1ZK4A

Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and nadp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific alcohol dehydrogenase
publication title Atomic Resolution Structures of R-specific Alcohol Dehydrogenase from Lactobacillus brevis Provide the Structural Bases of its Substrate and Cosubstrate Specificity
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 100
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zk4A00
2JD0A 1RM5A 3OMLA 1ZSYA 4GBJA 5L7WA 1DLIA 2PLAA 5A1TA 4IIVA 1T2CA 3A14A 3GR6A 1ENOA 1XA0A 4Q3DA 2DFDA 1H93A 1JLLA 1XHLA 1MXHA 2ZK7A 3TZCA 1GPDG 4LVUA 3AFNA 3X2EA 3MOGA 4BNLA 4R9RA 3BTVA 5JCJA 1E1NA 1NHGA 4JGBA 3VC7A 4AJEA 3PLRA 2ZKLA 4FFMA 4KWIA 2FPPA 4FN4A 3GEGA 1HYEA 1O9BA 3DBRA 3F5SA 3LDHA 4WEOA 3ZDFA 4PG8A 1PGQA 1D1SA 5KJCA 3WWYA 3F9IA 2C82A 3AU8A 3RUCA 4BKPA 3JQAB 3PXXA 4B4OA 3PFFA 3EAGA 1UZMA 3VOSA 4R01A 4Z9XA 2C5AA 4A73A 5EQFA 4UUPA 4E2WA 5BSHA 4R68A 1QSGA 4L76A 5HBRA 1ZNQO 4M89A 5BR7A 2OGUA 2VWPA 4HXYA 1IOLA 4OYRA 5B4VA 2JAHA 3BMNA 1CDOA 4BNKA 4FB5A 3WGIA 3DZJA 2JJYA 2JCYA 3JD3A 3TRIA 1ZO8A 2CVQA 5IN4A 1GZ3A 1SCUA 4MP8A 1LQTA 4KUEA 1C1XA 4RV9A 5U4QA 1LDGA 1EVJA 1AN9A 2YV2A 3K73O 4IJVA 4I9UA 1YB4A 3D3WA 4EJMA 3ZV3A 5HTOA 4ND4A 2QW8A 2G5CA 3BAZA 5KJEA 5I7SA 4E2ZA 4GGOA 4E2YA 2D1YA 3NKLA 4RVDA 3ZWMA 2YY7A 3FHLA 1U1IA 3MJTA 3R3JA 1DIGA 1GUYA 3VAZA 1E6WA 3NTOA 1ZJYA 3DOCA 4GH5A 2NTJA 4ZQBA 1NWHA 5FI3A 3W8EA 4CQMA 3IOYA 2PZLA 2VWHA 1D1TA 2AHRA 3QIVA 4B4UA 5T6BA 4ND3A 4FQ8A 3BA1A 2DVMA 4GLLA 2ZJ0A 3JQ7B 4KMSA 1YGYA 2Y1CA 3PK0A 3JQ6A 1EE2A 3AM3A 4YYZA 5TIIA 1EDZA 2ZYDA 1QLHA 1B3RA 3BIOA 3INRA 4AG3A 1ADGA 4GVXA 4QO7A 1KS9A 4Q3NA 4CM6A 4YB8A 1Q0LA 4RF4A 5T67A 4XD2A 3G3EA 1A9YA 2Y05A 3L6EA 3PDJA 1UP7A 4EUEA 1I3NA 2X0JA 2XXBA 1WDLA 3S55A 2GNAA 5JSFA 1MA0A 4Z0HO 1A5ZA 3PVZA 4K6CA 4BO8A 4R41A 2W4QA 3NX4A 4JBIA 4W6ZA 2C2YA 3ON5A 4FDAA 4OM8A 4UAGA 1OC4A 1K5HA 5K6AA 5CHEA 4J7XA 4EZBA 3ASUA 2GN8A 5EJ2A 3U5TA 1B0AA 2TMDA 1OOEA 4LW8A 3B1JA 1RWBA 4R51A 4DIBA 2B0JA 4Y9DA 3TFQA 2CDCA 3VH4A 3RWBA 5C7LO 4AJKA 1CERA 1N1GA 3FBTA 2V6MA 3Q2IA 4PVCA 1ONNA 1NPYA 5COBA 3ZWAA 4DBZA 1NFRA 1DFHA 3L9XA 2DPGA 4PG7A 4WLUA 2IZ1A 2QZZA 4GPD1 1R37A 1DB3A 1UAGA 1HTBA 2PGLA 1LA2A 4J0EA 1VKOA 4B8WA 2Y68A 2EXXA 5F21A 2XF8A 1MFPA 3WNVA 1UXGA 5FFFA 4D42A 1P0CA 4W99A 1ISMA 2W2KB 2OFPA 4NNJA 1MC4A 1VL6A 2D3TA 2GR9A 1T26A 5DULA 4YJFB 5FWNA 3D5TA 1IHXA 4XQCA 3HN7A 3ONDA 4NZ9A 2D0IA 2UVDA 4FFPA 4YT2A 2VRCA 5JYDA 1BMDA 4QSMA 3PWSA 5DBFA 4AICA 4F45A 3ETEA 5L40A 4UEKA 4UVEA 3SX2A 1ISJA 3AUTA 4BGUA 3GFBA 2WE7A 1HT0A 3LF2A 4ZQGA 4ALMA 3WLEA 1NNUA 1X0VA 4YQZA 1KYQA 4XEHA 4Z0PA 3I4CA 4CQLB 3GPDG 2PGJA 3MCVA 3SJUA 2PNFA 3EHEA 1NFQA 4HFJA 1YVEI 2EW8A 3CINA 4BOYA 3FNEA 1BG6A 4I9HA 3M1LA 4Z0TA 3D64A 4YJGB 3JQEA 4R69A 3PHIA 3ZHBA 3NYWA 2CF6A 4WCFA 1M6HA 3GZNB 2Q1UA 3ANNA 2IEBA 4O1MA 4R1SA 5I7VA 2CNBA 3EVTA 4E2XA 1N2SA 1YL5A 1NR7A 1XQ6A 5CAEA 3ZHXA 1PQPA 2PTGA 2FPGA 4LCEA 3SXPA 1WMBA 4PZCA 3C7AA 1PTJA 2YHIA 5L45A 1R12A 3JYPA 4BO4A 4OJNA 2HUNA 1UXHA 4CLHA 3ENNA 3PYXA 4LRTB 2DAPA 4JCOA 1FDWA 1ULSA 3GNSA 4JP3A 2WE8A 3UF0A 4Q3CA 4B7CA 2EP5A 5AOVA 4DUPA 3UOGA 2WD8A 4RGBA 1UDAA 1X7DA 1Y8RA 4GX2A 3RD5A 2W90A 1KY4A 1P33A 3I5MA 2CF5A 3UCFA 1ZMTA 3RVDA 3DZGA 1YL6A 2VYNA 1XCBA 4DIOA 2ZB3A 2ZB7A 4DMMA 4QXMA 1WZIA 1T2AA 3LT4A 3ZWCA 5CDUA 2IEDA 1D4FA 4Y8VA 5DBGA 1GZ6A 3LT2A 1JKIA 2D5CA 1SMKA 1E3SA 3QVSA 2PGDA 5BNTA 4W7HA 3N7UA 1HE4A 1KVUA 1M2WA 3O38A 4E30A 1B8PA 3AI2A 1EK6A 5THQA 2Y93A 3N58A 3PFWO 1NPDA 4INAA 4RL6A 2Y1OA 4BKRA 4BNYA 4NU5A 1WDMA 3W6ZA 4CM7A 1JDJA 5C5IA 1SBYA 5K6AC 4A5OA 3ZU4A 2NVUB 1K3TA 2J5QA 4XJSA 4PLZA 2C29D 1LSOA 1JVSA 3BMCB 3SLGA 2X23A 4W7IA 2FWMX 2OP0A 3NRCA 4BNMA 3I1JA 1P1JA 3EW7A 3MJSA 3ADOA 4DRYA 1HDXA 2VQ3A 3CEAA 5DCWA 1V8BA 3F3SA 1U3WA 1J49A 2NSDA 1UXIA 3KHUA 3ULKA 3NT5A 1DIBA 2HDHA 2A9FA 3NTQA 3EYWA 3EY4A 3VVBA 1AGNA 2YHUA 1YDWA 3O26A 1F8FA 3PZRA 3OBBA 1BW9B 1Y5RA 3QVXA 2OZPA 3V1TC 4E3ZA 5CDYA 1MXFA 2BFPA 2ZATA 4J1TA 4I9NA 4WLFA 1H5QA 4U5QA 3H2ZA 1ZK0A 4EYEA 1YB5A 3AOEC 4NG5A 5ICMA 3FNGA 4PCVA 3TZQA 3BHMA 1PQUA 5ICSA 3HFSA 4CLXA 1H0KA 4URFA 3ZGYA 4Z6KA 2ILTA 2BFMA 2Y99A 3DHEA 3KYDA 2WD7B 2I6TA 3AUAA 4H15A 4J3FA 4OKNA 3RROA 2GZ3A 1MG5A 1EFKA 1PL8A 4RDIA 4J1NA 1RM3A 2NVWA 4B4VA 5ITWA 1Q0HA 5JPIA 3HDYA 3T7CA 4YT5A 5JDIA 2V6GA 1B7GO 1PWXA 1U5CA 4ALNA 5JCJD 2Q46A 3GZ4A 4FS3A 2P91A 2WEKA 2VRBA 1XQ1A 4W4TA 5T57A 5BSEA 3BMOA 2AQKA 4CLRB 5A05A 4JBHA 5IDWA 1R4NB 2X9NA 2P9EA 2BKAA 3ONFA 3MEQA 3L07A 4HY3A 2DC1A 1KVQA 3DBLA 1E6UA 1DHRA 3PHLA 4H3VA 3C8MA 4ND2A 2BFOA 1PZFA 4CL3A 1YJ8A 1IYZA 4TMFA 1C1DB 1VI2A 2I3GA 3RBVA 2RH8A 4BB5A 1OZAA 4YAGA 4GAEA 1O89A 5JNLA 1A27A 3BTSA 1S7CA 4WLVA 4PG5A 1ZJZA 5HM8A 1RJWA 3JQBC 3B70A 3JTMA 3LC2O 4DC0A 3MZ0A 3HG7A 5KWEA 5KIAA 2LDXA 1NR1A 4GWKA 1NVGA 2WM3A 3GAFA 4W9NA 5B4UA 2EJWA 1Y8QB 4RF5A 2DPHA 2PH3A 1D7OA 4FJ1A 3X2FA 5EINA 4J1QA 3IKTA 1GYQA 1P45A 4N5NA 1BVUA 1AXEA 4XGNA 4MINA 2ZJ1A 2PD6A 2PKQP 3L77A 2DLDA 3KSUA 3H6KA 4WECA 5JS6A 4DMLA 1I2BA 2VT3A 1MX3A 2E49A 2AEJA 5L7TA 1Y9EA 3H4VA 2EP7A 4XZ3A 5L9AA 2P4QA 4FJ2A 3IP3A 2ZYAA 3DOJA 3K5PA 2I76A 1UXJA 5CDGA 5TLSA 4EI2A 1PR9A 4YACA 5COAA 3OF2A 3IJRA 5EIOA 3ADPA 4CQMD 3T7EA 4YEDA 3KBOA 2PWZA 1WAMA 3JV7A 3FN4A 1KIFA 4RCVA 4IGFA 4FFLA 2BF7A 3NV9A 2Z95A 3EK2A 3UVEA 4M49A 1DJNA 3LC1O 5TJHA 1E92A 1RPNA 2VZ9A 4LVCA 2XOXA 5IZCA 2VHWA 5L95A 4AJLA 3IP1A 4CM4B 3RJ5A 5F5LA 1K89A 3DAPA 1GD1O 1PJSA 3L0DA 1P1KA 3GG2A 1T4BA 1HSZA 4D0SA 2HMVA 1Z73A 3KXDA 3ZWXA 1VJ0A 3WJAA 2W8ZA 3RUDA 1BXZA 1DC3A 4BNXA 3EZLA 4N54A 4U8GA 2GRAA 1B26A 4J7CA 1QR6A 2I9PA 3T4XA 3ZNQA 1IL0A 3BTOA 1U2DA 3KYCB 4YBZA 4YR9A 1DEHA 2H1SA 4GSKA 4IZIA 2J6IA 2E82A 2EGHA 4E6PA 1XEAA 4FFRA 3OIDA 1UH5A 3U4IA 1CIVA 2RHCA 2WYUA 5J23A 4IJUA 4MP6A 3D3EA 1XU9A 4BVAA 3JD2A 1JAXA 2VYVD 4R5MA 4JJGA 4CPDA 1GU7A 4NI5A 5ER6A 1ADCA 1ADBA 1B2LA 3AY6A 3GFGA 3CZMA 5BQFA 3TN7A 1R15A 2GASA 1LU9A 3KSDO 4EW6A 3AM4A 2PV7A 1DFGA 1I8TA 1ZEJA 3PQDA 3VPXA 2CZCA 4RVUA 3WJ7A 4BO9A 2GLXA 3AW9A 3KVOA 5T64A 4OMUA 3CKYA 1P77A 3RUFA 3U49A 3ROPA 2YDYA 3WMWA 4BNWA 1X0XA 1ZH8A 2GZ2A 1BWSA 4S3MA 5JDIC 2WYWA 2Q3EA 3LK7A 4LGVA 3CIFA 4E5MA 3JQAD 2G76A 2FHSA 4PLCA 3V2HA 3VPSA 4B3JA 1VLLA 2G1UA 2EW2A 1ONPA 2NU6A 4FC7A 3HHPA 5HS4A 5L4SA 3OJLA 5IAAA 3DBRB 4BNFA 1AHIA 4DA9A 5JO0A 1GV1A 1CYDA 4HX5A 3V5NA 2X58A 2PZMA 4JQCA 4MO2A 5DP2A 5FF9A 1IZ0A 1IB6A 2O3SA 1SOVA 4PZDA 1PGJA 7MDHA 1HRDA 1FF9A 2GERA 1NQTA 1MC5A 3E6AA 4MJLA 2X0IA 4MIOA 1HDRA 4DXHA 2B69A 3Q1LA 2V6BA 3EVNA 3G79A 5HS6A 2EEZA 5KKAA 3W4JA 3BMNB 4R1TA 1LDYA 3DR3A 1WMAA 4W9NC 1CQIA 5A02A 4OIMA 4TRMA 1PJBA 4I5GA 4XRRA 2R2GA 4NR0A 4NBUA 3OSUA 3GDFA 1C1XB 4AJNA 5B1YA 5F1KA 5F1PA 3ZCXA 1Z7BA 3SLKA 3D3WB 3UGKA 2VHVA 1P0FA 1I0ZA 5COQA 3P2OA 2HMSA 4GL4A 3EDMA 2VNAA 1MP0A 3RC2A 2OHXA 4N7RA 4UVIA 1PJ4A 4KDEA 3KRTA 2NTVA 3PHHA 1YBVA 2VCYA 5G4KA 3PJFA 4E12A 2CY0A 2Q99A 4WLEA 1DIRA 3DZBA 4RVFA 4BGEA 4CQMB 5KJFA 1K6IA 1MFZA 1YQDA 1HDCA 5G4LA 1JWAB 1GADO 1ISIA 5HA5A 3DTYA 3I6QA 4NMHA 4BO0A 4CM9A 5TT1A 3H5AA 4HP8A 3UN1A 2IZ0A 1VSVA 1PZGA 2GF2A 2O2SA 3IDSA 3NAQA 4CUZA 3DDNA 2HCTA 1E1MA 1IUKA 3ZNPA 3A28A 5KVVA 3IJPA 3H2SA 3WGTA 1XLTA 3LC7O 4L4RA 3U4HA 2HQ1A 4ZRNA 2BELA 1HKUA 2NQTA 3GRPA 3WBBA 2C7GA 1IULA 3DBHA 3AY7A 5LDGA 1OC2A 3B20A 3SBOA 3WFJA 2DBVO 3QWHA 4GWGA 1JKFA 4OGWA 1PL7A 3MJ4A 3I9JA 3JYLA 1NQAO 4Y6PA 2Q49A 1NTOA 3S2GA 1GAEO 3UICA 2VHXA 3ICPA 1U7HA 4BQRA 1SZJG 2PA3A 1RYEA 3L4BC 5KKCA 2BFAA 2AW5A 4MKXA 1C0KA 2CMDA 4PG4A 1H94A 3I83A 1KY5A 2XAAA 5CFZA 2I66A 2H5LA 2J3KA 4IDFA 3GRKA 2YYYA 4PRKA 3CTMA 1KC1A 3NTRA 5L4NA 5EQDA 1N5DA 4BV9A 1YBMA 2X6TA 4FC6A 4GGPA 2NUAA 1G1AA 1KVSA 1HDOA 3AWDA 1LC3A 1SAYA 4FGWA 2JD2A 2BD0A 4B79A 3IC5A 4R3NA 3ZW9A 1ZXLA 5DDIP 1VM6A 3ROMA 4FFNA 4EJ6A 4LSWA 1DO8A 5DN9A 3A06A 3BHIA 4LISA 3ZV6A 2VUTA 1LDNA 3PP8A 1HZJA 3WGYA 1NM5A 3V2UA 1MUUA 4JN6B 1V6AA 1E7SA 4FIZA 4DLLA 5JC1A 2X5JO 1EVZA 5JDCA 4EDFA 2Q2WA 1ONOA 5DCYA 2IRWA 4R4JA 4J90A 3UW3A 3WXBA 7ADHA 4J6FA 4M87A 1VC2A 2PD3A 1ID1A 1ISHA 3DC2A 1ZFNA 2HO5A 1P74A 3OECA 3CE6A 1LX6A 3PEFA 4IM7A 3PWZA 4IDAA 3AI3A 2D2IA 3OETA 1I33A 2ZCVA 5THKA 5C7OO 3JSAA 4TQGA 3ZWOA 1F17A 2WTBA 4ALLA 4ZQFA 1EVYA 3K96A 1ZK1A 1XYGA 1PJCA 1FDTA 4WCFB 3Q6IA 4XCVA 5DF1A 4Z3KA 1ML3A 1CWUA 3TNLA 3UH1A 5AXBA 1F14A 4U6QA 3WGGA 3WQQA 3DMTC 2HJSA 2IE0A 5ITVA 4KTTE 1HYHA 5JAIA 4L74A 4HNGA 5JYEA 2YHIB 4YJHA 1NQ5A 1HE5A 2EHDA 4YAEA 4MKRA 4JIGA 4WGGA 5I7FA 3H8VA 5CG1A 2O2YA 2D5AA 4EGFA 4KQXA 2X1HA 4ROSA 4GX5A 4C7JA 3RC7A 4LN1A 4BNUA 3KM0A 2EKQA 3ASVA 6ADHA 3ZHZA 1Y8RB 3PGJA 2Y0CA 3H9QA 3L4SO 3PHJA 4CMEA 5ENVA 1AUPA 2YQ5A 1VPDA 1L7DA 1DC6A 1NQOA 2HJRA 3WGHA 1Z82A 2IXBA 4CV1A 1GEEA 1FDSA 1P31A 4XKJA 2I3AA 4YAJA 5EESA 2YFHA 1EUCA 3F5QA 4EEZA 1ZCJA 5T8KC 1RKXA 3FSRA 3FWZA 3VKVA 1T2DA 3O4RA 4J7UA 4A03A 5JCXA 4IQ0A 1J0XO 4F6CA 3GC6A 2OUIA 4DQVA 4OKIA 2J5KA 2D59A 3HDJA 3WYEA 1QV6A 2AEMA 1JA9A 5FI5A 1LI4A 1WNTA 4CM1A 3UXYA 3VH1A 4E21A 2R6JA 4O6VA 2DU8A 2I67A 5G0UA 5CPBA 4A26A 2P2SA 3FRJA 3RUHA 1FMCA 4P4LA 3QY9A 4BGVA 4BKQA 4GQAA 2IZZA 3U4DA 3NEPX 1YE3A 1WW8A 4C7KA 2PFGA 1SEVA 1TB4A 2O3RA 3LZ6A 4YDRA 2J3HA 1BXGA 1HEUA 1Y81A 3MTGA 5TC4A 3A1NA 4R54A 3U62A 4OOEA 4N5MA 3ABIA 3QVOA 3OIGA 3ZU3A 1PL6A 4RQUA 1JQBA 4MVJP 1ULUA 3DB2A 2BI7A 4BNNA 4HKTA 1UR5A 4NK4A 4BNHA 4YAKA 3OH8A 3PQEA 3QW2A 1XWFA 5A4DA 1NXQA 1VKNA 2CVZA 2B4TO 2WDZA 3B1FA 2ZYGA 3LT0A 1Z75A 1RYDA 2J8ZA 3TOXA 3G1TA 3LT1A 4WLNA 1E1LA 4OQZA 1VJTA 3KYDB 4G81A 1LNQA 1EQUA 5KNLA 4WUVA 3AI1A 1EQ2A 3PJDA 2Y67A 1Y5MA 4G65A 1OMOA 4U7WA 3G0OA 2QRJA 1B14A 2ZQZA 4RO0A 4BKOA 5I8WA 3OICA 3BMOB 3RSHA 4Z9YA 3HFGA 1E7MA 5IN5A 2EG9A 3S2IA 1ENYA 1QP8A 3DBLB 2B83A 3ZV5A 4GI2A 1QKIA 4DYVA 3IAHA 4II2A 4L73A 2B36A 1N7HA 1I01A 4CV2A 3ORFA 3OP4A 4HV4A 3PJEA 5JY1A 1Z7EA 2GSDA 3VPFA 2XPCA 1HSOA 1ORRA 4RDHA 4MOWA 2GGSA 3RC1A 3DAGA 1U4SA 1YJQA 2JHFA 2GN6A 3D4PA 1I30A 4RLHA 4XX0A 2Y1EA 3K31A 4I5DA 4ZRMA 1NP3A 1V0JA 3DMYA 3WTBA 2F1KA 4ALKA 1QLJA 4H16A 4QECA 3C7CB 1YRLA 4J0FA 1PJ2A 4XRGA 1HE3A 4PLVA 1N9GA 3F6YA 3Q11A 3W6UA 2NU9A 5K9ZA 1BTOA 3TPCA 4PLFA 3NJ8A 3C3XA 2BMAA 1Q7GA 4KUHA 4FW8A 4CV0A 3DONA 1ZSNA 3GEMA 4TROA 4Z9FA 3WGOA 4DTIA 2P5UA 2J3JA 3DBVO 2H6EA 2Q45A 5GZ6A 3WYBA 4CM9D 4RPKA 2X86A 4E31A 1TXGA 4YQYA 3HADA 2X5OA 1E3WA 3I9LA 3L6DA 3FBGA 4O0LA 1Y1PA 2VOJA 4BMSA 1BVRA 2WMDA 3HB5X 3JQFA 4ND1A 5KVQA 3KO8A 4A7PA 1L1FA 2ZQYA 1XR3A 3BMQA 2O3JA 4NH4A 3VDRA 5DT9A 4ZJUA 2CVOA 3BTUA 2DKNA 4E5PA 5CPFA 1VL0A 5IZ4A 4ALJA 1F06A 2B37A 4NBRA 1DXYA 5F5NA 3C7DB 3JYNA 1QRRA 4K6FA 5I9MA 2C2XA 3ZV4A 4DL9A 3NGXA 2DQ4A 1OBFO 1U3VA 3Q3CA 1LLQA 3GK3A 1GY8A 4TKMA 2GDZA 4BNVA 1I3KA 2NACA 3PIDA 2QYTA 5IDXA 1SEPA 5JLAA 2BGLA 1GTMA 2I65A 1RM0A 2FY8A 1T24A 1EE9A 3GLQA 3ANLA 3PWKA 2VOEA 2AG5A 3D5QA 3FNHA 4E32A 4J9VA 3RFVA 5A9SA 4D43A 4KP7A 4HFRA 3VZSA 2YV3A 4PLPA 4IPTA 1YBAA 1YH3A 5G0TA 5TX7A 4L4SA 5ES3A 4LK3A 1M66A 4HBGA 3VPGA 4NFYA 2Q1WA 4QEDA 5I9NA 3WBFA 1SC6A 2W2LA 3TZHA 3TDKA 3QVTA 4MKZA 4CMIA 3MOIA 4BGIA 3GGPA 5TRTA 1YXMA 4D3FA 3M1AA 1E7WA 4ONEA 2FZWA 5IJZA 1NHWA 3FPLA 3FNFA 3H5RA 4MIEA 3WLFA 4AJPA 3QJ5A 3DL2A 1KVRA 1DSSG 2UDPA 5AXCA 3MWDB 4A2CA 3ZN2A 3H9GA 2C5EA 2UV8A 2C59A 3T4EA 3STHA 4PRLA 3E1KA 3L9WA 4NHEA 4BKUA 2AE1A 2OMEA 2I5PO 1LDEA 3SVTA 5IF3A 4RORA 1Z74A 3I23A 2YUTA 3KLPX 3U9LA 2HK7A 4PG6A 1JKJA 4J49A 4WCFC 3FI9A 4CMBA 2Q1TA 4J2HA 4PFJA 3DQPA 4JX8A 5FYDA 3E5MA 4WNIA 1IPFA 2X22A 3OFSA 8ADHA 3O8QA 2YV1A 2BRUA 2PY6A 1I10A 4LMRA 4M55A 3GMDA 4XR4A 5KTKA 1WLYA 1OI7A 3FPCA 4D3DA 3PLNA 4MVJA 3KSZO 4WJZA 1M6WA 1X13A 2O7QA 3R0IA 4XYBA 3WSVA 4AJ4A 4UEOA 1E3EA 5TQVA 4ITUA 5BSFA 3PZBA 3CXRA 4QTZA 3IS3A 2B5VA 4F3YA 3S2FA 4ZICA 1UP6A 3QWFA 4W82A 1IPEA 3GDGA 5LCXA 3MWEB 3BHJA 5IG2A 1MLDA 1J6UA 2ZTUA 4EITA 1LLUA 3K30A 4NFHA 4XGIA 4MVJE 1AXGA 4Y6SA 1E3JA 2AEFA 4AJHA 1SOWA 3HSKA 1GEGA 3AUUA 3PHGA 2CSUA 2JL1A 5G4KB 2FSVA 2DBZA 2A35A 3TSCA 3LSYA 1YO6A 1W8DA 4CV3A 2VWQA 1DLJA 1KEPA 1Q7CA 1S6YA 1KOLA 4OO3A 3ZNOA 4E33A 4M54A 3DZFA 4QQRA 4KUGA 3HNPA 3C1TA 3EUWA 2PD4A 1H6BA 4DIFA 5A9RA 2QHXA 4XIYA 3H3FA 4ZQEA 1SB9A 1GL3A 1UP4A 5A3VA 1R4MA 5LC1A 3UAGA 1N7GA 3K6JA 1DOHA 3GEDA 1UAYA 3TFOA 2P68A 3VPHA 1PSDA 1U8XX 3F1KA 1GCUA 3DBHB 3PIIA 4C4OA 3ITKA 4NU6A 5JO9A 3WMXA 1F0YA 1V3UA 2OP1A 3GHYA 3WSWA 5ADHA 3S1LA 1PJ3A 1G0NA 4D44A 4ZA2A 4D3SA 1EZ4A 3ZZNA 1FDVA 4BMNA 3WNQA 4UREA 5IDQA 1IZ9A 1HLPA 4MPDA 2BHLA 4L8VA 4N18A 4OHUA 1QORA 2DT5A 2FN7A 5DCUA 1C3VA 1MGOA 4Z3DA 1W4ZA 5L3ZA 3H7AA 2X8LA 4XGKA 1DAPA 3ZWWA 4D79A 1HXHA 5L51A 5EERA 3RIHA 4XQEA 2DUWA 5I9LA 5A3JA 3BZUA 5JMPA 5DNAA 2NM0A 1YB1A 2H9IA 4GVLA 1IY8A 3HDQA 4JK3A 3A9WA 3M2PA 5JE8A 1ZK2A 1EK5A 4I8XA 4L4XA 3FF4A 4CMGA 3KV3O 3B1KA 4WEQA 3GUYA 3H9JA 3RQSA 4PVDA 3WFIA 3RAJA 1LUAA 3QVWA 1GFSA 4BO2A 5KVSA 4ZN6A 1HDYA 4N5LA 5A06A 5JAZA 3NJ4A 3HE3A 3O03A 2NADA 2VRCD 4TSKA 3ZI0A 3QWBA 4CL8A 3ROQA 5DP1A 3QLJA 1QYVA 2B5WA 2Y1GA 3GMSA 4A0SA 1HE2A 1NVMB 2V6FA 1UUFA 1C0PA 3LVFO 4E13A 5TJ9A 5TF4A 1NFFA 2DUUA 3MTJA 1KBZA 3PI7A 1A71A 4M86A 3TL2A 1K6XA 4KQWA 4P4GA 4JBGA 4BNZA 4DREA 3ONEA 4CLOA 1C1DA 3KUXA 3CH6A 1IE3A 1ZMOA 3OIFA 3RKUA 2X9GA 5KVCA 1HF3A 3H5NA 4IBOA 4XDYA 2Y1DA 4KTVE 3I9MA 4IXWA 1F8GA 1QXSA 1SB8A 4Q3EA 5JC8A 2RHRA 1C0IA 1CRWG 5IXSA 4KDFA 4YJDA 5AXDA 5ILGA 4CUKA 3UUWA 5K0ZA 1T2FA 1E7YA 4UUOA 4X54A 1Y8QA 4IMRA 4BNGA 4BO6A 1I3MA 4R1NA 1WZEA 4PLWA 2Z1NA 3RUEA 3LLVA 1R16A 3C24A 1NAHA 4NJMA 2X4GA 2OORA 5I8ZA 3C85A 3G49A 4QFDA 3F4BA 3W8FA 4BUCA 4FBGA 2VN8A 2EV9A 3GN2A 4MVJF 4OL9A 3HWRA 3I52A 5CEFA 4CODB 1K0UA 2PH5A 4UEJA 1ZVMA 3FTNA 2VWGA 3NGLA 3K2EA 1P1FA 4IXTA 3FR7A 4YJHB 3S2EA 4B4WA 2ZTLA 5HRUA 3KEQA 5KOIA 4QO8A 3JQGA 3E5RA 3EC7A 2P9GA 4FOOA 1XSEA 3CUKA 4MVJI 4XJTA 1Q2XA 2VYND 1A9ZA 4YT8A 2W98A 2XXJA 4RVGA 1P9LA 1Y6JA 1T1SA 5IZCC 3V2GA 3HN2A 2WWRA 1LTHR 3I9KA 4IDCA 1B15A 5ER9A 4YTEA 3TQHA 4DYDA 1ADFA 5BT9A 1AHHA 5B4TA 2CDBA 4RVSA 2FOIA 4B3IA 2HRBA 2OO5A 3HB4X 2NWQA 4IZHA 3QRWA 2NU8A 3F47A 3TJRA 1JTVA 1NX6A 2EJVA 4E5KA 5EL0A 4ZD6A 1V9LA 2NLOA 2ZB8A 2IXAA 2QYSA 4BNTA 4CLEA 5L7YA 1U7TA 4JP2A 5U1PA 3INGA 2O3TA 2JFHA 5GMOA 2AG8A 3QP9A 4XQGA 3E9NA 4BQPA 1JN0A 3OEWA 1W6UA 3AJRA 3OJ0A 3JD1A 3QWAA 2D8AA 4HFMA 2AMFA 2A92A 2GZ1A 3S8MA 2PZKA 1PS8A 4MVJG 4RPLA 3CPSA 2YW9A 3GGOA 3JYQA 4BIIA 2FRDA 2HMUA 4XR9A 1R0KA 1BRMA 4OXNA 1W73A 1GUZA 4UULA 5CDTA 5AYVA 2JHGA 2Z5LA 4ZGWA 1TT5A 1YKFA 3AK4A 3VZQA 3LYLA 1LSSA 1ZBQA 3JD4A 4IMPA 3KOUA 3QWIA 1VE9A 3OHSX 1PZHA 1U4OA 3JQ9A 2UUOA 1LQUA 1BXGB 2GPTA 1P1RA 1RM4A 4RPJA 1GV0A 1I24A 4WPGA 3NDJA 4WLOA 9LDBA 1VSUA 2JFGA 1K6JA 1LDBA 1U3UA 1X1EA 4LCJA 1DJQA 2O23A 4Q9NA 4CM5A 3D4OA 5DOVA 2A4KA 2RAFA 3H65A 3UFXA 2O4UX 4B3HA 2E4AA 2AQHA 2EKLA 3JQ8A 1ARZA 5KJ1A 1YWGO 3JD0A 4FOSA 1JVBA 2W2LD 1WWKA 5AVOA 1UXKA 2P5YA 4WKGA 1U3TA 2A94A 4DLAA 1A7AA 3TF5A 4Q3BA 1ZSVA 5A9TA 2GN4A 4XYEA 1XDWA 3RBZA 1A72A 4BO7A 3VVCA 3MJEA 5GZ3A 4CMCA 1X7HA 1UZNA 3OJOA 3V1UA 3PPIA 1EVIA 2UYYA 1TI7A 4NQZA 4GMFA 4DVJA 4CM8A 2FR1A 1QG6A 4RPGA 5DBIA 3TZKA 4OSOA 3DHNA 4KWHA 2GUGA 1N92A 1GPJA 5DOZA 1C14A 1LC0A 1E0DA 3WQSB 1O95A 4CM3A 3VTFA 4WASA 2GYYA 1SNYA 3SC6A 1GUFA 1P3DA 1H6AA 4YRDA 5JW6A 3IIEA 1DC5A 5JMWA 3GVXA 3Q9UA 4YVFA 4CMAA 1O0SA 5A5FA 3RU9A 5TS3A 4WCDA 3DO5A 1PJQA 3GT0A 3OQ1A 4F6LA 4BNIA 3WR5A 1WPQA 1E6EA 3PTZA 4MVJD 1HWYA 4JJFA 4MVJM 4XWYA 3ZWNA 1BSVA 1H2HA 2Y66A 1A7KA 3WQRA 4XYMA 3B6ZA 4BL5A 4K9DA 3AFMA 3IQDB 3DFZA 2O50A 4IDGA 3KYBA 5A03A 3OJFA 1ZIDA 2D4AA 2HK9A 3PYMA 4RQTA 4AL4A 4G2NA 3D7LA 4IINA 3ZU5A 3NT2A 4DC1A 1N9GB 1ZKMA 4EUFA 2FPIA 1KETA 3D4NA 3GVHA 1KEVA 2VHYA 3P5SA 2OBNA 3KB6A 1D3AA 3K8ZA 4IQGA 2GO1A 3VZPA 1P44A 1OAAA 4A10A 2C20A 1ISGA 3A4VA 3IL2A 3DXFA 1CETA 5EMHA 1YQXA 1DRVA 1MV8A 1M75A 3E9MA 4P8RA 3GVIA 3ST7A 1B8UA 4BNJA 3E9QA 1I5RA 1DAOA 1NPTO 4AJJA 4CLDA 4OOFA 1P1HA 1J5PA 1E3WB 2B35A 2UAGA 2JAPA 2WJPA 4DPMA 5L53A 9LDTA 3IUPA 1FJHA 5ENDA 5JAQA 2V65A 3EMKA 3R1IA 4GLOA 5B37A 4B8ZA 5G0WA 1PU2A 3GH3A 1DC4A 1QYDA 1WVGA 2HSDA 2O3UA 3DOOA 1PGPA 3BMQB 3OA0A 1YOVA 4BB6A 1O6ZA 1PS0A 4FGSA 3D1LA 4Y98A 3VKUA 1BDBA 1NAIA 2FP4A 3JYOA 3SEFA 1B8VA 3WX0A 3WWZA 1N1EA 4RVHA 1HZZA 1NVTA 3F4LA 4FSHA 4PLHA 4YT4A 3E8XA 3KLMX 4IIUA 2AQ8A 3JCZA 1Z45A 2CFCA 2VYVA 1GQQA 2WSBA 4J4HA 2O3QA 1PGNA 3JQ9C 1PEDA 3W1VA 3ANMA 3P19A 5CDSA 4EBFA 3DZHA 4NFSA 4NPCA 4J91A 1HL3A 4CR6A 4L9RA 1EBFA 3DFUA 3PYLA 5FEUA 1SO8A 2TMGA 3NT4A 3NUGA 2ZTVA 1E7RA 3L6OO 4AJ1A 5A9SB 3COSA 5JBIA 2HK8A 4L75A 5JFOA 2G0TA 2RCYA 1NBOA 4ALIA 3GG9A 2B4RO 2YJZA 3AOEA 3DZKA 2RBEA 2BH9A 5JDCC 3VH3A 4EJ0A 4CMIB 5DZSA 1QYWA 3JQAA 1A4IA 2YZ7A 4KZPA 1KVTA 1BXKA 3QA9A 2ZCUA 3WGZA 2O4CA 3AM5A 4AJ2A 1E5LA 3N74A 1F12A 1LLDA 1MG0A 1XGKA 2CUKA 2X7HA 2DTXA 1T1RA 1BHSA 2QQ5A 2PZJA 2AQIA 2Q2QA 3JQCA 4CUJA 4TVBA 2G82A 4L0QA 3VZRA 3RI3A 2VUUA 1VJ1A 3INTA 1JWBB 3W4IA 3K2BA 3U0BA 2JKVA 3O9ZA 1TEHA 4BO3A 5AXAA 3H9UA 1H6DA 1U28A 2P4HX 1LEHA 1ZZEA 4GKBA 4UVHA 2HKIA 1QMGA 2SCUA 1FK8A 3O8QB 2HMWA 2QZ9A 3HJAA 3UCXA 1PGOA 1V3TA 1LJ8A 3P2YA 3JQBA 1ZUD1 1GZ4A 3BXXA 1KC3A 1GQYA 1Z6ZA 3I4FA 5I7EA 2IYPA 1PS9A 3D0OA 1E7QA 3UKOA 3AU9A 5MGBA 4WE3A 3RUAA 4DLBA 2Y1FA 1AE1A 1JW9B 1KEUA 1XU7A 4YWJA 4CMHA 4CMEC 3JQ7A 4O59O 4P4NA 3IKVA 4M8SA 3Q2KA 3VHRA 1M67A 4A27A 4HUJA 4RF3A 4NBTA 4R9SA 4PZEA 5H81A 2JCXA 5G0SA 2PK3A 4RLSA 1EEHA 2J3IA 4ESOA 2CD9A 3JQDA 3ZH2A 1YDEA 2VUSA 1NASA 4IS3A 1D8AA 3PQFA 1TT7A 3GUCA 4P22A 1LXCA 4IQ8A 4P38A 2G17A 4FR5A 1R66A 4QX6A 1GCOA 1DDOA 2X0NA 4ZU3A 2DTDA 2HLPA 2P9CA 3LQFA 3ICCA 4XDZA 3C1AA 2BI8A 4BO1A 1M76A 2O7SA 3RCBA 3ZWBA 4CMJA 2AA3A 3ETDA 1EUZA 4QT0A 3E03A 4II3A 3WS7A 3GPIA 4YRAA 3AY3A 1R4MB 1Q1NA 5C7IO 4Q39A 4XIJA 1PR3A 3KETA 3WICA 4CMKA 4NIMA 1GYRA 1BGVA 4ILKA 1LLCA 1PWZA 4R3WA 3CSDA 5GY7A 3OQ6A 3GNQA 3EZYA 4RPHA 4XB2A 1R0SA 1GYPA 1GQ2A 2JCVA 3ROKA 1LRLA 1H9AA 1ZK4A 3QE3A 1PIWA 5B12A 4WK6A 1ISFA 2Q2VA 4UVGA 3LLSA 5CP8A 4OSPA 4OXKA 1LRJA 2DTEA 2QRKA 4PLGA 4DPLA 4K1LA 5JAMA 4IY1A 3RBXA 3AOGA 2IDZA 2W2KA 1EUDA 4I1IA 4E4YA 2GN9A 4YJFA 4UUMA 4I08A 4HWKA 3GHHA 2NVBA 2NV6A 4F46A 1VL8A 4MVJH 2YDXA 2UUPA 1KERA 1WXDA 4XB1A 3KEOA 2RH4A 3U4CA 1Q7BA 1YONA 4K28A 4Y6RA 1XKQA 1QYXA 5TSDA 5ILOA 4NBWA 1PJTA 3TOZA 3GVCA 5BNFA 1HDZA 2ZB4A 1NWCA 3DEYX 4YRBA 4ZQHA 3DWFA 3F1LA 3Q9NA 3UCEA 1E1KA 3WIDA 4AJIA 2EKPA 2EIHA 1K2WA 4CQLA 5H82A 1H2BA 3OJEA 4JNKA 1J4AA 5T5QA 5IDYA 1LDMA 2POQX 3W8DA 4JXKA 3TL3A 3GAZA 4DPKA 1DFIA 2DM6A 1E77A 3MJVA 2NU7A 4YJGA 1WP4A 4WOJA 4O5OA 4RZHA 1O94A 3FWNA 3RFTA 3GZNA 4WOKA 1H6CA 3R6DA 3FD8A 1EBUA 1YQGA 3GF4A 3GOHA 4NJOA 4TKLA 1LSUA 2HMTA 4CLOB 4JROA 4IGEA 2BLLA 4JLWA 3RU7A 1Y9AA 4QUKA 2DBQA 2EF1A 2OBYA 2E6UX 3EGOA 4XQ9A 1QV7A 2R00A 4G5HA 1X14A 2QRLA 4HFNA 1UZLA 1U9JA 4LRSB 2AE2A 2GCGA 2C0CA 2NNLD 5KCZA 5TNXA 1HETA 1DHTA 2F00A 1X1TA 5TT0A 4KOAA 1LRKA 3U3XA 3GDOA 1ZK3A 4J4BA 2ZIZA 4D41A 4UVDA 4E5NA 3ZW8A 2FZEA 2C7VA 4E0BA 4NJMB 4IJKA 1T2EA 5G0VA 3BYZA 4TZTA 1CJCA 3IMFA 4XA8A 2CDAA 5JXWA 4OAQA 2VTDA 4J4TA 4I5EA 4OXYA 1JU9A 2OOSA 4YCAA 3DHYA 1EDOA 2JFFA 3FR8A 3QQPA 4M1QA 1HYGA 2V7PA 5F3RA 4RF2A 1I36A 4XYGA 4PIVA 3PRJA 4IDBA 3FTPA 3H3JA 3W4KA 3OQBA 3JQGB 1NYTA 2Q4BA 4MDHA 1GDHA 1P1IA 1O8CA 4E5YA 1T4DA 4IDDA 5CEJA 2QG4A 2X5KO 4EEXA 5MDHA 3M6IA 1U5AA 3QHAA 3TZ6A 4ID9A 3JQFC 4YPOA 3HUDA 4DQXA 4MP3A 3QV1A 1KEWA 3CMMA 4CR8A 1ZW1A 3I3OA 5F1OA 1VRWA 1OFGA 2AXQA 2NVUA 1E5QA 4RZIA 2DBRA 3ETGA 1G0OA 3NDRA 4J9UE 1TVEA 4ZHSA 3H9EO 2YFQA 1XELA 3BMCA 2HRZA 4TWRA 4GX1A 2Q50A 2X9VA 4YAIA 3GGGA 4OH1A 1U2GA 2E37A 4IJWA 1E3IA 3M2TA 4NDNE 3ZWYA 1V3VA 1SPXA 3G17A 3OA2A 4J43A 1TLTA 2NTNA 3WG9A 4TRRA 3PGXA 3ENKA 1CQJA 1B16A 4PLYA 1LBEA 2VNSA 1HDGO 4TVOA 4Q3AA 1BW9A 4UUNA 3L4BA 4J16A 4HADA 5BNIA 1TT5B 1EMDA 3WYCA 4BS9A 2VHZA 2WYVA 2J5RA 4XYLA 3ITDA 1IHYA 3ZWVA 1JAYA 3DZIA 4O63O 3UHAA 3Q0EA 3RKRA 4H7PA 6LDHA 4AVYA 1R6DA 2WD7A 1WDKA 3MJCA 4LMPA 1Q0QA 4IS2A 1R0LA 2FMUA 3E18A 2VTEA 3GVPA 1I2CA 4PGFA 1ENPA 3JQ8B 5AQ1A 4CLRA 2Q1SA 4JJIA 1XIVA 4R16A 3KTDA 3P7MA 3SC4A 1YS4A 3WIEA 1R4NA 2Y0DA 2H63A 3VDQA 5H83A 2B4QA 1L7EA 3QSGA 4IDEA 3ZWPA 4AFNA 5IFLA 1CEQA 1N8KA 1PJLA 4D45A 2Z1MA 5EPOA 4K26A 4LSMA 4S1VA 4U0JA 3SJ7A 5A04A 5IXYA 2FR8A 2QIOA 4DQUA 5G2OA 4CM8B 1G6KA 4I5FA 2Y0EA 4TRJA 4BO5A 4AJOA 4TRNA 3VH2A 2VZ0A 1YL7A 3F46A 1UDBA 4D46A 4NBVA 1W0CA 2HAEA 2PR2A 3K92A 2HU2A 3FCOA 2R00C 4B7XA 3GN1A 5U9CA 4EUHA 4OQYA 4FJ0A 3U09A 4IUYA 5BSGA 3E82A 3I9NA 2FR0A 3CZRA 1B3BA 3ZHYA 1LSJA 3AUSA 3DTTA 3RFXA 3WTCA 2VT2A 2VZ8A 1O5IA 2OL4A 3GY0A 1CF2O 1TA4A 3TWOA 3VTZA 2E48A 4CJXA 3HZZA 1DIHA 3R3SA 1GR0A 4HNHA 3DMTA 3HQ4O 4MIYA 3E48A 1X7GA 2BGKA 4NK5A 4YXFA 1A4UA 4R1UA 2ZTMA 2ET6A 3HDHA 3OEYA 5HWSA 5A5EA 2YQ4A 4FFOA 4WNCA 1PQWA 3WB9A 5C37A 5LDHA 1UDCA 1BDMA 4J1SA 2PKRA 3KZVA 1U8FO 1Y7TA 3ZU2A 4GKVA 2IYOA 2LDBA 2QX7A 4GSLA 1ENZA 3LU1A 3V1YA 3IUSA 5CEEA 2PKQO 4DWVA 4FD3A 1PX0A 1FXSA 4CM4A 3OM9A 2RIRA 1XG5A 2BGMA 4GX0A 5TGDA 3PDUA 1H9BA 3I6IA 1C0LA 4BMVA 4PLTA 4YA6A 4CR7A 4U0KA 1FDUA 1T25A 3K9QO 3WOHA 1ZEMA 4Y67A 2X0RA 4J2OA 5EN4A 3RJ9A 1I3LA 2Q4EA 1EFLA 3DAFA 5T8KA 4PN3A 4DGSA 3C1OA 3ZNNA 2OXIA 2C07A 1DIAA 4DBVO 1PZEA 1DPGA 4B7UA 4FPXA 3RUIA 5JY6A 4GMGA 1I2ZA 3KYCA 2O48X 4ND5A 4FCCA 4D7AA 5CG2A 3G1UA 3NDIA 4RJTA 1DRUA 1QYCA 2C54A 2FSSA 4R5HA 4BV8A 2EGGA 3GNTA 2GD1O 4BHTA 2I99A 5C3MA 3GA0A 1HLDA 2EERA 3GQVA 1ZXBA 5KJ6A 4TZKA 3I9OA 2JD1A 2IODA 3CMCO 8LDHA 1YOVB 3LF1A 2DFVA 4QFCA 3V8BA 1UJMA 3RASA 3WDSA 4ZVVA 4U6SA 3PJGA 3RC9A 2EWMA 1DBVO 1V35A 5GZ1A 1DRWA 4D0RA 1MB4A 2NQ8A 1X15A 3WGQA 1E3LA 5L4LA 1I32A
chains in the Genus database with same CATH superfamily
4DDKA 4GS5A 1RM5A 4GOLD 1GO2A 1AHNA 5L7WA 4RYDA 4L3WA 2OXTA 1FNCA 3A14A 1ZM7A 3GR6A 3NU1A 4OH7A 3KV1A 3WOVA 1XHLA 1JLLA 4EJSC 1MXHA 2IW1A 3TZCA 4REMA 4AYWA 4LVUA 2Z5VA 2M6SA 2Y6VA 4BJHB 4FDUA 2PO7A 3MOGA 4D9GA 3G2KA 1DBIA 1JILA 2AWNA 1Z5PA 2K4MA 3DEJA 4R9RA 1JB9A 5CX1A 3SEAA 5JCJA 3VC7A 1W19A 3F6BX 3D7MA 1LTQA 2FUCA 1KDYA 4AJEA 4D4GA 3PLRA 4TXLA 1EK2A 1IK6A 1U94A 2AN9A 4X41A 4PSVA 1KQPA 4QPCA 4YHHB 3HA2A 1H4TA 3FYTA 3LDHA 3QFFA 4K87A 4LCBA 4LNHA 3OZ7A 4WEOA 3ZDFA 1PGQA 4KYUA 4CU5A 2C84A 3MGAA 1EQAA 2JGKA 3RG8A 5T41A 2C82A 1YE5A 2IX3A 4J0KA 3NBZC 3P32A 4KI7A 3PXXA 5E3HA 1PVOA 2AUMA 4F5WA 4YUWA 4ZEVA 3EAGA 2ZRMA 3MC1A 1QCCA 5DGXA 3GYBA 4RESA 3V8RA 5LNK1 4NXMB 1FPMA 3OE5A 2C5AA 4Z9XA 4Z5XA 4A73A 1C7JA 1GN9A 5I8WA 1F2VA 1TO1E 2XGMA 4L76A 5GONA 3RC3A 1KZ4A 4M89A 1L6RA 1UF9A 2OGUA 2DYKA 3SDBA 2F59A 2Y9MB 4O2BA 1DZIA 1G7CA 2VA9A 5G1NA 2OXRA 2WPDA 5B4VA 3OO0A 3T7JA 1CDOA 2XAUA 4LQDA 3DBIA 1PT6A 3WGIA 3EEBA 1O94D 2JJYA 4OX9B 1ZO8A 2J9FB 1OGIA 2CVQA 3U81A 5IN4A 3TE7A 3GLGA 1GAWA 4MP8A 2ETXA 4HTAA 4KG7A 1LDGA 1QVRA 5ICCA 4IJVA 5FA5A 2YV2A 1KPIA 3K73O 3HJUA 3LY9A 4I9UA 3V8QA 5JXGA 1T3TA 4NESA 5FPSA 2EP8A 2OZLB 4EJMA 3N0RA 5IWCA 5D5HA 4GGOA 5WRFA 4RTMA 2XCRB 4ARZA 2ZT6A 4E2YA 2Q3JA 3D0KA 4K0RA 3FTDA 2GM5A 4QGAA 5DHTA 3VYVA 2YY7A 4DMGA 2NP6A 2HPAA 5E0KB 1C7FA 2APJA 2W71A 2X1LA 4BBAA 1SA0B 2K6GA 1KH3A 3MB8A 3MJTA 5AO9A 3R3JA 1XHEA 4Z53A 2F4NA 2Y76A 3VAZA 3NTOA 1M2JA 1ZJYA 1P0QA 2PRZA 3MTAA 3BF8A 4GH5A 2WT9A 4HPJB 4C6SA 4ZQBA 1NWHA 3W8EA 1RZRD 3VNUA 5JH7F 4AYXA 1LY1A 2VWHA 2R8BA 1D1TA 3D2AA 4UJ5A 3QIVA 3QFHA 3ZDRA 1R3UA 4MUBA 1TCUA 1SWWA 4ND3A 4FQ8A 1WCWA 3OX4A 3VR3A 3BA1A 2DVMA 2YVQA 3NXSA 3AFIA 4RDCA 1F2UA 3EOAI 2ZRPA 3IR7A 2YWCA 2I8AA 1EE2A 3HP7A 3M89A 3ZLBA 1EDZA 1U9ZA 2ZYDA 1QLHA 3KQWA 3INRA 1XTJA 2DECA 1M1UA 1WHTB 2EW1A 3Q41A 4K05A 5KC9A 1FSSA 2YVKA 2W6CX 1KS9A 3EMVA 3OTWA 4GYWA 2G8LA 4KFUA 4QUGA 4UZSA 1YDGA 1GPBA 5T67A 1OBHA 4RU1A 4X9XA 3L6EA 2Y05A 5ALQA 4WWHA 3PDJA 3U39A 3W2TA 4EUEA 4QRDA 1EK1A 1I3NA 5E2AA 1WDLA 1VLZA 1Q84A 3HCDA 4KGDA 2QTLA 2QV0A 1TCCA 3FWKA 2XITA 2YRWA 5EZYB 3MA0A 3G13A 4Z99A 2GARA 2C9YA 4HWSA 3D8BA 5DSTA 4ZU6X 4BO8A 5DN6A 4JQSA 1CY8A 1Z4QA 2VP0A 4P5PA 1P7VA 4JBIA 2IYWA 4QOSA 1UFRA 2C2HA 2C2YA 3ON5A 4FDAA 4UAGA 4X1KB 5E7MA 3V55A 2NXJA 2WIKA 4MSUA 3P9SA 5T6MA 4BVGA 2Z4RA 1HOTA 4IIDA 4EZBA 1E64A 2H0AA 2D5LA 1EXMA 1UC8A 3KCQA 4XDHA 3SPXA 1ILEA 2CB9A 4YX9A 2CDCA 4GZ6A 5BW5A 3IV7A 4BMDA 4HEA1 2P6RA 1SQSA 4HTFA 1CERA 1N1GA 5HQ3A 1ZN8A 4LJRA 2D2FA 3I73A 1NPYA 1G4HA 1Y7IA 2CL5A 2ZT8A 3DEKA 3P5BA 5TV2A 4NSNA 3ZWAA 2V0NA 3G8YA 4XVUA 4Q03A 2VYCA 3S7TA 1NFRA 1Y1KE 4FQ7A 4PG7A 2QQGA 3O2QB 4WLUA 2CNWD 2I33A 1A0OA 2V96A 5ENZA 3ZHSA 2WF9A 5EIXA 4OYLA 1G9SA 3WC4A 2IHVA 3NORA 2DETA 2JAWA 4EKNB 3HCEA 4YV2A 2WF6A 1GN8A 4K6KA 4KFTA 2UYCA 1DAIA 4J0EA 4RM2A 1NIJA 1GTG1 1EFTA 3SJAA 3OPVA 1RQ7A 2Q5FA 2OE2A 4P7KA 4P92A 3KU1A 4KACA 5FFFA 5KSPA 1KWGA 1OLOA 3EPLA 4I1PA 2PTHA 2ZLBA 3L4KA 1QOQB 5EUCA 1H2EA 3EFOB 4IFIA 1U63A 2GM3A 5TE9A 2OFPA 3N07A 3H13A 2GR9A 5K8IA 4HRXA 1U98A 4G9GA 3RF7A 1IHXA 1KY2A 3HN7A 4AAYA 5TPWB 2O2DA 5KCMA 2Q5JA 1CULC 3RSGA 5BP7A 1OFHA 1JECA 2UVDA 1SD1A 3IP9A 1SCQA 2VRCA 3D6HA 3JWJA 3PWSA 3QQ5A 3ZD6A 1G20B 3GD5A 4FWBA 3L0IB 1L9XA 3ETEA 2HFKA 3LQKA 3O8BA 4FMDB 1PUXA 1ISJA 1AZTA 1GTRA 4NLLA 4KEAA 4Q7LA 2NZ2A 4QBTA 4RZSA 1SELA 5HSGA 4ZEOA 5T4EA 4YQZA 1FTSA 1EESA 4P31A 4PPFA 3I4CA 3IPYA 4CQLB 5H1YA 4H0FA 3GPDG 3T9FA 5DW3A 1NFQA 3K0CC 1F6WA 2PUJA 4HFJA 4M46A 1YVEI 2EW8A 2R96A 3NP9A 4I9HA 5DTJA 4Z0TA 3ZHRA 2NU7B 2ZDQA 3D64A 4R69A 1XNQB 1TDJA 3O8OB 1C4XA 4A0HA 5IT0A 4E46A 3A3KA 2CL7X 1J8DA 2Q1UA 4PHTA 2IEBA 4BBZA 1CUXA 2PL3A 1G7RA 1R6VA 1E3DA 3CUUA 4JR0A 5AVZA 4E2XA 2IYXA 2XRYA 1J21A 3WWEA 2QTAA 1YL5A 1ZD3A 1WXXA 3FG9A 2YXPX 1PQPA 1F20A 5F2KA 2FPGA 1TD1A 4QOIA 5A71A 3UJ9A 5DIFA 2Z04A 2NYVA 5CX4A 2WFZA 4K9QA 5JRZA 4D5EA 1FP6A 1JDBB 1T5TA 4HAUA 4RY0A 3P9NA 5K6RA 1SZCA 2ZT5A 2DAPA 3BJRA 5EJ8A 1T0HB 4LK2A 2JIQA 4RY2A 1W1UA 2WE8A 5K3FB 4B7CA 1HEYA 1E63A 2XUJA 5FA6A 3TLGB 3GLFB 3KUKA 2RKBA 3LQQA 5I4BA 4RGBA 1UDAA 1Y8RA 4GX2A 4L5CA 3I92A 2BEUA 2W90A 2ROQA 4LXIA 1OLUB 4PGMA 1LW7A 1YRHA 2LIPA 3ELYA 3UCFA 4F3RA 1KMQA 1ZMTA 3RVDA 4URXR 5J4VA 3CVYA 1XZPA 3DZGA 4P3KA 1M7HA 4JDPA 1H2ZA 1BJTA 1I7QB 2HK6A 1M10A 1TZ2A 1XCBA 3OZAA 4B4KA 3CX3A 4C03A 4DIOA 5JPCA 4BLTA 2ZB7A 4ZOLB 3OM0A 4PFQA 2WTXA 2Z8ZA 4L02A 5CDUA 1TYAE 2QL5A 3V7YA 3D8NA 3TIVA 2N0SA 3FOEC 4DR3B 4BECA 4I19A 2NIPA 4RKFA 1JKIA 1YQ9A 2D5CA 4OLFA 4AK9A 2UU9B 1UPAA 3UKJA 3M6AA 2V03A 1E3SA 1EJ0A 2ZROA 4W7HA 3O38A 3UV6A 5EZQA 3WGVA 4E5SA 4TXMA 1BVYF 1L6IA 5A3RA 1F4VA 3CZQA 2C8VA 3S28A 2EBFX 2Y93A 3PFWO 1YJCA 1PW5A 2XNSA 2HIAA 4BKRA 4BNYA 3TCXB 1WDMA 5FNVF 1JDJA 1WPXA 5C5IA 1GR1A 3HPQA 1P7WA 1YZQA 3OPQA 5C8YB 5IF9A 5K6AC 3GIWA 5ALRA 1SVOA 1TRHA 3VNBA 3WDMA 3GEBA 1USKA 4PLZA 3MUEA 3IHKA 4RZXA 2HB6A 1N2ZA 2ID4A 4I0WB 1FQKA 1CR1A 2EIXA 2X23A 3EF1A 4W7IA 3WYGA 1XT6A 4GRDA 2OP0A 2PRKA 3LLCA 3SM9A 1AQYA 4R9VA 1YZFA 3L6BA 4TLCA 1LVUA 1P1JA 3NB0A 3AF4A 3TS1A 2K5UA 4DRYA 1HDXA 3V1KA 1JPJA 2C5GA 3J81A 4KNYA 1RLJA 1KKMA 4ZYLA 1J49A 1V1MB 1NJ5A 3NG1A 1PDWA 4HUTA 1UBUS 1N32B 3PDCA 3D2BA 3WZMA 1CQJB 4P36A 3NT5A 2FEKA 1DIBA 4N9WA 4O2LA 1EM8B 4H31A 5DYYA 2Q6TA 4YCCA 3NQ41 5KDDA 1CP2A 1X1AA 5GADl 1ZOOA 3OFVA 4P0QB 3OBBA 4OI1A 3SSOA 1Y5RA 1U04A 3T3DA 5HKKD 2QD2A 4TQAA 1X7WA 5HF8A 4PAGA 4EB8A 1ZWLA 3W5VA 1B0ZA 2QDKA 3A31A 4I55B 4U5QA 1F0NA 4WNYA 3X1MA 2AOXA 1SHZA 3D0RA 1ZK0A 4H35A 3RS7A 1OI2A 3BHMA 4M0MA 3B51X 2PKYX 4I1OA 2HTEA 4URFA 1OXTA 4Z6KA 4IJ5A 2MSEB 2EAUA 1MIOB 2P2YA 2Y99A 3DHEA 5GOZA 3AUAA 3RROA 3R5TA 4JP1A 2GZ3A 1UBMS 2QSJA 4GXRA 4RDIA 4J1NA 2YVUA 3RRZA 2NVWA 2VNHA 1Q0HA 5JPIA 5ITWA 1O03A 4YT5A 3L0BA 1B7GO 1PWXA 3GRAA 2PCLA 4FS3A 1N75A 2P91A 3OZTA 3NUZA 2VRBA 2DR0A 4B43A 3NOQA 4OA5A 1WE2A 3IOCA 3JTEA 3DNFA 4KLRA 4ZVNA 2XGOA 4CLRB 2D74A 3LP5A 3X43A 3DYBA 2RGYA 5IM4A 3HK2A 3PNSA 1BQ3A 3OF3A 4MMYB 4KITB 5I3ZA 2ZSUA 3LGXA 1DBWA 3DULA 4ZCLA 1FTQA 4I9GA 6Q21A 5AI0A 2GPNA 2WU0A 1GTL1 2ZWOA 5J47A 1EB9A 4QUEA 1FJGB 1RWMA 2IQ5A 4BB5A 2N47A 2XWBF 5F9FA 2P75A 3IHLA 3JZIA 5ECGC 4YAGA 2HHHB 2C7OA 4WLVA 1F1JA 1QH0A 2QLLA 4P3PA 4PG5A 1ZJZA 3R5SA 3VVMA 4A8HA 3LUAA 3JQBC 3JTMA 1HTWA 4DC0A 5EMLA 5CT9A 1UEIA 3HG7A 4LDQA 2EVWX 2PSHA 1C4KA 2RIPA 3Q3IA 1NVGA 3GAFA 4PQFA 1HQYE 1RSZA 2UVPB 4JR1A 1Y5IA 3G9TA 2FUG1 3AFOA 5E4YA 3NVKI 1T4GA 3EZFA 1D7OA 4FJ1A 1XXHB 4KPUB 3UOAB 5IJXA 1MPTA 2SHKA 2ZIWB 1DV2A 4KJZA 5EINA 4R3UC 3WMGA 4RMGA 4ZQIA 2GVDC 2RONA 3WLQA 2HT1A 1QYRA 1Z5WA 2WJ3A 3FSEA 4DV0B 3F97A 3QH4A 2CXUA 4MI3A 5JALA 2PD6A 4DWOA 4N3BA 2I1VB 2PKQP 1VDZA 4C3VA 2DLDA 2WJJA 3KSUA 3H6KA 4WECA 1ECLA 3EPHA 2IBMA 4FEYA 4AXXA 5KKCA 1NUAA 2VT3A 1MX3A 4JOQA 5KDLA 5IEJA 1OIVA 2X7XA 4ZU1X 1GA4A 4AT1A 1DWOA 1VFNA 3W90A 3AX6A 3WQHA 3NJRA 3LW8A 3LBHA 4PINA 4RJKA 1AS3A 3K5PA 2I76A 2CEKA 1KF0A 3EISA 1PR9A 1K9VF 1XN1A 2OYSA 1P3JA 4PY2A 1XAJA 4YJ3B 3NHMA 3OF2A 2I1WA 3AR3A 3IJRA 3T7EA 4DQKA 4LHVA 3CO0S 5TY0A 2VJDA 2XB8A 3KBOA 1WY7A 5KU1A 1RE1A 3C8ZA 1N6NA 5AOBA 3OEHA 3R5HA 2XT6A 2ABWA 3PFKA 5HF5A 4QTYA 2A4MA 1V1RA 1Z0JA 1PSZA 2Z95A 3E3NA 3QUTA 3IJ5A 3QLTA 2JVJA 1IVNA 3O8LA 2REQB 1DTEA 3LC1O 4HPWA 2WNIA 4I46A 4M49A 1RPNA 4LVCA 1GTSA 2BR5A 1ZJ4A 2PL5A 4FZRA 4I6JA 5HIIA 5IPFA 2XOXA 2VHWA 5L95A 3LVRE 3FZNA 2NNWB 4FKBA 4FBMA 4I4TF 5EZYF 1RLOA 1F3OA 2P4SA 3E15A 4FHZA 2UUAB 1PJSA 3GG2A 4MW6A 4YCBA 5EA2A 1KJZA 4B82A 1N6LA 1WHSB 3GAAA 3VBEA 2HSGA 3WJAA 4YMVA 4MRMB 1BXZA 2HQBA 3MG9A 1DC3A 3FVRA 5EE5B 3RG2A 4AMUA 3EZLA 3KT0A 3L8EA 1JSXA 2I03A 4U8GA 3WKAA 1ZIOA 2GVZC 2IVZA 2VPWA 3I76A 2AK3A 3LKDA 3MLAA 4DT1A 2JLXA 4M1KA 3O4HA 3RK4A 3DMPA 3D0QA 3QXCA 4YR9A 2RK3A 3RK0A 3WIOA 2GJ4A 2J6IA 2E82A 4LOIA 2M98A 3ZLTA 3VNSA 4P2BA 1NC3A 3OIDA 2P77A 3U4IA 4FUQA 4IHJA 2VAWA 4G5OA 5J1TB 1MB3A 3WRYC 1VBNA 4CT5A 3HXOA 4IJUA 4A8JB 2AFRA 3TSOA 2E2WA 2BGRA 4FYXA 1Z2NX 4LBVA 1GLGA 1C3LA 2V98A 2ZIGA 4HX9A 5F3WB 4OIFA 4JJGA 4CPDA 1G19A 3HR7A 1C4WA 1Z34A 2QM3A 2NXNA 4HQKA 1R15A 2GASA 4QASA 4UAUA 5CFPA 1WUTA 4YMTA 2ID7A 1MOQA 3QKRA 4IO0A 3DOFA 1I8TA 1WF6A 2JNWA 4MS3A 4JB2A 5BQOA 5DX1A 3KNZA 4MGHA 3ZGZA 2XA2A 2FRXA 2ECQA 1STOA 3JVEA 4YLEA 1YB2A 2X9LA 4HEJA 3KVOA 4Q4HB 3U49A 3HWWA 3DS8A 4Q1CA 3WMWA 5K6TA 3TOVA 3PEEA 1DT3A 1QOZA 2GZ2A 4RQAA 3CH5A 5IC5A 1NE2A 1NXOA 2AL7A 3EVFA 2VDRB 4FMDF 4H1TA 4LGVA 3K4QA 2G76A 1PKXA 4MQEB 3TGLA 4CMGA 1Y9JA 4FC7A 2NU6A 1SZDA 3HHPA 4NCIA 3QBJA 5IAAA 3U80A 1JR3D 2BN4A 4HN9A 3DBRB 1NV9A 1QRAA 1AHIA 1NZJA 2AD5A 3E8MA 4DA9A 4F56A 4AKGA 1GV1A 4HX5A 3P96A 3UAZA 1WEHA 2R7LA 3G6WA 4ZMBA 2ISCA 3A6DA 1DCKA 1IZ0A 2XDQB 3CN7A 5DEOA 1ACJA 4BJ6A 5F7OA 3A9VA 2QBYB 3STTA 4U7JA 1AOXA 2FSIA 4KXUA 1G42A 2A9KA 1IQPA 3ZV7A 3P9XA 1ECCA 3BE5A 1H65A 3EVNA 3X1KA 4X94A 4G23A 4TLEA 3G79A 2EARA 4GPEA 5KKAA 3SC2B 1MZVA 4N47A 1LDYA 3C3PA 3EZ2A 4PYKA 2E4WA 4W9NC 1CQIA 2PQ2A 5A02A 2OSVA 2H5IA 3ZD8A 1JHVA 1ZD9A 1JAHA 3EGEA 1I3CA 1PJBA 2B92A 1BYIA 1P2SA 2P30A 3FIJA 3IFSA 4NBUA 4NCXA 4NR0A 4XRRA 4AJNA 1OLSA 1VBFA 1E99A 1FUYB 1QH1A 1YR3A 3IHTA 3H11B 3L0OA 4MS1A 3EIUA 1Z7BA 3GUHA 1DKOA 1MQSA 1EGVB 1R0YA 1S1MA 3D3WB 4KYVA 4BLVA 4G56A 3UGKA 1ATZA 3EZXA 5CA1A 1KSJA 1U11A 2BVNA 2FETA 2JLQA 2B1IA 3BPSA 2CV2A 2PANA 2FW7A 2BF4A 3JWHA 3EDMA 4IP0A 3UA4A 5TMBA 3HYTA 3S5UA 3RC2A 5ICEA 5JHHB 4UVIA 1UOEA 2LPMA 1HNZB 5HJEA 5K05A 4WBNB 2HL6A 2OAP1 1LPOA 1YBVA 2CFIA 3PHHA 4ESVA 1WU8A 3ENWA 5EUMA 5HF9A 1NNI1 4BGEA 3FWPA 1CB7A 2WWVD 1K6IA 1MFZA 3OOSA 1HDCA 4C30A 5G4LA 4AMGA 1JWAB 2P2NA 4ECAA 4RTSA 5HA5A 1S5PA 1F2TA 1ODSA 2G36A 2NXCA 4ZOLF 4ZCIA 1N2EA 4BO0A 3R40A 1W4BA 4LZOA 3H5AA 4O4HA 3R0JA 4MS4B 5FTNA 3O9VA 2VF8A 3JU3A 3UN1A 1I2DA 3DE7X 3LPAA 2GF2A 2O2SA 4CUZA 3CZAA 3W9YA 4DGQA 4RIIA 5KYUB 1W0KD 1UEJA 1KYXA 1QIGA 2D1FA 4AQDA 1VLQA 1E1MA 1O6CA 2AUNA 3PI6A 3UGJA 3Q8WA 4LRYA 2DERA 1IUKA 3ZNPA 3A28A 3EUAA 3FSGA 3OM1A 3TNFA 3VISA 3VJMA 5BUQA 1Z08A 5KVVA 2Q29A 4TTRA 3QLVA 3UWMA 5EUBA 4Q1DA 3GDHA 2BEKA 4YR7A 1QQBA 3B9QA 2XQIA 2XB9A 3EHDA 4Y18A 4TSRA 1KFCB 5C8YF 4JSYA 4PF1A 4A6PA 4PZ9A 1BN7A 3FYUC 3GRYA 4TMXA 3H0EA 1RWKA 5BV2P 3WLOA 2IT1A 3BFJA 3MRTA 1JKFA 3N5CA 3DG9A 1M73E 5CW2A 5FWAA 1GTVA 4MI6A 4QL3A 4CIDA 1OXVA 3GW8A 1P8JA 1K8YB 4JUDX 1NTOA 3V6MA 3S2GA 4FYVA 4WGFA 1L7NA 3NIFB 3AVTA 5DTIA 1E4VA 1I2MA 1RYEA 3L4BC 4X84A 1DP4A 2V4ZA 1N2HA 4TV9A 7YASA 1M72A 4RTOA 2CMDA 1JG7A 2BZGA 2O8DA 2V9PA 1HKHA 1XX6A 2QRVA 4KC0A 2XAAA 4LY6A 2H5LA 4X7RA 3OWOA 1BAPA 3GRKA 2C8JA 4AN0A 4D8YA 2H51A 4ITVA 2YYYA 1WQ1R 3VYTB 4PRKA 1IRXA 1PSWA 1KC1A 2CLFB 2Q2NA 3CU5A 1P80A 1EAMA 2QTVB 3KK0A 1FYWA 3HZHA 1LJLA 4J07A 3HVUA 5ILQA 1WTAA 3ZKWA 4I55F 2RI1A 3K70D 3VU9A 2YV5A 1HE1C 3E5HA 5ERXA 2BD0A 3LZCA 2GLUA 2WJGA 4MWOA 4R3NA 3ZW9A 4B84A 4LRXA 2A78A 1VM6A 3TTYA 1RTTA 5BWNA 3N2GB 1QHEA 2ZYSA 3ETCA 3O3OB 1PR5A 4MQ6A 3V97A 1TM2A 3BHIA 1YZLA 2GD0A 1YE8A 3AESB 4FK8A 3QELA 4UFOA 3ZV6A 3DVLA 2VUTA 4H1WA 1LDNA 3DCNA 2X8AA 4YONB 3V8NA 3WGUA 1OH7A 3WGYA 3QEJA 1KI7A 2XUOA 1CHNA 4K7JA 3V2UA 1DJMA 3PRYA 1DVRA 2DEUA 4S2UA 1FL9A 4YH1A 4PSDA 4U9UA 5DI3B 2NW6A 2V7GA 3JZMA 3FGPA 5K5EA 3F71A 3OFNA 4R4JA 1C7EA 3R44A 4BVKA 2FI1A 3VR1A 2AKYA 1XZHA 3DC2A 5K3CA 5HFAA 3RFUA 1LX6A 3PEFA 5SZJA 3T1TA 1M1YB 3MTIA 4HH3C 3GRFA 4RK1A 3SHTA 5IKEA 1QTNA 1W36D 3R3HA 1A9XB 2HM7A 5C7OO 3JSAA 2QJFA 1RS0A 3DGEC 2R7NA 3O7MA 3ZWOA 4JI0B 1CRZA 1SCAA 4ZQFA 4MQUA 3TECE 2B1GA 3CUSA 1A8UA 1XYGA 4X95A 1MMFB 5KNBH 3WADA 4AG6A 3Q6IA 1RBMA 2XE6A 2CYCA 1N7IA 2FQ1A 2IEAA 4KRGA 3TQQA 2ZS8A 3PCRB 3TNJA 2XEDA 3WGGA 4FGJA 3NAZA 1Z0IA 3P0JA 4C0LA 4I3FA 1QKJA 1WG8A 2ZS9A 4KTTE 4HK4A 1HYHA 5H3CA 1CNFA 3G7NA 3I01M 2IXDA 3AINA 3WKEA 4DRXB 2I4RA 5IJ9B 3B13B 5EC8A 2YHIB 2WKWA 2PJZA 4U7GA 1A7UA 5AKEA 3TUJC 3ZTWA 4PQGA 4Z49A 3I05A 5ALKA 3QVGA 5BYAA 5FWYB 4N3CA 3ETJA 4WGGA 2ZBQA 5JSYA 2O2YA 5KO2A 2HPHA 1UM9B 4GI1A 3NANA 3AUFA 4YJ3F 5FOUA 1FRNA 2H1FA 4N65A 3X1WA 4C7JA 5I7RA 5P8WA 5M2QA 2XOKD 3ZHZA 1FEZA 3U3MA 3H4IA 4EVSA 3L4SO 4DDVA 2QPLA 3JPYA 3QGMA 1AUPA 1X3SA 2YQ5A 4KN5A 1GSIA 1L7DA 1NQOA 2HJRA 2RJOA 1Z82A 2CDRA 5HIJA 1TYBE 3IE0A 5AK4A 1AHPA 1P31A 2DPYA 3JATA 3ZXUB 3X44A 4YGYA 4Y9RA 4C43A 2QN3A 1G6HA 1MABA 3BVPA 3TX6A 2C5FA 2UZ3A 3HVIA 3B6MA 2YFHA 2B20A 1EUCA 2FF7A 4EEZA 1RKXA 1S2LA 2FOXA 2HDNB 3ZVRA 4MUNA 5IAEA 2I6QA 2AG6A 1VIMA 4A03A 4EGAA 3GC6A 1AK2A 1G2PA 2R8OA 3I1FA 3BK2A 1YA4A 3TSYA 2C7QA 5CT4A 3LBYA 2ALJA 3AERB 1DG1G 1X7YB 3WYEA 2NYUA 2ZI4A 5LA6A 3V33A 1QV6A 3NO4A 1JHAA 1YCDA 4KWTA 1NZFA 4O4LB 4R31A 3T54A 1NXVA 4CM1A 3KKPA 2PIAA 4TMYA 1U8CB 2A30A 3LUFA 4E21A 5HQJA 2FNAA 3AB3A 2GTIA 4PQEA 3ZQUA 1II8B 5CPBA 4IXDA 2P2SA 3FRJA 1JXQA 1FMCA 3D7RA 2PGAA 3RVMA 4BGVA 4BKQA 4GQAA 1RAGA 4LOJA 3L05A 3VZBA 4E3WA 5LP1A 1ULTA 2L69A 3CX8A 1YE3A 3S2SA 1N5JA 1WW8A 3UUFA 4C7KA 3IEIA 1U0JA 2YKGA 3QLUC 2GA8A 3D59A 1SEVA 2O3RA 2W43A 2BPOA 4HVLA 4EK9A 4MUEA 2ZWMA 4TYQA 2IBTA 3STYA 2FFJA 1Z13A 1Y81A 3MTGA 1TA9A 1XVAA 1C8KA 3K7EA 1PG2A 4KR0A 2R4UA 3RANA 2CW5A 1A5SB 5AKGA 3SFVA 2NZUG 5EJMA 3L84A 1PFYA 1PQYA 1W30A 4YREA 1AVTA 3IQZA 2OK8A 4JNCA 3G2OA 2R1ZA 1DC8A 2GK6A 2I78A 1JQBA 5AVQA 1BC5A 2G1KA 1B0UA 2AVNA 4QATA 4F4FA 2ZJ7A 3T52A 4BNHA 1T9GR 1HMYA 5JS8A 1KH1A 4FN5A 2QZ4A 2ZUEA 4GLFA 2F1JA 5GQSA 2OZVA 2H1VA 2E5WA 2ZYGA 4FM9A 1Z75A 2J8ZA 4BU0A 4PNEA 3G1TA 3K0BA 2F55A 4CRWB 2CXPA 2GAFA 4D8VA 4CG1A 1SM4A 4C3UA 1N3BA 3DGFC 1CUVA 1H2RS 1NM5C 4DLYA 2FGKA 2C8KA 1QVWA 3MTEA 4DHWA 2YHAA 5IH3A 1MEEA 2WKRA 5AKIA 2H2IA 4RXUA 3A3NA 4TWIA 3AI1A 1SC4A 4G0YA 3UMGA 5GGXA 4EB6A 1A2OA 2Y67A 4OHVA 4B3BA 3LCUA 1M0EA 2WM8A 4KE6A 2HIMA 2VDNB 3GT3A 2II6A 3HKDB 5DXJA 1LNZA 1B43A 1GRCA 1Q92A 1D2HA 1GZUA 2WTAA 3PPYA 4DF3A 2GPBA 2W22A 2HMYB 2XUIA 4TKVA 5CLHA 4RIGA 1E6KA 5IMBA 4AS1A 3LMKA 1W44A 3ML1A 3OICA 3CUEF 4IJMA 4M0LA 4MV6A 2Q5LA 4C6TB 2F62A 3AEZA 2IHZA 1KWKA 1SVMA 2RJNA 3HFGA 1E7MA 2P11A 2WHPB 4PNZA 3PX3A 4QPDA 3X3HA 1GPH1 1FZQA 1W5AA 3FJYA 1P7YA 1EVEA 3RV4A 4D4JA 4LJ6A 2AMJA 4N76A 2VTBA 1QG4A 2A1UA 2B83A 4PICA 1N2GA 3CY6A 5ALWA 1K4KA 1QKIA 5FUXA 3IAHA 2DR2A 3AUYA 1M1YE 4Q3KA 4CV2A 1AT1A 4KODA 5D7BA 3ORFA 3X2SA 4J0HA 4Z4QA 1JE0A 1E4EA 3NDBB 4IIHA 3VVLA 1IXRC 1Z7EA 4KV7A 2R6HA 4O1IA 5I01A 4XVHA 2CNKA 3G2LA 1P5FA 1RE0A 2DF8A 4EUKA 1KYTA 2GA9A 1Z36A 3ZDEA 3DAGA 4FIDA 4JDUA 1YJQA 4XX0A 2LVBA 3K31A 4I5DA 1PEAA 4Q6WA 4HSGA 4P0PB 1Q0TA 3WTBA 2Q3DA 1EZZA 4ALKA 4CCYA 2P4UA 3H1GA 3NS7A 4B33A 4KW7A 3I72A 4ED9A 5BN1A 1FP4B 2LNDA 1NI4A 4CXMA 6REQA 2J7PA 1YRLA 3Q5DA 1SC9A 3KEMA 2IVFA 3DLAA 4WBNF 1CE8B 4EW6A 3Q8XB 3RYHA 4XRGA 4YY3B 5B6PA 3GGJA 4F3CA 1D0VA 1PP4A 1N9GA 2B1QA 1L8AA 3RRNA 1W48A 2NU9A 2PUFA 1Z6XA 3VHLB 4PLFA 1M5RA 4MWSA 1JQEA 1WXQA 1F8UA 1YR6A 2BMAA 3PXCX 4Z3OA 3N39C 5F35A 3BSYA 1A1VA 1FLNA 2YXDA 221PA 4F7DA 3G2QA 4WKPA 3BB4A 3UMSA 3GEMA 5DE3A 5EZ5A 3TPZA 1AK9A 1W2GA 3RH0A 1T6ZA 2H6EA 1Q83A 2Q8PA 4U9HS 2Q45A 4OXRA 1AXRA 1XCMA 3C6KA 2OK7A 1XKXA 3F3MA 4Q7KA 4AM8A 1JJIA 2X5OA 5REQA 1DPFA 1Y1PA 1A4XA 4WK2B 3AHHA 1G8AA 1GKIA 3U3JA 1K8RA 3JVVA 4CIVA 3UH0A 3CRZA 3HB5X 2XWJI 3GRUA 1NL3A 2QUHA 5KVQA 2VDWB 1W85A 3KO8A 5CCDA 3U4GA 4YRKA 2ZQYA 2P8SA 4C5BA 1ZL0A 2ZVDA 3HXKA 1U8EA 1XR3A 2NUTA 3BMQA 2PKXA 4B6JA 4KAXA 4KR2A 4ZTZB 2IDJA 1MCZA 5DT9A 1FUUA 2WG1A 3UMYA 3QITA 4E5PA 4HS9A 1K63A 4MWGA 5CPFA 1KYYA 5GJWC 2B37A 1Q1EA 4NBRA 1W94A 4N0MA 3SZOA 3P2JA 1ZM3A 3JYNA 3FYUB 2C2XA 2FLWA 2IYAA 1OBFO 3B8EA 3Q3CA 1D2EA 1QZZA 2J3LA 2Q5IA 3MMSA 3GLIE 2OCYC 2XDWA 4KLNA 4Y2XA 4L07A 1AUXA 3VC3A 1T6YA 2HI0A 3EIFA 3R8XA 3UK2A 5JLAA 3FY4A 3NHUA 1JTEA 2V74B 3T9CA 2FY8A 1LBSA 4S24A 1QX3A 1CS0A 4DNPA 5HZHA 2AIRA 5CYFA 1B23P 2C03A 1M8JA 1WCIA 1G8GA 3D5QA 1KSFX 2PZFA 3CX4A 3HBNA 4J9VA 1CIJA 3CCFA 4Z2YA 4HVAA 2JHAA 1JU4A 2B0CA 2W11A 3W1WA 2AXEA 1V1JA 2EFDB 2PS0A 3KU4A 1BWQA 2XXAB 4ZZ3A 3H0KA 2YV3A 4DZTA 3QKSB 3EXHA 3MQ4A 4YP9A 4D02A 5HKAA 1PEYA 1RKUA 5TX7A 3I5UA 4CI0B 3MT8A 3U26A 1VLHA 1BWPA 1SUSA 5ARDA 4CGYA 2BM9A 3HYSA 5I9NA 1UK9A 3CF4A 4MKZA 4CMIA 3JX9A 2R751 3OMXA 5TRTA 4P34A 2H07A 4WFJA 1P4JA 1T15A 3C74A 4Z7JA 1C50A 3M1AA 1E7WA 3CURA 4ZHQA 3O4IA 3T5PA 3IDZA 4B2IA 4LRWA 2CFSA 4A4DA 3WLFA 1IMJA 1NRWA 1UKAA 3DL2A 2UDPA 5LLDA 5JZMA 2O2CA 3DV9A 3IPRA 4XD7D 5EXXA 2CB0A 4H3HB 4OKSA 4AN1A 3TTXA 1Q74A 5IASA 5DM1A 4ENUA 5GAJA 1YZVA 2OMEA 1LDEA 3MIIA 3SVTA 3I23A 1FRQA 1ZOPA 2H54A 3KTFA 4MHOA 1T5BA 2HK7A 4DA4A 2GFIA 2OLEA 2C3OA 1F0KA 3USES 1K4MA 4D4LA 1Z2DA 3LWDA 4JX8A 3TLXA 5FYDA 2BCGY 1MAAA 2X8WA 4XSVA 3UT6A 1RXUA 2VQDA 2WPDD 2X22A 3LRPA 1P39A 3O8QA 4C1BA 1VBMA 8ADHA 2C96A 4A92A 2BRUA 1AKTA 3E9ZA 3MJDA 4OGKA 3LPCA 4HO1X 4RJLA 2PY6A 3D81A 5DLPA 3MRSA 5C80A 3QX9A 2C99A 1PVVA 4KR7A 2RGWA 3DDCA 4MB0A 4LGYA 5CW1A 4DMHA 4DCTA 4JENA 2DFNA 5LZ5A 1M6WA 2P6OA 2OFOA 5AW8A 4E1AA 4AJ4A 5AI5A 5TQVA 1E3EA 3BIXA 2BKLA 2XVZA 4QTZA 2ASEA 2R7AA 1W9HA 2VHCA 5ANRB 3HYLA 2B5VA 2ZJ6A 5D3ZA 4RIFA 2B5OA 5IAKA 3GARA 3PC2A 3QWFA 3O84A 3BJZA 3RVSA 2Q3MA 4IGIA 3GDGA 1W34A 4M38A 3AEUA 1K5DA 3BHJA 2QP9X 1KBQA 1MLDA 1NRXA 2AKAB 3PR1A 2ZTUA 1Z9BA 2X9QA 2FXIA 3LHIA 2PSFA 4P0TA 4Y6SA 1M6YA 4AJHA 4GOND 4YIHA 4V2IA 4JOCA 4OSEA 5EXSA 1KZHA 4B3DA 1W59A 4MARA 3C3JA 2O59A 1L5FA 4UJ3A 5G4KB 1QIEA 2I6UA 4KLZA 1KK0A 1NMEA 2DBZA 4WHMA 1PZMA 4ZVQA 3B53X 3KZMA 2X3YA 4KSYA 5DTRA 1GRVA 5BY2A 3A6JA 4OGFA 3IPLA 2YBDA 3FCSB 3LSYA 4RVNA 5IFKA 1U1CA 3DL0A 4E94A 5BSUA 2VSNA 4AIIA 1W8DA 4CNQA 2F6RA 2QMZA 2VWQA 3EGXB 3AF5A 1D0SA 1CF9A 1S4QA 1WQ4A 3DZFA 4WIAA 4G63A 2BSQA 1KXZA 3C1TA 4TTIA 5M3BA 1LVGA 4PU0A 4D81A 5A9RA 3N6RA 4Z2AA 2Z0MA 1Z7GA 4EFDA 2VVTA 2GCPA 3ROXA 3H3FA 4ZQEA 3HKBB 5KX5B 1L4HA 3CRRA 1GL3A 1LZLA 4O4LF 2CUNA 2QIPA 5A3VA 3W6OA 4CKCB 1R4MA 2V7BA 1N7GA 4ZOEA 3GEDA 1N2IA 1UAYA 2ZRJA 3K1YA 2IU0A 1D1QA 5I45A 1KYVA 2BFFA 1E4OA 4MI9A 2X2FA 3UAXA 3F7MA 4AU1A 3DBHB 1M8GA 1FSZA 1NC1A 2H5JA 2YMQA 3GFVA 3N8DA 3PIIA 4NU6A 1OIXA 1OREA 1V3UA 3WSWA 5ADHA 2R5WA 3FPJA 3W05A 3BM5A 1RCUA 2EFYA 3TTTA 2DFLA 1XVLA 4BMNA 5IDQA 2JHCA 4TWZA 1HLPA 3DEAA 3KKLA 3ZCXA 1FIUA 4N18A 5FOVA 1DG3A 3OQJA 3M4JA 4Z3DA 3CUWA 4ZRDA 1ZAKA 3H7AA 3BSWA 3L7DA 4PWYA 3DEHA 4UTOA 1X2BA 2XNCA 4TS4A 3VRHA 4XGKA 2DQZA 3VR2A 4JQZA 3RABA 5JSHA 1INLA 1XEWY 4QZVA 2IXEA 1QZ3A 2IPXA 3OJWA 2EATA 5EERA 3RIHA 3LUPA 3BZUA 1R6TA 2P27A 4UCXA 3M81A 1TJNA 1IY8A 4EUNA 1RCTE 3PQ2A 4ARUA 1Z5NA 2CJWB 3DKRA 5HNKA 1IXSB 2ZU6A 3PVCA 4KRYA 4TLDA 3FF4A 1XD2B 4XIFA 2NUAB 5ITZB 4DUYB 4GDMA 1ZVKA 1OB2A 1OAOC 2A2ZA 4BV2A 3KV3O 2VL7A 1Z8NA 3GUYA 3H2KA 3H9JA 3RQSA 1JQDA 1LUAA 5AP9A 5LLTA 4BO2A 1X6VA 2IV7A 5KVSA 2XODA 3LH5A 2WWWA 4N5LA 1JF8A 5JAZA 3LQ4A 1SVLA 1JPUA 5K8UA 5KYWA 2VRCD 4DJAA 3ZI0A 5BOSA 2W83A 5LYJB 1XEFA 2LZ0A 3M34A 4HS4A 1LW6E 3VGPA 2Y1GA 5B1IA 4LJ8A 1HE2A 1OYVA 3LVFO 4J8PA 1W5TA 5TJ9A 1E3TA 3A6ZA 5TF4A 2DUUA 3LRTA 3MTJA 3BBPA 4CQJA 1Y82A 1JEYA 4PX9A 3V4PB 2F9FA 4PAMA 3PI7A 1OVGA 5C1BA 1SCJA 4DIDA 4KQWA 2IYTA 2ERCA 3Q10A 5F98A 5JAPA 2WU3A 3MCTA 3THYB 3E7XA 3WGNA 4BNZA 2IZ6A 1T9GS 2OBBA 3C45A 1RWQA 3HXLA 4LJ9A 1UPBA 5AJWA 4B9AA 1C1DA 1XAHA 4H17A 4CLOA 3EQ2A 4J94A 1KMHB 1MVOA 3VBCA 1HF3A 4ZT5A 2W42A 3I9MA 2CFTA 1QLWA 3LNTA 5CJJA 1SXGA 4Q3EA 2GPAA 1VECA 2RHRA 3EMBA 4UHDA 5DBHX 1OT5A 3AF0A 4U7PB 4ZEXA 2WJYA 3SFTA 4OAPA 3UK6A 5D86A 2B1JA 4UUOA 3PX7A 4PCLA 1Y8QA 4QD3A 4BO6A 1I3MA 4QGHA 3C3EA 3H0CA 4AXBA 4XE5A 2Z1NA 3E9CA 2Z2KA 3LLVA 2A0FA 2R8ZA 5LKAA 5EJ5A 1W49A 2I4TA 3C85A 1OBCA 4QNMA 1CF4A 3JARB 1CDEA 4R84A 3R7FA 1GPLA 1O6BA 1RQPA 4BN4A 1KEEB 1M2OB 5JQWA