA 1OI7A 4FN4A 4TRRA 4ILKA 2AE2A 3VPFA 1GD1O 5LCXA 1HE2A 1ENYA 1T2AA 1L1FA 3AI3A 1WW8A 3L4SO 1P3DA 1F0YA 1AHHA 2X9VA 4IJKA 4J9VA 4W9NC 4XJSA 2A92A 2HKIA 1EEHA 3QWHA 3PGXA 2NTNA 5TC4A 4DQVA 1SEVA 3QLJA 2CVZA 3RROA 5F1OA 2DTEA 3L4BC 4XDYA 4BNNA 3MJEA 3M1AA 5CP8A 2PGJA 1ULUA 2GN9A 4CQLB 4FCCA 4CM3A 4MIEA 4OGWA 1GU7A 4XR4A 4WEOA 3IC5A 4GX2A 1EK6A 1N92A 1Z45A 2AG8A 2QX7A 4XR9A 3DBRA 3KVOA 1PQWA 1RYEA 1XHLA 4GMGA 3WFIA 2IYOA 1B26A 2BFMA 3PJEA 1NASA 2O3SA 4Q3BA 4UEJA 5JAMA 1RWBA 3ZWWA 1J5PA 1P33A 2VWGA 1J6UA 1DIGA 1UH5A 3FBTA 5TLSA 1E77A 2WYUA 4B7UA 4ALIA 5A04A 4RPLA 2H6EA 5H82A 5I9MA 2CDCA 5COAA 1E1MA 1YB5A 4AVYA 2HMTA 2VCYA 3ZHZA 2PKQO 1DHTA 4PRKA 1IYZA 1PSDA 4WNCA 1XELA 4D43A 4E32A 1C1DB 4CM8A 4PIVA 2UV8A 3ORFA 4TSKA 3Q11A 4TQGA 4HX5A 2CVQA 3IMFA 2ZYGA 4NPCA 2I9PA 4O0LA 3WICA 2E48A 3U3XA 4DA9A 5CEFA 3H9UA 1E6WA 1H2HA 3RUCA 2TMGA 2FY8A 3AY3A 2OP1A 3AI1A 1VM6A 2AQKA 2QYSA 1AXEA 1D3AA 4TZTA 3GVXA 2EJVA 2VNAA 3MJ4A 4KQWA 4BO4A 2FSSA 2EWMA 1ZK3A 2PH5A 1N1EA 2ZJ0A 4ZQEA 3VKUA 4D41A 4YR9A 3EDMA 4L0QA 1LA2A 1RPNA 4DPKA 1GPDG 3Q0EA 2NADA 4JJFA 1BRMA 2HJSA 5IAAA 3GF4A 3GN1A 3OA2A 3FCOA 5DULA 3NTRA 3LLSA 3GEDA 1MG0A 4NU5A 4BQPA 2WD7B 3RI3A 3S8MA 4R5HA 3ITDA 2YV2A 5A06A 2HK8A 1A72A 3GZNB 3D1LA 4B4VA 2EGGA 1CETA 4ND4A 1O0SA 4WK6A 2D59A 4DLAA 4ND5A 1IHYA 2V6GA 3JD1A 4DYVA 2H1SA 5FEUA 4D79A 5AVOA 1ZKMA 1Q7BA 1YXMA 4RZIA 1ZO8A 5A1TA 1CRWG 3VZRA 4U7WA 2DU8A 3ETEA 2QHXA 3PHJA 1P0CA 3JTMA 2X22A 3ZU4A 4ZGWA 1DFIA 1ISFA 3RUIA 1QSGA 3GVPA 3GVHA 3SVTA 3I4FA 2EHDA 4FFPA 4XJTA 3RUHA 3H2SA 2FRDA 5TT0A 5B1YA 3A1NA 3ROKA 1QP8A 2VWPA 3RC2A 1YL6A 4WLFA 3BXXA 2F1KA 2GO1A 1PGQA 3EVTA 1O94A 4F3YA 1ZEJA 4PZCA 4TVBA 1LUAA 4IZIA 3JQFC 3ZWOA 1ZBQA 2UUOA 1SNYA 5THQA 3WSVA 2OFPA 1E3WB 3I23A 3WGTA 5I7VA 4J1SA 1E3WA 1EUDA 3RWBA 4CM9A 3EVNA 4JBHA 1IB6A 1Y81A 2CF5A 2FR8A 4XGIA 3KZVA 4L74A 5KVQA 4DTIA 3RKUA 3OJ0A 4GGOA 1UZLA 1B3RA 4YT2A 3B1FA 4YJFB 2Y1OA 3CKYA 1QYDA 1XU9A 4FJ0A 1K6JA 2BI8A 2Q1TA 3F47A 4F6LA 1BSVA 5L95A 4N54A 5JCJD 3GQVA 2C0CA 3M1LA 3S55A 1PJ3A 1ZSNA 4J1NA 4FFMA 2Q50A 4NQZA 4CMHA 3PQEA 1RM0A 4M87A 5JCJA 1FK8A 3D0OA 1GZ4A 1DIRA 4YPOA 5ILOA 2PR2A 3JYOA 3NDJA 2DFDA 2EKPA 3H65A 1SO8A 4WJZA 4O6VA 1X14A 4BGEA 5A4DA 1N1GA 5DOZA 3A14A 2PA3A 3CMCO 1LX6A 2Z1MA 3FPLA 3U0BA 4M8SA 4IDCA 3DAGA 1U7TA 3I52A 3LC1O 5TQVA 2CMDA 3D5TA 4FDAA 1HLDA 1WXDA 1H6AA 4UULA 5A9SB 2D0IA 4XGNA 3WXBA 5MGBA 2RHRA 2FZWA 4JN6B 1PX0A 3N74A 3ZWYA 4EGFA 2ZTVA 2DUUA 4TRNA 3U62A 4IM7A 4PFJA 4AJEA 3BZUA 3O9ZA 3SLKA 3E03A 1EZ4A 2B36A 4BKRA 2VHYA 4CQMB 2NVUB 1VSUA 1ZUD1 5JW6A 2QYTA 3FBGA 3E9MA 2J6IA 1H2BA 1XLTA 3GMDA 5K6AA 2VOEA 1DC3A 4EUEA 3PIDA 2GRAA 4MP8A 4UREA 2ZYAA 5TSDA 4BNHA 1E7RA 1MXHA 3RJ9A 4J2OA 1ZH8A 3I4CA 1NP3A 4CMBA 3CTMA 1IL0A 1HYGA 4QFDA 1NVMB 2FOIA 4LMRA 4UVGA 3TL2A 4DMMA 4HFNA 2DQ4A 1WVGA 1VI2A 2AHRA 4UAGA 4EBFA 2EW2A 3I83A 4IJVA 4J4HA 1LLCA 4EEXA 2BFAA 3VDQA 4CM8B 2JAPA 2GF2A 4E12A 4MVJM 2D2IA 1NBOA 2UVDA 1SC6A 1ZK1A 4WPGA 1E3SA 2QRLA 3HDHA 2VYVA 1HE5A 2Y0DA 3KHUA 3UW3A 2V6BA 1VC2A 1YO6A 2VRCD 4W99A 2BHLA 2VOJA 1B0AA 1MFPA 1YDWA 2PFGA 2IZ1A 1HKUA 3QE3A 4J90A 4NK4A 3IKVA 1R4NB 4AJOA 2C54A 1HDYA 4AG3A 3ABIA 1ID1A 2X5OA 4HV4A 4M54A 4NK5A 3JQ8B 4N18A 1VJ1A 2Y1EA 2YHIB 1AE1A 4XGKA 4CLOA 1U4SA 3DBRB 3HDQA 5FFFA 4BUCA 2EXXA 1EMDA 3KXDA 1YBVA 4WKGA 4WE3A 3FWZA 2CZCA 3DTYA 3ZHBA 1NPYA 1SMKA 1NM5A 3WYEA 1PWXA 3E9NA 4E6PA 3GFBA 3NRCA 4R5MA 3Q6IA 1D4FA 2PH3A 1W8DA 2ZCVA 3GNTA 4U6QA 5AXAA 4DVJA 2G5CA 3AY7A 3ZGYA 2GSDA 1JLLA 1GZ3A 3KV3O 1DDOA 1KS9A 1X0VA 4YT4A 2VYND 1GFSA 4M86A 4XIJA 2VUTA 3GC6A 2PKQP 4P38A 3L6EA 1NR1A 1YQDA 1YDEA 3EW7A 2BELA 4XYGA 5HA5A 3ZCXA 3OMLA 3VZSA 5DP1A 1QR6A 2OBYA 4ND1A 3JQEA 4L4SA 2J8ZA 3LT2A 1JKFA 3RC1A 1K89A 2W4QA 1LDYA 1ZVMA 3U9LA 2QG4A 3WOHA 3NAQA 4B3JA 3IDSA 2NWQA 5U1PA 1V6AA 3PIIA 1MX3A 1PJ4A 4TRMA 4IDBA 1YBMA 1YONA 3LZ6A 5JAZA 2O7QA 3IP3A 2JCYA 4J6FA 1Q7GA 3GPIA 5KOIA 7MDHA 5BSGA 3W1VA 2O4CA 3DEYX 1JVBA 2W2KB 3ZWMA 2H9IA 5A5FA 3DBVO 3F1KA 1VJ0A 3L0DA 3V8BA 1QORA 4YJFA 1I3NA 2P4HX 4BNIA 4A26A 2X23A 4GSKA 4UUPA 4CL3A 3GZ4A 3RAJA 3ZNQA 4CM1A 4BO3A 5IDYA 1SEPA 3OICA 1SB8A 2VZ0A 2X9NA 3OJEA 1ZK2A 3EHEA 5LDGA 5DT9A 3SLGA 4BNXA 2IE0A 5JDIC 4BKPA 5JE8A 4CM5A 3CIFA 4AICA 3HQ4O 5G4LA 1H9AA 1Z7EA 2Q2WA 4XYLA 3ASVA 2X1HA 3U49A 2QRKA 3K5PA 3L9XA 2FWMX 3GN2A 4BHTA 1QRRA 4BO0A 2ZQYA 4DL9A 5I8WA 1VE9A 3HUDA 1GZ6A 3G3EA 4OXKA 3VH3A 3WJAA 1E1LA 2EERA 4EEZA 4IDGA 3DMTA 3MOIA 5CDSA 5TJ9A 4ZD6A 1ENZA 3I3OA 4BVAA 3ICPA 1PWZA 1SOWA 4A73A 3IOYA 1MLDA 1H6DA 1QXSA 1CQJA 3BHMA 3KRTA 1PJBA 4LK3A 1H6BA 1YOVB 2AEFA 1ULSA 3OIGA 4CMKA 1K2WA 2FSVA 4RPHA 3B1KA 1R37A 5L9AA 3PJGA 4J4BA 5A9SA 1LC3A 2PK3A 4DIOA 3GGPA 1P1RA 2ILTA 1IUKA 2DKNA 5JCXA 3GA0A 3JQFA 3W6UA 2WYWA 1MP0A 1R66A 3NT2A 5T64A 5DCWA 4O59O 3V2HA 3FSRA 4CM6A 1HWYA 1U3TA 4PRLA 1AXGA 2R6JA 4FBGA 4GH5A 4WCDA 1R4MB 3ZN2A 1DO8A 2C7VA 3H4VA 4Y98A 3NDIA 4A5OA 3FNEA 2C29D 2YV3A 3LK7A 1AUPA 2D4AA 1HDRA 4R51A 4I5GA 1RM4A 4CJXA 3JQCA 3LF1A 3LYLA 3OH8A 2DBRA 2JHGA 1XKQA 4MVJE 2VHWA 1LSJA 3O03A 4CL8A 1MC4A 2VYVD 4QSMA 3BTVA 1X13A 1HSOA 3PK0A 4B4WA 2YDYA 1EUZA 4YAKA 5IZ4A 1MA0A 1FMCA 3OBBA 4GMFA 2X4GA 1VLLA 1AHIA 4ND3A 1V3UA 1EE2A 3OJLA 1WDKA 4XQEA 2Y1DA 4JBGA 5DZSA 5JDCC 4ND2A 2XOXA 3L6DA 3GDOA 4IQGA 5AQ1A 1LBEA 1LNQA 1M76A 3JQ8A 3T4XA 4A27A 1P1FA 1DHRA 1EE9A 4NFSA 1UXGA 4J4TA 4OQYA 4GX1A 3VC7A 3UXYA 3VHRA 1HT0A 1V3VA 4KTTE 3NJ4A 3RD5A 1DRVA 3DZJA 3V1TC 4LISA 4GAEA 1BDMA 1BMDA 4DBVO 4QXMA 3RFXA 1WLYA 3VDRA 3W8DA 1BW9B 3BMCA 1LDGA 1TT7A 2IDZA 1UP4A 4I5EA 3ENNA 2BFPA 1EBFA 1O89A 3H9QA 3UUWA 4DPLA 2GZ2A 4JNKA 4Z3KA 2X7HA 1I36A 1YWGO 3AI2A 3H9EO 4CR8A 3QV1A 4GI2A 4IQ8A 3VPXA 3O26A 1XQ6A 2Y99A 4CODB 5ITVA 3TZHA 4FSHA 3K2BA 1LSUA 5LDHA 4W7HA 3ROMA 3FHLA 1VL0A 5L7YA 2JD1A 4OO3A 1NQOA 4HBGA 1HEUA 1JWAB 4TKMA 1P31A 4GX5A 2GN4A 1QV7A 4MVJI 4WLEA 1XGKA 2O50A 1PZEA 4DGSA 4OOEA 4BL5A 3JQGB 5EMHA 4EI2A 4GVLA 3WGYA 2YY7A 2O7SA 2RHCA 3AUAA 3RSHA 2XXBA 1NHGA 3D5QA 3ZI0A 4OOFA 1ZZEA 4IBOA 4WLVA 1KETA 4Y6RA 5EIOA 1GV1A 2OUIA 4ALLA 5JAIA 4KMSA 3I9JA 4RPGA 5JDCA 1DSSG 3KYDB 4FJ2A 3BAZA 3ENKA 3HADA 3QW2A 4EJMA 2OMEA 5KKCA 3KYCA 2A9FA 1EFLA 3GGOA 4O1MA 2GCGA 4ZICA 3S2IA 4B8WA 2EW8A 4R1UA 4E5MA 3NJ8A 3OF2A 1I10A 2EKQA 3DR3A 4KTVE 2NTJA 1AGNA 1JU9A 1OMOA 1I24A 1E6EA 4BV9A 4JP3A 5GY7A 2OGUA 4YBZA 4P4NA 4DIBA 2UDPA 9LDBA 3SBOA 1ISJA 4HNGA 4W82A 2PD3A 2X0NA 4KDEA 3MTGA 4WGGA 3I1JA 3OJFA 2G1UA 3MEQA 5G0WA 3DFZA 4Z0TA 4YA6A 3JYPA 2VTEA 2AXQA 2PV7A 5AXBA 5A9TA 1P77A 3C8MA 1PL7A 3H2ZA 4D42A 2DBQA 3WGIA 1ZK0A 2WWRA 2BGMA 3GMSA 3VH1A 5KVVA 1E7WA 4E5KA 3FPCA 3TZQA 3JD2A 3FR8A 4TRJA 2I76A 4RJTA 2AG5A 1BXGA 4J7XA 4TZKA 3INTA 3WJ7A 4BNLA 4EYEA 4QO8A 3HB4X 3KLMX 1EK5A 4OH1A 4WUVA 4WLUA 3GOHA 3TZCA 5L7WA 3F4LA 3LT4A 2NQ8A 1R0KA 1X7GA 1V8BA 1E0DA 4XQCA 4JP2A 3RBVA 1P1IA 1X7DA 4E0BA 2WMDA 3ZW8A 5JYEA 4J7UA 3KSZO 5IG2A 4A0SA 1P44A 2F00A 2DAPA 1U4OA 2YV1A 1YVEI 2ZCUA 3QRWA 4O5OA 3E48A 3IIEA 4CMAA 1NXQA 5KJ1A 3BMOB 3CXRA 3JQAA 1XEAA 5BT9A 1V3TA 4ZJUA 4DBZA 4KP7A 3MJSA 4EJ6A 4FFLA 4K9DA 2VRBA 4YEDA 1J4AA 1LLQA 1PZGA 2HMSA 5IDWA 4YVFA 4G81A 4PG7A 4XB2A 3CZRA 1NFQA 1H5QA 3EUWA 4URFA 3O8QB 1C0KA 3GNQA 2YQ4A 1HDXA 3O8QA 3LC7O 1O95A 1IPEA 3DAPA 4AJNA 4EDFA 1U2DA 5T67A 2HRZA 1E1NA 2HK9A 1DIBA 4Q3DA 2WE8A 4RORA 5JBIA 2R00A 1DFGA 2V65A 5KJ6A 3UOGA 4E31A 3PXXA 4YTEA 2IXBA 1PJSA 4GKVA 3JYQA 2HMVA 3PPIA 4FIZA 3JQBC 3DWFA 4BNTA 3HFSA 1WNTA 5B4UA 3KEQA 4IZHA 3OQBA 2J3KA 1UXIA 1OAAA 2W8ZA 4JLWA 3PYXA 4E5PA 2LDBA 4MVJH 2GZ3A 3F6YA 1JVSA 1VKNA 3FRJA 3QVOA 4ID9A 2D8AA 3R1IA 4GGPA 4HFMA 4Z6KA 3NX4A 3FF4A 1KVRA 4IGEA 2R00C 2B5VA 4NJOA 2Z95A 3E9QA 2OP0A 3K8ZA 5IXYA 3C24A 4RVHA 4BGIA 4DXHA 5DBIA 5TNXA 4Z9YA 2G17A 3JSAA 3L6OO 2HJRA 1KY5A 2PNFA 3WNVA 1A5ZA 1TVEA 2NVBA 3WQRA 5G0VA 3VPGA 1M6HA 2GNAA 4MP6A 1T2FA 3H5AA 3N7UA 1WWKA 3PI7A 1UP7A 1V9LA 1ZJZA 4DLLA 1G0NA 2EP5A 1CQIA 1EFKA 3Q9NA 2GERA 4R16A 3W4IA 4YDRA 4BQRA 4FFNA 1Y8QB 3ITKA 4RQUA 1LQUA 2NSDA 3CMMA 1YB4A 4I9UA 3OFSA 3ICCA 3DL2A 1ONPA 3PLRA 4BMVA 2PKRA 4N5NA 3WGQA 4E2YA 3GPDG 3I9OA 3TQHA 1LDMA 4MKRA 2GN8A 3G49A 4PCVA 4RF3A 4CUZA 2E37A 1N9GA 3C7CB 1GYRA 4CV2A 1IULA 4I1IA 4IJUA 4K6CA 2Q1UA 4R1NA 3QY9A 2CF6A 1EDOA 4RQTA 1P9LA 2A35A 5KKAA 4YQYA 4ESOA 4JGBA 1PJLA 1FDTA 1RM5A 4J3FA 3GEGA 3DBHA 1BXKA 1E5LA 3B20A 4GLOA 4UVEA 2EJWA 3TN7A 3C1OA 3D4NA 2NQTA 3WTCA 4NJMB 2O2YA 3UFXA 1I01A 2AA3A 1W73A 3IAHA 3KETA 2XPCA 2Q45A 2CFCA 1KVUA 3PFWO 1JKJA 2YW9A 3MJVA 2O4UX 1HZZA 4Z9XA 1TEHA 4TROA 3TFQA 4AJPA 1MXFA 4YT5A 2YYYA 4IXTA 5G0TA 3AK4A 4GBJA 2NU8A 3T7CA 4LRTB 3VH2A 1DBVO 3NEPX 3QIVA 4FC7A 3TPCA 2O3UA 3M2TA 1YQXA 3WBBA 1ISGA 4J9UE 1GCOA 5HM8A 4HADA 2DLDA 4CMJA 1A4UA 3X2FA 3I9KA 1DAPA 1I2ZA 1X0XA 2HAEA 1ZIDA 4B3IA 2Y05A 4OKNA 1BDBA 2WJPA 4CUKA 3ONDA 4XEHA 3JQAD 1GQYA 3G0OA 3BMQA 3VZPA 3OP4A 3WFJA 1BVUA 1E5QA 1T24A 3QVSA 3PJFA 3JD0A 4L4XA 1I32A 3R3SA 4E2XA 2JFGA 5EJ2A 5F3RA 1R4NA 2J5RA 4J0EA 3RVDA 3UHAA 3WS7A 3NUGA 4O63O 5CG2A 4H3VA 4CLOB 3PWZA 1IZ9A 5T8KC 3ROPA 1LLDA 1TXGA 2ZB8A 4QECA 2I66A 3AW9A 5HWSA 1KIFA 3GHHA 3PEFA 2HDHA 4MVJA 3GFGA 1SCUA 3ZDFA 5TGDA 3OIDA 2I3AA 5H83A 1XA0A 1J49A 2IEDA 3WYCA 1N9GB 4FJ1A 4JX8A 5EN4A 1HDCA 3FTNA 4GKBA 4CR6A 1NYTA 4YQZA 1DFHA 1YL7A 4YJGB 4CPDA 1ONOA 1C0LA 2HK7A 2NV6A 3LT0A 4OXYA 2XAAA 1F14A 3Q1LA 1DC6A 3T7EA 1B8UA 3HWRA 5JMPA 2DFVA 1R16A 4DC0A 3DBHB 1U28A 3VH4A 3IJRA 2BI7A 1UR5A 4NI5A 4EITA 3JD3A 4GWGA 3UCFA 2HRBA 3JQ7B 3PZBA 3H5RA 4TKLA 4E21A 2J5QA 1HXHA 1HF3A 2C5EA 4HY3A 4R1TA 3DZIA 4JK3A 3W4KA 1O6ZA 2RIRA 4CUJA 4YRAA 1LJ8A 1YQGA 4K28A 3PHLA 3ZNNA 2CNBA 3PWSA 4MVJP 3OM9A 1IE3A 3LSYA 2PZJA 3IL2A 4YACA 4BB6A 2ZJ1A 4RLSA 3PWKA 1TB4A 1XYGA 2C5AA 3MWEB 4IDFA 5IZCC 1EQ2A 4IUYA 1VJTA 5JY1A 2G76A 1I0ZA 1C14A 3H3JA 3WGHA 2ZYDA 1E7YA 3OQ1A 1ZK4A 5GZ1A 1XQ1A 5B12A 2DBZA 1QG6A 4H16A 4Q3AA 2IXAA 3R3JA 2AW5A 4U6SA 4AJIA 4HFJA 1UZMA 4Q3NA 4WEQA 5F1KA 1W6UA 1TT5A 4PG8A 2EEZA 1LI4A 2TMDA 1DRWA 2IZZA 1UZNA 5G0UA 4YYZA 1XWFA 2DTDA 4D0SA 2C20A 3OEYA 4RF2A 3PTZA 5TRTA 2HO5A 1IOLA 5T8KA 3WMWA 5HBRA 1IPFA 3DTTA 5I7EA 1GY8A 3ETDA 4JROA 5BNFA 2YUTA 4MVJG 1BW9A 3BMCB 1T2CA 3S2EA 4QO7A 4YXFA 2VHXA 1DJNA 4NBTA 4WCFB 1GYPA 5DN9A 3KSDO 2QRJA 3WBFA 3BHIA 3GZNA 1N5DA 4PVCA 4R9RA 1A7KA 5JC1A 3FNGA 2Z5LA 1P0FA 4BNMA 3WB9A 4EUHA 2ET6A 2HCTA 1XDWA 2ZB3A 3AU8A 2YDXA 3LDHA 4E33A 3H8VA 3WWYA 4D46A 3PFFA 4L8VA 5TF4A 4EJ0A 3KYCB 3BTUA 3V2UA 2EG9A 4MVJF 4YAGA 2JFFA 5C5IA 1T1RA 3RUAA 1E92A 2YFHA 1H93A 2VT3A 3DMYA 5CPBA 1G1AA 5T5QA 4Z3DA 5LC1A 4KUEA 2DPHA 1HDZA 4N5MA 4OJNA 1ARZA 2YHUA 1DLIA 3PVZA 1P1JA 2NVUA 4FOSA 1DLJA 2WYVA 4G65A 1QLJA 1GQQA 2X58A 2OZPA 3DAFA 4F45A 1LSOA 8ADHA 1OOEA 3NGLA 3OHSX 4D7AA 4E2WA 3KTDA 3PHGA 4RVSA 3U4DA 3GRPA 3CSDA 4CQMA 1NAIA 4XRGA 5U9CA 1B16A 1PJTA 2JCXA 2PWZA 4RVFA 1EDZA 5I9LA 2UAGA 3HZZA 2OORA 3H6KA 4WOKA 5BNIA 5JDIA 1LLUA 1R4MA 2DBVO 1NWCA 3ADOA 3AUTA 4ZQFA 4BO9A 4DMLA 4MPDA 3VPSA 3QVXA 4IMPA 4CM7A 4L4RA 4PGFA 1UDAA 2E6UX 2W98A 3ONEA 4LSMA 4BB5A 4CLDA 5A02A 3S2GA 1WAMA 2VYNA 3ZHXA 5F5NA 1R0SA 1T4BA 4BMNA 2VZ9A 4OSOA 5BSFA 3AUSA 3QSGA 1CJCA 3X2EA 4J0FA 5ICMA 3FI9A 4XQGA 3MJCA 4GQAA 3ZU5A 1XIVA 2P68A 3WMXA 2EP7A 2WD8A 4IDAA 5JMWA 4K26A 5ENVA 1N7HA 3NDRA 4ZVVA 4YJGA 4YWJA 3VOSA 3PHIA 4CM9D 5KNLA 4D0RA 3AWDA 4MP3A 4IJWA 3RCBA 5T6BA 1K5HA 5L51A 2J3JA 3ASUA 4RGBA 3JQDA 5JXWA 4XD2A 4K6FA 4ZQBA 3RC9A 5L40A 2PD6A 2PY6A 1LRLA 1ISHA 3N58A 2I5PO 3UICA 4XCVA 3LQFA 3GHYA 3DXFA 5CG1A 4R3WA 1UXHA 5JSFA 1YE3A 1H94A 2AE1A 5G0SA 1ORRA 5DOVA 2DT5A 2VUSA 2EIHA 3IJPA 4E5YA 5DCYA 3V1UA 3EGOA 1Z74A 5KJCA 3FNFA 1FXSA 4CQMD 2I67A 1PGNA 4CLXA 1D1SA 4J1QA 1Q7CA 4J2HA 5A3JA 5DP2A 4BGVA 2X0RA 4CLEA 1N7GA 2JAHA 1ISMA 4J16A 3U09A 4LGVA 4NU6A 3RBZA 1NFRA 4IDEA 4MINA 1YJ8A 1YKFA 5BSEA 4JBIA 3DQPA 5C3MA 3EK2A 3ST7A 3QWAA 5IZCA 1ENPA 2ZATA 4LMPA 4GSLA 4XIYA 3VAZA 4IS2A 4D3SA 4IMRA 2I3GA 1JAXA 2ZB4A 3GT0A 4F6CA 3MZ0A 1GUFA 2P9CA 4NBWA 1FJHA
chains in the Genus database with same CATH superfamily
1GR0A 3BFVA 1XXLA 4WY8A 5E9QA 2H5EA 3FE2A 4RL6A 3U0BA 2HIGA 2NU9B 1Z06A 1ZL2A 1CZNA 3DJYA 4M76B 1K3UB 4QDJA 2CLSA 2ONZA 1UKVY 3OKPA 2QJRA 3Q12A 1GUZA 5B55A 2AEJA 3ANSA 1V1JA 1J0BA 3K1AA 1K7SN 4MJLA 2ARKA 3A4TA 4WNAA 4U7FA 1SY7A 2FPIA 1PEYA 1NXVA 1E2JA 5LD2B 4ZYUA 4RVCA 1PR3A 3AETA 3WB0A 4GR5A 3FWPA 1T5BA 3U6KA 4R2KA 4ZI3A 2FR0A 4JLOA 2G80A 3TW0A 4KU4A 3KHSA 3HO8A 2PZ8A 2EYQA 1XOIA 2IIPA 4HEA6 4QICA 5K0ZA 4W7SA 2NAPA 3KOOA 4DC9A 1T6BY 5KWJA 1C0EA 4NCXA 2BDTA 3IUYA 4RMNA 4PFSA 4HWGA 4WK0B 3GI1A 1YHYA 2P2SA 3D7RA 4IINA 4URWR 5CRIA 5AJZA 1NN3A 2Y1FA 4D6YA 4ZAVA 3IDAA 4QREA 4M1QA 2CLIB 1XZDA 2HLDA 1QQBA 4G3XA 1IEWA 4MVCA 3DFUA 1J5XA 2ADFA 3TINA 1OLXA 5DCLA 4BQIA 3SXUA 1IIBA 1OASA 2SCUA 1Q83A 4GMXA 2JH9A 5EXTA 3UAOA 4KQKA 5IS2A 3P7MA 3EZYA 1B15A 2G0NA 2YMQA 2B6HA 4J49A 4LX8A 3RBAA 1PR1A 2HW8A 4WCVA 1P8JA 1H8HD 5BR4A 3RVPA 3SFTA 1T4DA 2D6FA 1TK3A 1GRQA 3CZ4A 4D9JA 3S2FA 3SC2A 5J4YA 1RKVA 1Z6ZA 1WW3A 2XI4A 1BVHA 3OKAA 4FGWA 1B8PA 3AHFA 4UDNA 4RZHA 3C3PA 5C4GB 3W2FA 2NSJA 2AKYA 3O1IC 2VRNA 1A82A 2BIFA 3FNBA 3GUYA 3HCNA 4RHEA 5E2BA 2QTAA 5HMMA 1WXFA 4KUGA 2Q6VA 3D4OA 4IKPA 3W7AA 1CJUC 2REQA 2ERCA 1SQSA 3LMKA 3KQVA 1M2GA 1TLLA 3KB1A 4U2EA 3PCTA 4WVFA 3TLZA 3VUFA 3BMQB 4WXRA 1CZOA 2GUGA 3HYSA 4RVOA 1I4WA 5CB8A 2PZFA 1YS9A 4HAYA 5KTNA 5LP1A 4HXGA 3PSAA 4C07A 5AT1A 2KWIA 4M1YA 3UMMA 2I7VA 4I1VA 3WYBA 2I2WA 5K0GA 3DVAA 4ZA2A 3EEOA 1E0KA 4X7PA 4D9BA 5IN4A 2RH9B 3PC2A 4KWHA 3VZBA 1LTQA 5DF1A 1DAOA 4YAFA 1CS4C 5E6UB 2YZNA 3K70B 4Q18A 5EE1A 4L02A 4RY2A 4YRDA 1GKIA 3ELYA 4V2UA 1CVLA 3V4VB 1TOAA 1E2LA 1GG2A 2A5YB 3A25A 3RARA 2H1FA 3E58A 4X65B 4Y2UA 5LU8A 2Z1NA 4Q9LA 4I5DA 4R2JA 3V5NA 1N4AA 1EK1A 1B7GO 3NT5A 3RSFA 1KYQA 1E79D 3BYZA 1U7WA 1ISIA 1Q44A 1R5NA 1C9NA 2WM2A 4IIVA 3ZYCA 1RXEA 2ID9A 4IY1A 3LHKA 2IHVA 2NU6B 3BCHA 3HKBB 3C6QA 4YMGA 5AVSA 3TZKA 2FUG1 2PBZA 2YJ5A 1UMCA 3I04M 2GEBA 1VIYA 4GQIA 1MEOA 3AHCA 4B0OA 4EG3A 4TLBA 3QNMA 1L5QA 5C37A 4XWYA 3RVQA 3T3HA 1HEYA 1G1MA 1RI3A 3AONB 3UJPA 4YDQA 1SVSA 1Z0AA 2X8LA 1JJFA 4LMBA 3EGXB 3MJTA 3ZZNA 1MEEA 1ESMA 2EJBA 5I5GA 3SWWA 1GPLA 3GDFA 3U7GA 4X0EA 1D0SA 1B6SA 3AEUA 4TYMA 4II2A 1CJVC 1B8VA 2OY0A 4KI7A 4MKIA 1IQUA 3O8RA 2XDQA 1PJQA 4QXPA 4RESA 2FFRA 4OL9A 1SUBA 2VIIA 1QR2A 2R1UA 1JNXX 5B2FA 2JAUA 4GVPA 5LXTB 1FF9A 3PJDA 2PUEA 4E14A 5ECYA 1Y9AA 2Z5FA 3KR2A 5HIMA 1XT6A 1YC2A 3AP1A 5DT2A 5F73A 2ISQA 5GMOA 4CCYB 3E15A 2X9QA 1RWNA 3ZIAA 1QHYA 4E3WA 3A6HA 3CKKA 2G9ZA 5DI9A 1NI3A 1SQ6A 4X71A 4MWTA 4OL0A 3ZCUA 3OEHD 2VJMB 1H2YA 1GN9A 3OECA 1F8FA 3CLSC 1ZDMA 5JXGA 1W9MA 2AR9A 2ZB7A 1P4GA 3LPCA 4H1HA 1UK9A 3FPJA 5FLKA 4KIJA 3QVLA 5FUBA 3V7YA 4EUNA 3G9TA 2OESA 5JC8A 3TXYA 3ZWBA 1R0BA 1BH2A 3IBYA 1WUYA 4AKEA 2QGZA 3HN7A 1G9TA 2OFFA 1IY9A 2D3TA 1PQPA 1QVAA 4OXNA 3KSRA 2OFOA 4IIJA 5FUQA 4PLVA 4RZ2A 5LBIA 3EXG1 3KWFA 1G4AE 2XR1A 3ZJ5A 2PH7A 1Z6AA 1OWNA 5C5CA 5IFLA 1CF9A 3HJTA 4D4LA 5LBUA 3F5QA 2OQVA 5BNTA 1X1BA 2CDAA 1KQFA 1K68A 1L4EA 2BFBB 4KWIA 5F5XA 4ALMA 2CZGA 3G17A 1PV1A 1YBAA 1KGDA 2XMGA 3PQ6A 3Q3GE 2PQ6A 1Q17A 1UWVA 1K0FA 1N1DA 1VRWA 2MIIA 2WUFA 1E2KA 2JFWA 5CYPA 2EG5A 2AZMA 3VO2A 5CBKA 3D4IA 3PE4A 4LFCB 1QOQB 1G8YA 3WQSB 3JQ9A 4B8YA 4JKIA 3LVFO 4H9GA 2YH2A 4YH1A 3VKVA 4BX3A 1U3UA 2FKAA 2P90A 2QRNA 3C7AA 1FLNA 4IUDS 4F1WA 2XLBA 1SZJG 4MPPA 1QIJA 1AG9A 1PFQA 4U7GA 2E4WA 3KB6A 3P5SA 3WP0A 1PI3A 1AKYA 5KWEA 1KARA 2IP2A 2Z09A 2O57A 2Y9MB 3I4LA 4JCOA 1J2JA 4ALKA 3BGVA 4B32A 4OHMA 5I5EA 2C2WA 3K72B 1A96A 4L5BA 2A9OA 5DGCA 3HLYA 1P4JA 3Q1KA 4CFYA 1F2UA 1M6EX 2Z9DA 4FX2A 3KQYA 1P6QA 2IYUA 3DT6A 3RIXA 1TLTA 1RRGA 4F3NA 3ZHOA 4PZDA 5BSVA 1RRFA 1Q6ZA 2H8GA 3KPYA 1NJ5A 4TKUB 1EQAA 1C9EA 1A4IA 1K4YA 4G5OA 4UHHA 2C61A 4PYMA 4MYUA 2P9GA 2PJZA 3WGJA 1XB2A 1PK8A 5I45A 4JLUA 5P8WA 1GG8A 5AW1A 4URHA 3IURA 4QU8A 4TL6A 2TSYB 3BSFA 2FPKA 2GOYA 5IJXA 4X1KA 4GPTA 5L6LB 4CU5A 2L0XA 4PBRA 4DSTA 3NVKI 2QJTA 3QOWA 1KK2A 1NT2A 4UCFA 3IRUA 3USCS 4AJKA 2YOFA 1NF8A 1MIOA 3PUJA 4JZKA 5JQGA 2W2KA 1MAVA 1XCPA 1GU0A 1U02A 2C1XA 3ORSA 1WUIS 3Q9LA 4KX3A 1VYTA 2VTVA 3D8NA 2J85A 2BFCA 3FUVA 1YJQA 5LOVB 2WPNA 3DEJA 3C5CA 3B9RA 4IL5A 4PLWA 4AJ1A 3W9YA 2VS1A 3GAFA 4H17A 1T34A 4EG5A 4TTRA 2JI9A 3GDHA 3MWDB 2Y1GA 3M4YA 5I7FA 4BRSA 2WAMA 2JIZA 2LR0A 1A4XA 4G89A 4LQDA 4FEYA 4MCHA 5E7IA 5CVVA 5JVDB 3E35A 3RU9A 4YRMA 2XB2A 4R68A 1BVYF 2ZZKA 1LDEA 3PDIA 2H2GA 1Y8RB 3KQSA 4HMQA 4IR7A 1WHTB 1EWKA 2ENUA 3LNCA 1F4PA 2O2GA 1ENOA 3FMFA 4YREA 3BSWA 3K1ZA 2EWWA 4HVTA 3EWNA 4KR9A 2W93A 3L8GA 3T5DA 3WRWA 4LN1A 1RACA 4U6NA 4HXYA 1PS0A 4EB3A 3U3DA 5KTKA 1PQ4A 1ZD5A 1DTWA 2FFJA 2P1ZA 3BJMA 1JR3A 1XUOA 3H1PA 5EUMA 4XW2A 5L3QB 1NU6A 1P1CA 1S4MA 4R8SA 2GXQA 5CUQA 5CAEB 1ZPDA 3M34A 1MOZA 2B30A 4AMZA 3DHNA 4A6XA 4BDSA 1OAOC 3IQWA 2CVPA 2YRFA 1V47A 3U9SA 3GGCA 2DQYA 4GL4A 1RJFA 4GVXA 4B4KA 4A6EA 1T4GA 1XZGA 3RM3A 3TJRA 4BZQA 1DBRA 4V24A 5HHTA 4A0HA 2B5WA 3WHLA 2QTRA 2IU0A 3UAWA 4DCUA 2PGDA 4W7IA 1J0XO 1XNQB 1ZQ9A 1VBKA 2ZIXB 4E6EA 2XCRB 5FA6A 4UNPA 5DM1A 1X1SA 2C82A 2Q29A 1GAXA 3AU9A 3VNQA 1HLGA 3OLVA 2C3YA 1E69A 1K3TA 1O5TA 3HK2A 5CU7A 1XNHA 1L4LA 2HQBA 1DIAA 1GGVA 2VNIA 3EODA 3GH1A 4KBFA 2E4XA 2ZG6A 4N1AA 2UUCB 3BB4A 4D0NA 3UK1A 1SHZA 2R44A 2V6FA 5CK5A 2BEWA 4F6RB 2B7CA 3HHPA 5HQJA 1NA5A 2HQ1A 3EULA 4Q01A 3ZJUA 9LDTA 5BV7A 2VUIB 3E18A 3S5UA 1A2OA 2J3IA 2O2XA 3U1BA 2OHHA 1RC0A 4R69A 3Q8LA 5LLTA 1M7BA 2QD2A 3TOZA 4M6WA 2DHEA 2OM6A 3EF1A 3WFZA 3LZDA 1Y1PA 3QPDA 2FPPA 5CDUA 2VQEB 5D85A 2X0JA 3IEVA 3ML1A 2YYSA 1UKBA 2G82A 3ZBQA 4ER3A 1EM8A 3P2OA 1J90A 4LOKA 3T06B 3AT1A 4POOA 1U3DA 4IFBA 5FYDA 1W88A 2HMYB 4U3JB 3ET5A 3ZIUA 4LXIA 4BVBA 1PK9A 1VPVA 2VTDA 4Y7DA 4FGKA 1R8YA 1PSWA 1RRVA 3A9UA 4KL8S 1L7EA 2GK7A 3WQQA 3X1WA 3AOEC 3KO8A 5PNTA 1WX1A 4P4SB 5LR6A 1TF7A 3AIIA 3D4PA 3UGKA 4FZRA 5D5HA 1XZAA 4IJQA 1II8A 4C4SA 2WABA 4G8JA 2WFAA 3EN0A 4XVCA 1XSEA 2XWJI 3D6HA 2PLNA 3TQTA 3ZY6A 4EI8A 4HB3A 3V8QA 2YJGA 2QLBA 4X45A 5SZKB 4PN3A 1QVVA 3RB8A 1P19A 2YYAA 4DJAA 4F46A 4CKWB 4QUDA 1BNCA 2MSLA 2D5CA 4DPMA 3TBHA 5GJCA 4CDGA 4UM5A 2NU9A 1S3IA 1L3IA 4XYMA 2ZAGA 3A2LA 3L1JA 2IHUA 4O3MA 2UKDA 3KQTA 3UB4A 1RHUA 4Z0HO 3SE0A 5KQSA 2UYHA 3U4IA 2R6HA 1UAGA 4NHOA 3LDFA 4OSPA 1OB5A 2YWHA 4JL5A 2GM9A 3RVBA 4LRSB 4TWJA 1W25A 3C5EA 4ZN6A 1KJZA 2QUJA 1U8CB 3CR8A 1U3VA 1Q1NA 4GICA 4A2CA 5C2JB 2V7PA 1YA6A 3GRKA 3BJRA 3K09C 1I8TA 2DTXA 2GASA 3VVBA 1QCYA 5IAEA 4YAJA 1ZUHA 5AKKA 1L5HA 3N3BC 1BHO1 4ZT3A 3OI7A 4EY4A 2FW1A 3HBLA 1DJOA 2C2MA 3NBYC 1QUFA 1IEXA 1NAHA 1NLMA 2MYTA 3PFIA 4GEGA 5CTAA 1YS7A 4CMEC 8LDHA 5F2NA 1DXHA 1I3LA 2CVOA 4Q3CA 3DE2X 5J47A 4G0NA 3O2QB 4WHMA 4KV7A 3T4EA 4YRKA 3R9WA 1NVKA 3OLXA 4MRSA 2B0JA 3P27A 3P2MA 1ST2A 4RV5A 3BTOA 3T1YB 3HZRA 2IU4A 1CG6A 1A9XB 3IUQA 2X76A 5F3WB 5SZIA 3WIDA 1UJ5A 3H5VA 1C3OA 2WIFA 3KM0A 2JCGA 4O4HA 5LNK1 4AZWA 1BE6A 2A6PA 2HF8A 2XYGA 4B45A 4X8LA 4B84A 1ZINA 1FDWA 4N0EA 3ZHUA 1O6CA 2IDKA 5ERGB 1YIDA 4ZXFA 1L6IA 4A8JA 2CZQA 2N1BA 2OEPA 2O2ZA 2P77A 3FLEA 4A10A 3HGTA 3C43A 2AQIA 1EBUA 1NRWA 2XKKA 3DDHA 4QRHA 4ZVMA 5IBQA 1MVOA 3EIOA 3OMXA 1GKUB 1AZLA 2YHSA 3TLKA 3TNYA 4QOEA 5IC6A 1CUEA 5B36A 4JFAA 3VOTA 3WR5A 2DX7A 2ZWVA 1ZI6A 3G59A 5CT9A 4QEDA 5JZ9A 4ZVSA 1EUYA 3GJ0A 3IQZA 3PPYA 2C7PA 3HGMA 3ZCTA 5EXEA 4WERA 5EWLA 2H51A 1GNSA 3V2GA 2I6XA 4YMLA 1G0OA 1YJBA 1BGWA 2K87A 3I76A 4I55B 2GEJA 1C4OA 1E3TA 3MC1A 4KWCA 5EQJB 2FWRA 5FFNA 4F4CA 4KHPB 1VJ5A 1GDTA 3HVKA 4TQAA 4Q3LA 1UADA 2ZZMA 1WHSB 2ICAA 1IMJA 2WSIA 3B2NA 4BJHB 2CLKB 1UC8A 1IOZA 2C5SA 1CVRA 1GNPA 2P9EA 4RVDA 1UM8A 1MR3F 1OBOA 3AIKA 4TMWA 5E7QA 5AR1A 3ZBPA 4B8ZA 1JN0A 1Y89A 2PZEA 3INGA 5EE9A 1NN5A 1E4YA 1PP4A 1QRUA 1Y6ZA 3ZOZA 1IG3A 2FN9A 2XNKA 1U1IA 1CR2A 3EMVA 4FR0A 4OKIA 4OIMA 4OQMA 5AWFC 1PVOA 1FB5A 3V8VA 2ZSIA 2GHTA 3GLUA 3T41A 5DYNA 2R6R1 1NW7A 3PNPA 4AQDA 2HGSA 4WXMA 4AYTA 1VXRA 5EQTA 4AN0A 5LNK6 1E9EA 1U0OC 3FCUB 1OT5A 4NU0A 4CEIB 1UEJA 2FN8A 3IAS1 4HXFB 4N7JA 3EH1A 1R00A 4Z4HA 5CMLA 5BOSB 4DNQA 1OX4A 3AUJB 1QPZA 2VNSA 5GGYA 3QFHA 4V0RA 5BV1A 3W2GA 1F12A 3GCGA 5G4KA 3RUEA 5BYAA 3O83A 3FPFA 1Y9EA 3MTEA 3GCDA 2OO5C 3BJZA 2IHYA 1AA6A 3S68A 4KE6A 4AUKA 2R48A 3DMTC 4ZVOA 3CLUC 3ZY2A 3R41A 4KNYA 1HDGO 4DA8A 3ZKWA 3MFQA 1F48A 4JYCA 2DWOA 2GDZA 4AJHA 5GPBA 2EFDB 3SEZA 1R6AA 1H0RA 2CVFA 4FI3F 1Z36A 1ABBA 3TBKA 1BHSA 2OHIA 2Q4EA 2YIDA 3EZNA 2VZLA 1IVNA 1TUBA 2G28A 4G97A 5DU2A 3SFVA 3H97A 5ETJA 2C9YA 2WE7A 3UENA 2ZIFA 5AJXA 4ZYWA 1E1KA 4U2BA 5KNCH 4BV8A 4ICIA 1ORIA 1L8LA 2QUZA 2FEKA 4IIUA 2FZKA 3ICVA 5F77A 1V7ZA 4BCCA 4U3JA 1JT2A 2HHJA 2Q1WA 3NYWA 5JLAA 2OXIA 1L5VA 1C4WA 1CUDA 2FK7A 5DK4A 3U4GA 3URKA 4C5AA 4HFRA 2RBEA 1G7TA 1MQAA 4RPJA 2JD0A 4B35A 5KYWA 1B76A 5BSTA 2Q2OA 3Q3CA 3NC4A 4II3A 1M6WA 3DCJA 3HG7A 4PU0A 4UEWA 5JQGB 2R6DA 2WEKA 3DONA 4KMRA 1TF5A 1KNQA 1IBRA 2DR0A 4TYWA 4TVOA 2XYHA 4WBXC 7ADHA 1TKCA 2HQOA 3QYPA 1IXSB 4MAFA 3RYIA 1BU8A 4DV4B 4WOJA 1DKMA 4XKJA 2HMAA 3DOUA 2YKGA 1UKAA 3D81A 2Y0EA 4GPBA 5BT8A 3JWGA 4P22A 5CX1A 1JWBB 1TMKA 3KKEA 3DSRA 2G06A 4YN3A 5CB4B 1GYQA 1N2IA 3IBFA 4WX2B 4PQRA 3E1SA 4FFBA 5L7TA 3PX3A 3UJBA 1UFKA 3RRJA 4C4OA 5L4NA 5JD5A 3GLGE 2IITA 3D6FA 3MLEA 2C77A 4EZBA 4ERNA 2CXRA 1QK3A 1UDCA 1V71A 1XAIA 1G5FA 1WB4A 1TX4B 2OO5A 2Q9BA 4S0ZA 3HVJA 2P3QA 3ABOB 5K0SA 1GRVA 1OHHA 4Y9UA 5G3ZA 3BEDA 5FPPA 3ZHQA 5JUWA 1M54A 2QQEA 1I6KA 4D44A 3HTXA 1OLUA 3RS7A 3ED5A 4DY4A 3DUFB 3HO6A 5EOVA 3CNOA 3TI9A 2GBCA 4FDTA 3UHOA 1OGJA 3ADCA 2Y76A 2R751 4QFMA 2D5AA 4PVDA 1F5SA 4WASA 4MYTA 3BZBA 3K96A 1C50A 1XV5A 4IQFA 2HSDA 5HX7A 5HZGA 3AZOA 2DFTA 1A9YA 1RJEA 1U9CA 3Q85A 3ZV7A 2I54A 2VHEA 3OCWA 1QYRA 2QV0A 1PS8A 5J2UB 2NSLA 2C9MA 1PR9A 2H3EA 2UVQA 2ZTSA 4Q03A 3WIEA 4JLVA 4AROA 1Z22A 3NP7A 1GQRA 2N3ZA 3LBYA 3GH3A 4TV8F 5J58A 3ANMA 3GEIA 4C3ZA 3KIPA 3OESA 4MKZA 3RVNA 1CDOA 2GJSA 1M6VB 4NENB 4KPUB 2HRQA 1GTL1 3DD5A 5ADVA 5IH7A 1W46A 4RV9A 3FSJX 4HQ6A 3G88A 3V1YA 3ZYZA 1X7XA 1ADYA 4XIGS 3DV0A 4RAQA 5CLGA 3ZU2A 1GKKA 1HZJA 2IQ5A 3IHLA 4X1KB 4DYDA 3RC7A 4BLOA 3L7NA 3VR0A 4ODIA 1WPQA 1POXA 1KEVA 1KMQA 2ZOSA 3I6ZA 3PEUA 4QG7A 1AUQA 1EA7A 3HU1A 3JYNA 4HDSA 4WLOA 3QA9A 3ZIDA 1AMOA 3AOGA 4B3CA 1JHOA 4UCWA 3HWSA 4KEAA 1SXHA 4RTNA 4TMFA 9MHTA 4RCZA 3K0KA 5BSRA 3UWKA 2R68A 1OY1A 2I1LA 6ABPA 2QR5A 3O47A 2C2ZA 3HKEA 1EFTA 3L01A 4NZOA 4JBWA 1TAQA 3ACDA 1JTFA 4BNFA 2FPGA 4OM8A 5E4YA 3A05A 5JJCA 2NNLD 3FHCB 1KEUA 2D7JA 4H7DA 5DASA 5HQTA 4MXDA 4ALNA 3Q2IA 5EKSA 2CB9A 3LY8A 4F4UA 1DJQA 4YUXA 1AQJA 1KE1A 1XVIA 3SJUA 4BCBA 3G13A 4CV0A 3NHLA 4B79A 4RHYA 4RENA 2QZ9A 2PBFA 2WJ3A 3O73A 4PCUA 3SMVA 4ZI2A 3H11A 1P9RA 3GLQA 3IAM1 4K9KA 2Q07A 1AX9A 4L57A 1SUPA 4ARCA 4TWBA 2AQHA 4DC1A 2QMUA 1ZJ5A 3ED1A 3CLVA 3LH5A 3M9WA 1CUGA 2VDQB 1ZD4A 1PL0A 2BDEA 5HS6A 1XEFA 2GD1O 1GCAA 3OFND 4IHAA 4K6OA 3RJ5A 2Q46A 2ZS8A 1NGSA 1KQ3A 3H9JA 4ZDJA 4GL2A 3W4JA 3WKDA 1K1EA 4OUDA 4ISCA 4ZI7A 1UODA 1W6RA 1VE7A 1NW9B 5ES3A 2VRCA 5ANRB 3T3EA 4CKBB 1M6YA 4YMTA 3OEWA 1KSFX 3DBLA 3DMNA 4CT0A 3I42A 2JHCA 1WF3A 3BSYA 3CB4A 4P2GA 3VI4B 4C5BA 4EY5A 4YROA 3U7QA 1JYEA 4XWAA 4TN1A 4F8JA 1BKSB 1QH0A 2W0MA 2WR8A 3N87A 4CIVA 4EQZA 3O9MA 2H7XA 3FCYA 1YFKA 3WGGA 3FWHA 2BISA 4BNUA 2AMLA 5A3RA 4DBLC 4COKA 4QGBA 1VMAA 3DC2A 3UM9A 4D8XA 5FQOA 3PBKA 2B83A 1TK2A 2X77A 2I8LA 3DB1A 3E82A 3ZZUA 2RD2A 1I80A 1SU8A 4DAEA 4D9MA 1T1JA 1G6HA 1YGYA 4D74A 5JH7B 4O2BF 3LD9A 3ZDEA 3SHFA 3GFVA 1Y37A 3GLTA 4QHTA 3ZD9A 1P74A 1VHWA 1WY7A 3MJDA 4QU0A 4B6PA 4BGDA 2QN1A 1VOTA 5HR5A 3H05A 1MFZA 3K0FA 4Q4LA 3MOGA 2ZT5A 4B3HA 4D3DA 4R31A 1KEPA 3A4MA 2RH4A 3IAM6 1ORWA 1VMKA 3CONA 3F5SA 3P2YA 1FDUA 4QL3A 3C1TA 4LY6A 3FFXA 5EPOA 1LW6E 3REQA 4P7GA 5B7PA 4MV0A 4OGKA 4UQOA 3B36A 1YV9A 2CXHA 4GPD1 4EH1A 1HL3A 2AN4A 2O3JA 5FWNA 1P5RA 3JXEA 3QFSA 2V5VA 3LPMA 5TQ0A 5B3KA 1GEEA 4IKEA 1V5IA 1NW4A 3MK31 2WP0A 2OAQ1 1F7UA 2VNHA 3VYVA 1EFRD 3KR0A 1PL8A 1R27A 2AEMA 3A04A 3C4VA 3MTQA 3O1LA 4JEIA 5D87A 5ALLA 5G2OA 4R71A 3AC0A 4UQLA 3ZWNA 2VJLA 3O84A 3RFUA 3OWXA 2BMWA 5IF9A 3FVQA 4OHPA 4B40A 5TGTA 1J21A 2XWQA 3CINA 1Z7WA 2EOAA 5KMGA 2Z9BA 1K8QA 2ZWOA 4G25A 1MGPA 2ZTUA 1FMFA 4Q1EA 5JH7F 4XYBA 1Q0TA 2JFHA 3O7WA 4F2GA 1HLPA 3TLGB 4BB9A 4FBMA 4U2GA 2QX8A 3OOJA 1Q0RA 4QRDA 4N76A 3A6GA 3KKLA 2FWJA 5K0BA 4KFCA 2LDXA 3AJAA 3S2UA 2CMGA 4E4RA 3KQQA 1L4UA 3PC4A 1ZXLA 4HZIA 4N7RA 3F73A 3MD9A 4Y6LA 4FW8A 2C8JA 1OD6A 1TYZA 3L7AA 1DADA 2CDRA 2GM5A 4E5NA 3CSUA 3BGSA 3KOWA 3GVIA 2C5BA 2WPDA 3K1AB 1M1YB 1DB3A 3ZXYA 5KNDH 1X1AA 1Z5NA 3K5HA 4GWKA 4WRRA 2M2IA 4HTAA 1DL5A 2KBEA 3IE0A 1L8AA 2BEUB 1WLSA 3JYLA 4G5YA 4M60A 4UJ3A 5ECDA 2C00A 4DN6A 4NY1A 1KJ9A 3OY2A 3WGVA 4QUHA 2ANBA 2OQRA 4O8ZA 4C7MA 1KMNA 1CE8B 2JGNA 3QUCA 4P83A 1J99A 5DW3A 3V97A 1IY2A 2CLCX 2WIGA 4E70A 3ZE1B 1KJYA 2P78A 1QMGA 3MFYA 5EUQB 4RFSA 4NCBA 1CQJB 3LW7A 5IJ0A 1HE3A 1MRZA 3EZXA 5KQMA 4B3BA 3ES9A 4LYYA 3K31A 4BN4A 3IV6A 4DRXB 3U4QB 4RHFA 4WKBA 3U7JA 2GARA 2W71A 4TMKA 4YRBA 2HLPA 1JU4A 3K9GA 3MMSA 3AKZA 1DAGA 1W36C 4PC3A 4AY2A 5LBTA 1UMBA 2O0HA 4HBZA 4MRAA 4E5UA 3WV5A 1M1NA 2NO1A 3NV9A 3NALA 1QHHB 4DJFC 5DNYB 2VJQA 3RRYA 1S7CA 5BVHB 4BQSA 2N47A 2IUFA 3RAPR 1T4CB 2QGNA 1YUNA 4Y2QA 3PRHA 1HK7A 5FTKA 1EESA 1HDOA 1SHUX 1VGVA 3AM3A 5A3SA 3HGQA 1Z15A 2OCGA 4FXPA 3MHPA 1PE0A 2D5IA 3PFKA 1U2TA 2P6MA 3OFJA 4YASA 2Q99A 3Q88A 5LXTF 1SGWA 1ULAA 1JEEA 4DIUA 1FVFA 4H7FA 4LOJA 1U1CA 4X94A 1PR6A 2AJDA 1QZ3A 2JBHA 5FPHA 3QXJA 4NFLA 5DNCA 4LYFA 4WFJA 4ILKA 4B46A 1GD1O 5LCXA 2OHFA 3FTFA 1HE2A 1KGSA 2NUPA 1JV2B 2INGX 4IV8A 1QRSA 1PT8A 2A84A 3MG9A 1WW8A 4M9UA 1F0YA 3DE0X 3BE6A 4R2WA 1EEHA 4KE9A 3GU3A 4GOOD 3OPYB 4N6OA 4IEFB 5TC4A 1HG1A 2JZCA 2GMWA 1M5UA 1L5KA 3T1NA 1I3CA 5F1OA 3A1TA 3L4BC 4MDYA 5C3UA 4TT8A 4ZT6A 3M1AA 4UMDA 1ULUA 2Q3BA 2H7VA 2Z8XA 4MIEA 3R6WA 3BIXA 3Q7TA 1GU7A 4WEOA 2ZQ5A 1H3EA 3U3KA 3UGQA 2COUA 1TCBA 2L82A 3DBRA 1PQWA 1RYEA 1ZN9A 2H1VA 3KVOA 4H7KA 1AURA 3CRRA 4DBLE 3NWEA 3E5NA 1T0HB 2GFHA 4KG7A 4FYKA 3SIXA 4Q3BA 5EZYB 1JLSA 1TYBE 2FYTA 4FSXA 1QUEA 3T0FA 3TBFA 1EHYA 3OPYI 1JXAA 1TECE 3OOYA 4MUIA 3ZWWA 2E7ZA 4IF6A 1IJEA 3LQ4A 4Y9TA 1K6EA 5AVYA 1E77A 5A04A 1TO1E 3PC7A 1T3HA 2OLKA 3EGEA 4GOXA 1C8VB 4LJ5A 5JAUA 5JQWA 1TA9A 4A8JC 1U8AA 1VBMA 4H3KB 2CN1A 2AZDA 2W43A 4MUHA 5E1DA 3TAXA 2QPOA 3ZHZA 2PKQO 4LXHA 4CGZA 1VYHA 2X1LA 1IYZA 3PKZA 4WNCA 2G4CA 3G8YA 4U2CA 4G0XA 2PRIA 2WU1A 2ZBRA 3H5WA 4DNPA 3DFFA 4L78A 3KVNA 3ORQA 5IVHA 3BH6A 4O0LA 3GRUA 3N59A 1S8AA 2WINI 2GPNA 2F3RA 3ENWA 3K9BA 3O8BA 1ZM2A 1HFWA 3AERB 5CEFA 1H2HA 4BE4A 4BRWA 4D4JA 2O8CB 1FBNA 1M34A 2A33A 2VUHB 3AY3A 5DTJA 5JXHA 3AI1A 4EOGA 1VM6A 3CHYA 5B1EA 3PGVA 1YD7A 1D3AA 4R2MA 5EXPA 3G0BA 5FBQB 3R3WA 1XN4A 2EJVA 3T5BA 3ILVA 3IEUA 3MJ4A 1U4NA 4J0JA 4BO4A 5AK0A 1T8UA 2ZJ0A 3VKUA 2FE4A 4U2FA 1NJ6A 3M83A 3RC8A 1TVKB 3I12A 4L5JA 2VAVA 1L3CA 4BVEA 2WBLC 5KTRA 4KN5A 1RPNA 2UXDB 1QGUA 5DYIA 4JJFA 1BS2A 1TJ4A 2WWFA 1W52X 3BWCA 3HKBA 3S6JA 4JB8A 3QI2A 4UPEA 2LRHA 3Q8MA 3OA2A 3OZCA 3FCOA 2XB9A 3A3OA 1J09A 2F62A 2H7YA 2QM0A 2QU7A 3H13A 3GEDA 1MG0A 4OGGA 3DOEA 2G83A 4Q21A 3S8MA 4R5HA 5CYGA 2G09A 2VK2A 2YV2A 2NXCA 1RCTE 1CCWA 4E88A 4EBBA 5KS2A 5F3DA 4M7WA 2WRZA 1NQUA 4GOJA 4HB0A 4N0PA 4ND5A 4X3CA 1IHYA 3JD1A 4FGZA 4KAJA 2RI1A 2JLVA 3SQNA 1WM1A 2XZTA 2OVFA 1QPBA 1CUIA 1XTSA 1A3CA 5FI0B 3VFDA 5JNWA 5FEUA 4EA8A 3HVIA 2IPAB 4Z51A 4KLAA 1SKYB 3TCKA 1ZKMA 1XMPA 2YV5A 4RZIA 5EG5A 3I8OA 3KP1A 2IFTA 3OMWA 4B43A 4C4YA 4EKEA 1EVEA 1U2EA 3CLKA 2QHXA 3D8RA 2XVZA 5JR3A 4I2VA 1XEXB 2FJPA 4PEVA 1DAIA 2P2GA 3G1WA 3Q7PA 4X24A 2X22A 3ZU4A 1H85A 4L2IB 2X6QA 1TM1E 4J75A 5AHWA 4V0ME 1M8GA 4QGGA 4FX5A 4GYJA 3GVPA 3BWEA 3RUIA 3SVTA 2UUBB 2JLRA 1JAHA 3TLEA 3LS2A 4FFPA 1NMZA 4IIDA 4PICA 4RV4A 4I9GA 4IVQA 5CHYA 3G8CA 3IP5A 2AHOA 2WHYA 3DE1X 1XVUA 1YL6A 3B85A 4JCCA 3SXUB 3TSZA 5MHTA 5FORA 2FA9A 1K2VN 1WA5A 3SBEA 1Q57A 5TEVA 1ZEJA 4OQEA 5FL3A 3OM1A 4YP5A 3ZWOA 1JXQA 1LW7A 4S1TA 1ZCZA 1WD5A 2BWJA 2WF7A 3FFAA 3PXEA 5THQA 4KOEC 3WSVA 2VI5A 3NRBA 1Y7PA 1T9HA 1E3WA 1XMVA 2FMFA 2G04A 4AW9A 3NIWA 4CM9A 1Y81A 1R0CA 3QU2A 4PX2A 1XRRA 3BKXA 3FUWA 4L74A 2WD9A 2QMOA 3A3NA 2ZYWX 1KXZA 4L72A 3I58A 1B3RA 1P2BA 1G5RA 2DGDA 3CKYA 3SI7A 3I2KA 2BI8A 5DBHX 3F47A 2PMWB 4M88A 4IX1A 3IQEA 1BSVA 1NYRA 3P96A 4N54A 4BMZA 4D8YA 1ZJ4A 5JCJD 3TVDA 2C0CA 3S55A 1Y4AE 1QZXA 4EJSC 5B7QA 4J1NA 2VAXA 4CMHA 2KLHA 1RM0A 3VBCA 3D0OA 1GZ4A 3WBKA 2HCBA 1NI5A 4K9QA 4F97A 3IEMA 2DFDA 1QPGA 2XX3A 3FSGA 3H65A 3OCVA 1N2CA 4EVQA 3C6XA 1N1GA 3R9XB 4Y1FA 1ZN7A 4FT2A 3R0VA 3TB4A 3CMCO 4Y2XA 2IWRA 2VFAA 3CLRD 3O3MB 1ODKA 4WKNA 4QGAA 3HY4A 1UPBA 4WAUA 2BCGY 1EVLA 3I52A 1BHQ1 2YRWA 5A1JA 3A6FA 2XJ9A 3OZFA 1L5OA 4M4SA 1M9NA 3ROGA 1H6AA 4R9VA 5EZYF 1B00A 1ODIA 1X1DA 5JJLA 2KSQA 1IOWA 1NVAA 1N6OA 1NXWA 3UFBA 5KYXB 4IVNA 3OJXA 3ZWYA 3WA7A 2ZTVA 1W0JA 2ODWA 3K0SA 3T7JA 4IM7A 5IH3A 4LDPA 3G7SA 4KE8A 3R5KA 5AIAA 1RFGE 4EECA 1M74A 1M1UA 4JSRA 3E03A 2PWAA 2ZJ3A 1N7JA 5FOVA 3QI7A 2VHYA 5HW0A 1YFLA 2F8TA 5DNEA 4ER5A 4OK5A 1HV8A 2XMBA 3AEXA 2M9MA 4LDZA 5CT8A 1D2MA 5I3CA 1O0CA 1BFUA 4HGPA 4MA5A 3WLJA 2QR2A 4ATNA 2W2PA 2BOVA 4HDOB 3GMDA 5LOVF 1DC3A 2VDUE 3F4KA 4MUAA 2ZWPA 3UXHA 4EUEA 2TYSB 5EJGA 2O9JA 2QVLA 2IYSA 4JJ6A 1MXHA 1R18A 3PR3A 3RJ9A 4Y6QA 3THWA 1QAOA 5B3JA 4JS0A 1MDFA 1W4LA 4A3SA 4ZCMA 5FQNA 3K9WA 3LUAA 4QFDA 2F6RA 4JI8B 3P9YA 2IEZA 2XA1A 3B6EA 3OIVA 5J9FA 2QV7A 3C74A 2ENWA 3TL2A 2A9RA 4RABA 3UK0A 3I64A 1XK7A 3DTVA 3B3FA 4Q4JA 1TJ5A 4LQ4A 4FDMA 5ECWA 4C20A 3DEKA 5JRJA 3NJRA 4RZSA 3GRVA 2BFAA 1EJ6A 4JJAA 3L04A 2GF2A 3ND6A 4Q15A 5H7XA 4DA6A 3D31A 1W44A 2D2IA 2FFAA 2C03A 1GQOA 2UVDA 5LA6B 1ZK1A 2PCLA 1E3SA 4F9GA 4KFSA 3WIBA 3H75A 2O8CA 2B4AA 2E0IA 1ZICA 1VC2A 2OUKA 2ZM5A 1TUEA 3AVPA 3DLCA 4KAXA 5DN6D 4RW0A 5ALZA 4C6HA 5K4HA 4W99A 2BHLA 4NCIA 1E2FA 1MFPA 2HWXA 3AG5A 2PFGA 3WYDA 1HKUA 4ZJUA 2RG7A 1JECA 1DWPA 2EBFX 3F3KA 3OZGA 4FYMA 5TE9A 5TEWA 2X5OA 4GZMA 4HV4A 2QXTA 5KOHB 1X8JA 4M54A 2ATCA 3JQ8B 4B76A 2J5BA 1PV4A 4ECAA 2FCRA 2V9ZA 2BGIA 4C6SA 2BR4A 4GPAA 3VSEA 1A77A 1QTNA 3DBRB 3HDQA 4BUCA 5K3SA 1EMDA 2ZULA 1EFPA 3CZQA 3KXDA 5EHIA 8AT1A 4WKGA 1KAMA 3DTYA 3HA7A 3U9TA 3ZHBA 1NPYA 2R5WA 4H6XA 3NRCA 4UU0A 1D4FA 4P80A 2VDLB 2PH3A 1W8DA 1JA0A 3GNTA 4OMDA 4U6QA 4XCXA 3E8SA 3NWJA 3P97A 4AY3A 3UJ8A 1TVCA 3Q7IA 1JLLA 1GZ3A 1DDOA 1KS9A 2CLEB 1JR2A 2GEFA 2H18A 3LVRE 4Z4IA 4P6VF 3VYUB 3PFHA 4BP9A 1QQTA 5ITSA 1DG1G 2Z43A 4A15A 4X93A 1DG3A 3AP3A 4BMYA 4QT4A 1Q12A 2F1OA 3P9IA 3ZCXA 3ZVLA 1NL3A 1OH6A 5DP1A 4XEUA 3SIRA 9ABPA 4ND1A 6AT1A 3CBQA 1B74A 3HYCA 2I2DA 3HRHA 4DW8A 2AV6A 2O8DB 2LKCA 4P4UA 3JALA 1JPNA 1ZVMA 2E87A 3H83A 1JFLA 5M7EA 1XZEA 4I50B 3OQJA 2F8LA 3QXSA 3ESCA 3KU1A 3IDSA 5AKLA 2B4KA 1V6AA 1XCMA 3SQDA 4NTZA 2JLUA 4HVCA 4CNBA 4ARBA 5K0JA 1VGRA 5JASA 1H1TA 2QORA 4FYXA 3HVRA 5ALSA 1GLVA 3OD1A 5BSGA 4DQLA 1JDVA 2O4CA 3ZWMA 1OZHA 2QF7A 2H9IA 2VZEA 3KPUA 4K5QA 1VJ0A 2N1MA 1FMTA 5E1OA 4OHWA 2JI4A 1T5TA 3GZJA 5I7RA 1T9BA 2QTCA 1QZZA 1K08A 4GSKA 1RE1A 4RA6A 4JY7A 3IALA 3Q0TA 3ZNQA 4CM1A 1UWLA 1X1CA 2IHBA 3ZX5A 3G68A 5LDGA 4OBBA 3DLAA 3T3IA 2GWRA 1QV9A 2D4HA 4BKPA 1HQCA 4ARSA 5J40A 1YZ3A 1IEVA 2HNBA 1ND6A 3B6JA 3OD5A 4KK4A 1JFRA 2QTWB 3HQ4O 5G4LA 1H9AA 2Q2WA 4AM8A 4DR5B 3F6BX 1D03A 2IYQA 1JIIA 1JPUA 1J24A 2H9YA 1E8NA 4GKKB 4BHTA 4AO8A 3RRNA 3JVIA 3HBNA 3EG5A 2DR2A 2C4NA 4ZO8A 2OZEA 3ZGNA 4H4EA 4C2AA 3G0IA 4EJSA 1C7FA 3SK0A 5CDSA 2I9KA 2WWVD 3SYKA 1OA0A 3DE4X 5FUMA 2FW6A 4TTTS 5BWOA 5AVQA 1NXOA 1S2GA 4U7HA 3AINA 4K9NA 2OT3B 3VR5A 1BKYA 1EG2A 3BHMA 3KRTA 4LK3A 2AI2A 2C4WA 3I37X 5EZQA 4WY2A 3DKPA